2Y2TA

E. coli csgc in reduced form
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
SSQITFNTTQQGDMYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEKTLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQWPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords CURLI PRODUCTION PROTEIN CSGC
publication title Atomic Resolution Insights Into Curli Fiber Biogenesis.
pubmed doi rcsb
source organism Escherichia coli o157\:h7 str. ec4115
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2420 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y2tA00
2XSKA 2N59A 2Y2TA 2Y2YA
chains in the Genus database with same CATH superfamily
2Z0UA 3SPIA 2YAOA 2ATPA 2IAMD 4UQ2A 4Z7NB 4JQIH 4OB5L 4JHAL 4PJBB 5GSVA 3G6DH 2OSWA 4DGIL 4RX4D 3SHSA 5DLLA 4PTTB 2HT4D 1AOHA 3Q6FB 5HHMB 1E3FA 2OQJB 3SGEH 3DSFH 4MA7H 3A21A 4UWQB 1EMTH 3C8HA 4NKMA 2FH8A 4NLAA 1SUHA 1HXMA 3DSNA 4ICXA 2OR7A 4ADIA 1ZT4B 2KH2B 3QDGB 1S7WA 1ZMYA 4FQIH 3N1PC 5LBSA 4EF3A 4L1TA 5C3LD 5KTEL 4YXKL 3GIVA 4F7MB 4LSVH 4GIAA 3PWPB 3HKFA 4OCNC 5HXMA 3UTQB 1RH8A 3ZRFC 3LN4B 1CB4A 2DM4A 2HA1A 3EOBB 1JZ3A 2CO4A 3JBG7 3VFRB 1NCWL 3QSKB 4G11A 4RVBA 1FC2D 1N12A 4JL2A 1LVEA 5JIMA 1U8QB 4MDIA 3NJVA 2R1YB 1QP1A 2GITA 4P9ML 3RAJH 1A4KA 2Y9RT 4P23D 2ZCKL 4XXDB 5TQ0L 2GJ6E 4D0DB 2D0FA 1YQVL 4IOSA 2Q7YA 3GLEA 4OB5H 4JHAH 4DGIH 2J20A 1OLZA 4GRLD 4RFEB 3RU8L 4RDQF 1ND0B 1JV5A 4WDIB 4FQHB 3EDJA 2BNRB 1P0SE 2PPEA 2J6EA 5LBVA 4ZO7A 1TT6A 1TEYA 3RX7A 2R15A 5FF6B 3TN0D 4XHQA 2XQYA 4HDIA 5EO0A 3QWOB 3MRHB 2HP4A 3SDAB 4UV7L 3T6XA 1DJSA 1E8YA 2DWDA 3OL2A 4O00A 5GGVL 3CZNA 3P30L 2D3LA 4QYOA 1G94A 5KTEH 4YXKH 2EIMB 2AK4B 3HCVA 4LOVA 4B60A 4I7ZC 3L1GA 1EX0A 3VD3A 3G04B 1T7XA 5AZ2L 3VW3L 4JAMB 1KCKA 3TBSA 3V0HA 3EGDB 4EI5B 1NCWH 1B4RA 2VLME 5J11C 3VX0A 1K5NA 3NJKA 3P73B 3WEXA 4X4YB 2QL1A 2W94A 5F1SA 1T1ZA 2ICES 1T2XA 4P9MH 3WDIA 2IANB 1ODUA 3GTTA 4ELDA 1E5CA 1MCQA 2ZCKH 1MCRA 5TQ0H 1ZS8B 1X6NA 1PBYA 3U2IA 1MCIA 3QJUB 2XVKA 1YQVH 4OZ4A 1A3QA 2H3KA 3RU8H 2OXGB 4FQJL 3I75B 2IDCA 2GJ6A 4N2BA 2V9UA 2X4OB 1BEYL 1OW0C 4L8BB 1TEFA 2XA8L 4PLJD 3TF7C 1FNEB 5D93B 3MV8B 1LD9B 1MUJA 2GFBA 4UV7H 1C8QA 1FVDA 2PNDA 3KPMA 3QUMB 4J1UA 5IQLA 2W8CA 5CILL 5GGVH 1J8HE 4M6AA 3P30H 4JFFD 4OFPA 3IJEB 2IH3B 2ALWA 4MSWB 1YLBB 2D31A 2MIZA 4M5YL 3TO4B 2DQFB 3O4LE 5HI3C 1O7VA 3ESNA 3U2JA 1DJIA 1A66A 5AZ2H 1YPZF 4JRLA 3VW3H 4F8QA 3F12A 1GZHA 4FG0A 1HH6B 1UC6A 3PREA 4WNQA 3SGEI 3CFJA 1IEAB 4IKKA 1NCOA 1AACA 1D7CA 2JJSA 4OVUA 4S1QL 4QOKD 3CCHB 5D55A 3NSFA 2FSEA 4X6DF 4W6YB 1IBDA 1MJ7L 1CS6A 1SGKA 2Z92B 3E6HA 3HI1A 2W0FB 5KWYC 4U1HA 1CXIA 2AABL 3P4OB 4NNYA 3F7QA 4XN1A 4S0TD 4Q9QH 4RRPM 3C60B 2WQAA 2J8UA 4FQJH 3UC2A 1P6AB 3ESVF 2P24B 2WIIA 2WQXA 4CVWA 2OCFD 1BEYH 2Z8WC 1G5GA 4G82A 3BQVA 5IESL 1MFMA 2XA8H 4BFOA 5I66B 5IHHA 1LE9B 4GAYA 5MI0B 4JN1L 1KEGL 4AKQA 3HG1B 3HHRB 1E7VA 2EDYA 1VACB 2EICA 2WKLA 3QUKB 5CILH 1U8JB 5I6XB 5DDHA 2Z0BA 1EFXB 3I50L 3L45A 4YC2C 1WSST 4M5YH 4XMLL 3A0OA 3OXSB 2C9RA 4LXFA 5GGVY 4L5FE 4ZFGL 3U4AA 5JMRA 1JK8B 1RZIB 3KR3L 3WIIL 3F6LA 1J8HA 1CGXA 4HUXA 2WNWA 2LFGA 1YUKB 5D1QC 3RPIA 4GXFA 3CLWA 3D48R 2N56A 4FKKA 3W5MA 4S1QH 2ZXGA 2A9AA 3UDWA 2EDJA 1T4KA 1FNLA 2YGQA 1E4HA 3IEAA 4JHWL 4ZS6C 1MJ7H 3IDYC 2WYTA 3W38A 3FHAA 1IT9L 3B7SA 3KYMB 3W11C 2AABH 4FQXB 2EKSB 3MA9L 2XJKA 3D0LB 2G0KA 4I1PA 5CIPB 4J28A 3DBXA 2O5ZL 3HI5L 2WPGA 4UOW0 5IT2L 3WTSA 1KNOA 2YGVA 2EH8L 3BZFB 5MEPA 2EACA 3HEIB 3FTUA 5D7JB 3AQYA 4HGWA 5IESH 4IYKA 3HE6A 1ZDSA 2C7FA 2JKSA 1AYOA 4WW2A 1EXGA 4QO1A 3PAYA 3T1WA 4J39A 1KEGH 4JN1H 4V1DD 2HRPL 3MV9B 1UCTA 1TCRA 3C9NA 3I50H 4WFED 3EJRA 4XMLH 4NKDA 2J56A 5G4NA 1MLBB 1SN2A 2KLSA 1GW6A 3WO3B 2W59A 4B9PA 4ZFGH 3FCTA 2EDDA 3S88L 3KR3H 3WIIH 1ULVA 5BV7B 2E6JA 2PTVA 3ZTCC 4P99A 5C6TL 1GC1C 3CH8A 4IKJA 3IDMA 4HJ0C 3VXPB 1GYVA 4S0SD 3VXTA 5CJXC 2YAEA 2NQCA 4MD5B 1ZCRA 1BCIA 2UXTA 3MLRL 4JHWH 1BG1A 1TVHB 2VLLB 2DWEB 3HUJA 1I85C 1IT9H 5JXAL 5KVEE 3UIYA 4ORZC 1MHHA 5CD3B 3MA9H 1J0IA 2MQ3A 3ZLQC 3TA3A 2O5ZH 2SEBB 3HI5H 5F7DB 5IT2H 1BXVA 2GIYA 4G42A 4N2GA 5LNGA 1CYGA 2EH8H 3NN8A 4G1MB 5AUMA 1FE8L 3HZVA 4J3BA 3K0YA 3AADB 2YWZA 2G75A 4RIRA 1J9QA 4NI3A 4KKZA 1TPXC 3KL3A 2HRPH 4XI5D 5KBPA 2IH8A 3BKYL 2JKIS 4F9LC 2HJLB 2H6PB 5DHMC 1MFNA 5EBMB 1OD7A 5GGTL 4PJ8B 1AO7E 1A7OL 2Z4QB 4AXWB 3TEXA 5M7QA 3S88H 3WNMA 1JERA 4MJIB 1XF2A 4AQEB 3B3IB 4F15C 1TYRA 1GKEA 8CGTA 2J88L 2CLVA 4YDJB 1Z5LA 3BMWA 4GJTB 1PZDA 5C6TH 2E8ZA 2VN3A 2NLJB 5ELIA 4AYSA 1A6PA 3L6FA 1DYZA 2VZUA 2JF1A 4MNQA 3SE4C 4K71C 4FMKA 4BCZA 4PN6A 1JJUA 3BKCL 3MLRH 4XCYB 3IMWA 4N20A 4NRYB 2APXA 1WG3A 5JXAH 5EN2A 1CPUA 4F37F 4EUPB 2XVBA 5DJXA 3T77B 1SJEB 1Y0LB 5IGXL 4P2QB 5IVZA 4XO9A 5LKNA 5D7LE 4IBUA 2X1WL 4HWUA 1OP3H 1S7XA 3QQ3B 3WG7B 3HE7C 3MX0A 4UNIA 2EDFA 2AXFB 2VMFA 1M6OB 2X6UA 3LX9A 3FU8A 3LZNA 1F0LA 2VL5B 1FE8H 4RFOL 1EZUA 1GOGA 2CR3A 2WXQA 2GUYA 1NANH 3VXUB 3V4VL 4G83A 3PWUA 3VYNA 4OFKA 3RNKB 4BCXA 1EWHA 4N2IA 4NQSB 3BQUC 4LCWA 5ABDE 3UBFA 4DN3L 3REWB 1U8HA 2FBJL 2HVKA 3BKYH 3BVNB 4HGKC 4KKAD 3D2TA 5SWZD 2VJ8A 5GGTH 1SVCP 4ZUWA 3DETD 1I1FB 1D3CA 2R56L 1A7OH 1IC1A 3D2UA 4P0DA 4WI3A 5CP3H 3TNNA 4QRRA 4Y8DC 5GXBB 5SWQA 4B9CA 1FVEB 3MO1B 2YPKA 1AZBA 1BIIA 1IGYA 1NPNA 2J88H 3IDUA 2VC2B 4L05A 1AO7A 1OGAD 2XG5B 3C5ZC 5AL0A 3UGXA 1JTOA 4L8DB 4ZPTB 4YSRA 4Q9RL 1JPGA 2BVUA 4U1GB 5JIPA 1N59A 3O2WL 1KACB 5GGSA 4W9KC 1JBJA 4I0PD 3BKCH 2HXAA 2KS0A 2EKJA 4YZFE 4ZO8A 1MFEL 1X4XA 4E5XA 5CO1A 3RWCB 5J5EA 4GYBA 1OF0A 5IGXH 4HXBL 2HJKA 4G72B 3ESMA 4XXWA 4RCAA 4PWFA 1PSKL 5H8DA 3V5HB 2BMKA 1M7IB 3KPPB 4JG1L 1MI5E 4R0LB 2BIHA 4EE2A 4RFOH 1QFWI 2KDYA 1CE6A 3V4VH 4JDZB 5HD8D 1WDAA 4ATWA 5DZPA 3JV6B 5CEXA 2X0UA 4NI6A 4PTUB 2R2HA 4YE0A 1T5WA 4DN3H 1JXGA 4N2CA 2GI7A 2FBJH 4JJ5B 3HG5A 5EF3A 3V0EA 4HIJB 4ZMXA 4N2AA 5HDBB 2D8KA 3CZLA 3NCWA 2DRUA 1CD8A 4RA3A 3ZYZA 2R56H 4AJVA 2FIKA 4P4KD 1CVRA 2B4CL 4BSWA 1V3MA 3L2NA 3FQNA 4H0GA 2HRGA 2R1XB 4JZJB 3RY6A 4JFDB 5DMJB 4OZHE 2VKXA 1ET8A 3SDXA 4RAUB 3ULUE 1XGUB 4LNRA 2A6JA 4Q9RH 35C8L 1NMAL 3O2WH 4URTB 3RTLA 1T1XA 4I3SL 3PY9A 4LPVA 3UL4A 1JRHI 4O9HL 3CH1B 1ASQA 1MFEH 4A6YA 2OJEB 5GJTL 1WLHA 3ZE0B 4HXBH 3JV5A 2HFEB 3TJHD 4EZLA 2CDFA 1PSKH 2CO2A 2GSGA 4H5SA 2EO1A 2J6WA 1XWVA 5IMLB 2J1KA 2AS5M 2F7IA 4HK3J 4JG1H 2D7PA 5D8JL 1BQRA 2LTQC 2NQDA 2Q8BL 1DANU 3DX1A 3RWFB 2VLRD 4LL9A 5T1MB 3EJPA 2YUXA 1SBBA 5DZJA 3VH8A 3VFMA 4NIYE 4IK6A 1KDIA 2NNAB 3G5VA 3NFNB 1FZJB 1MI5A 4U7KA 4WHTB 3OZLA 4IGBC 2ZXEB 1SDYA 2ICCA 4F91B 2DTML 4KX8A 1BBJA 3JT0A 1L0PA 2LE9A 4RZKA 4BV1A 3EBAA 4UT6A 2I9LA 2B4CH 2XY1A 5DVOA 2ZNWA 2Y1ZA 5LAXA 5DMGD 4NT6A 1NANI 2X9ZA 3AXIA 2GCYA 4BUGA 4Z3IA 3BXNA 3ZDZB 3QDGA 2WXLA 5FO8A 2QQLL 35C8H 1NMAH 4KC3B 2ENPA 4I3SH 3S5LG 4H4NA 4TM9A 2YUWA 1AP2B 5F7HA 1OTUD 3T9WA 1W0YT 4O9HH 3VD7A 4ZMZA 4BRVA 2AANA 2EE3A 3LB6D 4X8JA 2I9TB 2VLJD 5GJTH 1AQHA 3DUSA 2VDOB 2EE0A 5KSAB 4B0MB 2JKJA 1QSFE 2ESVD 2VWEE 5D8JH 3VG0L 4WTZG 1T7VA 2Q8BH 3FPYA 5FGSA 3PPSA 1I8UA 4N0YL 2X4QA 5BRPA 4JRXE 2RQEA 4MJ6B 5ANMA 5TDNA 3QNYA 3VXMB 1HQ4A 1BFVL 3QEGL 4QHNA 2CGZA 2E0PA 3TZVD 4CVUA 1VAHA 3TC9A 3UPRA 4PRPE 4MQSB 1ND0A 4G8IB 5KYUB 3ZZQA 1BBDL 1A4AA 2DTMH 5SV4A 1FFNA 2Z3FA 3EBHA 4NO5B 2C3HA 2GTZA 2PETA 3KW8A 1A6ZA 2ITCA 3ME0B 3PL6D 5JW5A 1KTDB 1IAIL 3SDAA 5IQ9A 4ODUB 2FLRT 2NW3B 5DD0L 2QQLH 1WFJA 2WXNA 5EH1A 3VXSD 3GYRA 2ZXWB 1HWGB 3G04A 4LCYA 3QJZA 3I2CL 4JCMA 1AGCB 4DAGH 2QADC 4I89A 5C0CE 4TSCL 2D9QB 3O6FA 3HC3L 3PAVA 4WFHD 2PCFA 2NXZB 3E0GA 5FFOA 1BMZA 4MQTB 4ZFOL 3VG0H 3HZYB 4JREC 4ESKA 2XG4A 2M1KA 1NDGA 2IANA 4N0YH 3WJLA 3LQAL 2WXGA 2MNJB 5KYYB 2VO8A 4YJZL 3RDTD 2UX6A 3U82B 2BZ7A 1BFVH 1CXFA 2Z7ZA 4WKZB 3QEGH 5HI5C 1CDIA 3QBTB 4ECNA 5I71C 4A7VA 5AL8A 2OXGA 1YMME 3KPRD 1B4TA 5A2IH 2P48B 1GZPB 1BBDH 3UJTL 4YHPB 5C0BD 4OFQA 4PJCA 2BH0A 1SHMA 1OCWL 4Y4HA 4Z76B 5FDWA 1R3HA 4HEMA 3KGTA 4PRPA 2ODIA 4JFZL 4FTVE 3DOIA 3HNVL 4KUCD 4PGDB 2A0LD 3FHQA 1IAIH 3EUUA 5E99L 4GIPD 3S3CB 1DUYA 4Z3TA 2DM3A 1HHGB 2XN9D 3ZL2A 1H0DA 3FT2A 3GXNA 5DD0H 1X5HA 1DQKA 2ARJB 3MA7A 2P8LA 5CUSL 4O2EA 1J7VR 1PW3A 3O81A 5K39B 3I2CH 3T71A 5EF1A 2ENSA 2QPSA 3TFBA 3RJOA 2D2OA 1QO3A 3EYSL 1D7BA 4RRPG 4TSCH 3HC3H 5ILTL 5IOKA 4R96B 1OGTB 4MCYA 3D85D 4PVLA 1PYWA 3NESA 2V8MA 1O0VA 3VGAB 1XTLA 4NKOB 3RDJA 3EDDA 1CL7L 1I82A 4HOMA 2YA0A 2DYPA 3LQAH 5AALA 5BOZG 4Z7WB 1SXCA 3KLAA 4NJ9L 4NN6C 2QMKA 3PPEA 3CC1A 3I6SA 3QZPA 4WY7L 4ZMOA 4RWYL 1P5UA 2NY0B 4XPBL 3KBFA 4AZUA 4K5NA 2GEEA 3UJTH 2X4UA 1DFBL 5D1ZD 3H9SD 2F54A 1V8HA 2BRQA 3Q01A 4KTEL 4PBVC 1OCWH 2RA1A 2APSA 3LRSA 3GGWA 5FW8A 4LLDA 4YSEA 4JFZH 3VDBA 1YMMA 3HNVH 5E99H 3I9AA 3CN1A 2CA4A 2OZ4L 4X99B 4BBWA 3RWGB 3GMLA 3S4SB 1KJVB 2B1OA 2YUVA 2CHWA 4K7FA 3FRPA 3UTTE 4AV0A 4M7ZC 5CUSH 1AMYA 1FL5A 2AZAA 3N50A 5BW7A 2QELA 2HTKC 1BMWA 1Z32X 3I3EA 4NQCD 3EYSH 1OM3L 3F7YA 4Q4IA 5ILTH 1NDMA 2XZCL 5L9DH 1XB8A 1H5BB 4MWFB 3UYPA 4AIZA 5JXEA 1KIQA 4WNJA 4XWGL 4H8WL 1OCZB 2WLJA 2VR4A 1KBKA 2GYSA 2XYCA 3CDCA 1I1YA 4BE6A 1EDYA 2EIZA 1CL7H 4TNVK 3NBNA 4Q58C 2C9SA 5C9JA 2ADGB 1QBAA 4NJ9H 1AI1L 2ZX6A 4FQXA 1LE5B 3LPPA 5B8CC 1R5WB 3MCYA 3VFGL 3WN6A 1QNZL 1SOSA 4WY7H 2UY6B 4M5ZL 3KMDA 3UOAB 2WUCL 2JCCE 1QSEB 2A4CA 4DZBB 2RTTA 1M71B 4RWYH 1LMKA 3QUZD 4XPBH 1DFBH 1FG9C 1B2WL 1LXMA 1S9KC 4UYPA 1UXSA 2Q6WA 4PGEA 4KTEH 4ZG1A 2VDMB 4KO6A 2CO7A 4WQOA 4TS6A 4JBSA 5E6UB 3L9BA 3QDMB 3RWEA 4RMQA 3KL0A 1X5JA 4P3DB 2OZ4H 3MV9A 3T3PB 3DV4B 4Y4KD 3IPBA 3W3BA 4M7KL 2BNUB 1PZCA 1N3NA 4W9ZA 3S9DB 4GY4A 4W9HC 1ACCA 2X40A 3NEEA 2XFXA 4AJYV 5FM8A 3LZQA 1BOGB 2GW5A 4FFVC 2ERJB 3ENEA 3QJRB 1IFHL 4FI6A 4HEPA 1OM3H 2UVEA 2XZCH 3FFCA 4HKZA 4OZFH 4NZ8A 2LT9A 3TZVB 1CMOA 4XWGH 4H8WH 4GBXA 2UY7A 4RX4A 1YG9A 1OSYA 4HZLB 1K72A 3GZOA 1OGSA 3TL5A 3MJ8B 2O93L 2OJ1A 1AI1H 1T6WA 4GW1A 3VFGH 1QNZH 2P7TB 2XIDA 4Q6YA 4XMUA 4M5ZH 4PIBA 1IJ9A 2WUCH 1NCCL 5I75C 3B37A 3OKDA 5CCKL 4AKOA 5G4OA 1AQDB 2D73A 5B1CA 2BIIA 1A9EA 3FT4A 1B2WH 1Q94B 3C6LD 2B0SL 5I16A 3L4XA 5JLZB 1IIIA 3LDBC 3RVXC 5F0JB 3V5KB 3TJEL 5HPMB 4DEPC 5MEOA 5CEYB 4CA4A 5L2KD 2WN3A 4BD4A 2P8MA 4JHVA 2HJLA 5KOMC 4M7KH 1E90A 1E2WA 2B59A 4LLYA 4GW4A 3U7WL 3P3RA 2BIMA 2BP0B 4XC3L 4YHKL 2HT3D 5DRWB 3E80A 4HK0A 3WTWA 5HYJD 2EABA 2G2PA 5ERWB 4J3SA 4J12A 1RIVL 1KCUL 2NXYC 4MJIA 1UJ3C 3HBQA 4K73A 1IFHH 3ROLB 4LVOC 4EVNB 5JHMA 2NY2D 1A6TA 4UDTB 4BKLB 1MCLA 4Q74A 5E00A 3QIBC 1FNGB 5FKAA 3U46B 3AWEA 3C8DA 4F57L 4G8GB 1V3LA 4YDLB 4GRLA 3ELAT 4PLNC 3QCUL 2DEXX 2ZICA 3VXNA 4FEMA 3TGXA 3SDDB 2CZNA 1T89A 5G4MA 3GSXA 2WLLB 4N2EA 1SLVA 3VAEA 3WS6A 1JGEB 3BP4B 4PJXF 4P2QA 4JFFE 6PAZA 1A3ZA 3O9WD 3TN0A 4Q6KA 3FU9A 1NCCH 1EVTC 1UOKA 5CCKH 4TN9A 3INOA 3MLZH 2BPBA 2VZ3A 3J7HA 3FBQA 4BFEA 1TFPA 4J7RA 2B0SH 2RFXB 5EUOE 5I1CL 2XTJB 4HLZH 3STZB 1KXHA 3LAFA 5ACZA 2H2PC 1TQWA 2CRMA 3E8UL 1XSOA 5E2JA 3TJEH 3VD2A 5E6YA 3BEVA 4X83A 2YD6A 4QOKE 2OXHA 1L3WA 4UZUA 4YHLL 4A2LA 4XPHL 3VDCA 4XMWA 3K6SB 2DW5A 3U7WH 3WUWG 3L7FB 4MNGB 4WWNA 1I1FA 1YYCA 4M03A 2FLBT 4XC3H 4YHKH 5LNEA 4BSVA 1UXWA 3K71A 1RIVH 1KCUH 4XVUC 2K9FB 2CMRL 3MO1A 4U6TA 3VI4E 1DVXA 3MCG1 5FIEA 3PF2A 4FN0A 3WE6A 3MLTB 5JOPE 2IADB 2WQWA 1P7HL 2C7UA 4F57H 3EYQC 3QIWA 4JFPA 3O2DL 3QCUH 1P1ZB 2G9HB 5IB5A 4HD9A 5LJYH 4WUKL 2FLMA 1NFIB 4C83B 5FO9B 1HQRB 3MV01 1DJYA 1AR1C 2JKNA 3BVUA 1XGTA 4H44C 1RUAL 5DI8B 5GZOD 2MQCA 4ZBJA 3S5LB 3M17B 3KEDA 1JZGA 3QA3B 3D12B 2TSBA 3MNMA 3CIQA 5I1CH 4MAYB 4JFFA 3CPUA 2A4ZA 2Y7SA 3MLUL 3NJNA 3VFNB 1CDUA 4OCXL 1HCVA 1YNTF 1ZVHA 3E8UH 3RNQA 4Z0XB 1Q9WA 5I6OA 2O6CA 4D0CA 4YHLH 4JJ5A 3QHZL 4HIJA 2HJFA 1U58B 4ONHA 4XPHH 3HG0A 5CP7A 5GS0L 2YAQA 4NQXA 1MLCB 4HIEB 4TVUA 1IILE 1WCQA 4RGNB 1CFNA 3NZ8A 4QOKA 1LWJA 5IWLA 4PQXA 2YA2A 1F58L 2CMRH 3FB6B 4DOHB 2ED6A 3EO0B 1KCLA 1QATA 2CR0A 2C3GA 4K8RL 2H26B 1R3LB 3P9WB 2PF6A 1K4DB 4LFHD 3QARA 2R23A 1A4CA 4EMZA 3KPSA 3O2DH 3WEAA 2YD8A 4QT5A 1TU2A 4V1DE 4DKEL 1KCSL 5DJZA 4BK5A 4G9FB 4WUKH 3ZHLA 4CRPA 2VDNB 3SO3B 3FU6A 3PV7A 3CD4A 1MPAL 1QR4A 5H4ZA 4Y5VC 4JZOB 4MZ3A 4JY6B 3SEPA 3O3AB 4WFEE 4ZD3L 4ZX6A 2XT1B 3DO7B 1RUAH 1BP3B 3MRDB 1QKZL 4F7PB 1K8IA 2AQTA 4GB9A 5EEZA 2MFNA 2CRYA 1IE5A 3MLUH 3MVSA 3L2MA 4OCXH 1QLEB 1KYFA 3KVQA 4PJIB 4ZMWA 4AEEA 4N85A 4RFNC 4YSSA 1B0WA 5TF1L 3MNVA 1FZJA 3UACA 1EO5A 1OZUA 3QHZH 2PO6B 4HWBL 4P5SA 5HVFB 3DOSA 2JIXA 5GS0H 3ZE2E 4GP4B 4K8RD 1F3JB 4JY5L 3QQ4A 3VX1A 1J05A 1F90L 1F58H 4M4PA 5JQHC 3N1MC 3HIZA 4K8RH 4K3GA 5KW9L 1D5ZA 4PJXE 1XD1A 3PWJB 4IRZL 1MAKA 4LLVA 1ETB1 2ZQKA 5DUBB 3GHBL 3SY6A 4NJAL 4DKEH 2H9GA 1UB5B 1FL6B 1KCSH 5K69A 1NPJA 1Q8MA 5IK3B 2R4SL 3X1NA 1MAML 5JHAA 3VD5A 4NCC2 1MPAH 2BX5A 2DLFL 1QACA 5DK0B 4ZD3H 3LIZL 3P0GB 1RZGA 1OPOA 1WF5A 2ZF9A 2DN7A 3G3LA 3GXUB 4ILDA 5HY9B 1QKZH 3O3EA 3V0JA 1BDYA 2N7SA 1UB6B 4CVZA 1B9KA 1KV7A 2EDQA 1KJ2B 5C0EB 2OW6A 4MJ6A 1AGBA 4GSXA 4YLQT 5FOBB 3MRGB 1JGIA 5CD5C 1UXLA 5TF1H 1CIDA 2P4AB 1JZ2A 5EU6B 3V0DA 4Y9CA 2EVIA 1TO5A 1JCVA 2OTUB 4G8IA 4HWBH 5KYUA 4HC1L 4X4ME 3HE6C 4H2CA 4OKVA 4JY5H 4LOUC 3RG1C 3D39A 3D06A 4M5SA 1OCRB 2FO8A 1ODAA 1DVQA 1F90H 1HH9A 2WBJB 3OGCA 4R90L 1G7LB 4ZX3A 1F3DJ 2NY7L 5KW9H 2WC7A 4B3VA 5IM7A 1W72A 1RP8A 4IRZH 5EIIA 3GHBH 4PJ7A 2W9DL 3RWDA 3UC0L 5M94B 5EOCJ 4I18A 4NJAH 4ZXBA 5DC0A 2GIMA 2R4SH 3FU5A 4P2RB 3H54A 1MAMH 2K7QA 5D4QA 3Q1EA 2DLFH 4P57A 5SWZE 5JHDB 1G43A 2I24N 3FT3B 2AQSA 4J2QA 5C08A 3LIZH 4L18A 3WU1A 3RWIA 4GUQA 3PWVB 4M93C 4M56A 1I31A 1ZLUK 5F9JA 1AC6A 1NC2D 5FFLA 2K3TA 3BESR 3PHSA 4BELD 1WC7B 2F1AA 1OGAE 3LXBA 1D7FA 4B27A 5F2FA 5DRNA 3BDYL 4WFGD 3L7EB 1LILA 4XNDA 1S7UA 3EYUL 4QCIA 2BVQB 4PG9B 4XN4A 1BD2B 1WA0X 3GSOB 4HC1H 3W39B 2XYBA 2DKUA 1CYXA 2G2RB 4B50A 4APXB 3OXRB 4IOIB 3GSQB 1DUZB 2FO4A 1N0LB 5E8EB 3DRTA 3TO4D 1AHWB 1BVZA 1VADA 2MTAA 4WWKB 1VFBB 4R90H 4TSBL 3OKKB 3EYOA 4GNKB 3OR7A 4EKXA 1MOEA 2NY7H 1T4WA 2MHAB 4G7QB 3MNDA 2DJMA 3K91A 3EJZD 5I9QB 4JFOB 3MMEB 1RIHL 2W9DH 3IKCB 3K1DA 3OX8A 4G6ML 3UC0H 3PNWA 4HKXA 2MPAL 1NAMB 1W0VB 4HQQL 2HLFD 1D5IL 4BFFA 4PBWD 3IYLW 5GGTA 4MLIA 3EUDA 2AV1B 3D3VB 2OJZL 5CP3A 1WQVT 2ITFA 2R7EA 5C9KA 4HKJA 4NKOA 4KOCA 4LL1A 2DTSA 4MB5A 5AB2A 1SEBA 4MX7B 4P5KB 4Z7WA 2CD0A 3VWJB 2OKMA 1BZQK 3I02A 3Q5OA 4NRXB 1JL8A 3BDYH 5JZ7C 1F1DA 1A4BA 1TQBC 3EYUH 4GO9A 2YBRA 5I6PA 1HHKA 2ZIDA 1V54B 2VN6A 1U8MB 1YYML 3DVGB 3HHSB 4IKLA 4NN7B 5I5JA 5KVFL 1YMHA 4KY1L 5FWQA 4E68A 5EU3A 2Z93A 3RWJB 5LHDA 4AVJA 4EQ2A 4XNQB 1IAKB 4YSPA 3TLRA 4I0PA 2OPCA 5GRVK 3QFJE 5KBNC 4TSBH 3HC4L 2NZ1A 4X99A 1D5XA 2BVPB 2VR9A 3ABZA 2VLRE 3IJ8A 5G5DA 3S0PA 4PJGF 3V4VA 2OP4L 3AGWA 3M7FB 3L4UA 2NZIA 2VMEA 4G8FB 4BUHA 3MLYL 5ISZB 4YHIA 1RIHH 2KQNA 4LB8A 4G6MH 2J8UF 3IB4A 1GGBL 2MPAH 5DRZA 4U1IA 1LEKB 3N91A 2X4SB 4HQQH 1JIBA 2ZKHL 3STLA 3L3KA 1CG9A 1D5IH 1QFHA 3BPCA 1SVBA 2GUOB 3HRZB 2I5YL 3CFEB 4IU2B 4PV8B 1MG2C 1UUSA 5I1DA 4J3OC 2OJZH 3QAQA 2DLEA 3EGXB 1BQHA 5LXGL 1KT2A 2VM9A 1G9NL 3GK8L 1MY5A 4MQ7A 3DRQB 4HAFA 4KX7A 5D7JD 3WLWD 4XXWC 2ITDB 3L3GA 1ACYL 1U30A 5DK2B 3SD2A 3BMVA 4X5WA 1B4LA 1MFCL 2XWDA 3AS3A 1UFUA 1L6ZA 5I76A 3U6RB 1H3TA 3DYPA 3G9AB 1YYMH 1ML0A 1M71A 1VEOA 5E6IA 1S9WB 1Z0NA 2AK1L 1NGYB 2AGJL 4KY1H 5KVFH 2HFTA 4G1EB 3JUYA 4UF7C 2VLJE 1N5AB 1ZE3H 2CHNA 4JM2D 4CW1B 1HSAB 1FFOB 1P84J 1QUPA 1AGDB 4CBZA 4DCQB 1MRFL 3CFKB 3NSCA 1F56A 2NUTA 4PP2B 3TASA 4OW6A 4KKLC 2C4FT 2BNQD 3D4ZA 2ESVE 3ZE1F 2R1WB 1JPEA 1RK0B 3L3OA 3L54A 3HC4H 5T5NF 1AMXA 1IIKA 1JVOA 2QKSA 3AU1B 2ADYA 2JB6B 3JWOC 3SQRA 2BNUA 4L29A 3MRRA 4ZUVB 2OP4H 1H3XA 5DMYA 3MLYH 2BSSA 2ADJB 3D05A 3TFKC 3VTTA 5HBBA 3T0EA 3JQOB 4TNGA 1GGBH 3KPTA 1L5GA 1PKQE 1U8KB 3L81A 1VPOL 2CXKA 2F7PA 3KLLA 2ZKHH 3I85A 2ZXAA 1U8LB 2I5YH 2BC4B 1FO0B 2H1LM 3P3YA 4WW2F 5EA0L 3WUWB 5LCVL 4JQXA 4RETB 4LKXA 4Y4FB 5LXGH 1CGYA 3PHOA 3X1GA 3GK8H 1G9NH 5F9OL 3QZMA 3VM7A 4HZLA 3PHQB 3Q2LA 5DJ2A 2XIIA 2DI7A 1XIWC 2Y3AA 4FULA 1MCSA 5HGHB 1ACYH 4QY8A 1XGPA 2BW4A 2VJXA 1MFCH 5CZVL 2JELL 4L1SA 5JIDA 3LRHA 4KRPB 3E38A 1NICA 2AGJH 2AK1H 3F05A 3NCFB 4WGVB 3QAZC 1NFDA 4PJ8D 1MIML 3NSDA 3AU0A 4WFHE 1MRFH 2AHIA 3V5KA 3S8GB 5FK9B 3HVDA 1KBBA 3SDCB 3HUJF 1RJCA 2CUIA 4DO6A 1UTDA 3A47A 3S3PA 3SCMA 3S96B 4H8VA 2VSMB 4PRID 1R24B 1BG9A 4Z7VB 2ESVA 4HYTB 1WTGT 4F27A 3BPLB 3UO1L 4GKSA 1LP9B 1VPOH 1S5IL 2W38A 4JJHA 4XN5A 3WY4A 3CZGA 1KBWA 4CAGA 4XX1G 5I73B 2YRBA 3ATBA 4UQDA 3TWCL 3KWUA 1FFTB 5C0BE 5EA0H 3V0VA 3UJJL 2X89D 4HIHB 3U46A 5LCVH 3V4UL 5F9OH 3L3DB 3QULA 3NCBB 3ULUC 4LIQL 5GPRA 1FNHA 2XN9E 5B4MD 2WVTA 1NCUA 5KN5B 1ZA6B 5CZVH 4CSTA 2JELH 4JPIA 1HILB 3U0PA 5IEHA 4JVPA 3PL6A 3Q05A 4NQDB 4QGTA 4ZW3A 4RDQG 4OFDA 5E4OA 2XX1A 4FTDA 4OFIA 4A67A 5HHNA 1DBKL 1OSZB 3IRCA 3AT0A 2EVGA 2X1QA 3HBGA 4PS3A 3HLKA 2CJSA 3TIDB 1HSBA 1MIMH 4KDVA 3STZA 1G4MA 3VXSA 3GMPA 3VQ2C 5IMMB 3WNIA 4H20L 1KTLA 3TIEB 3S37X 4CJ1A 1UZ6E 1I9IL 4H13C 2EDTA 1YN7A 2MMXA 4U6YB 3QEUB 4PP1C 5FM4A 4N8VG 3UO1H 4D8PA 1FORL 1S5IH 5AWNL 1JAEA 5IJCC 4NRZB 4A38A 5CCGE 3BUBA 2DQEL 4HX1B 1BHGA 3TWCH 4XPFL 1EZVX 3H9SE 1KSRA 3UJJH 3L5JA 2X9XA 1ZSHA 5IIEB 4I13B 4FFYL 4F2ME 1Y18B 3V4UH 2DQDL 3ET9F 1OP4A 3KPRA 3LZRA 4UQ3B 2H32H 4LIQH 3VE0B 3O6FC 4P4RA 1FIGL 5E9DB 5C0BA 2KZBA 5DC9B 1PLAA 3WFEL 2HFFB 4W9GC 3ARGC 2AQ3A 1MSPA 3N43B 3SKNA 3LZLA 3QDJB 1QI3A 3O0RL 5E94B 1TYEB 4XO5A 1BJMA 5C0FB 3WJLC 3AGVA 1DBKH 1JZDC 1JZEA 3AWGA 2VWEC 3VFNA 5DVMA 4YGVA 1A7NL 2LVEA 1JHTA 1THAA 1NBZA 1SJMA 1B6DA 5DRXB 5C07B 1NL0L 4H20H 3ETTA 3TM6A 4OZIB 5HI4D 3UTZA 2WCSA 5KG9A 4OJDH 4JFDD 4OZGE 1I9IH 1L9QA 4QRQA 1RUKL 2EDKA 4Y4HC 2ZWSA 2J43A 3D85A 4RGOL 3GSNL 1QWNA 4XH2A 4AYFA 1A9VA 2YD3A 1CI3M 3CDGB 5DMIL 4MMZB 1FORH 3DPBB 4Y5XB 5AWNH 2R9HC 3EO0A 3VFVA 4XVJL 2DQEH 5JPNB 2HCZX 4XPFH 4Y16A 4GIOA 4HUWB 1WBYB 3AREB 3P02A 5JHLL 2I7SA 2B3IA 4FFYH 2Y4SA 4ZFZB 1QEWA 2JV6A 4EQ3A 3RIKA 2DQDH 4GUCA 4OGAC 2IDSA 4MCZB 4XVOA 2FAUA 1I7ZB 2GAZA 3SBQA 3RFZC 5D1ZA 1FIGH 3H56A 2KI6A 1QSZA 4B97A 3ABKB 1PLGL 3WFEH 3QPQC 3E7JA 3O3AA 4BH8A 4NO0B 4U33A 1NBYA 3VWKD 1JVLA 2AVFA 3IBEA 3NCCB 3O0RH 2UVFA 1TQUA 5FGCB 4KH9A 2UV3A 5AW1B 1CICB 3SDXF 2VM3A 4LSSL 1NEPA 2IPKB 1ID5I 1A7NH 5J12B 1KPUA 1NL0H 3G5YB 4NQEB 3TO2A 3Q44A 4XE0A 1CU4L 1P5UC 4R3SB 5LG1A 4NQCA 3HC2A 5KS9A 1PZAA 1RUKH 4HS3A 4RGOH 3GSNH 4X4ZA 4PJAB 1A14L 4WEUD 3C09B 2B2XL 5DMIH 1NKOA 3ILEA 3N41F 2BS71 4OZGA 1P7QD 3QO0A 1GKOA 2NSQA 3BAKA 4LGRB 3L5WA 2ZOKB 3HZMA 3D5OF 2BSDA 1NM4A 1RZJL 1YN6A 4XVJH 4BFNA 5F1KC 3N44B 2IG2L 1JN6B 1F4AA 1B3IA 2R4RL 3HAEG 4LLQB 5KSAD 2AERT 5JHLH 3MRBB 3TONA 2D7TL 3S2AA 5BW7C 2VUOA 1HKLL 5DUBA 5DJ0B 1G7JA 1EAOA 2BK8A 2GBAA 2WJ7A 2X2JA 4GS7C 1IM9A 5L2KE 4BFGA 4V11A 1VFAB 1U4FA 5JXEC 2FNWA 2CBOA 1PLGH 3DK0A 3RZCA 5KSBA 1QG3A 1DE4A 3WN5B 2V3FA 2YKLL 1IVTA 1W91A 4CN4A 5HYJE 2G3ZA 2XWJA 1ORSB 3OKNA 4KK9D 4J3TA 5F6HJ 1BVKA 4Y4KA 1I7TA 4WFFD 3QC6X 2EEBA 4OZFA 4LSSH 4A7GA 3DX7A 4R4BB 1FGNL 4WWOA 4X6FB 4JFED 2EYTA 1C7SA 4HWEL 4ZMTA 5HHOB 2AEWA 4ONOA 1CU4H 1N6VA 4HALA 5EU6A 5E51A 1P7KB 1SYVA 3INUL 1KIPA 1N6QL 4KBPA 5MEQB 3FQTA 4FLHA 4FA8A 1DBML 3CLEL 4OSUL 3T2OA 3RBGA 3TBVA 1A14H 1ONQB 3D4CA 2B2XH 3T3MB 2P80A 2WBKA 5BRZD 4BJLA 5D7IA 3VJ6A 3T0AA 3ZDYF 1Z3GL 5GZND 2Q10A 2KZ1B 1RZJH 3CQPA 2OL3B 2P5WD 2IG2H 2DLIA 3BFWA 2DKSA 4J8QA 2R4RH 1A7PL 1OT2A 1T66D 1FVCB 1KLGA 2D7TH 2R59A 3AXHA 4M5TA 2Y2TA 1HKLH 5E8OB 5HVHB 1G7MA 4XBMA 4FZ8L 1DZ0A 2E27L 1MJJB 3LXUX 4P2RA 4PRBA 1FIEA 1N4XL 2IWFA 1HXKA 1C5BL 5F3FA 3UJIL 2IAMC 3QI9D 5D4HA 4ZPVA 4RGMC 2YKLH 1A8JH 2CDEA 4OCYL 2HT4C 3APCA 3BAWA 4HISA 2J7LA 5T1KB 1E0OB 3WFHB 1MJUL 5D2NE 1WC7A 2AEPL 3QUYB 4GG6B 1J0HA 4MFHA 2P8PB 3VMOA 4G7VL 4B9GA 3D69B 3FQWB 3GBLA 1FGNH 1LJMA 1PDKB 1WUNT 2ORBL 3G6JB 3U25A 4HWEH 2BVQA 4KKBD 3DMMD 4E9SA 5DUML 1E8WA 3INUH 1N6QH 4ANWA 1XTMA 3DDFA 4KI1A 2OTWA 4QEGA 2X2IA 3OXRA 3FUEA 1DBMH 3CLEH 4OSUH 3O4OC 3BZEB 3GSQA 4XAWL 2IV8A 1OT1A 1N0LA 2NX5D 1QYGL 3G5ZA 4XHJD 1U8CA 1AGEA 2W0KA 5F9AC 5J06A 3NIDE 1Z3GH 2K78A 2WQVA 1CK0L 1J87A 1D9KB 1ZHBA 4APQA 4Q9CA 1JPTL 2IH1B 2TRHA 3PGFL 3RVTD 4BE5A 2NY6B 3IFOA 3CXHJ 1A7PH 2MHAA 2FYYA 2WINA 4PJHA 5JPMB 2QHRL 3O9WA 3IVKA 3VFWB 4MXVF 2YLHA 4FZ8H 1R3IL 1RP9A 2E27H 4Q8BA 2NTFA 3DX9A 1NAMA 4Q89A 1N4XH 3ASNB 4XBEL 5B7EA 1C5BH 1WIUA 3KWWA 4YR6B 3UJIH 1JZ7A 2AV1A 4HCRL 2FEDD 4GEJA 1SJHA 4NOBA 3CFUA 3KDMB 4GRLC 3W9DB 2VZVA 4UU9A 4NXKA 3HNTL 1CO1A 1T89C 1YAZA 3B9VA 4IJTA 4OCYH 2NY0D 3WS6C 1U95A 1MJUH 2AEPH 4NHCL 4IIQB 2EECA 1H6FA 2WXHA 3NA9L 1FV1A 4G7VH 4DEWA 3A4FA 3TN0C 4BZYA 2BY1A 2Y7QB 2ORBH 2WVVA 3N2JA 5C09D 4PJFB 5BS0D 5ESVA 3SKMA 3FUFA 2VRKA 3M7OA 5DUMH 4KMTL 3QWRD 3AG3B 1T5KA 3WNNA 4TVPL 4EAEA 4OR1A 1D5BA 3P2DA 3M07A 4IBSA 1INQB 3QC5X 4LHQB 4XAWH 4XMPL 4FF9A 4EIGB 1QYGH 2FGWL 5GGRA 4Z7NE 2LHAA 4HBCL 1CK0H 1UZ8A 4PJBE 4D0BA 2X44D 2P42B 4P2AA 1JPTH 1ECYA 3QXTA 2V5SA 3PGFH 2X4NA 1J8RA 1FPTL 5TPWL 1MIEL 1O9VA 3TCTA 2AKRA 4LVNB 2QHRH 3CVIL 4EI6B 1HI6B 1E6JL 5DD5L 5GZOA 1R3IH 4OT1L 1YEGL 5JW4R 1RZFL 3GT6A 1EJ8A 4XBEH 3L3IA 3CSYA 1X7TA 3SE3C 3AFLA 1GPOL 3KHOA 1N18A 4PRNA 1CGTA 1UWFA 4PV8A 1URIA 5IMOB 1BM7A 2X3AA 4HCRH 4JE0A 5J1TC 3D0VB 3QIWC 1CD1A 3EGXA 4TMPA 3PWPE 5L4IA 3HNTH 1ZRUA 3KPOA 1N2RB 1OTTD 4MMXB 3WOVA 2P46B 3UPCA 5T1LD 4WLCA 4NHCH 3FB8B 3NA9H 1QFUL 1KPRA 3HC0A 4KJYB 1Q1PA 4PLJC 2Q5BA 1GCYA 5D70L 4WSKA 2WLIB 3EOAA 3N0PB 3O2DA 3QDMD 4GKNA 2A73A 3ZMRA 4OIBA 4KMTH 2WN2A 3FSWA 5TDOA 4P5TB 4TVPH 2IF7A 3H6AA 3B8SA 2D7OA 1NOFA 1FFPB 4XMPH 1LO5B 1KBPA 1DQJA 4L48A 3RPKA 3BKML 3MRLB 1XGRA 3LXCA 2FGWH 5FECA 4HBCH 2FEJA 2YOAA 3LKNB 4MNHA 5CCHE 3NAAL 4LQ1A 1FPTH 3AU1A 1JSYA 5TPWH 5IVXB 2YS4A 1MIEH 3SPCA 3X1FA 3FONA 2BNRE 3L17A 5L88L 3CVIH 5IWLC 5ACLA 2VDQL 1E6JH 5DD5H 3ZYOA 5IR1A 1V27A 1IKOP 4OT1H 2VABB 1YEGH 1RZFH 2FNBA 4ACPA 5FAAA 1NEZG 4PGBB 1WA2X 3BO8B 1GPOH 2FHFA 3OWRA 2BSCA 2BC4A 3CXDL 1FO0A 3CIAA 1GOHA 3NRFA 1JNLL 3BUDA 5GSRA 4JFYB 1FG2A 3TNMA 4BK5C 2KPNA 2YOCA 1A3RL 4KNUA 2VE6B 4N8VB 3NSXA 3FOLA 1CZ8L 1AANA 3K74B 1RZKL 1O5PA 2FX8L 2YBGA 3W9EB 1QFUH 2HTLD 3OKEA 1TLMA 3DURA 3QIUD 1ITCA 1IBGL 4RNRB 5D70H 5B38A 1MW3A 4FQ1L 5DD6B 4U1MB 4U1SA 3PJNA 2AQ1A 2YSSA 3HJEA 5KANG 1KELL 2OMBA 2X7LA 4C56D 5AVUB 3DUUB 3L8QA 2UUDK 1DLHA 1O9ZA 1YYLL 1ZOXA 5ITFB 3OM3B 3BKMH 1P9MC 1NMCB 3WKYA 4ZMAT 4HIIA 1Q0EA 3NAAH 4ZMQA 3D18B 3QFDB 3S98A 5L88H 1T5XA 3L4TA 5BZWA 1P84K 4HKBA 1OWRM 2VSKB 3DYMA 2VDQH 2ADIB 4G8GD 4WFGE 3N3EA 1TJHL 3P4LA 2H0JA 2CKBB 3MV8E 3SDDD 4HWBA 1XT5A 3LKQA 1DZBA 1EZVY 3U2SA 3VU2A 2HZHA 4I0CC 4XMTA 3TBWB 4CU7A 3CXDH 5DU7A 3KDPB 2WJ5A 3IGAB 4QRTA 3V6FA 1JNLH 3V2AR 3V52L 3SJVB 1J48A 1KXQE 3AQXA 5LDUA 4FQ2L 4UQIM 3KVDD 1A3RH 5EEUA 1NJ9A 3WTUA 1CZ8H 5CXPA 1TF4A 4X98B 1RZKH 4U0RC 2FX8H 1KBGL 2XTJD 5IOPA 4NEHB 4YBQD 4DKFL 1IBGH 1BWWA 3ZK0A 2ZX5A 4FQ1H 4IRZA 4E9VA 1GC1L 1NIAA 1TVDA 2NYYC 3ZZLA 3NIGE 1ZHNA 4FNRA 1R3KA 3F85A 1KELH 3H85A 2QPDB 1XGZA 3KCWA 4X6BB 5C0DB 2ZUVA 2HN7B 1YYLH 2Z31A 4NN5B 3UCRA 3LIZA 1S6NA 2DICA 4QRPB 3ZYIA 4OV6F 3FN0L 5DTFA 4WF7A 1HESA 4MJ5B 1S7SA 4JY4B 2QLVB 2N0KA 3DX2A 3E1F1 3CV5A 1D7DA 5AD0B 3HKZA 5DJAB 1UEYA 1OWWA 1HAWA 3KPQB 3ZJAA 4N0UB 3U30C 3QRBA 1TJHH 4AH2B 3EKCA 5FYJD 1XCQB 3J8F7 4TQEL 5LLIC 1NC2A 4HC1A 2DH2A 2BWQA 1AXSB 2B9AA 5LNDA 4IRSB 3AT8A 2DI8A 4HWNA 4R4FL 2LU4A 5EBLA 1WFNA 5D96C 4WO4D 5DJ6A 1IQDA 5FXCH 3V52H 2EUWA 2QGDA 4X6EB 2GK0B 4I18C 4ZUTB 3UTSB 4FQ2H 2APVA 2YD9A 4RSVA 3IDJA 2Y0SA 1MHEB 3DYOA 4WW1A 1HZLA 3ARWA 3QXAB 2VDNL 3VE0A 3IDGB 1KBGH 4I9WD 1KOAA 5L8JB 4PJEE 4DKFH 4W93A 5FM5M 5J3HD 2FJHA 1GC1H 3HAEB 3EH1A 4LDOB 4LLWB 1U92B 3B56A 4P5RA 2FYVA 3W5NA 2VDRB 5AG9A 2YQGA 2ZSWA 5DMKB 4WSGA 1EAPA 3LY6A 4KDTA 4MJJA 5BQ7B 1K6QL 5LUMA 3FN0H 2FHCA 1Q0XL 4XB8A 3O8XA 1D2PA 2AJZA 1EA9C 4RZCB 3WJJC 4IMLA 4O02L 1TVBB 3PGDB 1FL3B 3VFUA 3OKLB 5K9KA 1K5WA 2VAAA 4PG2A 3NRQA 3WTXA 5FV1L 5KVFE 4L4VB 4EZJA 1RHFA 4KK6D 5AOMA 4GP8B 1KLFA 4TQEH 4Y5XA 1PX3A 4LMQE 2DBJA 5EN3A 1E6OL 1FJ1B 5JNYA 4PHZA 4A2DA 3EFOB 5C0AB 4R4FH 5F7YC 3ARFA 5CR8A 5C0JA 1B88A 2C1OB 2R51A 3AREA 4HUWA 2IQ9L 4S2SB 1BZ9B 5FHBL 2J5WA 5D7SL 4NCDA 3VA2C 5A43C 4LP5A 1CBJA 3HBPA 1HNYA 1JZ4A 2VDNH 2YPLD 3ZSSA 1OHZA 5HDBF 3N9GL 1NC4A 2CIIB 3BYYA 2A7BA 4I88A 1DN0A 2FT6A 4KKAC 3QCVL 4BIKA 5IHZA 2PO6D 3CFMA 4M62L 3DETC 3EJQA 2OI9C 3NJFA 2MWCA 3MRFA 4QF1A 4WV1A 1K6QH 3MPCA 2EEDA 2HRHA 1QWUA 1Q0XH 1AHMA 5CEZL 3LKRA 4HUUB 3K2KA 3FUIA 4O02H 3BAEL 1T6BX 2NOYA 2IOMA 4FYTA 5CLXA 2IGLA 3BOVA 1N8OE 5E8PA 3GSRA 3F7LA 4YSQA 1MFVA 4I0PC 1BAGA 4OCMC 4Y5YB 5FUOL 1XCTB 4XGZA 4X6CE 3TH2T 1JDCA 1E6OH 4Q52A 3CHPA 1IGTB 4PS8A 3X12A 3KS0H 3G9VA 3ZIMA 3CMOL 3ORJA 3FB5A 1JN6A 5IW6A 1JNNL 2OMUA 2IQ9H 3MNZA 4P04A 1G1OA 5D5ME 1KEML 3K46A 4OCWL 5D7SH 2NY3D 2PPCA 1NOLA 4ALAC 4F8TA 2YMXL 4DN4L 3A67L 4UUJA 1V55B 3BGMB 1VFAA 5HD8C 5DGRA 1A9BA 3N9GH 5F7KC 3TTYA 4JM2A 3VD4A 2WYHA 2ZAGA 4CSPA 4PRIE 3MYJB 5EU7C 1BFOB 2BNQA 2FQFA 1KZQA 5CEZD 3QCVH 4OLUL 1II4E 5BUGA 5BVPL 3MUGB 1LEGB 1UGKA 2Z8SA 4M62H 2AJSL 5DJ8A 4ZS7L 2H2SD 3ZDZF 4QWWD 5AVZB 4AOFA 4LHUD 4P4KC 3VMPA 1BQKA 2XWRA 5IJVA 5E2VL 3UEQA 2YFNA 4LSUL 2DYSB 4X6FA 4HSAC 1TKWB 3IXTB 3SBPA 5CEZH 2KC0A 2WBJD 1RMFL 4MAZA 4F33A 1G7PB 5KZCB 2J1ZA 3BAEH 4OIFA 3G6AA 4AM0A 4X9BA 1S78D 3KPLA 3UFIA 2ROYA 3MGTA 3IAPA 1TQVA 4WO0A 2Y24A 1MWAL 3JTSA 3VXUE 3APNA 5FUOH 4ZSOE 3IU3B 4M4RB 3L3OC 3WJMB 2LAAA 5J1AB 1K4CB 2NYZA 5EWIL 3SD5A 4GEIA 3CMOH 2BFVL 3TJHC 2PABA 1HZHL 5JHDD 4WU5B 1JNNH 1MXGA 1OY3B 3UAJA 3VDAA 5HYQB 1FVCA 1KEMH 2CSPA 4OCWH 4X6CA 2JTDA 3O45A 4U3SA 3BGAA 3VGFA 2IPUG 3DGGB 4P5MB 5IMKA 2YMXH 3OF6D 4DN4H 1XGQA 3A67H 4KFMA 3WY3A 2HKFL 3M45A 1EUUA 3GSWA 5D5MA 1MEXL 2B4CC 3RJQB 3EG9B 3ZTJH 3MRCB 1GS6X 4QHLB 4WCYL 4WIQA 1K2DA 2OFQA 2E5EA 4OLUH 5BVPH 1BD2D 1F00I 1M42A 3F01A 2AJSH 4ZS7H 1A6VL 5EUKA 4LIQE 5I1EL 5BUPA 3ETBJ 1DBBL 1H8LA 2VDPL 2ZYIA 4PRIA 1PF3A 2F53B 5E2VH 4LSUH 5CGMA 1PDKA 4PJ7F 5DHDA 2XPGB 5LCVA 2R0WL 3G6JA 5DMGC 1A1OA 4WWKD 1RMFH 4LZKA 3V6OE 3IAGC 4ZOCA 3SYAA 1QZNA 2CLZA 3MRQA 4P59L 4TNWF 2VITB 5EZIL 1C12A 5IFJA 5D1QB 1MWAH 2X89A 4XO4A 1RLWA 5GJSL 4UT7H 1OTUC 1ZT1A 1Z9MA 3LB6C 2QKIA 5E2TL 4BDVA 5EWIH 4EN3B 4N3TA 3OQRA 1CLVA 2ZXCA 5B1AB 4L3EB 2BFVH 2WV3A 3IDYB 1HZHH 5SWSD 3IE9A 4JPQA 4ZSOA 5HDBE 2AV7A 3ABGA 3D3VD 3PIQB 4JO2L 2O6FA 1I3UA 2E9JA 3WHE1 3QXUA 1IL1B 4FXTA 3L4WA 3IJYA 4JVWA 1PD6A 2H6UA 4KJWD 2HVJB 4GQPH 2V9RA 2AC0A 2HKFH 2IH9A 4JFDE 2RAMA 4YR6A 1NSNL 2VQTA 3BX7C 5GS1C 1MEXH 7PCYA 3TZVC 3JVFC 4JKNA 1T83A 5CFHA 4WCYH 4FGMA 4FFZL 3W9DA 3OMZA 1PL3A 3LKOA 4B9IA 4G2AA 4HS6B 3WI9A 2YD4A 2YK1L 3B34A 3ZSTA 4ZDHA 3LHAA 1A6VH 1IBZA 5I1EH 1C8PA 1QSVA 1DBBH 2VDPH 1L0XA 3ZE0E 2FWOB 2OAAA 1UD8A 2O61A 4U1LA 2R0WH 4KKNA 3MLPA 3PL6C 1JI1A 4K23L 5CHNA 2H32A 2QQQA 3DPDA 4XP6L 2Y7LA 5EZLB 4P59H 1N8ZA 2J5LC 5EZIH 4BK4A 4GRWH 1Z1WA 1ERNA 4L8CB 5ISZD 5GJSH 4YSDA 3QR1A 5E7BA 4POUB 3V6OA 1X9RA 3GMMA 3IK2A 5E2TH 1M2OA 2WZ6A 5H4YA 4IBTA 2PYED 3CFBB 5DC2A 3X14A 9CGTA 3CQQA 4Z7WF 5EFIA 3II2A 3QK0A 4OI9A 4JO2H 3F62A 3L1OL 1JF6A 2P43B 1HI6A 3JV4B 5HJ3A 4Y0GA 1XSKA 1OEZW 3TVMB 4NWTL 1XH0A 2JVUA 3RDTC 1NSNH 2EXWD 1N67A 3WBDA 3OMIB 2IALB 4FFZH 1NPUA 1ZXKA 3VCLB 2YK1H 4XZUB 2OLDA 3QYMA 4GMSH 1QQDB 4AJ0A 4PJ9D 1KJ3L 1YEDB 4JKMA 4LBEA 4JRFA 1RUQL 1G9HA 5AOZA 5LB1A 4K23H 5AOJA 2A0LC 5FA3B 3FOMB 3P4MA 3BIAX 3KJ6L 3VB8A 3QNXB 2FQEA 1WCBB 4H8UA 4XP6H 3R7QA 1XMEB 1MW1A 4JANB 5I8CB 2RR3A 5DURB 4F15B 3VRIB 3SODB 3REVA 1N68A 1WUZA 1UWYA 3QEHB 4X7SL 3VXME 4IRJD 1KV3A 5FYKL 4K71B 1P4LA 3LQAC 4PJDB 5AYQA 1QR1B 1N6UA 4WFFE 3VXRB 4G6KL 4MA1C 1VGKB 4X9YA 3D9AL 2WZPA 4G43B 3VFPB 4DPAX 3L1OH 4PJ5B 3VWKA 4Y4FD 3PUUA 3H7BB 4E2OA 4Y9GA 2EC9T 1PFCA 3DVNB 1K3ZA 3HE7B 1AD9A 1I8KB 3I3DA 4NWTH 4A2FA 5IV2A 1TIUA 5DVLA 1JXKA 2CGYA 2CPCA 3AB0C 3CXFA 4L3CA 1JWSB 1URZA 3OGOE 4GG8A 5A2AA 1S7RA 1N7ML 2Z9TA 4JDEA 4JRYB 4DEUA 3MV7B 4ATTA 2NYKA 5ABZA 4KRPD 5BRZE 3L1EA 2K6WA 3T3PF 5D1ZC 2VE6A 3BQUB 4NCC1 5L4JA 1RY7B 2ZG3A 4B9JA 3KXFA 1IZKA 1KJ3H 1U93B 3QWNA 5JHLA 4AUYA 1RUQH 4JE4B 3RFRA 1BW8A 2IC2A 1DDTA 5DD6A 5FYKD 5IBUB 1P7QA 3KJ6H 5F89B 2JLLA 5IJDC 1U8PA 3BT2L 1U8OA 4U1KB 3RGVB 1M1XB 1IX2A 2YXVA 1CBVL 3NOIA 4NPYA 3BVVA 2BOCA 3ARBB 3GB7A 2I32A 4X7SH 5JDSB 5JOFA 3UMNA 1WFTA 2GKIA 3N1GC 2WAQA 4LDEB 5FYKH 1DJHA 2JJUA 4FP8L 1TZHA 1OOWA 5C7ZA 4G5ZL 2YN3A 3ULSB 4G6KH 4ODWA 3D9AH 2BLFA 1CFBA 1GSMA 2AJUL 4G8EA 4XWOD 5D2LA 1WPCA 5DGQA 4GKZA 4PRAB 3RUGE 4B9ZA 1I4FB 5DA0B 1NFDF 4OF5A 5IEKA 1GOFA 2B20A 2PLTA 4YDNA 4F7EB 1U3NA 1N7MH 4JFEA 5L2JB 3IXAB 5DUPL 3WFBL 4BWTA 3QUZC 2HFGL 3QJFA 1U21A 1QTSA 3DI3B 1T80A 1F4XL 3LPFA 1SYSA 4Q6IA 3LRGA 1LGVA 4J3UA 1I3RB 2FSDA 2J1YA 3ETBF 4DF9A 2G30A 4DVBB 3RTQD 5BRZA 4AVKA 3V4PB 1GZQB 2V9QA 5EMYA 4ABQA 4UTBA 5DO2D 3WTTA 4Y4KC 1JF1A 3BN3B 5I1AA 3BT2H 2P5WA 4HUVB 3JVGC 4LPTA 5C0DA 5FKPA 5JYLA 1CBVH 1IO4C 4H8WC 4I1RA 4TQHA 4QRPA 4AI7A 15C8L 2XDHA 1PAMA 4FP8H 2EZ0C 4MJ5A 4LRNL 4P2YA 3LS4L 4G5ZH 3BW9A 4NZFA 4P2CG 5F3BB 5DJAA 5AKVA 2ENJA 4LF3B 3OKOA 3QI9A 4ZMVA 1GYAA 2VMCA 1WWCA 3SPVB 1M6UA 3FUDA 4FNPA 5C09E 2AJUH 2PWFA 5BS0E 4MVBD 4E9WA 5DHVH 3QR0A 1J12A 5TD4A 4XNMB 5JW4Q 2XZQL 2W07A 5EO1A 2LTQB 5KSUA 1PLBA 1RLBA 1HZKA 4HJGB 2IIJA 3NDZE 1HVXA 4L8SB 2NY1B 3H0TB 4QXTB 5DUPH 2XQYG 3WFBH 43CAB 3DMMA 5JTWA 3NZSA 3S35X 3QDJD 3RUGA 5AENA 5DZNA 1MCKA 3C6LC 3CHOA 5ECJE 1F4XH 3N1FC 1IKFL 3ULVL 3AY2A 2V2XB 4IGBB 4U49A 1IU1A 1KB3A 2EYSB 4LP8A 2NX5A 3QORB 8FABB 4F7CB 2MOQA 3LKSB 5F1NA 4IEFA 1U92A 3TEWA 3U0TB 4DZ8B 1H9DA 3QZWB 3WS3B 1JXJA 3FT9A 3F5WA 5T3ZD 5CLZA 1XH3A 4ETQA 2HT3C 3F7VA 4ZQKB 3EYVA 1I75A 1WAAE 4G3YL 4MXQD 1UEMA 1NINA 15C8H 2IDQA 3JT2A 4LRNH 4UM9A 4HOXA 3PGDA 1FL3A 4JN2A 2NY2C 4PRHB 5AOLA 3LS4H 3BH8B 4L9LC 4HMCA 1PCSA 2XSKA 4LO9A 5EBWB 3ARYA 3QG7L 5K93A 3RBSA 1NIEA 2VTFA 4R5TA 3HVNA 2DMCA 1U91A 2BIQA 1ANUA 1I53A 3QDME 4U3XA 4ZX5A 1E43A 1W6WA 1ACXA 3EJTA 3LZPA 2NNCA 2XZQH 3ULVD 3WTVA 4W4NA 4DUVA 3S36L 4F9PC 3O9WC 2L7UA 2C1OA 1A7RL 3MRPA 3DIFA 4IKNA 1U0QA 1BZ9A 5BS0A 4NO0D 4OAWB 1RJYA 2CCVA 2Y5EA 2PXYB 1JWMB 4F8OA 3QWRA 2OR8A 4DGWC 1IKFH 3ULVH 4JFSA 1CICD 5E8NB 5DSCB 4WENB 3RX5A 1XF1A 3PE9A 4LCUB 1UT2A 3FQUB 1URLA 4GO8A 4NQED 3GXDA 4D3CL 4E9LA 1E5AA 4XRCA 2X70A 1EK3A 3HS0C 1ZHKB 3T8XB 5ICZB 2D7MA 1MVFA 3GMOA 1O7SA 5F88A 4UNUA 4HCRA 1OP3K 3W57A 4G3YH 2PCPA 1U3YA 5IKCB 1EEZB 4WI7A 2P44B 1S9YB 4E9RA 4E0RB 2M26A 4WJ5B 3I6LE 4HIXL 2F5BL 5C0IA 4YAQA 3QG7H 3MLVL 2CNYA 4ZUUA 1PVHA 2JI3A 3ZKND 2C9AA 3VRLE 4CC0A 4O2FB 3PV6B 3WIHL 5T1LA 3S36H 4C56E 3BHBA 1ZKAA 1H15B 1E9PB 1A7RH 1X5KA 1NCTA 1NUDA 1ED3B 2OMXA 4GAGL 5GZOC 4WI0B 2ZX8A 1FQ9C 4KZCA 2WCPA 4XC1L 5FO7B 1DQLL 3SE6A 2VR3A 5EZOL 3V7AG 5KS9F 1P5VB 1TTFA 1Y7VA 5C3TA 4D9LL 3RL2B 5J1SC 2R69L 1DVFD 2XWBB 5ESQB 3EFFA 1ZVSA 3ALWA 4L23A 3U83A 4D3CH 5DQDL 3MU3A 4G8GE 2XXGA 2O26U 4FX5A 2CO6A 3L3JA 4KJQD 5TH2B 2Z1PA 5HYEA 4XBGA 4IBVA 2FE0A 4S10A 1JZFA 2JK5B 4R5XA 3MRKA 4X7DC 5K9OB 1IGML 1YZZA 2ZXDA 4Y19A 1XR9A 1UM6L 1TKWA 2J71A 4CMHC 1WD9A 1H3WM 1XF5A 3FKUS 3RHWK 2JQMA 4HPYL 5T5NG 5E56A 2RIKA 2ZJSL 4JHUA 4HIXH 2F5BH 3K6OA 1DSWA 4BHUI 1KB5B 2XTJE 3B5TA 4DERA 4DHLA 5KSBF 2DEWX 3MLVH 2VRAA 5HGDB 4OCRL 1TTRA 2PP8A 1M7DA 1D5MA 4X5XA 3WIHH 3L95B 2IAAC 3DO4A 2YAFA 2B16A 2UXFA 1R0AL 1SN5A 4FQCL 4Y1AB 1ZTMA 4A7GF 3QIUA 4GAGH 3UBXI 4MNGE 1F13A 2EADA 2ZKXA 4NN6B 4RMBA 1UWXK 4QHKI 4AW7A 1WBZA 1HHJA 1DQLH 4XC1H 1OAXL 5EZOH 5C2UB 3C5JA 3EGSA 4C56A 4D9LH 4PR5A 2R69H 3QUYD 3NCJL 2QMJA 5A1AA 1S9XB 3EG9A 4OU3A 5D7IF 4JCLA 2QGBA 2VISB 5DQDH 1T1WA 3QUGA 5FYJE 4XBPA 2Q8AL 4K8RC 1EBAA 3WMQA 3L5HA 4M1CD 1HC1A 5I5MA 1J9SA 2F53A 5EC2A 3S7GA 4QNPF 1IGMH 1RIUL 5IJKC 1UM6H 4Y89A 1FDLL 2ENQA 3DJZA 3TPKA 4M7ZB 5F3HA 1SFHA 2E76C 4HPYH 1HAUA 4NZJA 2ZJSH 1U36A 4ZAKD 2R29A 3DGCR 5J57B 1Q72L 3GPSA 2NY6D 3O41A 2WGXA 3STBA 3W2DL 4BFJA 4I9WE 3FFOA 4OCRH 2PYFA 4GOSA 1DFXA 3BWZA 4OUOA 3OMAB 2QSVA 1G9MC 1KIUA 4XNYL 1KTJA 1KYDA 1R0AH 4FQCH 4KTGA 2HKAA 3D4YA 2E7HA 5AB0A 1X5GA 1YC8A 2CCWA 3ARDB 3ILDA 4R7VA 4AIEA 2YHGA 4KGLA 2DWSA 5I6KA 5EC1B 2GJPA 5F7UA 1OAXH 1M53A 1G7HB 5KYNA 3AMKA 3ROOB 5ID0B 3X17A 4MD0B 3NCJH 2CK2A 1N64L 3TBCA 4OQ1A 1F18A 3FU3A 2EP6A 3U4BL 2XN1A 1GGYA 3F2LA 1TLKA 5T1JA 2OSLA 4LESA 2F74A 3E2HC 5FWRA 2Q8AH 7TAAA 2EDRA 3R06B 4MD4B 4X0KA 5KUKA 1KFAL 3FRUB 2ISDA 3EH3B 4PJHF 5E7FA 2B14A 1RIUH 2WLNA 4S1RL 5C7XL 2FJGB 1FDLH 1CFQA 2BVOA 2PUQT 1V3KA 3CN4A 1H8OA 2F0CA 2VR7A 4FOMA 3FNKA 4G71B 3QEQB 1Q72H 2YPLE 4NENB 3W2DH 4P2OD 1NZRA 1S7VB 4LCIL 4WO4A 3RWHA 4U6XA 4F3FA 4DT2A 4PJIE 1SXSA 2NT1A 3FT0A 5CJXA 2A38A 3EJUA 4FEIA 2A99A 3WXWL 3P9LB 4XNYH 3TV8A 3UZEC 4JGNA 1W8OA 3FQRA 1X5IA 1O9WA 4I77L 4BH7A 5HSFA 5DEFA 1ZT7A 4OD2A 5BJTA 5B1JC 3B9KD 3UBXB 2OULB 3BGFC 4YPGA 3DLQR 3JV4A 4OV5B 5CCJA 1DJXA 5I75B 1CLYL 1PQZB 2A2QT 5LGYA 3T6VA 4DP7X 1N64H 3ZO0A 4YH6A 4HJUA 1BXAA 3WUZA 5D93C 3U4BH 2ATPB 3DXAD 4UQ2B 4DVRL 1JPST 4DEPB 5GSVB 1XEUA 3VCLA 1HOCA 2DQIL 4W6WB 4FG6D 4P5TD 1KFAH 1MCFA 3LNFA 2MPVA 5CN3A 3GBNL 3O6ML 1WWBX 3TO4C 1USQA 2BS8A 3U4EA 4J3OG 4Y9EA 1TITA 4S1RH 5C7XH 2QEJA 3S5YA 4NKMB 2ZAIA 5ESAA 1HXMB 1CUOA 2CNZA 2UWEA 1OZTG 4YIQA 4E5XG 2NXYB 4YDIL 2BVYA 3DSNB 4FMFA 1GSKA 1WGVA 3EJZC 4LCIH 1S7WB 4LVOB 4MLSA 2ZNXA 3GIVB 3CTTA 4HUNB 2QTEA 2PCYA 1PG7W 2HLFC 3WXWH 5CEZE 2I85A 3M1OA 5KVEL 3GI9L 4LEOA 4I77H 1C16A 1MFAL 2Y06L 2X87A 3JZ7A 1CDCA 2DM2A 1SZNA 4UZSA 4G43A 2R27A 4BQ8A 1RPQA 3B4NA 4GP5B 5HGGS 1QFOA 2C3WA 4O02A 4MDIB 1AYRA 3P4NA 5A6MA 1CFSA 1CLYH 2GITB 2FQGA 1A4KB 3CVBA 5D6CA 4ZJ9A 3AS1A 4AC2A 4AC4A 4FZEL 4DVRH 5L8LB 2Q7YB 4D94A 3CDFA 2DQIH 1JV5B 3U9PL 4YNYA 3GBNH 5IUCA 3O6MH 1WK0A 3AXLA 3HMXL 5JHDE 4KXZI 3A5VA 3K5RA 2FUQA 2DQHL 2OSYA 4HDIB 5EO0B 1Y1UA 5HHXL 3GUTB 5GS2D 2PMZA 4YDIH 3MHZA 5C6PB 2DWDB 1G0YR 2IWEA 4WV1C 3MNWA 5SX4I 2QSCL 3C5ZA 4L9DA 3IGFA 3HCVB 5JDSA 4CGTA 1I8IA 3PQYA 4M7LL 4AGMA 4DK6A 3MODL 5GS2H 5KVEH 3GI9H 1BD2E 3NDYE 2Q1EA 1X5YA 1JGVL 3BAYA 32C2A 1MFAH 2Y06H 3TBSB 1KWGA 5B3SB 3VH8G 3SZKC 3H3PL 1K5NB 3QJVB 3WEXB 1AR1B 3MR9A 4JG5A 5CZKA 5LDSA 4BGLA 3WLWC 4ENED 5D7JC 2UX7A 3RI5F 5C92A 1T1ZB 1JOIA 3BD4A 3ZKSD 3BLPX 2VN4A 1ZE3C 1QHPA 3QQDA 1AJ7L 4LHUA 4MGXA 3GZKA 1ES0A 5JHBA 2QJDA 1A6AA 3IXAA 4FZEH 4OZ4B 1V3JA 1LNUA 1SLWA 5ADPL 3H4HA 1G0DA 4FCHA 3BH4A 3MGOA 4K0OA 1XL4A 3MRIA 3O3BA 3U9PH 2BS9A 2GJ6B 4JM2C 2XLLA 4N2NA 1I3RA 3HMXH 4YLBA 4Z7VF 4ELMA 5J0BA 1Y6KR 1E7UA 2DQHH 3D3VE 5BV7C 4WSJA 1MUJB 1G6VK 5HHXH 2GFBB 1FVDB 3FQYA 3GO1L 1T7YA 4J1UB 3ZTEA 1Z9SA 2QSCH 4OGYL 2A9DA 3VQMA 5DEJA 1ITBB 4PI2A 1KGIA 4M7LH 1G9NC 1OPGL 4AYBA 3MODH 4GFXA 5K59F 1E28A 1YO4A 3F12B 1JGVH 3OB0H 3T0WA 1I1AD 2XV0A 5HDRA 4WNQB 2K1MA 5KBLA 4TULL 3TCLA 1TQCB 3H3PH 4KI5F 3BH9A 4PVBA 3DWTA 4UNVA 5DUJA 4B0MM 2FSEB 2MCG1 3TBTA 2NY4B 1AJ7H 3E6HB 3HI1B 4NFBA 4U1HB 1MWAA 4NNYB 1NCGA 2V6HA 3LEXA 5LQBL 3Q6GL 4LP4A 4DESA 5ISZE 1IRAY 1FZMA 1H6TA 1BPLB 5ADPH 2MQ0A 2YGPA 3LQZA 4RFNB 2J8UB 4AQOA 1NFKA 4PJ8C 1J0JA 2VXQL 2FJUB 1ZLWK 1BFTA 1W16A 5J6SA 2RD0A 1LO4L 2XKNA 3K6NA 3JTTA 2IPTL 4GAYB 4GW5A 3L08A 3KW7A 2Y1AA 3QZWA 2CLRA 4IBYA 3BVDB 1UD3A 2A83A 4HD5A 3GO1H 4XR8C 1QBBA 5SWSA 2WB7A 3O6KL 3ULUL 5DDHB 4L4VD 4OGYH 4ZQKA 1N5YL 4DIXA 5HHPA 4BWWA 1OPGH 2YMOA 4JKWA 2WQUA 5INCA 4LVHC 1J8HB 4HUXB 4OF8A 3RPIB 1H6EA 3LPOA 4HJ1A 4TULH 1FYTD 3IN0A 1PCXA 4LGPB 3O4LB 2E9GA 3N43F 2K8MA 4AEHL 6FABL 3LYRA 1T4KB 1RERA 3GMQA 1MRCL 3ARSA 1DJGA 3FFDA 1VENA 5B4MC 4NYLA 3TV3L 2YO3A 4JG9A 4M8VA 5LN4A 1T3FA 4JL1A 1NIDA 5LQBH 3Q6GH 3K72A 3DBXB 4JS7A 2VDLB 1KNOB 2N0MA 2VXUL 5MEPB 3AQZA 4F8LA 5E8NA 3IGUA 2VXQH 1ZPUA 3TOPA 4BSJA 3N04A 1E9QA 2IO5A 1LO4H 4HGWB 1BVOA 3HE6B 3PU7A 2IPTH 4Z7OE 4QO1B 4KJPD 2PYEA 1F02I 2E6PA 1G6RL 2W65A 3MC0A 2JSFA 1ZHKA 3HJ0A 2WLMA 3NACL 3MRJB 3GBEA 1EAJA 2EIKB 3O6KH 1TCRB 3C9NB 5I1HH 2GSIA 1N5YH 5E4EC 4OLVL 4G6AD 5HDOA 4X8XA 4FFZA 4J6RL 4NKDB 1EEZA 5AVXB 5DQJA 4YLCA 3NCMA 4RESB 5I1IL 2XTSA 4WKXA 2DIEA 3VQ1C 4YGAB 4N0FA 3P2TA 3RA7L 1U3HD 3RLSA 1YEFL 3IDMB 3V6OC 3WNKA 4B96A 4KO9A 4AEHH 4HIPA 4WI9A 2NSXA 3VXTB 6FABH 2DWTA 4R0LC 4M6NL 1MRCH 1U6AL 4U6VL 4Q0XL 4XP5L 5FYKE 5KUMA 4M93B 5CZXC 2Y5QA 4BGDA 1WBXA 4CMMA 3HUJB 3TV3H 2VMJA 1AXTL 1MHHB 4HFUL 5D7KD 3E8VA 3TA3B 2VXVL 3DTUB 3O2VL 4G42B 1UENA 1KBVA 1LP9E 1L3NA 2VXUH 1U4EA 3NN8B 4K5MA 5AUMB 2BP5M 4Z7QF 4EBQL 3HZVB 3CVDA 1CLOL 3OHXA 3OLEA 2DS4A 1BLNA 2G75B 2ICEA 4JZJC 1A21A 5HI4C 1WZKA 1G6RH 3K4DA 5DVPA 4XCCL 4TTGA 3N44F 3NACH 1OIOA 2IBZX 5E6ZA 1T20A 5K1JA 4R7LA 4EPSA 4Y2DD 2DM7A 2ALAA 3IS1X 4OLVH 1PU0A 1QSFD 1NDTA 4J6RH 2JXMA 2IBBA 3Q2WA 4Y7MA 4I3GA 1XF2B 5IQOA 5I1IH 4NQDE 2A1WL 3FC8A 3AACA 4PHXA 1R47A 1HK6A 1XGYL 2CLVB 4LEEA 4Y1TA 4GXUN 3RA7H 3KG5A 1YEFH 3E9UA 3IFLL 4YN3A 8PAZA 4MYPA 4MNQB 2ARWA 3BRGC 4M6NH 1KGWA 1U6AH 4U6VH 4Q0XH 4XP5H 3T2LA 4ZNEE 4FQPA 2XFGB 1CT8A 3L95A 4K7PL 5DJXB 1MCEA 1AXTH 5K9QI 1KGJA 5M95B 3A3YB 4HFUH 4I5BA 3VWKC 4ODTL 5IVZB 5DFAA 2VXVH 4JR9L 3VYOA 4A39A 1S7XB 3O2VH 4LSRL 1TQBB 3F7PC 4HULB 3MX0B 1QLFB 2WTRA 4EBQH 1AKJA 2AF2A 3GSUA 1CLOH 5IG7A 4LARL 3M86A 3T3MF 4OF3A 1MCPL 5AW8B 3QRGL 4LCWB 1NCBL 4CNIA 4HEPG 4XCCH 1U8HB 1UH2A 2HVKB 3ECUA 3VFSA 4DPRA 1REIA 1TNMA 4RAHA 3B1UA 2X1OA 4ZUWB 1E4XI 4H2AA 1RFDL 3D2UB 4QRRB 3TNNB 1N9PA 5SWQB 4EN3D 1H8SA 4UBDD 3QDJE 2A1WH 2YPKB 5AKSA 5L6YL 1BIIB 1IGYB 1XGYH 1AO7B 1T22A 1PZ3A 4IMKA 2NR6D 4Z7UE 3IFLH 5DFTA 1JPGB 1N59B 1F11B 3Q48A 5GGSB 5C07E 4M00A 3ZT5A 2NUPA 5BNXD 4NQTA 4OZIE 1HINL 3HTLX 3KBHE 4K7PH 2IMMA 1MVUA 3BWUC 4GG6F 1ZTXE 1SEQL 4TLSA 5TK2A 5T3ZE 3D0AA 4Q2ZA 5JOEA 2HJKB 3BP6A 4HP5A 3RTQA 2RGSA 3G6JF 4ODTH 4UQ9A 1R33A 1E4JA 1EPFA 3DI2B 5B8CA 4P9HL 4JR9H 5L9DL 4KK9C 4D9RD 2B1AL 4LSRH 5EC1A 3VI3A 2E8YA 2BMKB 1FF5A 3CFTA 3FCBA 3LPWA 1FWXA 1GJWA 1KC5L 1BECA 4F5CE 1EFQA 1SQMA 3ECWA 5DYOA 1ZV9A 3KBEA 1CE6B 4LARH 1OB1A 3LEYL 2WZ5A 3LKPA 2BWIA 3QRGH 5CEXB 3FZUD 2K8QA 5LN8A 3ASOB 4NO3A 1NCBH 5DHVA 1RZJC 1T5WB 5CJBA 2QPUA 4Q6IC 4YO0B 2H6OA 2G60L 5FUZL 3QT2A 4KHTL 3ULVE 4AQAA 3BSGA 3H3KA 1RFDH 4GMTL 2VYRE 2FIKB 3ULAB 1JHKL 4BSWB 4M7LT 1HEZA 3VXQA 1OGPA 5L6YH 2J8OA 2PR9A 4ADJA 3QEQA 5GISL 3EOYG 5ID1A 1T66C 3SDXB 4M6OL 1UA6L 3VRJA 1PMYA 2A6JB 4LNRB 2DQ6A 5E1IA 1MY7A 3GLDA 2P5EA 1OE2A 5EPMA 1T1XB 5KBMA 2BSTB 4NQEE 2V2WA 4QRFA 3PDOA 1HINH 3A6OA 3EZ8A 5CGYD 2VERN 3TVMD 2PTUA 3PXJA 3QI9C 1SEQH 1LDSA 1C5DA 2VQ1B 1XIWB 3D33A 2CDFB 2GSGB 1OK0A 2VUYA 2X2UA 3R0NA 4H5SB 4K7PY 4NC0B 2B1AH 4P9HH 4PJAE 2G5UA 4QGYA 1RJLA 1WFUA 1B0GA 1KC5H 2A6KA 3RYMA 1PZUB 2WTOA 3IS0X 4K94L 3QAZB 4LSTL 3LEYH 4KKBC 3DMMC 3ML9A 3VFMB 2W60A 3H53A 1DJZA 4FMVA 3VH8B 4H25A 3G5VB 3TEYA 1MI5B 5L4FA 3FDWA 1GH7A 2P45B 3KPNB 4YFEA 4W6XB 1DL7L 2G60H 5FUZH 4KHTH 3GHPA 1BBJB 4MMYA 4KV5E 4XHJC 3VSUA 4GMTH 2I9LB 3EADA 1JHKH 4RLDA 3RVTC 3QZLA 2HT2D 4I1NB 1IGFL 3B2XA 1WFMA 5LAXB 1XHHA 5GISH 4NT6B 2GCYB 1UJ3A 3BXNB 3VXRD 4M6OH 5IZ7A 1BZ7A 1UA6H 4TUOA 3VGAC 5FO8B 4PJ5D 4PLKD 1OP5H 5DQ9A 3QIBA 5CLYA 3HPLA 3CVCA 5CJOL 5I74C 4X8JB 4GFTB 3WTYA 2VIRB 2I07A 4PW3A 2FEDC 3DUSB 4U2ZA 3VFTA 1YEIL 5ACMA 2C9VA 3D50A 4MDJB 4QI3A 4Q97A 2NY0C 1U8IA 1CXEA 1NCNA 2FL5A 1CGVA 2WD0A 4GH7B 4NP9A 3ZDYB 4P48A 3CAFA 4LSQL 3EHBD 4JEGB 4TSAL 2X4QB 2CKNA 4K94H 1QRND 5ANMB 3FYEB 4LSTH 5TDNB 1JDAA 3QNYB 1HQ4B 4QHNB 1W2KT 5FUCE 3UPRB 4I2XE 1BOYA 3FH7A 3Q9QA 1RK1A 4WJG3 1DL7H 4X5PA 5IVXF 5IFAL 2H0EA 3RGVD 1TXKA 2V4LA 1FFNB 5IHUL 3ARBD 1CLZL 2J73A 3T8MA 1FP5A 2GTZB 2XOTA 3V4PL 1A6ZB 2ITCB 5A6LA 3T0DA 5CSZA 1IGFH 1QW9A 5JW5B 5BO0D 4L2YA 3GUTA 5IQ9B 1H5BC 3QG6A 3SZ6A 3V9FA 1EHAA 4I8DA 1RZ8A 3W56A 1YCSA 3IDIA 3DHJA 3HPJB 2VGLM 4POZD 5EIQA 5BMFL 3B9AA 2R2BB 2G3XA 3CUPA 2QR0B 3EBIA 4LCYB 4NS0A 5CJOH 5AEAA 3PYCA 4N6RA 9PCYA 4N28A 5FO2A 1RVFL 4NBXB 1DVFA 2DI9A 3L4YA 3O6FB 4PEEA 5F96L 4Z6AT 2PCFB 1KYUA 1YEIH 3K4ZA 2FWLB 1YEWA 1OTTC 3C75A 2N4IA 3DDGA 1YDPA 3IFPA 4A7UA 4JZNA 1BSIA 4FNQA 3J27A 5DXWA 2XG4B 4LSQH 4FXKA 1NDGB 2GB2A 2H41A 2VW6A 3J2PA 4TSAH 1Q1JL 3ZMEA 4L1LA 2CO3A 4L1BA 4X2UA 3BRFA 1OOAA 1DVYA 2WNXA 5AVWB 4P07A 4Q9QL 2BO0A 2Y1YA 1RPUA 1DBJL 1CQYA 4E9TA 3WIHA 4EZMA 1ET7A 5IFAH 4KROB 4AYGA 5A2KH 2GIXA 3CFIC 1PGRB 5EZJA 1QTYT 2E47A 5IHUH 4PJCB 4TXVB 1CLZH 4Y4HB 4YBLC 2Z7WA 3TA4D 3V4PH 5FDWB 1R3HB 4I2XA 2ZKWA 1DBAL 2APTA 4PRPB 2E7LC 5D2LF 5C8JA 2X4TA 3WY1A 5J13C 4KMLB 2ZXQA 4LDLB 5F6HI 1J1OL 1DUYB 1K8DA 2R69A 5E23A 1H0DB 3FT2B 3U7YL 1T04A 2FBRA 4AQ1A 3H6JA 4QHUA 4KO7A 5BMFH 3MA7B 2P8LB 3QJHA 4PJFE 4O2EB 1W0WA 1S7TB 4R9HA 1QO3B 1RVFH 5F9DC 3W37A 4GRMA 3VGBA 5H2BB 5F96H 1E40A 3MCLL 1DVTA 1SLXA 3CPLA 4MCYB 4PWJA 2NY1D 5CKGA 1PYWB 4Y5VA 2X88A 3LN5A 1GAFL 2WLKA 4YFLI 4JFTA 4PRDA 3QFGA 4D8OA 2HTLC 1PTZA 3BYTA 1AAJA 2DYPB 1LQSR 3QIUC 1M56B 1Q1JH 4QRSA 3F8UB 3KLAB 1J1XL 3EYFA 4PVNA 4YL4A 5TE6L 4Q7DA 3QORD 3CX5J 2YD5A 1QOKA 1DBJH 2XWTA 1ADQL 3NSJA 4L4TD 1P5UB 3E6FA 4PAZA 5JOPD 2YZ1A 2X4UB 5CNHA 2F54B 1DCLA 1UG9A 1FLRL 5ALCL 1IGJA 1A22B 1CF8L 3ASWA 3LRSB 3GGWB 5E03A 4P3WA 4LLDB 1DBAH 3NVQA 5D7EA 1WICA 1YMMB 3JYBA 3ZDXF 3RVVD 4PRHD 5CSBA 1J1OH 2AQPA 3U7YH 4XX1E 1E3ZA 3RKDC 4AGNA 3FU0A 3GMLB 4YDLC 4K7FB 3FRPB 3T2QA 3F64A 4WGKA 1FL5B 3SDDC 4UDUA 3DXAE 2OYKA 3UG3A 2AXJA 5A16B 2OMWA 1RZKC 4GS7B 4AE1A 4CSZA 3PXHA 2AJVL 2Q2EB 3F7YB 1NDMB 3MCLH 1UACL 3MREA 3TBYB 3UYPB 4AIZB 4GT7A 1KIQB 2VDKB 2FEEL 3O4LA 5C97A 4QTHA 2PXYD 1XDTT 3H2PA 1RHHA 1GAFH 1I1YB 2X6MA 3RB7A 4ZTOL 2EIZB 4ZMYA 4A7QA 2XTJC 1ASPA 4S1DD 4YBQC 5C9JB 4ABVA 5EEYA 1J1XH 5TE6H 4E41D 3QH3A 2G5BA 2KMWA 1TETL 5EDXA 1KB9K 1ADQH 4CU6A 3QUXD 1YY8A 3B7UX 4R84A 2V17L