1JZJA

Pseudomonas aeruginosa azurin os(bpy)2(im)(his83)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords azurin
publication title Electron tunneling in single crystals of Pseudomonas aeruginosa azurins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jzjA00
1L9TA 4GYBA 1HAWA 4DP7X 1KCBA 2XV0A 2UX6A 2UXGA 3NJKA 1AZRA 4L0PB 3T6XA 3DTUB 3WKQA 3ZBMA 3ZX1A 4AI7A 3FU7A 2XUWA 3X1EA 1GS7A 1JVLA 2QPDB 1JXFA 3X1GA 2JKWA 4KOCA 3AZUA 1KCWA 5D4JA 1DYZA 6PCYA 4DP1X 4BWTA 3N2JA 2BW4A 1XB6A 1ZV2A 2YAFA 4Q89A 4YVUA 1CC3A 2GHZA 2XV2A 1PCSA 1TU2A 4YL4A 5ANHA 2OV0A 3KW8A 1AZCA 4UAHA 2BP8B 1NPJA 2X88A 3OMAB 3QJSB 4DP4X 2GSMB 1PY0A 5I6PA 2IH8A 5B3SB 4E9WA 3X1BA 2DWSA 1OV8A 1OE1A 2WO2B 2PPFA 2VW6A 3QPKA 2UXVA 1ASQA 2GC7C 4Q8BA 1FWXA 1RZQA 4UF7C 4WTQA 2ZONA 4KO9A 1V55B 3CDZB 1F56A 1ILUA 4E9XA 5I26A 2HZHA 2FWLB 3H4FA 3PAZA 1T5KA 2IH9A 4GXFA 3FPXA 4HALA 4AX3A 2RACA 2I7OA 1IBZA 4GY4A 1BAWA 2CUAA 3C75A 2PP7A 4FA7B 4KO5A 1NWOA 1SDDA 4YSOA 4A2HA 4G70B 3ZIYA 3GXUB 2BZ7A 1BQ5A 4F2FA 1A4AA 1OCZB 7PCYA 3OM3B 1SF5A 2IDSA 5PCYA 5FC9A 3IE9A 1M57B 3GDCA 2VSKB 3AY2A 5IY5B 1J9RA 2CALA 4AKPA 2PLTA 1JOIA 4M3HA 4E9VA 1I53A 3EF4A 2AZUA 4YSEA 2BZCA 1R1CA 3FU7B 4A67A 4E9SA 1PZAA 2XWZA 2YQBA 4KOBA 2FQDA 2LLNA 3T6VA 1OE3A 4DPAX 3S3CB 5D4HA 1KDIA 2XXFA 1WA1X 2J56A 2FT6A 3ABLB 3V9CA 5I6LA 1ZPUA 2WO3B 1MZZA 1NPNA 2H5UA 1ZIAA 1M56B 1W6WA 3TBBA 2HXAA 4E9RA 1IC0A 2Y1AA 5E9NA 3PAUA 1NIAA 4AKOA 2XV3A 1SHWA 4KNSA 3NSCA 3X1NA 2HRHA 3SBQA 4G7QB 1L9SA 4M4RB 4JKNA 2I85A 4KNUA 4DP0X 1HAUA 2BWIA 1MG2C 3IBOA 4TXVB 1ADWA 1AG0A 3NSFA 1W6LA 2HRGA 2IDTA 3H56A 5I5MA 1PF3A 1EZLA 4DP5X 3PLYA 1A4BA 3TBCA 1GS8A 3EH4B 1AS7A 1SFDA 1JZIA 2IDQA 4DPBX 2CAKA 3DKHA 1WA2X 3NT0A 1WS7A 1EHKB 3NJJA 4ZK8A 3T9WA 1SNRA 2J5WA 4A66A 1AZNA 9PCYA 4YSRA 4A2GA 4A2FA 1OCCB 2VM3A 2DYRB 2PP9A 4W1TA 3ABGA 4G72B 4QKTA 2OCCB 2GB2A 3FYEB 2YXWA 2TSAA 3UAEA 5I6OA 1SDDB 2Q5BA 4N8UA 3NJMA 3SQRA 2YAMA 1AZBA 1QLEB 5TK4A 3ASNB 3AW5A 2W8CA 1J9TA 1AACA 2FJSA 1PNCA 2J55A 2QPEB 2B08A 2MRYA 3X1FA 1CYWA 4BDVA 1E65A 1TEGA 1BXVA 1URIA 1AZUA 4DPCX 5I6NA 1X9UA 4P5RA 2BO0A 3S3BB 3DIVA 1NIEA 1OCOB 2BP0A 3CZUB 1J9SA 2AZAA 1AAJA 3UADA 4NB7A 2BW5A 4CSZA 1IKOP 1BQKA 1AOZA 2UXTA 2UX7A 1L9QA 2DV6A 2JXMA 3CVDA 2PPAA 2FTAA 4DP9X 4WKXA 1KV7A 2FQEA 2JFCA 1KBWA 4DP8X 3BQVA 3AG4B 4X4KA 4QLWA 3FS9A 4FAAB 3TA4D 3NJHA 3UAAA 3S8FB 1SFHA 1UATA 3NP4A 4AZUA 4GP5B 1PLCA 3MX0B 2ZOOA 1ZIBA 2CBPA 1WS8A 4YSUA 4BK5C 4YSAA 1ETJA 1BYOA 2FQGA 4KNTA 2VW4A 2FNWA 1N70A 1E67A 3V9EA 2TSBA 1AANA 3T6ZA 2E86A 3CG8A 1NINA 2XYBA 2EIKB 1MDAA 3NJLA 1OE2A 2VSMB 3HB3B 1SJMA 1JZGA 2QDVA 5B7MA 5B7EA 4PCYA 1X9RA 5PAZA 4E9TA 1A4CA 5I28A 4W9ZA 1AS6A 2VM4A 4G71B 5AFAA 3NSDA 4P5SA 5I5JA 4HZ1A 1BQRA 3FQ2A 3D12B 3S8GB 4HCIA 4ENZA 6PAZA 3L45A 1OCRB 4HIPA 2UXFA 1NICA 4BWWA 3NJIA 5AKRA 4BXSV 4NERA 1ET7A 1KGYE 1WAEA 2YXVA 4RH4A 3FQ1A 1JZEA 1GYCA 4A2DA 4BDVB 1N68A 5I5IA 1AIZA 3FSZA 4G7SB 3ERXA 1RCYA 3WKPA 2VN3A 3PPSA 3MBWB 1V10A 1ID2A 5LDUA 3TASA 2IDFA 2BP0B 1HFUA 3QJRB 3PXLA 3CVCA 1PLBA 3HEIB 3NSYA 3GYRA 2W88A 4HAKA 1BXAA 4JHVA 4HHWA 1XMEB 3OQRA 3QJQB 3WNIA 1NIBA 4MFHA 4YSPA 1E30A 1QNIA 3FU9A 5D4IA 4YSQA 3JTBA 2DWTA 2GIMA 4A2EA 1PNDA 1TKWA 4KO6A 1L9OA 3NP3A 1PZBA 2GC4C 1GY2A 2CJ3A 3ZDWA 3FQYA 1NTDA 3OMNB 2QDWA 3IEAA 2H3XC 3AG1B 4E9YA 2HX7A 3FSWA 1MZYA 5B1KA 3KW7A 4UANA 2HX8A 5B1BB 1FA4A 4YSCA 2FQFA 3QJTB 2PPDA 2YAHA 1JZJA 2IDUA 2XX1A 2DY2A 1RZPA 1SF3A 2B3IA 1OF0A 5EHFA 4EF3A 3EH3B 5B1JA 4G7RB 4DP6X 1JZHA 2FT7A 1VLXA 4CSPA 1QHQA 1MG3C 3SBRA 2Q9OA 1PAZA 1M9WA 1A65A 3IN0A 1BEXA 2HX9A 2PP8A 4HCFA 1W8EA 3NYKA 3FSAA 2IWKA 4GP8B 3FPYA 4K9JA 2R7EA 2AFNA 1J5DA 1ZDQA 3X2QB 1CYXA 2GBAA 3UGEA 2YAOA 1GW0A 3BVDB 3QQXA 3WNJA 2AVFA 2CCWA 2XX0A 2GI0A 5F7BA 1AR1B 2EILB 4YSTA 1CUOA 2ZWNA 1BXUA 3ABKB 3NJNA 1RKRA 4BXVA 1IBYA 3FSVA 1KBVA 2PCFA 1AS8A 1NDTA 5B1AB 2X87A 4YSDA 2DYSB 2WSDA 3ABMB 1WA0X 1NIFA 5F7AA 4N4YB 1ASPA 1JXDA 2I7SA 4HCGA 3T6WA 3ASOB 2OJ1A 3EH5B 2XXGA 3OMIB 2H47C 3TU6A 1BYPA 2EINB 1ET5A 2IWFA 2VW7A 3EHBB 1JZFA 1KDJA 3PAVA 1ET8A 3G5WA 5B7FA 3QJUB 4YSSA 5I6KA 1L9RA 2BP8A 1JVOA 1YLBB 2YAQA 4F2EA 1GR7A 3N55A 4JHUA 2PPCA 4PAZA 1GY1A 1A3ZA 1XB3A 1B3IA 1NZRA 2J57A 3CVBA 3PCYA 3UABA 2IAAC 4KO7A 4AKQA 1JERA 3WI9A 8PAZA 2EIJB 2BHFA 2YARA 4HHGA 2XU9A 1J5CA 3H4HA 3FU8A 4A68A 1PZCA 1PMYA 2Y69B 3AG2B 1E5ZA 2XVBA 2AANA 2YAPA 1IUZA 4BWUA 3QJVB 7PAZA 5A7EA 3CDZA 2P80A 3FT0A 1TEFA 2PPEA 1L9PA 2MTAA 1FFTB 3UACA 1ZDSA 3IN2A 1CURA 5I6MA 1GSKA 3NJGA 5AZUA 4GP4B 1GS6X 3WG7B 3RYMA 1AQ8A 2YAEA 2VMJA 4E9QA 2A3TA 1XB8A 1ASOA 5TK2A 1KYAA 2BWDA 1A8ZA 2EIMB 2FT8A 1PLAA 2R7EB 2IWEA 3JT2A 1DZ0A 1JXGA 1SHXA 4DP2X 2XLLA 1ILSA 3U25A 3NJFA 5B1JC 1E5YA 3AG3B 3T71A 3OD3A 3S3DB 1NWPA 2QT6A 2P80D 2PCYA 1J9QA 4NAJA 2HLEB 3FYIB 2ZXWB 2NRDA 4F7KA 1OOWA 3SBPA 1NIDA 3WIAA 1AG6A 2N0MA 4YVNA 1V54B
chains in the Genus database with same CATH superfamily
1JNHA 1CE1L 1KTJA 4LAQL 4LEOB 4P9ML 2GJ6E 4MAYC 2A9CA 4JDEA 3CMOL 2CO3A 3E6HA 2I9TA 2MIZA 1NGZA 2P46B 5IOKA 4L8CB 1VCAA 5L9DH 3VFRA 3I9AA 1A6WH 4WFGD 2ALAA 2WY3B 4KZEL 5D4JA 5K33A 4Z7QB 3U4EA 1LK2A 2UZXA 3LXAA 4H7VA 2QQNL 3G9AB 1HCFX 2VLKD 4L48A 4Y19B 2N01B 2XV2A 1FZOA 3IDGA 2CHZA 3X13B 4N2AA 3DUSB 3OAYK 4ONHB 2OV0A 4C47A 3QIUC 5JXAL 5D7JD 1RZJC 2UYLA 2NQCA 1BREA 4D0DB 1ES0B 1F6FB 3WFCH 3L9BA 4MXQC 4L1BA 3CFEA 2IH8A 3IJSB 4YDLB 2V4LA 4P2QD 5JOPE 1MIML 1UT2A 4MJ6A 5DXWA 5DI8A 3GEWB 4MS8C 3MRNB 3K6DA 5IMOA 1F4YH 3BP7B 3FBQA 1T1ZB 1HHIA 5BRZD 5I18L 3FH8A 7FABH 5HPMB 2ADJA 5JZ7C 3X3FH 4I1NB 1IC1A 4M61B 4PREB 2QFRA 2XCMC 4AX3A 2J71A 2XN1A 3QIWB 4I13B 3SDXA 1F42A 4R5VA 5BS0B 4LNVA 5TQ0L 3C75A 1IGJA 3WUWA 3FU0A 4FA7B 3MGOA 2I69A 5D9SB 4PJXA 4NN5B 1P1ZB 2ITCB 2MCG1 2JV6A 2FX7L 4I8DA 2WQUA 3ECUA 1ZEAH 4KVCH 1CI3M 3LPPA 4G70B 3BE1H 2XWXA 3KLAA 4G83A 4HH9A 1PPIA 4UILL 3B9KC 4P4KC 4XHQA 4F8LA 2QEJA 3MRJB 2ODHA 3GJFK 1F3JA 1J05A 4HQQH 1X44A 5GS2D 5FC9A 3UYPB 3K72A 5EF1A 4K3GA 4EKXA 3CHXA 3FO1B 4MXWL 5D72H 5GRZA 4FNQA 4XNXH 1FZJB 4PR5A 1L7TL 3D1MC 4BZ2H 3FHAA 5JW3L 4BRVA 1R1CA 4C56E 2Y36L 4J6RL 2K7PA 4J3SA 5KJRH 4JCLA 1MFAH 2PR4H 2VXQA 1VACB 2EE6A 3S3CB 4PP2B 5EFIA 1THCA 1FH5H 4M6ML 4HJJH 5FFOA 4R0LA 3DDGA 1O9WA 2NNXA 4ENEC 2VN6A 1LEGB 3RTQB 5I2IA 3WXVH 2R23B 2DQDH 4HKZA 3LNEA 4U1JA 4Q58C 5JIKA 5FYKL 4M5SA 4PG2A 2VR5A 5IJKA 1LILA 4KNUA 1Y1UA 4NO2A 1J1PH 4X7DC 3E3QC 1S2EA 2GG1A 1IGMH 4HKBA 4O02B 3W0WB 1AYRA 4HOMA 4KITB 2JQZA 3IDYB 5I5MA 3LKRA 1RJYB 2G3ZA 1OGAE 1YMME 3VD4A 3EH4B 1AS7A 1WF5A 2N7SA 1A1NB 1E2ZA 4BFOA 2VC2B 2X4OA 3SEPA 2V3FA 3T9WA 2VAJA 3W37A 2X4TA 4JO1L 1ML0A 1ZHKA 3IFOB 2J6EH 4P5KA 3LH2H 2DLEA 2DL2A 1NFAA 2QKIB 4QKTA 4HX1A 5DRWA 3C5JB 4WW2F 4ODHL 2Z1KA 4GO9A 4ELMB 2GTWB 4OI8A 3PDOB 1WSST 5FA4A 1K3IA 1GZPA 2C4XA 2KZBA 3AB0B 4UNIA 3O4LD 3RE0A 3A4DA 5KEZA 3RDTB 1N0LA 5JW4N 2OPCA 4PWHA 5FV1L 1F02I 4NHUB 2GJ6D 1MCDA 1N3NA 5DJ6A 3Q8FA 4K15A 5FW7A 4P5RA 4DPRA 3ISRA 1S7WA 4OLVL 4FTVE 3FTXA 1NIEA 2R0KL 2JLPA 3KHQA 3PJLA 3IVKB 1AYOA 2B14A 4HMCA 5DUPH 4CSZA 4J7RA 3K80A 4PW4A 4MCZA 4Z8FL 4NZUH 5HYJE 2EC9U 2XWTB 3QPXL 4TVPH 3CU7A 1SXNA 2PPAA 1SY6H 2R39A 3LV3A 3FQRA 3Q5OA 3D33A 4XXCC 3RIAK 5T33L 1G84A 2F54B 1KY7A 3FS9A 4H88L 4OGQC 5EO1A 1GIGH 3VD9A 2Y7LA 5KVFE 3BN9D 1X7QB 3U36A 2FCBA 2V17H 4KNQA 5I66A 4B53A 2W65B 2KL6A 1NKOA 4FG6C 4GP5B 5E00B 2Y5TA 5IF0B 3HUJF 4HFUH 4L37B 1F4XL 5JOPD 3O8XA 2FSEA 4I88A 3M07A 5JQ6L 1NBZA 4L4VA 4BK5C 4Z7WA 4ICWA 3IAGC 3INUL 1KYFA 1RZGB 5E94A 3U1PA 3U0PB 3U4KA 1IBBA 2FX8L 3JBG7 4DFIA 4PJEB 4JPIA 3PL6C 4LKCB 4Y88A 3TYGL 4DQOL 1YJDC 2HVJB 3KPPA 4X4XA 2QVTA 5BZDA 1XGQB 4QRTB 2VDKL 1FNEB 2F53B 4YBLC 5F0LB 5FYJL 4F7CB 1MNUL 2Q0ZX 3EGDA 3FAWA 5B7MA 4GQZA 3K2IA 3A67L 1WBYA 2ZF8A 3DRQA 1BLNA 1MDTA 1QD0A 4AE1A 3GI9L 3WD5L 2CWRA 1BQRA 1N5AB 2YR3A 2P45B 4QT5B 1MCSA 2YA2A 4R90L 2VLJD 3BWUF 2XRAL 1RY7B 3D18B 4KX8A 1SLVA 3CFCL 1R19A 4HCIA 3BLKA 4XPTL 5CO1A 3AVEA 4CN1A 1GCFA 2AV7B 1GTFA 1OCRB 4PLOB 3GI8L 3S96B 1NICA 3JWNH 2VDML 3NJIA 1R3IH 3F62A 3PV6A 4GMTH 3HRPA 4BQ9A 3L3OC 2DQGL 2D3LA 3C6LC 3FT2A 4RH4A 1TYEB 1BZ9B 2P24A 5IJBC 3FSZA 5J6GB 2N59A 3O2DA 4XNAA 3KYMB 4AV5A 3BDBA 5GGTH 4FMFA 4BKLB 2OMWA 3MC0A 5DURB 5IQNA 5SX4H 2J8UB 4UNUA 4C56D 3ME0B 2WP3O 4HSAC 1ODAA 2ADIB 3O11A 3GYRA 4L1SA 5EN2A 5GRUL 3KBPA 3MV8E 4XCYB 5DJ8B 2WLIA 1YPZF 5BZWA 1QABA 3ATFA 1LP9F 1UOLA 3K71A 5KSBF 2AJXL 4YEFA 1NIBA 1CWVA 1TQUA 4GQRA 4YH6A 2DMBA 4LLWB 2XPGA 4R7LA 5CN2A 2Y23A 3IKCB 5E95B 3HIZA 1SVBA 1DCEA 4JG9A 5D70L 2X05A 1UJTA 3T4AA 2HG5B 3EDDA 4OZGF 5E4EC 4MJ4A 1H5BB 1J8KA 1U8IA 3BN3B 3NP3A 3B9VA 2WMPA 3VFWA 4G8IB 1PZSA 2FYVA 3ZKXC 4OF0A 2FSDA 2VZ1A 3QUZA 3BHBA 3UC2A 1UJ3B 3THMH 3O6KH 1CXIA 4EXKA 4F33A 1IE5A 4ZQTA 3L5WB 3PDDA 3K6SA 4E41E 4FQXA 4WU7A 4UANA 3TGXA 4LU5H 3OKMB 3ZO0A 2W9EH 2FQFA 3PPEA 3BKYL 4PJAF 3JYCA 1G6RH 1OGAD 2YAHA 4YAQB 3FTUA 2ODIA 2OJEB 3EHBD 1RZPA 1J8SA 1SF3A 3DGDA 3TO2A 4AVKA 5ECJE 1ZGLM 3ZXAC 1E7VA 1KXTB 4KQ3H 1BBDL 5EHFA 5B1JA 3ZDYB 4AQOA 2F61A 3LOWA 2HLFC 2O6PA 3OLDA 2PYEA 2FL5B 5HYIA 1S9YB 4G8GB 3E3QE 4W4OA 4GO6B 1FFRA 4GMSL 3UDWA 2YBRB 4WGWB 5D6DA 2V2WA 1NFDA 5T3ZH 1MHHB 1L0PA 1MWAA 4MBOA 4RBPK 3TVMA 4XC3L 1X6LA 2V7HA 5GGSY 5CZXC 4UV7H 4I0CC 1RV6X 4HT1H 4P23C 3G04A 2ZKYA 4ALAH 1R3HA 1TZAA 3BVVA 5DHMC 2LLLA 3L81A 2QV2A 3HA0A 3TCLB 1UWGL 4AG4H 3KJ4B 3MJWA 4TSBL 2OL3B 3KDMB 4TUJA 4S1QL 4FQIH 4ZRGA 5DVNA 3OQ3B 5L4IA 4Z6AT 5HYJD 3WN5B 2WPGA 4XHJC 1VADA 1W0WB 3HE7A 3TT1L 4JFDA 2VDQL 3FFCA 4JRXA 5C0BB 4MAYD 4IIQB 4KVPA 1U21A 4UM8A 5DQDL 2EDDA 1E6OH 4XNQB 3TFBA 1JTOA 3FU6A 2YFOA 2X12A 2E8ZA 3UBFA 3O0RL 1ZLDA 1SBSL 3BGMA 4X83A 3D39B 3QO1A 5JPMC 2WXNA 2HUEA 2ATPB 5CEZL 3ZRCC 4MJIB 4W6YB 4AEFA 4PRPB 1ET5A 2VDPL 3AMLA 1KDJA 2DTML 1LO5A 2A0LC 2ED9A 4Z7OF 1X4XA 4EN3A 1GYWA 1G4MA 2BJML 1AJ7H 3GJEB 3IDNA 4L9LC 5KYWB 3A22A 4X9BA 5BQDA 2L7UA 4GIOA 3NMEA 2ZSVB 3QIUD 4OD2B 5I71C 4JDTL 1CFNB 2VRAA 4F27A 5TDOB 2R0LH 4GI8A 3EXJA 2J57A 1U8PB 1D7CA 4KO7A 1E4HA 5GQBA 5HGHA 2YXFA 3T3ME 1JERA 3QIBA 4MXQD 2CMRL 4PJGB 1J5CA 5DFTA 5E6SB 2QHRH 4QRQA 4H26B 1P5VB 3TT3L 2OTWA 1A0QH 3HHRB 5IHZA 4MS8D 5T1DH 4C83B 5CUSH 4R5XA 4U3CA 3IFLL 4G8AC 4M1GH 3U2SB 2OR7A 4MNQA 2NW3B 3GS0A 3K74B 5JZ7D 2H7WA 3RWFB 2BM3A 5JW4M 3T04D 8FABB 3QR1A 2A3TA 3GBNH 2E7LA 5CIPH 1NDGB 2QSCL 3WSQH 2ZNXA 4MSWB 4OZIF 3FRPB 3UJTL 3ULVL 3SOTA 5KW9L 1A14L 5BRQA 2XLLA 4HGMA 3I75B 1X5XA 2X6UA 3CZJA 3KJ6L 3P1VA 1H15B 3FUEA 1X5JA 2VDLB 7CGTA 2BVPA 3IJYB 1T20A 2A6IB 3HHSB 3IF1A 2QQKH 5D2LA 4FF9A 2BCKB 1IGFL 3IM1A 3QG7H 4ZMQA 2EDMA 4ODWA 2OXGB 5ILTH 4LSPL 5HHME 4A7UA 5LGJA 1SYVA 2PWDA 3B9KD 4P4KD 4U1NB 3TPUB 3OKKA 4PBDA 4D3CH 2MSPA 2FK9A 3GO1L 3QCVL 4GUCA 1F6AB 1LD9B 4NKDA 5KVGE 2ATAA 5D7JA 5DFWH 5D6CB 1KCBA 5EIQA 2MCPL 3AUVA 1RURL 4AUYA 3KGTA 4FQLL 4OJAA 4XVSH 4OZ4A 2VLLA 2LW3A 3LNIA 1RZKL 1XF5B 4AQEB 1N59A 4XX1E 5EN3A 1U91B 1H6EA 2CKBA 1ZLVK 5D1XB 2GJZA 5JTWA 2ZKHL 3BZDA 3GQFA 1RUML 2X1OA 5BRZA 3FQUA 1Q0XH 4Q89A 2ENSA 4AQZA 1HZKA 4O51A 1E90A 4HSQA 4A04A 4WHTB 4D8PB 5BPPA 1UQSB 4DH2A 2IPTL 3OMAB 4E41D 4U1MB 1RD6A 3VI4A 3ZL4L 1NGXA 1IQDB 2J20A 3KL5A 4N0YH 1T21B 3PQYB 2B1HH 3L5XL 3UG3A 3SDDB 4ENED 1EO8H 2ENQA 3B5TA 5HI3C 4I48A 3L7FB 3BISA 4ORZC 1E2VA 4FKKA 3OG6B 1IGTA 1M71A 4MMZA 3UBXG 2EUZA 5BZZA 1NGYA 4NRZA 4WTWA 3SN6N 1RZ8B 1KIQB 1X5FA 2NNAB 3BW9A 1YY9C 2HLAA 4J3XA 2V2TA 3IXTA 3HBGA 3ETBF 3SZ6A 3ULAB 1JUFA 3QJHA 4FNLL 5B8CA 3UYRL 3OKYA 4Z7QF 3CVIL 1S7UB 25C8L 1INDH 1FFQA 1QFOA 1LE5B 1BVLA 3SDCB 1TZOA 3FMGL 4NPKA 2VIRB 4MMXC 4JO2L 3NZHH 2BFVL 1J10A 3SYCA 4F2MB 1JRHL 3MV7B 1AVAA 3WS3B 3KR3H 3B7UX 1V7MH 4IDLA 4LLVB 3NTCL 2HRPL 4OF5A 1RERA 1IEBB 4ZFOL 3KNBA 4NDMA 7PCYA 2GHWB 3NIFE 3HZYA 3BSZH 5PCYA 3G6DL 1PKQB 4HHAB 4M1DH 3S5YA 4AJ0A 1MPAH 4EVNA 4NT6B 3EJUA 5HVHB 5F1NA 4MDJA 1OARH 3QI9B 5F7KC 2H8PA 3SKUD 3RGVB 3QFJE 2QFPA 4RRPG 1KGJA 3HZMA 1ZKAA 5CAYB 3EOAB 1JG9A 1KT2A 3E9TA 3K6NA 3T2NL 3FL7A 3TBYA 1D5XA 2VN4A 1QMUA 4A67A 2YUZA 2OX5B 3C09B 1YG9A 1JZ8A 4HUMB 4YHKL 5IM7B 1I3RB 4KQ4H 3UTSB 1E40A 5J1AB 1QSEE 3LRMA 4JKWA 4DPAX 2O5YH 3BSHA 1FHNA 1AD0A 3SKMB 2ZX6A 4BH8A 4P2RB 4YZFF 4FG6D 4NKIH 1KN4H 2XZAH 4CMHB 5CBAA 4DUXA 4UCFA 4QHNB 3IJEA 3T4YA 4OVUA 4YHIB 2BVOA 5D8JL 4H5SB 1OAYL 1ZLWH 2EECA 3S3SA 3GIZH 3OR6B 1QRNB 3X1NA 4OIIH 3IU3A 4ZO8A 4CC4C 4PY7B 4IBSA 2HTLC 3DXAE 2ESVB 3BKMH 4OD3L 3LN4A 3EJZC 2F5BL 4N1CA 5EU5B 3PL6D 1FCCA 2EQDA 2R56H 3VG9C 2XXCB 1XTLA 1KTLA 2QSTA 4HMEA 3VO0A 3O4LA 2ZXGA 3W9DA 1WFMA 2Z4QB 5D5MF 2R8SH 3RFZA 2WTPA 3VWKA 4WV1C 2GJ6A 2ENPA 4TRPH 4RZCB 9PCYA 5ID1A 5HGDA 4A2FA 1VSCA 1CLZH 2X1PA 2DYRB 2PP9A 3V4VA 1TVBB 2D8KA 3ABGA 2JJUA 1RJCA 4XBPA 4MX7B 4NAQA 4U1SA 3WTWA 2ZWKA 4UV4L 5KANI 4PJFB 3BJLA 4NZDA 5HHMD 1ACXA 1LL1A 5KSUB 3HI5L 5EOCH 4LRNH 3LZQA 3WHXA 4D94A 1TYRA 1KENH 4XWGL 1MCOL 3NIGE 3IBEA 3UBXA 1RIUH 3QRLA 5FGCB 3SYQA 3C6LD 1XGTA 5MENE 2YD5A 2C3VB 3JWOL 4G6FB 4HJSA 4ZAKC 1LO2H 2BP0A 2R4SH 5CEYB 3X3GH 1TZIA 4GAGL 2FO1A 3FFDB 3U46B 1BQKA 3HI6H 5IFAH 1HYRC 2UXTA 4G7VL 3RHWF 2AJUH 3HG1B 5HDQH 3BFQG 1AC6A 5AVYB 2GJJA 3GGWB 5I1JL 4RFOH 2GJPA 4S1RL 3IJHB 4H2CA 2AQNA 3HMWL 1T6BX 2ED6A 4WGVB 3CC1A 4PBXA 4EI0A 4MJJA 5EBGA 4HWUA 3WXWH 4EEEA 2AJVH 1MFBH 1T5XA 4G80A 1EPFA 3FN9A 1DVFC 4X6FA 1U8HB 3HS8A 5EO0A 4WHYH 2AXGB 3MXVH 3UTTA 3IGUA 4PW3A 5I19L 3MNDA 2VLJA 1WK0A 4NP4H 4YDIL 1E5AA 1OSZB 2XTJB 3GMMA 4KTEL 5F1OB 1G7MA 5FB8A 4AT6B 3ES6B 2ICEA 2YD1A 3US9A 2E86A 1CGSL 4LASH 2IH3A 3N43B 1IC5H 4RQQB 5MHSE 2F74B 1HHKA 3SDYH 1XSIA 5KBDA 2A1WH 1FPTH 4D9LL 1AQDB 4GS7C 4L29B 3HFMH 1HCZA 3GRGA 4QCIA 4KKCC 1ACYL 2P52A 5DHEA 3LIZH 3MNWA 1RK1A 4B9PA 3LS5H 4C56A 3G6JF 5ES4B 2OYLA 1JZ3A 1HC1A 4OI9A 2NT1A 6PAZA 2Z0BA 4HIPA 4UQIM 3L2MA 3QP3A 4BWWA 3DVGA 3BPCB 1DTUA 5CZXD 4QTIH 1URZA 1N8ZB 4P23D 3BD5A 4FULA 2WYTA 1KGYE 3PABA 5J13C 5I1DB 1JSYA 3DVNA 5AAWA 1EQWA 3BWZA 1UM6L 5EUOE 3EG9A 3VW3H 4JY5H 4P9HC 3ISYA 5DCCA 1GC1L 1PLGH 3EDKA 2EADA 4XRCA 1CDHA 3ZUCA 1ID2A 1TQBC 1LWJA 1VB9A 4I5BB 4AL8L 5CSZB 4RMTA 4YHNB 1FP5A 5TF1L 1DCLA 4XE0A 4XHJD 2CGRL 3HLAA 3QDGE 5IQ7L 4HFWB 4R7NA 4XPHH 2NXZB 1MI5E 3WFHA 1FE8L 4QHUB 1VKXB 4G6MH 1YEFL 4PJ8C 4OB5L 5FHAL 1SM3L 3NCWA 3L1OH 5E5MA 1G7PA 1NEZG 4LSTH 5DR5H 1IC4H 1TZHA 5AUMB 2LQRA 5I1GH 4MFHA 1Y0LB 2KQMA 2V3EA 3LZLA 4LPXA 5DRZA 2VJ8A 4PS8A 2YGVA 3EFFB 4O5LH 5DHYB 5EUKB 4KFMA 2CJUL 4QRRE 3CPLA 5B38G 1ONQA 1RMFH 4DKAA 2DQIL 2A0LD 5GRJH 5HHQA 3W9EA 4EUPA 5CJBA 3ZHFA 2EUVA 4JFEB 4BELD 2E4TA 3CXDH 1PZ5A 3DXAD 5TFSH 1NGWB 2ZAHA 5CLYA 3MDJA 5CF3A 4X0KB 1CK0H 3PDGA 2HX7A 4I18B 1VEMA 2Q1EA 1A6TA 3L5HA 1EEQA 3QJTB 4KFZC 1ORQA 1Q9KB 5CCHE 4PTTA 3DK2A 4LVHB 1KBGL 2WWKO 3BDYH 2J3SA 3OHXA 3OG4B 4I77L 3KYOB 3NCJL 3KAAA 4F5CA 4P49A 1H3TA 3KPQB 4ZMPA 1JZDC 1MG3C 3FHEA 1FSKC 1XF3A 3ULUF 1AKJB 3ESNA 4OFDA 3AWGA 1CD0A 3FSAA 3MPCA 1KGUA 1NPUA 1KC5H 5KJ7E 4ZUUB 4APXB 2VKXA 3EO0B 4HETA 4UQ9A 3HW7A 4X6DE 3S37H 1GGTA 4HXAL 4MAYA 1W72H 3KHOA 3H9HB 1ZT7A 2PUQT 4PRIB 4FMVA 4KX7A 1PW3A 1K8DB 4PB0H 1AGBA 1VGKB 3MLRH 4GBXB 5MEND 2X28A 1JGVH 3UCRA 3VXSE 2XQYK 1WEJL 3OXRA 5IB2A 1KN2H 2QADB 1E8XA 2W38A 4JY4A 2GY7B 4IRJC 1AGEB 1H9VA 2VMCA 1VZHA 4WI4A 5A40E 4X7TB 3ZKMC 5F0MB 1SMDA 4MQ7A 2VZUA 4J4PC 3FSOA 4BHUI 3IGKA 4FFYA 5B1AB 2X87A 3QIUA 4YSDA 1EH9A 1OAQL 1UA6L 4KUCD 3EDEA 3C12A 3BD4A 2J1WA 2EXTA 3EGXA 1JXDA 2I7SA 3CFDB 5EV7A 4TUUA 4GIAA 4G5AA 5CD5C 5F44A 4HJ1A 2IQ9H 2DQHH 2XXGA 2QGBA 3TU6A 1CDBA 3O3UN 3LYRA 4OLYL 4KTDH 1P5UC 2DH2A 3H8NA 2WKLA 3F7YB 1HH9A 5D7IF 1I9RL 3JWNC 4CGUB 3EYFA 1ED3A 3RVXC 5IB3B 5DJ2A 4I4WB 4JEGB 5FK9A 1U8OA 1U8CA 1QVOB 5JO5A 2YIHA 3ZPDA 1A6ZB 3KPOA 1DEDA 3C5ZB 1LM8V 2IAAC 3NCBB 2DAVA 1XIWC 1DJHA 5DZVA 1UD4A 3BUTA 3FU8A 4A68A 1FL5B 3B3IA 5MHSD 5FWQA 5HI3D 5CINH 4TUOB 2NLJA 3ILPA 1LEKA 3B9EA 4JGMA 5H37G 1MWOA 3NIDE 3SPVB 1MFCH 1S5IL 3NZUA 4MXVF 3WHE1 3F7RA 3E80A 1MRDL 1YY9D 1NEZA 3Q5YA 1IVTA 4HPOL 4U1IB 1T5WB 5HGAB 4Y4HC 3B9KA 3V8OA 1AQ8A 3P4NA 1CPUA 3K46A 3TTYA 1OGPA 4FQCL 4OIAA 5B38A 5TK2A 2VXVH 3CQPA 5H4ZA 2R9HC 4Y5VB 1TJHL 2WQWA 1ZTMA 2BY3A 3OKDB 1JXGA 4DP2X 5GGSB 2RALA 4TQIA 3L7EB 5E6IA 2KLTA 3NJFA 2CO2A 3NPSB 4W9FC 3U6XS 3WIIL 1AKPA 2LVEA 3SKNA 4JAMA 4P48A 5DDHA 2Q10A 1D6VL 2EYSA 4L3FA 5BOPA 2YGPA 4XBGB 3NUKA 2OYKA 1JF6A 4PJGF 1WZKA 4L1LA 4XP5H 1AG6A 3QDGD 2OZ4A 2QGEA 5ADPL 1CU4L 1A4JA 4MYPA 4XCNB 1JK9B 4GYBA 3QDJA 4E41A 1X7SA 2E9GA 4D8OA 2AC0A 3QB7C 3KZ8A 3RLSA 4PJDF 3WLBA 4AM0A 1I4FB 4AI7A 3MRQA 3PWLB 1RVFL 2X0VA 3CZFA 4D0BA 3RWGB 4AVJA 1KG0B 1KELL 1ZRUA 3P30H 4QRRD 1JXFA 3X1GA 3VGAC 3AZUA 2Y07H 3N2JA 4YGVB 1RZ7H 4X6EB 2EYTA 1TU2A 2BOBA 6FABL 5T5FL 4XX1G 3CX2A 2X88A 3HG4A 5KVDL 3QULB 4P3DB 4ALAC 5FO9B 3C2AL 4XC1H 2GYSA 5F0JB 4WI2A 3VGDA 1N12A 3LQZA 1AGDA 1IEHA 1A7PH 4MB1A 4NPYB 1PDKA 4OJYA 4M7JL 1XF1A 4OCYH 4JL1A 2QLVB 3ZJAA 2VW6A 2HTLD 2UXVA 3ZSTA 2I60H 1MRFH 4FQJL 1KXQE 4KZDL 4WTQA 3EJZD 1MCBA 2AQPA 4X9FA 1KIUA 5FM4A 2NZ1A 3QEQB 1ORSA 3DHMA 5KSVA 4XBMA 2BNQE 3RY6C 5ABAA 4GUPB 4D0CB 1NBQA 2WYZA 1FV1A 2QKSA 2RACA 4ZXBB 3DX7A 4EI6A 3MLTA 2VR6A 1JPFB 1S78C 2CUAA 3NBNA 2PP7A 1LEIB 4Y9EA 4M5ZL 3VG0H 1YEDB 5AVZB 1AMXA 2IGFH 3VXSD 5I1AA 1PFOA 2JWYA 4IK7A 4R3SA 1P84J 4QD2E 1IL1A 5HBBA 1PIFA 1MY5A 1W15A 3M1BB 1FQ9C 1OP4A 5FO2A 4HG4J 5DJZB 1W0YT 1JPEA 1HDMB 3NCXA 3QNZB 2R69A 3W5NA 4XXCA 3G5XB 2HJKB 5DTFB 1KXHA 4EI5B 4JJ5A 1H3VA 1MAMH 3PNWA 5H37A 5C09E 4OFKA 5I5RA 4OV5B 1AY1H 2IDSA 4B50A 1M57B 2ZOTA 4G6JL 2XN9E 1NCCH 3VRLE 3I74A 4FQQA 4ZAKD 1SDAB 5C0CE 4AKPA 2XOTA 2IDCA 4E42B 4HGWB 4ZMLA 4HCRH 4BK5A 3WKML 4Z3IA 2AKRB 3U7WL 2B9BA 4QJ5B 1S8DB 3NZ8B 3A6OA 5AW3B 2XWJA 1DUZB 3T6VA 3PL6A 4IMLB 2BC4B 4Z0XA 5DLML 1TTCA 2EDLA 4FKEA 3ABLB 2QMJA 3MRFB 3S7GA 3GSNH 3DURA 4RAUA 4OGXL 1MCEA 4ISVB 5JHLL 1I8MA 4OLWH 4ZMAT 5ACMA 1CD9B 3IS1X 4JM2B 4M7LH 4P8QA 2EXYD 5EO9A 3GF8A 1WZ1H 2W9DL 1DVFD 2FIKA 5D1QE 3F7KA 5LO7A 1RZFH 2N0KA 4KNSA 1UM5L 1SZNA 1QFHA 2EICA 2XNAA 1C8PA 1KTRL 3S5LG 3V6BR 1ERNA 3PS6A 4IIZA 5EPMB 4ZNCD 4PRDA 1NEPA 1HEZB 2FWUA 4M8QA 2XI9A 2WVVB 4HIHA 2YUVA 3TBCA 4U1KA 4YHYB 1A9VA 3G7TA 1WC7A 5DJDB 3DKHA 3L3OA 5CEXA 4UOJA 3PWJB 4KAQL 3C6LA 3HI1B 4N1HB 3GSUA 2HA1A 2P5EE 1CGVA 3QO0B 4LCIH 1A3LH 1JJUA 1XH3A 4KKCD 1P7BA 3I6GB 1ZLSH 5IFJB 4UTBH 1KJVB 3MQIA 1DL7H 1X5KA 4LB8A 2XTSA 3N40F 5IB5A 4Y9GA 4N8UA 5HHNA 1SXBA 1SYSA 1YZZA 2JB6A 3RFRA 5ALCH 2YBGA 3VD1A 1B0RA 3HN8A 4JO5A 3M7OA 1NMBH 3GSWA 1BXVA 3KLSA 4JZOA 5IR1A 2H4EA 1ND0A 1GHFL 3MYZA 1NANI 5GS3A 4P46C 4NN6C 4R7VA 2DQFB 3IGFA 1MHPL 2V2XB 4M5YL 4TNWF 1ZK5A 2WCGA 5I0YA 1Z32X 1BJMA 4G5ZL 3CZUB 4WF7A 4PJHE 3DDFA 5HJBA 4EO5A 3LDBC 2L0DA 3LH8A 4NC2B 5CN1A 4PGJA 2DBJA 5FW8A 4YEEA 4NQSA 5T1KB 2C7UA 4O4YL 1MFNA 4PJ8D 4A55A 5FW6A 5L2KB 3Q6FB 3A21A 1TZGH 1A6VH 3VGEA 2RQEA 1JP5A 1YEIH 1IGCH 2VABB 1KTDB 4E9LA 2E59A 3JTSA 4H8UA 3U9UA 3FB8A 1PLCA 2GIYA 2BS8A 2J1ZA 4KI5F 2A77H 3KBHE 1TR7A 4TKWA 4Y1AB 4CN6A 4F9LC 4ETQB 1D2OA 2VZVA 3CWGA 3QXTA 3BVNA 4K9EH 2CBQA 2F1BA 1E50A 3W1ZA 4LLDA 2PCPB 2VW4A 1USZA 2UWEE 4NRXB 1B6UA 2FNWA 3BAKA 5EZLB 1JNLH 4LESA 4XBEH 2YN3A 3EYQC 1XR8A 5BUGA 5JYLA 3BVXA 4QI3A 4Y4FB 3PWVB 1HHGB 4PJBE 5HGBA 2D7PA 2BNQD 4A38A 1AHWB 4P2CG 3QUMB 2WLKA 4P23A 5I73C 1M05B 4R4FH 4NNPH 3R4DA 2HJLA 3MZTA 5IROC 2ZOLA 3EOBA 2D7NA 4X6CB 2H26A 2HPTA 5FF6A 3L3IA 2KZKA 4IHOB 3U2IA 3N44F 4P2QB 3KPLA 1VIWA 3OAWA 1PEZA 2EC9T 2Y2YA 3KPSA 4M03A 4RWYH 3O2WH 3HRZC 2VN5A 1HSAB 3PGFH 3RY4A 3ZY7A 4CBZA 3WEOA 4LZKA 1I9JL 2NCEA 2ZXDA 3TEWA 1IAKB 1BVKB 5C09D 3MO1B 4O58L 2AAVA 4QXUL 5BUAA 4KHTH 5CHNB 1PY9A 5IHUL 1ET7A 1X5IA 1MJJB 1CFVH 2XN9D 5JPMA 3S5LA 1T7ZA 3FQWA 3Q8EA 4JFPB 5DMKA 1E4WH 1AIZA 4BQ6A 3GB7A 1ZT4A 1WBZB 3LAFA 3PPSA 3BGFC 1XF4B 5CJQH 3RB7A 4IRJD 2BDNL 1TO5A 4MHHI 1NC2B 3N43F 4YHOL 3ZKMD 2FUQA 4AEHL 3U4BL 4J4PD 3DI3B 5K9OA 1TJIL 3PGDB 3LMJH 6CGTA 4JHVA 1VA9A 3CC5A 3PGCA 5E2TH 1QUNA 1G6RB 5EU3A 4HKJA 4P05A 1SUHA 5FGSA 5J7CC 2X6MA 2HYMA 3M1CA 1KWGA 5CD5D 5TH2B 2UZIH 3HNVH 3BH8A 1TKWA 2JJTC 4EZKA 5BCAA 4KO6A 1LWHA 1N5YL 1QW9A 2NY5H 4K5PA 3IMWA 1OP3H 5C0JB 1NOFA 4P4RA 4K71B 3V0HA 2YWZA 3RVXD 4KV5E 2FZ3B 4ZS7H 3IEAA 3K6IA 4N68A 2YO3A 3MUY1 1I8AA 3BO8A 2VQUA 5B1KA 4M62H 1FA4A 4M7KL 3RGBA 3HZVA 1XIWD 2VXQL 4HSCX 2WXFA 4KQ0A 1MJ7L 2B3IA 3GSQB 4OJEH 5E8PA 4EF3A 3EH3B 5MENA 2OMUA 3MSPA 4JDVB 4MAUL 4MD5A 2BVQA 2P5ED 4UU9A 3QDME 1QPKA 3UTZB 1HXYB 4NQTA 1B4JH 3LKNB 1NDMB 4I9WE 4KY1H 2EAEA 2E9IA 2YPKB 5H4YA 4M29A 2OQJB 5CKGA 3DMMC 4Z78B 4Y4HD 4Y4KB 2IWKA 1C12B 4IKJA 2JQMA 2R7EA 3MLZL 5E03A 2XA8L 3GFUA 4BCZA 2R9HD 4QHMB 2IADB 5BV7H 4HGKC 2I25N 1U36A 3II2A 4FXLA 4ODXB 4ZTPL 1AZZC 3SDXF 1KEGL 1T22B 2OTUA 1QR1A 3MJ7A 1BWMA 5AL0A 5D71H 1GW0A 2IBZX 3BVDB 3I9GH 2J43A 2Q3AA 1FJ1B 5D7KE 4G9DA 3X14B 3W56A 1HZLA 3OL2A 3SE8H 5LWYH 1BXUA 1I8LC 3AS0A 3FH5A 4JZNA 5FIEA 2CRIA 4KUZH 3AXLA 4M93B 4KJYA 2NXYB 1MCRA 3HS9A 3TN0B 3CZEA 1M6UA 3RA7L 3IFNH 3HPJA 4IOIB 5E70A 5ICXA 2AEIT 1Q1JL 4LQFL 1RUPH 5TD4A 2CBTA 3P3SA 2Q8AH 3AM8C 4A1RA 1YSOA 3WJJC 3PWUB 2YPVH 4MGXA 2GEQA 1Z2KA 3M8OL 4W6WB 1T3FA 4EZMA 1XCQB 5IMKB 3GIVA 1J7VR 1L9RA 2BP8A 4KKAC 4OLZH 3R4RA 4OQTH 4B0MB 3WFEL 4Y9CA 3U79A 4MBRA 2PPCA 4Y5YC 3IDJB 4FCHA 1A3QA 2BSBA 5A2AA 3V0DA 2OMTB 5CJOL 2IC2A 3KXFE 4LVOC 2PNDA 3TS8A 3BUDA 2EIJB 3IXAB 3BIKB 2G3MA 3CFBA 4RESB 1S9VA 1M3JA 3TEXA 4WO4C 4UQCA 1E3FA 2AMGA 4LPVA 2PTTA 5ISZE 1ZE3C 4RGOH 2AANA 4YLQT 5CU9A 1L6PA 1M6OB 5EUOA 3VWJB 2IO5A 3SGDH 4P5MB 3GUFA 3K4DA 4MA3A 4AJVA 2W59A 4HU2A 2FEDC 4TSCH 1GSKA 2Q8BL 4GP4B 1RUQL 4NNYB 2WUBH 2MHAA 2O61B 4E9QA 1GPOL 1WLHA 1NMAH 2K8QA 2TRHA 4LPYA 3W39A 3N85H 3TBTA 3D69A 1BFOA 2MOVA 4GQ9H 1Y18A 2X10A 4GRWE 4JQXC 4LQ1A 1DE4A 5DK2B 1S78D 1SHXA 2CIKB 3FOLB 1RAMA 1GA2A 3U25A 3RZCC 3AG3B 3S3DB 3QQDB 3QAQA 4LHJB 4QRRA 5DK0B 3P9MA 3I6LE 3T8VA 2WINB 5D1ZC 1IKNC 1XAUA 2IAMC 3EAKA 3PHAA 4ZOEA 5EWIL 2O5XH 5EA0H 3GLZA 4HKXB 1ZLUH 2R0WH 4YVNA 2VO8A 1HJCA 3OV6A 1TTUA 4DW2L 1F90L 2OI9C 4KK5C 2J72A 3GTTA 1RIHL 2AITA 5CMAB 1BD2A 4S1SL 5EZPA 5ICUA 3U1SH 2EUXA 2A73A 4ANUA 4BFGA 2DICA 4CC4A 1JV2A 2WB1A 5I8OH 2GFBB 4JG1H 4XMLL 1EFXB 4MLIA 2OW6A 4NZ8A 1GZQA 5CGYC 3QFGA 3ZYIA 1MH5B 1ROCA 1HIML 1I7UA 1JWSB 2WJ7A 4PGBB 3GHEL 1EJ6A 4LLUA 4X9IA 1AZCA 1C5BH 5E9DE 1D5BB 2OJZH 1K2DB 4JANB 1BQUA 3QJSB 3VFGH 2APVA 1XGPA 4WV1A 4X6DA 3HS0B 3WLWC 4NS0A 4ODUA 1PJWA 4J3TA 1MHCA 5F9WB 3QXDB 2WIMA 3QEGH 3AWEA 4Y2OA 5I0VA 4EDXB 2WO2B 3MV9D 4Z7WF 5ICZA 2YD0A 1MIEL 2BXZA 5JPNC 3VXSA 2P4AB 3QDMD 3MRLA 3AAZA 3VXPB 5F7LB 4I9WD 4MWFB 1QG3A 1DQJB 3W57A 3ARDC 4PH8A 1SEBB 2LU3A 4GNKB 32C2A 4P07A 4LL4A 5B3JF 4HJGA 2F19L 5C70A 2IH9A 1KYUA 4PJ7B 2X4UB 4HJIA 1BFTA 3OSVA 3ZKQD 4HOWA 5E2VH 1GOHA 4ZAKA 4YLBA 3ARQA 5F97E 1BM7A 5IMLB 1KB5H 1IJ9A 1OGAB 4YSOA 1YMMB 3D87B 4LVNC 3HCVA 5D7KD 5JNYB 1R5IB 5HDBB 4G59C 2HVKA 2DW5A 3GSVB 1LO0H 4PWEA 2HKFH 4N9GB 2YK1H 5GGRY 2IMNA 3Q1SH 2G60H 5I24A 1F4AA 3N1FC 4OCXH 4Z5RB 5I23A 1H8NA 1JZ5A 1BX2B 3ZYJA 2GSIA 2SEBB 5FYKE 4K7PX 1MWAL 1T83C 4P46D 4TS6A 5JHDB 1OAZH 3GDCA 5IY5B 1HOEA 2VDRB 1XGUB 1NL0L 2CALA 1NCWH 3CSYA 4FJ6A 5SWSB 3RWCB 3TBVA 4DO5A 3ZTNL 1YYML 3BWAA 1DVFA 3UEZA 1FN4A 2Y06H 1WQVT 3ZZ1A 1FDLL 1Q9WB 4PD4J 3P02A 3DETC 2WLJA 2QVKA 3V4UH 3HN3A 2CLVB 4U6XA 2VWEC 1ESOA 4Z3FA 4FTVB 3NCMA 3WNPA 2FR4B 5JHBA 2UY7B 1M2VB 2BSCA 4FI7A 1GGBH 3RVTC 1FL3B 2JKSA 1WA1X 4WU5B 3UZQB 3V9CA 1BZOA 2H5UA 5HYJB 1HNGA 4JN2A 3KXFD 2C1OA 1M56B 3FTWA 4BZ2A 3M17A 4ODBD 2YMXH 3OX8A 3LB6C 4PVLA 3AY4A 2O72A 4Z95L 4CNIB 1Q9OA 2YPLB 4Y2DB 5ISZD 3SPHA 1Q4NX 3GNML 3ZDZE 3QJZA 2J21A 5IG7A 3MYJA 3PE9A 2H3NA 2D4FA 3KPRE 2DBLL 4MJHA 5GIRB 2Z7UA 4JQIA 4NFDA 3CK0L 2EEDA 3IBOA 1XSOA 5DD3L 3U9WA 3K2KA 4JGUA 4NYLB 1EGJL 5CCKH 4PN6A 5AYUL 2PYFB 1OTTC 3D3VE 3FAXA 3JWNG 3QW9A 4TNVK 4ABVA 5E8NA 1JF1A 1I8KB 5IV2A 3LZOA 1K6QL 5IROD 4ANVA 4FABH 1QWNA 3VXRB 3MRHB 2ZZUT 3QHFH 5TF0A 4GKNA 2VM3A 4W1TA 1DQMH 1UWEL 2EEAA 2XVKA 1NFDF 3V4PH 3UAEA 3I6LD 3CZKA 3C8DA 4PVBA 3A4EA 2KERA 3OR7B 8CGTA 2OAAA 3N41B 1CLOL 1CR9L 3RWEA 2ZPKH 4XPBL 3DARA 2W8CA 3F58H 1BF8A 4N28A 4YWGL 1PNCA 2J2ZB 3QNFA 4PJ8A 4IBWA 5KSBE 3DHJA 5B4MC 1DSFH 2WCPA 3G6AB 2J6EA 5CSBA 1DBAL 1DVZA 1X5YA 5TPWL 1AMYA 2Q2EB 2A4ZA 4JM4L 3IU4H 4OCRL 1KB9J 3GXIA 4M3JA 3VX1A 1FORH 4W9HC 4YXLH 2PXYC 1XR9B 2VL5A 1L0QA 1H3XA 1JFQL 1PFCA 1ZA3A 2A9ML 3EXLA 1JWMA 1DO5A 2HFFA 2Y5EA 4Q52A 4WKXA 2JFCA 3GBMH 3ULVC 1GZHC 2VLRE 4LHQB 5DO2D 1J86A 3I50H 5E9DD 4PJAE 3HN5A 1OF2A 2DIAA 4HXBH 4LMQI 3NJHA 3CLEL 4LSRL 5C0FB 2X0WA 5CZVL 1QI5A 1L3NA 4P4KB 5AZEL 2DH3A 1A1OB 3MX0B 3DX9B 5GSVB 1PSKL 3C08L 3MV8B 2YD9A 3K7UA 2XQBH 2CGYA 1EZVX 1NCDH 5AVXB 3O3DB 3MFFB 5AKTA 4PWKA 3UJJL 1D5IH 2AEOA 1CXEA 2CKBL 2YEQA 5JORA 2V9UA 1DVYA 4WFEE 3IDMA 2Y9RT 3QUKB 1L7IL 5E4AA 5AOZA 1MRCH 1NINA 4YZWA 4MCYA 4YLCA 4ZSOE 1SXZA 2ISDA 5C09A 1A7NH 2XWBA 4WKZA 1G5AA 5AB1A 3AGWA 2M2DA 2XN9A 4WCYL 2YOCA 3HC0A 3V52H 4BSWA 1UUNA 4KTYA 3UO8B 4I1PA 1MW0A 4X99B 5F2FA 4Q0XL 3TWCH 5I5JA 3RX5A 2CR6A 4IRJA 1U8MB 5CILL 5C3IA 3DMMD 3RNKA 1AE6L 5E6YA 3OLEA 5IOPB 4J4PA 4ZX6A 3VE0B 1WCBA 2B4CL 2X4PB 1YUHB 3NVQA 4LKXA 4TUKL 4OLXL 4PYHA 5DVPA 4NGHH 1XD1A 1YEHH 3V6OE 2Y6SC 2CUMA 3U6RA 5DC2A 1XCTA 2IQAB 3MA9H 5FYKD 3QA3A 4NERA 1W0VB 5BO1H 4HLZH 1WAEA 1R0AL 1HU8A 4HA1A 1G9NL 5E99H 4OM1H 5KVEL 5JDJA 4ZFFB 4NM4H 5D2LF 2VZSA 3GMLA 1K8IA 3KYNB 2G0LA 4FFZH 3WKPA 3T8XB 3PHOA 3FQXB 1P5UA 2JCWA 1HVXA 3CXHK 4NPJA 5LDUA 5DHDA 2H9GB 1UWXK 1OO2A 3BAEH 3PXLA 5DJYB 1CLCA 3TIDA 1FYTE 4FNPA 5F3BA 4K94H 1WFJA 4H0GA 4JUSA 4YBQC 2YSSB 1SN5A 4JFHE 4MNHB 3MR9A 3SE3C 2EKSA 3REVB 4PJIB 5GGTA 5KZCD 5MP6L 4JREB 4AQ1B 1E9OA 4MA7L 4F7PA 2DWTA 2ZG2A 3EO9L 4J39A 4M6NH 3BZFA 5T1LA 4BFBD 5IVOA 3OSKA 3EZ8A 2Q20A 2A83B 2IIJA 1YECL 3EYUL 4KI1A 1NBYA 4JVWA 5DD6A 1XBDA 4KKAD 3FUNA 4NO3A 3ZDWA 3DROA 3FQYA 3OKOB 2W60A 4Y4HA 3KPRD 4JFYB 1UKTA 5DEGA 1IBHA 2VQTA 3VI4F 2HX8A 4RX4D 4ZTOL 2H3KA 1W72B 3IGAA 4OZIE 3FO0H 1CTNA 1Q72L 1JZJA 2IDUA 3D3VD 4BFJA 3PP3H 3HC2A 3QWQB 4EDWL 4WO4D 4UBDC 3EOTL 3QC6X 2PETA 4DO6A 3S34H 5C86A 5K93A 3GXNA 3IETA 3P4OA 2VDOL 5EORL 2FEDD 5F3HB 5K1NA 4LOUC 3O2VH 1CFQA 4NSKB 1TYJA 1VPOL 1E4JA 2DWEA 2Q3XA 5F89B 4ZDHA 1BMWA 2FBRA 5CEZE 1GOFA 1J5DA 3O6LH 3GK8H 2XG4B 1FHGA 1UZ6F 4L5FE 5I1KH 4PJCB 5C0DA 1G5GA 3HG2A 1I1AC 3DX8B 4JPKH 3RZCD 2D2CC 3MOBL 4X7SH 5TGBA 2QGCA 2QTVA 1S9XA 5FCSH 4B3EA 4BINA 1JGIA 5F7BA 4DSYA 3TZVB 1G9EA 2XKNA 4YBLB 4CN4A 3U0WH 1CUOA 4JG0L 2IAMD 2R1XA 2YEVB 4Q6IC 3QQ9D 3BKCH 5D1ZD 5JW4R 2RMNA 1BDYA 2NW2B 4BXVA 4YDNA 3LKSA 4MDIA 3KCPB 4OAWB 2FGZA 3T3PB 4Q9RH 2NY4B 3GKWH 2RCSH 4WEEA 1U58B 2NNRA 2VLRD 1WA0X 5KOMC 1BJ8A 1CE1H 4A6YH 2H32B 4M3KB 1A1MA 3OKLA 4KK5D 1I85C 4IKNA 2MNJB 4AMKL 3ARFB 4JHAH 3E2HC 1KFAL 1TCMA 1E43A 5C08B 3N5AA 2JSFA 2ERJB 1R5VA 1YN7B 3DNKA 4WJ5A 3S2CA 5HHVH 1GSMA 1MVYA 1E6JL 3D2UB 5CGYD 4JJOA 4G3YL 3ULVE 3KWXA 3DTXB 3QS3A 2R1YB 3FULA 5FECB 1GR7A 3CFQA 3DUUB 2HT4C 3H53A 3S9DB 2GAZB 4GSXA 4WFED 4Z0BH 4L23A 3RY6A 4EPSA 2DQUL 2N1TE 3NFPA 1E9PA 3QH3B 1NUNB 3WLWD 4HJUA 5K1VA 4AV4A 2YMOA 2VC2L 4WNQB 2R2CA 2AXFA 3OB0K 1BHGA 5BNXD 1T1XB 3NA9L 4ZYKA 3ARBC 3QNXB 1OOAA 3QJVB 3O45B 1BMZA 4WLCA 1SMAA 2E4FA 3HKFA 2ICWB 1IIKA 1TDQA 1V3JA 2VXSL 2FGWL 3AFLA 3QYCA 3ARDD 2DQCL 1EEZB 1MAJA 1R3KB 3N04A 1J0JA 4FYSA 5D7SL 1AFVH 3SQOL 3ZKXB 2F7IA 3K2UH 4L8SB 3RUGA 4GW1B 3L3JA 3V4LA 5DSCA 4HUXA 1PLAA 1OK0A 2Z92B 4YUEH 4JDZA 4MQTB 2DWXA 2DD8H 4EBQL 4LCWB 2DWYA 3CSTA 3VI3E 3FB6A 3TOPA 1HILA 1X9LA 4TPRH 1YEKH 3U0TB 3VTTA 2WXQA 2ICES 3DJRA 3JYBA 1KCVH 4I87A 4IBTA 3UJIL 2IG2L 2WZAA 4Z7VB 5CIPA 1G0YR 4UIMA 4AMXA 4XCCL 5HVGB 4ZMXA 1FYTD 2DQ6A 3AU0A 3LS4H 4YZFE 1D6EB 2X09A 1BZ8A 1LWRA 4WZ9A 4PS4L 1MHEA 3VCLA 3WU1A 3X1EA 4BV1A 3MV9A 3DETD 3NIFB 5DC4B 2FBJL 2K9FB 2P49B 1DYZA 3Q48A 1UA7A 4J6RH 1F11B 1H3UA 1RQ5A 3QFJB 1OAKL 3RVTD 3P3UA 5BV7C 1PCSA 5KVMC 4CC1A 5DJ0B 2F6AA 4XN1A 2VDNB 3KW8A 5I15H 1NCBH 3WFDL 1QI3A 1DJIA 3GS7A 4AGOA 5HSFA 4ZX5A 4M02A 3UTQB 1S7RA 4MMYB 2CBMA 5ERWB 1UADC 4ADGA 4DEPC 1KIRB 4XP9L 3LB6D 4BFIB 1QSEB 4AL8C 3OB8A 2W81C 3B2VL 3MLYH 1R17A 2RFXB 1FWXA 1CE6B 2CQVA 1RFDH 3DSNB 3QZPA 4WWNA 1QO3B 1DJGA 3PYCA 2DEXX 5B22A 1T80A 5C0GB 1F56A 2CXKA 3H4FA 4L9LB 4Z77A 5CEZD 5GGVH 4GXFA 1OWRM 1OTTD 1AP2B 1VGEL 3DXAB 3T77A 1E28A 3QARA 4P46A 4JNXA 2Q7YB 4HK0A 4GY4A 3QQNA 5L4MA 3BZEA 2E27H 3AROA 3GD1C 1E4XI 2XQ0A 3HC3L 3KVQA 4Z7UE 3ECWA 4UI2A 4U6HA 2ZCKL 3C8KA 3H0TB 1HK6A 1TTGA 4YBHA 2Y72A 1INQB 5GS1C 2FYYA 2P47B 2IFFH 1UXMA 1WFIA 4N87A 2IF7A 2B15A 2I26N 2O6FA 4RFEA 2DTSA 4PGDA 3I6KB 5B4MD 4M1CC 2J7LA 3GSNB 5A43C 2Z35B 4JLRB 3MUZ1 3KXFA 2AXHA 3H7BB 2C9UA 2N3JA 2PLTA 1OTUC 3OPZL 3V6ZB 3HMXL 3IRCA 1RJLB 3ISWA 4HEME 4LSUH 2WZ6A 1GGCH 4M3HA 4F9LA 2HWZH 5I1CL 1A9EB 2C1PA 5ISZA 4X80H 2XFGB 4Y2NA 4OCSH 2XG5A 2HFTA 1XDTT 3KYKH 4AEIH 2A6JB 5D7EA 4YHZH 4WI0A 4WHYG 4BEIA 5DMJB 3IDXL 2IOOA 3ULVD 3WNKA 1ZHLA 3VFTB 3BSZA 1EWHA 4JFFA 4QEGA 4TQ8A 1JWUA 3ZL1A 4PRAA 4QRFA 4OJDH 4RSYA 4V11A 3W81A 4GQPH 2JB5L 2NX5D 4TLTA 5FCUL 1S5HB 1MFVA 2HXAA 4GKSA 4H1LH 2FE0A 3VGBA 1YQVL 5BW7C 2WJ5A 2BLFA 1OT4A 2OS7A 5IROA 3CFJA 3W2DH 4N6RB 1EHXA 4PM1A 1MCFA 1C1EH 2J88H 2DDQL 4U31A 3RNQB 4KMTL 1F0LA 2HSIA 3N9GH 2FX8H 3HRZA 3VD3A 1U42A 2DS4A 4GT0A 4O2FB 5AW4B 1AG0A 5FUCC 3UAJD 4Y1TA 3R1GL 1K4DB 2KDGA 1DEEA 3NSFA 5KYYB 5DEFB 1FLTX 1OAXL 1I7ZA 3WEAA 2R0ZL 1P4UA 1SFDA 2GW5A 1BBJA 5F96H 5L6YH 4DTGH 3JUYA 1SNRA 2V8MA 2JF1A 3DBSA 4J12A 3CIQA 4WWKC 2EE3A 4X6BB 1M3IA 4YX2H 3GMOB 3ILDA 1FF5A 1DN2A 3CN4A 5IVXA 1U93A 4L1DA 3F83A 3FHQA 3LNDA 4I0KA 1N64L 1VHPA 2AK4E 2O4EA 4X5XA 1UH3A 4QRPE 4APQB 5I6OA 1LHZA 2GVYA 1WE5A 3D34A 3SQRA 3VFOB 4HPYH 3HAEB 1EMTL 4EOWL 2Y6SD 1J9TA 2J55A 2GQHA 1EO7A 2VMEA 4NOFA 3R7QA 2V5SA 1G1YA 2FVNA 1U6AL 1ZSDA 3RL1B 5HY9A 4NIKB 1M7XA 5LUMA 4BGLA 2JJTA 3IFPB 4LNRB 3TNNA 4ZOAA 1J9SA 4L3EE 5GGUA 1INEL 4PGCB 2BW5A 4QOKE 2XT1B 1UWYA 1IKOP 3KS0J 3CN0A 3L3KA 2OYMA 3ETTA 3J27A 2O1AA 4LBEA 2E6JA 4ZFZB 3LEYL 4AYID 4NQQA 1RHHB 2G4EA 3MRIB 2XDHA 4MMXB 3P4LA 1HEJC 2ATKA 3BQVA 4RGMB 2A7BA 3BP5B 4YBQD 4IRSC 4ABUA 2JKNA 4V2CB 3WELA 4HIEB 2CDEA 2JELL 2OZ4L 1EFQA 4UM9B 3QDGB 3DO7B 2KZWA 4ACPA 1MI5B 3DO4A 1NCAL 4OKVB 5EU4B 1O7DC 4F7EA 2X3BA 4AENA 4ZI8A 5AW9B 1VFAB 5JIIA 2OA9A 4B3VA 3OTTA 3LIUA 5DWUL 2EH7L 2XYCA 4NHCH 1IAOB 4K5LA 4V1DE 3SCMA 4F92B 4AV0A 3GMQB 4AZ8A 2ZJSL 1I7RA 3F04A 3MRCA 5HI5C 3ZE1E 2X2IA 5DZJA 1OM3H 2F68X 3QFDA 1WZLA 4X9GA 3OJVC 2EJ1A 1WIPA 4UBDD 1R75A 2HH0L 4Q2ZB 3CHPA 5I74B 4C58B 4W9ZA 1NC4B 1ZANL 5AFAA 3FUKA 2DRUA 1CGYA 4P5SA 2AEWA 5I6XC 4LOUD 1I8LA 1HSBA 2OKMA 1QNZL 1KOAA 3D12B 3DIFB 3H6JA 2XVGA 4F80A 1WICA 2FLBT 1GGIL 5EBLA 4IU3A 2ZUUA 4CMMB 5A1AA 4YIQA 1FFNA 4XZUB 4LPTA 3VG9B 3ARGC 3FCTB 1I1AD 3Q2NA 1KLFB 4OKDA 4YE4H 5F7YC 3A5VA 4JZJC 5MEQA 3AM8A 4K3DL 1Q0YH 2P28B 3WJJA 4E0RB 5I82A 1EDYA 2IANE 1AD9A 3MBWB 3NK3A 3NN8A 4XP6H 5I1LB 1D9KC 5D7IE 4CADA 4M9PA 3AU1B 1F3DH 2X4SB 4FXTA 1DN0A 5H35A 4IU2A 4ELKB 1BAFL 1YEEL 4Y5YA 3D4GA 3ESOA 5ITBL 5AEAA 5SV4A 4QF1B 5IWLA 4QRUA 4RX4A 3WO4B 3ELQA 4Y5XC 1WZMA 4NFCA 1NAKL 2R69L 3NFNA 5B21A 4JKPL 4WO4A 4BFFA 2NTFA 3MREB 4HWZA 1G7IA 4R96A 1QEWA 3P2TA 4Y0GA 4MXVE 2EO7A 5GRYA 5L7XH 5JR1L 1JMXA 4EQ3A 1S7TA 2AK1L 2H0JA 3TA3B 3VD2A 2WLLB 4PRHE 1EVTC 1S6NA 2H3XC 2PW1B 3ECBA 3EJRA 3RDJA 2HT4D 4HC1L 4WFFE 1B0GA 3I9IA 2JK5A 4ODSH 4EZLA 5IQ9A 3ARZA 3SY0A 4F15C 1P4IH 3CLFH 4JQXA 2B16A 1CN4A 4OF6A 4J3VA 4X7EC 5FGBA 5IW6B 2F8IA 2NQDA 1KJ3H 4HK3N 4KROB 3GXFA 3V5HB 3ARBD 3F7LA 4LOFA 2MNUA 4KVNH 5FUOL 3MODL 3HNSH 5J1SC 4HIIB 3MRKB 12E8H 4KHXH 3KBEA 1IKNA 2IAMA 5D1ZA 5ICYA 1ID5I 3APCA 2J1KA 5EBMA 1TTAA 2AK4D 4PWGA 3AREC 5FKAB 3ZE2E 5IQMA 4QRPD 4HCFA 1QFUL 1UACL 4IDJL 1R47A 2AABH 3R06A 2UZYA 5LNGA 3NIDB 1S7XA 3FT1A 2VISA 3RPIB 2VLRA 4WJKB 5GHWL 5A16A 2C9VA 5C9JB 1N2RB 3H2WA 1OXYA 1HHHA 5LNDA 1Z9PA 1NLDL 4PJDE 3S35L 4OH2A 4Q4IA 1A14H 2AEPH 1SN2A 1NBVH 3VRJB 4PUBL 5GXBB 1B9KA 4ZFGH 3T6QC 1DVXA 1NANH 3SY6A 3DYOA 4EQ2A 1M42A 4L3ED 1IGFH 4QOKD 5F6IC 3GBEA 4F91B 2WBJB 1TOXA 4PRBA 3E8VA 3KPMA 3G9VA 2LHAA 5L88L 4RMBA 3MLWH 1HI6B 4NJ9L 3JV5A 4FXKB 3S5ZA 1SJHB 4AW4A 4OI7A 2KHAA 2MCPH 3T3MF 3LKOB 3V6FA 5K69A 3WEXB 5ESAA 3T6WA 1XGZA 4LBAA 3VXUA 1ZGLB 3EH5B 3BOVA 2HG0A 3QQ3A 2H47C 4PJ5E 5G5DB 3SODB 5JPNA 1B2WH 1B0IA 1OHQA 4YSSA 5EDSA 4IS6A 3ARDA 2AQ1A 5GGVY 5KBLA 1PD6A 1ETZA 3N42B 5AOJA 2R51A 4WWKB 4YHMH 4NKOA 3DPDA 1U3HB 1DQQB 5D7LD 3DX8A 4QJ3B 2JCCA 1HQRB 1PCXA 2BHFA 4HS8L 1NAMH 4LLMB 4XPAL 5D7HA 5AZ2H 5TE7L 2IV9A 4LSDA 4MA8L 2Y69B 5IJVB 3RP1A 1YEGH 5SX4I 4KRPC 3MRPA 1SVCP 1MEXH 1BXXA 2YAPA 3AQYA 1W2KT 4U6YA 3V5KA 4OCWL 4C4UA 3FB7B 5C07B 3D85D 1JYVA 4NC1C 4K94C 2YRLA 3QYNA 4AC2A 2P8PB 2EVGA 2H1PL 5E08L 4H4NA 3WIHH 1UB6B 5DT1L 3SDAB 4GW5A 5I17B 1KTKE 2WXLA 1FYTA 1KYAA 2X4QA 1T83A 2X4RB 4K3EH 1OPOA 1YYCA 4XO9A 3D09A 2EZ0C 2XY1A 4NKMA 1KCUH 2BNQB 1SEQL 2BNRD 3L5JA 3LEVH 1UZ8B 5FHBH 5KVDE 2O5NA 2IAND 3TX4A 5AOKA 1FNSH 3X11B 5AAPA 4OT1H 1E9QB 2NMSA 4F7KA 3G5ZB 1NIDA 3SBPA 1S4IA 2HRPH 1FSKB 1RZIA 4QMEA 1HNFA 4NZFA 4PV1C 4PRNB 1MREL 4M1CD 1QYGL 1O5PA 3DUHA 1XEDA 4OW6A 4K3JL 4OFYD 3CUPB 3H3PH 2UX6A 5EC2A 4G82A 5HP5A 2PO6C 4XCFH 3D52A 5EIIG 1OTUD 4X9YA 2RGSA 4OFVA 3SKOB 3B8YA 4UQ3B 4OUUA 1GS7A 1MF2L 1OPGL 1NJ9A 4HUVB 3H9SD 2IH1B 4QTHB 4KOCA 5AG9A 3S4SB 3QUXC 3B2DC 4GG6E 1O6SB 5I30H 4BWTA 5C0CB 3K4ZA 4A7VA 3EBGA 4O2EB 5E8OA 1EZUA 2UUDK 3G3LA 4O02H 4PRHD 3EJCA 4PV8A 3WNNA 3CCHB 4UZGA 1MUJA 2QLYA 3LRKA 3VXME 4TSAL 4AC4A 4DP4X 1PY0A 4KDWA 1CZ8L 5EBWB 1UT1A 2DQEH 2YOAA 2Z1PA 4OBRA 5B3SB 1BG1A 2EDFA 1A9BB 2LGNA 4UDTB 2QPUA 4MD0B 3TV3H 1BGXH 2H6PB 2VM9A 1KB5B 3IPEA 1ZY9A 4FRWA 1EHAA 3SD2A 3HZKB 4GRMB 1N6QH 3NGBC 2V7NB 2F5BH 5FM5M 1YNLL 5D1QB 2V37A 5FAAA 1HXMA 2I32A 2ZSWB 4XPGH 5D96B 3MRBB 3M86A 4RAHA 3BZ4A 1KGWA 1HZHL 1NCNA 4ONFL 4WWKD 1MQ8A 1RUAH 3EIFA 1BAWA 3GM8A 5E8EB 1OY3B 3FCSB 3WEBA 4MD4A 2VR4A 3RL2A 1CL7L 1WIUA 1XIWB 2YKLH 2ZICA 4JE0A 1EO5A 5T3XH 4DO4A 4NUMA 3BQUC 2O5ZH 2B1AH 4F3FB 4I3RH 5FUZL 2PXYA 1T1WA 1WWBX 2D4DA 3Q2WA 4URKA 2P5EB 1Z9SA 4J3BA 1GZHA 3RPKA 2HFEB 1OGTB 5B1CA 5JOEA 3QCUH 4N0UB 1KIRA 4KXCA 4NQDA 5HHOE 3QZWA 5TE4L 1A4KA 2P8MB 3B9AA 4R0LC 5GSRB 4DK3A 1R3LB 5JW5B 3RVUC 2NX5A 1AXTL 1J0YA 1Z9LA 1Y6MR 1K4CB 4KI5E 3JWOH 4OQ1A 3UO1H 2ITEA 4R26L 4I3GA 2NY2C 3MRDA 4X5WB 3A24A 5K9KB 3JQOB 4WY7H 3I02B 4NUGH 1OEZW 1BQLH 3NK4A 4KOBA 1JHKL 2AJZB 2I07B 3L3DA 2DLFH 2NY1B 2EVIA 4N8CL 5DEJA 1IFHH 4IRSD 4PJHB 1T2QL 2BSSB 2FT6A 4FS0A 1SOSA 2WBKA 1JK8A 4RA0C 3UMNA 4JFTA 4HCRA 2VR9A 4XVTH 2WYHA 3UBXI 1HEHC 4AYBA 4E9RA 4X4YB 3DLQR 1MW1A 1NKGA 5ADOL 4WSJA 4KK9C 3ESVF 3LPFA 3LXCA 2COQA 3O3EB 2A9NH 1KCSH 2E46A 3V4PB 1MCPL 1R5WB 1WDAA 3C6SB 5I19H 1PX3A 4Q6YA 5KN5A 3PIQB 2BWIA 3MRMA 2IFGA 5K9JL 1LDPH 1HESA 2FJGB 2WCSA 5EIIA 3SQBA 3CFIC 4K23L 4E2OA 2CHXA 1TXKA 5HI5D 4NCC1 3GLDA 4N86A 4DP5X 2W95A 4RGNB 4HWEH 5AOIA 5I8CA 4G9FE 3NIGF 2UWEB 1JHLH 3WTVA 5IMMA 1WS7A 2DMGA 2Q7NA 1J8HB 2R2BB 4K7FA 5EOTB 4XNDA 5DMIL 3HKZA 4PJBB 3TNMA 5AYQA 1BQHB 2CNZA 5T1MB 5KS9B 3O41B 4LCCB 4NC1E 3L9YA 4S2SB 5DJXA 3I6SA 4U1HB 5DZ9A 4R9HA 4H0HB 4ZMOA 2FHBA 4KUCF 2G75B 5L2JB 4GG8B 1CDGA 1H8SA 4Y1SA 2WUCL 4BDVA 4DPCX 3ULUH 3SE3A 5I0ZA 3ARGD 1JMZA 3KEDA 4HV8B 1J48A 1FVEA 3SSGA 4GH7B 4ZPVA 2LFEA 3D50A 1CVRA 4UTBA 5ENWB 2NCMA 2M1KA 4M8UA 1KLUA 2AJ3B 5AVWB 4GRLC 5ETUA 3LXUX 3T5WA 3RKDC 1D9KD 2YA1A 4XN2A 1YNKH 5GS0C 3GHBL 4YHLL 3CVHB 1U9KA 1GTNA 1NLBH 3RVWC 3MUUA 4U1LB 1CIDA 4ZD3L 4R8WL 5E56A 5A2JH 3BUQA 3VXMD 4GW4A 1A25A 5I1HH 1NEUA 2BOCA 1OB1A 1THAA 2GUOB 3QORB 4Q6KA 1RK0B 4UQ2A 3FNKA 1WS8A 5EU7C 5BMFH 5D2NA 3V0WH 1KYOJ 2BFGA 3AXHA 3VFNB 3WO3B 5GGRA 4Z7UA 2ALWA 2CO7B 4B9ZA 4L8BB 2WQ8A 5IBUG 1QWUA 1OLZA 4N25A 5FKPA 4B5ZA 1J87A 3CG8A 5LAXB 2D3NA 2L7EA 1CFSB 3MRRB 4IKLA 5EC1B 5FDYA 1I1AA 2K6WA 4PJXE 3UC0H 3SOBL 1X9RA 5EUOF 3PWNB 1S7VA 1Z5LB 4IEFB 2DIJA 4JFUA 3NCJH 4KXZH 5L9DL 3P9LB 4HEMA 2FO4B 1NCGA 3DV6A 3NSDA 1S9WA 4HZ1A 4C54A 4LOVA 2UY6A 4X8XA 5IEHB 3ARED 2OL3H 5KOVC 5CP7B 1ZOXA 1TIUA 1XGRA 4E5XG 1M7DB 2BOLA 3L4TA 1FFPB 4P06A 3L45A 1CT8B 4TOYH 3QDMB 5JOFA 5E1AA 1SLWA 1WFTA 3QHTC 5J6HB 5GGQH 2YGOA 1I85A 1DJSA 2FEEI 5H2BB 5HHOD 2WAQA 3WFCL 1BEYH 3IDIB 4IGBC 1QBLH 3VH8G 1TFHA 5FFLA 1RCYA 4Z7NE 1OSPH 5TTRA 1Z7JA 4RLDA 3B6SA 4CSTA 3O6FC 4U6VH 5J12C 1F4YL 3QUZC 3CDGB 4L2LA 5FO8A 3CN1A 3PHQB 1PLBA 4UT6H 1KCKA 3TH4T 7FABL 2ROYA 3X3FL 3JV6A 3TC9A 4ANWA 3CE1A 1P4BH 3LNFA 3OXSA 5HI4C 1FNAA 4ZQKA 2RA1A 1A6UH 4YHPA 2VXUH 3OQRA 4Q2ZA 4HUUA 5CCJA 4BZ1H 1XT5A 4OUOA 4XNUH 1JGDA 3FQNB 2FB4H 1A6AA 2E9BA 4LXFA 4HWNA 2AEQH 3ARBA 4NQVA 3NACH 4ODTH 4QHLB 1OVZA 1U8NB 3DYMA 1KULA 3L16A 3OC8A 1ZEAL 4IOSD 3UDWC 4KVCL 4J6IA 2AK4A 3BE1L 15C8H 4XGZA 5AVTB 1WD9A 3Q9QA 2DWDA 4QRPA 5FFGA 4GUQA 1AQKH 2GK2A 2BSRB 2NUPB 5HYSG 2C5DC 3TVMC 2VCOA 3AT0A 4X6DF 1KCRH 1G7HB 3L95A 3QDAA 4HQQL 2Z91B 4Y16B 3KH4A 4G8FB 4PWFA 5IREA 5D72L 5IEKA 4KRPD 4XNXL 2R1WB 2I27N 1G7QB 1JZHA 3FO2B 4DP6X 1ZV9A 5KG9B 2VDLH 3APDA 2J4WH 4BZ2L 1QQDA 2G5BB 4XVOA 3SBRA 4L3CB 4QOKA 3FB5A 2YQ3A 5DRNA 5F7DB 5J3HC 2DIEA 3D9AH 2G9HA 5KJRL 5C0IB 1AGFA 1GYUA 1MFAL 2PR4L 4R2GB 4GP8B 1NCJA 4H8WH 4UWQB 2AFNA 3MA7B 1NUGA 3MGTB 4J3WA 3WE1A 1GYAA 1C8QA 4FQCH 1FH5L 1HINH 3LH9A 4HJJL 1MCWW 1IM9B 2EZ0D 1R33A 4L4TD 3GMRA 3VXQB 4XO8A 2X5PA 3WENA 2DM7A 1IEAB 1KIPA 3WXVL 4ODVH 5IBLC 2XPYA 4EN3C 5I73B 1FO0H 3DGCR 3L17A 2PW1A 1RKRA 3V2AR 1S7SB 2NT0A 5AW5B 3K1KC 1J1PL 2Y7QA 1YNTA 1QSFE 1IGML 2E76C 5C2UB 4DGIH 3C2SA 3D48R 2PO6D 5D7LA 5KTEH 3BZ5A 2AF2A 1CTOA 1TPXB 2CLRB 4CW1A 1UVQA 3DV4B 4G43B 4HUCA 1CQYA 3OMIB 4E5XA 1B4RA 1D5MA 3D7PA 4ZW3A 3AC0A 2EINB 2J6EL 5FKAA 1YN6A 3QUXD 3LH2L 2EVFA 3L08A 3UAFA 4NENB 4JPWH 4F57H 3P3TA 3D85A 2Y2TA 1N67A 2FWOB 3BGFB 4CGTA 5CSGA 1B90A 1UYWH 1ZMYA 1Q9LA 2H0FA 2XFXA 4F2EA 5B3JE 3VH8A 5I16B 5J8OA 4UT7H 1FNGB 1XXFC 3D07A 1V27A 2OSLB 3VAEA 1L0XA 3T1FB 1TT6A 4UTAH 5E0QA 3WTTA 3TIEA 3OKNA 5EU7E 2XQYG 2EDEA 5E9DB 3VXTA 3E6FB 5DF0A 2BNRA 3JTTA 4OF3A 2NYKA 4OQTA 4U0RC 1RXLA 4XWOC 4QO1A 1QLRA 5DUPL 2IANA 2PPEA 2NSQA 4N2OA 3MV01 3PXJA 2EO9A 4NZUL 5GS1A 4HUWB 4AYFA 1SHMA 2CK0L 2FJFB 3WG7B 3QZLA 1U92B 1NMCC 3ROOB 1NUFA 1SY6L 4I2XB 3S3JA 2Q6WB 43C9B 5AW7B 1EXHA 1T03H 3VQMA 4OFYA 4WW2B 1GIGL 2W07B 5HVWA 1A8ZA 1UFUA 4LEEA 1VJSA 1BLIA 2GT9A 2V17L 3CD4A 3MRGA 4YQXH 5E5UB 3QE5A 1E4KC 1GKEA 3ZR6A 4HFUL 2WO4A 3WKNA 2EDRA 4M5ZH 3T71A 3WMPA 5G4NA 1NWPA 3BQUD 4JPVH 4S11A 3H9SA 2ZYHA 3NFSL 5HYSA 4E68A 1PG7H 2WGNB 5DFVC 2V0AA 2OMXA 3FYIB 5HDWA 3S8WA 5FOBA 5DZOA 5F7UA 2AQTA 2GITB 5LBSH 3MOAH 1HAWA 2KS0A 4GFTB 2P7TA 4XNMA 3DMMB 4I0PC 5E2UH 2VQ1B 2PCFB 1JZ6A 1J5OH 4X8GA 2W0FA 3RVUD 1P7KB 5F9DC 2A74B 1BYNA 3R18A 5BOZG 3B34A 1UHVA 4WAFA 4JG5A 4RVBA 3JV4B 3ZBMA 5BW7A 4JL2A 1NUDA 2R2EA 3BT2L 2NY2D 1DLHA 2BIMA 2C3WA 5KJ4A 3TJPA 3TONA 3L6FB 1KCWA 6PCYA 1UCBH 1XZ0A 4YVUA 4OD1H 3ARTA 3EUUA 5KYUA 2YGNA 5F3FA 5E2JA 5SWZB 1G43A 3LSOA 1IAII 1KJ2H 1X5LA 3AWFA 3LX9A 1G9NC 2PCXA 5INDB 1OL0A 4TNEA 1R3IL 2R4RH 2GSMB 3HG0A 3GZOA 1IGYB 1GGYA 3GRWH 4GMTL 4DZ8B 4EKJA 4Z7IA 2P5WD 4WWKA 2DYPA 3B4NA 2A6DA 4MRCA 2DWSA 1ZHNA 4KK9D 1J0HA 3HC4H 4LPCA 5L0QB 1M7IA 4XH2A 2IPKB 4L8DB 2PMZA 1ZWIA 4LE8A 4UYPA 5AOMA 5GGTL 4IRZH 1NFDE 1CFTB 1P7HL 1FLRH 4WW1A 5DRXA 4ATTA 4M43H 1V55B 1XF2B 2H0PA 3BAWA 2HJFB 4U6TA 4XXDB 4ZW5A 3GJFB 3V5DB 4EN2A 4XR8C 4YDLC 4W6XB 2HB0A 3FPXA 1YUKB 2WXRA 5TDNB 3T2LA 4GKZB 4H2AA 3DGGA 5HYFA 3OPUA 4GKLA 1EAPB 1IBZA 2QR0A 3KGSA 3KPRB 5HTSA 2ZCLH 4KK6C 3VRLF 4ZUSA 1U95B 1YCSA 2RIKA 3VXNA 1A22B 1QOKA 5DJCA 3D3VB 43CAB 3GT6A 4BK4A 4NJAH 3DX1A 1X3DA 4MKMA 2NUTA 4FQHB 3NQKA 3WTSA 3THML 2Z7YA 3O6KL 3FFCE 3FCUB 4JRXE 5MEOB 2D0FA 3A6CH 4MNGE 3MI6A 1J9CT 5HHXH 3Q2CA 3QIWC 1QSFD 2KLRA 2XQYA 1I1YA 4NQUA 4IRSA 4LU5L 4M8VA 1PL3A 2W9EL 3GUTA 3VXOB 4B41A 4G8EB 3VUAA 1G6RL 3L5IA 4N22A 2AS5M 1F2QA 2VSKB 4NN5C 1T1YB 4XMPH 4G1EB 1N8OE 1JOIA 4KQ3L 2D9CA 4GRLD 4N2LA 4E9VA 1KLGA 3RKDD 4DF9A 5KSBB 1IRAY 2BZCA 1I1RA 3UH8A 5GS0D 4PEEA 1SDYA 4ONGH 1F3DJ 1DBBH 1PZAA 5DHVH 3RZCB 3Q1EA 4PV9A 3TYFB 4NWTH 5IKCA 1S9KC 3RVWD 4OZGB 5T3ZL 3G5VB 1IZJA 3RWJA 1O6TA 1BOGA 5IW3A 3KLDA 3C9NA 1KXVC 5FO7B 2DM3A 2XZCH 4CSSA 1ZPUA 3T2OA 3WJLC 1G0DA 2VJXA 4YPGB 4UV7L 4JHWH 4HT1L 2CO4A 4KKRA 1FL6B 2ICWI 1JXKA 4ADIA 5CD3B 4J2QA 3UG4A 1V7NH 4ALAL 3VA2C 4NQEA 1K5NB 1QA9A 4MNQE 4PJAB 3LZFH 3DOSB 3TF7C 4AG4L 4KKQA 3DRTA 4FQIL 4P2AA 4AIOA 1B3JA 4TXVB 4R97B 1W6LA 2VR8A 1UXWA 5AD0B 4R4BA 2HFGL 3EH1A 3O0LA 1E6OL 3RTQC 3ARGA 1I8IA 2OMYA 1MVUA 1H6TA 1UB5A 3IJ8A 3KPNA 2X4NB 1KTCA 5G4MA 5TE6H 3BXNA 4JZJA 5H8DA 2Q86A 4WFGE 5F7WC 2JKIS 4CVXA 1CFMA 4P2OB 5IJDC 5DUBA 3I3DA 4ZSOB 4W4NA 4PJHF 1D9KA 4NQCE 5IJCC 3TEZA 1AJ7L 1SDDB 2Q5BA 3IDYC 4GG6A 3EBIA 5CJXC 3DIDA 4WI7A 1PYWB 3ASNB 1O0VA 1FNLA 3SJVE 3ZRSA 4O9HL 2R0LL 1J18A 3BP6A 5I6NA 3VXMA 2I24N 1P6AB 5A2CA 4N0FB 4IGBD 3MBEB 1X9UA 3S36H 2QHRL 3BESR 3ENEA 3ETBJ 4RISL 3EFOB 3F7VB 1A0QL 2QKIC 4FHKA 4GSQA 1JV5A 1DUYB 1NCHA 4WVRA 5T1DL 3O6FD 3V0JA 1TNMA 1YY8B 5CUSL 4ZUTA 1IU1A 1MXDA 3QUZD 1TCRB 4LF3B