2Y2TA

E. coli csgc in reduced form
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
SSQITFNTTQQGDMYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEKTLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQWPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CURLI PRODUCTION PROTEIN CSGC
publication title Atomic Resolution Insights Into Curli Fiber Biogenesis.
pubmed doi rcsb
source organism Escherichia coli o157\:h7 str. ec4115
molecule tags Chaperone
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2420 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y2tA00
2XSKA 2N59A 2Y2YA 2Y2TA
chains in the Genus database with same CATH superfamily
3VFPB 3NJGA 3KWWA 2HFTA 3QQDA 3REVA 3VWKD 3H9SE 5L9DL 2ZCKL 3NZHH 5C0CB 2PABA 4DOHE 3UERA 1YNLH 5CSBA 1H19A 1ZSHA 2KDYA 2VN5A 4WFHD 1CU4L 1FJ1A 2CD0A 3F01A 4OCNC 5DI8B 4Z7NE 3BLBA 5IQ9B 1MLBB 2DL9A 2MKWA 5BVPH 2AJ3B 2O5ZH 3CFDA 1XGUB 1KUMA 3F2LA 1A4JA 3ULUE 5CEZH 1KGWA 2C9AA 5AW2B 1HZHL 2ZUSA 4KRPC 2OR7A 1IM9D 1FHNA 4AVKA 2C1PB 1F8TH 3DROB 5FAAA 2EDKA 1BWMA 5AVSB 3I9PA 4FYQA 5LBSL 3U9UA 1IC5H 5E4AA 4BQ9A 3P2TA 2JE8A 4EQ2A 3WNIA 4Z76B 3JWDH 1A4KA 2VUKA 4MMYB 3SZ6A 5FS5A 5A7BA 4K7PX 3O9WD 2ROYA 3UYPB 4AT6A 2RBLA 5DQ9A 3HLKA 4FI6A 4U3XA 5FHAH 4DETA 2F0CA 3U1QA 3EYQC 5MENB 2JFCA 3F12B 3CXDH 1BZ8A 4G7SB 4Y19D 1A9BB 2ZF9A 2K70A 3BSZA 5F9WB 2ZYHA 3HPJB 5DT1L 3NA9L 3OKYA 3P1VA 4UAHA 2P42B 3ZIYA 1RZFH 2OMNA 1DQQB 2FJHA 3EJRA 3D0AA 3PRZA 5AOJA 3V79C 5KYUB 5CLWA 4CMMB 2ZWNA 2ENQA 2OPCA 4P4RB 3UBXG 4K5OA 3C5SB 3H7LA 4NQCB 1BZ9A 4IKIA 2AV1A 3O2DA 4R0LC 5EIIB 5D2LF 5CD3A 1X7QA 2DQDH 3PHOB 1JHKH 2FIKA 1U8HB 3TFBA 3ZX1A 2QKSA 3PHQA 2CNZA 5AAMA 4ANXA 5I6NA 1CMOA 1QFHA 3RA7L 1RLWA 4HJGA 4JFDE 1N64L 3NGBC 5HHMB 5I8OH 2N3JA 3TCLA 1C5BH 4U3SA 3CFKA 4JHVA 1KCBA 4MCMA 1YNTA 4IMKA 4JFYA 4R3SB 5E94B 5FW6A 3VGBA 1A6UL 4PYGA 1MOEA 4LCYA 5DJYB 3X3GH 2X70A 1T66D 5KJ7E 4OUUA 4GAGH 1I7UB 2LTQB 3TIDB 7CGTA 5F7EH 1HOEA 3PIQB 2B39A 2Z0UA 4OCSH 3ZSTA 7FABL 3WEBA 2CNYA 1NGZA 3EBAA 1YQVH 4JHUA 3T4AA 3IWUA 4XXCC 5E00A 3TO2B 2DH2A 1MIEH 3KZ8A 3TEXA 3QVAA 2ODHA 4PJEA 3QQ9D 2ZSVA 1MFCH 3KS0J 1WA2X 2DWEB 4ZO8A 2KZWA 4WTZG 1CL7I 3L1EA 4AQ1A 3K6FA 1MJJA 3GT6A 4Y5VC 4DH2A 3DRTB 4MJIB 3HHSB 5FO8B 3QDGD 2XTSA 3ARED 3S88H 3UYRL 2XG5B 5DJ6A 3MV7B 5E5LA 5I73B 2XTJE 1U92A 5L6YH 5E5MA 4X4YA 3QJOA 5L8KB 4FN0A 1OHQA 5EH1A 1A66A 2GI7A 3DXAD 4EKXA 2BP3A 3CPLB 4HFUH 2DQEL 4FG6D 1P4LB 1KPRB 4NKMB 3UAAA 4BJLA 3TA4D 1BQLL 2DWDA 1JGEA 1UEMA 3EJYC 3M07A 1X5HA 3Q1SL 5EU6D 5GS1C 1IGYA 2XWBB 3P3UA 5F8QC 5L7XL 1I82A 1G7IB 4P5MA 1N59B 3CH1B 4JGNA 4WKZB 3GSWA 2A9AA 4JRYD 4F7PA 5AUMB 5IM7A 1THCA 4QTFA 3GZOA 4LOUC 1HAUA 1U2CA 2V5RA 1ADQH 3QAZC 2A9NH 4U1NA 5FF6A 1YEKH 4HS8L 4K94C 3SBQA 2PN5A 4K9EC 4UWQB 3KBHE 4XN9A 3T2NL 4C4KT 1MRDH 4KK9C 4KNSA 4XPHH 4CN4A 4KH9A 4YXHH 1J8HD 4Q4EA 5IEHA 1MCRA 1MNUH 3ULVE 4HIJA 1T22B 3WFEL 4TSCL 5FWQA 3AGVA 3H6AA 5CLYA 4HX1B 4LLWA 4G59C 3UJIL 1FVEB 1PLBA 3EFOA 4Z3EA 3SGDH 4OF8A 4GW5B 3VI4B 4C8XA 3MYJB 2OMZA 1M7XA 3FN0L 3MNVB 2KZBA 3LRMA 4V1DD 2BHUA 4LFHG 1MCOL 1RP8A 4HJIA 3LKPA 2EC9U 2PCPA 2QMKA 4KAQL 2NY5C 1NCDL 2FLMA 2QSCL 3APMA 3EHBC 1N8ZB 3L9BA 1JZ4A 4KI5D 4ZMPA 4X5RA 5D1QA 5GRZA 1ICTA 4YBQD 2L04A 3LDBC 4FNRA 3QAQA 1RVFL 3APCA 3L6FB 1L9PA 3O4LE 2PPCA 4S2SA 4Z7AA 3OZKA 3IAGC 3VXUE 2O4EA 4YGVA 1ZV5A 1YC7A 3OKMA 1IGCH 1NUNB 2P48B 4OZIF 1BQ5A 3CFTA 1U58B 5IHUL 1JYNA 1XB3A 3E0GA 1JXDA 4R90H 1TZ8A 4EUPA 2E9WA 1GW6A 1MFEH 4X6FA 2XWRA 5F3HA 3IN2A 4G11A 2B14A 3QQXA 4GQRA 2X1OA 3TBCA 1IEAB 1GYAA 3ZKNC 5I16B 4JDZB 3AXIA 1S8DA 1AIZA 4M1GH 2FX7H 4MDIA 4N28A 4ODUB 2R56L 5IHBA 3CNKA 4RZCA 1GJIA 4POZC 5KVMC 5T1DL 1G9HA 1X9UA 1LXMA 3OKOB 15C8L 1UKSA 1ZGLB 1A25A 1PEWA 2ROXA 4LHUA 1YPZF 1BEYH 4ZOAA 2FQFA 3TC9A 3FSZA 5E8NA 3VI3E 3VJ6B 5KSAA 5E2VH 4GSXA 4D0DA 2WCSA 4ZNCD 5I8KH 4A37A 2AVGA 5LDUA 2XN2A 2R69H 4X8JB 1MCWM 4H0GA 3RWCA 2BHZA 4QRPE 4F7CA 2E4TA 1ML0A 1FNHA 1I8KA 1XGYL 3JTTA 4H1LA 3UACA 3ELAT 1BF8A 4XC3L 1F41A 4XZUB 1EZUA 4ONFL 4HPYL 2E7HA 2EXTA 2HAZA 3DPDA 2ORBL 1KDIA 1SJMA 2XQBH 1UACL 3QO0B 4WUUE 5GGTA 3T0AA 4NQDB 2G60L 4YDLB 4FHBD 2XWZA 4Z3GA 1N5YH 4S1SH 3RB7A 3QISA 4MMZC 4JHAL 4MKMA 4I5BA 3S3PA 1MPAL 2FJGB 1JZHA 3GB7B 3SO3B 2ATAA 5BXFB 3LKRA 1RIHL 4XCNB 3IE9A 4A6YB 4CA4A 2EYTA 4H13C 1AFVL 5D93B 4N9GA 2PXYD 5FYKD 3RVTC 1JPTH 1KTCA 4UTBA 4S0HA 4NQVB 1MCQA 4CC0A 2UZIL 1JZDC 3IMVA 4KMTH 3IDYB 4LBAA 2P9RA 3WEMA 4RAVB 2Q3AA 4WGKA 2IWKA 3TBYA 3CTTA 5DHYB 1KB3A 1Z1WA 4HSQA 4ZW6A 2VQ1A 1HQ4B 1GHFH 1Q9OA 5T3XH 5IBTL 1L9SA 1N2RB 3W11C 5T3ZH 5D2NC 4MS8C 5DZJA 2JQMA 4MHHI 4MXWH 3QZLA 1VA9A 4AKPA 5FW8A 3DYMA 2NTSP 3OZ9L 4LGRB 4OLVL 1NDMA 1WV7T 4QAMB 2APVA 1ZLVH 3UMNA 3W0WB 3IJSB 3L81A 4PW3A 2ID5A 5A1AA 1I9JH 4P3CL 4JN1L 3VXUA 3GSQB 4WLCA 4F93B 3FU7A 4U6HA 3BESR 4G8AC 4ORGB 5LWYH 2DD8H 2BMKA 5FM4A 1C8QA 3KPQB 3OMNB 3HC4L 3BP4B 4FQ2H 1DVQA 4GO8A 4A66A 1A22B 5C3LD 2GSGA 1I75A 3HG1D 2ZAHA 2A1WL 4YSPA 2ZX5A 8CGTA 3BIKB 2X7LB 2WBXA 3A3YB 3LZFL 4JB9H 2ENYA 3NZUA 1EAJA 2NZ9D 3BAWA 3TOPA 3DKHA 3IETA 3FUFA 4IOIA 3TN0B 2AJYL 2BSCA 4RVBA 5I1LA 2EH7H 4DGWC 1TUPA 4AGMA 4IRJB 3TZVC 5KVEE 3VI3A 3ZLQC 4QCIB 3RWHA 4A2EA 1EZVY 2FBJL 2W1NA 5ACZA 1MFDH 2WLLA 4XX1G 3MRJB 1O6SA 1I1CA 1RUKL 2YC1B 4MMXC 1IGTA 3P9MA 3MLUL 2VRAA 5L4IA 4AIOA 1SMOA 1AHMA 4M8UA 1H0DA 5EO1B 4DP0X 1PZ5B 1SJXA 2GC4C 4KGLA 4ZW5A 4H8WL 1UJTA 3FU0A 3OC8A 4Y5XA 4D9RE 2VSKB 4NKQB 4WUUA 2DQUH 5IHZA 5EIQA 3KJ4C 2W0PA 5T33H 5F3BB 1CIDA 4F2MA 1XL4A 2TRHA 2X0UA 5D7JC 5BS0B 5K9KA 3ARQA 1SLUA 3MLTB 4YOKA 1J88A 4ZPVB 2WLIB 3Q2NA 1JV2A 1RURH 5INDA 4F2FA 1L7TL 1VFOA 4PJ9D 4XPTH 4PG9A 1ED3A 4HMDA 2A9ML 4O51B 5BVJA 1KCUH 3MFGB 3O6KL 3LRGA 3TO4B 2NYZA 3LIZA 3CHOA 3AXHA 4UV4L 3MOBH 5I18L 3WGVB 3FTZA 3US1A 3MREB 4PRNB 2B2XL 5JIKA 1VKXA 1OTUC 1RZJH 1L3WA 1A8JH 3HI1B 4LKCA 1VPOL 1TDQA 1FNEB 1WC7A 5EUOF 2HVKB 4Z23A 1EEQA 4RISL 1WICA 2VIRA 3NBNA 4PUBL 4HLZG 5L9DH 1W0VA 4G8GB 1NFKA 4DNLA 2A3TA 1WBXB 1I53A 3HTLX 4I1RA 2JWYA 5T8IA 3GYRA 1FLRH 2AF2A 5D5MF 1XB8A 4L4TD 1HL8A 2ZUWA 3L5IA 2R39A 1CU4H 4JO2L 5GZND 2BIPA 3NSDA 1YEIL 3LZOA 2J8UB 2F18A 4HUVA 3OL2A 4P23A 1G6RA 2XVKA 1S7XA 4IEFB 4QWWC 2ATPA 4KKCD 4TM9A 3RNKA 1ND0B 1BZOA 1HZHH 4Y4HB 4MDJB 4H25B 4OIAA 4L8SA 3RVVD 2Q2LA 1U3HB 1UATA 1KCKA 5LBSH 4DZBB 2CUMA 2X0VA 1PEZA 4OB5L 1TTAA 2YUWA 3LNFA 3N06B 3K8KA 1KT2A 1YA5A 1TU2A 3CGTA 1XGTA 4WI2A 4EOWL 3RDTA 4GKNA 3SCMD 1IVLA 3M1BB 4WHYH 4AZ8B 3WOVA 3R06B 3REWB 1E4KC 2ZX9A 2ZAIA 4R83A 5GS0L 3ZHLA 5CP7A 5HVWA 3ZDZF 2GK0B 2UX7A 2WXRA 2NT0A 5H35B 4KZ0A 5DT1H 3NA9H 4YZFE 2IBBA 3G9VA 3VTMA 4X5LA 1NBCA 3CFJA 1RJCA 4QXUL 1KTLB 4U0RB 3RI5F 4FTVD 5EZJB 2L7UA 1SRDA 3EYUL 2VZVA 3WNKA 3FFDA 3WG7B 2OM5A 2UVFA 3ZKSD 4LB8A 3GNML 1QWHA 2K3HA 4GRLA 2EE6A 3M17A 2UZXA 2GY7B 1KJMA 4HHAA 2VLRB 3VNZA 1VF5C 4IS6A 3T4YB 3RA7H 3C5JB 5CKAA 4S1QL 2EUWA 3TONA 4I89A 1N64H 1VFBB 3EBHA 4PGEA 3PWPB 3ILDA 1PJ9A 4NRZA 1BSIA 4M5SA 4A1RA 5FO9B 4J1UB 2B8OT 1S7SA 3OHXC 4XR8C 2A38A 1QRND 1LEKA 2WQAA 4HHWA 4C47A 4Z5RB 1A6UH 4HUKB 1RJYB 4JL2A 3CZEA 5D4IA 5TH2A 1C08B 1JK9B 3ZR5A 1J12A 1XR9B 1LO2L 5TDOB 2Z31D 1IKOP 2CE6A 2OW7A 1ZDQA 1PYWB 3SGDI 4U6YB 4PJHE 7FABH 5I0YA 2O6CA 3C60A 3ZYZA 1G94A 1JWUA 3BJLA 2BZ7A 3GKWL 4ABVA 4XVSL 2CHWA 3O9WB 5KSUB 1QUNB 2LQRA 5CJQH 4B96A 1K5NA 4AGNA 4PP2A 1EEZA 5EU4B 2CHNA 2ZIDA 3AITA 3GMMA 2BNRB 2YGOA 2YXWA 4MYPA 2A9DA 4NRYB 5DJZB 2HH0L 4Y19B 3OLGA 5ANMA 2ZUQC 1AQDB 4J2QA 4KVNL 4XBEL 4JMNA 1L3NA 1KJ2B 5IB1A 4G3YL 4X5XA 3UYRH 4TLSA 4G6JH 3PDGA 5BQ7B 3WY3A 5J4MA 4KTEL 5HYSB 1S7WA 4H40A 3FYEB 3VH8A 3VTTA 1N3NA 1E4HA 2JCCF 2DQEH 3BGFB 2BS71 3HBGA 4GI9A 4WWKA 1CLZL 1EJ6A 2FR4A 1BQLH 4U33A 1E5YA 3L7EA 3Q1SH 3FAXA 3K6NA 3L4TA 3S37X 4KKBD 1RZIA 1G7PA 1H5BA 1IC7L 1AMYA 3IM1A 5L7XH 3F58L 4LO9A 4WI3A 4TULL 3US0A 1NGWB 3TTYA 1R75A 1BFTA 4NB7A 2Z35A 4X80L 3SDCD 4OFQA 4QF1A 2F19L 2EO9A 1HI6A 4NP4L 4L05A 4HGMA 3F7RA 3UG5A 3DHMA 4OCYL 4AV4A 2GJZA 1OD7A 1UWXH 4HS8H 1OPGL 1P69B 3A6OA 3WLBB 4DKTA 1BMWA 4OFVA 3AACA 3LEXA 3QUZD 2CHZA 4NCC1 3T2NH 5HDBF 3B2UC 2DKUA 1OXYA 2XBZA 3NEXA 5HJ3A 3FZUC 3JWNE 3QZMA 5FDWA 3WFEH 4KOBA 4TSCH 2B15A 1ORSB 3VFNB 3ZIMA 3EOAA 3KVQA 3K2MC 5AZ2L 1JPEA 1TZGL 3Q9PA 3UJIH 4PJXB 3QJUB 3L4ZA 4Y8AA 4Q8BA 5AKSA 5JORA 4OGQC 4ZMNA 4MZIA 2OBGA 5GRJL 3U30C 3FN0H 3LS5L 4CW1A 1T1WA 3AG3B 4JFXB 1GA2A 2ZF8A 3CFMA 4FMVA 3S0PA 3UL4A 2NYYD 3HVDA 4FERA 3PAVA 1PX4A 1MCOH 1ZS8B 3QXDA 3N41B 4ZS6D 2IEPA 4KAQH 2QSCH 5FYJL 4XMUA 2R51A 5IROC 4I2XA 2J43A 4NIYE 1MVFA 4PJHA 2GITA 4FJZA 2V9RA 2J1YA 3BP6A 1AACA 4LEBA 1AKJA 2IVFC 2JXMA 3AB0B 2ESVB 3WTYA 4FEMA 1F0LA 2B7DT 2XXCB 3BVWA 2WQXA 5C0RL 5IMOA 3BUDA 1VSCA 1P6WA 2AK4D 3AJ7A 5IP4A 3FCTB 3IB4A 4KVPA 1OP3K 1KFGA 5B4MD 2BWQA 1BD2A 4R7VA 4IHOA 4MNGB 3FRUA 3D3VA 5H2BA 2W0LA 2ZOWA 4E41B 4WW2B 5KYWB 3ZO0A 1M7IB 2GKIA 3BD5A 5GRYA 3S8GB 4IMKC 1DVUA 5E9DD 1MY7A 2C4XA 2ZG3A 2Y2TA 4M7JL 5T1DH 4R7NA 15C8H 5KSVB 2MQ0A 5J3HD 1GGIL 1A6ZA 3S36L 1J8HB 4AM0A 2IAMC 43C9A 2DJ4A 4PGBB 4IKKA 1IBDA 3ABMB 3MUUA 3TGXA 3L9YA 4WU7B 4APXA 4ETQB 2WXJA 3JVFC 2AQRA 1G1OA 2ZUXA 1DVTA 3POHA 2EZ0D 3RWJA 4Y4FD 1XGYH 1U8PB 4X9IA 4XC3H 3DV4A 1DJSA 4JY6B 2R2EA 4J3TA 4EVNA 3EO1B 4ONFH 2NYKA 4HPYH 3UTSE 1B2YA 2ORBH 2FAUA 4JUSA 4NYLA 4DGUA 2AQNA 3ULUC 1UACH 2D0HA 3UZEC 1BBDL 3E8UL 3HZYB 3P77A 2G60H 4AGLA 1ACZA 2GC7C 4MAUL 4MBOA 5CF3A 4XC1L 4L1HA 2ED7A 1MPAH 1NIEA 4PJGA 4QRSA 1PD1A 3QWOB 1RIHH 1AI1H 1AFVH 2HT3C 1TYEB 4LQ1A 4GSDL 4L3AA 4ONGL 4EBQL 4FA6A 4ISVA 2EDTA 4K4KA 4MNHB 4A67A 2X6UA 1IBGL 2UVEA 3SY6A 2VQUA 1TITA 3QJRB 1E5BA 1E4WL 2YRBA 4FKKA 2UZIH 3L3OC 5A2LH 1A3RL 1J0JA 1UXSA 4UV7L 2WZ5A 3RGVB 4ZFGL 1HTYA 3EOYG 2Q20A 1GCFA 4E9VA 1MCSA 3AS2A 4KXDA 1JWSB 4HWBL 1LGVA 1KCLA 3ARBC 4P46C 2WYHA 2W0FB 5IBTH 1GZHA 2FO8A 4OBRA 3V0AC 2EP6A 1E6OL 2BOBB 3MRRB 3O11B 4P9HC 5GSVB 1G9NL 2NY0C 3IAPA 5KSBF 3B3IB 3OZ9H 4OLVH 3A21A 3WEAA 3BXNB 3E6FA 2WN2A 4X6DB 1RUML 3V8CA 1JF1A 4PJ5E 3TA3A 5IR1B 1F4HA 4P3CH 4JN1H 3MBWA 5I8EB 1DEEB 4Q7DA 3OD3A 4GBXD 4I9WE 1KXTB 2OMWA 4LVNC 2OFQA 4JPVL 4M3HA 3HC4H 1OAQL 5HGHB 4PY7B 4HWNA 1E28B 4Z7WF 5KBPA 5D4HA 2WCGA 3GGWB 4LGPB 2A1WH 3AM8A 3QQNA 4QHLB 3LZFH 2WTRA 4JFHD 2I07B 3SKMA 3WLWC 4EXKA 1E4JA 4MB4A 4LCCA 2Z93A 4Z7VF 4MYWB 1PW3A 3BDYL 2E47A 1QFWL 4NXSA 5IBUG 2AJYH 3IJYB 5BOZG 3EGSB 5J06A 4PJ8A 1A1NA 4YWGL 4WTXA 3UJJL 3ARDD 4AYMC 1BYOA 1N5AA 1NC4A 4ZMQA 4UTAL 2Q1EA 1K4DA 1A6VL 3DA0A 5DR5L 4CILA 4XZ4A 2WBJB 2FBJH 2WOYA 5JA8B 3Q8BA 4GNKB 3T8XA 2ED8A 5I66B 1RUKH 4MB3A 3ASWA 4ZTEA 2QFPA 3MLUH 3P40A 4FEIA 1BLNA 7TAAA 1WUNT 4J8RB 1MZYA 2F7QA 4MDRA 5F1SA 3UTSA 1CLVA 2JJWA 3NIGB 1ANUA 4I7ZC 4JM2C 1KGYE 1NH6A 5T1MA 3VE0A 3FTSA 3PQYD 4WI7A 4JKWA 1IO4C 2HLEB 3JV4A 1DUZB 3M6DA 3UXFA 1NIFA 3VG9C 2YD2A 4PBWD 4JG5A 2Q86B 3KVPA 2XTJC 1CFTA 3CFBA 4JRXE 4HULB 2IFFL 5JA9A 2IALA 2J88L 2R2BB 2ZXBA 2ITEA 1A14L 2BSDA 3KDMA 1L7TH 3ISYA 1BFVL 2A9MH 4J8QA 4L4JA 1OAXL 3ZTJG 3K1DA 4QY8B 1BHGA 1ZXQA 1I8LC 3HJEA 4HZ1A 4G43A 5I18H 2JNZA 1X4ZA 5KSAC 2B2XH 5HD8D 1VPOH 3LZQA 1K4CB 1F42A 1JPSL 4RISH 2QLYA 5IHWA 3ZE2E 1OB1A 4PUBH 3B56A 3SYAA 4BZ2A 1D5MA 1HE7A 4JFEA 4PWKA 2MPVA 3PYCA 2ZWLT 3TVMD 2KL6A 1MCHA 1TENA 4JO2H 2CQVA 1YEIH 3TBSB 1XR8A 3UEQA 2NLJA 1TF4A 4NHUB 3TBVA 3ZMEA 4UOJA 1CGSL 2P7TB 1OHZA 2X44D 3AWEA 2XX0A 4PJ5A 5BRZE 4O9HL 4LLDA 1HE8A 2LAAA 1GMIA 1Z5YD 3ULVC 2EIMB 1FYTE 1NIBA 2VN6A 5E6ZA 4XMVA 4HWZA 1GTNA 4BFIA 4R5VA 4WAFA 4B95C 4OB5H 3TNMA 2ZD0A 2NSXA 2QSQA 3BVNB 5HYFA 3SBWC 2F9BT 1WF5A 1NCOA 4D0BB 3Q5TA 3MUJA 1EK3A 4Y0GA 3ORJA 5IGXL 4AQAB 3BP5B 1EX0A 3QNZB 3IFOB 4EOWH 3IRZA 2GG1A 5LXGL 3PXJA 5C0BE 3GZQA 2EVHA 3ZE0B 4LLUA 1I9IL 3SODB 1CDYA 1CICC 4ZPTB 5C9KA 4QRAA 3V0HA 5GS0H 3G5VB 4WFGD 5SWZD 1IILE 1X44A 2Y6SC 1KYOJ 3IPBA 4XMZA 1K8DA 4LCWB 4B9GA 3TT3L 4KHTL 4JFQA 4RAUA 2ZICA 4L9LB 2ZXCA 1FAIL 1QBML 3CFQA 3PG2A 3F5WB 5DURB 3H4HA 5HHPB 3MTRA 4QXUH 2QTVA 3KXFA 3OKEB 4AYID 4GMSL 5J13C 2OV0A 3C6LA 4LEEA 1JL8A 3EYUH 4NDMA 4ELMB 4FFVD 1HHHB 1O75A 3LRHA 3GNMH 3IKCB 4KNTA 2GAZA 1PKOA 2CGZA 2J71A 2PO6A 4I0PA 2D31B 4CADB 1BIIA 3FHAA 3MO1A 3WN5B 4L4VE 1RY7B 3GJEB 2RB8A 4Q58C 3B7UX 5C6TL 3OR7B 1JK8A 5K9QG 4AGQA 3FUMA 3LN5A 3D9AL 3I3DA 4N2GA 3L48A 3V5KB 3WFCL 1NL0L 1JZ6A 2VLLA 1PF3A 4HJUA 4L37A 4IRSB 2CRZA 1REIA 1AIFA 2J57A 3D39A 1NEZG 3OF6A 3ABKB 3JT2A 5BMFL 1XIWB 3GMNB 1INDL 3HZKA 5ESVB 1LEGA 1KIUB 4MTMA 5IFJA 2QHRL 4Q2ZB 2WLKA 3SDAD 1LO2H 2E7MA 3SKOA 1KF9B 2VLKD 1FFOA 4HZAA 3T3ME 1GGCL 3RVXD 4HLEA 1U8CB 3N0PB 2B20A 1UGKA 2OMYA 2ZAGA 3RURA 3GKWH 4XVSH 2W60B 2NDGA 1OT1A 3SCMB 1VEPA 3ETTA 5D1ZB 1Z5LB 1KGUA 1GKOA 1TIUA 5DHVH 4AG4H 5D1XC 4K9JA 1R33A 2HH0H 1L7IL 1AE6L 4AW7A 3BKCL 3N43B 2X1PA 4KO5A 1DSYA 4KVNH 4QDGA 4XBEH 5BRZA 2CJSA 5ICYA 3S4SA 5EF2A 2NNXA 2BHYA 2XPGB 3AAZB 4G3YH 3FQ1A 2EVFA 5C08E 1FYTA 2Y5QA 3X11A 4KTEH 2ZOLA 3RUGE 2JJVA 3RZCB 4DN3L 4X8XA 3QDJE 2AJXL 3TEYA 3H2PA 2AQ3A 1CLZH 1DVFD 2WCPA 3NCCB 1AHWA 1IC1A 1QVOB 4YL4A 1X6NA 5AL0A 4BZYA 1MWAL 4XBGA 4LDCA 2A6IA 5GGUA 1IC7H 4JHWL 2VWEE 3F58H 4TULH 2BY3A 4JQXA 3CG8A 3LKOB 5HHOD 4X80H 4ELKB 5A2CA 3BZ4A 1N6UA 2JQZA 1ZPUA 2F19H 4NP4H 3UTTE 4OCYH 5KBKA 4IGBD 4WWID 1OPGH 4G6KL 4YHZL 1SEQL 5CN2A 4PWHA 3DOSA 1DQDL 3KPLA 4B0MM 4KNUA 4Z7QE 1ZDSA 3GPSA 2LU3A 5LJYH 3GKZA 3ATFA 2G30A 3WNPA 1MF2L 1JGIA 3P69A 1TZGH 4L4VA 3RDTC 5SWSE 3CCHB 2Y23A 4Y2DB 5AWNH 3AU1A 1J0YA 1YMMD 4CMHB 4CVXB 1MCEA 3LS5H 4ADGA 3G6AA 2OJZH 1CGWA 1F4YL 3L3DB 4XCCL 5ID1A 4GRWB 2DJSA 1T4WA 32C2B 4FFTA 5FYJH 5A6MA 4PG2C 1LYQA 3VFMA 1SBSL 5EOQL 1BX2A 4M1CD 2E27L 1SN5A 4YXKL 2H9GB 3AADB 4HXBL 3HE6A 3IDGA 2FGZA 4X2UA 1AXTL 1R9FA 3QUYC 5C0RH 4ZQKA 3GSXA 4OJYA 2EEXA 3ZOAA 1TQBB 4GRWH 3WNLA 4NWTL 1QFOA 2C9SA 2P28B 3LRSA 2Z7ZA 1U8QB 2Z4TA 4PD4J 4S1DD 4C56E 4EZKA 3FO9B 2CKBA 2IH8A 3QO1B 3I6SA 3LZRA 3O3UN 1Q0EA 1ETA1 1WD9A 4NGHL 3CC5B 5C08A 3EJZD 3HFML 3ZU8A 3RUGA 5C0GA 2R1YA 4HUMB 4M7JH 3BKYL 2YAOA 1O5DT 4XODA 2R9HD 3KNBA 1GGIH 3S36H 1HOCB 2WKLA 5C0AE 2R0KL 3IFPA 3HUJB 3HB3B 4KJPD 1HXKA 5EBMA 2O6FA 1AAJA 4CU7A 2F2HA 2JJSA 3VI4F 3FRPG 4TNVF 5JHDE 1QTPA 3NACH 4MGXA 2XICA 4U0QB 4UDTB 1V3LA 5AAPA 3B9KD 3PJSB 3DMMB 2W5PA 4AIZB 4UDUA 2E56A 2DM3A 4IU3A 1E2WA 1B9ZA 1DL7L 4PRBA 5B38A 3GM8A 4G6AD 3E8UH 4D0CB 3CSTA 5F9AC 2I9LA 4ZQTA 2VDNL 3UTTA 4NN5C 4MAUH 4XC1H 2D03L 1QW9A 4JMXA 1ETB1 4G42B 4Q4IA 4XN7A 3R18A 1ZS2A 4OZGB 1BREA 3L5HA 4FNPA 1I3GH 4NN6C 3TIEA 4F15C 4N24A 1JHTB 4GUCA 1IBGH 2EKSB 5HYJD 3I3EA 1VADB 4PR5A 1E4WH 2X2JA 5D7KE 1J8KA 4ZJ9A 5I24A 4ZXBD 1A3RH 4UV7H 2X0WA 1J11A 4ZFGH 5SWSA 5D7LA 5E2WL 1VIWA 3CZGA 1M53A 1UB5A 2C3HA 5J12C 4JFOA 4N3TA 5JYMA 1H5BC 2A83B 4U3HA 4AJVA 4HWBH 4QI3A 3SPVA 3VTAA 4AH2A 3S34L 2QKIB 3HN5A 3I6LD 1FJ1B 1E6OH 3ECUA 4HS3A 3HPLB 4P5TC 5CFAA 5DJ8B 1C5DB 2XHNA 1G9NH 3ECQA 3QUML 4XTRC 4L0PB 3VFUA 1PLCA 1A4JB 1T2XA 1YZZA 4QUOA 3ZTNL 1BYNA 2G5BB 2XFXB 1EXGA 3I3BA 5DEGA 1RUMH 2VN7A 4HUXA 5ICXA 2HUEA 2WO4A 2WXOA 3PNRB 1T0NB 5KS9B 1TKWA 1M9WA 1MFAL 3U9UB 4FQXA 4ERSL 4BQ6A 1I1AD 3QIUD 4JPVH 5D7HA 2JIXD 1OAQH 5DS2A 5EFIA 4BSVA 4O02L 4RGNE 4C56A 3AUWB 5D7SL 1BVZA 3RVUC 3IJEA 2BRQA 4AT6B 1RJLB 2BNQE 1HWGB 2FL5B 1HEJC 2Z64C 3IT8D 1Y18B 3G5WA 5LDSA 2Z0BA 3BDYH 1UT2A 1I9RL 1QFWH 1YMHA 4FC3E 2K8QA 3QG7L 2OAAA 1KPUA 4U2ZA 1P2CB 1VCBC 4YWGH 4AWJC 4W9EC 3UJJH 4GO6B 2D4FA 1DVYA 4Y5YA 3V52L 1OLLA 2EO1A 4UTAH 5DR5H 1A6VH 5HSFA 1CLYL 1JPGB 5TE6L 5D6CB 4HIEA 3IN0A 3QIBC 1IM3D 2ZSWA 4EPSA 5JHDA 4TUOB 3FO1B 4MQXC 2EDMA 4WNQA 1EHNA 4APQB 3EOTL 4QYAA 3GO1L 3DX2A 4PJAF 5HPMA 4LMQI 1S7TA 5CD5D 3R0MA 3T0EE 3DUSA 4I85A 3PHQB 4X5PA 4IOFD 4ZOCA 5H8DA 1A7QL 2XIIA 4XMWA 3FOLB 1R5WA 1U8LB 3HMXL 4DK5A 3VFWA 3L3JB 3K4AA 2J6EL 5D72L 2IFFH 2Z8WC 3G5YA 3TCLB 2J88H 2BFVH 3CFKB 3K6OA 4HK0A 1A14H 3E1F1 2G0KA 2HT2D 2C5DC 2O72A 1BFVH 4FADA 2FWOB 1OAXH 4ZFZA 4ZW7A 4ENEC 4LCYB 4AEHL 2B59B 3CU7A 3TASA 2ZPKL 2DQIL 3F7LA 5DFVC 2ITCB 1A1MA 4M6OL 3WJMA 3FB5B 2DIAA 1X5XA 3HE7B 4IK6A 1JPSH 1NGZB 3U0WL 2NW2A 3J7HA 4FP8L 3T4AB 5E1GA 1MCKA 4Q6IC 4PJEB 1J5IA 4KK6C 5I30L 4XVOA 2IV8A 1CC3A 3DJTA 4FFZA 4IJTA 5K5YA 5CN3A 2WUBL 4UT7L 3BO8A 1PSKL 3IRCA 3TYGL 2ZOOA 3O8XD 4GT7A 2WVSA 4FGMA 4TMPA 3IMRA 1TNMA 4HPHA 4QYOA 4KY1L 1QR1A 3TM6A 1CGSH 2H2PD 3FQUA 4O9HH 5AZEL 1ZMYA 3BD4A 3IFNL 5E5MB 4NZJA 3JWNC 4MVBC 4ZAKD 4R4ND 3KG5A 1CE1L 2F68X 3Q6GL 3KW7A 1H3VA 2MEJB 5INCB 2DWDB 3BW9B 2PYEB 3T6WA 2H2SC 2Y7SA 4LNRA 2CO3A 4Y1TA 3PUCA 5IGXH 2BNQA 2VGLM 5LXGH 3CSFA 1OGAE 4OZIA 2DZEA 2ZP0T 1I9IH 4P5MB 5DJ2A 1VACB 1TO5A 4W9GC 4CGUB 5IMLB 3AWGA 1WPCA 3OSKA 4XO8A 5D1ZI 4OGXL 3RTQD 5DRZA 5ILTL 3L4WA 4X7TB 4IIQC 3K0WA 3CZFA 3HS0A 3X1EA 4YX2L 1JGDA 3TT3H 4KHTH 5E9NA 1B4TA 3MXVH 1FAIH 1QBMH 4PJFE 1Z7JA 2LVCA 1R0AL 1MI5D 4U1NB 2YKKA 2MOGA 2MQGA 4L3ED 2WZPA 2JKJA 3HHMA 5JPMA 1OE1A 3SYQA 1WISA 3FTXA 4GMSH 1EDYA 1P6FA 2P5WE 2YOCA 4HUWB 3WS6A 2WB7A 1SM3L 5F7KC 3QZWB 5IEHB 2LGNA 3HR6A 3WHE0 4HW6A 1UB6B 5HHVL 5E4EC 5IQOA 1YPZA 3QXAA 3UTZB 3T0EA 2K78A 4F24A 4KRPD 2FJSA 1XCQA 4QHUA 3V7MA 1T04B 1ASQA 3QORB 4PRDB 1F3DJ 4B5EA 3VXPB 2YD8A 4WWNA 4LU5L 2J1WA 3BEWA 1BW8A 3KPPA 3Q6FB 5F2FA 2DYRB 3ARUA 4KKLC 3D9AH 3GBNL 2ZOTA 4UYPA 5EBWB 3WFCH 1NL0H 2IH9A 2KQMA 4CN1A 2N7SA 3ZKMD 4F27A 3RJDA 4Y1AE 2PCPB 5H4ZA 1HSBA 1P1ZB 3KEDA 3VU2A 1E5ZA 5BMFH 1EAQA 1INDH 5JMRA 3SDDC 3NJJA 1CFNB 5D1QB 3GZKA 3HZ3A 1M4KA 2XUWA 3QDMB 1LO0L 3D85B 1GGCH 2PNDA 2WLJA 1EJFA 1OK0A 5CJXA 1C8PA 5MEQA 3VGDA 4NNYB 3MDJA 1XCTA 2WJ5A 5IB4A 4TXVB 3V0VB 1J5CA 4LLAA 2OZNA 3CVHL 5E8PB 4RNRB 4YFEA 3C5ZA 5F3HB 1JGLH 2WGXA 5F44A 4N2OA 1EXUA 3GF8A 1AE6H 3IPEA 3KJ6L 2NSMA 2GVYA 3BKCH 4MNQD 3NIDB 4PLJC 8FABA 3BVVA 3BRFA 1M57B 1J9RA 4G80B 3UTPD 1Q94B 1W15A 3MQIA 4NC0B 5F0PB 1OF0A 2AHIA 1QSZA 2YPVA 1URIA 4HH9B 1D2OA 2WQ8A 1WHPA 1WJ3A 3LPWA 3UC0L 3BPCB 5SV3A 1UT9A 5F9DC 3TXAA 5AW8B 4AYFA 4MB1A 4YLBA 3CZSA 4FS0A 2AJXH 3OTTA 3VGFA 4LDOB 4P2QD 3VRLF 1JERA 4N2LA 5C3TA 1HCZA 1ZLSL 4BXVA 2ADJA 5GZOA 1MWAH 5DZOA 1OGAA 5CZRA 3AC0A 3GBMH 2WUCL 4HIXH 1ZGLP 2P4AB 5F3FA 4JHWH 1N18A 4OV5B 3JTTB 3V4PL 4CKVX 2XWTB 4NQQA 1UEYA 3E80A 3C8KB 3TPUB 2IIJA 3S5ZA 1RHHA 4PJFA 3VXMD 5I1DB 5CWSB 2HJKA 3UGUA 4QJ3B 2W07B 3NCWA 2LT9A 3AROA 3EFFB 4ZFOL 1RZ7L 4G6KH 1WBYA 1XF1A 2EYTB 4YHZH 1SEQH 1MY5A 1JFHA 1DQDH 5DK2A 3UAJA 5B1KA 3MX0A 3ZDZE 3V0EA 1WAAF 1QHQA 4PTUA 1PIFA 1D3CA 1MF2H 2YQBA 1UM5L 1ZVNA 2IDTA 5L2KE 1DANT 3VSTA 2EE2A 3GJFK 5HVFB 3D6GA 3RIFK 2V7NA 1QSFD 2PETA 2GUOA 3IPFA 1C9SA 1Q9OB 1UGNA 4QXVA 3P11L 4JFSA 1QHOA 4CSPA 1F4YH 4XCCH 3UP1A 1T0OA 4Y1AA 2NTFA 2BSSA 2J5LB 4H8VA 4JDEA 3V4PH 3WIIL 1FZMB 1SBSH 2PPFA 4KHXL 4BFJA 3FO0L 5EOQH 4CDHA 3AS1A 2E27H 1A6TB 4YXKH 4YO0A 1NBYA 5EOTA 4HXBH 2XACC 5FYLD 4XB7A 2AEQL 3LPGA 3FU7B 1H9VA 4U6HB 1SOQA 1N0XL 1AXTH 2QJDA 4JAMB 4NCDA 4YVNA 2BMKB 1HHGB 3OKLA 4X4XA 4PGZA 4LOUD 2HP4A 4OJAA 2MWCA 2F53D 4KUZL 4NWTH 1AO7B 2GSGB 1TSHA 4IU2B 1AZVA 3ARVA 4OVVA 1X5ZA 2BHFA 3ML9A 3CN2A 5FGBA 4TOYL 1CDCA 1E42A 3I75B 3PGDA 3V9CA 3S35X 2BP5M 3FT9A 1E9QA 3BWAA 4H8QA 1TEGA 4NGHH 2CO6B 4ODHH 4QHKJ 5DD6A 5SV4A 3RL1A 3LHPL 5K59F 4JPWL 1I3UA 4F8NA 5MI0B 3HFMH 1BOGA 3U36B 3WNMA 2Y1ZA 3VRIB 1JDCA 4FHKA 2HJFB 3BKYH 3NH7L 4V2BA 2BC4A 4ZMVA 3KLAB 4JQIA 2X4PB 5JUEL 5TF0A 3T0BA 2R0KH 3ARGC 4BZ1L 2QGEA 4ZODA 2VDNB 4YHYC 4NN7B 1TTCA 1PAZA 1U8OA 2NY3C 4PJXF 4ZOBA 1W6LA 3KWUA 1JI2A 4KDTA 3P9MB 4ZUUB 1KLFB 2GIYA 1SDYA 3CK0H 4YHLL 3PWLA 3EHBD 2IWFA 4N8PA 3NSFA 1B4JL 1QFWI 5E95B 4P0DA 1YHPA 3K4ZA 4HIQA 1TMCB 4AXWA 4Y5XB 1M9SA 4XNZC 3MRIA 1B4LA 3BQUB 4PHXA 1DL7H 4I18A 4ZMYA 1UD2A 3BPOC 2IJ0C 5CZVL 2AXGA 4F2MB 1IAIL 4HH8A 1HL9A 3QEQE 3ZKXB 4C83A 3X1FA 2D03H 2P24B 4OJFL 1A6WL 2XWXA 5IJKC 3SYCA 2P26A 3FO2A 3SIKA 5INDB 2OTWB 4PG9B 4HKXA 5HGBB 5CJBA 3P54A 1UUNA 1AZRA 4WCYH 1EVTC 3C6SA 3ZKND 3GPEA 1KYOK 2XBTA 4Z7IA 1VKXB 5ITFA 2A73A 1AHWC 4LKCB 4JFZL 4DUVA 3RIAF 4XH2B 5L2KA 1TJHL 4POZD 5ERWB 4WW2F 3V8OA 2MKLC 1BBJB 1W0VB 2FZ3A 4EI5B 3GBDA 1VFAB 2E8ZA 1T83C 3IDJB 2ICCA 5ETUA 5HDBE 4BQCA 2YK1L 1SLWA 4JQXC 2Q87A 5ICZB 3CFIC 5FYLL 3IDNB 5I17A 1UZGA 1KLUA 2JJUA 3RWEA 4X98A 1YYCA 2AVFA 5HY9A 4BCZA 3F7PC 4O02B 3KPRD 2H3KA 5L4JA 3QUMH 2FLRT 4KROD 3PWNB 3ZTNH 4AQ8C 4HOZA 1HCYA 1UWEL 3AQDA 4L8SB 4NO0D 4K9EL 4ZSOE 1T4KB 1I9EA 1OALA 5E6RB 2R29A 1MFAH 3L3IB 3ALPA 4JHBA 4ERSH 1SXAA 1NGQL 1R1CA 1SPDA 2OYKA 5K1NA 3G5XA 1CG9B 3SZKC 3FUNA 2NR6C 4H20L 1TJIH 4O02H 4CKQA 5F7UA 5D7SH 1TU2B 3Q01A 1LMKA 4GKNB 3RVTD 4KI5F 3S3CB 1GMEA 3FFCD 1GZQB 3QIWA 1NC2B 5F1IB 4LSSL 3M1OA 1NWOA 2R0WL 3LSOA 1OAJA 3QJFA 4U7SA 4I48B 3LH9A 3D05A 4UB0L 3QG7H 2X3AA 3PFUA 1QATA 2NY5L 3GXUB 1ZD6A 2AJZA 1NKGA 1SJEA 2W65A 4PLKC 1AHKA 2NXYC 3AT0A 1ID2A 2G4EA 4XCFL 3QHZH 1KGCD 3GS4A 3PDOB 3V52H 1CLYH 5TE6H 5CMAB 1KWKA 5JW4Q 3CFJB 4R2GC 4MS8D 5AOLA 3B7SA 3KLLA 5IQMA 5F8RC 1Y6KR 3V0JA 3EOTH 1QP1A 2X6BA 2MRYA 2A4CA 3GO1H 4MD4A 4Y16A 2JCCA 3ARSA 1NDGA 1DP0A 2IANE 1C7TA 2OXHB 3Q3GA 3M17B 2C9VA 4NQED 2CO7A 4F37K 5IIEB 2FSDA 1H3XA 5HTSA 25C8L 1A7QH 4H26B 2AABL 1WE5A 4PJ7F 3HMXH 3PHAA 2PCFA 3QEQA 4ZDHB 3SKNB 1JDDA 4PJCB 4PGEB 2J6EH 4MCZA 5D72H 4BKLA 4ZUSA 1XMEB 4EN3B 1S7SB 4F5CE 4K73A 4YGAB 3CDZB 1OSEA 1XXFC 4UT9A 3ERXA 5F7BA 2H6PA 4MA3B 4BWWA 2NY6C 2NT1A 4W9ZA 3FC8A 4WUKL 4A2GA 4AEHH 5JO5B 3WIHA 1XV8A 2ZPKH 4G6ML 2DQIH 4CNIA 3SD5A 3RX9A 5JHLA 3U4EA 4M6OH 5FYJU 3MRKA 4MKTA 1Q1PA 3U0WH 2P5EB 2Y7MA 4FP8H 4DVRL 2ATKB 5HDWA 5ESQB 1THAA 4N2FA 4HS6B 1K5NB 2N7BA 2UZYA 4EN2A 5I76A 5I30H 1U8NA 2OK0H 2WUBH 4OFKA 4UT7H 3BN9C 2E9IA 5ANMB 3TYGH 2MPAL 1YEJL 3SJVD 3NOIA 3MRFA 1FNGA 5IVZA 1HJBC 4KY1H 4AEFA 3P30L 1L0YA 4QOKB 3NCJL 2EYRB 3OJMB 1UKTA 2KKQA 2FYYB 1T1YA 4ZSOA 5AZEH 3IFNH 4JY4A 4WFFE 2VDOL 4GG6B 2EECA 1FA4A 1BXXA 2XWDA 1W91A 4BKTC 3JVGC 1HNFA 3KPOB 3BZEA 3O45A 5B39G 5D7JD 3GI9L 1CE1H 3Q6GH 3FCSA 1NPUA 4P2RB 2AQTA 4WWKB 2Z7UA 5KSBE 4MAYC 5GRVL 1NJ9A 4JZOB 2ADGB 4PJ6A 1HILA 2HZHA 2KLSA 2WZ6A 1P7QA 3HBZA 3L7EB 3QRLA 1PCXA 4PRPE 3JYCA 1ZE3C 4AYSA 5EA0L 4ABWA 5BV7C 3P9LA 1OTUD 3RWGB 4OGXH 4LGSB 5ILTH 4UCFA 5KWYC 1TVHA 3ARFC 4M93C 1SFDA 3PWUA 1D2PA 1IL1B 4PD4K 5ACLA 1CGXA 1IC4H 3GDBA 5FIEA 1R0AH 1Y6NR 4NNPL 1PG7X 2P47B 2I7SA 1XT5A 2HLAA 2N59A 4G8FA 4EDWL 3HG3A 2VTFA 2IANA 1TZAA 5HJ3B 3MV9D 5HHVH 5FDWB 2YD3A 3VXTA 4DFHA 4N2DA 2EUXA 1NAMA 1V10A 1ZV2A 4IBSA 4NO5A 2IMNA 5CCGE 2MJWA 1G7JB 4GRMA 4LU5H 2IADB 3CAFA 5ANHA 4CJ1A 1XB6A 3FOMA 4WV1A 4G1MA 2DPKA 5KVGE 12E8H 4A39A 3GBNH 1RZKC 5I23A 2CLVA 2W94A 2VB5A 3CVHB 3PV7A 4Q9CA 3GMOA 1SDDA 3K5SA 3U7AA 3V4VA 3HRZA 4I2XB 3DI3B 2KQNA 2VISA 2VE6B 1LO0H 3TCTA 3QEHA 3QCTL 5IW1A 3FSOA 3DVNB 3ZE0F 3TYFA 1H3GA 5IMOB 5LCVL 1U95B 2Z7WA 3S98A 1FZOA 3LKQA 3C09C 2XG4A 1BD2B 3BGMB 1KV7A 3QPXL 5ELIA 4IHOB 4ANVA 1FO0A 3D3VB 3K6SB 1V5JA 1OTTC 3KJ6H 4EDXB 2Z92B 2I24N 5DQDL 2NNAB 1IAMA 1R3JB 5CBAB 2QZ5A 3IDIA 4YLQT 5DEJA 2X6VA 5CSGA 2C7UA 4LPUA 4GAYA 1CFQB 3IGUA 3V4PB 4ELMF 4R7NB 4PRIE 1MCWW 3UC0H 3GHEL 5E6IC 5TDNB 3T3PF 1A6ZB 4UQ3B 2FIRT 3LXAA 3OGCA 4GKLA 4PRHE 5KSBA 3MLVL 1NMAL 1S9VA 5GQBA 4AM0B 2ITDB 4OQTL 5DD3L 4ZNEE 3V6FA 5IBUB 1ZLSH 1KXQA 4PRPA 4YLCA 3WTVA 5L8JB 2VXUL 5J1AA 2MHAA 2WUCH 1LHZA 2XV6B 3D2UB 2OMUA 1OGSA 4W81A 3KGSA 4DIXA 4UOW1 4L5FE 2X4QB 3JXAA 3QQ3A 1KG0A 4M4RA 4EVNB 2VLJD 3EOBB 4NYLB 5BNXD 2P3YA 4KV5F 4UT6A 4OGYL 1NBZB 5F88B 5JOPE 2ZP8A 4RFNC 5MHSD 1CFVH 3OB8A 4PJGB 4YSCA 4G1EB 4GW1A 4DCQA 1RZ7H 4LL9A 3LV3B 2VW7A 2ZXGA 4PGDB 2CCLA 3TESA 4ISVB 3ZBMA 1RPUA 4RGNC 2A2QT 3EADA 5DVMA 3BFWA 5EUKA 1Y7VA 1JD7A 3E7JA 1UXSB 4PJIE 2BDNL 1B2WH 5CEZE 1UM5H 4RRPA 1D6EA 4LCVA 3ELQA 5B3JF 1BFOA 1ZA3B 4DO5A 1KPVB 4L18A 1WWBX 5C0CE 4BH7A 2O30A 1HXMA 4X9YA 5C07D 5TK2A 3QEGH 1SOKA 3P11H 5TGBB 1IFHL 3P4MB 3AW5A 5K9OA 1HHIA 3EO9L 5JW4N 1S7QB 2X4RB 4GT0A 3EYVA 2WGNB 2PLTA 2HVJA 4YHML 4KHXH 4L1TA 3FO0H 3E6FB 1IZKA 1I3RB 4HUUA 1YQ2A 1JF1B 2F1BA 4YHKL 3TA3B 3NGBB 5HDRA 4NOBA 4P2QB 4HCGA 2AEQH 4RGMB 5HI3C 3VXOA 5DUJA 2AXFA 1N0XH 1JV5A 1IGIL 2IC2A 2VCOA 4FNQA 2KYIA 3GSOA 3QUXA 3NJFA 5HXMA 4KUZH 5KTEL 1HCFX 3UABA 5DVKA 3L7FA 4TOYH 3ZXAC 2WTRB 3B2UD 4QRRB 3D5OF 5C0DA 3SKMB 3P4OA 4JANA 3FZUD 1HX0A 2Z93B 4LCCB 3LHPH 4X4ZA 5MENE 4L8CA 4JPWH 2ZWYA 3R0NA 1KJVA 3VXNA 1D9KA 2ICEA 4TSBL 4PJ8B 3FU3A 1JZGA 2DS4A 4GUPA 2WNGA 5CP3H 3S37L 3I02A 1WVZA 2PF6A 4PRHA 2IWGA 4JO8A 2D9QB 3BPNC 4Y5VB 5JIHA 4BZ1H 4GUQA 2C3VB 4ZNEA 2YBRA 4B7IA 1S9YA 1Q4NX 4UM9B 4MB5A 3HJ0A 3IS1X 1M1SA 5DRNB 2XFGB 4HIHA 4UM8B 4YHLH 5EV7A 1QABA 1ZSDB 4D9QD 5E2TL 1B4JH 2OJEA 1QSFB 4GAAA 4GRWF 4OZFA 5B1CA 3TFKC 3C5ZC 3MRMB 4WY7L 1KCWA 3VE0B 1WEJL 1DN0B 4FXKC 4RSYA 5EORL 2FK9A 5CZVH 3JV4B 4CN6A 4DK6A 4WWOA 1P5VB 3CVIL 1IAIH 3LH2L 5GS1B 3VMOA 3UMTA 5D9SB 5HHME 1P6AB 2GABA 4OJFH 1A6WH 3QXUA 2YQGA 1BIHA 1P7KB 1IEBA 5EO0A 1HHJA 3L95B 5E08L 1QSED 3CDGB 1I1YB 2PPAA 1TVBA 2IQ9L 2VAAB 5AW1B 1WTLA 4PJIA 1INQA 4RMTA 1P5UA 4JFZH 4WI9A 1CD1B 2F53B 1GSKA 3VFPA 1TJHH 3A4AA 4KGJA 1MH5B 5CBEB 2QELA 5C0CA 1NEZB 2FQDA 2ICES 5CM1A 3CLFL 3DX1A 1NANH 4U1GC 3STLB 2YK1H 4JFEB 2Z91B 5FYLH 5ECJE 5DI8A 2YRPA 2OL3L 2IAMD 4GSUA 5IQ9A 1MLBA 3H9SD 1YRKA 2AJ3A 3BUIA 3GUFA 1XGUA 4X7SL 3HLAB 2NLJB 4MJIE 1OP4A 4N0FB 2WVUA 1U8JB 4LESA 4K94H 4R7DB 5IF0A 2C1PA 1UWEH 3MV7E 4OZHF 1SJHB 4K9EH 3AFLA 4NZ8A 1JCKA 2RIKA 2NY7L 1UZ8B 4F91B 5C1MB 1HEZB 3G5ZB 3ULUD 3ETBJ 1JZ5A 1NGQH 3GIVB 2DQGL 2WKOA 3GD1C 4AE1A 4YS4A 3LDBB 3UYPA 2B1AL 3GSVB 1TJXA 3I9AA 2HT3D 1SF5A 1E65A 4TUJB 3NJNA 1CLOL 1WCBB 3MGAA 4O58H 5MENA 4Q9QH 1ONQB 4LSSH 4GB9A 2R0WH 3F12A 1CYGA 3VFVB 4OZGF 3F7YB 1E2ZA 1U4EA 3MRHA 4Z6AT 4MQTB 4UB0H 4WO4A 3BSZL 2B9BA 3SKUD 2NY5H 3HPJA 1QACA 4MHHG 1K8DB 3NCBB 4ONHA 3TJHC 2EDWA 4XCFH 1TTRA 4OZFG 1DQQA 1IGFL 4P46D 4KMLB 4CMMA 4P4RA 3KXFB 3OMZA 5CZKA 4OM1L 5LO7A 4NQCA 5EIIA 3VCLB 2FQEA 1YDPA 4OIBA 3T0VA 5TF1H 4UYQA 1UWGL 3PHOA 5JDJA 4GMTL 1U8HA 2NY0D 2GAZB 2J1XA 3O2VL 3GIZL 2PO6B 4YEFA 3D51A 3G6JF 5C0FB 1A6AB 4DAGL 25C8H 3MO1B 2LV4A 3MV8B 5FGBC 2VRQA 2AABH 2WC7A 4Y2LA 3VI4E 2DLFH 1JK8B 3DUUA 1MCNA 2WPGA 4KQ3H 4R3SA 1LDSA 5KS9F 2VLLB 2GCYB 2E9GA 4KUCD 4JFDD 1AIFB 5DJYA 1NM4A 3HZKB 2ZXWB 3KPSA 4WUKH 4Y9CA 3TIDA 3PIQA 3BOVA 3WLWD 3ZRSA 1DQTA 3FBKA 4G6MH 2IGLA 5IOPB 1IARB 1NUFA 2OMYB 2MOQA 4DVRH 3D52A 1S9WB 4TKWA 4PVLA 4I1PA 1ASPA 5JNYB 4OJCA 2DWEA 3LZNA 2Q8BL 1TEYA 3DOIA 5LGYA 4AYBA 4I18C 1KYFA 2J6WA 5F7YC 4XXWC 2MPAH 1YEJH 3SB3A 4H7VA 5FO8A 1C16B 2XN1A 1J0KA 2J8OA 3NEOA 2UY6B 2XG5A 5E8DH 1QBAA 3MV7A 3N42F 3P30H 4OLZL 3NCJH 1GKEA 4M7LL 3B2VL 1RD6A 3KPMB 1BXUA 2ZOLB 2VDOH 3CPLA 4K15A 3BH9A 3WEOA 4AMWA 4TNGA 5JQIB 4BEIA 3TEZA 3FB8B 1MVUB 1AGDA 4LBEA 5I0VA 1B0WA 1KPRA 4PS7A 4NKMA 4JGMA 3GI9H 3TV3L 2Y6TE 3WL9B 1QBLL 2XTJD 1ADQA 3DYOA 5F70A 4ZUWA 4OFIA 2EDJA 4LRIA 1IUZA 1NMCC 2XWBA 4I77L 1D5RA 1G7IA 4LHUD 2BWIA 3CH1A 1G0DA 4WKZA 4XMKL 5EA0H 3SYOA 1Y1DA 5IG7B 5KSAD 1Q0XL 5AUMA 2J3SA 4NSKA 2BOLA 2X9XA 4WSJA 3X13B 4P9HL 4QRFA 1J7VR 3IU4H 4BKSC 3FRPB 4NQDE 1WS8A 3GMRB 2V2WA 1HU8A 2Y7LA 3QJSB 1BV8A 3GXFA 4U1SB 5T3ZE 1L0QA 1NDTA 1Z66A 1KXVA 2NZ9C 3DOSB 3EUUA 3KPLB 4LLMB 5EOCL 5FA3B 4EDWH 1IFGA 2IAAC 1T22A 2YUXA 3L2LA 2Q7AA 1BEXA 1MHPL 1XZ0A 4XBMA 3H3BC 3TZVB 3VQLA 4XWOC 4HX1A 4X0KB 3QK0A 4ODXB 2NNCA 1FVEA 2QT6A 3MJ7B 3QI9B 4PLNC 5JIPA 4LK4A 4GW5A 3VI4A 1WBZB 2ZOKB 3ABZA 3OQRA 3ULVD 4BHUI 2R15A 1R34A 2OW6A 2NY4C 2A6DB 4RMWA 4DF9A 2GHZA 1JXJA 3NRPA 3GRBA 1KIRB 3NFSL 2AQ2A 4JCMA 3HEIB 1IFRA 4W93A 2YGNA 3BAYA 3KJ4B 2E7BA 4Y9BA 3W0WE 3UIZA 3L6FA 5DHEA 4BIKA 1CICD 4BWTA 1I4FB 3QCTH 2XLLA 3QXVA 4JW3A 4MAZA 3UPCA 5B7MA 4U1HB 1WZKA 1F1GA 2YAFA 4Y16C 2MCMA 2Y6SD 4AEIL 1U58A 3DX3A 4DKEL 4NC2B 4ZQKB 2QPFA 5LCVH 4KFZC 1UOVA 4PJ9C 4KZDL 3O4LD 4ODSL 2H32H 3QPXH 3VXUD 2D7TL 5SX4H 3RJQB 1F4XL 3FQ2A 1MJ7L 2IPUG 2R69A 3LEVL 3TH3T 4ADJA 2HXAA 2ZXQA 4ODUA 1DBAL 1HESA 3D4CA 5DQDH 1LP9F 4FNLL 4YNYA 4RBPK 5HI5C 1H6UA 3OKOA 2R1YB 2A6KB 3AZUA 1QWNA 1MKFA 2DKSA 2E7DA 3GHEH 2DM4A 5E03A 3ZE1F 3VJ6A 4JJHA 3ZN6A 5FGCB 3MLVH 1NMAH 2NXZD 1OCOB 3ZZ1A 1A2YB 4Z7OF 4OQTH 5EBMB 4X8JA 5DD3H 4CL7A 5HYEA 1ZLWK 1G9MC 1UFGA 4QRTB 2VXUH 3W5NA 3JTSB 4ZRGA 3VGEA 3RVVC 3X3FL 3DO7A 3V0IA 4XZUA 1PNDA 5IB3B 2OTUB 3GI8L 2XQYA 1QQDB 1CDJA 4QRPD 2WLMA 2DH3A 4NQDA 4OGYH 4XN5A 1HKLL 3W1ZA 5BS0E 1D5ZB 2C9PA 2XVLA 3GB7A 5JHAA 5FX3A 2ZZUT 2VJ0A 9PCYA 5BXFA 4XCNA 4A6YA 5H37H 2R4RL 4WUUD 2V3DA 3L17A 4GEIA 3CHRA 4N2CA 1WWWX 5DU7A 2F8XC 4YDMA 4UTBL 5FLUA 3LN9A 2CBTA 4NQVA 4L3FA 4GUOA 4H8HA 4LRNH 1HYRC 5AW9B 4WKXA 1C12A 2A9BA 3V0GA 2IGTA 2BDNH 1CT8A 3JT0A 4RAVA 1ZJBA 5D7LB 4JFUA 1ZT1A 3MLPA 3U6RB 2ZKMX 2X1XR 5DHYA 1E3FA 4OLEA 4O2EA 1MHHB 3HMWL 1HQ4A 1TLMA 3HAEH 1E0OB 4G8GE 2SODB 5D2LB 1N2RA 4RETB 5ITBL 1JVLA 4FA8A 3NVQA 1IFHH 5FKAB 1G87A 4H2AA 2GTZB 3EO9H 2J8UE 5IQ7L 3SD2A 4YHMH 4GY4A 3W0WA 4X8CA 4NQXB 3GSQA 4YHKH 4ORGA 1EFXD 3KYOA 3WHXB 4DO4A 2WWKT 3CFCL 5HVHC 1DUYB 3KPQA 2HN7B 4FQXB 3S3DB 3BP4A 2KT6A 1IGIH 4J3OD 4M5YL 2P46B 1NCAL 1CBVL 3VGGA 4XNMA 3MUY1 2JVUA 4AGOA 4KKQA 5KTEH 3BIKA 4HALA 2X7LA 3MFFB 2C4FT 4B53A 4RGOL 3BUPA 2ZTBA 1OW0A 5F96L 3DX7A 2WQSA 3FUDA 5DQJB 3TN0A 5A3IC 4GEJA 4EI6B 2XI9A 4OT1L 3O2WL 4TSBH 1KPUB 4IRJA 3RDTD 4U7KA 3M88A 5B1JA 5JLZB 5DD1L 3S37H 4NENB 4QCIA 3HRZC 4Y5YB 5HYQA 2ZUQB 2L4OA 5IJDC 5GJTL 3TTSA 2FBRA 3MJ6A 2WXNA 2XQYG 3C8HA 2J73A 3MRJA 4IKLA 3RX5A 2YC1A 3LNHA 4IBZA 2ZSWB 1PD0A 3DIDA 3N3EA 4WNQB 1WT5A 1NOAA 3VW3L 3UEZA 5EO1A 2VQTA 4G9FB 5E2TH 1MDAA 2R27A 3K1KC 5HPMB 3MROB 5C07B 5JHMA 3BWUF 4X9BA 4Y9EA 1ILUA 2VLRE 4WY7H 1KBKA 2N0MA 3VRLE 1YN7B 5F3BA 1SHMA 5EORH 1ZLUK 2VDKL 5BS0A 3CVIH 3ZHKA 1AOZA 3LH2H 3MLTA 3QUYD 4KPHL 4ZPVA 3PWPE 4P4KB 4D9RD 5BZXA 2BXZA 4NO3B 3LXUX 4O51A 5DRWB 2X88A 3DI2B 2W9LA 3LZLA 4Q52A 4UILL 3TO4A 5I26A 4RFEA 2CXKA 4F8QA 4ZFZB 1ZANL 2OL3B 3NCFB 4CSSA 2GBAA 5E08H 2RACA 5AVQB 4PRNA 4L0ZA 1U42A 4F80A 3FU5A 5IHLB 2IQ9H 3VGAB 2YUVA 1JZJA 3HI1A 4PV9B 5E1HB 2HVKA 4J6IA 4RDQF 3SDCC 5AEAA 2NW2B 4WEEA 4G8GA 4N68A 5BO0D 3QCVH 1TQTA 1WBXA 3B43A 1CB4A 4F2EA 5I9QC 5LBSA 1PFOA 3CLFH 4PM1A 1RIUH 4R96B 5GRXG 5LGKA 3QUZC 4ZMTA 2OL3H 3C60D 4G5AA 4TNEA 2BNRE 1WAAE 4MJ5B 1DQKA 1F6AB 3UOAB 1E5CA 1HVXA 1EIBA 1V7NL 4OCWL 4X7SH 4AK1A 2QADD 2KERA 2HRLA 4JS7A 4W4OA 4Y4HA 3QR2A 3NCMA 4MDJA 4H25A 1UWFA 4IBTA 4QYOB 3SEPA 2FNBA 3FQUB 1BJ8A 4PGJA 1JZ8A 3BE1L 2R0LL 3U30B 5ENWB 3FCUB 2NY7H 3MBEC 5JOFB 2NMSA 4KBPA 4AEEA 3VXSB 1OZTG 4DZBA 1QFUL 5K39B 5ESAB 4PB9L 2NX5D 3KS0H 1WS7A 3CWGA 4L2YA 4ZS6C 4ELDA 2DQGH 2OJ1A 1OT4A 1VEMA 4W9LC 4LNRB 4RRPM 3MHZA 1NFIB 3M1BA 2B1AH 4MFHA 5EEVA 1VGEL 4AZ8A 3OPZL 1D5IH 3R06A 1SYSB 1WG3A 1CLOH 4XB3A 4Z18A 2DIJA 4JR9L 1EXHA 1RFDL 2K45A 2QGCA 2LU7A 3MLSL 4XBPB 3BSZH 2GK0A 5H35A 4KITB 3FCGA 4GAJL 3HS0B 4F57L 1JGDB 3VU1A 1P7HL 4DP1X 2ICWI 1HDMB 3MGOB 5B4MC 2Z1PA 1ETZB 1IGFH 1IB5A 4EZMA 1KTLA 2YZ1A 3SBRA 5K59E 5EZJA 4OM1H 2CBOA 4P99A 3O2DH 4NKDB 1PAMA 4ZUVA 5FKPA 1UWGH 4F3FB 1GH7A 4GMTH 4LCIL 5HHXL 1U93B 1HFUA 2DKMA 1YPZB 3D50A 4OSUL 4Y4KB 2VLRA 3ROOB 5B21A 3O2VH 3GIZH 4GG8B 1A21A 1GY2A 3T4YA 1V3KA 5J3HC 4DAGH 4QHUB 3QJQB 2G5RA 3TF7C 4PJXE 3C5JA 4ZMXA 1L6ZA 3HW7A 3PWPA 3DDGA 5FO9A 4J1UA 3FSVA 5CO1A 3V10A 1DBBL 3H85A 1S9XB 4NFDA 3ASOB 4Z5RA 2Y7NA 4Z7NB 1RJYA 1CL7L 3K81A 2JKNA 3R4DA 4Y4FC 4X9FA 3RVUD 1C08A 1JK9A 3FJTA 1Q1JL 3UPAA 1XR9A 4FQ1H 1JFQL 1P4IL 2XA3A 5TDOA 3ZDXB 1PYWA 1BVLB 2BP0B 5A2IH 1UURA 3LY6A 4LVHB 2ESVE 1D6VL 2DI9A 4OGZA 4K8RC 5KSUA 3O9WA 1QUNA 2OTPA 4FA7B 1I1FB 4BD4A 2J7LA 1VLXA 5EU4A 2Q8BH 4MA1C 1AKJD 1RMFL 1WAAA 4NRYA 5DJZA 1EERB 1JI1A 5DEZA 4Y19A 5IB2B 4Z3FA 1AQDA 3ULUH 4MNGE 4MQXD 5EDXA 1EXUB 3GEWB 4HAGA 4JO4L 4E41E 2JCWA 1KJ2A 2O6EA 5LG6A 5ABZA 4OLZH 4UOZA 5BQ7A 4P46B 4AK2A 3ARBB 4B27A 1ZA6B 3B2VH 4FABL 4HISA 4XOCA 2AQSA 4O00A 1H8LA 3AY4C 3FL7A 3IXTB 3Q8CA 4AYFB 1BJ1H 1KJ3L 1SEBB 3TV3H 1UA3A 5E6UB 1QBLH 1P4BL 5I82A 4NLAA 4N8UA 1FG2B 1LK2B 2EAEA 4JBSA 4N6QA 4I77H 4PJCF 1JXFA 2K1MA 5FR3A 2DB8A 1W72L 1NGWA 1XH2A 1CLCA 4LVNB 4XMKH 4C4UA 3L3HB 1PFCA 4HSCX 2W95A 4G71B 3CQPA 2JELH 2WWNA 4UQEA 2MQCA 2RFXB 4WHDA 4P9HH 1RHHB 1L9RA 3KCWA 1U30A 1J8SA 3KLKA 5CR8A 2BP8B 3DSFL 1SVZA 3DRQB 1SVCP 2CRMA 3WLBA 5I1EL 4LLYB 3HC3L 3QH3A 4KK6D 3B7TA 2D7OA 5EOCH 1MHCB 2VZ1A 3MX0B 1QASA 3DYPA 1MHPH 1ORSA 3GXPA 3V6OE 3VFNA 4F9LC 3MCYA 2PR9A 4OJEH 2ZG2A 1RPQA 2H4EA 3ECWA 1OSYA 1YEFL 4PJXA 2JTDA 4R6UA 3S8FB 1S9KC 4FFWC 5FCUH 1FN4B 4Z3IA 4PB0L 1OY3B 5T1KD 1RPKA 2Q6WB 3RGBA 1QAWA 5C0JB 2JKSA 4MVBD 4JFXA 5KN5B 1DQIA 2VXTH 4PU2A 4BCXA 4D2NA 3AREA 2HX9A 1ZS8A 1WFOA 4NBZB 1N68A 5A6IA 5F9WC 3CZJA 3IF1B 4I0CC 3VXQB 2NTFB 2NSQA 4I3RL 2H2SD 1S46A 1E30A 3NFSH 4JM2B 2X2IA 4BA8A 4JDEB 3DWTA 4FQQA 1KZYA 4GIPD 2H0JA 5D70L 2WV3A 4X6DE 3PV6B 2YAEA 1NBYB 4XPAL 2WB1A 4OQ1A 5H4YA 3I50L 3EIFA 3N1FC 4W9IC 1Z9NA 1O7VA 1SJVA 1AVAA 5I1AB 1AZZC 4AEIH 3W57A 3VACA 4DKEH 1SXCA 3FCTA 3WO4B 1PY0A 3MMEA 4KZDH 4ODSH 1U36A 2J44A 3APFA 4ZO9A 2D7TH 3OJVC 5EUOB 3E1ZA 1F4XH 1G7LB 3CLEL 3LEVH 1S5HA 4WW2A 5FOJA 4E41A 5KYWA 4Z7UF 5HD8C 4GSQA 3V6ZB 1GTFA 3C2SA 1M7IA 4L29B 3RL1B 4YK4B 4J12A 2CXGA 4FNLH 4TVPL 3N44B 2IF7A 5D5MB 5J8OA 2Y7OA 2YEZA 1OGTB 1J8HA 3OJDB 1X7SA 3WJJA 4A2FA 1JNLL 4PGBA 3V0DA 4KKLD 2H6OA 2LVEA 4ETQA 5E6YA 1CURA 2JKXA 3UX9B 1A9VA 1PDKA 3ARXA 3KWXA 1O5PA 4XCYB 3X3FH 2ZG1A 4WEMB 3ZDYF 3NIGE 4OFPA 5GGTH 1DZ0A 3HZYA 1FWXA 2DTSA 3WUWG 1FE8L 2YLHA 4FQIL 3QULB 1HKLH 3LPFA 3ME0B 2E6QA 4PGCA 4B9PA 5I73C 5TQ0L 1OQOA 3UTSD 3QWOA 3EYOB 2DQJL 2R4RH 4PSRA 4R4BA 5FDYA 3U48A 4HKXB 3MRGB 4UTBH 4YSUA 4E9TA 3TWCL 5AD0A 2Y5EA 3OXSB 2RCSL 1RJZA 4OF0A 1WUZA 2A73B 2HFFB 4A2MA 2VKWA 1CDGA 3O4LB 5JTWA 2FDBP 3APDA 1TEFA 2HPOA 2EC9T 3IJ8A 3HMWH 5DMGD 2W0FA 3IMWA 5J13B 5ETUB 3N9GL 2EIJB 2NUTA 5ITBH 3NG5A 2YAQA 3ASNB 3MRRA 3O11A 4X98B 3ZSSA 3KPTA 4XO4A 1Y1UA 5I0ZA 2E0PA 1NGPL 4KQ4L 3UTQB 3B3IA 1XF5B 4PJ7A 3DX0A 5I6PA 3BXNA 1OCWL 4X6DA 3RHWK 2J4WL 1FP5A 5IR1A 5DJCA 2QL1A 2H0FA 5I8EA 3IU3A 3NFNB 1DEEA 3RX7A 3KGTA 3RFZC 3OWEA 1KXTA 1DO5A 3TV8A 1OE2A 3CFCH 4MSWA 2GT9B 4M9OA 3WSQL 3EFDH 4M5YH 5HGHA 1Z9PA 1P84K 1NCAH 3G5XB 2V3EA 1E28A 4PY7A 4PS8A 3U1SH 4PJ5D 1CBVH 1E9PB 4Y89A 4QHLA 4I9WD 4RGOH 2I07A 1DSWA 5F96H 3BZFB 3SDAC 2V6HA 4NZUL 3SE4A 4N9OB 3HKZA 3ZE0E 2Q10A 3HC0B 4FXGC 3FCBA 3LSOB 3CXDL 4BSJA 3IJYA 5B39B 3EGSA 2RMNA 3QJFB 4XE5B 3WJLC 4NO2B 4OT1H 3O2WH 1V7ML 4JK0D 1VZGA 1H8SA 4LCWE 5DD1H 5J11B 5D1XB 3EGDA 2IDSA 3JZ7A 2WBJA 2WYIA 2VDKB 3QWRD 5GJTH 5D4QA 4PJDF 3FQNB 2VN4A 3K8MA 5I66A 4D8PB 5DDHA 1BVKA 2JLPA 4J8RA 1A0QL 1NGYB 3AQZA 4EIBA 4ELME 2JCCB 4E9RA 1X9RA 3BWUC 4LSVL 4OU3A 1KULA 5DD0L 2BK8A 2WYZA 4N87A 2KLRA 3DV6B 2CO7B 1VDGA 3BLPX 4UANA 4N5UA 4BXSV 1DUZA 2D2OA 3C6LD 2Q86A 2VDKH 1PTZA 3BUYB 3CXHJ 1BG1A 1DVFC 4G8IB 4KPHH 3ULAB 5JIQA 4FNTA 5F9JA 5EIVA 2R2BA 1JUFA 3FMGH 4M02A 3B2DC 4G5ZL 4I0PD 3FDWA 4JFTA 4UILH 1EFXB 1EAOA 1ZRUA 1DJWA 1ZVHA 4QY8A 3WCYA 1ZGLM 1IEHA 1ZANH 2KS0A 3BDXA 3QFJB 4LCUB 4JRXD 1L6PA 4JDVB 1UXLA 1OO2A 5F9OL 1QD0A 1NFAA 1I8MB 1I7TB 4ZUTB 2DWXA 4PYHA 4DK3A 4DKAA 3A47A 2V37A 2OXGB 2C9XA 2QQLH 4PBDA 1F6FB 4QRBA 4HVBA 2R2HB 3L3GA 4RMRA 4HMEA 1C5CL 3D4GA 3Q1EA 5F89A 1MFCL 4IGBC 3SDXB 4DPBX 4RWYL 4LPVA 4AL8C 3ARGD 5ISZB 3TP4A 1ZAGA 4WO0A 1ZIAA 4HAFA 3S5LG 5JQ6L 2NY3D 4YDLC 3TBSA 4OCWH 1V7NH 4PSPA 4HIIA 1OP5H 4NHUA 1FNGB 3P0YH 3SO3C 2P7TA 3ZYJA 3ZYOA 1T7VA 1ZT7B 4N25A 1EDHA 5CXPA 2YPLB 4HA1A 3TWYA 5D93C 3BE1H 2R0LH 4ZYKB 2BIQA 2UXFA 3NZ8A 4BFFA 3B9DA 2H41A 3QUKB 1QFUH 1LL1A 2GTQA 2VMCA 3GSRB 4PB9H 1LK3L 5BRZD 3BVNA 3S35L 3IDYC 1ZY9A 4PCKA 4D0BA 1NCJA 2HRGA 5JIMA 1FYTD 4AQAA 3BP5A 3L45A 3QNZA 3IFOA 2CK0L 2VN3A 3EG9B 2P43B 1VGEH 5FV1L 3OPZH 4M1CC 3LYRA 1WWAX 4NAJA 3BMVA 4ZPTA 3OGOE 4AJWA 3QUYB 4HSAC 2HKFL 3G5VA 1WAEA 1RFDH 3ES6B 2DMHA 1DQLL 2ZCLL 4ZW8A 1AR1B 2PWFA 4LCWA 1CTNA 1BZ7B 4GAJH 1NCBL 4F57H 5C0BD 5B8CB 3E3QE 4NCC2 5FK9B 2X4NB 4MCYB 3F5WA 2QVKA 4KJWD 5HHPA 2WO2B 4S1DC 3DBSA 5BJTB 2QDVA 2D9CA 3OKEA 1YEHL 4R8WH 4ZTPL 5E4OA 4ELMA 3TT1L 1MNUL 1HHHA 4LSQL 3RWIB 2FH8A 2VJ8A 3IKCA 1VAHA 5JW3L 4LCIH 5FYJE 4OSUH 3T6ZA 4FMFA 4CADA 1PL3A 2DYSB 4L4TA 4F1ZA 4NQSB 1XSKA 2EO7A 1UH2A 2RQEA 5GZNA 3OR7A 1FNFA 2ADFL 3F64A 2WYTA 1JVOA 1YSOA 3K2UL 5E51A 2XWCA 4MJHA 2V33A 1DBBH 5AFAA 2G3MA 4IRSA 3EF4A 4GRWE 3H8NA 2TSBA 5B1JC 5DHVA 3GMNA 5ESVA 3ALWA 3VQ1C 1KIUA 2WIIB 2X53A 1Q1JH 4JFVA 3RE0A 1JFQH 1P4IH 4TNVK 2NX5B 2XZQL 3E6HB 1E5AA 4UMSA 2VISB 2DMCA 1F2QA 1U8CA 4OZ4B 5AAWA 1D6VH 1GGTA 3DBXB 2YBGA 5IW1B 3AT9A 3SCMA 4PLKD 5D1ZA 3FUEA 3BH8B 3NJXA 4NN6B 3VYPA 4HEMA 3EXJA 5EEUA 5I2IB 3F85A 2XY2A 3WV0A 4M8QB 4PWJA 1RMFH 1XBRA 3EH3B 3I85A 2YA1A 1S4IA 4JO4H 5GPRA 3AAZA 2XPGA 5D7IF 1B0GB 1E8WA 1RSFA 5I6XB 3SE3C 1G5GA 1KBPA 4MXQC 1IQDB 1W72B 4QNPF 2YD7A 4FABH 1FL5B 3PHSA 4YSDA 5KZCB 2H45A 1BEYL 1FYHB 1EO8L 4P5TB 2QPEB 4FULA 1KJ3H 1S9VB 3HUJE 1CVSC 1KB9J 5C08D 4AG4L 1QVOA 2AAAA 1P4BH 1UD5A 2DQFB 4FFYA 5DFAA 4WSKA 1URLA 3O3DB 3RZWA 2F54D 4Z0XB 3QBTB 2MHAB 4R4FL 5J89A 3QDJD 4NUJB 5EN3A 2DWYA 5DO2C 3MA9L 5JW5B 1W72H 2VDLB 4NRXB 1DJXA 2P8MB 4DPCX 1HINL 4Z7WB 3MAWA 4HCRL 1QRNA 4J2XA 3QIUC 3QZBA 1B88A 1EGJL 2XRAH 3QA3B 3WS3B 3DSFH 1U3HC 3H9YA 3QHFL 3NJVA 2Z31A 4Z7VB 5I1EH 2QPDB 1MXDA 2EEBA 4LLVB 2XU9A 1MCJA 2V9TA 3B2XA 4TN9A 3BN9D 3LNDA 2FT8A 3UTTD 3KLHC 2J12B 3ILPB 2K9FB 4LLQA 2BOCB 5J6HB 3FPXA 4MJ2A 5CNHA 4EKJA 1YEFH 1BQRA 4Y2DA 3T1WA 1DJZA 4TNWK 2Q76B 5GXBB 3QIBB 1T1XB 4PB0H 3QGVA 5LQBL 2BWDA 3ENEA 4GPVA 4NQTA 5T3XL 3MJ8B 2JJTA 2X4UA 2IDFA 3L3DA 3VVVA 3SE8H 5SWSD 1JZEA 2JKTM 2APWA 1J86A 1ZEAL 2EDDA 4EIGB 2BVQB 3KWTA 5F1OB 5CD5C 5D70H 3TCXA 4U3CA 1Z9SB 2H9GA 4U0RC 1LILA 1EPFA 2VM9A 3FQTB 1ACCA 3NSJA 1HWHB 2MCG1 4DSYA 3U1PA 4XPAH 4G2AA 1H3WM 3I50H 2IPKA 5KS9E 2YN3A 3MRDA 1DBJL 3ARFD 3AMKA 3T6VA 2B4CL 4XPGL 1MREH 3GSOB 3C12A 6PCYA 3L3KB 1U91B 1U8QA 3PL6B 1WQVT 4U4IA 3FO9A 3RLSA 3QO1A 1K5WA 3CFUA 3P0VL 3CLEH 5I1GH 4DUWA 1ET7A 5C0DB 2AEWA 3GSNL 3NDZE 4MCNA 1CTMA 5BUAA 4L8CB 4TVPH 3IFLL 4C56D 1JZFA 3VXNB 4EIUA 2ICEB 1ERNA 3WTXA 1O9VA 2YMTA 4XXDB 4H4NA 1O7SA 1HOCA 4KX9A 4DFIA 1W8EA 3IJ7A 1CDIA 3FT4A 3Q2VA 3HUJA 4HHGA 4I3SL 3GXNA 4BQ8A 2K3TA 1BECA 1JNLH 1JZ7A 2CDEA 2JK5B 5ECGA 3RJOA 5CHNB 2AEPL 3WXVL 1QG3A 4HIHB 4UDTA 3VQMA 5C0AD 1S7VB 3PJSA 4K2UH 2OJEB 1MUJB 2Q7NA 4YBLC 3NFPB 4OZFB 4AIZA 1HL4A 3ZYIA 1PG7L 4L8DB 5JHDD 3MXWL 4D0CA 5DUBB 5KANI 2C1OB 2H5UA 1FE8H 4XO9A 4FQIH 1UCTA 2WXPA 4P2OB 1P4UA 4G42A 5TQ0H 3QG6B 4HWBA 1GR7A 3GJFH 3TL5A 5MERB 1EEYB 1TTBA 2HKHL 4OZGA 4FI7A 2DQJH 2B1HL 1OB0A 3BGFC 3JWNH 2ADYA 3T2QA 1JHTA 3S96B 2ZONA 4IIQB 2IFGA 4U1IB 5FEBA 1OTTD 3TWCH 3ZGIA 2AK4A 2CG9X 3HZVB 1VADA 2RCSH 4JFFD 1INQB 2HLFC 5L4FA 5DVNA 3DHPA 5DZ9A 2H0EA 1J9TA 1WWCA 4UQDA 2A83A 5HGDA 4N2HA 1OANA 1MW3A 5E6ID 3LN4B 5D7KD 5F71A 4PJEE 3N9GH 5BV7L 1QEWB 3DPBB 1FLRL 4KK8C 1BAGA 2FBOJ 2VITB 5I8CB 1XCWA 2QKIA 3DNKA 2HYMA 3HPLA 2X38A 5DJ8A 3G6JA 1C5DA 3MACL 4UZSA 1NGPH 4KQ4H 4ES8A 2YWZA 4WGVB 5I1KL 2G5BA 2XFXA 1OCWH 1L9QA 1MSPA 4HD9A 2J4WH 3RWFA 5IF0B 1T0NA 1L5GB 4WTZA 5KS9A 2GK2A 3GBLA 5K93A 4J4PA 1X5FA 1UD6A 3S48A 4N4YB 3WSQH 3KBFA 3QYMA 4UTAA 1ADWA 5IHHA 3ZKMC 3SDDB 1DN2A 2M26A 2PYEE 2OX5B 2NDFA 3WEXB 5JPNB 2H3NA 1T5KA 3EO0B 4B3EA 1RJLA 2FL5A 1CE6B 3BT0A 3V95A 2Y7QB 1Y18A 5HGGS 4NZUH 5E1AA 2F6AA 4P3DB 3SGJA 3W2DL 3U4BL 4PWIA 1HCVA 4RGND 1RZKL 1H6EA 4IQHA 4TTDC 3MRHB 1P2CA 4WO4B 3UROR 1V7MH 2BNQD 3U82B 3L54A 4BA0A 1E50A 2ADIB 4ONHB 5D8JL 1JPGA 5IMMB 3Q8AA 5D6CA 3K3QA 1A8ZA 1RCYA 2WLYA 1GRWA 1U6AL 3FO1A 4TUOA 4Z9KB 2Z6FA 4YIQB 1O7DE 4APQA 1CWVA 3GXIA 1YDPB 1Q9WB 2DI7A 3CSYB 2VM3A 1A0QH 1ECZA 1NBVL 4R5TA 3FB7B 3FUKA 3NSXA 4FG0A 4LSVH 1PU0A 1NAKL 5DD0H 2WZPD 4EEEA 4EJ1C 4M61B 2FCBA 3V9EA 3FOLA 1U8LA 5HI3D 4DHLA 4NKOB 3BFQG 1LM8V 3MRPB 5F1NB 3QQ4B 3U46A 3L3JA 3CHXA 2ZXEB 3DUUB 1NCGA 4XP1L 4YDNA 3T0ED 4WFED 4X6EB 3ATEA 1XF4A 4G5ZH 5BOJA 3R7QA 2FWOA 2D7PA 4ZT1A 4PCSA 2J8HA 3L4VA 5MEPB 1GGBL 2B59A 2CRYA 3KPSB 4AYEC 3NMEA 5D1QE 2ITCA 3AG4B 5F9OH 3FB5A 3HE7A 4AQOA 4UQ9A 3QDME 4A2LA 4GP5B 5BZZA 4EO5A 3ROLB 3CFEB 1PG7W 2QGDA 5CJQL 3VWJB 3WY2A 1S3RA 1C5CH 4MXVF 5M95B 1WTGT 4GKSA 4RWYH 4XNQB 4GXUN 3SE9L 1SN2A 2I25N 2UWEF 1L9MA 1BG9A 5JQ6H 3UH8A 4AQEA 1E8YA 1MQKH 4KXAA 1FG9C 3NIDE 4PJBB 1A9EB 4G6JL 1QTYT 4OD1L 5T5NF 5EZOL 2VAJA 3TFKD 3C5ZD 3GUTB 1MLCB 2DM2A 4JNXA 2OSLA 3BH9B 4AZUA 3V6OC 2LW3A 3UIYA 4S1RL 1AGDB 3QRFM 4LBEB 5DMYA 3RGVC 1LK3H 4NLHA 3S35H 1OF2B 4K71B 2B3RA 3DGGB 5INCA 2KMWA 2PYEA 3BW9A 4ZUWB 3ZQXA 2VO8A 3HNSL 2CK0H 4HKZA 5AOZA 5CKGA 1HZKA 3CPUA 5IMLA 1VACA 3DX8B 4JGUA 2MFNA 2DYPD 2HKFH 4X7TA 1MJ8L 4WJ5B 4NSKB 3KCPB 1WO2A 2YAPA 3T08A 1DQLH 2ZCLH 4XX1E 5G5DB 5GZOD 1NCBH 1OGAD 1UWXK 4B9YA 1LVEA 1NKOA 1ZHBB 1PX8A 2V2WB 3NESA 3OAUL 4FG4A 4N8VG 4RWHA 3WFZA 2Y9RT 2DY2A 3QC5X 3GBEA 3TJPA 3UZQA 3RPBA 4L8BA 1DANU 3VM5A 1YEHH 4HUWA 4YC2B 4IMLB 4QRQB 4G8EA 4ZTPH 4LPWA 5AENA 3QZWA 3TT1H 2YMOA 3B5HA 2AMGA 1UB6A 4W9FC 3D09A 4LSQH 4WK0B 5IT2L 4F33B 1XZ0B 3UTZA 5ABDE 3IMTA 5JW3H 5F0LB 4P07A 3VXRB 3ARGB 1SOXA 1T04A 3QORA 4XP6H 4PRDA 2P5WD 2AJVL 2J25A 3VXPA 3TJEL 1KY7A 3Q6FA 4XNUL 3D12B 3SE4C 2ADFH 5DVPA 2G3NA 3K2UH 5EBWA 1NIAA 2MNWA 2NQDA 3RGHA 4H8WC 3RP1A 2Y5TB 3LH8A 1P1ZA 3WENA 4CU8A 2GJ6B 4XNZB 5EBLB 2WJ7A 1CFNA 2WBJC 3BPOB 2YFOA 3NCEB 5AB9A 1UZ6F 4M3KB 3GHPA 3QDMA 5C97A 2XZQH 2O1AA 3D85A 2X4OB 1PIGA 5CIPH 2X4TA 4NNYA 2F1AA 3FHQA 5JYLA 2E7LA 1AS7A 1XGPB 1UXWA 1QLFB 3V0VA 1DSFL 3TJHD 2NNRA 2HG5A 2CHDA 5E8PA 4RNRA 3KYKL 2FWSA 1AO7E 4BDVB 5E5UB