1JZJA

Pseudomonas aeruginosa azurin os(bpy)2(im)(his83)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords azurin
publication title Electron tunneling in single crystals of Pseudomonas aeruginosa azurins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jzjA00
4DP8X 2HZHA 4MFHA 2H47C 5ANHA 1E65A 2XUWA 2B3IA 2J56A 4W9ZA 1KV7A 2WO2B 3S3CB 1PZAA 1T5KA 2PPAA 1FA4A 1TKWA 1CURA 3IE9A 1AZNA 3ABGA 4P5RA 4M4RB 2J5WA 1PLBA 4HCIA 3ZIYA 2GC4C 4YSEA 2IWKA 1GSKA 1AZCA 2XYBA 3S8GB 2XLLA 1AG6A 3NJNA 2IDSA 2XU9A 1WS8A 5I6NA 2I7SA 3AZUA 3V9EA 4GY4A 3EH5B 3NJKA 4GYBA 3L45A 1AQ8A 1IKOP 1JZFA 3AG3B 3TU6A 3CDZA 2A3TA 3NJMA 1WA0X 3EH4B 4YSAA 1XMEB 2JFCA 2QPEB 2P80D 1NICA 3WI9A 3QJRB 3PCYA 2XVBA 2J55A 2WO3B 2CBPA 1BYPA 1L9QA 4G70B 4KOCA 2BW5A 4GP8B 1NIBA 2IH9A 4UAHA 3EHBB 3NSCA 2EIKB 2BWIA 5FC9A 1NIFA 5B1JC 3GXUB 3FU7B 1JERA 1IC0A 5PCYA 2YXWA 2HX7A 2VMJA 1WAEA 4A2HA 2PPFA 1AR1B 4F2FA 2GBAA 3WKPA 1V54B 2JKWA 3NJHA 3FSAA 2J57A 2GC7C 3G5WA 3X1EA 1MG3C 3PPSA 4BXVA 2PP9A 1X9UA 3UABA 2AZAA 4CSPA 4E9QA 1M57B 3UAEA 1AZRA 2N0MA 4A66A 4KO6A 2CAKA 3FSZA 2OCCB 2CJ3A 3H4FA 2FNWA 4NB7A 3QQXA 1OCCB 3ERXA 2VSMB 4A2FA 2VW4A 1ZIAA 1AANA 1ASPA 1N68A 1XB3A 2HRHA 2Y69B 3ABMB 4N4YB 5B1KA 2P80A 4DP6X 4FAAB 5I6PA 1A4BA 1L9SA 3TA4D 3T71A 2DWSA 1BXAA 4G72B 3S3DB 3NT0A 4UANA 4DPBX 1BEXA 4BWTA 5TK4A 2MRYA 1CC3A 1URIA 4KNUA 4QLWA 1DYZA 1J9TA 1TU2A 5B1BB 1PAZA 1M9WA 2Y1AA 3ZBMA 4CSZA 2BZ7A 3SQRA 4AKPA 1OE3A 3HB3B 1ILUA 1BXVA 1XB8A 2VN3A 1PZCA 3X2QB 3ASNB 4BXSV 4HZ1A 4JHVA 3AG2B 2EINB 2GI0A 3FSWA 4WKXA 2FT6A 1W6LA 3CVBA 3FT0A 1ETJA 4YSUA 6PAZA 1NZRA 5I6LA 2ZWNA 2HRGA 4QKTA 4A2GA 5D4HA 3CDZB 3PLYA 2PLTA 3SBPA 2DV6A 3DTUB 2BP8A 2YAFA 2Q5BA 2PP8A 4HHWA 3TBBA 1GS6X 1SF3A 2QDVA 5A7EA 2RACA 2HXAA 3PAUA 2IDUA 1JXFA 4W1TA 3PXLA 1JVLA 1IUZA 3WNIA 4KO7A 4YSDA 1V55B 1ZDSA 4AZUA 2H3XC 5AFAA 1L9RA 1UATA 1EHKB 1MZZA 4DP1X 3ZX1A 4DP9X 3QJSB 2WSDA 2AANA 5AKRA 2UXGA 1AACA 1AZBA 1SHWA 2LLNA 4AKOA 1ADWA 6PCYA 3OM3B 4KO9A 3FYIB 4BWUA 1JZGA 1KCWA 3NJJA 1ASOA 1QHQA 3NJLA 2ZOOA 5I5MA 4K9JA 1ILSA 3CVDA 1GS8A 2X87A 3QPKA 1SDDA 1FFTB 1ZV2A 1PLAA 5B7FA 2DWTA 1KYAA 3IBOA 3SBRA 1AAJA 3ASOB 5B1JA 1PCSA 1AZUA 2IH8A 1BXUA 1BAWA 4L0PB 2EIMB 1NIEA 3PAVA 2AFNA 5EHFA 2DYSB 2Q9OA 3AW5A 1E5ZA 3CZUB 2BZCA 2QPDB 3V9CA 4NERA 3TBCA 5I5JA 2YAMA 3GDCA 3NJGA 3T9WA 3SBQA 2FT7A 3WIAA 7PAZA 2VW6A 2PP7A 5B3SB 3NJIA 1JZHA 1PMYA 4DP4X 2HLEB 1JZEA 3FPXA 4BDVB 3FU8A 3GYRA 2OJ1A 1DZ0A 3KW7A 2PPEA 2IWFA 5LDUA 4A2DA 1MZYA 1W8EA 1PNDA 2BP0B 4G7RB 3KW8A 4GP4B 4EF3A 1I53A 1IBYA 2E86A 2JXMA 1ZDQA 4DP5X 3NP4A 4X4KA 2XX0A 4YVNA 3PAZA 2FQFA 1A4AA 4GXFA 2BP8B 4PCYA 1WA2X 3IN0A 3NYKA 2PPDA 4TXVB 1ZPUA 3OMNB 1BQRA 4KNTA 2GB2A 5E9NA 4KO5A 4YL4A 3N55A 3OMAB 1GR7A 3T6XA 4YVUA 4E9SA 3NSYA 2DY2A 2QDWA 2UXFA 3IN2A 2QT6A 1B3IA 1NWPA 3ABLB 1L9OA 1BQKA 4GP5B 3X1BA 5I26A 1NPNA 1W6WA 1J5CA 1CUOA 1ID2A 4G7QB 4HIPA 1AIZA 4AKQA 2IAAC 2FQDA 1KBWA 3T6VA 1GY1A 3BQVA 3UAAA 2X88A 4JKNA 4YSPA 4YSTA 2W88A 3AG1B 1NDTA 3UGEA 1E67A 3FQYA 1PLCA 1XB6A 4HHGA 4ZK8A 4YSCA 3ZDWA 1OE1A 1OE2A 1SHXA 1J9SA 2UX6A 2W8CA 2YAHA 3FSVA 1IBZA 3UACA 2TSAA 1E30A 3IEAA 1A8ZA 1F56A 3JT2A 3D12B 3N2JA 1ET7A 4YSQA 2I7OA 2XX1A 2YAEA 4DP0X 4M3HA 4KOBA 5TK2A 5I6OA 1L9TA 3NSDA 1R1CA 1V10A 3CVCA 4RH4A 4E9RA 3ABKB 2I85A 3OMIB 4E9YA 3JTBA 1QNIA 4F7KA 1JOIA 2GIMA 5D4JA 2FWLB 1J9QA 2HX9A 2VSKB 2BHFA 4G7SB 4NAJA 2XV0A 3U25A 2YAOA 1SFHA 3UADA 2R7EA 5B7MA 2XXGA 1KBVA 3EH3B 4E9WA 1A65A 1PNCA 2YQBA 4E9XA 2ZONA 2DYRB 3AG4B 3AY2A 2BO0A 5B7EA 4HAKA 3NJFA 2UXTA 1AG0A 3NSFA 1SFDA 4F2EA 1WS7A 1RZPA 2YXVA 1RKRA 1HAWA 2EILB 1E5YA 2XWZA 2PCYA 5I5IA 1RCYA 1KDJA 2AZUA 3DIVA 3FPYA 3HEIB 2PCFA 3QJQB 2CALA 1AS7A 1JZIA 3FS9A 1TEFA 5D4IA 3X1GA 1A3ZA 4HCFA 5I28A 4YSRA 1OCRB 1GW0A 2B08A 1AS6A 1KCBA 3C75A 1SF5A 3DKHA 4Q8BA 1M56B 1OV8A 4N8UA 1FWXA 3T6ZA 3CG8A 3H56A 3OD3A 4DP7X 1NINA 2YARA 2NRDA 5F7BA 4PAZA 3T6WA 1GY2A 1ET5A 1OOWA 4E9VA 4Q89A 3FU9A 2YAPA 2FTAA 3NP3A 4UF7C 1A4CA 3MX0B 7PCYA 1CYWA 4AX3A 3WG7B 1GS7A 2IDQA 3BVDB 1YLBB 5PAZA 1BQ5A 4YSOA 3QJTB 1X9RA 2BWDA 4WTQA 4DP2X 1BYOA 4HALA 4FA7B 2FQGA 4BWWA 4YSSA 4ENZA 1PY0A 1RZQA 3QJVB 2MTAA 2YAQA 4HCGA 1PF3A 2UX7A 4A68A 1L9PA 2FJSA 2UXVA 1GYCA 1PZBA 1TEGA 8PAZA 3FQ2A 1CYXA 2EIJB 2VM3A 3X1NA 1OCZB 2FQEA 2IDTA 5B1AB 1OF0A 4A67A 4DPAX 1N70A 2AVFA 1JXGA 1ET8A 1NWOA 3WNJA 5I6KA 3H4HA 5F7AA 3X1FA 1JXDA 1ZIBA 3S8FB 1EZLA 2FT8A 1KDIA 3OQRA 1ASQA 1HAUA 1WA1X 2GSMB 1JZJA 1MDAA 2HX8A 1KGYE 1MG2C 1SNRA 2VW7A 4BK5C 2CUAA 3FU7A 3FYEB 3EF4A 2TSBA 2R7EB 5AZUA 3MBWB 3S3BB 4KNSA 4A2EA 3WKQA 3TASA 2OV0A 5I6MA 1NIDA 3RYMA 4DPCX 1VLXA 1HFUA 2XV3A 4BDVA 1AOZA 2VM4A 1OCOB 1SDDB 2XXFA 4JHUA 4AI7A 5IY5B 1NPJA 1SJMA 1NIAA 1QLEB 2BW4A 2CCWA 2IWEA 2ZXWB 4P5SA 1JVOA 3QJUB 2BP0A 1J5DA 1J9RA 3FQ1A 2PPCA 2XV2A 9PCYA 2H5UA 1AS8A 1NTDA 4G71B 2IDFA 4E9TA 2GHZA
chains in the Genus database with same CATH superfamily
3L4UA 1UEMA 2OR8A 2ZOKB 3PV6B 3VXPA 2H47C 2P48B 3DX9B 2Y7OA 3P30L 2EUWA 3EJYC 2V33A 2AEOA 3OGOE 4UQAA 2P52A 3HE7A 4HJJH 1QPKA 3T4AB 5IHLB 3DJSA 5BW7C 1AYRA 2NY5L 4M43H 1RXLA 1NPUA 4HJGB 1AQDA 3ZIYA 3GMRA 3F6IA 3QRGL 1CQYA 5HHXH 5IWLA 1P84K 3MCG1 1T89C 2UY7B 3A23A 2E9BA 5A2CA 4LCIL 2X9XA 1LMIA 3WN5B 2N1KA 4JB9H 5JHDD 1IEBB 4YC2B 2XLLA 1GVIA 4X83A 2R83A 4XMLH 3Q5OA 5BVPH 1LEKA 4AOFA 5J0BA 2CK0H 4JPSA 4OZFA 3IDXL 4YL9A 5SWSD 1F45A 3WFCL 5DURD 4GYBA 1E4XH 3ZZQA 4FQ2H 3EBAA 3ZDYF 3MRBA 5BOJA 4IRJD 3O6MH 5J6SA 1CGSH 1BFOB 5EU4B 4YSAA 3U1QA 2WB1A 2V37A 3VH8G 4AQ1B 3L81A 4OCLC 2H45A 2BJML 2VMEA 4CADB 4PWIA 3PXJA 4K23H 5AB0A 2YFNA 4JLRB 4MMYA 3SDAA 4DCQA 2XCMC 4HKZA 4JR9H 3KPNB 3D9AL 3R0NA 4MBOA 4LSRH 1KXTA 1NIBA 4Y19E 2ZX8A 4RWYH 3AB0C 3A4AA 3ZKMC 3BP6A 1BM7A 3BP5B 1YEJL 4JY6A 5CP7B 3O4OB 3FU7B 4KRPB 4C4KO 1JZ5A 3P73B 3BT2L 3WS3B 3M8OL 5EIVA 1FG2A 3VG0L 5JA9A 1T5WB 2VABB 5BXFA 1RY7B 2J57A 5AKTA 5CBAB 4RAUA 3RTQA 4JCWA 1F6AA 4LHUA 2CGYA 4RIRA 1KJMA 5DUBA 4JPVL 5I8EB 3RWHA 1FNEB 2HMID 3DHMA 4RZKA 2UZYB 2VE6B 5FO8A 4GQPH 3CVHH 3PWLA 4AMKL 1IGYB 2GUOA 5DWPA 2CZNA 1R17A 1KJ2B 2ZPKH 3DRQB 3L7FA 2Y69B 4N4YB 1OARL 3L5XH 2J4WL 4B9ZA 4R26L 3MNVA 4L8DB 3WLWD 4PB9H 4YXKH 1EZVX 3VD3A 3BFWA 4CGTA 4FNRA 3Q1SL 2BY3A 4LSQL 4OGQC 5HTSA 4EUPA 3MRKA 2F53A 2VM9A 5HGGS 3BGAA 5B1CA 2NYYC 1U6AH 5GZOA 4L37B 4AGQA 3BDYL 3L2LA 1KPRB 4KI1A 1BEYL 3ARDC 4J3WA 4BZ2L 2AS5M 1IVTA 1FIEA 1RZFL 4UQ3B 4CSZA 2VISA 5C07A 2VKXA 5F7KC 5G5DB 3NN8B 3QXDB 4Y16C 4JHVA 2EINB 4I18A 4NENA 3CFEB 4PD4K 3RI5F 2ZE0A 4ZFOB 3NIDB 5IKCB 3C5JA 4NCC1 3CK0H 1MPAH 1W0WA 4RRPG 3WAKA 5IMKB 4IYKA 4YBLC 5IVZA 1I75A 5GGQH 3M1BB 2IC2A 2PUQT 2ETWA 1EX0A 2HB0A 2DV6A 3SBPA 3D0LA 1ROCA 2YAFA 2Q5BA 4MDRA 1ACCA 4BGLA 2XKUA 3KS0J 5FFOA 1NCTA 3P0GB 1T83C 3NAAH 5J4MA 2WNKA 1P6WA 5KAQF 1NAMH 3ZL1A 5T33L 1FUNA 4JDTH 1GYWA 4NQVA 4Q2ZB 1VZIA 1BQHG 3QNYB 5IBLC 5IW1A 5J6GA 1P7HL 2Q2LA 1OWRM 5CMAB 2HKFL 4MS8C 3EYVB 4XI5D 4X4MA 4HT1H 3FCTA 2Z3FA 3MR9B 3L4CA 3IFOA 1MHCA 3RWCA 1MI5D 4HFUL 1YEFH 1LL1A 3HR5B 4GO9A 4TUKL 1MZZA 3TH4T 3UZVA 1WFUA 1WEJH 1IM3A 4IK7A 4OGAD 1ZTXE 3PGCA 5BZWA 4PJDA 4EN3C 4WNSA 5AW8B 3QIBB 3MRNB 2FYVA 1A4KB 2UXGA 3MBEC 4WO0A 1FVEA 4FG6C 2GUYA 4U1MB 4HUMB 3UGXA 1MFBL 1KCWA 3WO3B 1GMEA 2UZPA 2R27A 1HE7A 3DK2A 4I89A 4NQDB 4F33A 5DC0A 1R34A 5I5MA 4IQHA 4WI6A 4AH2A 1ILSA 4L4TA 1ZLVH 1CBVL 3HLAA 2XETA 3S2AA 1OOAA 2DWTA 1HNFA 2G5RA 2VDRB 3QFJD 3QIWC 4BKLB 2IH8A 4W70A 4NUJB 3K91A 3ESNA 3ZYJA 1XAKA 2EIMB 3CVIH 4YXLH 1NIEA 4MJ5A 5KVFL 1IAMA 4AYFB 5EHFA 4F7TA 1BF2A 3CFCH 1NJ9A 3O8XC 2PF6A 2QQLH 5MI0C 4MBRA 4JHWL 5B22A 1EDYA 3TBCA 5AWNH 3APCA 3O3UN 2H1PH 3OHXB 3PABB 5IHZA 3BAXA 1QRNB 1MWOA 3H9HB 2KDYA 2V5YA 5I74B 2BIHA 1W72H 1ZT1A 4MA8H 5B3SB 4EZKA 1HSAB 3M45A 1NFIB 2YEQA 4CC4A 2OL3B 3ULSB 5I0WA 4AL8H 3D8MA 2GY5A 3BKMH 4KK5C 4UQIM 5FOBB 1E5UI 1F42A 1JPTL 3VDAA 4BFEA 5F1NB 3U0TA 4PMEA 3LV3B 3DGDA 1MLBB 1JJUA 3NCMA 3ZT6A 2Q8AH 1H6UA 1BM3H 4U1KA 2DRUA 5JHMA 5EIIB 1ZSDB 5C0EA 4Y2DB 4FQHB 2EYSA 4RISL 5BV7C 4G5ZL 5CN1A 1J5OH 2VT0A 3SKJL 3BHBA 3C8DA 4N2MA 1MHEA 5HDQH 3W39A 2PN5A 1E28A 2DM3A 3PP4H 1P2CB 3SDDD 2PCPA 1WF5A 3PNWB 2ZWYA 1MWAA 3RX5A 5KYWB 1PSKH 3DSFL 3MRFB 2GSIB 3BPOC 3BZFB 3O6FC 4OGXH 5CEZL 5ACZA 4M7JH 2FHCA 3ILPA 3SE3C 2QT6A 4X7TA 3T1FB 3T08A 3ABLB 4LL9A 4DW2L 1AMXA 2WJ5A 2L04A 4WFFD 2JQZA 2CIIB 1P5UA 2J8UE 1EHNA 1CUOA 4Z3GA 5I1GL 5LGHL 5CF3A 3QO0A 2XACC 2L7UA 4G82A 2MJWA 2VRQA 1CXIA 3VXTA 3BQVA 1IGCH 1BZ8A 1YMMB 5LBSH 3G6AB 5EUOA 2P5WD 1UVQB 3ZKMD 2H26B 4HP5A 1MJ7H 3SE4C 4HUVA 3U6XS 3DMMA 3VFPB 4AG4H 5D5MB 2DEXX 2WM0A 3VGAC 5CNHA 2WZ5A 3KPRA 2YAHA 4IBLT 3QAQA 3AT8A 1M7DA 2X0WA 3CQQA 4HS8L 4N8PA 1OGTB 4PGDB 3KPPA 3S7GA 4XP4L 3FB5B 4OM0L 4NRZA 3QXTA 2BERA 5FAAA 2DPKA 4M3HA 2EZ0C 5TK2A 1LNUB 4LSUH 1QPXA 3FT2A 1SQ2N 4KAQL 5TQ2H 2FO1A 1XCQB 3ABKB 3QUYA 5D7SL 4X4XA 5AW7B 4Z18A 1IIKA 3RG1C 3C9NA 4EJ1C 2R51A 2AABL 3BVNA 3R19A 2WAQA 4FLHA 3Q8AA 4U31A 2VC2B 1K6QH 1GCYA 2VSKB 4G8GE 1XIWB 4PJHF 5ICZA 5DK3A 2HFGH 1OP5K 2ALAA 2EVFA 4WGVB 4TOYH 4QXTB 1ZE3C 1CICD 1PIGA 3BWUF 4JPKL 5J13C 1XV8A 5HJBA 3ZDZF 1DZBA 2I26N 4V1DA 4XP1H 2X7LA 1ZLWH 1HCZA 4HEMA 1KTJA 2UXTA 4DK6A 3NOIA 2XWTA 2HRPH 4PJBA 1XR8A 1YECL 1X5LA 2ZUSA 3KLAA 4XT1C 3UTPE 1A6WL 4WFHE 3ARDD 4W81A 4ZAKB 1VFBA 5LCVA 4NNPL 1FQ9C 2PCYA 5I5IA 3KGSA 3RGHA 2W95A 4HJIA 3U46B 2ATPA 4AYBA 4R7NA 1GOGA 4JM2A 2P8PA 2PCFA 3V5HA 3VXRD 3F58H 2BOCA 4B6ZA 1OAKL 1FH5L 2ODIA 4YE4L 1A3ZA 2G9KA 4ANKA 1A7QH 3VYNA 2JI1A 4O02A 3HE6C 5DK0A 3BLKA 1I82A 4M61B 4R5XA 3EF7A 2XN9B 2JELL 4A7GA 1KXQE 3CQFA 2AJSL 3KCPA 4J39A 2XWBB 1IARB 1LWHA 4PGEB 5FYKD 3L2MA 3FU9A 3NABH 4E9VA 1JPFB 2ESVB 4LE8A 4CBPA 3WXVH 2DLGA 2COQA 5E2WL 4IU3B 4NO0D 3IRZA 4RLDA 4UM8A 1KCSH 4WJ5B 2XQ0A 4M93C 5IBLD 3QVAA 4C59B 4F9LC 3A4DA 4W6XB 1KB5B 3TBWA 4F2MA 1HXYA 4Z76A 1A7RL 3T0VA 1UH2A 1I8LA 3WSQH 3QP3A 3ESMA 4KTYA 1E3ZA 3W57A 1A1NA 1SBSH 2EDEA 3PRZA 2Z9TA 4FTVE 1Z5YD 3MLXH 3LXBA 4EN3D 1QO3A 1TFHA 3BZ4B 3TBSB 2Q86B 1Y07A 3DPBA 3MBED 4FMFA 4JN2A 4XO3A 2R0KH 3HRZC 1ZJBA 1KNOB 5B1AB 4FG6D 4MQXC 3HAEG 4BFJA 1NGQH 3LH9A 1UT2A 4OCRH 3L3KA 4Q58C 5I6KA 1EFQA 1G5AA 2PO6C 1EHXA 1CLCA 3TPUB 2KPWA 5FWRA 3OQRA 3P77B 2J1ZA 2XFGB 2XDHA 4EIUA 4R2GD 4U6HB 1JGEA 1MDAA 1QP1A 4KZ0A 4P04A 1L0PA 2LQRA 3RDJA 4H5SA 4OAWB 2R2HB 5EN2A 5AZUA 3B2PA 3HG2A 4PJIF 1CG9B 3SODB 3EYFB 3U9PH 4X6CF 1KEGL 3X11B 4ZMPA 3O8XD 4AYDC 2G2NA 2O5ZL 1VLXA 2WC7A 5JMOC 3J27A 4GXUN 5MERA 1AOZA 3MSPA 4MNHB 3UEZA 1IAKA 4OZHE 2Z31A 3FN9A 3LIZA 2ADFL 2VZTA 4KXAA 1YYLH 3KH4A 5DSCA 5HHMB 3PAYA 1P7KB 3EXLA 2WQ8A 2IOOA 3F65A 5CXPA 5HY9B 3FN3A 3QJUB 5DVKA 1ZPLA 1CLZL 4N8VG 4MJIE 4QIRA 3RKDC 1IKFL 1JFHA 3MNZB 4BSWB 3RDTC 2HP4A 4KK5D 4FEIA 4FFWD 4OY9A 2KYIA 3UPAA 1X5IA 2JJTA 4DVRH 2GJZB 2WGXA 2DQTH 4TS6A 2XUWA 1MCFA 1V7NH 3O2VH 5IBUB 2FX9L 2B5IC 1SLWA 4FXKB 4Z5RB 3OR7B 2AEIT 1P4LB 4QO1B 2YUZA 2FECI 2H3NB 3SJVE 1BOGB 3NIFE 5DJDB 2O5NA 4AV4A 4Z95L 1WGVA 2B2XH 4H4NA 3UJJL 3D3VE 1ZHLA 3O6FD 3KWUA 1I3UA 3ML8A 3SKNB 2VOTA 3NZUA 4QYOB 3QI9C 3BFQG 3GTNA 3OKMA 1SEQL 2RB8A 3P0YH 4PTUA 4Y9EA 2EADA 2EEXA 2XWJA 3K0YA 4GY4A 4JFFD 2VQ1B 2JB5H 1CDYA 3QUZA 5AZEH 5J57B 4HQQL 4JFDA 1SYVB 1MVYA 5GZNC 1HJCA 4FFZL 5H94A 4ZPVA 5DJ8B 3S2CA 1Q9KB 2P80D 3CLEH 5EZIL 3ARGD 4HSQA 3G6DL 1L6PA 4MJ4A 3LKQB 5E6YA 2ZKMX 3GHEL 5DJZA 4DEWA 2QSCL 3LEYH 4Z3TA 4QHKI 2WO3B 4HJ1A 1SHSA 1UURA 3MJ9L 4R4FH 5LB1A 1ETZA 1G7HB 4Y4FA 4ZSOE 1UA6H 2FIKA 3CSTA 4JM4L 2X6MA 4XN9A 1G6RH 4QHNB 3NSCA 1RH8A 1A3RL 2C7UB 2LU7A 1C12B 3ZE2F 5HHOE 4KX7A 1MLCB 2HT2C 4XMVA 1MQKH 4ZTOH 1UZ8B 2EZ0D 1PIFA 2ZCHL 1HCYA 5LAXA 5JPNB 3NG5A 4HIHA 4F57L 3PWNA 4OZGB 1WBYB 2HVKA 2VZSA 3CPLB 5FUZH 4LEOA 1J0KA 3MV7E 1SM3H 5JHDA 1JWMB 5HXMA 4PI2A 3FN0H 3MFFB 2AZAA 4UU9B 5HHNA 2ZX5A 2VITB 4U2ZA 5SWSA 1MCPH 3SDCB 2OCCB 1H15A 4GAFB 3NRQA 3WDJA 2CLZA 4L4VB 3V6ZA 1BZDA 1C08B 4J12A 4G43A 5J3HC 1CXFA 4N28A 4A2FA 1GGCH 3HCVA 2YK1H 4C54A 3QUMH 5I30L 4ZUUB 3VXPB 5HYSA 3LCYA 3KJ4B 3R0MA 3S36X 5I1JH 1J1PH 1Y1UA 3LYRA 4BQCA 2OR9L 3T71A 3S88H 2WXPA 4L1HA 2NY3B 4FQXC 4QRAA 4BFNA 4ODBD 5LXVA 4D9RD 1AQDB 2MRYA 2AQNA 1R3IH 3S37H 1OAJA 1HXMA 4AKPA 4XODA 1YDPA 3HE6D 3S5LA 3X17A 2MCAA 2QLVB 2YUWA 2MCPL 4JFQA 4X5RA 2XN0A 5HI5C 2IG2H 1LO4L 1CN4A 1PZSA 4OZFB 2ITDA 3T0WA 2XN1A 6PAZA 3DX0A 5JYMA 3OXRA 3CHPA 3MRBB 4OD3H 5EU6E 4Y5XC 2RCSL 4DVBB 3CVHA 4I87A 3FUJA 3PLYA 3QQNA 3SDXF 2ZOTA 2DWDA 4K94H 1OD9A 4M1DH 4H88H 3KG5A 4LLMA 4LT7A 5C3LD 4H0GA 3O41B 1H8NA 1RK0A 2IVFC 2KDGA 1EMTL 2IDUA 3QEGH 2KBGA 4MMYB 4HETA 5HHPA 3SDAB 4DCQB 3MMEA 4HKZB 4LCVA 5I19L 4NFDA 3AQYA 3ARSA 4XPFH 2DEWX 4I1NB 1KXTB 4MJJA 4KO7A 1DVFC 3MUGA 4PB0L 1T1ZA 3BP6B 3U4EA 2NSMA 2PTTA 5A16A 4JY6B 4WJG3 1P7QA 2FH8A 2VLLA 1D7DA 5D7IA 3SGJC 1G1CA 2AV1A 3DBSA 5F89B 5F1IA 3MXVL 4ELKA 5GGSY 2PO6D 3BKYH 4LF3B 1FG2B 3RB7A 1X9LA 3I74A 2F61A 2E7DA 1U58B 1R3HA 4FG2A 4IJTA 4JAMB 5BXFB 3K2UH 1NFAA 3L1OL 4RAUB 4G9DA 4JW3A 3RL1A 5FYJE 1F6AB 4LHUB 4RIRB 3RTQB 2R4SH 4Z77A 1KJMB 5DUBB 2GJ6B 2DLIA 2I60L 3RWHB 1GJIA 4OCWH 1I85A 2IAMD 4JFOA 3PWLB 3MKKA 2EECA 4JL1A 4UDUA 2GUOB 4L2LA 3HNSL 3F04A 2XG5A 4MHHI 4YDNA 3SBRA 1G9ML 4N2GA 5FV2A 3L7FB 5FECA 2EH8L 2FSDA 1FVDB 3IS1X 1A14H 1NAMA 3GT6A 3TV3H 3WKML 2CJTA 2HYMA 1NLDL 4U7KA 3ZE1B 3AW5A 3O45A 3HI6L 4EUPB 5B4MC 4F93B 3V9CA 1N18A 4NPYA 2F53B 1ADQL 3ZKQD 3RDTD 1AE6L 2CHXA 5EWIH 4Q9CA 2YD3A 4LPUA 2V2WA 4V33A 4XOEA 1E9QA 5TDOA 1MI5A 2P8MA 3H3PL 2VISB 2VN4A 3MODH 5C07B 4DN4H 5J06A 3QK0A 4KGJA 1DQML 3HHRB 4IOIA 1UUNA 3H7BB 3JQOB 2R9HC 3D06A 2N0KA 2Q8BL 3GLAA 3QCUH 4I18B 2XA8L 4MMZA 4NENB 4PHXA 1MZYA 1RU9L 1JMZA 4OD1L 3QDMA 4X0NA 5HI4D 2F7PA 1DDHB 3C5JB 1W0WB 1ERNA 4LEBA 1IGFL 5HGHA 3WUWA 5GHWH 4MA1B 1KBGL 4UM9D 2DI7A 3K6IA 4PJ7B 2FQFA 5FM8A 3D0LB 1J7VR 4XCCH 5LO7A 4PCYA 2WP3O 4KTDL 1CFVL 5AVYB 3QI9D 4GUPA 1MJUH 5IVOA 4L3EE 4RGOL 1M1XA 4MQ7B 2APVA 1BQRA 1RZJL 3ZZ1A 3GIZH 4NQVB 3LS5L 5IW1B 5J6GB 5TE6H 5CUSL 4XC3L 1BIIA 3OMAB 3GXPA 1AIFA 1ECZA 5GZND 1VFUA 2UXFA 5E2JA 5KVDE 3FCTB 4F8LA 4PJXA 4HLJA 3IFOB 1MHCB 4MA7H 4PRIB 5F0PB 8FABA 1ZK5A 2VDMB 3ELAT 4TVPL 1PZ3A 1GZPA 1IM3B 3PGCB 5BZWB 1MFAH 4HIPA 4PJDB 2C9AA 5A6MA 3N9GL 4Y1AE 2E4TA 4AIZA 2B4CL 3GPEA 1EVTC 4XP9L 2C1OA 3IDUA 1FVEB 3I6KA 1U92A 1A7BA 1WVZA 2GIYA 4JKNA 2RR3A 4JQIH 4H8WH 3EGDA 3OAUL 3UGEA 4F33B 1EEUA 4HK3J 4ZK8A 5BW7A 1OE2A 2NTFA 2QZ5A 3PWPA 4FQQA 4AH2B 4L4TB 1RULH 1KB9K 3HLAB 3MCKA 3WIHH 3THML 3IMWA 1AYOA 3B9AA 4U33A 3CZEA 2F68X 1T89A 5F0JB 1OGAA 4UYPA 4XX1E 5E1IA 3ZZLA 3VFUA 3D85D 4JN1L 4X2UA 3VWKC 3LS4H 4BFGA 2OXGA 4W93A 2YAEA 4KOBA 3F05A 2WCGA 4MJ5B 2XTLA 3C87A 2H9GA 3Q9QA 1FZJA 3P3UA 1YJDL 3DO4A 4F20A 1NJ9B 3C60C 4M56A 5GRVL 1GCFA 1FGNL 2C9XA 2G2PA 4V2BA 2YS4A 3ARBD 3VD7A 3QZLA 2G5BA 4WUKL 5IHZB 5CZVL 1ZT1B 1VCAA 1BREA 2RGSA 3JWNG 1SMOA 3EH3B 2IJ0C 4DOHE 4ZXBC 1QFWM 2DYRB 2Z7YA 4M1GH 1RUMH 2BO0A 4HISA 4Y5YB 3NSXA 4NYLA 5LBSA 4X5WA 1AG0A 1VZGA 4UINH 4P05A 3U0TB 3MACH 1QKZH 2YPLA 5IQLA 5L0QB 3MRDA 3N1QC 1A8JH 2D0GA 3HC2A 1XZWA 1SOXA 4U1KB 4RGNE 1B0RA 5AD0B 4OLZH 1TNMA 5C0EB 2LABA 1PZUB 2EYSB 5DFVD 1JL8A 1OSZA 4JQVC 4U0RC 4XAKD 3V4UH 3BHBB 4G8FA 4UNIA 1MHEB 3TJHC 5HI5D 1AS7A 3W39B 3FHQA 1E4HA 4NEHB 1E28B 1A66A 2EE9A 3I02B 4LVHC 2JKNA 3HUJF 5I28A 4WEMB 1F11A 3RU8L 1TJGH 3LTVA 3O6KH 4JANA 4NQTA 4TQEH 1J9CT 3P11H 3ZKXB 5ACZB 5ICUA 3ILPB 2E7CA 1CI3M 4X7TB 3CHOA 4PYGA 1GY2A 1CCZA 4QRPA 5E9DD 1P53A 4NZTL 3GHBH 3QO0B 1RL1A 2J6EL 2P8LA 5KTEH 4L3AA 1S7WA 4PWEA 3MRRA 3H6JA 3VXTB 2NYKA 3PY9A 2D4DA 4XPBL 2BWDA 3PQYD 3QO1A 4P4RB 5EUOB 4FULA 4HUVB 3DMMB 4YHML 1QHPA 3BZ5A 3KPRB 3RGVB 4Z0BH 3ULUF 5F6IC 2PTUA 5E00A 1M7DB 2HPTA 1A7PL 3B5HA 2CD0A 1DQTA 1QACA 3ARDA 2EO7A 3KPPB 2IDTA 4GO8A 1NCCL 4LBEA 1SDYA 4NRZB 5FO2A 4BUHA 5DD1H 4UV4H 4F58H 4Y16A 3VW3L 1GZHC 3EO9L 3QE5A 4GI6A 3AAZB 3FT2B 4JZNB 4UMSA 5AYTA 5LAPA 3QUYB 4X4XB 3C9NB 5DO8A 1CDCA 1TCRA 2GSMB 3D2TA 1HWGB 4KDWA 2DIBA 4KI5C 1HH9A 3NK3A 5ICZB 4JFHE 4L1DA 4U1GC 2F54D 2DLTA 5DWUH 4JG1H 4ZW7A 3QHFL 2VDNL 1PAMA 1AGEB 3S3SA 1SUHA 1T83A 5D5MF 4AMXA 2WWKT 2P42B 3SE9L 3NA9L 2VUKA 3KLDA 3T8VA 2O5XH 4V1DB 2X7LB 2ZUTA 5B4MD 5B38A 4QTHA 2XWTB 3GBLA 4XN1A 5F3HB 1NGZA 4PJBB 4X8JA 4LRIC 3TYFA 5CEXA 2DQDL 3MV8E 5MEPA 3KLAB 3D30A 1GW6A 4O2FA 1VFBB 3KPTA 3EUDA 5AVVB 1UD5A 3FRUB 1RZKL 2OMNA 4P0DA 1J11A 2ATPB 2VLJE 4EN3A 4R7NB 7FABH 4OSUH 4JM2B 2P8PB 5DQDL 2GHZA 2R9HD 2YQ3A 3EGSA 3NIGB 4KKQA 3V5HB 2BOCB 1HJBC 3T1WA 3NQKA 4DESA 2B3IA 3FRPA 1UM4L 4HEPG 4JRYD 4LRNH 3ETTA 2FX7L 4P59L 2EO1A 5DK0B 1XGUA 4TLUA 3H85A 3LOWA 3T6QC 5I71C 1WV7T 1TZIA 1UD6A 4ILDA 3ABGA 4ONGL 1TEYA 3GB7A 3KPMB 2ENQA 4I3RH 1I1RA 3KCPB 4HCIA 4UT6A 1I7UA 1VZHA 1CYGA 1NUDA 1SLUA 4AQ8C 4GFXA 2WTPA 4HIXH 3WOVA 3RUGA 4HU8A 2IPTL 3QIWA 4ATTA 3CIQA 4UM8B 3FONA 2G2RA 2JKRM 1AZCA 2A99A 3HVNA 3TO4D 3HJEA 4FP8L 1BFVL 3TBWB 1HXYB 1NMAH 1OGPA 2JXMB 3M1OA 3QFDA 4Z76B 2DQGL 3O8XA 4OCXL 3RB5A 3ETSA 5J5EA 2DTML 2CBOA 1A1NB 3VQLA 3TO2A 3OZ9H 4TYUA 1AFVH 4Q4IA 3VMPA 1QFWI 3W5NA 3DPBB 4JN2B 1QVOB 2EXSA 3C09B 3JYCA 1MDTA 4RA0C 3HIZA 3L3KB 4C57C 4P5TD 3PCYA 4ODSH 4L8CA 1XGPA 2Y9RT 1MWAL 2GEQA 3CX5K 2GK0A 2ADGA 3QXAA 4JMNA 5FYKU 4B9GA 1TZOA 1DO5A 3LNDA 1AR1D 1JGEB 3QZOA 3L2NA 4LMQI 5BOPA 2VJXA 5JOFA 4ZD3H 2JIXA 2QL1A 1KJ3L 3QEUB 5TGBA 1RJYA 1JERA 2J88L 4H5SB 1UM5H 3VWKD 4KQ3H 3VWJA 2SODB 3W2DH 5EN2B 1I8UA 4RCAA 4DETA 4F7PA 5C7ZA 4O9HL 1VIWA 1E8WA 4BRVA 2HTLC 6TAAA 3D34A 2DL9A 2IBZY 4F2FA 3C60D 3FSAA 4XNAA 3HZ3A 3X1EA 5MERB 3D1MC 4M1CC 3O6FA 1IAKB 2PP9A 2L4OA 1RZGA 5E99L 3SE3A 2WWOA 1CGUA 2N0MA 4POYA 5E5LA 5CJBA 3TCLA 5DSCB 4PY8I 2CAKA 4M7LT 2R59A 3TVMD 5FF6A 3UMNA 1QEWA 2WINA 2G75A 4P9MH 1S7RA 5GGUA 32C2A 2CU9A 2HG5A 4RRPA 3RIFF 3RA7L 5E2VL 1NGPL 1ACYH 2P80A 3VE0A 4N90E 3KBEA 5I6PA 3T0EE 1ZT4A 1FNLA 3SE4A 1K85A 4GQQA 1G9NL 2EDWA 4G72B 4NZDA 4PRDA 2ISDA 1G6RA 3NT0A 2V2TA 3CFMA 2KERA 4K7PX 1SJVA 1BQHA 1C1EL 3IJHA 1T3FA 3G6JA 5D93C 5E56A 5TFSH 3FTGA 4C4KT 1FG9C 1PAZA 4IKLA 5LBGA 1ZLUK 2BZ7A 1OE3A 1NMBL 1XB8A 1ZHLB 5FA3A 3NCYP 5KEZA 4K8RL 4BV1A 3AG2B 1HHIA 1AD9A 3OKMB 1N12A 4EBQH 4LSSH 4PTUB 3OJ2C 2XWJB 1HOEA 4YSUA 2EDLA 3QUZB 1T6WA 4KKZA 1NCAH 5LCVL 5M7QA 4QCIA 1PFCA 4HAFA 4A2GA 3QS3A 1NCDH 4JFDB 3BAKA 1PYWA 1FAIL 4I9WE 1GZQA 4S2SA 4F80A 1DVSA 5H94B 1EUUA 1OHQA 4ZPVB 5FEBA 1PDKA 3MLWL 2WJ7A 4KJYA 1MJ8H 5E6IA 4UILL 4DKAA 4MAYD 4WO4C 3UG4A 1MW1A 3NCJL 3QUMA 4YOKA 5EBWA 1I3RA 5DJZB 1R3JA 5J11C 5FUOH 3VNZA 5JW3L 3MLRL 1M2VA 2Z92A 3PFUA 2P26A 4O02L 3ZDYE 4UTAH 1ETZB 2XVGA 2RJMA 4Y4FB 4LEXL 2FIKB 2YPKA 2Y0SA 3OKNA 2MWCA 1U3JA 2XRAL 5IJBC 4AY0A 1FZKA 5DVMA 5C0CE 3N44F 4P2QE 3D4ZA 5FKPA 3A6OA 4MAUL 4LARL 5J9PA 2ED9A 1J05A 2EEDA 1LM8V 4IDJL 4LLVA 1SXSA 3OR6A 2DQCH 3RAJH 5LAXB 5E5UB 4HXBH 4YMPA 4HIHB 3PWNB 4LP8A 2NQDA 1AZBA 2C26A 3L4XA 2B1AH 2EEAA 4ACPA 5L6YL 4J3XA 5KBMA 3HE6A 5JHDB 4L9DA 4KC3B 3A6CH 2EVIA 3GJFH 3US0A 4FQJL 3JZ7A 4M62H 5HHNB 2NY4C 2ZD0A 5SWSB 3RVXC 5DURB 1AY1H 1H15B 2X87A 3QPKA 1TQSA 4F92B 2CLZB 4I5BA 4IIQC 4L2YA 3V6ZB 1T2QH 3DVGA 4F7EB 1A6TA 25C8L 4BINA 2YSSA 4F37F 2G60H 2ICEC 3ARVA 4LPTA 3FO2A 3MJ8A 4M6OL 1S3KH 5K5YA 4F9LA 5ERWA 2J1YA 1CF8H 1UOKA 2F08A 2A1WH 5BMFL 4B9JA 1ZLEA 3ZKSD 5C8JA 4IRSA 1S4IA 3BW9A 1L6ZA 4XHJC 1KTKE 3A4FA 4MYPA 4I0PC 1T2XA 1GPOH 4MNGE 2Y07H 5J56B 4NERA 4QRRA 3GSXA 4O4YH 2KZWA 5DUJA 5T1LD 1EBAA 3TT3H 4U6TA 3HRZA 1W2KT 3FPXA 5HVHC 1C5BL 1EZVY 3QCVL 1HXMB 2E46A 4JX0A 2ROYA 2CHWA 4GMTL 1HZLA 2PO6A 3IPEA 4G8IB 2QV4A 3S5LB 3T2LA 5GXBB 1I1FA 1QNZL 1WHPA 3JWNH 4JFQB 2Y36H 4PU2A 1QYGL 3BI9X 1YPZA 5CLTA 3NSJA 1YCSA 2V9QA 2ITDB 4G7RB 4YPGA 3CXDH 5T3XE 3IGUA 4GIOA 3CVHB 1OLLA 1TZGH 5C08D 3GSNL 4OBSA 4ONHA 2DWDB 2R0LL 2FJFA 4B9CA 1MAML 3VXMD 4QD2E 5F8QC 1RK0B 1I9IL 3I6GA 4RMRA 2NZ9D 4TLTA 1WC7A 3SZKC 1YEDA 5CGYD 1HYSC 3EO1A 2HJLA 3GMPA 5HHPB 2DKUA 2BZDA 2GB2A 5E9NA 1MFUA 1BFSA 1UYWH 1C9SA 2R1XB 1FV1A 3MUGB 3U2SB 4RDQF 1T1ZB 4YHZH 4JZOB 2PTTB 1GRWA 2DH3A 3BH8A 1P7QB 3BUQA 5JHLL 2X9WA 1A9EA 5D7IB 3X1BA 2AV1B 3RDTA 5F1IB 2X4RA 4ELKB 3MX0A 2XICA 1JHLL 4UNVA 2FQDA 4Y9GA 1XH0A 2J3SA 3WO4B 4BM7A 1X6NA 1GY1A 4GQ9L 2ZXDA 3GSUA 1R3HB 5ISZE 4OCMC 2ZX6A 2RTTA 4I2XA 5DC2A 3ROLA 3VRLF 4G9DB 1KTBA 3OKOA 3RL1B 1OAUL 4Z77B 4CNIB 5BVJA 4DN3L 4KKPA 5FGCB 2VXVL 4HHGA 4CDGC 3UYRH 1CFMA 5K9QI 1G7QA 3OC5A 4JFOB 4OT1L 4BUQA 5DD6A 1F4WH 2HTLD 4UDUB 1F56A 3TCXA 3IVKA 4M6MH 1P9MC 5BZXA 2XG5B 3BT0A 4MX7A 4CC1A 4UM9A 3A3YB 4CBZA 4LHQB 2VDQH 4NQCD 4GMSH 1ACZA 4M1CD 3S3PA 1PX4A 1UGKA 4I77L 3QAZC 3NSDA 5GRUH 5IFAH 2E8ZA 5DK2A 2YBRA 2BIPA 3FOLB 3EUUA 4BSJA 4B9KC 2IIJA 3MREB 3O45B 3D0VA 4ZO6A 5DGRA 3W0WE 4M00A 4NO3A 2FJUB 4M43L 4ODHH 1JFQH 5GZNA 1DBAL 1YEHL 2V2WB 1VADA 1E9QB 1MI5B 2XQYG 2AJ3B 4NJ9L 2VXQL 4QOKE 1V27A 2X4TA 2P8MB 4BFRA 1AO7E 2MMXA 3B4NA 4JB9L 1NBZA 5CJXC 2H8PA 1ETA1 1E7VA 1O9VA 1PD1A 3J07A 4XMLL 3RLSA 5BVPL 4IOIB 1Q0YL 2CK0L 2F58H 2XQYK 4MMZB 4XNZC 2IALA 4JQIA 5MP6H 1E4XL 4M5ZH 3QDMB 5KSAD 3SPIA 4FQ2L 3BWSA 3U0PA 1IV8A 5HGHB 3PJNA 1HAWA 1CGSL 2FGZA 3WIHA 4AM0Q 5C09D 1YC7A 3FOMA 3V7AE 3HEIB 3V6OE 3G04B 1OW0C 2XY1A 1R0AL 4GUPB 2J5LB 4K23L 2WYIA 3WS6C 1JNNH 5FGBC 1M1XB 1U2HA 2AMUA 3OL2A 4HCFA 4KXBA 3H9SD 2O93L 1BIIB 1FWXA 1KZYA 1AIFB 1TT6A 4M48L 5E94A 3VTAA 3VXNA 3ZE0F 2R1YA 5AB2A 2F18A 4PJXB 2A9NH 5F7DA 4JQXC 1Y7VA 2R69H 8FABB 4F27A 3QDJD 3KAAA 1S8DA 2QLYA 3MV11 2CK2A 3AGWA 1GZPB 3CFJA 4PJGA 4DTGH 1YC8A 1QOKA 3MVSA 4NKDB 12E8L 2D3VA 4IMLB 1CGYA 3BSZH 3BVDB 1WICA 4FGMA 2C1OB 1TO4A 3NK4A 4C4BA 4AYGA 3PDOB 3I6KB 4JKWA 4NM4L 3EGDB 4MNQD 3QJVB 4BH8A 4G5AA 3LZLA 4FQXA 4H1LH 2NTFB 3CV5A 3MRQB 3PWPB 2CJSA 4FQQB 1F13A 4GEIA 2DL2A 3BKCH 3STLA 1ORQA 1WDAA 1JD9A 4CU8A 2JF1A 2E75C 2LFEA 1OGAB 3ULAB 3L5XL 1CDUA 3QQ4A 1IGIH 2VLKA 4Y4HC 4YR6B 3U9WA 4WI8A 2OXGB 2H9GB 1FO0H 2NY4D 1FZJB 4HGWA 3OPZL 3ZO9A 4QHUB 3RVXD 3V0HA 4PJDF 1PZ5A 4H0IA 4V1DE 2WXQA 2XVLA 1PX3A 1DEEA 2G5BB 3O11A 1JHKL 5CIPH 3M17B 5SX4H 3EF4A 1XWVA 1D9KC 3S3BB 2A74C 3PHQA 3W3BA 4X80H 1F86A 5E9DA 3QDGA 4NM8H 4CW1A 5HD8C 3I75A 3DX2A 2AKRB 3R06A 3G5YA 5C0AD 4I0PD 4BFIA 2XV3A 4NYLB 2IQAA 2O1AA 4OF7A 3H1ZA 4X5WB 1KLUA 4ZOAA 4J3OD 4PJHE 4PP1D 1DVFA 1YNLL 4X8CA 3BSGA 3AB0B 1NPJA 2YPLB 1TQVA 3CK0L 4TQ8A 3FU3A 3MRDB 1WAAF 1X5AA 3SYQA 4N22A 1PY4A 3TN0A 3WDHA 1X7QA 5GGQL 3SGJA 3QS2A 4CVWA 3ZDZE 2E56A 1G7PA 4EMZA 4OLWL 3OV6A 1EFXD 3EJRA 1OSZB 4OCSL 5ECGA 1QFUL 2ZAHA 1HKLH 5DYOA 1CD1A 1NAML 4R4BA 4HIQA 2Y5EA 3AXLA 2NX5E 4JDTL 4P2RA 1F11B 4PJEA 4UNTA 3S3CB 1N0LA 4I1PA 2WZ0A 4HT1L 4I3GA 4R8WL 5K1JA 2W0PA 2P46B 4JGNA 2WUCH 3KGTA 3MZTA 1MFDH 1N6UA 3D48R 4LOVA 4QRPB 4YS4A 1TR7A 1P4IH 2F8OA 4DGYH 2P8LB 2F54A 2HTKC 2NNCA 5IB5B 1S7WB 3MRRB 4BHUI 4HU2A 4B9PA 3DO7A 1LO2H 5B3JE 4F91B 4P46C 4WCYL 3FUDA 2A9BA 2DLHA 4X5XB 2VJ0A 4QXGH 4G6JL 5IV2A 2ADJA 5DMIL 5ESVB 3ARDB 3KPOA 2JFCA 1JSYA 3GRWL 3VI3A 5IEHA 2XBTA 4FQLL 4LBEB 1DBJH 1J86A 4Y16B 1XTMA 1WSST 3V4VB 4IBSA 2Y24A 2LR4A 3CFCL 4EZJA 4ZNCD 2V5TA 1QPPA 4G7VL 4WWPA 2IH9A 4GEJA 4YQXH 4JRYA 2H1PL 4XO9A 1EERB 4YBLB 1IQWL 1CE6B 1Q9LA 3LZOA 1HH9B 5HDRA 2BFVH 1JGUL 1W72L 5IQ9A 3H9YA 2BNQE 3AREA 2PKDA 1JPEA 3RZCC 4AL8L 3L3JA 1T20A 2UZIH 5TJWK 1WWAX 4NO0B 1YY8A 1OTTC 3F7YA 3MYJA 1JRHL 2P28B 4WUUA 1NM4A 2Y7LA 5T5FH 5B38B 4QTHB 4TSAH 4KXCA 3P9MA 1NGZB 1WTLA 3OLGA 4X8JB 3TYFB 3N40P 1I31A 4TQIA 5CEXB 5MEPB 3APFA 4FKEA 4PJIE 3QC6X 4UZGA 2Q8AL 2G0LA 1XF2A 3JXAA 3ZDXF 4X6CE 1NANH 1E0OB 2Z8RA 2FNWA 1N67A 5H4YA 4NRYB 3ERXA 2OPCA 2W5PA 4WRLA 1RZ8A 3GKWH 3NRPA 4EN3B 3DARA 3LH2H 5HDQL 3D69A 3EGSB 3CU7A 2HRHA 1WK0A 3P4NA 3FO9A 4L1TA 1ND0A 4ZODA 1EJFA 4OF3A 3FRPB 5T1MA 2WXIA 3JVGC 5DLMH 1CD9B 3GXIA 1OSPL 3MLSL 3H2QA 5LWYH 1VDGA 1EGJH 1U21A 1WFJA 3IETA 4NQED 1TZIB 3NQIA 1BVOA 2A9MH 3GB7B 4JEGB 5K69A 1NFDF 5JIPA 1I7UB 2OJZH 2BNRD 1EXHA 1YG9A 3RUGB 3CMOL 1INEH 1CXEA 3QIWB 4NNYA 4AVIA 2EDJA 3A0OA 2X3CA 2Y1AA 3VWKA 2APSA 2I69A 3FONB 2G2RB 3RJOA 3KNBA 1IGCL 4XNMA 4WTZG 3HS8A 2K6YA 3MLYL 4ZNEE 1JTPA 3QFDB 4PJ8D 1F00I 3O8XB 1MJ7L 3C60A 3HBGA 5MI0B 2DI9A 4OZIA 4KKCD 2D0HA 4KUZH 1Z0MA 4JM2F 3TO2B 1J1XL 3WELA 3ZU8A 2EKJA 2HRGA 1OZUA 4PRPE 1QFOA 1I8KA 4OD2A 4P23D 5E08L 2F5AL 1D2OA 2ZT9C 1N9PA 3IKKA 3MGTA 4ZXBA 1Q72L 1KULA 2EE6A 2JNZA 3MNDA 3K3QA 4X8GA 4IKNA 1PU0A 1BD2A 1Q1PA 1XGPB 5TQ2L 4N2CA 4EI0A 3MV9E 2ZP8A 3N5AA 4WSJA 3GBDA 3N85H 5DMYA 2ADGB 3AWGA 3QXAB 1XXFC 3UERA 3OTTA 2PWFA 3K7UA 1Y1DA 3RVVC 2WUBL 4Q14A 1UATA 3EH2A 2HFGL 4TOYL 5D71L 3QWRD 4NHUA 3VWJB 5BV7B 4F7PB 3ZX1A 3IAGC 3UZQA 2HWZH 4JQVA 2ED7A 3ECVA 1ZD6A 3B8SA 3PDDA 4M5YH 4FQIH 1TDQA 1TIUA 1GHFH 1SVZA 2ITCA 2YKLH 4LCYB 4LAQH 4PR5A 2ZSVA 5G4OA 1DJZA 1E4WH 1HHHA 3FFCE 3FYIB 2WNWA 1MFNA 3BPOB 3O6FB 3ZE2E 1ASOA 4YIQB 3LXUX 3ZYOA 4CKQA 3WHE1 5IHUL 4AVJA 1RZGB 4M6AA 2QVFB 4ZS7H 3TCLB 3FUEA 5FF6B 1DFXA 3TXAA 3WUZA 1QEWB 4HS6A 4PRNB 1JGDA 1MF2L 2WINB 1R9FA 2G75B 4PM1A 1S7RB 2X38A 5HD8D 5GGUB 32C2B 2HG5B 4L29A 3FQTA 4QYAA 4S1SH 3VE0B 5BQDA 4YH6A 2A6DA 3PAVA 2VJ8A 2AFNA 3S36H 1ZT4B 4B96A 2EKSA 2ZSWB 3B34A 4JO1L 1O6TA 3HMXH 4O5LH 4UTAA 1IJNA 4UIMA 4XC1H 4PRDB 3VGAB 1SMAA 1LDSA 1P84J 1G6RB 5LUMA 2V2TB 2YEVB 2J7LA 3BXNA 5DS8A 3P54A 3SBQA 4MB1A 3IJHB 1T3FB 3G6JB 3OPUA 2BFGA 3FTGB 2B0SH 3O3EB 1KCSL 4Y8DC 1GZHA 3WE1A 1UZGA 1LVEA 1DZ0A 1SZNA 4JO2H 1DVUA 3PGDB 4OJDH 1HHIB 3WSQL 4DGVH 4BZ1H 4UQEA 2VZ3A 2EDNA 4KVPA 3EOAA 4A55A 3GJFA 2MCMA 4OIAA 3U4BL 4BQ6A 4ZI8A 1SBSL 3R8BB 4QCIB 3KZ8A 3NFSH 1A0QL 4NQQA 4Y19D 1PYWB 2HTKD 3LMJH 1GZQB 1A4AA 2WHVA 2R0KL 3EJSA 4CGUB 1PDKB 1PG7X 4GXFA 5BQ7A 3KXFA 4KJYB 4IBUA 1NGQL 3O3AB 5E6IB 4OCRL 4FXLA 2ZAGA 4OF8A 3NYKA 1MH5A 1G5GA 1BF5A 3EJZC 5EBWB 5FFGA 1A5FL 4P46D 1R3JB 2I24N 4IIZA 1M2VB 2Z92B 1YQVH 3U7YL 3GSQA 5LGKA 1ZV5A 2D7PA 2YPKB 3OKNB 4LRIA 1YSOA 3SDXE 2JCCF 4DIXA 5HJ3A 4R83A 4YVUA 3EGXA 3IN2A 4KK8C 1A22B 1ZK9A 1FZKB 3HRPA 4JO4L 5FKPB 5J9PB 1J05B 5T1LA 4LLVB 2Q76A 3GC3A 1DO6A 1KV3A 2W60A 1IM9D 1TQUA 4KXDA 2XY2A 3HE6B 4JKPH 4XPHH 5JR1H 1FL3A 4HK0A 2E59A 1IL1A 1BYNA 3FUIA 1HKFA 1YYLL 3V6BR 2HH0L 1J9SA 2VDKH 4HLEA 1IBZA 4FNLH 3APNA 3UACA 3KM2A 4I5BB 1E30A 2BXZA 4AQ8A 1BJ8A 3C6LD 1U8PA 3DVGB 1A6TB 1T4KA 2YSSB 3D12B 4M8QA 1DJGA 1XD1A 1E6JH 1OTTD 1QBBA 4ODUA 3V6FA 4YSQA 3FO2B 3MJ8B 4M93B 4DVRL 1GGIL 2DDQH 3RVUC 4JM0A 3RVTC 4IEFA 3O2VL 4FLRA 2EDRA 5C8JB 2WBJC 3BW9B 4TSCL 2R0WH 3L08A 3QORD 5KVFE 2YZ1A 1IBGH 1ONQA 4QRRB 1JOIA 5E6ZA 1I7RA 2CMRH 3CFQA 4NAJA 1H3VA 3FQ4A 4R90L 3HRZB 3S48A 3M46A 4U1SA 1Z9SA 4KJQC 4LEEA 2YQBA 3QFJE 2PO6B 3BUBA 1I1FB 5EBMA 4HCRA 4KQ4H 2IV8A 2WXOA 5AZEL 4F2EA 2GJRA 2JB5L 1YN6A 5DJCA 4XBEH 4YPGB 2YQ2A 1RZPA 4Y2LA 1CU4H 3VGGA 5A2JH 1B0WA 2WXFA 1FRGL 4YLCA 5J89A 1C5DA 4ONHB 2K1MA 2FJFB 1SJEA 1R3LA 3O3DA 1NGWB 4PRAA 1WC7B 3LEYL 3RY5A 3EO1B 2HJLB 3FS9A 3GMPB 4FQ1L 4NSKA 4ODVL 5DA0B 1F2XK 4NQCA 1OCRB 1ZTXH 3L3HA 4GJTB 2JKSA 2X05A 3MGOA 2CQVA 1G6VK 4ZO9A 5D1XE 4PI0A 3TEZA 3GXTA 4K07A 3BH8B 3S8WA 1A9EB 4CVZA 5CEZE 1MQ8A 4ZTOL 2WWNA 4LU5H 3RDTB 1V8HA 2X4RB 4GNKB 4F8PA 3CHSA 3MX0B 4BCYA 5LDSA 3V5KB 4G6KH 2NW3A 2X89A 4I2XB 1SM3L 3ROLB 5G2NA 3OKOB 3RVVD 4JG5A 2B5IB 4FA7B 1IMHC 3FN0L 5BVJB 1T7WA 4ENZA 3N04A 2Q7NA 2I32A 2IO5A 1TO5A 4XMPH 4XNUH 1UXSA 1SN0A 1G7QB 5DD6B 3AT0A 3IVKB 4Z8FH 2G4EA 3LX9A 4MA3A 4MX7B 2FBOJ 4UM9B 3REWA 4A67A 2I25N 3G5ZA 1JXGA 3QUML 4AGPA 4NBZB 4JRXA 4NAMA 3U82B 5I1JL 3GSOB 5IQOA 1J1PL 1HH6A 1FPTL 2DQUH 1OZTG 3BVUA 2YBRB 5DK2B 3S88L 3B7UX 3SD2A 3ZGIA 4N9GB 2F1EA 2Q2EB 1HAUA 4KZCA 4PCKA 3D0VB 4M7LH 3H9SA 1JN6A 4NO3B 4GKSA 4LK4A 1FNGA 5A43C 2CPUA 2R69A 2FEEI 4GRLC 4YDZA 4YDLC 3O3BA 1OCWH 4DGIH 4HBQA 1RJLA 4YZWA 4LDOB 2HT3C 5E8PA 3S37L 3QDJA 4WO4A 5F9OH 2X4TB 2DJ4A 3R18A 3DECA 4NQXA 4MHHG 4TNGA 2XXMB 3DC0A 1NBZB 2BSEA 1NUGA 1S2EA 3BSZA 2H8PB 2WB7A 1FC1A 3ARWA 3LQAC 1DQQA 2IALB 1MCOH 2X2UA 3A47A 3IKCA 5D2LE 4XH2A 4DAGH 4H1LA 3ZY7A 2CCWA 3V79C 3U0PB 1FBIH 1KY6A 1NUNB 2N4IA 4X5PA 3SKMB 3STBA 2EAEA 5E6UB 4J3OF 5I1KL 2P45B 1J9RA 4BA0A 1BWMA 4K94L 2ZG2A 3VI4A 4NN5C 2V2XB 1COBA 2EIDA 3LSOA 3ZQWA 1BOYA 3B9KD 4OKVA 2WW8A 3D85B 2J56A 4LPVA 4J3VA 4XBPA 1FO0A 1GIGL 4XPFL 5JZ7C 3ESVF 5IHWA 3IPBA 2AV7A 1CURA 3EFFA 5E94B 3VXNB 2Z35A 3QG7H 2YD4A 1AZNA 2R1YB 4HH9A 5F7DB 1NGYA 4IIQA 3UTTA 5CIPA 3WNNA 1S8DB 5JXAH 3CFJB 1HZHH 3EJZD 3HUJE 2DD8L 2ICEA 4PJGB 2FAUA 3AROA 3ZUNC 4HWZA 4XOAA 3UJTH 1B4RA 3L5HA 1Z3RA 4R7VA 5D2NE 4TM9A 1HWWA 1IT9H 4KK8D 5FK9B 5C0AA 2NNRA 4I0PA 5MENE 1VPOL 3AZUA 4BH8B 3DIFA 2ZCLH 4OCWL 1NCWH 4FQXB 1DSFL 4UOQA 1G0DA 1RHHA 3CH1B 4ZO8A 3W9DA 5EIIG 1JK8A 1ORQB 1WA0X 5TE7H 2FIRT 4G8GD 2CDGA 2E27H 1BJ1H 2OZ4L 3QQ4B 5I18L 2BOLA 1R19A 2VLKB 4HKJA 1EFXA 3G9AB 4HYTB 4R5VA 3TV3L 3DOHA 4PJXF 4MVBD 3ULUE 4CU7A 4XN5A 4HGWB 2YZ8A 2WVTA 1MCWW 2EVGA 2C34A 3E2HC 4XB3A 1PZ5B 2ZXBA 3GM8A 4Y5XB 1DEEB 4KRNA 1NIFA 3O11B 4B3VA 1AMYA 3GXUB 1A6UL 1NEZA 3QZMA 3UTPD 4WFHD 3RVUD 3PHQB 3ZHDA 1B90A 1UD8A 4PRBA 4DN4L 4JDEA 1QFPA 1RUAH 4E42A 5KG9A 5E9DB 5FCSH 3QDGB 1GGUA 2WBJD 3I75B 5K9KA 3VX0A 3R06B 2FJGB 3G5YB 1MRDL 3BCDA 3Q1EA 4PW4A 4BFIB 3QCUL 2IQAB 4ANUA 1CDBA 3BFOA 4NKMA 1KLUB 5E0FA 3IMBA 1X9UA 1DVFB 1CPUA 1AHMA 4I4WB 3BP7A 5GHWL 3B3IA 1X7QB 5H8DA 3WTUA 2XQBH 5D5ME 2YMXH 2IV9A 4KKBC 1FCGA 2BPBA 3I85A 4ZMWA 2F1BA 4NO5A 3KEHA 1YZZA 1U8HA 3N50A 5DYOB 3ZUCA 1EHAA 1CD1B 2NXYC 1QLFA 3OKEA 4R4BB 5F88A 4ZW8A 4XCEA 3AXLB 4XO5A 4FYTA 3V4LA 4X9BA 4P2RB 5DO2C 5SX5K 1CLOH 5JLZA 4PJEB 1N0LB 5TE6L 1LO3H 4KVCL 2HJFA 3ZL2A 3S3DB 4FC3E 2KQNA 1D2PA 3MTRA 4EPSA 2Q6WA 4MA7L 4KY2A 4NHCH 1QBML 2WMPA 1T1XA 4FQPA 1P9MA 4OU3A 5ABAA 3E80A 4HUXA 2X6VA 2DMGA 4FTVD 4E5XA 5FXCH 2CR6A 2F54B 2C7FA 3BGFB 3FB6A 4XTRC 2ICWA 4GSDH 1I7ZB 2X2IA 3DO7B 4H8WL 2K6WA 3AS0A 5T5FA 4JRFA 1NCBL 5JW4M 2CLRB 2ZWNA 2BOBA 1RULL 1JV2A 5IV2B 2VDOH 2ADJB 2GSGB 1WD9A 1KTDA 3KPOB 1U8CA 2BP8A 4HHWA 3VI3B 5IEHB 4FDWA 2RACA 4K3JH 2UWEA 1Z9OA 1X6LA 1XF1A 4D0DA 4FHKA 4W1TA 4YHIA 1XT5A 3C12A 5JUEH 4HPYH 5AW3B 1N26A 3OLDA 2DF3A 2DBJA 4RMTA 4X7SL 4JRYB 1EGJA 4JFFE 2AXGA 3T3MB 4ONOA 1IGMH 1Q9LB 3L7EA 2AGJH 3VYOA 3H3BC 4NQEA 5IQ9B 4XP5H 2XN9E 5HYJA 3BAEH 4NNXA 3X12A 2X9ZA 4PLKC 5I0ZA 1W8NA 1LEIA 1KXVC 1KY7A 1OW0A 2WGNB 1JP5A 4MJID 4GW5B 2GTQA 4M1GL 3L3JB 1T20B 3WS6A 1RUML 1VACA 5C0RH 4FZ8H 2NY0C 2OXHA 4KMTH 4O00A 5GS3A 5DJYA 1YY8B 2C9QA 2YJLA 3F7YB 3MYJB 4WUUB 5GJTL 4B53A 3MACL 3QUXD 2AMGA 3P9MB 4YDIL 4X99A 4LCCC 1R24B 2Z0UA 4N0FA 5JIDA 3MA7A 3O6LH 4JQXA 2HT3D 4YWGL 5HI3C 1IAIM 5EF1A 1XF2B 2UVEA 1J1OL 4OLZL 4E41E 1P5VA 1E2WA 1IZKA 1RZ8B 2FCBA 2AJVH 2Z8VC 2WIMA 5B1JA 3CSGA 3P4NB 1O6SA 5I9QC 4WWID 2WQRA 3FU0A 3N1GC 3LQAH 3O6KL 5T1MB 4TQEL 3D3VD 1KCUL 4IBZA 3IETB 3IJ8A 2X0UA 2VGLM 2O72A 4LSDA 3DV6A 4GS7C 2BHYA 4K7PH 5DEZA 4EI5C 3GINA 2F19L 4PJAA 3NJIA 5IFHH 1JZHA 3S97C 1EO5A 4P2AA 5KTEL 3X3FL 2W1NA 1TTAA 2CLVA 3LB6C 4NNYB 3JV0A 4Y4HA 2AP2A 4NP4H 3VWKB 2APTA 4OM1H 1LK3H 5EG6C 4DFHA 4AJYV 5L7XH 3QIUC 3BD4A 1J8SA 2PPEA 1BVZA 5F21B 5EU3A 3UIZA 4A2DA 3C60B 3PL6C 4U05A 4OZIB 4Z0BL 3I3DA 2AHIA 1P69B 3JV6A 5JIQA 4NWUH 4JFYB 1I8KB 3F12B 3QPXL 4OD2B 1REIA 2XX0A 1D9KA 3KL3A 3B2UD 1JZ3A 1UFGA 2CM5A 3MGTB 4ZXBB 5HHOD 5DD1L 4W9HC 3L8QA 1LLAA 2OMTA 2PPDA 1HL9A 3TEYA 1BD2B 1AH1A 4WK4B 4HPOH 5GSVA 5IBUG 5DYFA 4LSTH 2GITA 1FN4A 3HMXA 4JUSA 5IB2A 3HZKA 3RUGF 2QVMA 4AQOA 1GR7A 4PS3A 1JNLH 4NUGL 3T6XA 2WQVA 5GGVY 4O2EA 3ZPDA 4G7YH 4H7VA 4JG1L 1H3PH 1AGDA 4NHUB 5DJ2A 3BESR 1SGKA 3OWRA 4U0RB 3UZQB 1K72A 1ZOXA 3UTSE 4CJ1A 4NI6A 5AW1B 2ITCB 4LVHB 2O5XL 4AITA 2ZSVB 1VGEL 1VKXA 3RURA 4OB5H 5D7JC 3TEUA 1VEOA 3HZMA 1XSIA 3GXDA 5INCA 4F24A 1XCXA 1QLEH 3L5IA 3BEVA 1S7VB 2FZ3A 1HL4A 1KEML 2QFRA 4Z7VB 3B2XA 2EXYC 5C0NC 5AYUH 1JGDB 1T2JA 5L4IA 3DJ9A 2X41A 2GJPA 2KHAA 1SXBA 5CILH 2FUQA 2WN3A 3FQTB 2FL5B 1F2QA 1F97A 2VRAA 1VA9A 3MCLH 4BEIA 1V05A 3CZGA 1M53A 2A6DB 4LRNL 4RGNC 1B4JH 3D39A 2VDPL 4P46A 3HI1A 4F1SA 3KPSE 5FV1L 3DJRA 4I3SH 4LVNC 1AXSA 3GMNA 4B50A 5F6IB 1OEZW 1HQ4A 3BXNB 5DS8B 2P49B 2E76C 4NPKA 2FLMA 5KZCB 5ICXA 2JLLA 4HIXL 2NXYD 5EU6D 1OQOA 5DO2D 1KF9B 2G3NA 5DD5H 3QFGA 3MXWH 3BVVA 3D87B 1NMAL 5I1LA 3OKYA 1IM9A 1NEPA 3LN4B 3GHPA 2FUTA 3FMGL 3EOAB 4PREA 3B9EA 3GJFB 1UM6H 4KTEH 3A4EA 4X42A 3OZ9L 4URKA 2E6JA 1Q0XL 4U1GB 3UAJD 4XZUA 3QB7C 3VVWA 5BQ7B 4YHPA 2AZUA 4XXWC 4KUCD 4W9EC 3KXFB 3RZCA 3KLHD 4L4VE 5AW2B 1QW9A 5BUGA 4ODSL 1MH5B 4Q9RH 3H9ZA 2NNXA 4QY8A 2H2PC 4J6RH 3X1GA 5EZOH 2VN7A 3BWAA 3UYOD 1HINH 2Q3XA 1JZ8A 3OHMB 5I15H 1NBYA 1O5PA 3GSQB 1P7BA 4LQFH 1OV8A 1IAII 1S7SA 5HJ3B 3CAFA 3EGXB 5FYJD 1D5IH 1U8MA 2D31A 2HT4D 4XAWH 4ZD3L 3A21A 2YOAA 5LGYA 3TX4A 3P9LA 1BZ9B 5F3FA 2VN5A 4KQ3L 1V3KA 2XZCL 3MCYA 2K3TA 2PW1A 1MEXH 1SPDA 5T1LB 4WJKB 5BO1H 2Q76B 1J87A 4MQSB 1UEYA 2W60B 4TVPE 4JFTA 2OL3H 3JVGA 1U95A 4OZFG 4ENEC 4BWWA 3KPQA 4U3SA 2TRYA 1FL3B 3PGFL 5I71B 2VZOA 5GS2H 2YD1A 3BUDA 4A68A 4XWGH 4P2OC 3UL4A 1QA9A 3V9FA 1O7DC 1ZRUA 4L3CA 1XQ4A 3E1F1 1U8PB 3BX7C 2E47A 4P9ML 2NY0D 3VRLE 4M8QB 3MUY1 4ODUB 5EOTA 3V6FB 5GSRA 1WAPA 4GBXD 5CD5D 3VXMB 4I0CC 3D2UD 4JE0A 1DQKA 3X1FA 4IEFB 5BS0A 1H6TA 4KK9D 2B7DT 1F4AA 2WCPA 2X6BA 5HI3D 5CR1A 1ZLSL 4W9GC 1Q94A 1KYUA 1I7RB 1Q90A 4I85A 1GTFA 3ESUF 4J1UA 3O4LD 1NBCA 3T0DA 4U1SB 1SHMA 3VU2A 5KVMC 1Z9SB 2J1WA 2XPYA 4EXKA 2OFQA 1U8JA 2BSCA 3MZGB 2KH2B 3KPLA 1HFUA 5EBMB 1HIML 35C8H 3F7KA 3GWJA 2DYPD 3MUJA 1SDDB 2HLAA 4L3ED 5DJCB 1YN6B 5DHYA 5IY5B 3K6SA 2BINA 3FUKA 3WV0A 3BSHA 1NCDL 3MC0A 4JY4A 4M8RA 3UBXA 1C5DB 4DKEL 5AG8A 2Z7ZA 3JUZA 4JREC 1DQJA 5LN8A 1E6OH 2CO6A 1SJEB 1R3LB 2VQTA 3O3DB 3QIUD 4P5KA 1KIQA 3JWOC 4PRAB 1R4XA 2XPGB 4UTAL 3F64A 4NQCB 1MHPH 4Y1AD 3FTYA 4H13C 2X12A 3L3HB 1PZAA 2VO5A 4EUPG 1F3JA 1SXZA 2WLHA 1WUNT 3VUAA 3MGOB 2OTUA 2PCXA 1B6DA 1FH2A 2J5WA 2JJWA 1EPFA 2N7BA 4IU2A 4GLRH 4CVZB 5DUML 2F53E 2YD8A 2J44A 5F6HI 1YPZF 5HJDA 2VC2H 2DQCL 5FYLD 3OMZA 3RRQA 1UUSA 1RVFH 2B1AL 2NW3B 4JGUA 1XFPA 3ZE0E 5K9JH 1KB9J 3ARFC 3L9YA 1WS8A 5C07E 3RJDA 3PPEA 4NQSA 3FW6A 3KJ6H 3A24A 1F18A 4MDJA 2X4UA 2AEQL 4KGLA 1ML0A 3CSYA 4FLSA 4MB4A 1T2QL 2A3TA 5D93B 5FYLL 4LKXA 1R5VB 4J7RA 2G60L 4FLOA 1BZEA 1NICA 4HZLA 3WI9A 2NYZA 3REWB 1S3KL 2H6OA 3G5ZB 5IHHA 3S35L 3A67H 4XMZA 5D7JD 5GJSH 4JRXB 1CF8L 3SYOA 5CO1A 3U1SL 1L9QA 1HH6B 2R4RH 4Y1SA 2Y7SA 2A4CA 1OQXA 2X3AA 1I9RH 2EXYD 2Y07L 5C0ND 3S8FB 4O4YL 4XPAH 2EIKB 1DN2A 2IFFL 2ZKHL 3H9SB 1JN6B 2CCVA 2WD0A 4EVNA 1TJIH 4GKSB 1FNGB 4KJPC 4KZEH 2D7QA 3T0EC 5A3IC 3O3BB 4F8OA 5K9QG 3L6FA 2OK0H 3Q6FA 5E8PB 5K33A 3QDJB 1QBLH 1RI8A 4WO4B 1B9KA 1B2WL 4NQXB 4PV9A 4FEMA 4TL4A 5GRJH 1V54B 4QRSB 4AEEA 4GRWH 2Y36L 4PJDE 2GC7C 3GTVA 1L3WA 4UBDD 5GGRY 2OYKA 3VGDA 4L48A 1FGVH 1SYSA 1JTTA 1DQQB 2H1XA 5D9SA 5IFJA 1BHGA 2VRKA 4CSPA 1CIUA 3CBJB 3CXDL 4KKNA 3IKCB 4AYSA 4XH2B 3UAEA 2XIDA 4H1LB 3WMPA 5EF2A 2CRIA 3I2CL 3FSZA 1U8IA 4DQOH 2GKIA 3OGCA 3VI4B 4L4TE 3LEXA 1GTNA 2HJKA 2W9LA 2CKBL 2R56H 5AVZB 1TYEB 2F6AA 3LSOB 5LXGL 3TC9A 2X4PA 4AEHH 4OKVB 2ODHA 3NCYS 4XCFH 4BFOA 1UYWL 1WAAE 1TTUA 4XBPB 3GI9L 2VR9A 4Z23A 2AV7B 3VACA 1IBBA 2AERT 2NY4B 2Z35B 1U93A 4KV5F 4HH9B 4L1SA 1KZQA 5IOPA 1WP6A 1NGYB 3MHZA 4IIQB 3UTTB 5CIPB 4KH2A 3TBYA 4FOMA 3DX8A 4QLWA 5KS9E 2H2PD 2ICEB 3FO0L 1OPGH 3GF8A 4KY1H 4A7VA 4FS0A 2VERA 4HWZB 5BO0D 2M83A 2OMUA 2VN3A 2WYHA 5C6WH 5B8CC 2NSXA 2WBJA 1CVRA 5C0AB 1ODAA 4I0PB 2YLKA 1FDLL 3FT0A 5FA4A 3DIFB 1TITA 3LRLA 3EHBC 4QHMA 4TNWK 1RHHB 2QQNH 3AY4C 4PJFB 4P9HC 1VF5C 3W9DB 4M6ML 4PSPA 1JK8B 1RLBA 2VXUH 5D8JL 1K3IA 4N6QA 3FFDB 4UV7H 1YEEL 2YOCA 5HVHB 4P8QA 2VDQL 3M7FB 2CDGB 2Q3AA 4JFHD 4GMSL 1DFBL 2HXAA 4JO8A 5A7EA 4XPTH 4ENED 1KXQA 4HKJB 1EFXB 3H2PA 1R33A 5ENWA 4P3CH 4EOWH 2X70A 4B9YA 3BOVA 5I1HH 4PJGF 3QEQA 3FJTA 4BUGA 4ODHL 2LVCA 1JFQL 2QELA 1NC4D 4MXQD 2PXYD 2ARWA 5DD3L 1JVKA 1NEZB 3MV8D 3EYUH 4HXAH 4ZTEA 5FHBH 2I07B 1WPCA 4U6VH 3RILA 1ZHBA 1UJ3C 5D1QC 4DP9X 1P4BL 3H8NA 1S5IH 3OAWA 4J2QA 4JDEB 4PRBB 5HDOA 4NFBA 4E42B 5KG9B 1Q9OA 2AXWA 2VLJD 5K9KB 1SHWA 3FUMA 3FCUB 3AQDA 5E8DL 1TTRA 2F58L 5DT1L 3U83A 1HHGB 4HULB 4LL4A 4NKMB 4PJ5A 1BG1A 1QFWH 4XNXL 2OJEA 2ROXA 3HPJA 1ZXKA 1CI5A 3B3IB 1N6QL 2JKIS 1BWWA 3OC8A 3KPRE 4MD4A 4A39A 3NUKA 1TVHA 1UD4A 3MLZL 2W9EL 4LAJH 4NO5B 1U8HB 4MZIA 5LHDA 1QLFB 1DCLA 2Q87A 4WY7L 4L0PB 4XCEB 4CN6A 4XVSH 5AUMA 5JLZB 2PWGA 5C2BH 5T3ZE 3ZDXE 2HJFB 4UT9L 3QQ3B 5B39A 4U6YA 3INUL 3QCTL 2QGEA 4N1HB 1OM3H 2Q6WB 3NJGA 1C5CH 3T4AA 2WMPB 1AHKA 5F97E 4YHOH 5I66A 1OTUC 2G3MA 2WLNA 4U3XA 4OZHA 4HUXB 3JWOH 4DP4X 3SBWA 4U1JA 4E5XB 1EEZA 2VR5A 1T0OA 3BSZL 5CZXC 3FB6B 5C3TA 1TLKA 2ICWB 3QAZB 4CILA 3IFPA 4MJIA 1S46A 4N86A 1J5HA 1JF1A 4N8CH 4U4IA 1NFDE 3QISA 1J8HA 3CN3A 3UXFA 2AK4E 2NY7H 3WN5A 4Z9KB 1VAHA 4S1QL 1IBYA 2E86A 2BOBB 2C3VA 4ABVA 5FDYA 4G9FD 3P0VH 3BKCL 4GRLA 1JV2B 3ZHKA 4WW1A 1KTDB 4L9LC 1U8CB 3UBGA 2BP8B 1IGIL 1TOXA 2ENSA 3ARFD 1GC1L 2EYRA 2UWEB 4C83A 4BK4A 3WMQA 4D0DB 4YHIB 5KUMA 3SJVA 3D6GA 1S5HA 1WIUA 1FO0L 3C6SA 5IJDC 4XNZB 1QABA 3QUKA 5DD0L 4ZX3A 5CSBA 4FYQA 3D3VA 2AXGB 4EO5A 5E2UL 1J88A 3L7EB 1NWPA 2FB4H 3S34H 4NQEB 2FD6H 2OS7A 1K5WA 1W6WA 5HYJB 3X12B 3KGRA 1RPUA 1J5CA 1FE8H 3SEPA 1LEIB 3UH8A 4ERSL 2BNRB 4U0QB 1KCRL 3IU4H 4NM8L 4AT6B 2XZQH 1VACB 2F5BH 4Z3EA 2OXHB 4N0CC 2WVUA 1AZVA 2X44D 5DJYB 4IBQA 2YD9A 1B9ZA 1EDHA 5E1QA 4YSPA 5AOIA 5IK3A 3HZVB 4N90D 1XAUA 2D2OA 4KJPD 5I1IH 1XX9C 4F2ME 3VI3F 4X99B 1OGSA 4G6FD 4BRJA 5A3ID 4N0FB 2YD7A 2TSAA 1OAZH 2DH2A 1P5VB 4QRQA 2QKSA 2EDOA 4HUUB 1IGYA 5F8RC 1O6SB 1E4KC 4DP0X 1SY6L 5I6OA 3C2AL 4RH4A 5C0DA 3QQ9D 1MCRA 4LLUA 3A6BL 3DJZA 4L8DA 3V6OC 4X9FA 1LILA 3VCLA 2FO4A 1MFDL 3DV6B 4WWKC 2IANE 1BQSA 4ZZKA 4OIFA 1SOQA 3MV7A 3T77A 5FIEA 1I9EA 2FWSA 2C1PA 3L17A 4PJAB 2JK5A 2PETA 2YMOA 4DGYL 3VA6A 1MFEH 1YHPA 2CLVB 4I9WD 4Y4HB 3DETC 4N24A 5IBTH 3K1DA 3FTUA 2OMWA 5C0BE 4JFEE 3QWNA 5B7EA 4HDIA 2KZ1B 1LO2L 4HAKA 5EU3B 3NJFA 2JTYA 2AJYH 3U7WL 1T7XA 1ZHNA 3NN8A 3QXDA 4FD0A 3GNML 5BRQA 4MZRA 5K93A 3JV6B 3MBXH 4QXGL 1FFQA 4C56E 1JGLL 2EILB 4U2YA 3GMLA 2GJJA 5F0MB 4ZFOA 1D9KB 2ZYRA 1PG7H 2A74B 3AS2A 3PG2A 5C0CD 2L0DA 5CCHE 4P2QD 2CA3A 1DBJL 3EOTH 2AI0H 4NBXB 2OMTB 4IBWA 3SCMC 3DK0A 4GFTB 5F9DC 3LNIA 5GSVB 3UYPA 3EHBD 2ZOWA 1TJHL 4JGMA 4ZQKA 2GITB 4FZEH 3VSQA 4YQXL 3O0LA 2EE3A 1XR9B 3OD3A 2CKNA 3BLPX 1MN4A 2QSQA 2JJVA 2YPVL 3QNYA 1BG9A 2GBUA 4O2EB 4P9HH 2XN2A 2AXHA 3ILDA 5CMAA 2ICWJ 3FQXA 5A2IH 3EYVA 1XGYL 1AGDB 2YAPA 1I1CA 5DJ2B 4XMKL 3MR9A 5HGAA 4DKTA 7PCYA 2BMKA 1SOKA 3Q3GB 5EU6A 3PHAA 3RGBA 2JCCE 5PAZA 3MOBL 4YSOA 3IT8D 3TZVD 1VKXB 4DP2X 1ES0A 1ED3B 1A4KA 3HZMB 5INCB 1OO2A 4RZCA 4UAOC 2Q7AA 8CGTA 3BEVB 1JPSL 2H32A 2YIHA 2FZ3B 3Q2WA 3ZN6A 1BVNT 5IESH 2YRLA 3GKWL 5EA0H 5M94B 4Y19B 4JFDE 3VFOA 1WH0A 2VZ1A 3TCTA 3FQUA 3GZPA 3W11C 1X4ZA 3H4HA 4DUWA 1JXDA 3D39B 5D55A 2Y6TE 3GMOA 4BKLA 2Z64C 4P46B 3L13A 3HI1B 1EGJL 1JZJA 3EJUA 2A9ML 1AXSB 3GMNB 3V8CA 3BMVA 1IC7H 1HQ4B 3M1CA 1FAKT 2VW7A 3R8QA 4BK5C 3K72A 1SXAA 1AGFA 3DUUA 5ICXB 5T3XD 2VIRA 2PWEA 3FC8A 1IZJA 4OIIH 1JHTA 1CFBA 4G42A 3CZJA 3WKQA 5CINL 1QRNA 1I1AC 3P9WB 5I6MA 4EEEA 4QXVA 5AYQA 4AXWA 2OL3A 3S4SA 1IM9B 2FHBA 3N41B 1LO0L 3PNRB 1PG7W 4KUZL 4C58B 3L3IA 3MTXA 2OTWA 3DOSA 3JSSA 4QKXB 4YGVA 4ZFGH 5EFIA 5F1NA 5C6PB 2VDKB 5F70A 1KENL 1MFCL 3CMGA 1JVOA 1TJXA 2WXJA 4U49A 1J0JA 1J5DA 3LV3A 3WJJC 4XZUB 1VESA 5CZXD 5K9OB 4YLQT 3C2SA 3ETBJ 2V7HB 3JTTA 1KXVA 1PJ9A 4YHPB 3HOGA 3RZCB 1PL3A 3WXWH 1J5IA 3AC0A 4NZRH 1X5HA 3GSVA 3WMSA 4QY8B 4FQHA 5I8KL 3MOAH 1NBYB 2PPAA 3D2UA 2R8SL 5ISZD 3OLEA 4LCCA 1S9KC 1RURL 3QRLA 1S7SB 1TZAA 4FJZA 4S1RH 1U8MB 3GRBA 2D31B 4FXGC 4OGYL 3P9LB 4Z7UA 3FF8A 2GSIA 1S7TA 2HWZL 3WTYA 3T1FA 4BIKA 4OJFL 4FQIL 4GT0A 4KZDL 3ZL4H 1D7FA 1GHFL 2NY2C 1H8OA 2YKLL 1LXMA 4JG0L 4KI5F 3S5LG 5KYYA 1ULVA 1JPGB 2KMWA 5FW7A 1FL5A 4K2UL 2Z1PA 2I7SA 1OIOA 3KPQB 4U3SB 4OLXL 1KT2B 5C0IA 2VWEE 3L95A 2AEPL 5D70L 2CO7A 1JZFA 1UVQA 1X3DA 2VSCA 1OSEA 4L5FH 3ZKND 4EI5A 1QA9B 4I48A 3WEBA 4L3CB 4PWFA 3W0WD 3EH4B 2FVNA 2QPEB 2YBGA 3GD1C 2VMCA 5AKSA 3QJRB 1D5XA 5EOTB 1PCXA 4NDMA 4S1SL 3EADA 5GSRB 3QIUA 4MD5A 3MOQA 1HEZA 2P7TB 5FYJU 4ZFZA 4O5LL 4QOKD 3S36L 1RFDH 3FB5A 5BS0B 4XN2A 1AO7D 5CU9A 3OSKA 3PL6A 2DLEA 2CGZA 3PREA 2EIZA 4XC1L 2QHLA 3T2NH 5C6TL 1Q94B 3LHPL 5CN2A 1ZGLM 3VTMA 2CJUH 1FSKC 4CAGA 2OMYA 1F8TL 3BP4A 3DPDA 3GLEA 1Q0EA 2B0SL 1L7IH 2QSTA 2PPFA 5GIRB 1L5GA 1U8JB 2X1PA 5FKAA 2BSSA 4MCZA 3VRIA 3KPLB 3DYPA 4WU5A 2BY1A 5SWZE 4BZ1L 1CWVA 4DUVA 4QEGA 1MUJA 3MLVH 3UCQA 4E9QA 2NY5C 4GKOA 2ZWZA 5DHYB 2WLKA 3HFFA 3K6SB 1O6VA 4JY4B 3VG9C 3HG4A 3UBXB 1M3JA 3VB9A 3DETD 3POCA 2GQHA 1BGXH 1DQJB 5EB9A 2CO6B 2WKOF 1A7NH 1HNYA 3N43B 1NSNH 4ZAKA 4P5KB 1KGXA 1TUPA 4ELMF 1WD8A 1ASPA 1N68A 1QWHA 3T3PB 1KGUA 2ZUWA 4ABQA 4B7LA 2AC0A 3II2A 3Q8EA 4OQTH 2FYYB 5IQ7H 5KW9H 5D7JA 1TYJA 4IW4C 3CZFA 3UPRA 3FQNA 1F3JB 3ILQC 2CNYA 4BWTA 3SE8H 4IU2B 2B59A 3QEHA 4FERA 4FFVC 1K2DA 2APBA 4NCC2 5INDA 1KC5H 1A6ZA 2ZUXA 4U1LA 4BH7B 3AT9A 1U41A 1JPFA 1PZCA 4IRJC 3TJEH 5JR1L 3CDGA 2VLMD 3DDGA 4NQSB 3SGEI 1N8ZA 3I3EA 4WJ5A 4ABUA 4I9XA 4MDJB 2X4UB 1RZ7H 1NZRA 5DVLA 3SGKC 3MRIB 1WFNA 1CT8A 5D4HA 3DTXA 2I5YH 1RMFH <