2Y2TA

E. coli csgc in reduced form
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
b'SSQITFNTTQQGDMYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEKTLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQWPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CURLI PRODUCTION PROTEIN CSGC
publication title Atomic Resolution Insights Into Curli Fiber Biogenesis.
pubmed doi rcsb
source organism Escherichia coli o157\:h7 str. ec4115
molecule tags Chaperone
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2420 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y2tA00
2XSKA 2Y2YA 2N59A 2Y2TA
chains in the Genus database with same CATH superfamily
3RJOA 5J1AA 5D6CA 5I73B 2QHRL 3C8HA 5KSBB 3TURA 4K5LA 4F7KA 1A7PH 5DWPA 3SPGA 1BD2D 2XN9B 4LOVA 3WAKA 2DQDH 4LEEA 4I77H 5AB9A 1GPOL 2B0SL 2A83A 3QEQA 5LDUA 3ORJA 3CX5J 3FT2B 4XH2B 4QEGA 4OTXL 3EH1A 2BIMA 4HGKC 4G9FA 5CJ8A 5T1KA 3MFFB 1S9YB 5AWNH 5I8CB 4LF3A 1SXZA 1DQML 4X6DB 3BSZH 3CFJB 1ZTXH 1BMWA 1P7KA 2PR4H 1P6FA 3QCVL 1FYTE 4G7YL 4HKXB 4PGZA 4ONFL 3MROB 3RE0A 3ZSTA 3FUJA 5SV3A 1XXDC 4IMKC 4U1GC 5EPMA 3RWFA 4NQQA 1MNNA 2WJ5A 1FZOA 3DV6A 1HOEA 3DUSB 3BLPX 1GMIA 4BZ2L 3K81A 4Q9RL 5BRZE 4ZD3L 2MWCA 5DJ8B 1F4WL 3GHEH 4YDVA 5FUCE 5JHLH 1ZA3B 1D5IH 3QXAB 1KXHA 2DWSA 1A64A 4P4KA 3I3BA 3VFWB 5AB2A 4B5EA 4AI7A 1DO6A 3MRDA 4UYQA 1E27B 5F1IB 4RA3A 2CDGA 2P4AB 5IVOA 4HC1A 3LKPA 2ZXCA 2CAKA 1IQDA 3F7YA 5I15H 4JUSA 2H1PL 3ZYIA 2QQQA 5GHWL 4JFHD 3HMWH 3CZJA 5TE6H 1CYXA 5KJRH 2Y6SC 3LS5H 1CGUA 4K8RD 4EN2A 4WQOA 1W91A 1QWNA 5CSBA 2AXFB 1ITCA 2J44A 3GWJA 3FU0A 3DRTA 1HU8A 4JGMA 1COBA 2IDUA 4P2RA 4AGPA 3OXRB 1J8RA 1A6VH 2AV7B 2CQVA 5AVSB 1T3FB 2A0LC 4R83A 3KPQB 1CCZA 3BQUD 2ALWA 3BVXA 3QXUA 1UM4H 3VXSD 3STLB 4EEEA 3HAEA 4H25A 5J6HB 4Z8FH 4L2YA 4U6HA 1KCLA 3DBXB 3QNZB 4HJEA 3L6FB 3JZYA 4P8QA 1IBGH 4YSRA 4N6RA 1P5UB 1TQVA 5B4MC 2J21A 1E5ZA 2Y25A 1NJ9A 5BNXD 5HVHB 2YWYA 1KYOJ 2JIXA 4MB5A 3HS0B 4YSPA 4EAEA 2WN3A 4JRFA 3SGKC 5KSVA 3WYRA 4GPVA 1FL5A 2JQAA 2K8MA 2GEEA 5LXVA 4QRFA 1MCFA 1FG9C 1P4IH 2Z92B 5C6TH 4WV1B 3DGDA 1F18A 3KXFB 1BDYA 5C0AA 1IKFL 1ML0A 1ZHLA 4F9PA 3RIFF 4QY8B 2XV3A 4HEME 2DKMA 4M43H 5I1DB 1P4BH 2NRDA 5KVFE 4D94A 4F7EA 4R7DA 3DUUB 2CD0A 3H56A 4GO8A 4EUPB 1FUNA 5C7XL 2PXYC 2WKLA 5CUSH 3V95A 4LT7A 4WJ5A 5FYLE 4X6FB 1AP2A 1U33A 5F3HB 1MF2H 5D7IB 1W80A 3HHRB 4X0NA 4XPAH 4R7VA 5D71H 2ZJSH 3TZVD 1FV1B 2WVTA 4IRJB 5FFOA 5HDWA 1OF2A 1S78D 5HHMD 2I25N 3NN8B 2X89D 1X7QA 4ZXBC 1P2CA 3Q05A 2VDQH 2R56H 3R0NA 2X4OA 4MCZA 1JZ2A 2P7TB 3ILPA 5K9OB 5E00A 4EBQH 4UUJB 1KWGA 3KPOA 3Q2VA 4NWTL 4ONHA 4WW2B 1BOGA 4PRDB 4PJIB 4CW1B 1ZPUA 3NIFE 1ND0B 4NPYB 3B9KA 1RK0A 2E9JA 2HTKD 3HW7A 4KMTL 3DPDA 4PLJD 1J1PL 2E59A 2DTMH 2QQNH 4M6NL 1NPJA 3E2HB 1QBLH 4FJYA 4N26A 1QW9A 4PW4A 1LK2B 4Z7UF 3FDWA 4IDJH 3RLSA 2I32A 3V4VA 1U95A 2EDWA 5IB4B 4U1SA 2OKMA 2AJ3B 1F00I 3N40P 4WEBH 4GAJL 4KPHL 4BFEA 5EFIA 2C1PA 5EO0A 3L08A 1MQKH 1NIAA 1T1ZA 3N41F 1NAMH 1SHWA 2EXYD 2VKXA 4ZS7H 3K71B 4WI9A 3VDBA 1KT2A 4WO4B 1MFAH 3OV6A 4CVZB 3FQTA 5K9KA 3RVVD 1P4LB 3CCHA 3O81A 2CPCA 4XP4H 5KVGH 4WFED 3L3KB 4NBZB 5GS3A 3DDGA 2LAAA 2IAMB 4QXUH 3L3IB 1BWWA 4HBCL 2C5DC 1ZTXE 4XMLL 4FYQA 1N3NB 4NOFA 2AJVH 1N4XH 4PGBB 2YUWA 5L4IA 2NY7L 3GSNL 2J4WL 2WGXA 4YH6A 3H9SA 1HSBB 5LGJA 1I1FB 5DR5H 3BFWA 3F5WA 4J28A 4QRBA 5I1KH 1BVKB 1CXEA 1KFAL 4BZ1A 3VD3A 4ALAC 4NC0B 1AJ7L 1BBDH 5EEZA 4MJ5A 3TBWA 5J12B 4JGNA 3T2LA 3X14A 3MREA 3MAWA 3MRLB 4ENZA 3IDXL 4HKZB 5IB5B 4FLOA 1BPVA 2QBWA 5L9DL 2EXTA 2PYEE 2QQLL 1IM9B 1MCPL 3HB3C 4J8QA 2G5RA 2AQSA 2IANA 5LG1A 3DTXA 5HVWA 3ZZSA 2V7NB 3O6FC 3BD3A 1HWHB 3HNSH 4L4TE 1BG9A 1MXGA 2YPVL 2Z4TA 3ZKXC 5GS2H 1Q94B 1RVFH 2BNRA 1MRFL 5D1QD 1FO0A 2CBQA 3QQ3B 5DVKA 3TBBA 4ELME 4PJFE 4PCYA 4BKTC 2EVHA 2F54B 2KC0A 1TVBA 2WQXA 2WWOA 1Q9OA 2W07B 5DEFA 4DPBX 2GBAA 2ZXQA 3DC0A 2NUTB 3LKSB 3Q5YA 4DP4X 2W94A 2WLJA 3OGCB 3KLHC 1KN4H 3MXVL 1KIRB 1J0HA 1DBKH 4PR5B 2V9QA 1NANH 2ICWA 4M1CD 3EJYD 3V2AR 4X4XB 4M7KL 2BS9A 3OR6B 1LO4L 1R5VB 3RWJA 1OCCB 5AYTA 4N86A 4JFOB 4HCRH 3GMOA 1CDBA 2XACC 1U3NA 3VD7A 5J6GB 5E0QA 2ZD0A 5T33H 2OXGB 2XI9A 4WY7L 2P44B 3ET9F 1F42A 2WWMD 3ILDA 3WD5L 1IBZA 1IARB 3LIZA 4HS6B 4Z77B 5HGBB 1EZSA 5FO2A 3S3JA 2W0FA 2VB5A 5SWZD 3ZKMD 4EI0A 1ETA1 3RTQA 3KWTA 4B9IA 4GQRA 3TVMB 3JTTB 4PJHB 2WQUA 4I1RA 3SODB 3MRJA 3ML8A 3AXLA 1QTSA 3NJIA 5DHVB 3DJ9A 3LKRB 4L4VD 2OW6A 2FR4B 3MOAH 3L5IA 1YCSA 1YEJH 1Q72L 4TVUA 4UQDA 4YBLB 5DRWA 1MCWM 4QOKA 4ORZC 2QTEA 4YXKH 5JPNA 2XOTA 5IVXE 1KXVC 3P4OA 4GAYA 4FC3E 5AW9B 4K8RL 4W9FC 3W11D 2GI7A 2GK0A 4MS6A 1VKXB 4NWUL 1XGUB 1MDTA 4HH9A 1XIWD 1WZ1L 3IDUA 4W4OC 5TE4L 3VD2A 5F9JB 3P3SA 1OAUH 3SBWC 1FVCB 1X9UA 2AK4E 3W56A 1ID2A 1B0GB 1GS7A 3M8OH 5TDNB 3RDTC 2CJUH 3S5ZA 2L7UA 2B15A 4DEPC 3M07A 1RUAL 2E0PA 1RZ8A 4GSRA 3QEGH 2X70A 3JBG7 4YDKL 4KZCA 3KCWA 4HJTA 2VMFA 2JB5L 4MYPA 3KYOA 3SOBH 1BMZA 2XBTA 4WEUD 1R1CA 2BDNL 3FO1B 3U2IA 12E8L 3LKQB 4I9XA 4AJ0A 4MA3B 5EIIG 5E2TL 2ATPB 5AQ0A 3C2AH 2WXRA 3VRLE 2R0LL 3WS6A 2F7OA 2X4PA 3JVGA 3T71A 4N3UA 5D6DA 5KVGE 1NDTA 5BQDA 3V6FA 4PRHB 2FECL 3VQMA 2F74A 4BE5A 1P5VB 1YEKH 4MRCA 4LCIH 1R3KA 1RU9H 1NCJA 4M93C 3M1BB 2R4SH 1E6JH 3U0WL 1DEDA 1U8OB 3DMMA 1H6FA 2CHNA 4MD0B 5DFWH 5E2WL 3AWEA 2QL1A 4ODXB 5L6YH 4R84A 1XEUA 2QZQA 4E9VA 3P9LA 3AG4B 5DHXB 3I9PA 4YHMH 4FQXA 4KTYA 1TTAA 2IPUK 2YD7A 4YLCA 4QRUB 1DN0B 1A3RH 1FDLH 2WM0A 1AKJB 3BUTA 3CZKA 4A7SA 3S37X 5DYOA 3UROR 4BYHA 1F6LL 1MCDA 4AGMA 4N2HA 5F3BA 1X3DA 4E41A 2GSIB 3SBRA 5ABAA 2J8OA 1FGVL 1SGKA 4RDQG 2PNDA 4ZUTA 4U3HA 3N6YA 1UOVA 2ZSWA 3MX0A 1XCTB 3N1PC 5KVDH 3LMJH 3CQQA 3RWGB 5HYIA 2OR9H 5FEBA 3ZDZB 4YL4A 3UAJD 5FYKD 5ALCH 2AXGA 4JO1L 3ESOA 1U8PA 1QZ1A 2ZG3A 4LO9A 3V9FA 5D1XE 1ETZB 4P2OD 2P5WE 5IKCA 2Y6SD 1EHKB 4FFYL 1TJIH 2XLLA 5DT1H 1U92B 2W9LA 2YSSB 3STZB 2BIQA 4MDIA 1A14H 2CMRH 4FJZA 1KCUL 5EN2A 4PLOB 1DUZB 3CVBA 3IN0A 3MNMA 5EUKA 3TPKA 1TJHL 2WXHA 2AQQA 1PJWA 2A0LD 3JV6A 3EAKA 3U79A 4BQ8A 1EO5A 4DETA 3ARXA 2A6KA 4U1MB 3ZQ9A 1ET8A 3FU9A 1IBDA 3R06B 5TE7H 1BEYH 2NW2B 5MERA 5MI0C 2R8SH 5A16B 1QBBA 1A6PA 1ODUA 4R0LB 1RIHL 1DJYA 4MTMA 1BXAA 1VRSA 3J7HA 3EJQA 3GSNB 5C0NC 5KBKA 3WTXA 3QYCA 4I5BA 2J25A 4DN3H 3UGUA 3O2WL 4ZQKB 4QRSB 2KLSA 3LNGA 2DQIL 2YKLL 5TF1H 2MHAA 3U6RA 3P77B 4QHMA 4UV7H 1XSJA 3NIGE 4MDJB 3DJTA 5ERWB 2DY2A 4Z7NB 2E4FA 3QEUB 3H3KA 2CHXA 4N0FB 3Q1EA 4FG0A 3JWNC 3H53A 2R1XA 2L7JA 4JFQB 1PKQE 3BZ4A 2FX7L 3FNKA 4M7LL 1CQKA 3GSVB 3MRHB 4Z0BL 4URKA 3ZR5A 2VXQL 5KJ4A 2Z35A 3GIVA 1UYWL 3T0DA 1FFNB 1NKOA 1YNKL 3L5XH 1U8MB 3QI9C 1CG9B 3RIFK 4PV1C 4MMYB 3JWDC 4WKZB 4ZXBD 3X3GL 1BD2B 4Q97A 2H45A 4UYPA 4OLYL 1T7VA 4DO4A 5DJ2B 4DN4L 2SEBA 4YZFE 2FUTA 1ZK9A 1PVHA 3ZZLA 3RIAK 1X4XA 1T4KB 3FU8A 3QUMH 2AJZA 4HSCX 2F53A 2GJ6E 5TPWL 4KHTH 4Y89A 1VENA 4K9JA 3ROOB 3VXMA 4XBGA 3KEDA 1G1CA 5E6UB 3VX0A 3X3FH 5SWQB 1YEDB 3IJEB 5DUMH 4WEMB 4NEHB 3UJJL 3V9CA 1RZKL 5F7KC 2VH5L 3FONA 1AMYA 1N5YH 4NLAA 2WVSA 3EF4A 4IJ3C 4KNTA 1NPUA 1E5AA 1BFOB 1ZWIB 2B08A 3VXTA 2OR8A 2CO6B 3GRWA 4HPHA 1I7RA 3BVNB 5KYXA 5PCYA 2BWIA 1A4KA 4JJOA 4XB8A 3OKLA 2BO0A 2D7OA 3EHBC 3LPWA 3SKMB 5IR1A 2MEJB 2QGCA 3VFRB 5DWUL 2H9GA 1K8IB 2E86A 4OJCA 1R34A 2BP8A 1HKLH 2CNZA 3I6KA 3K0WA 1WGVA 1NFDE 1SMOA 1L9QA 1U93B 2VDLL 5D7SL 3BPLB 2RIKA 3U4AA 1BM3L 1XR9B 2WIIB 2XXGA 5JO5A 1NFIA 4PJBE 3CK0L 3P73B 3FT3A 4P4KC 3POHA 4DGIH 1T1WA 3MO1A 4LVHB 3A6BL 2PMZA 5LCVH 1B4JH 4OB5H 4BSWB 4QGYA 2X6VA 5BQ7A 3TNMA 4A7GF 5IREA 1A3LL 2GAZB 4HOXA 5TGBB 4OCYH 1OAZL 3MJ6A 2V9UA 3O0LA 1KLUB 1IQWH 4EXPX 2VISB 5B1AB 4ZFGL 3W5NA 4K71B 3SPJA 2Y07H 2ZYHA 2HMIC 3GUFA 1B3JA 1H0DA 3BQUB 2V4LA 4NN6B 1QNIA 1O5PA 3TCLA 2WSKA 3AWGA 4XVUC 3R8QA 3HB3D 1NMAL 1JVKA 3VXSB 4PG9A 4JFTA 1NCTA 4L4TD 4J23A 4UINL 1NWOA 1KG0B 5K1VA 3D50A 1Z9SA 2V33A 3PP3K 3HE6D 1F11B 4KRNA 1CL7L 4D0CA 2BWDA 4E68A 4AQ1B 5CBAA 3IJ9A 1S7TB 3UTSE 2DJUA 3RHWF 5L7XH 2AXHA 2OCFD 3GSUB 4Y4FC 2Q76A 4JKPL 1UOLA 4QRRA 1E4WL 2XPGA 2QKIA 3UERA 2AJYH 4EDXB 5I6XC 2E4TA 1XZ0B 3VFTB 1Z3GH 4Y2DA 1YNLL 1OP3K 2ENSA 3BHBB 4PCKA 2XWRA 3MLWH 3WKNA 4N25A 1PZ3A 4LVNC 4F9PC 3ZQXA 1LP9E 4FZEL 2OS7A 3EJSA 3BN3B 1FIGH 1XT5A 4JANB 3NJGA 1DQVA 1AR2A 2H0PA 4BFFA 3EKCA 4U6YB 2VN4A 3WKMH 2IDTA 1CDJA 4OT1L 5ALBH 4OCMC 1OAXH 3TZVB 1TCMA 1U6AH 5HHMB 1SJMA 3MLVH 4AMXA 3MRKB 3ZHFA 3PAYA 4LOUD 3P02A 2HKFH 4LLDB 1KLGB 1QTYT 3NTCH 2FLBT 2PW2B 5INDB 1FFPA 3BWSA 1R3JA 2HJLA 3L4ZA 2B4CC 4PY8J 5CZXD 1QPXA 1EEYB 3ZLQC 1HTYA 4P4RA 1VGKA 2HFEB 4ZO6A 3CSYB 1MCHA 3IB4A 4OIIH 4WFHE 1VZIA 4OGXL 1BIHA 1SLWA 5FYKL 3WKQA 1FSKB 2ARJA 2JI3A 4U0QB 3RU8L 2EDLA 4C4KO 2X2UA 1CBJA 2X7LA 4JHBA 1TCRA 3B9KC 4JR9L 1YC8A 4TNVF 3UBFA 4F5CA 3ECVA 5CIPB 1RQ5A 3MLUH 1A9EB 1DQDH 2EIDA 3OKYA 5AVTB 1IAKB 1EHAA 3N42B 3ULVC 2J2ZB 3L54A 4UDTA 2AK4D 4ZOBA 2VXVL 4D9RE 1IGJB 5AZEH 2OSYA 4HIIA 2PO6A 5BCAA 1CI5A 1NSNL 5AB1A 4J39A 1G7PA 2QT6A 4FS0A 4KDWA 2WOBA 1UGNA 4FFWC 1QASA 1X9QA 1J1XH 1AFVL 2J3SA 2EDQA 3I02B 2BWQA 2WQAA 3HC0A 3NCEB 3VXOA 5IQ7L 3VH8A 5D7LE 4FQJL 4R9HA 1GMEA 1WDAA 1G84A 4NQDA 5C9JA 1G0YR 2FO8A 4N8UA 2CR6A 4L0ZA 3VFSB 1EXHA 2NX5E 3ARDC 4JEGB 3VYNA 3UTZA 2VN7A 3HRZC 1JPGB 4GIOA 3WMQA 4WK0B 1X5YA 4WTQA 1BVLA 4X98B 3DIFB 3OZLA 4M4RB 1A1MA 4H8PA 1YPZB 4YK4B 2JJWA 1WBZB 4HJGA 3T09A 5KVEH 3B37A 3I3DA 3NABL 3IPBA 4ZFZB 3HUJE 4N5EC 3FCSB 1BVOA 5F7NC 3N1FC 2AJUH 4UILL 5BRZA 2CCVA 3GIZL 5D1QB 1S7UB 2FX9L 1USZA 5MHSE 4M5TA 1SXAA 2O6CA 3F3HA 2W9DH 2Z9TA 2AAAA 2JSFA 2JKTM 3MCKA 1FVDB 4Z7VB 4ADJA 1KBBA 3F83A 3I6GB 2BFVH 4AQ8A 1Y07A 4LLVB 3B5GA 1ZJBA 4FP8H 2J6WA 5AOZA 4J27A 4WK4B 4LEOB 2YFOA 3A67H 2OL3H 1UQSA 4DAGL 5GS2D 2O6FA 5D70H 3AZUA 4GO9A 2G75A 3ZO0A 1I9RL 1H3UA 4Q0XH 4H1LA 4MB1A 3IMBA 3MRNA 1ZIAA 2EH7H 4HKJB 3G5YB 3D39D 4Y88A 4YHZH 2R51A 3GS7A 1P6WA 2A6JB 2HCZX 4AVJA 3AT8A 3U7WL 3Q8AA 2PP7A 4HIHB 4X6CF 1CDIA 2DQDL 3C09C 1R5WA 4HK0A 2CLRA 1KUMA 2YPLE 4GW5B 1JZJA 4LLQB 5FHBL 3W38A 3GBLA 1HCYA 1NCNA 3T1FB 1MHHA 4AUJA 5SWZB 4M00A 2ED8A 3B3IA 4F8NA 4LKXB 4LLYB 4XAWL 3TEWA 1L0PA 3BUYA 2VDLB 3U4BH 1JGUL 1MI5E 4NC1C 4PY7A 4H8VA 4X99A 1R0AH 3QQXA 1NBZB 3CAFA 3RTQC 4L4VB 2ODIA 4WJG3 1TG8A 4R3SA 3BSZL 4PGDA 1S5IH 4P9MH 3RI5F 2PR4L 3RGVA 4M8RA 5EUOE 3KWWB 4HUMB 4EE2A 5B38B 1LJMA 1LWHA 2CBMA 2BSSB 4WWOA 1A7OH 2XQYK 3VDAA 4XPHL 4KHXL 3L9BA 1LE5B 5BXFA 3ARFA 5ID0B 1AZRA 5JPNC 1YMHB 1L9SA 4ALAL 2EC9T 4E42B 2CKBH 4H13C 3GHEL 1XIWB 3ERXA 4KZ0A 1HHGA 5JNYB 3PQYD 5IF0A 1U3HA 1U8KA 1YC7A 4DPCX 3CXHK 2Z0UA 5EC1B 5HD8C 3HC4H 4OCXL 4WU5A 4AVIA 3FQRB 1MFCH 5E2VH 1NCBH 3QDJD 3RIKA 4I2XE 4LSQL 4I13B 1W0YT 2W59A 1M71A 5KJRL 3ZYOA 1CTNA 2YRBA 4NXKA 4HPOH 4U1JA 5HYSB 1GXEA 4AKOA 1INEH 2QTVA 1OGTB 3LJ3A 2R2HA 3Q44A 4I3RH 3PYCA 3PWUB 2IQAA 3HNTL 4EVNB 4JHVA 3NCYP 2I7SA 2BSCA 2WLIA 1WFMA 2I9TA 2ICES 4N2KA 5KEZA 4P04A 4GKNB 3X1GA 3HKZA 1RKRA 4R5TA 3PP3H 3REWA 5ENWA 1H3XA 3QEQD 4Z8FL 4NQXB 4HXAH 2PWFA 4JPVH 4NNXB 5D4JA 1IBGL 3MRPB 4AYGA 4BFGA 5D4QA 2VN3A 3CZEA 5E70A 1AR1D 5KBDA 1DLFH 3WS6C 3HI6L 3JVGC 1YYLL 5D6DC 1D5XB 1F8TH 4QO1B 3LDBC 3TH4T 4U1GB 3UZQA 3BZ5A 2VN5A 1R3HA 3GMQA 4F57H 1Z0MA 3MRCA 4C4UA 4JKLA 3DMMC 3BDXA 4FTDA 5C6TL 1M7IA 1UWEH 3FC8A 1OGSA 4XVJH 4WZ9A 3HG2A 5FFGA 4AQAB 5C3IA 4JAMA 4ODUB 4WI0A 1S9WA 1DVZA 4AH2A 1OPGH 3H6JA 4CN6A 3BEVB 3MMEA 4HHAA 4K94H 3Q01A 3F6LA 4GSXA 4JHWH 1RLWA 4MQTB 5CINL 5LGHL 2IJ0C 3U9PH 3L45A 4ZFFA 2IWFA 4IEFA 3CPUA 3RWHA 3A22A 4JCLA 5EULV 5KVEE 4LOEA 3H1ZA 1EAPB 1QA9A 4ZTOH 1F1AA 5AAWA 2ZX9A 1UVQB 5EU4B 1WHPA 3NJVA 2VDNL 5EC2B 3L2MA 3GSQB 3WEMA 4P2OB 4ZW8A 2IMMA 5F7DB 4HMCA 4FQQB 2JKWA 5D71L 4PLKC 4EDWH 1NLBH 3FB7B 4PM1A 4YHNB 2XG5A 2DYPA 2BOCA 5E5MA 2OTWB 3BO8A 4RAVB 2N7BA 5IJKA 2R56L 4G8FB 1A6TA 4WDIA 3TEUA 1J05A 5DJXB 3UZEA 5EBMA 4W6WB 2VKWA 3ELQA 3OKMB 3HZVB 4YPGA 4C4BA 2XXMB 2IVFC 3GMRA 2A6IA 1RK1B 1KZQA 3MR9A 2DDQL 1CD8A 1E2WA 1PYWA 1YYMH 4OCSH 3CFTA 1EUUA 3IDJA 5EORL 5EOTA 5DDHA 5IV2B 5F88B 4CN1A 2X2IA 3HHSA 5AKSA 2PETA 3MLZL 3AFLA 3FN3A 3AB0B 2VDOL 4I48A 5J1SC 3NGBC 2R69A 2YXVA 4HJJL 1QBLL 4EI5D 1TYRA 3SJVA 5GS1B 4MWFA 4LCWA 3ZL4H 5KSUA 5KBNC 2JIXD 4PAZA 3OB8A 1Z9LA 3CU1A 3U4EB 3VI3F 3PGDB 5FF6A 3VXRA 4ENEC 1NAML 1UXWA 4MXVF 4AL8C 3QORA 4A04A 4CMHC 1HQRA 4OD1H 3VG9C 1Y0LB 5CLZA 2R59A 5F89A 3IMVA 2DZEA 4TUJA 3RUGB 5BV7C 1MPAH 3HFML 1NAKL 1IB5A 4PJCB 1UGKA 4W9EC 3L4XA 3P11L 4X4YB 1NIDA 4OH2A 4L2LA 2XG4A 5C0EA 3TEYA 1U8NB 1MFBL 5TD4A 4Y0GA 1A7RL 4UOW0 3AQYA 2AEIT 2Q7YA 5DR5L 4PJ5E 5AUMB 2YMTA 3HZ3A 3MXWH 4Z7UE 4ZSOE 4ZXBB 4DW2L 5I1KL 5I76B 1U58B 3HN5A 2W65B 4QKXB 1FGNH 1SNRA 1BBDL 3N1GC 3C60A 1Z6JT 1UCBL 2OX5B 5DD1H 3FCBA 3FTXA 1UH4A 3NSYA 3I2CH 3REVB 4HUWA 2IQ9H 4XN7A 3TWCH 4MNQE 5MENE 3JT2A 3UTTE 4PRBB 1YN7A 1IAII 3NIFB 5CEZH 4ZMTA 1VFBA 1NC4A 1IL1B 2Y72A 3QG6A 4OLWL 3WN6A 4PJ7A 1SJVA 3X1NA 1SVZA 4PP1C 3HNSL 4XCYA 4AIXA 2WAHA 5D1ZD 3ABMB 4O58L 4OVVA 4NQSB 3BPNB 1S46A 3D51A 5HHOA 5F93C 1MAMH 3UACA 5B3JF 5DS8A 1S5HB 3VXUE 1EO8H 1QRNA 3LZFH 5L4FA 4RZCB 3SDXF 1ZCRA 3P0YL 1T2XA 1MH5B 4J3VA 2A9CA 4HWUA 3MLSH 2QPUA 4NQCE 5CD3A 2EEDA 3ULVD 1SBBA 2BXZA 3CDZB 4TQHA 3ZE1B 5ICYB 4OUOA 3I74A 4L1HA 4WI4A 4LPUA 2N1TE 4Z3JA 4LKCB 2BX5A 1CFSA 5I5MA 2FQEA 1OSZA 3APMA 1MHPH 4TNVK 5B7MA 2QELA 2YRLA 3V6ZA 2V7HB 5EEXA 1GZPB 1FE8H 3E6HA 1KPVA 3WY3A 1QFPA 1T83A 2Y1YA 1SEQL 4YAQA 1KCBA 5JLZB 2BNQA 2Q0ZX 3B1UA 3SDAA 2ETWA 3X1FA 2X4SB 3CFCH 3PWPA 1J5IA 5CKGA 1N18A 5DSCB 4YDIL 2N4IA 1O6SA 5KUKA 3L3DA 5I1AA 3IDYC 1M6OB 4UZSA 5I19L 2FB4H 3GKWL 1EGJH 1QEXA 5L2KD 4KJQD 1R5IA 3K7UA 1X44A 5I1EL 3OAUL 3COOA 3NFPA 5AZUA 3OKOA 3MYJA 4F91B 2XWZA 2EZ0D 3HB3B 2EACA 2LABA 1K85A 4JREB 1B4RA 4L4TB 3MOAL 4N5ED 4TN9A 3U4KA 4E9YA 4CC1A 1ORQB 1HNFA 1TEYA 4BQBA 5CEYB 1AE6H 1DDTA 5I8KH 4LL1A 4U1HA 1YAIA 3O3EA 1S3RA 1A9BB 3VQ2C 2WSDA 2BXYA 3HE6B 5DVLA 4QF1A 1T0MB 4WO0A 5DK0A 4P3DB 1HNGA 2NT0A 3RL1A 5GZOA 2X0UA 4ELMB 1B9ZA 2XWJA 4PJFB 3JWDL 5E9DA 1JV2A 3LD8B 4EZJA 1ACZA 4KROC 1S7QA 5FV1L 3GM0A 3S2CA 1FZJB 3NCCB 15C8L 1BQHB 1A1OB 3FW6A 1P4UA 2P5WA 1QO3B 3QQ9C 4NP4H 1GY2A 1IAOA 2CO3A 3U82B 4HXBH 4OKVB 4OZGF 2QKIC 1ZSDB 4DP6X 1RHFA 2XWEA 3HIZA 2FQGA 3GXDA 1KPUA 3M8OL 1LMKA 3N55A 3UXFA 1CBVL 3HMXA 5SWSD 2V9RA 4FYTA 2HG0A 4Y2DC 5CJ5A 5C2UB 4U2ZA 4JO3L 1DQTA 1AXTL 4PJEF 1CB4A 2VM3A 1ACYL 1U41A 4OLVH 1HXMB 4R4FH 3ARGD 1M42A 1A65A 1HJCA 1DJSA 3I50H 5KW9H 4H8WH 3SOBL 2JKJA 3FF8A 5L88H 2ZSVB 4GXVH 1RJYB 2VLJE 1VERA 3WNJA 3WSQH 1DQJA 5ANMA 2H1LM 2K8QA 3IN2A 4PJGB 3T1WA 1AQDB 3C2AL 1G6VK 3IKCA 1KGCE 4DVRH 1MI5D 2ARWA 3R7RA 1YJDH 4UIKH 1SPDA 4W9CC 4H1LG 2EEXA 4N2FA 2VDNB 3UFIA 2VUKA 1YEKL 1BWMA 4HV8B 4LCIL 1OGAE 3ASOB 3ZHLA 3DO7B 2NTSP 4YSQA 3WJMB 1HOCA 1RZQA 5L6YL 4JB9H 4HLEA 1EVUA 4M62H 3DX7B 4L0YA 3WFDH 1WJ3A 3QIWA 3L5WA 1KIQA 3C8KA 3VA6A 1G7IA 2J43A 4OV6F 4QOKD 1OLLA 1EH9A 3P0GB 1ZPLA 3QFDB 2BSBA 2WXQA 2VL5B 4XBMA 1IEBA 1IIIA 3L8QA 4KK8C 3V0VB 4MXWH 5A2JH 4FL4B 3B2UC 1XL6A 3FO9A 5L0QC 3RI5K 3OKNB 1HQ4B 5CWSB 2B5IB 3WTUA 1AIFB 1UB6A 2AK4B 4JJ5A 5HD8D 4MA1C 3S3SA 5KVDL 4UQIM 4BQCA 5CEZE 3LMJL 5EWIH 3QFJE 4AC4A 2WZ0A 1E2ZA 2OR9L 4Y16A 1MFNA 1IO4C 4ZMOA 3KAAA 1CWVA 2VDOB 5ALCL 4KFZC 1E42A 1U3ZA 1RI8A 1A7BA 4EN3A 2YGPA 1ZT1B 5HVFB 2PO6C 3WIAA 1GR7A 4HUUA 4MZIA 4DZBB 2X53A 3O9WD 4BA8A 3QZMA 2UYLA 2MPAL 1TQTA 1HL8A 2EIKB 4IBQA 2DL2A 1AGFB 1NAMB 4JFZH 3CFMA 3FFCA 3WNPA 5F0LB 4FE9A 4LGRB 4XN9A 4PN6A 3DX0A 5CZKA 5D2LA 3ZQWA 1BEYL 4OZ4B 3Q8EA 3WFHB 5IQ9B 3G04B 4Y4HA 3LKOB 1NCHA 1CVRA 3RFZB 1AD9B 1L0QA 2YD1A 4LQ1A 2WPGA 4CVXB 4CU8A 3S36H 1I8KA 4JDEA 5D7JD 5B7FA 1U0QA 1X5AA 5B7EA 3TYFA 2BINA 1J8HE 1SMAA 4DN3L 5DD3L 5H94A 2EXWC 1NFDA 4HKBA 4LCYA 4PBWD 5TF1L 4XWGH 1DUYA 1I3VA 2OMXB 4NO3A 1DJZA 1E5CA 3HI5H 3O2VL 5HYJA 4UT7L 4OZHA 4G2AA 3HG3A 2VUOA 4FQXD 2ZUTA 4XO5A 3IM1A 1RL1A 4HA1A 2AK1H 1FNGA 2WMPA 1EA9C 3ZK0A 4HOZA 4ABQA 5IQMA 1J8KA 2I26N 4KX8A 2B4CL 3FCGA 4FULA 1D5MB 3EFDH 3SQBB 4AQ8C 1UJTA 2P42B 1WLHA 1R19A 3CH1A 2R29A 1BZEA 5AOJA 3O8XA 4N9GA 4XP1L 5CJOH 3AQZA 2X4TB 4PLKD 3U0TA 3OMAB 3CX5K 2ALAA 3D39B 4MASA 2UY6A 4G7RB 1XF4B 4AXWA 4HZ1A 1JNHA 1XTMA 3FQWA 4BGLA 2AEOA 1KIPB 2WUCH 3PGFH 1U8JB 4S1QL 1E7VA 4FXKA 2ZOLB 4ZPTA 1WD9A 3QQ4A 3CZFB 4XP6H 2EAEA 4U6VH 2Y4SA 5IOKA 4NZRL 1Y1DA 3ULVL 2DICA 2WLKA 3FUKA 5CGYC 3VYOA 3ESMA 5MI0B 4UU9B 4E36A 4P59H 2WBJD 5BVPH 2AQNA 4I8DA 3UTSA 3PAUA 4PJAA 1JRHL 4NO5B 1XF5B 4JO4H 2AXWA 3IPEA 2NUPA 1OAKL 3VWKA 1F4HA 4MNGA 3IFLH 4N8VB 1N5YL 4L5FH 3N85H 4JKKA 1ZSHA 3BWUC 4IOFD 3RKPA 6TAAA 1R75A 4JFXA 2N01B 3GC3A 4KRPD 1T0PB 5T3XH 1V7ML 4HX1B 4JQVA 1KB9J 3NIGB 4ENED 1LP9A 3GB7B 1TMQA 3RGVC 3HCVA 3BISA 2HTLD 3LEYL 2FL5B 4NENB 3VWJA 3IFPB 1K6QL 2R0KL 3PQYB 4HWNA 5JQHC 2W0LA 1EXUB 3ARFC 3JT0A 2EYSA 1QYGL 1I31A 3SGEI 5FW8A 4PWIA 2XPZA 4WHYH 1FN4B 5KS9A 2J55A 3QDJB 5EIVA 1S3KH 2PPDA 1U3HC 1KYFA 2EIZB 4PYHA 4DGIL 3AVEA 3DGGB 3QI9B 1LTXA 4S1RL 4DQOL 5FOBB 5LCVL 1B4JL 2HVJA 3EOAA 2C3VB 2FSEA 1UEYA 2O5XH 4ZRGA 4HUVA 3ZTEA 2V2XB 1A3ZA 4KV5F 1TKWA 4X8GA 4N2EA 3OKKA 4IJTA 4OCYL 4DH2A 3CQFA 4Y5XB 3D4ZA 1I85A 3QS3A 2XNAA 1G9MH 1QI5A 1IQWL 5EU6D 4ZDHA 5J11B 1EZVY 5MEND 4WWPA 3UTTD 1NGWA 1PF3A 2BZCA 2GITA 3B2DC 4N0UA 3QZLA 4I4WB 3ILQC 2A83B 3QEQB 4GXFA 3VX1A 4PP1D 3AITA 4L8DA 3O6LH 5E08L 4YQXH 4B5ZA 2Y7MA 2ENPA 2HVKA 4G70B 1AR1B 2F53D 2X4NB 5T1KB 3V7MA 1JUFB 1QX1A 1E8ZA 2A9AA 3VXMD 3FTZA 1K4CB 2NY4C 3ME0B 3TT3H 4UDUB 5A6LA 5KSBF 4Z18A 3HI1A 2JCCB 3TBYA 3BPCB 3WNNA 4RGOL 3K1DA 5IBUG 2CK0H 2J5LC 1U4EA 2CIIA 5A6IA 5JIQA 1RXLA 1C5DA 2G3XA 2ZX7A 4KO7A 1R9FA 4XAKE 4R4NC 4QT5B 1RP8A 2DS4A 2GJZA 2F19H 4TM9A 1NGPL 3LIZL 3WUZA 4PJBB 1ZGLP 2P8LA 2NX5A 4W1TA 2E8YA 1I75A 4HEPA 5IMMA 1AO7A 3ATDA 3LTVA 5JHDD 3WKML 4X6DF 4PTTB 2ADFL 1OAXL 4XOCA 5HYEA 5AAWC 1U6AL 2CDGB 1YN6A 3LKPB 2IPTL 3GINA 4RSYA 3ABLB 4X0KB 1RV6X 2Z0BA 1T4WA 2APWA 4ZX3A 1CLVA 4I9WE 4JM2F 4EI6B 3QUGA 2AEPH 4QTHA 3RPKA 3DHJA 3DYOA 4KZEH 1UD6A 5ESVB 5E56A 3WLWD 5IJKC 1ZEAH 1J18A 1KXTA 3OR7A 3VTAA 2Z7YA 5ESQB 3CZNA 2WVUA 3Q6GH 3UZEC 1HI6B 2ESVA 5HDOA 2W9EH 1J0ZA 5F7EH 4OFIA 2Z3FA 5AZ2H 1MCQA 2ITFA 3GTTA 4OIIL 4U6XA 3NESA 3HAEB 4H25B 2C9PA 3KL0A 2HG5A 4M6OH 2AKRB 4V11A 3TBSA 4EI5B 4UQ3A 4F1SA 2XVGA 5J89A 3EH2A 1A4JB 1WS7A 4N6RB 4ZO9A 1JAEA 2IGFL 3FCUB 4KROD 4PIBA 4HIJB 3LRKA 5DHYA 2JIXB 3MLUL 3S97C 3CFUA 3C5JB 3JYCA 3BGMB 5KSVB 4EMZA 1BLIA 4JX0A 1FL5B 4QLWA 3K0YA 3D34A 3IYLW 3QQ9D 3ZTCC 1U8LA 1NCDL 4OSUL 1ZANH 4LPYA 5CSGA 5BW7C 4QRRD 4XNBA 1DANU 2VW6A 2XTJC 4J3SA 4ABWA 4LVNB 4HOMA 1ZHLB 1MQ8A 1Z2KA 2LVCA 3CLFH 4I88A 3HC2A 3QORC 4MJ4A 5HDQH 4LP8A 1C9SA 2NW3A 2Y1ZA 3X11B 3GSRB 4L5FE 1U8CA 4P46D 1YEEH 3W57A 1YA5A 3GSXB 4YSSA 4D0DA 5GRJH 2ZAIA 4ISVB 1ECZA 4OLEA 4YC2C 1YEGH 3T77A 5T3XE 4WJ5B 3NCWA 2AV1A 5GGRB 2WAQA 1HE7A 2VLJD 4GQZA 2C9XA 1YLBB 2DM7A 1TTUA 4AT6A 1S9KC 5DUJA 3AUVA 1XGYL 4X8JA 1P2CB 1G9EA 4OIFA 2P45B 2CALA 3ILPB 3C60C 3ZL1A 4QWWD 3E0GA 1OGAD 4MGXA 4PRNA 4Y5YA 4LCUA 4PB9H 3R8BB 5D5MA 5F9DC 3JWOH 1VZHA 3K5SA 3KPOB 4FQHB 5D1ZB 3FCTA 3OGOE 1A4CA 4RFNC 5DRZB 2WJ7A 1I9IH 5D7IF 1MCCA 3GXIA 5C09A 1Q0YH 3CFEA 2W9DL 1I3RB 3DX1A 1I1RA 4LLUA 2A3TA 3D4YA 3P1VA 3T0EA 1G94A 2BFVL 2X9XA 2CGZA 3B8YA 3B2UD 3FPYA 1U95B 2JH2A 4FP8L 4NRXA 4JW3A 3QFJD 2OL3L 1LO5A 4ATTA 2GJJA 1V8HA 5EO0B 5ANHA 3WTSA 2RTTA 1T1ZB 1KCSL 4WW2F 1B2WH 2R4RH 5D70L 2LFEA 3NZ8A 4PJIF 5GGQH 3V6OA 3IDNA 1RSYA 4Q0XL 3N1MC 3ULSB 4K2UH 2PO6D 2EH7L 2FATH 4NFCA 4PBVC 3PU7A 4JQXA 4YHZL 1AD0A 3VRJB 2CXKA 2HT3D 1RIUH 3DOSB 3NZUA 1AHKA 1IX2A 1SLUA 4WUUD 1C5BL 2OMWA 1ESOA 4KKLC 3KG5A 3QNXB 4NYLA 1T83C 1RH8A 3OKEA 4FQ2H 4YEEA 1GAFL 3QJFB 4ZW7A 3SDAC 2G60H 3WFBH 3PHAA 4CAGA 5L2KB 1DCEA 3F5WB 1AZBA 2XZAH 4RRPG 2R0WH 3ZUNC 4AL8L 4A55A 5C2BH 3IRCA 3LN5A 5I5JA 2RJMA 4GRLA 3U4BL 2WCGA 4MJ5B 3KPRA 3TBWB 3OAZK 1R0AL 1K2DA 2EH8H 3HUJB 3X14B 4YHLH 3ZGHA 2YRZA 4X6EA 5BV7L 3MTXA 7FABL 2NXZD 5E8PA 1CD0A 3FU6A 1J8HD 5CSZA 5DU7A 1Z9PA 2HXAA 5EEWA 5DD5H 2QLYA 2EXWD 5KYNA 1A7OL 1Q8MA 3DXAE 2FWUA 4BKLB 3KPPA 3PAVA 2VXSH 5EO9A 1OOWA 4X6CE 3VI4A 1U21A 4F7PA 4Z3EA 5GZOC 4F2FA 4IBSA 2K3HA 4J5VA 5C07D 5C0GA 3CN4A 1JTPA 3ABZA 3FU3A 4LDEB 4WF7A 1IGCH 3HC4L 4XNYH 3OWRA 5I1LB 1E7UA 1Q9OB 2V2TB 4X5LA 1NCBL 2DL9A 4GG6B 2X0VA 2XN2A 4GB9A 5F7HA 2QV4A 1PIGA 2G2PA 2Z1PA 4G1EA 4U1LB 5FM4A 5SWSB 4N68A 1GRWA 4NM8L 1SXCA 3T65A 2JI2A 4J2QA 2ICWB 5E4AA 3EG9B 4HPOL 1ZXKA 1BJMA 5ACZA 4POUB 4IM8A 3QUYA 1HYRC 1D9KA 1RHHB 3DIVA 3RWJB 4I3RL 1A7QH 3ARGB 3X1EA 5DA0B 1SOSA 1G87A 4L8BA 2VJ8A 4RX4A 1QKZH 2HB0A 2RFXA 1NC2D 3BKJL 3L95B 4HUNB 4JFEE 3S37L 3S8WA 5KAQF 1OM3H 2EICA 4N8CH 4BHUI 3GRWL 4PWGA 1MI5B 2L7QA 3LRGA 4KJWC 4LEBA 4HXAL 2YHGA 4JPVL 4EQ2A 1RSFA 1WD8A 5CCGE 1IE4A 3L3HB 4ONGL 2PTVA 3KGRA 1DLFL 3MRJB 1F8TL 2E6JA 2E9BA 5EUOB 4K5OA 3WGVB 1NEZA 3D6GA 5LAXB 2ZCHH 4JG1L 2OJ1A 2XA3A 3NQIA 4F57L 4W9DC 3RX7A 5CBEA 4QOKB 5AD0A 4IIZA 1G7MB 1D5BB 3B9DA 5JPNB 5LQBL 2LTQC 4FXGA 2D7MA 1SUHA 3B7YA 4XVJL 3P4OB 4GAYB 3CFBA 2CIKA 4U6TA 3QIWC 4NDMA 3SE6A 4CJ0A 4JCWA 4K94L 2WTRB 4ZMQA 3GPSA 5BOZG 2GK0B 4AEHL 4F37F 1BYNA 1NCUA 4PJHF 4HH9B 4D7BA 1XGRB 1QBAA 4FTVA 2DBJA 5AW5B 4BGDA 4G11A 2DQJL 3HR5A 3HLAB 3LZRA 4IU3A 3NVQA 4EDWL 1IEAA 4U31A 1NLBL 2ZOTA 4Y16C 3WHXA 2BHUA 3GJFK 3O9WB 1QAWA 5C0CA 2CO7A 3QULA 4EN3C 1L0YA 4U1IA 3VACA 3TV8A 1TZHA 4CUCA 1OTSC 2HFTA 4DOHE 2OAAA 1I9EA 3IJYB 1FH5H 1RZ8B 4IBVA 3AS0A 2X70B 1YEWA 3MBWA 3MA7A 4U7SA 2IFGA 2VNCA 5E6IA 4FKKA 2DMHA 3VSQA 4PGEB 2ZKHH 1YYML 4F33A 2WCSA 1ROWA 4FFZA 1VSCA 3AY2A 1LEKB 4PMFA 3DX8B 4NQCA 4Q6IB 4RRPM 4H2AA 5D7JB 4YDJA 3V52H 3Q2CA 4H2CA 4Y4HC 5DZJA 4J12A 3ROLA 1HESA 4M8VA 3BDBA 4DIXA 3N2JA 3GFUA 4X4MA 1R3KB 1SF3A 4K7PX 3SY0A 3OD3A 1P7BA 1VACB 3FKUS 2VMEA 1BZ9B 2JKXA 3W2DL 2FWSA 1JZGA 1ZRUA 3P9LB 3ARTA 4UNUA 3N0PB 5ADPH 4TUOB 2XKNB 1I9JL 2AGJH 3I6SA 4OD1L 4XAKD 4FQXB 3DROA 4H0GA 2KI6A 1N8ZA 4M1DL 1F6AB 2HT4C 1OARH 2WIMA 4JHZA 4YSOA 1BVNP 3EDEA 2QSCH 3FRPB 2XVLA 2XQBL 1AQ8A 1MPAL 4AYSA 1YO4A 2V8MA 2WTPA 2ZSWB 4DEWA 3IGLA 5ITBL 2X10A 2JJUA 4UZGA 1R24B 1URIA 4PRPE 5I5IA 1DVFA 1L5GA 2OBGA 2AXGB 4AENA 5L2JA 1NOAA 1PZCA 4WKXA 3O8XC 4WCYL 3ZT6A 2V5MA 2MFNA 1QHOA 2RCSH 4O2FB 4OV5B 2OK0H 5DD1L 4X7CC 4BUQA 1BGXH 2OL3B 3CFQA 5A2AA 3VI3E 3TWCL 1SY6H 3NZHH 5EN2B 1EIBA 2GABA 2KZWA 5EUKB 4MXVE 3CN1A 5AVUB 1G9NH 1OCOB 1SJEB 4FXKC 3TP4A 1J86A 1FLRL 3JV6B 1LO3H 4HEPG 5FXCH 4U3SB 5L4MA 1JWMB 1T80A 1HDMA 3NA4A 5C6WH 3ZDZF 1RMFL 2IALA 2WLYA 1E2VA 2ED7A 3L4UA 5SX5H 4QTIH 2NY1D 2J1KA 3QUXA 2UZYA 3QCUH 1EO8L 4G6AD 3LZFL 4ZO7A 4KKCD 5F44A 5C08E 4JFUA 4KRPB 4E9QA 3MLSL 3VWKC 5FKAA 3WIHA 4NT6A 4W93A 5IB2A 3WDHA 1PG7X 4JPQA 2CHWA 3TYGL 4AX3A 3LKNA 2BH0A 2LT9A 4HD9A 4I5BB 4LCWD 1KZYA 3QRLA 3E3QC 3VG9B 2N0KA 4CMHB 5FB8A 3PIQB 1WFUA 1GH7A 1SQMA 5C6PB 1AS6A 3LPFA 1MXDA 2MHAB 4JQVC 4N85A 3U6RB 3ETTA 4QHMB 4UAOB 3VXRD 3RVWC 2C3XA 4LBEB 1J9CT 4R7LA 1T2QH 5AAMA 2EILB 4KI5F 2K6ZA 3VWJC 5I0DA 4GXUN 3VD0A 1FE8L 2D7NA 5DC0A 4JM4L 4PSRA 3A3YB 4MJ2A 2KYIA 4JS7A 5T3XD 1KEMH 3BIKA 2BSRA 2IOOA 4Z7UB 3CFCL 4ZSOB 1JFQH 2Z35B 3GIVB 2DJ4A 3P3YA 5B3JE 3QDGE 4NNPH 5DVMA 1I1YB 4P2QE 4AGQA 4JFDE 3SDXE 1MW2A 4WHDA 2UVFA 4ZOEA 3N43F 4LQFH 5EU6B 2FB4L 4LVEA 1E5YA 1EGJL 5BZXA 1LWRA 4XR8C 3M1OA 3N41B 2IXQB 3FQYA 3MLYH 3MV01 4LCCA 4NM4H 3EH5B 3UTTB 4AJYV 4GP5B 4X2UA 3C60D 3EYUH 4OGZA 1UZ6F 2W38A 4Z7NF 4KUZL 1I85C 2SEBB 4G6JL 4PVBA 2QQKH 5FO9A 4YDNA 4XPBL 4ZUUA 4X8CA 1V3JA 3WXWL 2XZCL 2R7EA 4HAGA 3PHOB 1U3YA 2AJZB 4DKDC 1AE6L 1KJMA 3T4YA 3B43A 2F53B 5TDOA 1S9XB 4APXB 3KBPA 3L2NA 4HBQA 3BFOA 3VXMB 2G3NA 2WWKT 1PLBA 1JGLL 2YN5A 3EO0B 2FJGB 2EYRB 3ZHNA 2OMTB 2Q8BL 3FQNB 3IRZA 1R3LA 1SJHA 1X5HA 3U7YH 1O7DE 2F68X 3GXFA 3VXTB 1BCIA 3TLRA 1I7RB 1YHPA 4NP4L 5KYXB 3NCMA 1A4KB 1E67A 3OKLB 4YE4H 4DKFH 3W39A 4PPTA 3FB6A 3TJHD 4MYWB 3MJ9H 1CTMA 4YR6A 1C1EH 5F6IC 2BP8B 4AV0A 3QYNA 3RNKB 3UCRA 4TL5A 4XHQA 3N9GH 2AMUA 5J3HC 5DMKA 1J0YA 5C0DB 2K3TA 3O41B 4R90L 5JHDB 4KK6C 4OF5A 2DLTA 4OLVL 2DEXX 4RFOH 5JO5B 2WXNA 2XKUA 1T5WA 3I50L 5ICZA 2IPUG 1N19A 5ITFB 4H8WL 1T1WB 3MO1B 4WSKA 4GXVL 1NFKA 3SKNA 3FPXA 3F6JA 1ZLUK 2QFRA 2ZWKA 1QFWH 3PWPD 3RWDB 4JPWL 2WKGA 4YHOH 3WSQL 2R2EB 5E8NA 2CO1A 1KCRL 3GPEA 2FLRT 2FEDC 1HCZA 4UNVA 2TSBA 2DD8H 4E5XA 4AJWA 3E8UH 2VAAB 1ETJA 1OHQA 3HBQA 4Q9BA 1H0DB 2KPWA 4OZGE 3RY4A 5HI5C 1T1YB 3II3A 4KXBA 4BH7A 4XWOC 4LSUH 4PG9B 4M62L 2WXKA 1GGCH 2GY5A 3WFDL 2YIHA 4ZUSA 2KZKA 3QJHA 4PJEE 4JRYE 3KPMB 1K5NA 2Q87A 3UP1A 3A23A 1KGIA 4KROB 2DQTH 2XQYA 4D0CB 2VMJA 1T7ZA 5GZOD 3KJ4B 2X3AA 2JFCA 2KLTA 2ZAGA 4TOYH 2F7QA 1UD3A 2F8IA 4YSTA 3C5ZA 3UADA 3D09A 4J4PA 1QTPA 4QRRB 1H9VA 1OF0A 4HHGA 3P3TA 4N2NA 3RBSA 2YBGA 1ZTMA 1TMCB 2ICEA 1A66A 1YY8A 3GJFH 3QA3A 2FGWL 5HHXH 2VZTA 2FLMA 5IHUH 4WWKA 4Y2DB 4JY5H 3VFGH 4G6MH 4BFRA 4P46B 2X42A 3QDME 2DWTA 3LXAA 3F7VA 5CO1A 2NT1A 3NUKA 1K4DA 1J0JA 2P80A 2FDBP 1P69B 3CQPA 3IWUA 1YEHH 3U36B 3FJTA 1PQZA 4B6ZA 4EQ3A 1YNTF 2VLJB 3WU1A 2WLMA 5ETUB 4JFED 4XZUA 4QJ5B 5C0JB 5ISZE 4UT6A 1JNLH 3MODH 2OSWA 2VIRB 2QGDA 2VQ4A 5FA4B 4LP5A 4GLRH 3NSDA 1GCFA 1KC5H 5L8KB 2OMVB 3V0GA 5B3SB 1OVZA 4B9PA 4CVUA 1T5XB 3MOBL 1USQA 4QRQB 2ENJA 2LQRA 1BZ7A 2Z91B 4PBDA 3K6DA 1ZD6A 2H47C 1HHKB 2YXWA 1OP5K 1E40A 4LSVH 1J9QA 4QXGH 4Y5YC 1HX0A 3HZYB 3VJ6A 3H4HA 1G6RA 1E43A 1U8IA 2Q86A 1WAAA 2K6YA 4WNJA 4HUXA 5T3ZH 3EFOB 2B59B 1LVEA 2GG1A 2ZYRA 1VAHA 1LEIA 1NMBH 5FUOL 4M7ZC 3HI5L 2X7LB 2VW7A 1P9MA 3QIWD 4L29B 3SKOA 4D9LL 3F7QA 1CU4L 2NYZA 3SSGA 3FH5A 2YEZB 3QFJB 4N2CA 3PXJA 3T0EC 2V17L 3R0MA 4GRMA 4HK3J 1I4FA 3EJZC 3TH2T 5CILL 2G0KA 4WUKH 3U9WA 2OYPA 1K9TA 3D69B 1HHHA 2VLKD 2VR3A 3ZDWA 3S88H 3VFPA 1NEZG 1JDDA 4O2EB 3IGAA 2L7EA 2PO6B 4Y1AD 4Y16D 2Q9OA 3B9VA 4HJIA 2COVD 4XPFL 1KGJA 4G83A 5CNHA 3WE1A 4AJVA 1IGYA 2NZIA 3MLTA 3V6OC 4HWBH 4ZMVA 4F37K 3UPAA 1QABA 2CO4A 2WUCL 4UT9H 4G8GE 4WUUB 2BP0B 3HC0B 3US0A 2QPEB 4OQTH 3VXOB 1OD9A 3HG1E 4JQXC 3VH8B 1KV3A 2NMSA 2R69L 4XP6L 5IESH 4U6VL 5DGQA 4PS7A 4XNQA 3QJXA 2AQTA 3N42F 5M94B 4IYKA 1AMXA 4A37A 4NUQA 4P59L 3FFCD 3O11A 4APQD 2VMDA 3DWTA 3NJHA 5DI8B 2AVGA 1JWSB 5C70A 2BERA 1F58H 5GISL 4R8WL 1DSFH 4U05A 3EYOB 4HDIA 2KMWA 1A1MB 3H9YA 2NXZB 1HKFA 1L9NA 1J8HB 1OTTC 2H6PA 3N85L 3F00A 3O2DA 4GRLC 4ZODA 5EZJB 3BKCL 2YAEA 4LPCA 5C92A 3UDWA 1WRFA 2EE9A 3OZKA 4OF8A 5T3XL 1SN5A 1UJ3B 5EU7E 3MJ8B 4ZFQA 1PZ5A 2IADA 3EDDA 2RACA 4HIQA 1DSYA 2BSTA 3PUCA 3MCYA 4I0PD 4IRZA 4EOWH 2EEAA 3QO0A 4TVPH 4F2ME 2OA9A 4Y8DC 5C07B 3UYRH 2A9MH 1U2YA 2R27A 4LMQE 3OM3B 2CR0A 4UTAA 1KXQA 5HYJD 1YPZF 3RWEA 4V1DD 3TNNA 2MNUA 5I71B 1OB1B 5CLWA 5ICUA 3L3OC 3G5ZB 1CLZL 3H85A 4DK3A 1UQSB 3SYCA 1T0NA 2G75B 3T8XA 3LPPA 2ICWJ 5EO1A 4ZS6C 3DRQB 1JPST 3RY5A 3NAAL 3O8XD 1QPKA 3JV5A 4HCGA 1UG9A 3IU4H 3OF6D 2DJSA 5A6MA 2FYYB 3D12B 3ETBJ 3MRNB 1LM8V 2UVEA 4CILA 4MKTA 4XI5D 3DSFH 1BX2A 4BSJA 1J5OL 1KTLB 3QUYC 1NC2B 2YD9A 3FT0A 1D9KC 4Z7VF 5EB9A 4NKDB 5LB1A 1AOZA 1XCXA 4QCIB 4PS3A 2CLRB 2HN7A 2H6OA 3E8VA 1VCBC 1BQUA 4N2OA 1Q38A 3TC9A 4GMTH 1L7TH 3G08A 1KNOA 3B3IB 1GGBL 3BUYB 3CZSA 5FGBA 2ROYA 2WWNA 2YAPA 3SDCA 2BVPA 4YDLC 4PY7B 5C08D 4X99B 3UGXA 2DQUH 4KTDL 3FTSA 3TIEA 2W60B 1DBML 3EYVA 3GNML 4RIRA 4KV5E 3RGVB 2EDTA 1HXYB 2APSA 2H41A 1AHMA 1ICTA 2GUOB 7PAZA 1RUQH 5IVNA 3TBVA 3KR3H 2H3NA 1N64L 1UT9A 1L6XA 5DF0A 2Y06H 4R97C 4FXGC 3RVWD 1WICA 4CKVX 2BIHA 3I75B 1IGTA 3VWJD 5EU3B 3MRRA 4QGTA 1HHGB 1ZDSA 4LPTA 3INUH 3N04A 1JGIA 3EUDA 4AC2A 4L1LA 1S6NA 5DO2D 4LSRL 4MJIA 5B39B 2XV2A 1ZLUH 4JHAH 1RZ7L 5E5RB 3MRIA 5IM7A 3D25A 2EDOA 5EZLA 2VN6A 3N44F 4JFDD 1FZMA 5C3TA 4NZTL 3BP4A 3B3BA 4KNUA 2BZDA 2D7TH 3UTPE 2DAVA 3GLZA 3LHPH 4K7PH 43C9B 1Q0XH 5KSBE 4RAUA 1JMXA 2AEPL 2EABA 2XN9E 2X9ZA 3BH8A 3SBQA 2P5EA 4KZEL 3A4FA 1ZEAL 4UM8A 3GMNB 2IQAB 4FQCH 4IOSA 3Q06A 2H26A 2HLAA 1J10A 4HFWB 2I9TB 1OZTG 3T9WA 2CGRL 2UUDK 5F7EL 5AZ2L 5E6IC 3GRBA 5JUEH 1EZUA 2EKSB 2H2SC 2W5PA 3REWB 2AABH 2ZCLL 1YQ2A 1HILA 3A4AA 3A0OA 2H3KA 4RWYH 4YGVA 4X9YA 4X6DE 1LEGB 1MN4A 1JYXA 5GRVL 4AE1A 1MREH 1PCSA 1ZKAA 2AFNA 1UHVA 2QADD 3O3DB 4NPJA 3MBXH 6CGTA 5IOPA 1GKOA 2PTTB 5H2BA 4B27A 2HJFA 2J5LB 4Z1PA 4L8CA 2C7UB 3APCA 4E9XA 4CVWA 4UIMB 2P26A 3MRCB 1MIML 3BKYL 3BT2L 2XJKA 3PWNB 1WITA 2ZXAA 3FH7A 1TDQA 4RFEA 3K4ZA 1S9WB 3MRGB 4AH2B 2P24A 3MMEB 4HHAB 1BAGA 2D0GA 1QHPA 5J3HD 1FFRA 1Q9KB 3RWHB 3MUGA 1A0QH 3CWGA 2E6PA 4UM9D 4FABH 1RZJH 1YEGL 3GLEA 3LRHA 4LRNH 2OXHA 3F64A 4B95C 1AO7D 5KN5A 3IJHA 2QHRH 1UD5A 4AZ8A 4JZJB 2MQGA 2H0EA 3P2TA 3BP6A 5KOMC 3C2SA 3M88A 1C16A 4H8HA 1KDJA 3L13A 3WENA 2NY5C 1DVFC 1IC5H 4TVPE 2XG5B 2DYPB 3O4OC 1PG7H 4WGKA 3BO8B 2HWZH 1BIIA 1GPOH 1WPCA 2FEDD 1CR9L 3U9UA 3ZMNA 1J05B 1M4KA 4Y9EA 3BKML 2W80C 3BGFB 3DXAA 2F5BL 3FSVA 5HI5D 1K8DB 4PB9L 4AK1A 5IFJA 2Q1EA 4YPGB 4K3JL 1FHGA 4YNYA 4MX7B 3GMRB 4KXCA 2A6IB 1H8SA 3FUIA 4KVNL 2IBZY 4X6CA 3MR9B 4NUJA 4X5PA 4YO0A 3D85A 4Z7WA 4FXLA 2NY1B 3IDJB 4Y4KD 5EOTB 5CR1A 4KKRA 1DQMH 3OB0K 5DDHB 4JRYD 1ZV2A 1BYOA 3K74B 3QCVH 4G7YH 1AZVA 2CU9A 2OTUA 4M8UA 3EDFA 3QUXC 3ZKQD 2J8UF 4K15A 1UTDA 1IM3A 2E5EA 1AGDA 2ID5A 4LCWB 2VZOA 4MWFB 4B50A 4XOAA 2H3XC 4J3TA 1EBPA 1F3RB 5DZLA 1H6TA 4ZUVB 4FN0A 5KSUB 1EQWA 4E5XG 2VOTA 2DKUA 5D8JH 4YFLF 5LBSA 1F4WH 3KXFE 4NO0A 2K4WA 4ORGB 3VXRB 2A6DB 1OY3B 3WLBA 1B2WL 1UXWB 4AYEC 4XPTL 3HZMB 1CGXA 4XVTH 5GGQL 1U30A 3UPCA 4AK2A 4N0RA 2XWTA 1JWUB 4JGUA 3UCQA 2FATL 5IK3B 1SN2A 3QAZC 3GKZA 1FFOB 1TZGH 1FHNA 4PUBL 2NQDA 5AAMC 3NJJA 4MSWB 1AGEB 2H1PH 4HS8L 2XQYG 3GXTA 3R19A 2OQJA 5D7IE 4RNRA 4GW1B 2LLNA 5CD3B 4K4KA 1M7XA 5C0EB 1F2XK 4HWEL 1KCWA 1EANA 2DEYX 2WXOA 1DEEB 2C34A 4HULB 5KZCD 3BRDA 3GMLB 3QJVB 2FWOA 2XZAL 2Q5BA 4DUWA 2R0WL 1N12A 1IBFA 5JW5A 4NCC1 1ZGLB 2E9IA 4BD4A 3C60B 1FVEA 3BT0A 4A2MA 1CXIA 1RJZB 2PCFA 5LBGA 5I30L 4YHLL 3H4FA 3KNBA 4FHBD 4NQUA 3RUGF 4LCCC 5IMOA 4PJCF 4PJIE 1YN7B 1ZHBB 2XSKA 2PYFA 2VO5A 5G5DA 1VFBB 2VLME 5DD5L 3CPLA 5JIKA 4M56A 3RVTD 1TFPA 4PJ7B 3IGKA 4BUGA 2LR4A 2AITA 1KB5A 3GDBA 4FEMA 5HHOB 2R29L 4X8XA 2VXSL 3WE6B 3BJ91 2ZF9A 5DS8B 3AROA 4DFIA 2X6UA 3BYTA 4RGND 1G1KA 3HG4A 2JJSA 1BJ1J 1IGCL 1TU2B 2UY7B 1UFGA 1IKFH 3FO0H 3QUKB 2DIEA 1R4XA 3LOWA 3D0AA 3B4NA 1FH2A 3FAWA 2A9DA 3ULUC 1PCXA 4XMVA 4ELKB 1A9VA 1RZPA 5DJCA 2H1XA 1SXBA 4OZFA 4GUPA 5C7XH 2DWEA 1A6AB 3LNHA 1QLFA 4TSBH 3V6ZB 4ODBD 1FWXA 1GYVA 1A7QL 5GGTA 4BDVA 3BAKA 5JOEA 4G71B 3TO2A 3WJLA 4K23L 4YAQB 2HT2C 2ZOOA 1RPUA 3V8OA 3JV4A 3BPOB 3PWPB 3DX6B 5I0YA 2VXUH 5LNDA 1S7XB 1AH1A 1LD9B 3K91A 3ZE1F 1O6SB 1ZLDA 3VQ1C 3L3DB 2WYTA 1VADA 5KSAD 3V5KA 1FL6A 5I5RA 3ATBA 1R6VA 2ITCB 3MUUA 5TH2A 5LXGH 1TOXA 1AIZA 4XNMA 3IVKB 1OTTD 2MJWA 2PPEA 3MYJB 3T8VA 3KPRD 5FYJE 4AUUA 5DFAA 1GL4B 4OM0H 4JN2B 3K6FA 5C0FB 3S4SB 5E7BA 1J1PH 1OL0A 4MCYA 4S0TD 1TJMA 2L8AA 4M6NH 4DWHA 5BJTA 1V7NL 5ESAA 5AW2B 2QVKA 4U1HB 3O3EB 5DEJA 4AVKA 5ABDE 2VSMB 5C8JB 1AI1L 5CHNA 3X13A 1E4XH 3BVWA 3RL1B 1OXYA 4NCC2 1PD6A 2R2BA 4PB0L 3ECQA 4GAJH 2F54E 5DTFB 3LH8A 1JV2B 1YEIL 2WYIA 1S7QB 1CD1A 1NIEA 3MJ7A 1BBJA 1H19A 5HHPB 4ODVL 3SN6N 4NRZB 3GHPA 1NEPA 3C5ZC 2CJ3A 4JO5A 4CJ1A 2YGNA 3IRPX 4J4PC 3HG5A 5DVPA 3H2QA 1X5JA 3CZGA 3EW3B 2O5ZH 3A24A 2ICEC 5I75C 4HBCH 4XMLH 4ZS6D 3ZVVA 2UX6A 4GSQA 4WWKC 1ACCA 1ZVNA 2Q2LA 2MOGA 3ECBA 3D5OF 2EE6A 2WNXA 2FBJL 3GSNH 2GKIA 1EEZA 1T22B 2C9UA 5ID1A 4PGCB 4JFEB 4KKBD 3ZRCC 1JK8A 2CHZA 1AHWA 2Y6TE 4M9PA 2UUDH 1AJ7H 2O26U 1MCNA 4YBQC 5E1HB 3DJZA 3SGDH 2K78A 1KMGA 4RX4D 1TYEB 2ZKXA 4TF4A 1EFXA 3MV8D 4B41A 1YY9D 2ILLA 2W0KA 3IDXH 3NFNB 1LQSR 5ANMB 5B1KA 4AVHA 1SLXA 3ARQA 1NCIA 1JXDA 1MCPH 1NKRA 2BY3A 2J6EA 3LSOA 1UEMA 2XJLA 4LHUD 4P3WA 4P07A 4PTUA 3UX9B 3LEXB 5DMYA 5JA8B 4K3DL 4LK4A 4PVNA 2YPVH 3N40F 1KBPA 5CEXA 1C8PA 2RAMA 4POYA 1HH9A 2Z64C 1OAQH 2IF7A 2LTQB 4WFGE 3KPNA 4JRWA 3PDOB 2J73A 3QIWB 1UOKA 1JV5B 1YJDC 1KIQB 1S7VA 2H32A 3C8KB 3L5WB 1JPTL 1XCWA 1W8EA 5E8EA 5AW8B 1OARL 3QPXH 1IEBB 4PJGF 3S6CA 1BYPA 2QSCL 2K7PA 1P9MC 3W0WD 3CDGA 4BJLA 3QDGA 3D3VA 4NRYA 1JXJA 5AEAA 3GMPA 1QSED 4MAZA 4P2QA 5DRNA 2VLKB 3SDXA 3ZTNH 4NZJA 3L17A 3BAYA 2C3HA 1GZQB 2Z31A 3BEWB 3LNDA 4Y1AB 4Y16B 4FTVD 5T3ZD 3TEXA 1ZK5A 2H0JA 3ETSA 1ZDQA 4TTGA 3G5XA 4NZDA 1IVLA 1IILE 3OLIA 4HUUB 4OJDH 2YQ2A 2EEBA 5FM8A 3F7RA 4GYBA 4WY7H 4YIQB 2D7QA 3ESUF 1YDPB 2UYLB 1SY6L 3WD5H 4IQHA 4ZFOA 4GXUM 4RESB 3L7EA 4HFUH 1GJWA 1LO3L 3FFCB 1QVOA 4Z5RA 4APQB 5KBLA 3OB0H 4PREA 3SPHA 2GIXA 3NDYE 1CFNA 1KB9K 2YXFA 4KKAD 2A73A 3TO4D 3II1A 1KEGH 4QTIL 4RVBA 4AKPA 4WHYG 1BZOA 1Q72H 4YFLI 5E24E 4PFEA 1L0XA 1OAYH 2QVIA 2PPAA 1NBYA 4JDEB 4EZLA 5FCSH 4B96A 2VTFA 3MV9A 3NACL 3FH8A 3BZEA 2I85A 2Z4QA 3L3JA 5T5FA 5I24A 4JM2D 1SEBB 1U3JA 1Y6NR 1HSAA 4I0PB 4K8RH 3UDWC 4QHKI 2PW1A 3IJ7A 1LNUB 1WIPA 1UD8A 2C3GA 4NWUH 4LCYB 1X5GA 4MMXB 3ESVF 4XHJD 5I16B 1DUYB 4NO3B 3C6LD 3KD4A 3FTUA 1W8NA 5JOFA 2WTOA 2COQA 3SO3C 5HYJB 1JI1A 1LMIA 3V5HA 1T2QL 2YA0A 1UT2A 1JPFB 4OZHB 4V1DB 5CFAA 1FNGB 1G5GA 2WMPB 5E9NA 5TQ2L 5I6KA 2VW4A 1UB5A 4HAFA 4JDZA 3JTBA 3BN9D 2MCG1 3ZDZE 1QR1A 3OWEA 3S5YA 1JFQL 3CH1B 4U1KB 2CHDA 3QPQC 1S7RB 2D2OA 3BE1H 3O8XB 3KLSA 4NNPL 3P30H 1RUAH 2JELH 3U0TB 1F97A 2NNRA 4GUOA 3DK2A 3PWLA 2NY2D 4QRAA 4LQFL 3QJQB 4YDKH 2G5BA 4NM4L 5CP3H 4NI6A 5F9WB 1CLOL 1NUDA 1ZOXA 1ZVYA 12E8H 2Q6WB 3ZZ1A 4ZUWB 4JFPB 3PL6A 5EH1A 4IK7A 3CXDH 5B22A 4B3EA 3QGVA 1HZKA 1A6WL 1PAMA 4OI7A 2R0LH 5CD5C 3WDIA 4I18A 5CLTA 1TQUA 4PV8B 1UENA 3EYSH 4KI5E 5E8OB 2RMNA 3U0PB 2EP6A 5C08B 5JW4N 4GEJA 2EO7A 2QGBA 2DM3A 4PW9A 1PDKB 1DVQA 2Y23A 4A7QA 3U0WH 2JVUA 3ARWA 5E2WH 4LPVA 4DHLA 4ZTPL 2NUPB 5FGBC 4U0RC 4MNGB 1DJGA 3SDCC 3W3BA 3QHFL 5B21A 3RKDD 4K5NA 2I27N 4GAGL 3Q48A 3TIDA 3ZT5A 3HG0A 3DOHA 4PJ8A 3KXFD 2D3VA 2FRGP 3DGCR 3QDMA 4DKFL 5G4NA 5IHZA 3HCVB 1DQLL 1HHJB 3MJ9L 1UKTA 2OM5A 1IT9L 1UZ6E 4Z7NE 1C1EL 1CPUA 3VWJB 2IDFA 4K55A 2CDFA 1CVSC 5KWYC 3WO3B 2Y7SA 4FMFA 4S2SA 2EYSB 1DQQA 4Q4IA 5DQ9A 5E51A 5AVVB 3ZRSA 2YBRA 4ZZFA 5ISZA 4AGNA 4H8UA 4KNQA 2O61A 1MNUL 1GY1A 1Y18B 2NCMA 4N2DA 1NFAA 2ZUQC 3Q2NA 4JFDB 1ADQA 1REIA 3MYZA 1FFTB 3MRQA 1SDDA 2VITA 1H3PH 3TF4A 3US1A 2HVJB 3EOAB 1KCUH 2FSEB 4J6RH 1QFWL 4M61B 1BD2E 1IRAY 1TKWB 2CG9X 1TJHH 2CXGA 4TQPA 4GJTB 2NYYC 5H37A 5CIPH 4GEIA 2CDEB 3BH4A 1GHFH 4TUKL 3D2UA 4PP2B 5IMKB 2XU9A 3IMTA 1FNSH 5BOPA 3CLEH 1MHCA 4WI6A 2C9SA 3GO1H 1BQLL 5AG9A 1H8OA 4PWEA 4RWHA 3WNLA 1JF6A 1RIHH 1TQBC 4N0UB 1JVOA 5I1CL 1JYNA 4P3CL 5DJDA 4NAQA 1GGCL 1ITBB 4AEIL 4A39A 3OQRA 4CMMA 2N56A 1L7IL 3NDZE 3C12A 4BWUA 1OHZA 5BUGA 5IGXL 3KLAA 3O4LA 3CC1A 2QADB 2DQTL 5A40E 1CIUA 4JE4B 1CIDA 3GLDA 4R26H 4H0LC 2DQIH 4Y8AA 4YL9A 3W81A 4BWWA 3DURB 3S98A 3DIDA 4HGMA 1W0VB 3WL9B 3S5LG 4JPIA 4HISA 4P48A 2W92A 3TBYB 1TTGA 3RX9A 1M7DA 5J9PB 2HX9A 4WO4D 3TBCA 1II4E 1H15A 1ASPA 2VR6A 1URLA 3NCXA 4WU7B 5HHXL 3TTYA 4JUTA 1AZUA 4PSPA 5IHUL 2Y2WA 4JMNA 3HG1A 4M7LH 2FX7H 4G6ML 3VFGL 3IF1A 1VEMA 2YEQA 1YUHB 3BH9B 4KI1A 1EDQA 4Z0BH 3V4PA 2VR8A 2GJZB 1W0WA 2Z8VC 4AYFA 1MW0A 1UYWH 4UM9B 3GLAA 2P8LB 3LVTA 1CQYA 1YNKH 5BS0E 4LLWB 3FRUA 5E4EB 1YEHL 1AO7B 5K93A 4BE6A 2X6AA 2HUHA 4JFHE 2A9BA 3NJNA 4IRSA 1U8HA 2Y7OA 2WQWA 3G6JA 2JCCF 3A21A 4ETQA 2YAOA 4OLYH 4XCNB 1JNLL 2YQ3A 1YN6B 3WI9A 3U2SA 2OJEA 3F7KA 3PXHA 4DN4H 4KUCD 3ZR6A 3ML9A 1SDAB 2BS8A 2RD0A 2Y1VA 5D96C 5DA4A 3L1OL 5TF0A 4OZGB 4K9EH 3RB7A 2DLFL 4A68A 1HFUA 5DXWA 3KPSE 3T0WA 4MFHA 3RWCA 1NBQA 3PRZA 1QSFE 4OFYA 2FO4A 4PJBF 3VXSE 4D2NA 4D8OA 1INQB 3DPBA 2NR6A 3MGTA 4LSVL 4L4JA 5HSFA 5IB3A 1KTDA 4Y4KB 4QXGL 3ZRFC 4U4IA 4PJEB 3CIQA 5C97A 1RZKH 4JRYB 2EO9A 5T3ZL 1E8XA 5DQJB 3ILEA 4NQEA 4JFFA 4U6XB 3KWUA 1NMBL 1J5HA 1MFEH 3TBSB 2D4DA 2G9KA 5D9SA 5JZ7D 3WV0A 5C0RL 3WS3B 1R33A 4MJ6A 4U49A 4LU5H 1LE9B 2CLVA 1BAWA 1WIOA 3IXAA 3QXTA 4LVOB 3TN0A 3SEPA 5I1HH 4M02A 2IG2H 5DWUH 3CGTA 3VYPA 5T1MB 4W68A 5AVQB 4DGVH 5C9KA 1KULA 1U8LB 2BW4A 1KOAA 3DDFA 4ZYKB 3SDDA 3TL5A 1UXSA 1RPKA 2ZUUA 5DO8A 2A4CA 2FO1A 1DE4A 1QLRA 2G5UA 2R9HC 4WWKD 3EOBA 4PS8A 3UYOD 4HWBL 3LH9A 3AWFA 5GQBA 3RZCA 1CDYA 3GJFA 4BH8A 4JNXA 3GGWB 1MHEA 4OQTL 3EF7A 1E50A 2J20A 4D0DB 5HHME 4LOFA 2DLIA 4GT7A 4MD5B 3T77B 4DKTA 5KZCB 1BM7A 1PNCA 1OAZH 1FNLA 1ZAGA 2WN2A 1FNHA 2BY1A 2FVNA 1YRKA 3QHZL 1XH0A 4G80B 32C2A 1D6EB 3PWJA 2QR0B 5DJ0A 4AT6B 3FQUA 2Y0SA 5ILTL 2E47A 1F58L 1FZKB 1VIWA 3APDA 4UNTA 1NMAH 4V33A 3M7FB 2E3VA 2X05A 5BZDA 1PGRB 2DQFB 3KJ6L 3P9MA 1BF5A 4G1MA 2YC1B 4Y5VB 2OZ4A 3QNFA 3RB5A 4PD4J 3WG7B 4PRNB 4AG4L 1EK3A 2VGLM 2QFPA 4WFGD 3FCTB 4G59C 1CL7H 1QSVA 4R6UA 3K6SB 2OP4L 3IFOA 4M7ZB 2BM3A 4MHHI 5HJBA 3MUHL 3CFEB 4CL7A 5DJAA 3UJTL 1HH6A 4EOWL 1CICD 4JKPH 3F84A 4CSZA 2NY5L 5IMLA 3C75A 1E4WH 3MV7D 2XBZA 3FT4B 4RGNB 3UYRL 2A9ML 1KJ2A 2QVTA 5IG7A 3PWVA 2FEEI 3AY4A 2D03H 4F8LA 1MFVA 4NPKA 4S1DD 1KPRB 1YNLH 1I7UB 4NRXB 3V55A 4J1UB 1MZYA 4BHUA 4LDLB 1Y6MR 3Q13A 3B7SA 5KSBA 2JJSC 5T5NF 1J87A 4KXZH 4LRIA 2X28A 4WFEE 2BHFA 3QXWA 3EJUA 1PTZA 3FQ1A 1KELH 4JVPA 3IU4L 3LZPA 4DUXA 2A1WL 3FT2A 1VGEL 4PH8A 2YD8A 4XH2A 4FMVA 2A9NL 1AD0B 4LL4A 4X6BB 5A3IC 1AC6A 1PY4A 3ULVF 1S9YA 2ZCKL 4NYLB 2GHWB 3WJLC 3UC0L 3WIHL 1KTJA 2FIRT 5KSAB 3IWVA 4X6DA 4GMTL 1N67A 4HG4J 4HKXA 4PG2A 1QMUA 3RPIB 3MROA 2VQUA 5EU5B 5BO1H 2DQEH 1YPZE 4XO3A 1OK8A 3MRBB 4OLUL 3LN5B 4Z0XA 4ZX4A 1ZE3C 1A21A 2RALA 3KPRB 4MAYD 1FF5A 1MEXL 2YMXL 4J3OG 4YFEA 1K2DB 1NANI 2DQUL 3DO4A 4M48L 5FA3A 5G55A 3DUSA 3ARYA 5FYKH 1QI4A 4FNLL 3KS0J 2P43B 1GSMA 3K8MA 4JKNA 5KUMA 2FX8H 4A6YH 3GI9L 3RU8H 5I2IB 5DJ8A 2X44D 1OO2A 5DURD 1PZDA 3CVHH 2ZXWB 5IHWA 1GOFA 2AI0L 3QXAA 4JR9H 1HT6A 2EYTB 3W37A 3D9AH 4DKEL 1G43A 1RUQL 3L1GA 3VFWA 1MWAA 2FD6H 1ZLVH 2VQTA 4Z7VE 1E27A 2Y06L 3GYRA 3PDDA 4J7RA 5EO9B 2RA1A 5DFVC 1DBAH 1CDCA 2VXVH 1HNYA 1S8DB 5KVMC 3VO0A 4TQEH 4TSBL 3BGAA 5C0GB 1XV8A 1KTCA 1NSNH 1EEQA 5I74C 2Y1AA 4UTCA 4XNZC 2AXFA 5GGSB 1SF5A 4OJAA 4JHAL 3E7JA 4HSAC 1CK0H 3T08A 2JI1A 3D18B 2AV7A 3IE4A 1BXXA 4BCXA 5IW6A 5IQ7H 2XQ0A 2BZ7A 2D7TL 3QC6X 5GRZA 2GW5A 2ZUVA 4K7PL 4RMUA 3KW7A 4QXTB 3ZDYB 5ACZB 2NLJA 3MNWB 5GRWA 3STLA 3MACL 2LAGB 3L6FA 3KYAA 4TMPA 2UWEB 4YDZA 2ISDA 4G72B 3H7BB 2MMXA 4N1HB 3MV8B 5SWZE 1EJ6A 1GVIA 5AW6B 5CD5D 4PIRF 4PWHA 1AHWC 1I8IB 4WI7A 5FO7B 5AOLA 1BFSA 4GG6F 1XWVA 3L7FB 1MLBB 4LHUB 1R3IH 3VGEA 3FYIB 2IH3A 4YDLB 1RK7A 4M03A 1WC7A 4LL9A 3NABH 1OE3A 4HGWA 4XMKH 1XF2B 3KDPB 1PLAA 2OMYA 3WNKA 4L4VE 1SOXA 4RWYL 5JXED 4UILH 3GIZH 5K1JA 3UTQB 1Q0EA 1CLYL 4G8IA 4BQ6A 3L2LA 2XDHA 3MBXL 4MXQC 1AQKH 1CFTB 4ZTEA 1C12B 4NC2B 5BRQA 2R0ZL 3ZE0B 5CBEB 2QMKA 5AD0B 3BC9A 1SOQA 1XQ4A 4R97B 4EUPA 35C8L 3P40A 1VB9A 4X6FA 3CFBB 5F3HA 2CIKB 6FABL 5D7IA 3CFKA 4NDMB 3T3PF 3W0WB 3CC5B 5T1LA 5K33A 1QSEB 4IRJA 4QHUA 1A1NA 3LN4A 4DAGH 4MCNA 4JY6B 4NSKA 3NN8A 3AGWA 3NIDB 3IFNL 2HRPL 1I9RH 1JP5A 1M6UA 1RZJL 4FTVB 1Q1PA 4IKJA 2H2PC 2QJDA 3CBKB 2P7TA 3NH7L 4LRNL 4NKQB 4FYSA 5EUOF 4ZW6A 5K9OA 3HR5B 1G7QB 3VB9A 1JN6A 3NJKA 3KHOA 3NK3A 4IU3B 4P5KB 2Z31C 1WE5A 4UUJA 5J5EA 3ZE2F 3U7WH 3WHXB 1IC5L 5E5LA 2IGLA 2CO7B 1PG7L 5FHBH 4JG5A 2XPYA 2HWZL 4PJIA 4J3OC 4CW1A 1QWUA 1EBAA 4KJPD 3L4WA 4NPYA 4HIEA 1F4XL 4NHUB 3K80A 1CYWA 4P23D 4XAWH 3VVVA 2YK1L 3MBWB 2P5ED 1T7YA 3SKJL 2DH3A 1JGUH 4FI7A 4KDVA 2J7LA 3TO4B 2F5AH 4N0YL 3EJPA 1X5XA 4CC4A 1FRGL 2AJ3A 4KMLB 5TK4A 3D0VB 4P9HC 4FA7B 4UQ2A 2W81C 1T20B 2OSLA 5FKPB 3GZKA 4CADA 4MNHA 3K71A 1V55B 2IO5A 3B7UX 3EOYG 3UPRA 1ZT4B 4CVZA 4UTBH 5H37G 4XPHH 4M7LT 4KHXH 4QYOB 4JM2B 1AS7A 1HEZB 4ALAH 3AQXA 5D8JL 3AU1B 2YQGA 2IAMA 3L3IA 3C6LB 2YN3A 4O51B 2ZNWA 4Z3TA 1N3NA 1KBGH 2BNUB 4XVTL 1WCBA 2Z7ZA 1WBXB 3DROB 4OCXH 4UT6L 2HKHL 1N8ZB 1RJLB 3HS9A 1FNAA 4X5WB 1HSBA 1DSWA 1E28A 1I1FA 1NQBA 4LSQH 1TZGL 3I6LD 4Z23A 3BMWA 1BVKA 4P5TD 4FDWA 3QIBA 5BS0D 5FYKE 2X1QA 1JYWA 2XY1A 1EPFA 2PP9A 4A7VA 3CMOH 2CGYA 4HS3B 4K07A 4NJ9H 3JUZA 4BK4A 3ZDXB 3MRLA 1PSKL 1H3WM 4HKZA 5IB5A 2NY2B 5HHVL 3U2JA 3O4OB 4WENB 4AENB 5L2JB 2XTSA 2J8UE 4FXTA 3QG7H 4XOBA 5H35A 2PR9A 1G6RL 3HNTH 2VERN 3V0AC 1MCEA 3QRFM 2GCYA 4ZZKA 2ROXA 3KPSD 2O6EA 1Q94A 3OLGA 3QZPA 1QSFD 2EDHA 3GEFA 4Y19D 3D33A 4B3VA 1E4HA 5JORB 1DDHA 1LO2L 2XV6B 5K9JL 2DQCH 5HI3C 4RGMB 2GTQA 3PL6C 1MCKA 4XT1C 5E4OA 3Q8FA 3L3GB 4Y4FA 3FO2A 8FABA 2O93L 3HI6H 1YYLH 1RZIA 4I18C 2W07A 4AYDC 2PP8A 2J71A 3D85D 3PV7A 3D4GA 1B90A 1DLHB 3OGCA 5FR3A 2YZ8A 1KIRA 3PPSA 2QPSA 4PR5A 1G9NC 4M4PA 5D1ZI 3D06A 4GINA 4OU3A 4X4XA 4M3HA 3MLRH 5FKAB 4NT6B 1B6DA 5SX4H 4KZDH 1GS8A 1QNZH 3FO0L 4LESA 1R5VA 2Z34A 3LKNB 4MD4A 5CINH 1CI3M 1T66C 2E7BA 1EX0A 4PJ8C 5IHHA 5FDYA 4AYID 4NO0D 4BFBD 2XIBA 4F15B 2PWGA 4Q58C 3RUGE 2OXGA 1GTNA 4BZ2A 3DVGB 4TRPH 2R9HD 1HXKA 2VDNH 4PJCE 4I3SL 5I1JL 4URTB 1EZVX 4LFHG 2CO2A 1SZNA 1WZLA 4Z77A 5HGBA 5IQLA 2TRHA 2BW5A 1I8UA 1JRHI 1P1VA 2X4UB 4P5SA 2MQ3A 2HFGL 3JTTA 4PJHA 2BSRB 4DP7X 2VXUL 5FDWB 4WWNA 4BIKA 5DHVA 5AOMA 2BVEA 3F7PC 3LKRA 2NNAB 2FR4A 3J27A 1YMMA 4HHWA 2XWCA 3EFFB 4NKIL 4ADIA 4JQIA 5FO8A 5LXGL 1BG1A 2DDQH 1JD7A 3Q43A 2J88H 5EORH 3MGOB 2F7PA 1WA1X 4OM0L 3JTSB 3VA2C 4LBAA 3MLZH 1UZ8A 2BRQA 3H55A 4DKAA 2DWXA 2VZSA 5FS5A 2VDOH 2DMCA 2R7EB 1VKXA 4HJJH 1XGUA 2HX7A 3OLEA 3T4YB 1P0SE 4ZO8A 5TDOB 1RPQA 1E4XL 1NDMA 3INOA 4N0CD 5FLUA 4IHOA 1FVCA 5FOJA 2MCPL 3OTTA 4DP2X 3LZQA 4LIQH 1MVYA 2B1AL 3K3QA 5TDNA 1LHZA 1NDGB 1R3LB 1SJHB 4YLBA 3MOQA 3ZE1E 1N5AB 4NUMA 4XODA 3VXPB 4ZX6A 3E1F1 4LXFA 4LAJH 3TX4A 5JHBA 3L1EA 4X7FC 4G42B 3TEZA 2CA3A 2MTAA 4TNFA 2VRQA 2WC7A 3HFMH 1NAKH 2O5ZL 4YSCA 3OC5A 1IGFH 3P11H 4KH2A 3GUTB 3ARDA 3FO1A 2WW8A 3HRZA 4GW4A 3UZVA 1MFBH 1PLGH 5DMKB 4MA3A 1A7RH 4HALA 2EKJA 3P4MB