1JZJA

Pseudomonas aeruginosa azurin os(bpy)2(im)(his83)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords azurin
publication title Electron tunneling in single crystals of Pseudomonas aeruginosa azurins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 31
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jzjA00
2CJ3A 1WAEA 1A8ZA 3AZUA 1FWXA 3NSDA 5IY5B 3ABMB 2AVFA 4NERA 1M56B 1CURA 1PLAA 4DP1X 1AS6A 1NIDA 3UADA 3WNIA 2XX1A 1V10A 3UAAA 2B08A 2UXFA 3JT2A 2LLNA 4AX3A 2Q9OA 1OF0A 2VMJA 2DY2A 2GSMB 2PPFA 3KW8A 4YSUA 2EIMB 2I7SA 2BP0B 1BYOA 2I85A 3WIAA 5TK4A 5ANHA 4AKOA 2VM3A 1NDTA 2H3XC 3SBQA 3NJJA 3SQRA 3ZX1A 2R7EA 1ASQA 2NRDA 4X4KA 2JKWA 1PMYA 2J56A 2AZUA 4BWWA 2XXGA 1ZDSA 3NJMA 4NAJA 3NT0A 2UXTA 1R1CA 3TA4D 2WO3B 3RYMA 3ZIYA 3FU7A 3TASA 1E30A 4AZUA 2XUWA 1A4BA 2BZ7A 4A66A 3QJUB 5I28A 3X1GA 4E9RA 1SFDA 1ILSA 1J9QA 2UXGA 2XYBA 3ZDWA 2BW5A 2BO0A 4M4RB 2IDQA 1PZAA 1MZYA 2UX7A 3QJQB 2BP0A 4BWTA 4WTQA 5F7AA 1AANA 2BWDA 1L9SA 4YSOA 4A68A 3ABLB 3PAZA 1SF3A 1M57B 2HX9A 2W8CA 4QLWA 5I26A 1E67A 2HLEB 2QPDB 5D4JA 4F2FA 1GS7A 1XMEB 3S8FB 3FU8A 1EZLA 1CYXA 1WS8A 1ET8A 1PY0A 4YSRA 1XB3A 2FQDA 2XV0A 3UAEA 3H56A 4E9SA 5AKRA 4KO5A 1OE1A 4E9YA 1GY1A 2FQFA 3HB3B 2W88A 3V9CA 4UANA 2XLLA 2VN3A 4G70B 5B1KA 4Q8BA 2FT7A 3FSVA 1MG3C 3ERXA 1J9RA 2AANA 4A67A 1PZBA 2UX6A 1TEGA 2OJ1A 2YAOA 3AW5A 3IN0A 1ET5A 1UATA 4CSZA 2JXMA 4ZK8A 4HZ1A 1VLXA 1AS7A 2XWZA 1JXDA 1OE2A 2XXFA 1OCCB 3GXUB 2ZXWB 4DPCX 4AKPA 2A3TA 2OCCB 4G7QB 2WSDA 2B3IA 2YAPA 4KOBA 4UAHA 3FSWA 2IWEA 3MBWB 1MDAA 1TU2A 1DZ0A 4YSQA 1AZCA 4WKXA 1AZNA 4E9TA 2DWTA 1SNRA 1N70A 3JTBA 1OCOB 2IWKA 3IBOA 1BXAA 5FC9A 4L0PB 1GSKA 3PAVA 5B1AB 1JXGA 1IUZA 1J9TA 5TK2A 2EIKB 4QKTA 1A4AA 2CCWA 2AFNA 3X1NA 5I6OA 3S3BB 3CVDA 1NPNA 4KO6A 1E5YA 5B1JA 1AACA 4YVNA 3WKQA 1ETJA 1IBYA 5I5JA 2VM4A 4A2HA 3BVDB 3FQYA 1ADWA 3ABKB 2Q5BA 1JZHA 2FWLB 1HFUA 8PAZA 4BWUA 1BXUA 3N2JA 5B7EA 1CYWA 3QJRB 1NIEA 1AQ8A 1WA1X 2N0MA 4HCIA 1RZPA 4DP5X 1CC3A 1IBZA 4F2EA 1TEFA 1NIFA 1URIA 3UGEA 2HRHA 1ZV2A 3AG1B 1KCWA 3ASOB 3X2QB 3NJLA 3DIVA 4UF7C 2FQGA 1YLBB 2OV0A 3EF4A 3UABA 1WA0X 3NJFA 4DPBX 2XVBA 1WA2X 3FU9A 3GYRA 3NSCA 3NSYA 1X9UA 2VW4A 4K9JA 1RCYA 2HZHA 1ID2A 4A2GA 2I7OA 2PP7A 1N68A 3T71A 2CUAA 2J55A 1NIAA 1OE3A 1ZPUA 3FT0A 3NYKA 3QPKA 4A2EA 3AG3B 4DP2X 1L9RA 4E9QA 3NJGA 1A3ZA 3OQRA 5D4IA 2TSBA 3TU6A 1ZDQA 1JOIA 3CZUB 2QDWA 4BXSV 3CVCA 2J5WA 1A65A 1ASOA 3OMAB 1GS6X 5I6PA 4W9ZA 1AG6A 3AG4B 4HAKA 4AI7A 2IDSA 2FJSA 4EF3A 2UXVA 4PAZA 5AZUA 5I6LA 4DP4X 3G5WA 1DYZA 1V54B 2X88A 2IWFA 3CDZB 1AIZA 4HCGA 5I5IA 1KCBA 1W6LA 1BXVA 1L9TA 3FPXA 5AFAA 4KNUA 1W8EA 2VSMB 3X1BA 4GP4B 3FQ2A 2MRYA 2AZAA 3CVBA 3EH4B 3DTUB 4N8UA 5B7MA 2IDFA 1BEXA 1KDJA 3X1FA 2EIJB 4YSSA 3H4FA 1JZFA 1HAWA 4N4YB 1NPJA 3NJKA 4NB7A 2YAHA 2E86A 2HX8A 2ZWNA 1GR7A 1JZEA 2GIMA 4JHUA 1AG0A 2YARA 1KBWA 3D12B 3NJNA 3ASNB 1W6WA 3T6WA 1KBVA 4MFHA 1QNIA 3CDZA 4JHVA 4YL4A 1SJMA 1PZCA 4YVUA 4YSAA 4GP8B 4DP7X 1L9PA 6PAZA 1GYCA 3OMIB 2P80A 4FA7B 1FA4A 4G7RB 1NICA 2PCFA 1OV8A 3NJHA 3PPSA 1ZIAA 4YSPA 3MX0B 3NSFA 5B3SB 3GDCA 2QDVA 2CBPA 4BXVA 2PPDA 5E9NA 2YAFA 1AS8A 3UACA 2XU9A 3FSZA 1KGYE 2FQEA 2CALA 3ZBMA 2YXVA 4TXVB 1ZIBA 2QT6A 7PCYA 5EHFA 2FNWA 9PCYA 4DP0X 4GP5B 4DP9X 1ILUA 1FFTB 2DWSA 1IKOP 1PLBA 1RZQA 2YQBA 3FYIB 3TBCA 1SF5A 5A7EA 1BQ5A 2YAEA 4W1TA 1M9WA 4GY4A 1PNDA 2FT6A 1RKRA 3X1EA 3C75A 2EILB 3WKPA 5B7FA 3NP4A 2HX7A 4P5RA 2EINB 3S8GB 2H47C 3FSAA 2VSKB 6PCYA 1PAZA 4BDVB 5LDUA 2VW7A 1V55B 2IDTA 3QQXA 1NINA 3EHBB 4GXFA 4ENZA 2YAMA 1IC0A 1EHKB 2FTAA 1WS7A 1F56A 5I6MA 1NWOA 2DV6A 3HEIB 1SFHA 1KV7A 2PCYA 4JKNA 1MZZA 3S3DB 3DKHA 1GS8A 4KNTA 2BZCA 2IDUA 4KO7A 2IAAC 1BQKA 2TSAA 4CSPA 2IH9A 4E9WA 3PCYA 2Y1AA 1JXFA 2JFCA 4RH4A 3U25A 5F7BA 1JZIA 4HALA 2PPCA 5PAZA 4M3HA 4A2FA 3T6XA 3S3CB 3N55A 1OCRB 1ET7A 1SHWA 3FS9A 1TKWA 2PP9A 4BDVA 2PPEA 1J5CA 2GI0A 1NZRA 5B1JC 2J57A 3WNJA 2PLTA 3OM3B 5D4HA 2BP8B 2CAKA 2XV2A 1JVOA 2HXAA 2GHZA 2PP8A 1AOZA 4G7SB 4E9XA 4BK5C 1XB8A 2YXWA 3NP3A 1PNCA 4DP8X 1ASPA 3EH3B 3AY2A 1NIBA 1GY2A 2FT8A 1BAWA 2VW6A 4FAAB 3L45A 1PCSA 1SDDB 3CG8A 1B3IA 1J9SA 5I6NA 2PPAA 4DPAX 1QLEB 2BW4A 2GC4C 1J5DA 1PLCA 1KYAA 3QJTB 1JZJA 1L9OA 2BWIA 1X9RA 1E65A 2BHFA 5I6KA 2DYRB 3OMNB 5B1BB 2BP8A 4PCYA 3T9WA 3EH5B 4HIPA 3OD3A 5I5MA 1JVLA 2YAQA 4G71B 3IE9A 4YSTA 1XB6A 4GYBA 3NJIA 4Q89A 3WG7B 2P80D 1AZUA 2QPEB 3QJVB 4KNSA 3SBPA 2GC7C 2XX0A 1E5ZA 3H4HA 3TBBA 2MTAA 4KOCA 1SHXA 4AKQA 1L9QA 3T6ZA 3KW7A 3ABGA 3IN2A 2GBAA 2Y69B 1OCZB 1SDDA 4HHWA 1NWPA 3QJSB 4F7KA 4YSEA 4DP6X 3FPYA 1AZRA 1AZBA 4E9VA 2HRGA 2ZONA 3SBRA 1JERA 2ZOOA 3PXLA 1BYPA 2X87A 4HCFA 7PAZA 1A4CA 1AAJA 4YSCA 1JZGA 2XV3A 1GW0A 1MG2C 3FQ1A 4KO9A 2WO2B 4HHGA 1OOWA 1I53A 3PLYA 3WI9A 1HAUA 1T5KA 3PAUA 1CUOA 5PCYA 4A2DA 4G72B 1AR1B 1QHQA 4YSDA 1KDIA 2RACA 3FYEB 2R7EB 4P5SA 3T6VA 3BQVA 1PF3A 2H5UA 2DYSB 3AG2B 3IEAA 2IH8A 3V9EA 2GB2A 1BQRA 1NTDA 3FU7B
chains in the Genus database with same CATH superfamily
2HLAB 5IHBA 1XGYL 3AS3A 3PWPD 4P57B 4N85A 3QXWA 3TNNA 3KPMA 1WAAA 1NKRA 1NIDA 2B7DT 4QRQA 2VUYA 3D6GA 4CSSA 3P30H 3QB7C 4K3JL 4MVBC 5HHOD 4JFYB 4KJPC 1HH6A 3B4NA 3VFMB 2BCKB 1P5UB 3WIAA 1JWMB 1T04A 1WZMA 2C9VA 5C09B 1EVTC 1T7YA 2DM3A 1V3JA 3CLWA 2BNUA 2G3NA 1SYVB 4R2GB 3IDNB 3ULVL 1OAJA 2MKLC 2M8XA 4L0ZA 3CFUA 4NAJA 3U48A 3W5NA 3V6OE 3G6JB 1MELA 2ADJB 5GISL 4RA0C 2D2CC 4G6AC 3RUGB 3B9KD 3HN5A 4KVNL 1RU9H 4KKNA 2XYBA 2XN9B 4NSKA 5LCVL 4M4RB 1OP5H 2IDQA 1FC1A 5LBSL 3EXLA 5ILTH 1AXTH 2JJSC 2C34A 3QJQB 3PGCA 4HWZA 2F9BT 4N6RA 4OUOA 3QUYB 4QAWA 3EDEA 2IALA 5DUBB 5I17B 2P24B 5DEFB 3H9YA 5D93C 4DUVA 4BH8A 4OFDA 5HDWA 3IU3B 1RZKH 4WW1A 3H6JA 2G9KA 1E67A 3DXAE 4AJYV 3CFKB 1BOYA 4OCXH 5DZAA 3RRQA 3EOYG 1JAEA 3FQUA 5C07B 5I76A 4I3RL 5HDBB 3VI3B 2QGDA 2DLFL 3N44F 2LOEA 3O6KH 3P11L 5KWYC 3BMVA 5AKRA 1ED3A 1OSEA 1YEHH 3AC0A 5HDLA 3VXSE 3PWVA 1AR2A 1PEZA 1YPZA 1DE4A 3IDUA 4B97A 2W88A 3FTZA 3DGGB 1BZDA 2YKKA 2VN3A 1TJGL 4AT6A 2ATKA 3B9AA 4PJ7E 4YDVB 3ERXA 5TE4L 2WZ5A 3GBLA 1TTBA 3OKDB 3QQ3B 1PZBA 1U3HD 2VM9A 2YC1B 4ONOA 4RX4A 3U46B 4B9FA 3D18A 4XO3A 2Q3ZA 2CMRL 5F3HB 1OTSD 3VG9C 5SX4H 4ZFZA 2JJTA 4YOKA 5I1IH 1FI8C 1KC5L 2X6VA 5HGBB 2XWZA 4UNIA 3W11C 5F6HJ 2WLLB 4DPCX 1C5BH 5DD5H 4G7QB 4HPHA 3UL4A 3EDDA 1UVQB 4NC1E 1E27A 4PJIB 5DC9B 5GHWL 5D7SL 3TO2A 1X7SA 2C4FU 4B9PA 1UM6H 2LFEA 4IBUA 3MBWB 2AS5M 5JHAA 4YSQA 5K9OB 4ELKB 1CT8A 4Z1PA 1NGPL 1FFNA 3L3IB 2NOYA 1PAMA 5T3ZD 5AKTA 1K8IA 2QSQA 3QZWA 2Y22A 3T0EC 3WFHB 2NY2B 1V3KA 1ZXQA 4DZ8A 1GPOH 1DBBL 3ZTNH 4HF5L 4Q9RH 2I5YH 4DH2A 1ETZA 4G59C 3MTXA 4OQTA 3VNZA 2OR8A 4YEEA 2XWBB 1JJUA 3HI1A 3V6OA 5AB2A 1R3LB 2EUZA 2ZP9A 1CR9L 4JRYD 5TDOA 1KN2L 1Q8MA 1JSYA 4NJ9L 3WE6A 3LX9A 4LGSB 1GCFA 4GKNB 1CLVA 4J1UB 4PMFA 1SBSL 3DURB 4YE4H 4TQEL 1GMEA 1M2VB 4FQQB 1WA1X 3JUYA 5EUKB 4AZ8B 1QFWL 2JF1A 4JFZL 1JWUB 3U6RB 5LGJA 4QXTA 5CP7B 4OLZL 3G9AB 5MEPA 1RPQA 3ESNA 5CJQL 3A23A 1A5FL 5EU7E 5AVYB 5FM5M 4ES8A 1KCWA 4UINH 2SEBB 1NDMB 2FDBP 5LLIC 1I85C 4TNWK 1FIGH 1NCWL 3L3GA 4F57L 4RQQA 5CP3A 4DN3H 1WICA 2WLYA 2Z4QA 5H2BA 1RJZB 4AMKL 1KJMA 2H32H 3DXAA 5F1IA 2H2PC 2I7OA 1KACB 3T71A 1FNHA 3T3MF 3VFPA 1NIAA 4GAFB 4OLVL 2FH8A 1U92B 1RD6A 3C5ZC 1PVHA 5DMGD 1OGPA 4OFQA 3RWIB 1CICD 3VXSA 3PIQA 1KTDB 3P77B 3NJGA 5FYJU 4Y5VA 1A3ZA 3Q1SH 3A5VA 3SY6A 5K93A 2J8OA 4GAJH 2BOBB 4FTVD 1HSAA 2JI1A 2VZTA 4PJ7A 1IFHH 3HC4L 2DEXX 4L8SC 4FYSA 4OIFA 3FQXB 1KWKA 2PWGA 1AZVA 3WN5A 4YLCA 1M71B 4NQUA 3F7RA 3L6FB 3B8YA 4NT6B 3GPEA 4JFEB 1J48A 4WFEE 4RSVA 5FM8A 5E4IA 1IQWL 1AD9B 5D1QC 4G8GB 1MVUB 3KYMA 2YHGA 2HWZH 4W9GC 5AZ2L 4JN1L 1UA6H 4M7ZB 5I9QC 3D2UA 2VZVA 1PQZA 3FT4A 2CJSA 2ZXBA 4BHUI 2AZAA 1UWEL 1FVCA 4JL1A 3RGVA 1BEXA 1RSFA 1E42A 4M4PA 3ZE2E 1LO4L 4LASH 5C2BH 5DDHA 4DKEH 3MNWA 5T1KA 1WHOA 4W4OA 5AD0B 5DRNA 5IZ7A 1OP5K 2BS9A 4GG6E 4LXFA 2YAHA 4F24A 1KBPA 3QDJA 4UDTA 1E8WA 4TVPH 1XCTA 5EOCH 3ZMEA 5F7UA 2EUWA 1OCWL 2OYKA 5F9WC 2BY3A 3NJNA 5GS0L 2HT4C 2BVYA 3E8VA 3KPOB 5CEZL 2HPTA 1WITA 4ZXBC 1LO2L 1WFTA 4LCCC 1JHKH 1C5CL 3BWAB 4OF3A 1E3FA 2BVPB 3E1F1 2XIBA 1NH6A 4J28A 3NN8B 5ECJE 4HEPA 3CWGA 1NC4B 2IV9A 1GYWA 1O7VA 1NMCC 1W80A 3HB3D 5L88H 2XVGA 5CGBA 4U4IA 3CJJA 1RUPH 4DW2H 4Q0XH 2ZYIA 3O3AA 2ZOTA 3KYOB 3RFZA 1ZOXA 5IMOA 3O9WB 4G7RB 3F64A 1PZ5B 3FCUB 4L4TE 1CXLA 3VMNA 4DEPB 4J4PC 1MOEA 4JZJA 3PPSA 4XI5D 1U8KB 2PR4H 1EANA 4YSPA 3BP4A 1I7TA 2B1OA 4PP1D 4G1EB 4OAWB 4TUKL 2CO6A 3DBXA 3OJDB 1DQDL 4U31A 4G7YL 3SKNA 3DGDA 3VXPA 4M1DL 4WUKL 3JVGA 5DWPA 1HVXA 3U9UA 4KKRA 4LLDB 3RAJL 3KGRA 2B20A 2BXZA 3T04D 4YHML 5IB1B 2B4CC 3RL1B 1QTSA 1OTUC 1ZPLA 2ZCKH 5CD5C 1DN2A 4PJ5B 4XMWA 4DERA 5T1JA 2EDKA 4EI6B 3S88H 2E6JA 1WWCA 4GJTB 1TETL 3LH2H 1BQ5A 4MMXA 1MF2H 5DK0A 1NGZB 3L3KA 1PS3A 1D6EA 1A02N 4H88H 3TWCH 4JM0A 4Z7QB 4PJAE 3CFCH 1MRDL 5GJSL 2AXHA 2UZXA 1YY8B 4CA4A 4QNPE 1UM5H 2IMMA 4JDEA 4JHBA 4Y5YB 4YN3A 4FQ1H 4GQQA 1HCYA 4BA0A 5C7ZA 2R69H 1C12B 3QR0A 1J86A 1DJWA 1ES0A 3TCTA 1NDGB 4RBPH 4IBVA 4G6ML 1L6ZA 3VJ6A 1FFOA 4M8QA 3ATDA 4E9WA 2K6WA 3PCYA 4LVOB 4WJ5A 3RVXC 4F58L 3O6LL 5JIIA 4E68A 4MMZB 4XE0A 2EEDA 5SX5H 2KLRA 1FFPA 3O0RH 1E9OB 3KVDD 4PJHE 1BD2E 4D8PA 4ZOAA 2NXZB 4G11A 3KJ4B 1HL4A 4GG6A 2CJTA 4P2OA 1ETB1 5IEHB 3IFLH 1WEJL 3P3RA 5EA0L 5HVHB 1WAPA 4IEFA 5I19L 3B7TA 1IE5A 4NQCE 4C55A 2I9LA 2FEJA 2HJFA 2WLKA 2HN7A 3N1MC 1QWUA 3MCG1 3A67H 5D7JA 1J5CA 4XNYL 2DTML 4FG2A 4XCFL 3S9DB 5I16B 4TSAL 3NIDF 5DVLA 2A6KB 3IMVA 4BFJA 4FHJA 1IIKA 2VUKA 2JI2A 2YD7A 5EU6B 3D87B 4QXUH 4WW2A 43CAB 1V8HA 1DJXA 4QR7A 1LP9B 3SBWA 1NL0H 3PREA 3RPBA 5IJDC 1W72H 4QWWD 1TOXA 2ICEC 2WYHA 4ONGL 4YHNA 3U36B 4DGWC 4YFEA 4WFGD 2MOQA 5TH2B 3WJMA 3AY2A 1URLA 5BUPA 1C7TA 1JIBA 1MIEL 1MUJB 3ATBA 3MODH 4L4TA 4M5ZL 4APQC 2BRQA 5AYUH 3GQFA 2XFXA 3BZFA 4JDZB 4NM8H 4HHAB 3L5IA 3QAZC 2A1WH 4JFPA 5HHMD 1JPTL 3QIBD 1PLCA 2MTPA 2VITB 1O7DC 3QJFB 2VSCA 4U2YA 4QHUA 1B0RB 3CH1B 1AQKL 1MRCL 5G5DA 3VD5A 1PPIA 3L2MA 2AEQH 1B9KA 1N59B 1HTYA 5B1BB 3TTYA 4KJQC 2FBOJ 1U6AH 1AO7E 3FO9B 3DOHA 3Q2LA 5HDQL 1IBHA 2ZXGA 5BO1L 3UEZA 4A7TA 1FORH 4FEIA 4GYBA 4AC4A 3WG7B 3H42H 1N0LB 4HPYH 4BZ2A 3DSNB 2BSRA 3UBXG 2R1YB 2BP3A 2V6HA 3P4NB 4YHLL 3LKSB 4XPAH 3WY4A 4C4KO 3ESVF 2VMDA 1UHVA 4GXUN 5DUPL 3S35L 4KZDH 5JIDA 2BERA 3M7FB 1A9BA 4OZIE 4FNRA 4GKZA 5J11B 3QE5A 1P2CB 1HHIA 4HJUA 1U2CA 3GSQB 4I4WA 4YDLC 3MKGA 3L1FA 5EOQH 1AFVL 1NMBH 4E0RA 4MQ7A 2FGWH 3KPPB 3Q3GB 5J9PA 3TN0C 4MKTA 5IVZB 3QCTL 3MQIA 5BO0D 4B3EA 3GS4A 5KSAB 1S7WA 3EFDL 1JGLH 4KO9A 3NA9L 2B2XH 3FHEA 4MTMA 3QUMB 3K91A 2OL3A 3MOAH 2BVQA 4ZO7A 3ZSTA 1KOAA 1LK2A 1IL1A 4G72B 5JXEA 4Z76A 5IB5A 2GK0B 2DQJL 5L9DL 3GM0A 2BY0A 4U1JB 2NX5B 2XTJB 2VR6A 2PO6B 4PJHA 1BD2A 4RMWA 5F9AC 4XNMB 1BOGA 1YSOA 4DOHE 4WUUD 2ITFA 1VF5C 1DFXA 2YEZA 2Y6SC 4NQCA 3KPLB 4J39A 5JUEH 1I3RB 1FWXA 2AVFA 2AITA 1I1RA 3GZKA 1CURA 4JX0A 4JVUA 3DXAD 2CDGB 1FE8L 4NQXB 1EVUA 3I75A 5I1LA 1ZVHA 1QTYT 3EYFB 3GJFH 3LKRB 4L9DA 5E08H 2DQTL 2X42A 3D0LA 3ZDZB 2XWRA 3UERA 2OMTB 3D06A 4JHZA 1ZLUH 3H0TA 5HYJD 3ULSB 4JB9L 4XO4A 5ANHA 2Z31C 1HX0A 1WZLA 2CO7B 4I0PD 1BZ9A 4O2FB 2G4GA 2J56A 4ODWB 1HHJA 1VFMA 2AZUA 2L3BA 4A2MA 1HK6A 3QQ9D 2P26A 1UEYA 1CK0L 4PCSA 4WWKB 4MDJB 2QFRA 3HTLX 1CFBA 3NACH 4UIMB 4JQVC 3DMMC 5FO2A 2WTRB 5A16B 4C8XA 4H25B 3KPQA 4U3SB 4FXGA 3KPTA 4FYRA 4IYKA 3VFUA 5DK2A 3FB7B 3M8OH 1XIWA 3WBDA 2Y1YA 1AGDA 1X5ZA 3SE6A 1AO7A 3H3PL 1FJ1A 4RBPK 1J11A 4KK8C 3V7AE 3LXUX 3RGVD 3I9GH 1I3GH 5A6MA 4JFFB 3DVFA 2WXLA 5CJBA 1P4BH 5DD3L 2H0EA 1IBBA 4WSKA 5GS1C 3BAEL 1QFHA 1MJ8H 3QDJD 3L48A 4YSOA 4MQSB 2AJUL 4ZT1A 1IGIL 4HD9A 1GL4B 2QADC 3KPRD 4O4YH 4OZIA 2XG5A 1CLZL 1YG9A 1RZKC 5D71L 3HE7D 4YDJA 3D09A 3CXHK 3MRGA 3V79C 3MUZ1 2V2XA 1MFAH 3WNNA 4ZFOB 4MDIA 3WLWD 4EAEA 5IFAL 3N1FC 3LEVL 5ADOH 4YXLH 1X4YA 2YSSA 4OIIH 3L95B 5I6XB 4PGCA 2FQFA 4Y8AA 3UBGA 2XLLA 4FFZA 5KZCD 1CXIA 5B1KA 4DVBA 3ARPA 1RUQL 2WTOA 5C6PB 3ZTCC 1FNGB 4TSBH 2F54A 5CD3B 2XDHA 4TQIA 3LEXB 1MCRA 1SOKA 4R8WL 5AW2B 4A7GA 4KMLB 4LCVA 4HWBA 3BEWA 3QUXD 1F3DH 5IFHL 4XZUB 5IGXL 4KUZL 2Q7YA 1HL9A 3FCBA 3SYAA 1ZLVK 3DROB 3V4PH 1R5WB 3L7EA 5E6IB 1CDJA 3NVQA 5EF2A 2QR0A 2P3YA 4MXVF 1CFVL 3IFNH 1VADB 4HLEA 2Q86A 1QEWA 2LR4A 5AAMC 3FQ4A 3V0HA 1CZ8L 4AM0Q 3BZEA 5FC9A 3A4FA 1U58A 3MLXH 2VIRA 5B1AB 3TT3L 1XCXA 5GS3A 2C4FT 3HG2A 2A73A 2NYKA 3GBNH 2YBRB 3ROOB 4EMZA 1JNNH 4Y19B 1DQVA 1MQKH 4Y0GA 5DHYB 4Z78A 5CIPB 1LO5B 1TLMA 2X0VA 2HT2C 5D1XB 4U1MB 2Z93B 4GKSA 4DTGH 3ES6B 5GQBA 3VB9A 4RGOL 3OXSA 3VWJB 1WV7T 3GZQA 3V5DA 5LJYH 1P4IH 2EXSA 1WT5C 4R96B 2BIQA 3CVIL 4FQ2L 2J5LB 4GRLD 5CJ8A 4AW7A 1JV5A 1GJIA 3QUZA 3TNMB 1CC3A 4F2EA 4W68A 2FVNA 4XCNA 3QNYA 5JOFB 1NIFA 2DPKA 4LARL 5IV2A 2NNAB 4L3EB 1YVLA 1GZPA 4KWUA 4ODUB 5FEBA 4XX1G 1E4WL 4PJCF 1Z2KA 3L3HA 4PV9B 3AU0A 1R5VA 1CTNA 5EDSA 3RDTC 4QRTB 5K9JH 3FL7A 3UABA 3F58L 1K4CB 3FCSB 4A38A 4DPBX 4JG0H 2MPVA 3FULA 3OR7A 3GS0A 1D7FA 3O2WL 4MMYB 1JTTA 3BVNA 1MJJA 1KXTB 1CGYA 1OAQH 2NY4C 4CVZA 1T66D 4FQLH 2VLKB 1SJXA 1A7RH 5L4MA 1ADQH 3LSOA 1GZHC 1NBZA 4AGOA 4DPRA 4HP5A 1GHFH 5D1ZC 2GSGA 3VQ1C 4MCZA 4NJAL 1DQMH 3HA0A 5DJCB 4HKZA 3VXQA 3GRBA 3NFPA 5DVKA 4J3TA 4DCQA 1U93A 3SY0B 2AMGA 5LCVA 5E5RB 1T1WA 5FKPA 3AFLA 3BJLA 1I9JL 5LBSA 3GJFK 3Q1EA 4PGBB 4GB9A 5SV3A 3NZUA 2QELA 3VFWA 1WJ3A 5LB1A 4N3UA 4WEBH 3S36L 4G9DA 4JZNA 5I6LA 1E3XA 4AQ8A 1A4KA 1NCCL 2AK1L 4FTDA 4LO9A 3AABA 2X88A 3NTCL 2F2HA 3FTYA 4AYDC 1YZZA 2UWEB 3PQYE 2A6JB 5CNHA 1K5NA 5C0RH 2WXJA 3TEZA 1D5BA 3ZK0A 5AFAA 1MCFA 2IC2A 4J3UA 1BVKA 5DS8B 3DTXA 5HHVL 2K3HA 2DWEA 5D7IB 1JE6A 2KPWA 4BUQA 2AJYL 4NEHB 4ZSOE 5I1AA 4HYTB 5C08E 2E86A 5GRUL 3UYRH 3PFUA 3O3DA 1TJHL 4N8VA 3SOTA 1H8SA 4C4UA 1L0YA 5I1EH 2Z64C 1MFUA 1WVZA 3BWUC 4Y2NA 3PL6D 3IDMB 4NLHA 1MFDL 3W5MA 4N0FB 3UPCA 4M48L 5E03A 2COVD 2ED8A 1CE1L 1UXLA 3C6SA 4JDVA 4NX0A 5K9QI 2V7HA 4M29A 4L1TA 3UIZA 3TF4A 3WXVL 3L5XH 2Y9RT 3K3QA 4PN6A 1OP3H 1MY7A 1NUNB 1RL1A 1T0NA 3INUH 4LHUA 1YAZA 1SJMA 2ZUXA 2H0PA 1NCAL 2F15A 5AZEH 6PAZA 3SDAD 1NBVH 3VXOB 1KXQE 4KQ4L 2C8NA 3TO4B 1FV1A 5IIEA 3WXWH 2H6OA 1NANH 2YBGA 4J6IA 4LEXH 4ZS6C 4MAZA 5JXED 4LSRL 2AQ1A 2XPGB 3CDYA 2WWNA 1ODAA 5CCHE 2GJ6B 2EYRA 4BXVA 4NO0B 3DRQA 3EFOB 4EUPG 1BD2D 2DJUA 2EABA 3PPEA 3U7AA 4X5XA 2D0FA 4ZX4A 2OJEB 2OYMA 4RA3A 2YMTA 4HUVB 1UJTA 4JG5A 4NQCD 3WGVB 3VE0B 3O11B 2DDQL 5FGRA 1KB5B 4G7VH 4F9PA 2VN7A 3EYVB 1YHPA 4NDMA 4MCYB 4NN7B 3TBCA 3WSQH 4HWEL 3S5LA 3MO1A 2VN6A 4NQEB 5DD0L 1T80A 1BJ1J 4ODXB 3SDXE 3ISRA 4GAGH 2DQDH 5HPMA 4FL4C 4M61B 1GCYA 5A6IA 1ML0A 2XJLA 4Y16B 1FBIH 1PZ3A 4MS6A 4U1HA 3AS0A 3UTQB 3RWJA 1H8OA 2X4PA 3U0WH 3ULUC 1NCGA 3S2AA 1DN0B 1T7VA 2PW2A 3X3GH 2QFPA 3QUML 5E5LA 3N3EA 2OMXB 1EHKB 1SN5A 3MRCB 1WS7A 3PQYA 1BQHA 4UTAL 1BQLL 1QLRB 2X10A 5I6MA 3ZKMD 1N5AA 3WY1A 1RZGB 2G60L 5FYJE 3RHWF 4ZMYA 2BZCA 1XIWD 3F65A 5GRWA 3QA3B 2IH9A 5T1LD 1MCKA 1Q38A 4XBEH 1CG9B 3SGDH 3QYMA 3TPKA 1JBJA 3QFGA 5C0CE 1KTCA 5SWQB 4ZSOA 2BY1A 3RFRA 3S48A 3EJCA 1UUNA 1NBCA 5C08A 1AKJB 4HS8L 1RPUA 3C9NB 1H5BB 4P46A 1IC1A 1OCRB 1F4WH 3BUBA 4WFHE 3RPIB 2F8IA 1TKWA 2N1TE 2PP9A 4HKXA 4V1DE 3U82B 3HHSB 2APVA 2DJMA 1TQBB 4X98B 3LN4A 1DLHB 1TTFA 2VOTA 5CJXA 4PBWD 5I0DA 3C8DA 4OM1H 1IAOB 4P59L 3GMLA 4IGBC 5CWSB 3UTZA 1MNNA 1NAMB 2VC2H 3VWKA 1IB5A 1RUKH 1SUJA 4OFYD 5DLMH 1HKLL 4NZRH 2QBWA 3LIZH 3LD8B 1KPUB 4QXGL 4BBWA 1W0WA 1KXQA 1GY2A 3LKPA 3WFCH 5A2KH 4OLUL 1IBGL 2MEJB 2WC7A 3JWDL 1M6OA 3UBFA 2JIXB 1QSFD 1MI5B 1AHWB 2AV1B 2F54D 2YWZA 3J07A 3O3BB 1FNEB 3QR2A 3R06A 4AEFA 4CKQA 1OGTB 2H1PL 3OKKA 4CMMB 2LTQC 2GC4C 2NY1D 3GSWA 2WY3B 1J8RA 4M62H 3HR5A 1YEGL 3IDIA 3NJXA 3CFQA 4ZMOA 4X6CB 5DQJB 1RH8A 1XSOA 4YH6A 1DQQA 3JVFC 1A66A 2ROYA 3IPBA 3THMH 1FNSH 1G9NH 2BFVH 2F7QA 2OBGA 4YSTA 2AQQA 4ELMF 2XX0A 1XCQA 4G8IB 5C09E 1E5ZA 1Z0MA 3V6ZA 3KBFA 1IKFL 1S7RB 1SHXA 1L9QA 4XZ4A 3IN2A 4MNGB 4PU2A 3NZHL 3SDXA 2WXKA 4LAQL 4WY7L 4ONFL 4UV7H 4F15C 1AZBA 4TUOB 2JCCF 1YUKB 5IMMA 3UMTA 5EORH 5H94B 4ZFOL 1D5XB 5DHDA 4OR1A 3O4OC 3LZOA 4GPVA 3B9KC 5E4EC 2XN9E 4YDIH 2NTFB 5JHDB 1AE6H 4PJAF 3SD2A 4K7PH 4Y4FD 4X80L 5E5MA 4PGZA 1YYMH 4ZQTA 4ZAKD 1XDTT 1OP3K 2ZJSL 1AYRA 2YN3A 4IW4C 5KS9B 4N0RA 3RVUD 4G80B 4FXLA 3EGSA 2DQUH 1KGUA 4DWHA 4F92B 5KVEE 1VRSA 1XL4A 3VQMA 4NRXB 2R7EB 2YGQA 2W0FB 4WO0A 4PJEF 3RX5A 3S34H 3HUJF 1KGJA 2ZE0A 5C0CA 5KTEL 5C8JA 4KRPB 4L4VB 5ADPH 1VEPA 4D2NA 3QI9C 1M53A 4KKCD 3TBSA 5HDBE 1AH1A 4K7FA 3RWHB 2X6AA 5MENE 3ULVD 2A9BA 3VI3E 4V1DA 1VB9A 3NRFA 4WTZG 3SE8H 3SSGA 3WNLA 1M56B 1AI1L 1PLAA 1QR1B 2XX1A 4BK5A 4PJBF 2NCEA 1A7NL 4NNYB 3WS6A 4P5TB 1CGTA 1MCHA 4P23B 1U3YA 12E8L 1ZA3B 5E2VH 2ESVA 4CNIB 5EU3B 1T5WB 4JANA 4AT6B 2UZYB 1YRKA 2QKSA 3PGDA 2RQ8A 4GSXA 2MHAB 5F0LB 2AV7B 5D7EA 3CZKA 3QIWA 1I1CA 4B96A 1OTSC 5A2AA 2XXGA 3NJMA 3U4BH 2ZKWA 3CMOH 5KVFH 2UXTA 3LXAA 4JM2F 5ESAA 1FPTH 3BRDA 3TASA 4M8VA 4FXTA 4P57A 4K94H 2WXMA 1KCUH 4OUUB 4PJIE 1CVSC 1F6AB 4UZGA 1PX3A 3BPLC 4JK0D 3VM5A 2M2DA 4GBXB 1YEWA 3TZVA 2XQYG 1HZKA 3F8UB 1D6VH 4JFYA 2MNUA 3VFMA 4A37A 2BCKA 1P5UA 4M3JA 1JWMA 3OGCB 5C09A 3TYGH 2AXWA 1WIUA 3MOBL 1YQVL 1SYVA 1JPGB 1TZIB 3IDNA 4PSPA 3GO1L 4P3CH 4LCWE 2E8YA 2VDMB 5F44A 1FAIL 5IBLC 2X9WA 3CHQA 2QPDB 3G6JA 2ADJA 1HEHC 2ZX8A 3PWLB 2YFNA 4M1GH 3ZQ9A 2W9EL 5J4MA 4AVIA 2WUBH 5JMRA 4LSDA 2IGFL 1MVFA 2VO5A 2XN9A 5CSGA 4FJYA 3L2LA 4M4RA 1DVFD 3KLAB 2Y23A 4OF5A 1G9EA 4NQSA 4W9DC 2WWMD 3CLFL 1T7XA 4R7DB 1T6WA 3EYUL 2NR6C 5IWLC 4XMTA 4JPQA 3OPZL 4NI3A 4P5KA 3QUYA 3RZWA 2W94A 3ALXA 5DUBA 5I17A 2P24A 5DEFA 3A24A 5FM4A 4ALAH 5B3JE 4ZUTB 4ERSH 1OO2A 2AC0A 4DGYH 4YC2B 4XHQA 5I74C 1GGYA 1PX4A 2P5EB 4HFUH 4PG9B 1TZOA 4ZK8A 1N18A 4NNPL 2OLDA 4KMQA 3QS3A 3CFKA 1C1EL 3EIFA 3WKNA 3ZZSA 5MENA 5DEJA 3VI3A 4D9QD 4KOBA 4WSGA 1TMQA 3OHXB 4PWHA 3AB0C 5KSUA 3UC2A 3NG5A 4V11A 5DMGC 3FSWA 4N90E 1MFEL 2CHDA 3QWOB 3DGGA 3VXRE 4PRHB 2ZCLL 3BESR 1N64L 3JTBA 3IBOA 4P9ML 5KBNC 5D93B 3EJYC 3ZTJH 2NY3D 3KVPA 3OKDA 3QQ3A 1FCCA 1FLRH 3U46A 2YC1A 4NQVB 1NFIB 2W60B 3GLZA 3LQAL 5F3HA 2C3XA 2EKSB 4JFEE 3WMPA 1IC4H 3WO3B 3RVTD 1WFUA 1AGBB 2XI9A 2YIHA 4A6YH 5DT1L 5HGBA 2D9CA 2J3SA 1M05A 4AYBA 2ZCZA 2WLLA 1I82A 4ZPTA 4OFKA 3SQOH 1E5CA 1DHKA 2H0FA 3M1BB 1JGIA 5HVFB 1H6UA 1J1OL 4O02H 4MXWH 2EIBA 3ABKB 5AALA 1UVQA 4ODHL 4PJIA 3OC5A 4NWUL 3PQYD 4LE8A 1I7RB 3MBWA 1RHHB 1Z32X 5K9OA 1AQ8A 4ELKA 3KWXA 2G2NA 3L3IA 4X0KA 1G6RH 4Y7OC 2ZWYA 2WQ8A 2JCWA 2V3EA 1QSVA 2BM3A 4W70A 3VXTB 3ASOB 4MLIA 1EBPA 3B2VH 3II1A 3WFHA 5D2LB 3UAFA 1NLDL 1TFHA 3MHZA 5DZPA 4XPFL 4NM4H 4KBPA 4DFHA 3DSFH 4P46D 3AGVA 3CZFB 1HJBC 1QAWA 4P49A 4PD4K 3QEQB 4GRWF 1KB5L 5DD6B 2QHRH 2HZHA 4ZW8A 3TEYA 3HOGA 2PXYD 4N0UB 2K78A 1F2QA 1SRDA 2WB7A 4GKNA 4J1UA 3DURA 3MRJB 1D5IH 4BA8A 2QVTA 3VWKD 2VKWA 1M2VA 2IDCA 4FQQA 5B3NA 5KG9B 4POUB 3HE6B 4R3SB 5EUKA 5JW4M 2WVVB 1JYVA 4HT1L 1LLAA 1JWUA 1RURH 1JDCA 3U6RA 5CP7A 4PP1C 2VZUA 3B6SB 4LP8A 1DBKH 3B9VA 3X14B 1A65A 1PZSA 5I6PA 5BZZA 2J5WA 4IM8A 3WJLC 3AY4A 2SEBA 1L7TL 1NDMA 4OF6A 2IGTA 1B0GB 1KBGL 1Q94B 1TJIH 4YDKH 3SO5A 1FG9C 2KC0A 3CDZB 1RJZA 4LNVA 1BQUA 5CF3A 1W6LA 3D07A 4OGXH 5GS0D 1A25A 2OA9A 5IIEB 1X6NA 2BHYA 2AK4D 2NY5H 3X1BA 5CEZD 1VKXB 2ZOKA 1U92A 4LLWA 5L8JB 1MHPH 3MLYH 4CN6A 3I02B 5DF0A 5TQ2L 1FF5A 1DJIA 3CHRA 3RWIA 2Z7WA 3CXFA 1KTDA 1MCPH 2D7QA 1IC7L 2JSFA 3P77A 5IHUL 4F8TA 3PAYA 2AI0H 1YECL 3MACH 3B2DC 2LFGA 2BOBA 4QHPA 1GR7A 1OAYL 3KLHC 3FCGA 3WTWA 4XR8C 3RE0A 4RFOH 3RA7L 1KBWA 4PGEA 3QRBA 1OSZB 1Z0NA 2XG4B 3T0AA 4KK5C 5AL8A 5DVPA 4HJJH 3L6FA 4CN4A 1CD1B 2CJUL 3ZR5A 4NT6A 3OLIA 4JFEA 4OZHF 1NAML 1AD9A 4YK4C 4OCWH 2EDHA 2Z1KA 3C5ZB 5I8KL 1CDYA 5F96L 1NJ9B 3ZN6A 5CINL 1L9PA 4Y1AD 3C6LB 4OCYH 3U6XS 1U3ZA 4AY0A 3VD0A 2WJ7A 4J2QA 1GC1C 1YY9C 3IK2A 1OGAB 4HIXH 2MCG1 4N2IA 5BQDA 3N41F 3ESMA 4PRDB 4UU9B 3S3PA 4N2DA 4PRID 3WIHH 5H4ZA 1Z3GL 4P04A 2BVOB 3ARYA 1MJ7H 4KROD 5JIKA 4BCXA 4HA1A 3SPHA 1S7VB 2IF7A 1CU4H 1KGYE 3HHRB 1UKQA 2X89A 3KPOA 4XVTL 3AITA 5D1QB 2VRAA 2Q8AH 3RX8A 1V3MA 2BVPA 3AXHA 1I7UB 5E1HB 3DO7B 1S46A 3NN8A 3JYBA 5I23A 1NC4A 1O0VA 4PJ9B 4PY7B 3ZL1A 2R4SH 5HYSG 4UB0L 5ENWB 1QFUH 4ESKA 1LK3H 2G5BB 3KYOA 2CKNA 1I8UA 3D3VD 3O9WA 4FFZH 1F3JB 3TBWB 1PZ5A 2ESVD 3BLBA 3ARFB 1J8SA 3UJTL 2W59A 3MREB 1DQIA 1U8KA 2FEEI 2QZ5A 2D3LA 1BQSA 3C75A 4OAWA 4UM9B 3OJDA 4LU5H 4AYID 3HR6A 4E42A 2Q8BH 3S4SA 2Z7YA 1XVSA 3FQRB 1IAIH 2A0LC 2WXQA 5C7XL 6PCYA 1BBDL 1TTCA 1EJ6A 2JJTC 5C1MB 4YHOL 2BPBA 5IG7A 3F01A 3H3BC 3KYKL 3K4AA 3UO8B 1TTGA 5T3XH 2IDTA 1NMCB 2IOIA 1AQDB 5IB1A 4WHCA 3ZT6A 5J1SC 3RL1A 1PFOA 4NKIH 2AW2A 4HGKC 1KV7A 1GS8A 2WAQA 1KZQA 1EK3A 4KO7A 5DLLA 4EI6A 1RZIB 3MRKB 4NHCH 4U1NB 4QEGA 4PQXA 2O5NA 4YAQB 1NGZA 5AUMB 4H20L 3SYCA 1H3WM 2K7QA 1P6FA 4J3OH 4K2UL 3FTVA 2PPCA 4UV4H 5IVOA 3WJJA 3NCEB 1SVCP 3VA6A 4Y5YA 4JO4L 2DQEH 2GI0A 3CZNA 2DMKA 1C12A 5HYQB 1R4XA 3V6OC 3OBAA 4JPIB 1NDGA 3S37L 4FRWA 1EAOA 4POZD 1MCDA 2XN9D 3NCXA 1S5HB 2KZ1B 1Q9WB 5ESVB 2DOCA 2EH7L 4ZO6A 3JUZA 4MMZA 5AW6B 2H4EA 1XH3B 2NX5E 2XTJE 1KPRB 2GTQA 4N2GA 1E9OA 2Z4TA 1CFTB 2EAEA 4LHJB 2C1PB 1NC2B 2F0CA 2J1WA 1YMHB 1BFSA 3IFPB 3RGHA 4OT1H 3QUYD 3QZNA 1EJFA 5IEHA 4AL8H 1J9SA 5I6NA 2ZQKA 2NZIA 3QG7L 2C5DC 3CFEB 2DRUA 1D5RA 3QQ4B 4KPHH 1EFXD 2BHFA 1AIFB 4G6KL 3BKYL 1UZ6E 1YEJL 2FWUA 3EYSL 4NFCA 3GSUB 3M46A 2A6KA 3MRBB 1O6SB 2K70A 4FQIH 4YDNA 5C07D 2WZPA 43CAA 4DNLA 4WFFE 1XAKA 5HYSB 3MYJB 1XHHA 4MJ5B 1A64A 3ZDZE 4WU7B 1LP9A 1BAFH 1Z9OA 5D8JH 3V52H 2GEQA 2XRAH 3Q48A 3TJHC 2Y25A 2D3VA 1OY3B 4JMXA 4UTBL 5TH2A 4HQQL 4Y5VC 2NY6B 3ZDYE 4PJGE 4ZUSB 1MUJA 5IB4A 3WFBH 4H26B 3UPRB 2VZ3A 1PZ2A 4KHXH 2VDML 1OCZB 5TPWH 2EXTA 32C2B 3RZCD 4H40A 3P0VH 1XH2A 4MJ4A 3QQ9C 4JDZA 1TZGL 1K8DB 4HHAA 5JHLH 3WN5C 1Q9OB 3GI9L 3J8F7 3LDBB 2VITA 1OSYA 3QJFA 1NCHA 3MRLB 1B0RA 3DWTA 3CH1A 2XN2A 2ZZUT 3DX8B 2O5XL 2ADGB 3V4LA 1N59A 4H2CA 3QJXA 4X8JB 5A2BA 3UTOA 1YNKH 3IBEA 1S3KH 2XV3A 3K71B 2Q20A 1JYXA 4NUGH 3C5XA 2VERA 3RGVC 1OKEA 4NC1C 2N0KA 4W4OC 2CIIB 5H8DA 3DSNA 3IGKA 4JDTH 2R1YA 3P4NA 1IAMA 3LKSA 4F9LA 4BYHA 4Q74A 1U8LB 1U30A 5AW5B 1PF3A 4ZTPH 4S1RL 1E6JH 1KCSL 4HS6B 1IM9D 1P2CA 3GSQA 2AJSL 2E9JA 4MZRA 2DMBA 1YYLL 1LEGB 3NIGE 4YXHH 1E6OH 5C71A 4B9JA 1A8ZA 3KPPA 3Q3GA 3SCMB 1KB3A 4OZGE 5IVZA 2JKIS 5I18L 3F7VB 3UADA 3FUFA 1THCA 5KSAA 5E7BA 3BKCL 3VD1A 1UWGH 3VU1A 3QUMA 1E4XH 2ZX9A 2VXSH 3RTQA 4XNUH 1HU8A 1KIPB 3KW8A 3RFZC 1QATA 1SLWA 2GK0A 4M3KB 3DRTB 4K3EH 4DKDC 4YEFA 1DBML 4JZJC 4OJCA 3C09C 2NX5A 4U1JA 4PJFE 1XEUA 1RZFL 2PO6A 4X4KA 3QIUD 4XNMA 1RMFH 5EU7C 3EBGA 1I3VA 2DQFB 4H8VA 4I9XA 3TA4D 3JVGC 3WOVA 3ZIYA 3ZHNA 3WIIH 3KPLA 3AREB 2VL4A 3PG2A 1KGIA 1I3RA 5JOEA 5I28A 4K94C 4JG1L 4N9OB 4Z0XA 2CDGA 2PTTB 4FQPA 4NQXA 2BJMH 3L9RB 3LKOB 5AVSB 4Q6IB 4QUOA 4PP2B 1CD0A 3EYFA 1GTFA 2RH0A 3LKRA 5TFSH 5BV7B 4I5BA 2NDGA 5LN8A 3K2MC 2OMTA 4N0YL 4MMXC 1DJYA 3V55A 3DVNB 2YRZA 5GZND 1H0DB 2CO7A 4IQHA 4JUSA 4Y19E 1SJHB 4O2FA 3OSKA 4PJGA 1XGQB 1OZUA 4ODWA 3WKYA 5A40E 1F4XL 1SF3A 5IQLA 5D1XE 2Z8VC 4NO5B 4R5XA 4WWKA 4O51A 4MDJA 2E7BA 5F0PB 4HK3N 4UIMA 4IKLA 4XMPL 2WTRA 5A16A 2VH5L 4GIOA 4XO9A 3S8FB 2BC4B 4U3SA 1ZS8B 1G7IB 4L48A 4LFHG 4G8GD 2X0UA 3IS0X 4H0IA 5E99L 4TTGA 3IDJA 2VQ4A 4BZ1L 4JHAH 3X3FL 1F42A 1FGNH 3H9SD 4R9HA 2W9DH 5DMYA 5C0IB 1J87A 1U3JA 3CZSA 4L3EE 2IPUG 4B9KC 5G4OA 3VI4B 4XMXA 5FECB 5IJVB 2ZWZA 2F8OA 5EEZA 2O30A 2BIOA 2Z35B 3JTSA 4KTYA 3MAWA 2HP4A 3CU1A 4AV5A 3LPFA 4KC3B 1TEGA 2VR3A 4P2OC 3VG0L 1UC6A 4KMTH 2OMWB 3E6FB 1T7ZA 3TBTB 2X89D 2ZTBA 1OE2A 5D7JC 2CK0L 2ILLA 1JF6A 3L3DB 4R26H 2VQUA 4ZFOA 3RVVC 1LYQA 2APTA 1DQLL 4OZGA 4NPYB 4UAHA 5C9JB 1IAIM 3J2PA 3AVEA 3L95A 4WW2C 3T65B 3EO9H 1LDPH 3SBWC 3RQ3A 4JO5A 1I9IL 4GI6A 3TEXA 2WINB 5E5UB 1WTGT 1CIUA 3SDYH 4X4XB 2FE0A 1FNGA 3TVMD 4JREB 5CD3A 5TK2A 1WIPA 5I66B 4PJFA 3LEXA 3R18A 5TF1H 4S1QL 2AFNA 3ZL4L 2X05A 2UWEE 1UOLA 3S3BB 1RIUH 3CVDA 1XD1A 4HS3B 5B21A 2JNZA 4HAFA 2WCPA 4XZUA 3HMXL 3N42F 4NBXB 2P48B 4POYA 1BJMA 1AC0A 1KCVL 3DROA 5D7IE 5D7LD 4W6XB 2KQNA 4XH2B 2Q5BA 1KEGH 5FOBB 3LRKA 1BXUA 1ZAGA 4HV8B 3IJYB 4I1NB 4PJ5D 1KV3A 1VADA 4TTDD 2BK8A 2QQKL 2N0MA 3VFOB 3MLUH 5CBAB 4IDJL 1MCCA 3MROB 4KUCD 3P4OB 5EUOF 2OSLB 1JZ4A 3W82A 4BE6A 1YEIL 1NFDB 2X0WA 4KH9A 5HP5A 3DIVA 3GHEL 3ROOA 2YBRA 4J3BA 4Y19A 2AGJH 5C0BD 5JQIB 2A9ML 3WNOA 5DHYA 2WZ6A 4PM1A 4M7JL 3STLB 1LO5A 4RVBA 3GMOB 5D1XA 4U1MA 2Z93A 5CLZA 3ES6A 3UPAA 2WUCH 3QHFL 3E9TA 4BFRA 4L05A 2Y06H 4BUHA 2J25A 3VWJA 5BMFH 1PYWA 3TJEL 1ZANL 4R96A 2J6EH 3QPKA 1U42A 3SEPA 3HFMH 3NIFF 4QRPB 1TMCB 3T4AB 3W37A 1UZ8B 2KQMA 3NDZE 5E9AA 5FYJH 5KOMC 3TNMA 4E9QA 4XX1E 5JXEC 5JOFA 2ED9A 5JO5B 2NNAA 4L3EA 5DQ9B 4N68A 2Q0ZX 4ODSH 4R4BB 2CHWA 4PV9A 3RIKA 4P4KB 3GLAA 4QRTA 2DBLH 1V54B 5KW9H 1U8IB 4FNLH 1K4CA 2WANA 2W91A 3W56A 4MMYA 3H54A 5CMAB 1R17A 2H8PB 3KDMB 1KXTA 4LSPH 2YK1H 4GXVH 1EO5A 2DWYA 4D7PA 1NAKL 2NY5C 3QQDB 2CO1A 2XWTB 5EU6D 2FD6L 1JXKA 1PTZA 2IDFA 5BRQA 4O58L 2GJJA 1ZT1A 4NQEE 5DJCA 1U0QA 1YN7B 1SQMA 1E4HA 1DBJL 2YWYA 2GUOA 4Q7DA 4YBQC 2IOMA 4FNUA 4B9GA 1KGXA 1JL8A 2OXGB 4G9FB 2XPZA 4ZTOL 3EG9B 5E0QA 2A74B 1J12A 2E5EA 1DZBA 4LCIL 2EH8H 5DFAA 1L7IL 5EU5A 1O9VA 2H32B 5DWUL 2C3WA 1A1NB 4QTFA 3BO8B 2ZUWA 3C2AL 3E9UA 4UDUB 2UWEA 3RWEB 2A6JA 2FJFB 4JHVA 1KYOK 8FABB 5ABAA 3N5AA 4FXGC 5D1ZB 5JDSB 2GBUA 3ZKMC 1RZJH 5DS8A 5E1QA 4MAYD 3UTTB 1XIWC 5D7IA 4ACTA 1AHKA 3OMIB 4OTXL 1Q0XH 3KGSA 4XMLH 3AWFA 4XB8A 2BRRL 1S9KC 4HMEA 1F2XK 2CHXA 2EXWC 2XZQL 3NJHA 4P07A 3NFSH 5TDNB 5TDPA 3POCA 3O4LD 3WFEH 1ZHNB 2Z92B 1H9DA 2YD1A 5CBEB 2CBPA 1QNZL 4OZFH 4LSTL 3FAXA 3IDMA 3GKZA 4OCRL 4X9FA 4N0FA 2ADYA 1CD9B 5AB0A 4BE5A 2PW1B 1EXHA 2GEEA 5I71B 1KGCE 3Q8FA 1Q9KB 5LQBL 4IRZH 1NPUA 1L0QA 1TO4A 4MA8H 4AVKA 3L17A 4R5TA 4WO4D 3O2DL 4GOSA 5KSAD 4ZX3A 5HHNB 3VXOA 4JFHE 4JQIH 5HGAB 2FLMA 3TO4A 4P2RD 1SF5A 5A7EA 3APDA 3QEHB 3P0GB 3Q7JA 1MI5E 1PNDA 4RGNE 2XPGA 5KVEH 3AWGA 2V9UA 3S8GB 1NGQH 2PO6D 3BUQA 3EFOA 3FQTA 2NY1C 5T8IA 5JZ7D 1JXJA 2C7UA 4N8PA 4S2SB 5LBGA 4F7PB 5C6TL 2OJEA 1UXMA 4X6CE 5BZWB 4LBAA 1JI2A 2ZPKL 4FGMA 4OD3H 4LCYB 4HUVA 1V55B 2QHLA 1XT5A 2V5MA 2FJGB 3U30B 2VTFA 3CQQA 3EHBB 2VE6A 4LZKA 4TM9A 1IC0A 3VE0A 1TDQA 4JKNA 4YLBA 1KB5A 2B1AL 3PJLA 1N10A 2RR3A 3QEGL 4U6HB 3UG4A 3EYVA 4DHLA 4UQBA 4UIKL 9CGTA 3OAUL 4MCYA 1RZ8B 3JT0A 2PYED 4JGMA 4MNGE 1C16B 4NQEA 3QISA 4J3OC 4Z77B 4M61A 1PSKL 5D9SB 3JWOL 4IS6B 4R7VA 3IU4H 2LT9A 3N44B 2DQHL 4Y16A 5A43C 1DL7L 3TA3D 4NP4H 1FAKT 3EOTH 3UTQA 2G9HB 4ZNCD 2OSWA 1WCQA 4NN6B 5JHDE 2J57A 1DN0A 1MWAH 4XNZC 2OMXA 5KS9E 4LOUC 4IJTA 3IJ9A 2H6UA 2NYYC 1QLRA 1MLCB 5EEWA 3S6CA 1LHZA 1RZGA 2APWA 1KENH 4OF0A 3QA3A 2F1BA 1QKZL 1RVFH 4P9HC 5JMOC 5GRVK 2UY7B 5JQHC 4FQJH 1PNCA 4KRNA 1CG9A 1HXYB 3QUZC 4Z18A 2AQSA 4DGVH 5LUMA 3BDBA 5F9OH 3EJZD 5SWQA 3UJJH 4JFFD 3Q2VA 4OLYL 4L4VE 1AKJA 3G5YB 3JV0A 4QTIH 4OD2B 4AL8C 4PCTA 3C9NA 1H5BA 2YPVL 3D69A 3NZ8A 1J5DA 3P69A 3ASWA 1QR4A 3VDCA 1EEUA 5DJZB 3HHSA 4X98A 3N1GC 1DLHA 4N8CL 1ICTA 1TJMA 2OSYA 3OMNB 4XMVA 4DVRL 1A6UH 1IAOA 1SJEB 3G5XB 3W0WD 5CWSA 1N4XH 3MBED 4M1CD 3SO3C 4AK1A 1DFBH 2V2TB 1MLBB 2FIRT 3CFNA 4XAWH 2WQAA 3T08A 2DTSA 3MTRA 4D9RE 4FG6D 1UCTA 2WYZA 2CGRH 2HUHA 3WYRA 1ZCRA 4NRZA 1HWHB 1KPUA 3UBHA 1Y0LB 3U1SH 1D2PA 2QMKA 5FGSA 1DJZA 2YOCA 3ML8A 1HCVA 4TV3A 3WUWG 2JIXA 4XVUD 2AV1A 1MI5A 1AHWA 1EEYB 2ZYRA 4QHKI 5FGCE 3O3BA 4EUPA 1CO1A 4PWFA 3GMMA 1OGTA 4CMMA 1I8AA 1EGJH 1SXNA 4G43A 4AQ8C 4XMUA 5TQ0H 3K4ZA 1SHSA 1IJNA 5C0NC 4FKHA 5DMJB 3P30L 1S78C 2BSTB 3FUIA 4HCRL 2J8UF 1X5JA 4X6CA 5DQJA 4FLRA 2YQ2A 3DO4A 3M88A 4HJ0D 4MRCA 3CNKA 3VMPA 1W72B 1CL7H 5E6ID 2OYPA 1I53A 1KLGB 1HAUA 4G8IA 4L2LA 5L2KD 1S7RA 3B7UX 1G9HA 3FO0H 4U0QB 3U0TB 4N5UA 5E9DE 3DUSA 3DETD 4MNGA 4P5SA 4RMSA 2IBGA 3BCFA 5BRZB 1KJVB 2OCFD 3T3MB 4TUOA 4EN3D 4U6XA 1WH0A 1RU9L 3BGMB 2O6PA 5H94A 2XBTA 1D5XA 4FCAA 1KMGA 1NTDA 4JPWL 5HHXL 4LOEA 5D72H 3UCRA 3AS2A 2R9HC 5ILTL 1HESA 3MRQB 5IY5B 1AXTL 5K69A 3PP3H 3EKCA 3HNSH 2NTFA 5JHDA 5LGKA 2IAMB 3ROLB 2XIIA 3WNIA 5CZXD 2Y3NA 3DX4A 4ZG1A 5KS9A 3ARUA 3HRZB 1UURA 1WBYB 2WWMC 4UOW0 2D03H 2VMJA 4G80A 5LVEA 2VKXA 3BFWA 4JHWL 1RZKL 2VDLH 4IKIA 1IEAB 4NRXA 1KLUB 3SQRA 1UZGA 4OCXL 2R7EA 2W0FA 4L3ED 4XXDB 2M26A 1ZDSA 2EIZB 4TL4A 1RHFA 4L4VA 2NY0B 4I48B 3O4OB 3O6KL 4XVSH 4BCZA 4YQXH 4B9YA 1YEHL 1KG0B 4EEEA 5FUZH 3RWHA 1E30A 5I5RA 5IJCC 3NABH 2X38A 1QR1A 2J6WA 3SDDA 3OJVC 5EN2B 2WK2A 4NNYA 4MJ2A 4P5TA 4PRHE 4XWGH 2VLKD 3V0JA 3TCXA 1ZA3A 3VQ2C 4X6FB 5BW7A 5EU3A 4F9PC 4U1LA 1T5WA 3FOLB 3VD7A 1M1XA 4OLXH 2UZYA 2QQQA 2ZX6A 5I1IL 1DSYA 1H15B 4TUUA 1UB5A 4J23A 4WTQA 2MHAA 5IESH 2AV7A 2ZAGA 3WUWB 1PZDA 2BWDA 1A6VH 2VDQH 1SY6H 4A2LA 5AEAA 1C5BL 4K9EH 3HC2A 4S0TD 3O81A 5F2FA 3C08L 3LVEA 3WNMA 2QGEA 4WHDA 3ZDYF 2R0KH 4PJGF 1UM6L 5ALCH 5MP6H 3FU8A 3FB5B 4OUUA 5FA3B 5KBMA 3WTXA 1F6AA 3GJFB 2F53B 3OKOB 4E9YA 3SYPA 4GBXA 2APBA 1U95B 4FULA 1GPOL 3ZTNL 5KVGE 1JPST 4Q9RL 3F3HA 2I5YL 3OGCA 1NMAH 3QXAB 4WZ9A 1E5BA 1MNUH 3MNZB 3TF7C 4UOZA 1JPGA 1TZIA 4UTBA 5E9DA 1OB1B 1FSKB 5KYUA 1V5JA 4AM0B 4P46C 3QEQE 5AW7B 2Y6TE 3PWLA 2Z0BA 1A2YB 2XZCH 4OJFH 4YE4L 3RBSA 1HHKB 2XBZA 1CDGA 2MQ3A 1WG3A 2ZXWB 4LSVH 4N0UE 4P06A 5FGBA 2B3IA 3MRHB 5CJXC 2CH8A 3S35X 2WP3T 5KN5B 3VWKC 3RWCB 5CILH 3NIGF 2R29A 5FK9B 3ARBB 4I9WD 5FDYA 4R7DA 4UINL 4XCCH 3OX8B 3FW6A 3KR3H 1HL5A 4H8QA 4OZGF 2JWYA 1FIGL 2AXFB 1TVDA 4LRNH 5L8LB 1KB9K 4DN3L 4FMVA 5ETUB 3ECWA 1ZSDB 3UZQB 3U4KA 4ZUTA 2V7NB 1Y6MR 4P2QB 3EOBB 4QKTA 1G7JB 2GJ6D 4PG9A 4NO0D 2CU9A 3PUUA 5ECGA 3GNML 1R75A 5MEOB 2Z65C 5IHLB 4WTZA 5GS0C 5KSBF 4MA1B 3BVDB 2BS71 2XWJB 3K81A 3Q1SL 4YPJA 4Q52A 4NAQA 3OHXA 4GAJL 3ARDB 3LMJH 2XT1B 1IFHL 3QWOA 4BFIB 5AB9A 2IXQB 4PRHA 5GGUB 5CHNB 4R4ND 4D9LH 1TEFA 3L3OB 2BNQE 1URIA 3EJJX 1RP8A 3APNA 4NQED 4TUJB 3NIDB 1NFIA 4NQVA 4PVNA 2EVHA 4BSVB 2W60A 2HWZL 2NXYC 1QWHA 4J6RH 1UA6L 1FL3B 4H13C 4MB1A 4NZFA 2EKSA 2V5TA 3QSKB 4PUBL 4RMBA 3ECBA 4RRPG 1AGBA 5B4MC 5JXAH 4AEHH 1TQCC 3NSCA 2G3XA 2VN4A 5C2BL 2R2CA 4LASL 3A6CH 4K9JA 3V4PB 1YC8A 4DKEL 1ID2A 4U1GB 4FLOA 3M1BA 4N20A 4ZO9A 3FT0A 3A3YB 2XQYA 3CHSA 3I84A 4TVPL 4R4FH 5EOCL 4IU2B 4WJG3 1I7RA 2F7OA 1RHHA 2Y7LA 1G5AA 1OGAE 3OB0K 1MHHB 1JOIA 1NLBH 1ZDQA 4L1DA 3LH9A 1JHKL 3VXTA 1V7NL 3O45B 2EZ0D 2CNYA 3K6IA 5CJOL 1AXIB 4NUJB 3SKUD 5FV2A 1ACZA 3A4EA 2PWDA 3G5WA 2X4SB 5T5FA 3LIUA 4OGYH 1SXAA 2IWFA 5L88L 1ZJBA 3IKCB 1EZVY 3CZFA 3E0GA 5DURB 1RUPL 3QEQA 4Q0XL 4ACPA 3CGTA 5DD6A 1ANUA 2HSIA 2JKTM 3ENEA 4JKWA 4CGUB 3FO1B 1LD9B 6FABH 4N0UA 1KYOJ 1R9FA 1QUPA 2YFOA 2FZ3B 2PR4L 1OOAA 3ZKND 4OJYA 3MRJA 4L23A 3VFGH 4B60A 3WS6C 2ZF9A 4MAUH 4C56D 2GVYA 3HE6A 4K73A 4R3SA 2WVVA 4YSSA 4PJ6A 3T8XB 2RFXB 4A55A 3B6SA 4EOWH 3NJVA 1T03H 3X14A 3KWVA 2QJDA 2VYRE 3QORD 4JHUA 3DHMA 2QLYA 1QI5A 2Q2EB 3QIWC 3ILQD 2NY7L 3D12B 3HFFA 2H1XA 2R1XB 1B0GA 2Q76B 2ZCKL 5C3TA 5C9KA 3CDZA 2AXGB 3K7UA 1TQUA 4IOIB 4PLJC 5KYXB 2VABB 1H3PH 4LT7A 1MF2L 1VKXA 1RZJC 3JV6A 5J3HD 4H88L 3TWCL 3I02A 5F7NC 3TZVC 4CADB 3X13B 3CFCL 2YXMA 2LGNA 3HCVB 1P5UC 4FQ1L 4M6OH 1GGTA 2BNQA 4R2GC 2R69L 1OSZA 4GRMB 4DO6A 4M6NH 2HG5B 3OKNA 4O9HH 3MA7B 2B77A 3GK8H 4CKVX 1CD1A 1YEKH 2CALA 3HZYB 1KWGA 4N1EA 5EHFA 2MOVA 4X2UA 2JKNA 1R3JA 4BSWA 4HVBA 1EA9C 4DP0X 4IK7A 1BYNA 4MLSA 3HMXA 2X28A 4KHTH 3C6LA 1DR9A 4AGNA 1HH6B 4OLWH 3TXAA 5EF0A 3IFLL 1HEZB 1YMMD 1T04B 2MQ0A 5CEXB 3FH8A 1R47A 3MVSA 3U2JA 1XF2B 2LV4A 1OGAA 3P2DA 3QUYC 3A67L 3QZWG 2NPLX 4UU9A 4PRDA 5D55A 3QFDB 2BVOA 1PDKB 1MCNA 3GZOA 3OWRA 1S7VA 3BUYB 4FX5A 4QXUL 4XNAA 3RP1A 3EBAA 2E8ZA 4KRPD 2TRYA 2R0LL 1CGWA 1I7UA 3DO7A 3NOIA 1W72L 1L3WA 2DLGA 1NINA 4Q2ZB 1CXHA 1BP3B 2E9GA 4HUMB 4PJ9A 4PY7A 2YZ8A 2ENPA 3RGBA 1BM3L 3TOPA 5C0DB 2DIJA 3IPFA 3MODL 4WK4B 2YA0A 5ENWA 5AYUL 2G5BA 4ZI8A 2E0PA 2EEXA 4LVNC 4XNQB 4P23D 3TBWA 4BQ8A 1F3JA 4NM8L 3SKMB 2OP4H 3ARFA 4XN5A 2A1WL 5H4YA 4DEWA 2Q2LA 3MREA 2DI8A 5DVNA 1JZIA 1B6DA 3PWUB 3LZNA 3LB6C 2AEQL 4HALA 4U3CA 3SYOA 2NTSP 1J1PL 3NFNB 1H9VA 2DQCH 3FQRA 4ANUA 5DO2D 1SHWA 3Q9PA 1FORL 4E5XG 5I76B 2Z7UA 4ZMZA 3H42L 1RK7A 2CZNA 4PB0H 5BUAA 4JAMB 1AQDA 4KJWD 4DQAA 5KVDH 4LF3B 2GAZB 1DE4B 4XPAL 2IFGA 4NIKB 5GGQH 2GYSA 5BCAA 1ZXKA 4KZDL 5G55A 2EC8A 1RZIA 1ECZA 3BN9D 3MRKA 4U1NA 1JZDC 1H8NA 1DBAH 4PVLA 3BKJH 2FSDA 4YAQA 5EOQL 5AUMA 1ZMYA 1NMBL 3O6FD 1JPFB 4JFTA 4FQXD 4W81A 3D18B 2FGWL 2ZIDA 7FABH 3T4YA 3F83A 2NY2C 3R7RA 2RD0A 2PPAA 5AENA 5IBTH 2X40A 5DFTA 1LO0L 4XBGB 4U6TA 3R8QA 1JGLL 3ARGB 5HYIA 1SXCA 2A38A 1TLKA 3MOAL 3E80A 5HYQA 4FMKA 3HW7A 4JPIA 1E27B 2WLIB 1SLVA 1JGVL 4LQ1A 1P9MA 3OD3A 3SQBB 2TRHA 4ODVL 2EYSB 4LQFH 1EDHA 4MVBD 1S5HA 3O41B 1Q9WA 3D9AH 3QCVH 3LNDA 1XH3A 2MTAA 1PIGA 2DYPB 1K8IB 2DMCA 1CFTA 3QZWB 4ZMTA 4J3XA 2C1PA 1NC2A 1YMHA 2GBAA 3IFPA 1L3NA 5JUEL 2W0PA 4TN9A 4XRCB 3CFEA 3WTVA 4XC1H 3AY4C 4YGAB 3TGXA 1OD7A 3TLRA 4E9VA 2P5ED 2Z91B 5FWRA 4PLNC 2AP2A 1SM3H 3QQ4A 3HG1D 1AIFA 5E08L 2VGLM 5F9JB 5TDOB 1GRWA 4TLKA 1AGEB 2VC2B 3GSUA 3MRBA 1O6SA 1V7MH 2P5WB 5LGYA 5ACMA 3MYJA 2UYLB 2H26B 4MYPA 4MJ5A 4PJCB 4WU7A 5DR5H 2V4LA 3OLEA 5SX4I 3WI9A 2UUDH 1B3JA 4QXTB 4A2DA 3O2DA 1AR1B 4PRHD 4ZOCA 4UT9H 1UFUA 3WNPA 2IQ9H 4ZUSA 3NACL 4H26A 3FN0H 5F7KC 3UPRA 1XBDA 4ORGB 3FU6A 4X9IA 32C2A 3X11B 3KEHA 2D31B 3K1DA 4UOW1 3IEAA 1K8DA 1ZEAH 4UAOB 3W9DB 1BPVA 4D0DB 1Q9OA 4R90L 2OJZH 2Z4QB 3LPGA 1A7PH 2DH3A 3M8OL 1BQRA 1KJMB 4E5XB 5KYYA 3MRLA 1BVOA 4NZ8A 4Y4HB 3DX8A 1J0IA 2ADGA 5JTWA 3EBIA 1INDH 2R4RH 2X4OB 4Q9BA 3I9GL 1AS6A 1MFMA 2NNRA 4M7ZC 5EPMB 1I3GL 1DVXA 2E59A 1WP6A 4TNVF 4Y1TA 1P4BL 3KE0A 1MJ8L 1U21A 3OLGA 2AEPH 2Q9OA 2DY2A 3ULVF 3CSBA 2CIIA 3OR6B 3MV9B 1HSAB 4WI0B 5F7YC 3NQIA 3DI2B 1RUMH 2GQHA 2H3XC 4U0RB 1U8LA 4AGLA 5DHVA 1FH5H 1MFAL 3BFQG 2EADA 3DPBB 3SPJA 4G5AA 3UTPD 3FZUC 3UZVA 4YXLL 1LEGA 4OIIL 1ZKAA 5IHZB 3W11D 2QPSA 4GSRA 3SCMA 3EF7A 2R2HB 3CN2A 1FVCB 4DUWA 4HUXB 3AADB 4TSBL 5DDHB 2BSSB 3LXCA 1E43A 5DRNB 2K4AA 2ATAA 1KIPA 4AMXA 3P3SA 2RIKA 2VAJA 3O9WC 4HMDA 4PRNB 1JNLL 3DRTA 1NBQA 1S7UB 2AQ3A 3T0ED 3BQUB 3QJOA 5EO1B 1IGJB 5D1ZI 4QLWA 3CSTA 3P3UA 3TTSA 3V4PL 2DQFA 3Q6GH 1LWJA 1I8IB 4APXB 3SYQA 3GINA 3AQZA 3AREA 4F2FA 1OWRM 2YPVA 2FGZA 3IFNL 4XXWA 4WJKB 5JOPE 3CE1A 1CYXA 1ET8A 4OIBA 5AL0A 2PTTA 4ECNA 4CW1A 1R3KA 1DJHA 3L9RA 3LKOA 3MLXL 3N91A 1ACYH 3QJHA 4Q6IA 3RVWC 4PP2A 3RFZB 1U36A 1UG9A 3GBNL 4G70B 1JNNL 2ZX5A 4UUJB 5CEYB 3FSVA 1MQKL 4LDOB 4CAGA 1NFDE 3ZTJG 3DVNA 3WTUA 1H0DA 2N4IA 1QQDB 1SJHA 2X4NB 3WV0A 1AD0B 4I0KA 1XGQA 4DTGL 2GW5A 2UX6A 4X5LA 3GMQB 1EAPB 2HVBA 3QHTC 2YAOA 5FW8A 1JFQH 4GI9A 4NO5A 4MBOA 1P4IL 3WJJC 4AYMC 1AS7A 6CGTA 5AWNH 5AAWA 4OH2A 4Y5YC 1KXHA 1P84K 2EUVA 2BC4A 4J8RA 1BFTA 5EZJB 5HI3D 2EVJA 3B9DA 2B5IB 4WK2B 4N2EA 3CU7A 4I18B 4BH7B 4QRPE 5I15H 1ACXA 3C5ZD 1S9YB 2IWGA 1J0HA 3Q5YA 3FFCE 1O7SA 2V0AA 4BZYA 4FG4A 4L5FH 5C0IA 4YR6B 5HJGA 4LVOC 1JK8B 4UQDA 4JNXA 2IGLA 4MMZC 4JFUA 5E8DH 5K9JL 1IGFH 5FECA 5E8EB 1G7MB 1QHPA 2Z35A 4JG0L 4YFLI 5FV1L 2NXZC 3FKUS 2IIJA 3FUNA 3KJ4C 4DZBB 2FX9L 1OAQL 4PV1C 1OM3H 3SJVB 4FQLL 1A7RL 2OMWA 1ADQL 3E6FA 1M4KA 3VA2C 4WI2A 3TBTA 1GHFL 5D1QD 1DQML 3L3DA 3ETBJ 3RI5K 2WKOF 1WBXA 4NPYA 5TJWK 3UP6A 5C9JA 1U8PB 2FWLB 4C59B 3LKNB 3T65A 4FP8L 4ZMPA 4WEBL 1PKQE 2I69A 1N8ZA 1R6VA 1RULH 2WINA 1Y18B 3QZMA 3G9VA 1A4JB 4G9FE 4JJ5B 3AQDA 3ARFD 4GG6B 1QI4A 2ZUUA 3MLZH 2Z8RA 1TSHA 5I66A 4UM9D 2I9LB 4EUPH 2O5ZH 1YLBB 2HN7B 1WRFA 2YQ3A 3SB3A 4AGMA 3EF4A 4TQPA 4ZXBD 4LRIA 5C0AB 2Y07H 4U1SB 3U2SB 3FU9A 4HS3A 3D39D 3ZY7A 3HRPA 2X6BA 3UYOD 3UTTE 3KD4A 3OF6D 1OE3A 4XH2A 1AYOA 3UYRL 1QBBA 3BKMH 5FOBA 4HV8A 2ZX7A 4YUEH 2C7FA 3EFFB 4J8QA 5I1EL 2YSTA 4PW3A 1X5HA 4J4PD 5CBAA 2HH0H 2GT9B 3MROA 2OSLA 3GLEA 3CVCA 3IWVA 2ICWB 1F13A 4F9LC 1Q72H 1NFDA 3HJ0A 4Y2OB 3AG4B 3L5XL 2FJSA 3INUL 4PAZA 2A9CA 2C3GA 3CIQA 4A6YB 4DP4X 4XCEB 2G5RA 1UWXH 1MAKA 1BV8A 2CLRB 2EP6A 2O1AA 5G5DB 3STLA 4ELMB 1CF1A 5AZEL 3GMOA 4JRXB 1I75A 4YX2H 3ILEA 2QPUA 1NBVL 2HRPH 4O02B 4ANVA 5CZRA 1Q1JL 1OTUD 5KVMC 3ULVH 2VLJB 2G3ZA 3IGAB 5CD5D 5KSAC 4LEXL 4W9CC 1CFQB 1X7QB 1T6BX 4CC1A 4QRPA 3T4AA 4TVPE 1G6RB 2JCCB 1F3RB 2MCAA 3RTQC 2ITCB 3FFCA 5DFVC 1HIMH 4FFYA 5I0VA 3H85A 1T83A 1A9BB 2CIKB 2HX8A 5JO5A 2WXGA 3WO4B 4M9PA 4XNBA 1CS6A 1MEXH 2XTJC 4YBLC 1NC2D 2PO6C 4JMNA 1WUNT 4I4WB 4R4BA 4PJAB 4P4KA 5GSVB 5FYKU 3SDCB 3INOA 3T6WA 1GOFA 3PWJB 1U8IA 1BA9A 4NGHH 1JZ3A 4G7VL 5K1NA 3S7GA 4JCWA 2JLLA 4PMEA 1DQJB 1S7WB 2H8PA 3KDMA 4PWGA 4PRPB 3BI9X 4YPGB 3WSQL 2X4TB 3ARQA 3QQDA 4PJEB 4GAGL 2DQDL 2XWTA 3HUJB 3RNKB 1LK2B 4L8BB 3QULA 2WQWA 3RVXD 2LVCA 4X50A 2OZ4H 1A6AA 4I3RH 4TS6A 1IV8A 2P44B 4ENEC 2DLFH 3NSFA 4NFDA 1QRND 3U0WL 2OXGA 3BPOB 3NCCB 4G9FA 1MCOH 7CGTA 5GGRB 2A74A 3X3GL 2PPDA 4JM4H 5DGRA 4PJBB 3G6AA 5SWZB 3VTTA 1T0MB 4WWKC 2XA3A 1RK1B 2H32A 2OTUB 3JWDC 5AW3B 5BJTB 1A1NA 3HVDA 3BO8A 4UDUA 2QT6A 3G08B 5TE4H 2DMGA 3RWEA 4YDZA 3TPUB 2FJFA 1H3GA 8FABA 1TQTA 2VXUH 4XBEL 3L4TA 5JDSA 4GP5B 1SVZA 2X9XA 3K4DA 3J27A 1JTOA 2HB0A 3M17A 1QBLH 3UTTA 1LEKB 1ZHKB 3E3QE 3H0TB 1I7ZA 1JUFB 4MWFB 4XVOA 5EIIG 2HVJA 3EADA 4JM2B 4M56A 4APQD 1F4WL 1SBBA 3EJZC 5TDNA 4A7VA 1BZ9B 1G7QA 4J3OG 4R7NA 1ZHNA 2Z92A 3X1EA 3WTTA 3WS3B 2MQGA 4HUNB 1TUPA 4LKXA 3NP4A 4ZMWA 5CBEA 1S7SB 5K59F 4M6MH 2OTWB 2VERN 5IOPA 4OM1L 2Y24A 3FSAA 4DQOH 4PCKA 1OANA 4ZUVB 2VC2L 4X7TB 2PW1A 3CC5B 5DLML 4NZRL 1K3ZA 1VFOA 4KJQD 1PGRB 1Q9KA 4TRPL 1WTLA 2VXQH 2FTAA 1UH3A 1J18A 1RY7B 3IAPA 2A99A 3F5WA 4LSSH 5I6XC 3QDHA 5JHBA 3JWNE 3B3IB 5AD0A 4PRBA 1D2OA 1DUZB 2J1KA 2VZSA 4LP4A 4EIBA 2JFCA 4RH4A 4MJID 4Z3TA 1JDDA 3QEHA 5E56A 3T3PF 4M62L 4Z7IA 4ODTH 2A7BA 3O8XA 4JRFA 3MV8D 4F8PA 3B5TA 2OS7A 3CFMA 4S2SA 4K7PY 4F7PA 3THML 1QFWH 5I1CH 3CSPA 1G9NL 2BFVL 3TN0D 1UWYA 1EDQA 2VCOA 3L1OH 5J12B 2FJGA 5D4HA 4GO6B 1B6UA 4IOFC 4HIJA 4ANWA 2BP8B 1GZQB 2YSSB 2ZXEB 1Y7VA 4PGCB 1URZA 2GHZA 3P4MB 3DX9B 4U6HA 3O3UN 3IDGA 2Q7NA 3FUMA 2J2ZA 4UV7L 1RZ8A 4NZUL 1C16A 3EH3B 1GA2A 4QF1B 2MQCA 5EORL 4JPVH 1BAWA 3BN3B 2PWHA 1RK0B 1XR9A 3DETC 5BRZE 4IRSB 5FKAB 2VRQA 3T3ME 4Z77A 2IAND 4RZCB 2C3VB 5EZPA 4O2CB 5D9SA 4IS6A 5F72S 4AEIH 4DPAX 1GKOA 4NKMB 1R24B 1A47A 1JPEA 1AE6L 2Y6SD 3QDGE 4HBQA 3BAJA 4K7PL 2CLVB 4XP9L 1KYAA 1BMWA 3N40P 1YYML 2G9HA 1SVBA 2Q7YB 5D1XC 2E75C 2LU3A 5I6KA 4U33A 1VENA 2EO7A 4HJTA 3HNTH 5JA9A 1EUUA 3VWJC 5L2JA 1UGNA 3GIZH 2V33A 1QEWB 4OFIA 3S34L 3VFTB 3B56A 3VGAB 5I8EB 5EIIB 1A1OB 1JN6A 5J89A 1A7QH 1A3LL 1HXYA 4NQDB 2KMWA 3ELQA 5AZ2H 2Z31D 4YFDB 5KVGH 2G4EA 4EQ2A 2VR8A 3K8KA 1UWEH 3G5YA 3VFRB 3F7YB 2ZKHH 3SE8L 4OD2A 4LPTA 2NLJB 3GSNH 3DMMD 4ADJA 2R69A 3CPLB 5DJZA 4HOXA 5E2VL 3DV4B 2GCYB 2GY5A 1BYPA 3CHOA 4RESB 3UH8A 1EJ8A 1ECYA 2ZAIA 1SJEA 1Z9SB 2K3TA 5FHAH 4MASA 2V2TA 3QP3A 2CPCA 1JV5B 2FIKB 3QUZB 3OJMB 2J1ZA 4KK8D 3DO3A 4WWPA 2DEYX 3C5SB 1T5KA 1Y0LA 3GI8H 3U4BL 3CMOL 1GZPB 5KVFL 3DJSA 2P7TB 1FPTL 1XGPB 4GRWB 1WBZB 1O75A 3OLDA 1IT9H 1YNLH 3DV6B 1EEYA 2H3KA 2QADD 4K94L 3EOAB 1KCUL 2YPKB 4KQ3H 3HC0B 2ZUVA 2X7LB 1BF8A 2JTDA 4N2BA 2DWXA 3CN3A 3FU7B 3GUTB 1THAA 4RGMB 4ICWA 1KTJA 5MEQB 2BSTA 2DQMA 3HKFA 4W9KC 3AT8A 3W38A 2CQVA 1WO2A 3PHAA 4DP1X 4JFXB 4AC2A 1FO0B 2P4AB 3IMRA 1W72A 4G7YH 4MCZB 3U1PA 3L4WA 4HIHB 4N2CA 1U93B 1KLGA 1T1WB 3BIBX 3QC5X 2XQBH 2E56A 4P3CL 2KL6A 3S96B 4G3YH 3U0TA 3WHE0 4F8OA 5TK4A 3LQMA 2O26U 5F6IB 3RJDA 3C5JB 2ZYHA 4JZNB 4M1GL 5ANMB 1I8LA 5BRZA 3ZKSD 1A4KB 1KJVA 2G5UA 4MBRA 2MWCA 2WUBL 3I6LD 3NT0A 2L7UA 3AWEA 3QDGA 3LZPA 1XGZA 5IB3B 2XUWA 3MRQA 1YCSA 4H0LC 4OKDA 1YJDC 2IAMA 3ROLA 4MD4B 3QNZB 3QFJD 3HRZA 3L4VA 1BEYH 1WBYA 1JZ8A 4ALAL 1BGXH 1PZAA 3QPXH 5HDOA 4ERSL 4DGYL 4AG4H 1BM7A 3TO4C 4HFUL 2A9DA 4Z7WF 4N8VB 1MCJA 1YEDB 4OZHB 4JJHA 1IEAA 1KLUA 3STZB 4NWTH 4P2QE 2WQVA 2DW5A 4XP5H 2ZSWB 2X2HA 3S37X 3I50H 4HAGA 3VXUB 1QACA 4NQTA 4W6YB 2EIZA 1LE5A 4I48A 4AE1A 3C6SB 4ISVB 2HT2D 2WQSA 1KG0A 1FVEA 3FSOA 5BRPA 2DKSA 1JPSH 3BVTA 3GSOB 4J3VA 5AVWB 3RBGA 1P84J 4QHLB 5EN2A 1E9QB 1XB3A 2XV0A 2YQGA 3W57A 1C9SA 3N41B 5I19H 4OCSH 2A6DB 2FYVA 1FLRL 2NCMA 4X6FA 1TVBB 3FOLA 1PKOA 4NC2B 5LGHH 4EIGB 1OALA 1CGSH 4NN7C 2WM0A 1JVKA 4Q56A 4R4NC 3KWTA 4C57C 3CFBB 5IW1B 1H15A 1IVLA 3C60A 4KI5D 3NIDE 3NK4A 4A6YL 1GIGH 3WUWA 4A67A 4Q9CA 3DRQB 1TVHB 1FNFA 2EEFA 3Q8EA 3SQOL 4PTUA 4IKJA 4IDLA 4WHTA 4PJ8B 3RDTD 4O02L 4XMZA 1CVRA 3IN0A 4MXWL 4HBCH 4Y16C 3S2CA 2PMZA 4NKDB 3ZPDA 2XXFA 1MIEH 3FB5A 5FA3A 5KBPA 1SPDA 2NY4D 3TIDB 2DWDB 3LV3B 4ABVA 3GJFA 4LDCA 4RISH 5D1ZD 3OKOA 4DKFH 1HL8A 3B2VL 3UAJA 4Y4KB 1MDAA 4W9LC 1LTXA 3Q9QA 4WKXA 2DWTA 5F6HI 4PR5B 3NEEA 5GGRY 5HPMB 3S3SA 3QXAA 4LEEA 1GSKA 1RIHH 2FO4A 2QSCH 3DSFL 3MNZA 2QTVA 5HDQH 1IUZA 3N0AA 2EDOA 1OB1A 2QHRL 4GFTB 1UD8A 3HN3A 4PBDA 3RWJB 1T1ZB 4AM0A 2JB6B 1H5BC 2X4PB 4HUUB 2Q3AA 5I0XA 1AJ7H 1D5IL 2W65A 1HNFA 1OAKH 4KKLD 1NANI 4YVNA 5EWIH 1HHKA 1TQBC 4PH8A 2VM4A 4QRRB 3MRHA 4HUWB 4OVUA 3RLSA 4TYUA 4A7UA 1RURL 3ZKNC 4MJJA 3U4AA 1KZYA 1DBKL 1DO6A 5KN5A 1N7MH 1QFWM 1IGYB 5FK9A 5DJ2B 3ARBA 3B8SA 4NO2B 3LD8C 4RAVA 1NA8A 3OX8A 5LAPA 3DUHA 2AXFA 4YDKL 2XWXA 5ETUA 2LHAA 3UZQA 4M00A 2EDFA 4P3WA 4PY8J 2FJUB 2V7NA 3U7WH 3V4UH 1AHWC 4OGXL 4P2QA 2XWDA 4PG2A 4RGNC 1G7JA 4X4YB 1EQWA 2NY5L 5HI5C 2WMPB 1MHPL 4HDIB 1WA2X