1HOCB

The three-dimensional structure of h-2db at 2.4 angstroms resolution: implications for antigen-determinant selection
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Histocompatibility antigen
molecule keywords CLASS I HISTOCOMPATIBILITY ANTIGEN (H2-DB) (ALPHA CHAIN)
publication title The three-dimensional structure of H-2Db at 2.4 A resolution: implications for antigen-determinant selection
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1994-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hocB00
5DD0H 1UZ8A 5BCAA 3SKMB 4LAQH 1VEOA 2WV3A 5AYUH 1ND0A 3VXSA 2MWCA 4PRHB 4CKVX 1K3ZA 5GRVL 1UEYA 5B3JE 1HH6B 1YUHB 1R3IL 3D39E 3O9WC 2V2TA 3MYJA 7CGTA 3DSFL 1I7TB 3AAZB 1BJ8A 1UENA 4R8WL 3D39D 1AGBB 2OM5A 3ES6B 1LO3L 2EE9A 4MVBD 1P7KA 2AXGB 4WFFE 3N1QC 1DBML 1S7QA 2WWKT 4IRSB 4OAWA 3RTQA 3L5HA 1TQCC 1UZ8B 5ESQA 3VDAA 4WFFD 1ND0B 3JWOH 5D93B 3VXSB 4XP6H 4FMKA 5IWLA 2WUCL 3LS5H 1L0QA 5I8CA 4PJAA 4NO0A 4LHUA 3MYJB 4PRPE 2V2TB 4L9LC 3KPMA 4YZFE 4CAGA 3U30C 5LAXA 4XC1L 2YD8A 4PRPD 1P7KB 5B8CA 2ED9A 1S7QB 1DEDA 5C0RL 4R4FL 4OAWB 4O58H 4OKVA 3RTQB 3VWKC 5ESQB 3ZDXE 5IMOA 4LCUA 1W72L 5DGQA 4KKLC 4R4NC 1FFRA 3NN8A 4GMSL 2JKXA 4P0DA 5I8CB 4GQ9L 4PJAB 4NO0B 4LHUB 1CLZL 5J06A 3KPMB 4KUZH 5B3NA 4JFQA 5BV7B 5LAXB 3TP4A 5B8CB 2F54A 5J11B 1IGCL 4OKVB 3MJ9L 3UDWA 5IMOB 4UDUA 2MQ3A 1AFVH 4LCUB 3QJFA 5CP3H 4FFWD 3ZLQC 3NN8B 4ODVH 4K7PX 4UI2A 5F9DC 1FYTA 1MEXH 3HAEG 3IFLH 4OLXH 4JFQB 1DQDH 1Z2KA 3INUL 4HCRA 3UO1L 1KC5H 2F58H 3EYSH 1DQLH 2A77H 2F54B 4QXUH 2AI0L 2WLYA 3BGFB 4UDUB 1FNSL 4NQTA 3SHSA 1CG9A 3WJJC 5CMAA 2F9BT 4U33A 3QJFB 5C09A 1P6AB 4W70A 4PRIA 3H2WA 4K3EH 2PW1A 4G6JL 3LN9A 2BY3A 3NABH 1EUUA 4O02H 1FYTB 4XAWL 25C8H 5DURD 2OR9L 1EVUA 4XI5D 4WI2A 1XF2A 1VFUA 4ODXA 4KK8D 2VH5H 4JO2L 5I1JH 3V6ZA 2HFEA 4JHWL 1ZTXH 5JQ6H 1J10A 1CG9B 4QTIL 4X5LA 5CMAB 2CRIA 5C09B 4NHCL 4Z7VE 3LQAC 1Y18A 4PRIB 2DQGL 3CXHK 1LDPH 1QFHA 2PW1B 2VDNL 4J4PD 5F7FA 4J3XA 4Z7WA 1QHPA 1T66C 5TE7H 1TQCB 1T2JA 1XF2B 2Q8BL 2CDGA 3O45A 4EXPX 4ODXB 2HA1A 3WFDH 1YNTA 1B4JL 3CXHJ 4KQ4L 2OTWA 1ZLSH 3LN4A 1GAFL 3V6ZB 5LKNA 2HFEB 5F9WC 3MV9A 5A40E 3GHBH 3LEXA 1TMCB 1YA5A 2D7OA 3VFGL 3RIAF 3VWJD 1Y18B 3P30L 5KSVA 1LP9A 4TSAH 5H37G 5MEQA 4HXBH 4Z7WB 4NOFA 1IFHH 2CDGB 3O45B 4I0PC 1YNTB 3EAKA 1N64L 3TFKD 2Y06H 5J8OA 2IBZX 2OTWB 4KI5C 5F1SA 3LN4B 3WCYA 1BAFH 4XMLH 5L2JA 5BVPH 5CEZE 1CL7I 4J8RA 3MV9B 1G1CA 3U7WH 3LEXB 1JGVL 2C3VA 2QLVB 2YKLH 3BKJH 5CEZD 1F02I 4R0LA 2ESVE 1MCOH 3MSPA 4DAGH 5KSVB 1LP9B 2QQLH 2A9NH 4LPTA 5MEQB 3V8CA 2P47B 3VXUE 2BRRL 1VGEL 2ESVD 4G8IA 4BZ1H 1MRDH 4KKCC 3KXFD 1A22B 2NY0B 4PJ7E 1TJHH 1QBLL 2PUQT 4UILL 1W8OA 4XP4H 2IMMA 5L2JB 1A6WL 4IOFD 4M1CD 1ROWA 4LCCC 4J8RB 4JPVH 5D9SA 4WUUE 5F3HA 3QCUL 2V7NA 1L7IL 5E2WL 2C3VB 3SDXE 1YQVH 1LEIA 4R0LB 4TN9A 5J13B 4N0RA 5DYOA 3D87B 2P44B 3QCTL 3STZA 2ZSWA 2HTKD 4G8IB 4UTAL 3S7GA 4KK9D 5CIPH 1MRFH 3RX8A 4M00A 1A2YA 5D2NA 2FCBA 3MV8E 2APBA 5E6YA 3QWRA 3HI1A 4K3DL 4L1HA 5D9SB 1H3TA 2GK0A 5F3HB 3MV8D 4R9HA 3EDFA 2V7NB 1IT9L 4OD1H 1OTSC 3RVVD 3KYNA 1E4XI 2DLFH 4PJXA 1ZVHA 2D0FA 1LEIB 3VGBA 3CSBA 4JZNA 5DYOB 1NFDF 2ZSWB 3STZB 3VH8G 1KB9J 1RIVL 1UT9A 5E8PA 4Q9CA 3LH2H 3RZCC 3W2DL 2CJUH 2B2XL 1A2YB 3MLUL 5D2NB 5IHUL 5GISL 1A7NH 3K81A 3V7MA 3QB7C 2MCPH 3HI1B 1OM3H 5J9PA 2GK0B 4C58B 1PY9A 4YC2B 2R4RH 3KYNB 4PJXB 4TTDC 1J0JA 4J2XA 3R0NA 4MQXD 1UH4A 4JZNB 5I1DA 3QHFL 3MACL 4OZIA 4OLYH 4QXTA 1DLFH 5DLML 4K2UL 3MUGA 5E8PB 3SQBA 3OF6D 5T3ZH 5F9WB 2FD6L 2ZUWA 4P9HH 1JZ3A 3HMWL 3WIIH 3NZ8A 4LEOA 5J9PB 4BSJA 4CVXA 1KENL 4KK5D 4QF1A 2D0GA 3QEGH 2H9GA 1W0YT 3T3PF 5HGAA 4ZSOA 3GIZL 4G8GA 1NANH 5I1DB 2J4WL 2ZCKH 4F7EA 4OZIB 2R0KL 3L95A 2ZNXA 4QXTB 1JZ5A 3C9NA 3UTTA 4YXKH 3MUGB 2VDQH 3PP4H 4EQ2A 1IZJA 2UZIL 3NZ8B 2DTSA 4LEOB 4MYWB 5GXBB 3T08A 4WGVB 4CVXB 4ENEC 3I9GL 2WIMA 4QF1B 2H9GB 3R4DA 4LMQE 5HGAB 4ZSOB 5E2VH 4U1IA 4D2NA 3VE0A 2FSEA 4G8GB 2BVOA 3AS0A 4F7EB 3VD3A 4N90E 3L95B 3MNVA 3T77A 1Q1JL 4AEHL 3C9NB 3UTTB 4F9LA 2YMXH 4OZGE 4N90D 1NCTA 2XT1B 4LCWA 2AK4E 4WEBH 3S35X 5JZ7D 1X5KA 4XAKE 4P5TC 3MXWL 1FNEA 3GI9L 2AK4D 1LD9A 4K9EH 2MCG1 4XAKD 1JZ6A 2VDLH 4U1IB 1PZUB 3VE0B 2FSEB 2L4OA 2BVOB 2DQIL 4NZJA 1DANT 4ZG1A 5BO1L 4GLRI 3MNVB 2GCYA 3T77B 2ARJQ 2IQ9H 3VXME 1QRNA 2BVUA 4LCWB 4LSQH 4FFZH 2OYPA 1IARB 2ORBL 5FYJL 2AJYL 5I9QC 3WO4B 1XIWD 5C6TL 1FNEB 1LD9B 4XBGA 4AK1A 4F57L 3UZEA 1RQ5A 3JBG7 4PTUA 5A3IC 4R7DA 4R2GC 4KMQA 1HHGA 2EYTA 2GCYB 4YDIH 3P2TA 4UT9H 1NAML 1QRNB 4FN0A 1CGYA 2FX9H 2VN7A 5GHWH 3ALWA 3N50A 4X7TA 4PJHA 3B6SA 1JZ8A 4JCLA 4HSQA 5IM7A 5F9JA 4KC3B 4U1SA 4OFVA 4XBGB 4LVHB 1IC5L 4PTUB 3MLPA 1A7RL 15C8H 4R7DB 2OBGA 5J3HC 3OR6A 2APVA 3B9KA 1LE9A 3I2CL 4JPKL 1XF3A 4HPYH 3V7AE 4N8VG 1HHGB 4PGJA 2EYTB 3HE7A 4M48L 3BX7C 4TVPE 1J86A 5IK3A 5KZCD 5FO9A 4TVPH 3WFEL 1TDQA 3BQUD 3HNTL 4MXVF 4M62L 4TVPD 5DR5H 4X7TB 4PJHB 1HWHB 5JMRA 3B6SB 3SCMA 5IM7B 5F9JB 4U1SB 4F58H 1BJ1J 3FT2A 5IMKA 2X4QA 2DIBA 4IRJC 3V6OE 3OR6B 1FSKC 3B9KB 1LE9B 1XF3B 4ZTOH 1JJUA 4YGVA 3LPWA 3HE7B 2YUVA 3TBSA 1GCFA 4KKAC 5JO5A 5IK3B 4MNQE 2FJGA 4GAJL 5FO9B 4TUKL 4Y16A 4TSCH 1SJHA 5DQJA 1OOAA 1NBQA 4MNQD 1CDCA 3SCMB 2R9HD 1F42A 2PN5A 3B5TA 3FT2B 4PRBA 5IMKB 2X4QB 1SJVA 2V5RA 1YEKH 2AK1L 1TTFA 1A7OL 2IPTH 4YGVB 2V17L 4KJYA 2I24N 3TBSB 4G6AC 5JO5B 2EIEA 3ARGD 3QI9C 1KNOA 4MDIA 2FJGB 2WWMC 3NIFF 4XPTL 4Y16B 2O5YH 1SJHB 5DQJB 4JDTH 1A0QH 1GOHA 1MHPL 2F53E 1WZ1L 3P11L 2AEWA 2NNAA 3FHQA 1FO0A 4PRBB 3GJFA 2DJSA 4YDJA 4ONHA 5FIEA 1IGML 2F53D 3UYRH 5FCUH 3QHZH 3I3BA 1FC2D 4NM8H 1JV5A 5E94A 2JCCA 5C1MB 2AGJH 4KJYB 3FZUD 1UKQA 1G7MA 5L8JB 4BYHA 4M6OL 4KJWD 1KNOB 4MDIB 5F7KC 2YD5A 1AJ7L 1CLYL 2HVKA 4LRIA 1U3ZA 3RWIA 2YPLA 3C2SA 3FQNA 2BFVH 2NNAB 2X42A 5FEBA 4R2GB 3SDAA 1FO0B 4LSUL 3GJFB 4YDJB 4ONHB 3EYFA 2Z91A 4XCFH 4FXKA 3FAWA 4M7JL 1ZHBA 3UTOA 1JV5B 5E94B 2JCCB 1BGXL 4ZNCD 4JR9H 5CBEA 4JN1L 3J7HA 1G7MB 3GMOA 4TVSa 4YDLC 2IQAA 4KROC 5DRWA 2P48B 2HVKB 3AMKA 4ZXBC 3RWIB 2YPLB 4G7VH 3FQNB 5J56B 3RDTA 3NCYP 1PKOA 1MI5E 3FO0L 4U6VH 5EOQH 3SDAB 4PJ5A 3ULUF 3ELAT 3EYFB 2Z91B 4P2OA 4KTEL 4FXKB 1CGSH 3EW3B 1OARL 5C86A 1ZHBB 1MI5D 3DOSA 4N8CL 3EJJX 1T2XA 4OQTA 5DHVH 3LY6A 3S36L 5CBEB 2HRLA 5MI0C 1A14L 1GIGL 1JCKA 3GMOB 5BRZE 2IQAB 5DRWB 1P9MA 1JBJA 5BRZD 3STBA 1U3HD 3MOBL 3OJ2C 1CDUA 3RDTB 1WT5C 2N7AA 4PJ5B 2V9RA 1I3GH 5E70A 4P2OB 4S1RH 4HJ0D 3BXNA 3MRQA 4FTVA 2AJVH 3C60A 2PW2A 3HG1A 2AVGA 4I5BA 3S3PA 4MLSA 4YNYA 5DC4B 8FABA 3MV7E 5ESVA 1AD9A 3ULVF 3MRDA 5E0QA 1S9KC 4DVRL 3MV01 3MV7D 4OZHE 1QFPA 4LVNC 1WBZA 2NY5C 5HYEA 2ED8A 3LZFL 1NMCB 2EE3A 3VFNA 3NGBB 2X89D 5F8RC 1BM3H 4Q9RL 4XCCL 3BXNB 3MRQB 4FTVB 3HB3D 3C60B 2PW2B 1JWSA 3HG1B 4I5BB 4K7PY 3SE4A 1IC7H 4R97C 4ZS7H 4YNYB 5B4MD 8FABB 4KRPD 5ESVB 1AD9B 1CK0L 4PP2A 1RHFA 3MRDB 3RBSA 3ULUL 4JQIH 3SKNA 4KZDL 1J8HA 2YPKA 4OGZA 1Z3GH 1WBZB 4C56E 3BSZH 3QR2A 4HQQH 3HPLA 1O7VA 2VAAA 3GSQA 2N4IA 3VFNB 4KJPD 1KCUH 3NZHL 4C56D 3ZTNH 1T1WA 3EO0A 1DBBH 3OZ9H 4CN1A 4CDHA 1I1YA 2Y5TA 3UZVB 2WP3T 1JWSB 2WW8A 3LOWA 1MOEA 4CL7A 4X80L 3L9RA 1T4KA 3DX7A 3EO9L 3MJ7A 1YEJL 5IB4A 4P2YA 5C0JA 4PP2B 3REVA 3S5LG 3EKCA 3IS1X 5JOEA 4ZXBA 1SVZA 3SKNB 5IEHA 1CLOH 1SY6A 1J8HB 1FG9C 4NJAH 4WJ5A 3GM8A 2YPKB 2WSKA 1KB5A 3HPLB 3NA9L 1P69B 2VAAB 1OHQA 3GSQB 3MBEC 5EWIH 3LEYH 4ZUWA 1T1WB 1WIOA 3EO0B 1OY3B 4APQA 3ULVL 3RGHA 1I1YB 2Y5TB 1INDH 4PB9H 3H8NA 5TFSH 3L9RB 1T4KB 3DX7B 3AB0B 1X3DA 3MJ7B 2JELH 1JF6A 2N7BA 4I0CC 4KY1H 5IB4B 5C0JB 3REVB 3DUHA 4ZXBB 4HZLA 2GFBA 5IEHB 1G9NC 1SJEA 3CVIL 1WT5A 4WJ5B 3U1SL 1MCDA 1GC1H 1A7PL 1KB5B 3T1FA 4I77H 4XBEH 2J8HA 5K59F 3WN5C 4ZUWB 2AQ3A 4Q58C 4APQB 5DUPL 3NOIA 3T0EA 5MI0B 2DJUA 4PPTA 4MX7A 2ZKHH 1G84A 4XC3H 5JHLL 3Q5YA 5IQ7L 4JFDD 2R2CA 2D4DA 3BPOC 3DROA 4NJ9L 3N9GL 1UH3A 1QPXA 1GZQA 2D0HA 4HZLB 2GFBB 3IB4A 4ZOCA 1EFXA 1SJEB 4HUKB 2PO6D 1HHIA 4FNLH 3LCYA 4OGYL 1KJ2A 1YMMA 3OMZA 2WBJA 3PHSA 3T1FB 1CFVL 1MWAH 1PSKH 3BPNB 5GRUL 4M7KH 2B39A 1OSZA 2DBLL 2YK1L 4E9LA 3T0EB 1A21A 1UQSA 4BK4A 4MX7B 3G6DL 2FGZA 1I8KA 4I2XA 5KG9A 1B2WH 4K8RH 3DROB 5GRYA 1GZQB 2HFFA 4K8RD 3DJ9A 3Q3GA 1EFXB 3MJ8A 1RMFL 2Z8WC 2XRAL 4AQ1B 4POZC 1HHIB 5K9QI 4FQLH 2ZUVA 1KJ2B 3RPKA 1YMMB 3OKOA 2A1WL 2VNCA 2WBJB 4OJFL 3BUYA 1RIUH 3S97C 2Y23A 1OSZB 5L2KA 3FFDA 4R97B 3E3QC 1JF1A 1NMBH 1UQSB 2F74A 4QHKI 4R90H 2HT2C 5LVEA 1QACA 1I8KB 4I2XB 4EUPG 5KG9B 1A9EA 1X4YA 3UMTA 1ZEAL 2HFFB 4FFVD 3Q3GB 1CFSA 3MJ8B 3MOAH 2BOBA 4LF3A 3W81A 3UBXA 5SWQA 1UEMA 3BPLC 3OKOB 4JDZA 3KR3L 3KAAA 5GJTH 3BUYB 4P2QA 1W0WA 5BV7L 3PL6C 4H88H 4Z76A 1MFAL 5L2KB 2XWTA 5I76A 1ADQA 3FFDB 3IYLW 4Y4HA 3ORJA 5CD5D 4Z8FH 1JF1B 2CUHA 4ZNEA 5L9DL 1S5IL 2F74B 3RZWA 3CVHH 3MLWH 1ZANH 1D5ZA 1A9EB 3OAYH 5IR1A 3BWUC 4H0HB 4B7LA 1A5FH 1XGPA 1CFSB 4XNYL 4JVPA 5DC9B 3WFBL 3WN5A 4RCAA 1F58H 2BOBB 2F5AH 4LF3B 1T6VN 3UBXB 4N0CC 2VWEE 5SWQB 1OAQL 3F58H 4JDZB 4EDWH 4BH8A 2EDHA 4D0CA 4P2QB 4MAYD 4J12A 4Z76B 2VXTL 2XWTB 2PF6A 5I76B 4Y4HB 1D7FA 1K4CA 2B0SH 4Z7WF 2YXFA 4P57A 5IFHL 1D5ZB 3SE3C 2R15A 4F9PA 3M07A 3PV7A 3H7LA 5IR1B 1IM9A 1NSNL 1PDKA 4HT1L 5HXMA 3U7YL 5AZ2L 1XGPB 2IJ0C 4NZTH 4WFGE 3WN5B 1LO2H 1R5WA 1QFOA 4EIZC 3TT1H 4BH8B 4D0CB 1N26A 5GGQH 4WFGD 5B38G 5F7UA 4HCRL 4NGHL 3MZTA 2EC9T 4E0RA 4R6UA 5J7CC 2VLKA 5AG9A 4OLZH 1K4CB 2MQCA 3VW3H 3HUJA 4LSRL 4JG0H 2XA8L 1RZGA 4TPRH 2PR4L 3VXRD 4P57B 4LIQL 1IGJA 1A3RL 1L6XA 4KVNH 3DRTA 3MUJA 1IM9B 4LFHD 4WW2C 3VGEA 5EPMA 3B9VA 3QPXH 4MA1B 1R5WB 1VEMA 3OGCA 1VEPA 4KK6C 3CK0H 4LPCA 4BFGA 5J57B 5E8DL 4JO3L 1L7TL 4E0RB 1U8HA 3O4OC 2AV7A 2DQTH 2VLKB 1I9RH 3HUJB 3DSNA 3NTCL 1I9IH 4L4JA 4OF8A 1RZ7H 1RZGB 4BSWA 3RL1A 5D7JD 1IAII 5D6DC 3EJZC 1IGJB 4FQXC 4UIMA 3DRTB 5EPMB 5CGYC 3PL6A 4PB0L 3RWFA 2UY6A 1VPOH 4YE4L 2W9EH 3OGCB 1NUGA 3TGXA 5DMIH 3G5YA 3NFPA 1U8HB 1N5YL 1UWEL 2AV7B 2DAVA 3GKWH 3ZT5A 3U0PA 3D3VA 4XXDA 3NIGF 4BSWB 4AG4L 5CFHA 5EZJA 5D2LE 3RL1B 1IEHA 1G0XA 3O81A 1N0XL 3QXAA 4UIMB 2ID5A 4GOSA 5GGSY 3O11A 3PL6B 3RWFB 1ED3A 5KSAD 4UAOC 1WCBA 4Y8DC 4PBWD 4QT5A 1MIEH 3G5YB 1MFCL 2VO5A 3NFPB 1MF2H 4MNGE 4Y4FD 3U0PB 4OI7A 3SE3A 5GRJL 1EVTC 2FWOA 3D3VB 4MS8C 3DGCR 4XXDB 4P4KD 1CU4H 3BH8A 4OI8A 5EZJB 3ISWA 1HIML 4YH6A 4UV7H 3S9DB 1J7VR 3QXAB 1JI1A 4J3UA 3ZT7A 3LB6C 4PJ9C 1QSFE 1B0GA 3LS4L 4QHNA 1FVCA 1YNKL 3ZL4H 4NP4L 3O11B 3MO1A 4AQOA 1ED3B 1BFVL 1QSFD 3WHE0 1WCBB 4KJQC 4QT5B 2VE6A 4LP5A 2X7LA 1PY4A 3QNZA 2FWOB 2APWA 4GUPA 3WEXA 4HUMB 1N4XL 3BH8B 4WW2A 5MP6L 1VGKA 4CJ1A 5EDXA 2IGFH 4UNUA 4Y0GA 1B0GB 4QHNB 5KSBE 4JHAH 4JFFE 1FVCB 2LU4A 1BQHA 4M8QA 4ETQA 3MO1B 3LIZH 4HIIA 4JFFD 4FQQA 2E9BA 2VABA 3JTSA 3WIHL 2VE6B 2X7LB 3QNZB 4IOIA 4DGVH 4GUPB 5I18L 3WEXB 5TDPA 4RZCA 1QEWA 3LQAL 4WW2B 1VGKB 5JW4N 5HYJA 4UV4L 5HI3D 3V4UH 4M5ZH 5EO1A 1N6QL 3QUMH 4LSPH 1BQHB 4M8QB 4ETQB 5HD8C 1D9KC 1EA9C 1MFEL 1Q9OA 4YHZH 5DDHA 4HIIB 4FQQB 3BIAX 2VABB 1MFBL 3JTSB 3K80A 4NKIL 3ZE2E 1T2QH 4IOIB 5TDPB 4QWWD 4Z7QF 4LSSH 1QEWB 2X10A 4RZCB 4HKXA 3SDDD 5HYJB 4HBQA 2A0LD 3CLFL 4OUOA 3KPSE 5EO1B 2B4CL 3MFFA 3QFJA 1YYML 2CK0L 3V4VL 3ARZA 5BS0E 3KPSD 2IAMC 1Q9OB 5EZOL 3OPZL 4LRNL 3CAFA 5DDHB 1QD0A 4B5EA 3ILQD 1S7WA 5BS0D 5E8EA 1D6VL 3PWPE 4PS4H 4XMKL 4BK5A 3PQYA 4YEFA 4ZFGL 3KHOA 3PWPD 1B3JA 4UNTA 4HKXB 4UTBL 4Y1AE 1S9VA 4OB5H 5EUOE 4WU7A 5TF1L 3MFFB 4NKMA 4UAOB 3QFJB 1NGQL 3K1KC 4LGRB 3BP5A 4Y1AD 4MZ2A 3ZDYF 1C8PA 4FQPA 3F62A 4LPWA 4Y4KD 2B7DT 2QL1A 4GAGL 1S7WB 2AI0H 5DUML 4WTWA 5D5ME 5E8EB 1NH6A 2N1KA 5DWUL 3UJTL 4ALAH 4HBCL 1N3NA 3EO1A 4KKBD 4OD2A 3FQRA 1H5BC 4GG8A 3PQYB 4JM4L 4NN6C 1KGCD 1OTUC 4K94C 1S3KL 4GMTH 3CH1A 4G6JH 2E7LA 1S9VB 3MRGA 4PG2A 4WU7B 4NKMB 1RUMH 3BP5B 3ZKNC 5JA8B 4POUB 3RIFF 1NDGA 1YEFL 4Z7UF 1I8LC 1F2QA 4PJBE 2P46B 3VXQA 1NCWL 2VYRE 4JANA 4JHWH 3C6LA 3WXVL 1N3NB 3EO1B 4OD2B 3MFGB 3FQRB 4GG8B 2EXWD 2DQGH 1U8KA 3B2UD 3CH1B 3V5DA 1FNGA 4NQUA 5JQHC 1T3FA 1HKLL 3MRGB 1EHAA 3ESVF 2P1YA 4H1LA 1RU9H 1HQ4A 1A1MA 1S5HA 4CW1A 1NDGB 1DSFL 5IBTH 3QUXD 2YHGA 3MGAA 1QQDA 5KANG 3VXQB 5FA4A 5EBMA 5FUOL 4LAJH 4JANB 1TLKA 1GAFH 2JJVA 3C09C 3A6CH 4HWBH 2NXYC 5EU7E 3C6LB 3QIUC 3DV6A 4RFOH 4FQ2L 3CDFA 4AENA 2H6PA 1U8KB 4O2FA 3V5DB 4JM2A 1FNGB 3O6FD 1T3FB 2IAMA 4XNUL 1FH5L 4H1LB 2VZTA 3GBNH 1HQ4B 4M03A 1AHWA 1A1MB 5D71L 1S5HB 4CW1B 4EEEA 5K9JH 3EOAA 1UJTA 1QQDB 5FA4B 5EBMB 1GVIA 4HIEA 5JDSA 3IDJA 2BJML 4NWTL 3PDOA 4P5KA 3DV6B 4XVUC 5EORL 4Q6IA 3TM6A 1OP3H 4OZFA 4AENB 1G0YR 2H6PB 4O2FB 5ITBH 3FOLA 4XMPH 4JM2B 5LGJA 3BKYL 2IAMB 3K4AA 3V7AG 1AHWB 4NNPH 5BVJA 3QG7L 4OIIH 1P7HL 3O0RL 3QRGH 1CT8A 3CFIC 4Y88A 3EOAB 3ESUF 2AJXH 2B1HL 2P5ED 4LCYA 4XVTH 2PKDA 3VI3F 4HIEB 5JDSB 3MYZA 3IDJB 5I8OL 4H20L 2YOCA 3PDOB 4P5KB 1TIUA 4Q6IB 4WI7A 4GRLC 4GRWE 4OZFB 1UCBL 5I74C 5HHOE 1ZVYA 4LOUC 3FOLB 4GRWH 5LGJB 1J8KA 1QLEL 2FATH 1RZJL 2JB5L 5HHOD 2F19L 4UTAH 1CGVA 5MENE 4FQIL 2NLJA 5BVJB 2FEDD 1CT8B 2C5DC 2E8YA 3T2NL 4LCYB 3MPCA 4OIBA 4P99A 5ID1A 5MEND 3MRNA 1IEBA 5HGHA 4L3EE 5ACLA 4NN6B 3VCLA 3VI3E 5J6HA 4ELME 4B0MM 3SGEI 4L3ED 4RGNC 4S11A 1R6VA 3ARSA 3WNKA 1YY8A 2VMFA 2JJTC 1RZKC 1CDBA 4HIHA 5EU6E 3ZTJG 1OP3K 4S1QH 2NLJB 3GIVA 3RVTC 5EU6D 4X98A 3NH7H 2NY1B 3LKSA 4XNXH 5ID1B 5IHUH 3MRNB 1IEBB 1T21A 3MLXL 5HGHB 5KBNC 5HSFA 1I75A 3MZGB 1LO5A 3VCLB 1CL7H 2QSTA 5J6HB 5IOPA 5T5NF 4OFYA 3RY5A 5D7IA 1X5YA 4XNMA 2J6EH 4GG6F 3QISA 3QQNA 5JOPE 1YY8B 2R0ZL 4UOJA 3TO4C 4NNXA 4HIHB 3UJJL 2ZUQC 4PUBL 5KOMC 4R3SA 2X1XR 3GIVB 4K2UH 4X98B 3HFML 3LKSB 2NY4C 4WHCA 3I50L 1T21B 3VGFA 1LO5B 3HMWH 3EFDL 5D7SH 5IOPB 1Z9SA 4JRWA 1I4FA 4HF5L 5D7IB 2E6PA 2X05A 4XNMB 3B8SA 4N9OB 4GG6E 2QSCL 3RI5F 3QWOA 3ZKMD 4NNXB 2IADA 3F6LA 1C1EL 2J4WH 2FIRT 1NLDL 5T1LD 2DM4A 1U93A 2HT3C 4R3SB 4Q9QH 1JN6A 4DOHE 5L6YL 4G6KH 2ZUTA 3U48A 2FECI 2K1MA 5E1HB 4FQ1L 1WGOA 1ERNA 3FO9A 2ZWLT 4F8QA 4LSTH 5FUCC 4DVBA 3MXVH 4G7YH 4G5ZL 1JNLH 1I4FB 1KELH 1KBGH 4IRZL 1ETZA 3DMMC 5GZND 1G7QA 3QWOB 5ALCL 2IADB 2EIBA 3MLVL 1QTYT 4P9MH 1IVLA 1U93B 1A4JA 1Q1JH 1JN6B 4S1DD 1HHHA 2AJ3A 4OQTL 1BQLH 2A74A 4YBLC 5TGBA 4JPWH 5DJ0A 3WSQL 5BOPA 3FO9B 4OCNC 1NC4D 4DVBB 4QNPE 1EO8H 2FGWL 4WWKD 1YJDC 1JWMA 3I85A 1ETZB 1MH5A 3VFTA 1G7QB 1A47A 4FZEL 1A6VL 4DKDC 2HJFA 1E4WL 3BDYL 3TZVC 2AS5M 4DEPB 1A4JB 1E4XL 3TN0D 1HHHB 2AJ3B 2A74B 5TGBB 5DJ0B 5CJOL 2W60A 9CGTA 5JXED 3ZZ1A 3HNSH 3WD5H 2AJYH 4D3CH 5C6TH 3ZO0A 1V3JA 4DKEL 2E7BA 2XTJE 2DTMH 4F57H 4JO4L 3HZMA 1JWMB 5JA9A 2NCMA 1QFWH 4X6DF 1MH5B 2XTJD 3VFTB 5IB3A 2DQCL 5BOZG 4PJDE 2HJFB 2GT9A 1MIMH 3F7PC 2WWKO 2JLLA 1OAUH 2R0LL 3RI5K 3U9PL 4U2YA 2W60B 1J88A 2VXUL 1N5AA 4YHIA 1IGIH 2YUZA 2GITA 3TA3C 3HZMB 4FP8H 1DBAH 3CSGA 1G9EA 4P23C 4CVZA 3G6JE 5IB3B 2GT9B 1FL3A 2R29L 5CILH 5AAWA 5DEGA 1SEQH 1QNZH 1BIIA 3C87A 1NEUA 4YFLI 5HI4C 3RPIA 1N5AB 3A6BL 4YHIB 1F4HA 5IVXA 3RUGA 1KCSL 2GITB 4NC2B 4W6YB 5FO7A 1YECL 2BP3A 1P4IL 4CVZB 3CGTA 4XTRC 1WIUA 1IBGL 1FL3B 7FABH 1GRWA 3VA2C 4TRPH 4UBDD 5DEGB 1BIIB 3GRWA 4UQ3A 3IU3A 1QZ1A 5EG6C 4EI5D 4L8SA 4NWUL 3RPIB 5IVXB 1MNUL 4MXQD 3BHBA 2DYPD 1GGCL 3QPQC 3RUGB 3V52H 3Q6FA 4HG4J 5FO7B 3CX5J 1KCLA 3B5HA 3S3SA 5E2UL 3IU4H 5D4QA 3NFNA 4YBLB 4OLUL 3HS0A 1HK6A 1PJ9A 3B83A 3MLZH 2NY3B 5DD1L 1SYSA 4UQ3B 3IU3B 3LKQA 4XPTH 5HI5D 2RQ8A 4HS8L 4L8SB 3RVWC 2H45A 5H8DA 2EDRA 2NY5L 3BHBB 3RA7L 4WTZA 1J1XL 4LSDA 3Q6FB 4GQPH 4AT6A 1KJ2L 2YS4A 4LLVA 4Y2DD 5FGBC 3NFNB 4X6FA 4AMKH 3WS6A 3HS0B 2CO7B 2D7MA 5FV1L 4YDKL 5DFWH 5J1TC 2X4TA 3GBML 4JRXA 1X7QA 1SYSB 3LKQB 3QUZA 1WFUA 3TA3A 3WHE1 4L4VA 2NW3A 4IDJL 4OCXL 2R69H 1CICA 1NMAL 4AT6B 2VXVH 1IQWH 2EZ0D 3ALXA 4Y19A 2XZAL 4LLVB 3KLHC 4UINL 2WZPD 4X6FB 1OD9A 5CJXC 4JN1H 4U3XA 1SVCP 5JUEH 4JE4B 2CPCA 2X4TB 1SM3H 4JRXB 2E6JA 5DJXA 1X7QB 3X3FL 4XPGH 3QIBC 3QUZB 5EIIA 3TA3B 4KHXL 2B5IB 4PJFE 1SHMA 3HUJF 4L4VB 4OTXL 5GSVA 2NW3B 2F5BH 5AG8A 1CICB 3BIKA 3TYGL 4U3CA 2MKWA 3AREC 4NBXB 4KTEH 5MHSE 5IBLC 4LLQA 3WHXA 1AGCA 1ZGLA 4Y19B 1RVFH 4MA7H 5MHSD 4WO4D 1ADQL 5CLWA 1DVFC 1SMAA 2NXZD 4IS6A 5DJXB 5GS0C 1FAIH 5EIIB 1G9NL 3IFOA 1WICA 5C0ND 3VMOA 5CD3A 2CK2A 2EYRA 4Y5XC 5GSVB 1II4E 4PJCA 3O3BA 3NCMA 3BIKB 4N5UA 4DN4L 4LLQB 3WHXB 1AGCB 1ZGLB 3MLYH 2YC1A 4X9GA 4XPHH 3TVMC 4OF3A 2W59A 1C16A 2I5YL 2BNRE 4RMSA 1OPGL 1UZ6F 5FYLL 2BNRD 4IS6B 4QOKA 2OZ4A 1VESA 5A16A 2NZ9D 3IFOB 4GH7B 3ARFA 1BWWA 1EEUA 4M93C 4L8CA 5CD3B 2EYRB 1V7ML 3MRFA 3LZFH 3OKMA 3B3IA 2WBWB 4PJCB 2UUDH 3O3BB 5D6CA 5DEZA 3I02A 1I1AC 1NJ9A 1MPAL 2YC1B 3S34H 3T8XA 3QUYA 2EH8L 1C16B 4WV1C 3S37H 3VMNA 5FYKE 5ALBH 1G6RA 3WKML 1JFQH 5FYKH 1A1NA 5DT1H 3MROA 1CK0H 3MNZA 5FYKD 4QOKB 4FA8A 3QHTC 3WIFA 3SQOL 5A16B 3ARFB 4L8CB 2OJZH 1TJIH 1O0VA 3MRFB 3OKMB 1CXLA 3B3IB 1MREH 5D6CB 1T6WA 4PGEA 2DWEB 3IJYA 1WWWX 3I02B 1NJ9B 3QIWD 5CJ8A 5CJXA 4ISVA 3BIBX 3T8XB 5CKGA 3QUYB 4X80H 4BJLA 2NPLX 1G6RB 1B4RA 3OWEA 3DRQA 5I1GL 5GGTH 1A1NB 2IH3A 3NPSC 3MROB 5CZXC 3MNZB 1WTLA 5HDLA 1BFOA 3WIFB 3O2VH 1QO3A 5JW4M 1QR1A 3TJHC 5C3LD 5T1DL 4PGEB 4WW2F 2XZZA 4IDLA 2GJJA 3P0VH 1LO4H 3IJYB 4P3WA 5DVKA 2PCPA 4ISVB 1DVFA 3QQ9C 5ANME 4HGKC 5GZOD 2UUDK 2VDRH 4HFUL 1FNHA 1RJYA 3UX9B 2PTUA 2XN9A 2YD2A 3DRQB 1MAKA 1MLBA 2IH3B 4YUEL 4YHOL 2PYFA 1PW3A 4PLJC 3SDCA 1NL0L 2MTPA 2F15A 1BFOB 5J1AA 4OM1L 1QO3B 4OD3H 3U1SH 1QR1B 1KEML 5FHAH 5CJ5A 4MCZA 1H9VA 3T0VA 3X3GL 3ABZA 3MRKA 2EDJA 3Q5OA 5D1XD 4MJ4A 2PCPB 4YDVA 4QXGH 1DVFB 2VXSH 4EQ3A 3LQMA 4ZQKA 4PRHE 3S36X 1RJYB 2ADFH 2XN9B 3CDCA 3RRQA 3PUCA 4XRCA 3RJDA 1MLBB 3O2WL 2PYFB 4HFWA 4PRHD 3SDCB 1FE8H 5J1AB 5DMKA 3MLTA 2NY6C 3VI4F 1IC4H 1NLBL 3DNKA 4MCZB 3UC0L 2HG5A 2G5BA 4AEFA 3MRKB 1X4XA 1J5OL 2DBLH 4YDVB 2Q8AL 2HMIC 1KIRA 3H42L 4OCYL 2DL2A 5KVEL 4IRSD 3VXSE 1WQVT 1DEEA 4ZQKB 2H3NA 1RURH 5CGYD 5MERA 1JGLL 4CUCA 4NIKB 3H6JA 4XRCB 4RMVA 2MNUA 3CFCL 4HFWB 2XKUA 2ZG1A 32C2A 4ZAKC 3LRGA 1IRAY 5DMKB 2CRYA 3MLTB 3LDBB 4PJEF 1IC1A 2A1WH 4GXVL 2HG5B 4G6FD 2G5BB 1MCSA 1HINL 1OP5H 5I6XB 2V2XB 4KTDL 1PKQA 1KIRB 3RVUD 3WNPA 4JVUA 3S37X 4F3FA 1DEEB 3RTQD 2H3NB 3WFCL 5MERB 1CFNA 1ZLUH 2IH1A 1F97A 4M1DH 4PJAE 32C2B 2LE9A 4RGOH 4KMTL 1JPST 1X6LA 4NO0D 1JGDA 2DF3A 5BV7H 4MVBC 2D7TL 2IFGA 5DC0A 4DK3A 2EEBA 3UTSA 5TPWL 1OAXH 1PKQB 3MCLH 3NPSB 3O2DA 4CBPA 5BQ7A 4F3FB 1CFNB 2Z8SA 1RFDL 3JWOC 3LPFA 2IH1B 5B39G 4HUXA 2ITDA 1INQA 4M6MH 3H3PL 4I18C 5MEOA 1JGDB 4EIGB 4YAQA 1CR9L 1S9XA 3FTGA 3UTSB 1CFBA 2C4XA 2DDQH 5BQ7B 5TE6L 5IJKC 3ROLA 1OP5K 1NCCL 2ZJSH 1RULH 4TNVF 4HUXB 4HT1H 5AZ2H 2ITDB 2R23A 1INQB 1Z9OA 4YR6A 1FYTE 1N2RA 1ZLUK 4IIQC 4RFNB 1H3WM 5MEOB 4UU9A 5I75B 5JDJA 1O5DT 4YX2H 1A6ZA 3V4PH 4ZFOA 4YAQB 2VZ3A 3FTGB 1S9XB 4F7PA 5C9JA 1XF4A 1AQKH 2Y07L 4P59L 3D1MC 2QTEA 5C09E 4MA8H 3ROLB 5CS7A 1XGQA 4FFWC 4PRIE 3RHWF 3WLBA 5C09D 2R23B 4HMCA 1H3XA 4YR6B 3SKJH 2QHRL 1FBIL 2HWZH 4WCYH 5D70L 4PRID 5HHXH 3GMMA 1N2RB 3KJ6L 4PJGA 4UU9B 3ARRA 3BDXA 1A6ZB 4FXLA 5KS9F 2JJUA 2Q7YA 3P4OA 4JN2A 4ZFOB 1EBAA 2ADIA 1LK2A 3C5ZD 4OT1L 4F7PB 5C9JB 2VR9A 4P2RA 1XF4B 1D5IL 4XP5L 2DQDL 3VFOA 4LMQI 1WAAE 1XGQB 4RWHA 3UPRA 3QG6A 3WLBB 1KG0A 2BVTA 4S0SD 3X13A 4K23L 5HVHC 3GMMB 3ARPA 4HLJA 4PJGB 1N7ML 4NQDE 3TWCL 5I1HL 4XI5C 4HK3J 4HHAA 2Q7YB 3P4OB 4JN2B 2ADIB 1LK2B 1NBVL 4KK8C 4NQDD 1HYRC 2FZ3A 1P2CA 1XH3A 4GSDL 1QYGH 3TBVA 4P2RB 5IKCA 5L8KB 3MV9E 4XZUA 5TDNA 3CSPA 3VD5A 3VFOB 3D48R 5J1SC 1BF2A 1RI8A 3TO2A 3MV9D 3UPRB 3QG6B 1KG0B 3GGWA 1LP9E 1S7RA 1UCTA 3MJ9A 4UMGA 1BZ9A 5CSGA 3X13B 4J4PC 3MQIA 2CO6B 1M7XA 3BUTA 2BZDA 2MMXA 3L5IA 3QXVA 4MQTB 1GGBH 5KANI 1TZGL 2DQEL 3V9FA 4EOWH 4OFDA 4HHAB 3M8OH 4K71B 1MUJA 4QHKJ 2X4NA 3D85D 2FZ3B 3TNNA 1P2CB 1XH3B 3TBVB 4FFYL 2NY0D 5IKCB 4RX4A 4XZUB 5TDNB 1JGUH 1RZ8A 2EDXA 2GY5A 1DBJL 3MRPA 3R1GH 3HAEH 1Q0XH 2AEPL 3WDJA 3VGAC 3TO2B 3Q6GL 4YHLL 3QEUA 3VWJC 1F3JA 3GGWB 5ADOH 1S7RB 1CBVH 1BZ9B 2CRZA 3QDMD 1P6FA 2X4UA 3SGJC 2X1PA 3RWDA 1AE6H 4RWYH 3ZHDA 3MRRA 1GL4B 2ILLA 3IFPA 1MQKH 4LEXH 3GKZA 1FGVH 1MQ8A 1MUJB 2X4NB 4P46D 3TFKC 1LK3L 4RRPA 1HEZA 5I71C 3TNNB 4E41A 2XWJA 1B90A 2FH6A 1IAIH 1RZ8B 5CP3A 4MMZC 2J12B 2E9WA 4K94L 3MRPB 2WINA 4J23A 3QEUB 1F3JB 2UWEF 4JZJC 4DKAA 3BI9X 3V6FA 4LHQB 2VKWA 2X4UB 2QQNH 4O5LL 3RWDB 3FB8A 5ISZA 3MRRB 2FJHA 3SOBH 3IFPB 4Z95L 1QBML 3L5XH 3ZYIA 1O7SA 5J89A 5DVLA 1F8TL 1FYHB 5D2NE 5DVNA 1HEZB 2VL5A 1QKZH 4E41B 2VLRD 1CXKA 2XWJB 3P0YH 3H3KA 2O93L 4M1CC 3TT3L 2DI9A 1P53A 4PJXE 2WINB 1FLTX 3O6KL 1WSST 3HI5L 1E4KA 2DKSA 3V6FB 1OT1A 1T7XA 4YWGH 5KVGL 5EB9A 3FB8B 1KF9B 4NHUA 4QRUA 5ISZB 2FJHB 4H8WH 2HTKC 3UXFA 1MCPL 4WY7L 2VERN 4KK9C 3KYOA 2H32H 2C4FT 5CGTA 4F37K 1BBDL 2VL5B 5MEPA 5IHZA 5E08H 2OP4H 4ONGL 2H26A 1A7QL 5HVHB 4J4PA 5DMJB 3RVVC 4HWNA 2B4CH 4MSWA 5D96B 1YYMH 4OZIE 4KMLB 1QLFA 4NHUB 1RUAL 4QRUB 1IGFH 3T2QA 4KI5E 2E27H 5F7NC 2OI9C 5F1OB 3KYOB 1B0RA 3I6LE 4CU8A 4LOUD 3BMVA 5BW7A 2W92A 5MEPB 5IHZB 1V8HA 4JZOA 2IBGA 3I6LD 4ZFGH 5HHQA 1QSEA 2H26B 2NY2B 2QV2A 2J8UF 4BQ8A 1GSMA 2GSIA 4XVSH 4PJIF 3SGJA 3ULSA 4ZSOE 2D03L 1MCCA 4MSWB 2DQHL 2EEDA 2DLHA 4F7MA 4M9OA 5BJTA 5K33A 1CDIA 1QLFB 2DD8H 3U0WL 2X1OA 1R3HA 3UTTE 3D2UD 4RGND 1NAKH 1A4KA 5C2BL 4V2CB 4IMKC 1B0RB 4PGDA 2YRZA 3UTTD 5A1AA 1GPOL 4XP1H 4JZOB 4QRQA 3VGAB 4HWEH 5HHQB 4JZJA 4M43L 1QSEB 4P9HC 4OBRA 1NBYA 2GSIB 5C08A 1RUPL 3ULSB 4KK5C 1LILA 4TNWK 2AV1A 5BJTB 5HYSG 4F7MB 2LFGA 4OM0L 3JWDH 3KXFA 1NCDL 2UV3A 3A67L 3FN0L 5I0DA 1ZMYA 1MCHA 1R3HB 4JFHE 1A4KB 4J6RL 4QGTA 5CZVH 3VFWA 4PGDB 4LCWE 4PJ7A 4X83A 1UACL 4QRQB 1S78D 2Q1EA 4LCWD 4JZJB 3BRDA 1NBYB 5C08B 1RZKL 5CHNA 1U8MA 2X70A 2AV1B 1KTRL 3QXDA 3KXFB 4N0UA 4OLWL 4PG9A 1KPRA 3MCKA 1X6NA 2KL6A 1QRNE 1UA6L 5GGSA 5FUOH 2BHYA 3VFWB 5JW4R 3QFDA 4PJ7B 5DJAA 1QRND 1I1RA 1MCBA 5JZ7C 4PREA 1VA9A 2QKIA 4G3YL 4DQOL 1PEZA 3LD8B 1PX4A 3F5WA 1AGEA 3OHXA 4S1SL 5CHNB 1U8MB 2X70B 1RPQA 1WEJH 1WZLA 1CGTA 3QXDB 4JFYA 4N0UB 5HHME 5J4MA 4PG9B 1KPRB 3MCKB 5GGSB 2Q3ZA 2R0WH 5HHMD 2UZYB 4FMFA 4X6EA 1OAKH 2G60H 3NCJL 3QFDB 5DJAB 2BJMH 4KQ3L 1LO0L 4PJHE 4LARL 1W2KT 1DUYA 4PREB 1TTGA 2QKIB 1FPTH 1XIWC 4NT6A 4Q2ZA 4EKXA 5A2IH 4MMXC 2HYMA 3F5WB 4ZFZA 1AGEB 3OHXB 4NFDA 2JJSA 2ARJA 3Q1SH 3QZWA 5IROA 1JE6A 1I9JL 4JFYB 4IMKA 1BPVA 3I3DA 5CP7A 4LQFL 3OF6A 3B9KD 3NIDF 3IDYB 3EHBD 3HE7D 4X6EB 5C0BE 4R26L 1H15A 3MTRA 4TQEH 1DUYB 2PXYA 5C0BD 4NT6B 1P4BH 4Q2ZB 2YUXA 5HHPA 4ZFZB 3EOTL 1QLEH 3O3EA 3SCMD 2ARJB 2JB5H 2XZCH 3QZWB 3IKKA 5D8JL 2O61A 3PWNA 3TV3H 4WHDA 5CP7B 1K2DA 1L4IA 1MY7A 4FZ8L 4MD0A 5DFVD 4RGMC 2HP4A 3CFEA 3BQUC 2R8SL 4NQSA 1H15B 4ERSL 2OXHA 2PXYB 5KVMC 1YJDL 4ZOAA 4Y16D 5BZWA 5C6PB 1KCRL 3TIEA 4ODSL 5HHPB 3O3EB 2OS7A 1PYWA 2Q6WA 2ZP0T 5E4EC 2O61B 3PWNB 3VDBA 3V6OC 1K2DB 3PWUA 4MD0B 4LDLB 4ZUUA 2VDOL 1INEH 3IXTA 4PV8A 1ZHKA 3CFEB 2ZCLH 4GS7C 4NQSB 5KTEH 1VENA 3P9MA 3OAUL 5BZWB 1AXTL 3DUSB 2R9HC 3QNXA 3TIEB 4X6CE 1JHKH 1FO0H 3GJFH 2EE6A 4HLZG 3GO1L 1PYWB 4PUBH 2Q6WB 1F90L 4I3SH 3H0TA 2JCCE 5FAAA 3RY6C 3WE6A 3HFMH 4PJCF 1AY1H 2VXQH 1AI1H 4F15B 3PWUB 3DURA 4OSUL 4KVCH 3ARGC 4ZUUB 2VDPL 1XIWA 1HOCA 3IXTB 4PV8B 1ZHKB 4HC1H 5DA4A 4DUWA 4Y89A 3GSNL 5KW9L 3P9MB 4KGLA 4J3WA 1RIHH 2YPLE 4NZUH 2D7QA 4L4TA 1IKNA 3QNXB 2FX7L 1JPSL 2AQ2A 1I1CA 4Z5RA 2YPLD 4A6YA 2G9HA 5LXGH 1NLDH 3SDAD 1OAZL 1B6UA 1C08A 3H0TB 2RFXA 2WNGA 4OLEA 3WE6B 3FZUC 4NQCE 4XCEA 5C0IA 3DURB 4FQ1H 3QXTA 4KJWC 3BT2L 1XIWB 5L0QC 1HOCB 3C5SA 2E5EA 4NQCD 4I9WE 4W68A 4GXUN 1H3PL 5FK9A 4FXGA 4DN3H 4O4YH 1GGTA 1KIQA 2XOTA 2GI7A 2FX8H 4WUKH 4I9WD 4L4TB 2E3VA 5J12C 4Z5RB 1X5JA 4M1GH 2HN7A 4A6YB 2XY2A 1K8DA 1QSZA 2G9HB 5HDBF 5ELIA 3RDTD 1QLRA 35C8H 1C08B 3EDKA 3QDAA 2RFXB 4P2OD 1MRCL 1LHZA 2ZCHH 3GJFK 4X9IA 2NW2A 1BWMA 4XCEB 5C0IB 3P9LA 1J18A 3VG0L 5IW3A 3C5SB 4KAQL 1E6OH 5ADPH 5JOFA 5FHBL 2C1PA 4PGZA 4RAVA 4FXGB 5FK9B 1OF2A 1KIQB 3ARTA 3RU8L 4MXWL 2HN7B 3EYQD 4M7LH 1K8DB 4MD5A 4UB0H 5M95B 3V6OA 3BYYA 1QLRB 2LV4A 3HG1E 3SE9L 3G5VA 1NKRA 3EZ8A 3VRJA 5KZCB 2K7PA 3C60D 3HG1D 2NW2B 5JIPA 2O5ZL 3P9LB 1C7TA 2XZQL 2AERT 5ILTH 3EYOA 4IHOA 4UOW0 4JO4H 2VC2L 5DVMA 5JOFB 1CF8L 4NZDA 2C1PB 4RAVB 1OF2B 1U3HC 1HI6A 5E4EB 4G9FA 3RY6A 4MD5B 1Q9KA 1EHLH 2DIAA 5HHNA 1U8QA 4AL8L 3Q48A 3G5VB 5DD3L 3MCG1 4GKNA 4PV9A 2R0LH 4PY7A 3VRJB 3Q5TA 3VDCA 3S4SG 3TF7C 3AXLA 2VXUH 1T1XA 1OLZA 1MFDH 1J8HE 3EYOB 4IHOB 1BLNA 3SDYL 1CXHA 1MCKA 6FABL 2Y1VA 1HI6B 1D3CA 4PD4K 4XGZA 4G9FB 2HLFD 4LSVL 1Q9KB 3EDJA 3BZDA 5HHNB 1U8QB 3DPBA 1FHGA 5HVWA 2PYED 3HB3C 4GKNB 3EJYD 2FBJL 1A64A 4PV9B 2QQKL 1ZKAA 1GGIH 2DM2A 4PY7B 3JV5A 1J05A 2DICA 4RQQA 1D5MA 2HVJA 4ZOEA 3K2UL 4XPBH 4PYHA 4KRPC 3AXLB 1T1XB 4GBXA 3V0WH 3HNVH 2AJZA 4XPFL 1MAMH 1KCSH 1BLNB 4PJ8A 2XQBH 1YEEH 1SY6H 3MLSH 5I1IH 5L7XL 1FL5A 2C3HA 1KB5H 1RD6A 1YEHH 2VDKH 4XGZB 4KJPC 1VERA 3MLRL 4HIXL 4PYGA 5A2LH 3IJHA 5I8KL 1A3LH 4JGMA 4APQD 1QFUL 1JWUA 2Y5EA 5DGRA 3A0OA 1J05B 4RQQB 5GS0L 5I1LA 1D5MB 2HVJB 4LLYA 1UM4H 5C7XL 4NWUH 4XPAL 4GBXB 3IFNL 1MNUH 5F7LB 5TE4L 1U3JA 3MODL 2AJZB 4PJ8B 1WFOA 3UYOD 1FL5B 4PLOB 1DN0A 5F7EH 4UT6L 5E2UH 1NCUA 2KZ1B 3T0EE 3BWAA 4P3CL 3VXTA 3JXAA 1I7RA 3IJHB 5DHVA 4DGIL 5I30H 4QRPA 4U0QB 4YFLF 1JWUB 3HI6L 4ZD3H 3T0ED 4Z0BL 4RAHA 4DKFH 4LVOC 5CUSH 5I1LB 4LLYB 1NCBH 2M26A 1DBKH 1U3YA 2EKSA 4XCNA 4EBQL 1U8PA 3DVNA 2DB8A 3DVIA 1RJZA 4V1DD 1YMME 2D9CA 1I3RA 1EFXD 4YXHL 1DN0B 4ODTL 5CGMA 4EN3D 1XAUA 1JK8A 1YMMD 3RWJA 3S98A 1BZ7A 3BWAB 3VXTB 3S4SA 3O8XC 3GNMH 1I7RB 5DHVB 4QRPB 2IFFH 1UYWL 5KVFL 3DVFA 3H9HA 4WHYG 1FORL 3MV7A 3DYPA 5LQBL 2CR3A 1FRGL 2EKSB 4XCNB 1RZFL 1WWBX 4GO6B 1U8PB 3DVNB 3UEZA 1RJZB 2BY1A 2PO6C 2X89A 5DQDH 1I3RB 2CRMA 2Y36L 2BC4A 5T33L 4ZTPL 5IESL 2XZAH 1F4XH 1JK8B 5L2KE 3RWJB 4OUUA 1MCLA 1BZ7B 3JVGA 1ZLVH 4QCIA 3S4SB 3F12A 3RWGA 1PG7H 1CDYA 1WIPA 2WUBH 4O9HH 2P8LA 3H9HB 1EAPA 1KTDA 3MV7B 1BF8A 3DHJA 3ILPA 4KFZC 5CCKH 1ACYH 4LHUG 4K8RC 4Z0XA 4KHTL 4W81A 5AWNL 4D8PA 1X5FA 3HKFA 5IHBA 3BAEH 2AEIT 4HJJL 3WMSA 1OAYL 4J3OC 4WI3A 4C56A 2GUOA 4P2QE 3EYVA 2BC4B 4ZUTA 1YNLH 4OF6A 4XVJL 3R06A 3UP1A 4OUUB 5CZKA 4P2QD 4QCIB 3E8UL 3F12B 4ZNEE 4JB9H 3RWGB 3SBWC 4KRPB 1UM6H 2X41A 4DGYH 3CCHA 2P8LB 1EAPB 1KTDB 4OGAD 3S88H 3VGHA 4N8PA 3ILPB 4KDWA 4TSBH 3LV3A 4FFVC 4KRNA 4Z0XB 1FIGL 4D8PB 5EN2A 4X4XA 5JIKA 2Z4QA 4C56B 2GUOB 4RBPK 3EYVB 1KEGL 4ZUTB 4RISH 3PWLA 4KRLB 4RMTA 3R06B 1F3RB 2AJUH 5F6HI 1DCLA 4IEFB 5FYLE 4GKSA 5CD5C 2HJKA 1J1OL 4TOYL 3QAZB 5H35A 2HKHH 3CCHB 4L8DA 2CMRL 2BERA 1FAKT 5FYLD 5F9OH 2DS4A 3BFOA 4BUGA 4K7PL 3LV3B 1V7MH 4NM4H 1SBSH 2HH0H 1IKFH 5KJRL 5EN2B 4X4XB 3FN9A 1JRHH 1JUFA 2Z4QB 2BNQA 3GM0A 4MAYC 3PWLB 5L88L 3SGKC 1KCVH 2VWEC 2VLKE 3GMRA 4M5YL 4ZFOL 4KUCF 4GKSB 4LVOB 4JFDA 2HJKB 1DFBL 2A83A 1AR1D 3FO2A 3OB8A 5FFLA 5H35B 1U2CA 2VLKD 4YPGA 3CMOH 4YZFF 5T5FH 4L8DB 4DUXA 3AU1A 1TPXC 4KKNA 2PO6A 4N1CA 2D7PA 5EU5A 4YQXL 3ZDXF 1EMTL 2AEQH 1JNNL 1MWAA 1JUFB 2BNQB 1QA9A 5EZIL 2HFGH 1U2HA 5D72L 2H1PH 4LHJB 3ZDZE 4OV6F 3GMRB 3HMXA 4EUPH 5CLTA 5DZLA 4JFDB 4LAQL 3FO2B 2A83B 4FABH 5AYUL 4YPGB 3SJVA 1UH2A 3GI8L 2KZWA 3L3HA 3AU1B 3PWJA 4KUCD 3QDJA 4ONFH 3NFSH 5TDOA 2PO6B 1S7VA 5EU5B 4FQJH 4X4ME 4YXLH 3GSUA 4KZEH 5DHXB 2ARWA 3HLAA 1MWAB 1DDHA 1AIFA 1QA9B 3JZ7A 3O6LH 3VFMA 3SBWA 1T7ZA 3F8UB 4JQVC 1MCEA 4GKZA 3D3VE 1PG7X 4OCMC 3MGTA 3JWOL 3SJVB 4HV8A 5HYIA 3D3VD 3L3HB 5D7JC 3PWJB 3LS5L 3Q2CA 3KYAA 3QDJB 3LKOA 4OM1H 1U9KA 5TDOB 4D9LH 1GHFH 1S7VB 4MAUH 2RR3A 5DD5H 3GSUB 5DO2D 2IWGA 3TBYA 3LAFA 3HLAB 4ODHH 2VDMH 1DDHB 1AIFB 3VFMB 3FL7A 4GKZB 3QA3A 3CVHA 2FR4A 3MGTB 5C07A 4HV8B 3DARA 5F7WC 3L1OH 3SO3C 3LKOB 1Q72H 4BUHA 3N85H 3UPAA 3DETD 3TBYB 3SGKA 3THMH 2I9TA 4HUWA 4KUZL 1ZHNA 5KSAC 5DK2A 4XP9H 4ZPVA 4Z7VF 4JG1H 5EBWA 3NCCB 3O9WA 4JY5L 4Y4FC 1YEGH 3QA3B 1AGFA 2RIKA 5F9AC 3CVHB 3OX8A 3B2VH 2LTQC 2FR4B 1AFVL 3BKCL 4RIRA 3CFCH 1NGPH 4P4KC 5C07B 3RVXD 1X5LA 3BMWA 2GQHA 5GJSH 4ODVL 1TCRA 5AZEH 1CZ8H 2R56H 1MEXL 1EJOH 1D6EA 3IFLL 2CKBA 4OLXL 4WWID 5F96H 4HUWB 2I9TB 1ZHNB 1DQDL 2X4PA 5DK2B 5JHDA 1KC5L 4ZPVB 5EBWB 3O9WB 2F58L 4L9LA 3EYSL 1DQLL 2A77L 4QXUL 3VXRA 2EDNA 4MWFA 1AGFB 5GQBA 3OX8B 5ESAA 4RIRB 1TPXB 1BIHA 2C3WA 3EYUH 2GY7B 1FVDA 1QPPA 3DECA 3B9AA 3VWKA 2VQTA 4WIQA 4K3EL 1TCRB 4KV5E 3TPKA 5FGCB 2JF1A 4O02L 25C8L 2AXFA 1D6EB 1NEZA 2CKBB 4GW4A 2X4PB 5JHDB 2O5XH 4ODWA 4L9LB 2VH5L 1EDQA 1R24A 3VXRB 1U91A 4MWFB 5D7JA 3U30B 1MCWW 2I9LA 5JIHA 5JQ6L 1ZTXL 4MJIA 4HGMA 5ESAB 1NUDA 2APTA 2YA1A 4XCYA 4AM0A 3PNWA 1FVDB 4OF7A 3VWKB 1T7VA 5F8QC 2CSPA 4WI6A 4MB5A 5HI3C 4PJ7F 1SQ2N 3QFJE 4JHBA 2AXFB 1NEZB 3ECBA 4GW4B 5TE7L 3ARWA 2AABH 5CEZH 4WEMB 1UWXH 3SDXF 4ODWB 1R24B 1U91B 4XNZC 1ZLSL 5D7JB 5I73C 1KIPA 3PQYE 3RKPA 2I9LB 4MJIB 5HDOA 4QWWC 1EIBA 4AM0B 2ZG2A 4XCYB 3GHBL 3PNWB 1UWGH 3PQYD 4KI1A 3SDDC 2P49B 5AEAA 3VXUD 2A0LC 2EDOA 5DZOA 1ZA3A 3CLEH 3WJJA 5E4IA 5KSAA 4TSAL 1BOYA 3FN3A 4XB7A 5ID0A 3LKRA 3S35H 1K4DA 4AIXA 3ECBB 4X8XA 2J88H 1IFHL 4YHML 4JFXA 1PQZA 4Y4FA 1X5AA 3ILQC 3U0TA 4MNGA 4RA0C 4WUUD 3ZKSD 1KIPB 1UADC 4XMLL 5BVPL 1IJ9A 3V8OA 1KN4H 3U7WL 3CUPA 3WIHA 5HTSA 4OV5A 3BKJL 1ZA3B 1JHTA 4O2EA 4DAGL 1MCOL 5LBSH 2Y7QA 4JREC 3CZFA 5KSAB 2MQ0A 1J1PH 2QQLL 4XXCC 2A9NL 5HBBA 5ID0B 3GJEA 1FNFA 3LKRB 2GYSA 4L9DA 1K4DB 5ITFA 4BZ1L 4JFXB 1PQZB 3IRPX 4U4BA 4Y4FB 2W1NA 2IALA 4Y4KC 3MUY1 2LTQB 1TJHL 2IF7A 3U0TB 4MNGB 4XP5H 3MR9A 2AW2A 4KU1A 4XP4L 1QSVA 4KKBC 2ZPKH 3VRLE 3C6LD 2ED7A 1UWXK 4LLAA 4U1LA 5F7DA 4HWUA 4WRLA 3CUPB 1F4WH 4OV5B 1YQVL 1HNFA 1WTGT 1JHTB 4O2EB 1I7ZA 2Y7QB 3CZFB 2NZIA 3OKEA 4WW1A 5KSBA 4JFFA 3TWCH 3GJEB 5ITFB 1EZVX 3IRZA 2IALB 4YGAB 4NZRH 1MRFL 4L8BA 1JYXA 3CX2A 1UKTA 1XT5A 1X5XA 3MR9B 3SO5A 2EXWC 4I0PA 4OKDA 4U1LB 5F7DB 2EDEA 4OD1L 3B2UC 3AUVA 2DLFL 1UC6A 2G5RA 1I7ZB 4JM2D 3OKEB 4WW1B 5KSBB 4JFFB 5TQ0H 2BXYA 4YK4C 1XGYL 3G9AB 4EDXA 3QUXC 1WVZA 4UOW1 3KYKH 4G6MH 1HCVA 1EPFA 4L8BB 2XYCA 3LH2L 4OLVH 3WL9A 2CJUL 2OL3A 1FL6A 3EGSA 1QFWI 4HZAA 3DXAE 3H9SE 1A7NL 2J7LA 2ICEA 2AEPH 3DYMA 1OM3L 5C3TA 2MCPL 4I0PB 5EU7C 1JGEA 3DXAD 3H9SD 2R4RL 4OZGF 3O6FC 3V6BR 2M1KA 1FIEA 2EDQA 3KPSA 4LCCA 1ZSDA 4X7SH 1VDGA 5BS0A 2ICWI 5E6ZA 4EDXB 4M8VA 1DLFL 4XNZB 5DF0A 4FRWA 3BZ4A 5T3ZL 3WL9B 2ATKA 2OL3B 1FL6B 3EGSB 3OG4B 2Z8VC 4P9HL 4QHMA 1SBBA 3GK8H 3WIIL 2ICEB 1EHXA 3TNMA 4I1NB 4KRMB 2C3GA 2IBBA 4GXUM 2A6IA 5E8OA 1JGEB 4XXCA 3AROA 1G9MH 1OWWA 3WNMA 1T83C 4OCWH 3KPSB 4LCCB 1ZSDB 5KVDH 3B4NA 4UIKH 4Z95H 1Z0MA 2YA2A 2ZCKL 5IT2H 3P4LA 3QCVL 5BS0B 3VFPA 3M45A 5FOBA 5SWZE 5EBLA 4YXKL 2I27N 5B22A 4DW2L 2A9MH 4JRYE 4U2ZA 2VN4A 3BZ4B 2ATKB 2NY1D 5SWZD 4PLKD 3PP4L 3TT3H 5F1NA 3K8KA 4JRYD 4QHMB 3TNMB 3QO0A 4NKOA 3RZCA 2A6IB 4JREB 5E8OB 4MDJA 4JKPH 3DX9A 2DQFA 4ETYA 1X9QA 1P7QA 2W07A 2Y72A 5E2VL 1PBYA 3C08L 1I85C 3AVEA 1MCPH 3PGFH 3VXMD 4JKKA 1GH7A 2FEDC 3VFPB 5FOBB 1NPUA 5EBLB 4F33A 2YMXL 2HTLD 4HUVA 5D7IE 1C5DA 1NGYA 5F1NB 1A7QH 5SV4A 2ZSVA 1WCQA 3QULA 3FMGH 3QO0B 4NKOB 4OFYD 3RZCB 4OGXL 5F3BA 1V7NH 4MDJB 2Z0BA 4K9EL 3DX9B 2DQFB 1A6UH 1P7QB 5EO9A 2VDLL 1JVKA 3QUXA 5E99H 2EDTA 1IM3A 3FB6A 1JP5A 1GXEA 5FYKU 1ZVSA 2IQ9L 2K9UA 1OB1A 4Z7UA 4F33B 4HWBA 4QHLA 1MY5A 2FYYA 1QR4A 4HUVB 4DFIA 1AXSA 1C5DB 1NGYB 2ZSVB 3QULB 3O6FA 3I75A 4H25A 2MSPA 2J3SA 4HMDA 1ACZA 5F3BB 2NY7L 3QRFM 1TZIA 1MVUA 1RUQH 5EO9B 3BKMH 4A6YL 3QUXB 1IM3B 4Z7NE 1T7WA 3FB6B 4BH7A 3K4DA 5KAQG 1L9NA 1PLGH 2DKMA 4YDIL 2DN7A 1ZVSB 4Z7UB 4UT9L 1OB1B 4GT7A 5EIVA 1W0VA 4QHLB 4B53A 2FYYB 2FX9L 5GHWL 4HXAH 1AXSB 1ORSA 1FDLH 1T1YA 1EGJH 1REIA 3O6FB 4V2BA 1BD2A 3I75B 4H25B 3BYTA 1LNUA 1TZIB 4GRMA 4L1DA 1MVUB 4AIOA 3I84A 3ZKMC 3T04D 2AJSL 5T5NG 2J8OA 1CD1A 2IPUG 3A67H 4P5TA 2P5EA 1Q94A 4HPYL 1AKJD 4OQ1A 3O3AA 4BH7B 1C12A 3P77A 1W0VB 3BPCA 2Y9RT 4AEIL 1ORSB 5DR5L 2XI9A 1T1YB 2BOCA 4YHKH 1BD2B 5CWSA 3ZTJH 4F58L 2BSED 5HHOA 5FM4A 1IEAA 1I85A 1LNUB 4GRMB 5GZNC 5FUZL 5ABDE 1CD1B 4P5TB 2P5EB 4ZTOL 1Q94B 2VISA 1CN4A 3O3AB 4S1DC 4G42A 1C12B 3P77B 2VKXA 3VXNA 3V95A 1AO7A 4L3EA 3BPCB 3U4BH 1A6PA 2NTSP 4TSCL 4ELMA 5I1KH 1TCMA 2BOCB 4WWKC 4LDEB 1P84K 1J87A 5CWSB 4GRWB 3W39A 4AEEA 1I3UA 5E1AA 5HHOB 1IILE 1IEAB 2P42B 3FOMA 4MJ2A 1YEKL 5I9QB 2IEPA 3RKDD 2IPTL 1FLRH 3RAJH 3QP3A 3WKNA 2VISB 5D7LE 3ARBD 1MJUH 4G42B 5D1QD 3TN0C 3NCJH 1ZGLM 3VXNB 5D7LD 3S8WA 3DO7A 3HC3H 1AO7B 3VA6A 5JXEC 4L3EB 2HKFH 1NDMA 2XNAA 2O5YL 4ELMB 3U4AA 2J6EA 4JDTL 4U7KA 1BHGA 2DMBA 4RSVA 4YEEA 4U7MA 3W39B 5E1AB 4B50A 2XTJC 3FOMB 3ZHKA 1I9JH 3UYRL 5FCUL 3QHZL 4NM8L 4QRSA 4K07A 4IRJA 2AGJL 4FQCH 1UFUA 5E2JA 1S7SA 3ET9F 4LNRA 3DO7B 1AXIB 2IG2H 5IVXE 1J0ZA 1NDMB 2XNAB 3RUGE 4NUGH 3P73A 4GG6A 4I3RL 5T1LA 1BQSA 5D8JH 1RJCA 4XCFL 5LGHH 1U6AH 1ZA6A 5I1CH 4QRSB 1EEYA 4OZHF 2ERJC 4OCRH 1OTTD 4JR9L 4FZ8H 4IRJB 1LVEA 1YEIL 1S7SB 3ZE0E 3GRWH 2Z9TA 4LNRB 4H0GA 1FSKB 4ERSH 2NY3D 1QBAA 1K9TA 2HRPH 1F4YH 1MHCA 3P73B 4ODSH 3P40A 3QI9A 1I8MA 4G7VL 4GG6B 1ZLWH 3O6MH 5T1LB 4U6VL 4LGPB 5EOQL 4X99A 1CGSL 1ZA6B 4N0YH 1EEYB 4NC0B 4HW6A 4DOHB 4UBDC 2P7TA 4LKCA 2X9YA 1T03H 4QRRA 3NAAL 4Y7MA 3RJQB 1YPZE 3RX5A 4J3TA 4EI5C 3IDUA 4X9BA 4JY6A 1DQQA 3FRUA 4FG6D 1MHCB 3MRJA 4MXQC 2OLDA 3D9AH 2VR5A 1RAMA 3QI9B 1I8MB 4M6NH 3MRCA 3GO1H 5T1KA 5HDQH 5EA0H 1I3GL 2BVYA 4S1RL 4X4YA 3GBLA 1NUNB 4X99B 4ZS6D 2YPVH 3EBAA 4POYA 1NUFA 2AJVL 3JV0A 1F6AA 2AKRA 5JXEA 4JRXE 4OSUH 2E7CA 2P7TB 4LKCB 1U0QA 1JZ7A 4BQ9A 4QRRB 4XH2A 4JRXD 5HI5C 2V5TA 4JY6B 4L4VE 1DQQB 3FRUB 3T0XA 5IF0A 3MRJB 3ZE1E 5F89A 4HEPG 4L4VD 3MRCB 1DANU 4Y19E 5T1KB 3WXWL 1UJ3C 1BM3L 4X4YB 4PJDA 5LCVH 4Y2DC 2DBJA 4Y19D 2FEEL 1KLFA 3LHPH 3CZJA 1ZLWK 1NCNA 5GGVH 1F6AB 1QOKA 2AKRB 1IC7L 2Q76A 4ZS7L 4DTGH 5GS1C 4XH2B 5IGXH 4JQIL 4RA3A 1NC2A 1OCWH 4X5WA 3UBXG 5IF0B 1NGZA 4ORGA 5F89B 1Z3GL 4YDLB 3BSZL 4HQQL 5DHYA 4KROB 4N0FA 1KCUL 2EZ0C 4X6DA 5J0BA 3G6JA 2YZ8A 3ZTNL 3OZ9L 4C83A 1DBBL 4PJDB 3H7BA 4NCC2 4M9PA 1DQMH 3UJIH 1ZHLA 2Q76B 4U1GC 2KDGA 1WFTA 5A2JH 1OGAA 3NACH 1MJ8H 4LCIH 1NC2B 3O8XD 4X5WB 1KFAH 5C0CE 1CLOL 3OJMB 1AR2A 4XWGL 3IDXL 1NGZB 3BE1H 4NJAL 4HPOH 4MXWH 4ORGB 3HC4H 5DHYB 4N0FB 5C0CD 3AC0A 4QY8A 3MBXH 3LEYL 4JY4A 4X6DB 5EWIL 3G6JB 1E6JH 4C83B 3FQTA 5ENWA 1INDL 2CH8A 3H7BB 4PB9L 4WO4C 3LN5A 3LMJH 2D3VA 2NXZC 4ZFFA 2IBZY 1ZHLB 43C9A 2AQ1A 1EO7A 5DSCA 2JELL 2OZ4H 2EIZA 2DYPA 4JKWA 1HZHH 1OGAB 5C0NC 4W4OC 4LASH 3KS0H 3ARFD 3ARXA 1OD7A 1C5BH 5GIRA 1GC1L 3T4YA 4TULH 4I77L 4XBEL 4QY8B 2DQUH 3FKUS 4JY4B 4BZ2H 4LVNB 3FQTB 2XTLA 3OAZH 5ENWB 2GW5A 4RDQG 5EOCH 1KV3A 3QUYD 3LN5B 5K93A 5IUSA 1G6RH 2OR7A 2ZKHL 3L3JA 2Q3AA 5GRXG 1OW0C 4CN6A 4ZFFB 3PWVA 2BDNH 43C9B 5DSCB 1V3KA 1A3QA 3MREA 2EIZB 2DYPB 3S96A 5JXAH 2NZ9C 4XX1E 1EAJA 5F70A 4Q7DA 5H2BA 1UJ3A 4JFEE 4FHBD 3WS3A 1S7TA 4FNLL 1KYOK 1UB6A 5GIRB 3T4YB 1U8LA 1PSKL 1MWAL 4KPHH 1TTUA 4L5FH 4JFED 1R0AH 1WZKA 1JI2A 1XEDA 1Y6MR 3HTLX 4NRZA 4KWUA 3HMXL 5GS1A 2FJFA 3MBEA 3VJ6A 1UVQA 3L3JB 5INDA 1MELA 1MJ7L 3PWVB 1WJ3A 1B2WL 4CNIA 2EDLA 1CXIA 3MREB 4K8RL 4WVRA 3ARYA 3PGCA 3S96B 1C5CH 3ARVA 5HHVH 5H2BB 4LU5L 1UJ3B 2BSRA 3WS3B 1S7TB 2R1WA 2R4SH 4FQLL 1UB6B 2X9XA 3RNKA 5IFAH 1DL7H 1U8LB 3MLRH 2VOTA 1CE1H 3MA9H 1NCAH 3FFCA 1RIUL 3QIWC 4KXZH 4C55A 4NRZB 2KPNA 4Z7OE 1URLA 2FB4H 1NMBL 2DQJH 1WBYA 1KN2H 2FL5A 5GS1B 2FJFB 3MBEB 3VJ6B 1UVQB 4R90L 4JO1L 1K85A 5INDB 2CGRH 4CNIB 3OAZK 3IFNH 3X17A 3EOBA 1W0WB 3PGCB 3KS0J 4TTGA 3SDCD 5C0AA 4PJFA 3MOAL 1I1FA 2BSRB 1MVFA 2R1WB 3RNKB 3FFCB 4H88L 5E9DE 4JGUA 5GZOC 4Z8FL 5CEXA 1WBYB 2FL5B 5E9DD 1JYWA 3CVHL 2E7HA 3T2PA 3MLWL 1ZANL 2Z93A 5TQ2H 3EOBB 3FQXA 4QKXB 4YBHA 3T2OA 2BHUA 1A5FL 5C0AB 4PJFB 3MJ6A 3KPTA 5FGSA 1YC7A 2W0KA 1I1FB 5I19H 1F58L 2F5AL 3BPOB 5IP4A 5I15H 3F58L 5KOVC 4EDWL 3F65A 4O2CA 5D1XC 2CUMA 3LEVH 3PV6A 3CFDA 1YYLH 4AY0A 2BNRA 2YXMA 5CEXB 1TETH 1Z5LA 1FORH 3OAYK 2MPAH 5C9KA 3K4ZA 2Z93B 2GAZA 3ALPA 2Z31D 3FQXB 3PP3H 3B43A 2YUWA 2XKNA 1WC7A 1BQHG 4J7RA 4NZTL 3O41A 1HILA 1LO2L 5FKPA 1T5XA 3TT1L 5D2LF 4ZPTA 2CKBL 2CLVA 5GGQL 4O2CB 5CJQH 1PKQE 4NFCA 3PV6B 3CFDB 2BNRB 4IRSC 3VW3L 2WQRA 2FLRT 4OLZL 12E8H 5SWSE 1Z5LB 1JHLH 4JG0L 1F3DH 4TPRL 3HZYA 1JPTL 4U1MA 2VLME 5D93C 5SWSD 2GAZB 1Q38A 3KJ4C 3EDEA 3HC0A 2XKNB 3OKKA 2VLMD 1WC7B 1OSPH 1Q0YL 3CJJA 3O41B 3TCLA 1HILB 3QPXL 1BEYH 1K6QH 5FKPB 1T5XB 4I0KA 4BFBD 3JSSA 5LGKA 4ZPTB 2CLVB 3CK0L 3UTSE 5DJDA 3ZSTA 3RVUC 2OK0H 3O2DH 3BPLB 1WZMA 1I9RL 5GGTA 3RTQC 4NSKA 1I9IL 3S6CA 2L7JA 1RZ7L 2Y6SD 3HZYB 1XGRA 4U1MB 1VFOA 3G9VA 3BOVA 5IWLC 1FIGH 5HYFA 3HC0B 4LLMA 1OQXA 3OKKB 3OGOE 4JFZH 3TCLB 3ZKXC 5HGBA 2X6MA 1VPOL 2W9EL 3PP3K 2W9DH 3SGDH 5BV7C 4UT7H 5LWYL 5DMIL 5DJDB 3GKWL 4UNVA 5KSBF 5J11C 4NSKB 1KJ3H 3DWTA 1XGRB 2ZOKA 1CXFA 5JW3H 3P4NA 4OCSH 3H9ZA 5LJYH 4LLMB 3BZEA 1AP2A 2QADD 2GTWA 2WM0A 1ZT4A 4U49A 5HGBB 4WU5A 2CXGA 1QRKA 1R3IH 5CINL 1MIEL 1MF2L 1XR9A 3DSFH 5JPNA 4R8WH 3V0AC 1S9WA 3UDWC 3IVKA 1LO3H 3L3KA 2H2SC 1CU4L 2ZOKB 3F7VA 1DBMH 2DI8A 3P4NB 4UV7L 4NPYA 2E9IA 3FJTA 3BZEB 3ZE2F 1AP2B 4PJGE 2GTWB 1T0MA 3ZL4L 5D6DA 1R5VA 1ZT4B 3GSOA 5EZIH 2WUCH 4FQXA 4WU5B 3G08A 1HNGA 3PF2A 3WJLC 4HS6A 4P2RE 1XR9B 3FAXA 5JPNB 3BZFA 1S9WB 3GI8H 1BZQK 4P2RD 3IVKB 4XC1H 3L3KB 2X44D 3BP4A 4HKBA 5ACZA 3F7VB 4AZ8A 3O4OB 5C0RH 4R4FH 4NPYB 4H1LG 2C7UA 2IGFL 5I2IA 1T0MB 4JHAL 1W72H 5IQ9A 5FOJA 1F5WA 4PGBA 1R5VB 1VFMA 3GSOB 4FQXB 3T0DA 3LIZL 3G08B 4GMSH 1EV2E 1MJJA 4GQ9H 3C5ZC 5EULV 3UYPA 3K74B 4HS6B 3F7YA 5EUOF 4ZMAT 1CLZH 3KLSA 3BZFB 5GRVK 4DGVL 3KJ4B 3AM8C 3BP4B 4HKBB 5ACZB 2VLJA 4U1NA 2V6HA 2ADGA 1IGCH 5IB5A 4RMUA 3MJ9H 3V4UL 5D5MF 4M5ZL 2C7UB 4C54A 4G6FB 3QUML 4U05A 3RNQA 5I2IB 3KPRA 4LSPL 5IQ9B 4PGBB 4PJEA 1IL1A 4YHZL 4P3DA 4PJ9A 3G6AA 5GS2H 1MJJB 1DQJA 3F7YB 5GS2D 4CDGC 5IV2A 1T2QL 2XFXA 4ZUSA 2WQ8A 2OL3L 4OZFG 2EIDA 3INUH 4RX4D 3UO1H 4LSSL 4PJBF 2VLJB 1EH9A 4U1NB 1Y0LA 2ADGB 3GSXA 3U7AA 5IB5B 3ZKXB 4ODBD 1BECA 1FNSH 3RNQB 3UAJD 3KPRB 4PJEB 1IL1B 4CVWA 4NKQB 4JY5H 4P3DB 4PJ9B 3G6AB 5CSZA 1DQJB 4E41E 3U36A 4HH9A 4XAWH 4MQ7A 1Y6KR 4G9DA 5IV2B 2NY0C 2XFXB 3BKCH 4PS4L 4ZUSB 2OR9H 3ARDD 4E41D 4NC1E 3CFBA 3QQ3A 2BNUA 2CUIA 1Y0LB 5GRZA 3GSXB 2ZUUA 4JO2H 4OB5L 5IMMA 2QBWA 5ISZE 4R0LC 4QTIH 1EEZA 3WJLA 5F6HJ 3O4LE 5DVOA 5J13C 6CGTA 4NHCH 5ISZD 2OTPA 5SX5H 5CSZB 3O4LD 4P46C 1HXYA 2VDNH 3U36B 4HH9B 3ZYZA 4MQ7B 1D9KA 2VQUA 4G9DB 4HGWA 4ALAL 4BQCA 3WLWD 1ITBB 3VG9C 2ZG3A 3CFBB 3NVQA 3QQ3B 2Q8BH 2BNUB 2P5WA 4GMTL 1B4JH 3F7QA 4KQ4H 5D1ZD 1TVHA 5IMMB 2G75A 3RP1A 1RUML 1EEZB 2DLIA 2EC9U 1CDHA 3C5ZA 3VFGH 3QXUA 1KCKA 1ZOXA 3P30H 1HXYB 3AM8A 1D9KB 4NBZB 1WITA 4HGWB 5F72S 3C8DA 5D2NC 2EKJA 1WAAA 1IZKA 2NY2D 1HYSD 2P5WB 1N64H 4YC2C 1TVHB 2G75B 1JZ2A 5A2KH 3D69A 4MNHA 1RU9L 1HDMA 3H3BC 4NQDA 3C5ZB 3OQ3B 1JGVH 5IBTL 4GRWF 4H8WC 1KTKE 2CIIA 5KS9A 3A6CL 4HWBL 4PY8I 2BRRH 3D25A 1VGEH 2EO1A 1KPUA 1QSEE 3KPPA 5SX5K 3DX6A 4RFOL 3QT2A 1QSED 1M71A 1QBLH 1H5BA 4UILH 5K9KA 2B4CC 3D69B 4MNHB 1A6WH 4ELMF 4YHMH 3FONA 1HDMB 3D85A 3GBNL 4NQDB 3QCUH 3MC0A 5K9JL 1L7IH 5E2WH 3AGVA 2CIIB 3BEVA 5KS9B 1TVBA 4Z78A 1RK0A 4A2LA 5IJVA 1AD0A 3D25B 3QCTH 1KPUB 1I8LA 3HAEA 3KPPB 1DQTA 3DX6B 3OKNA 5C08E 1G7JA 3QDMA 1S7XA 5ITBL 4XMPL 1M71B 5C08D 1H5BB 3KXFE 5K9KB 4M7ZC 3IDMA 1M4KA 2EE2A 4K3DH 3FONB 3D85B 4P46A 2Z92A 4NNPL 5F1IA 4F7TA 1IT9H 4OIIL 3QRGL 4Q74A 1CFQA 2AJXL 3BEVB 3RGVD 1TVBB 4XVTL 4Z78B 1RK0B 1M7IA 2BHZA 4U3HA 5IJVB 1AD0B 4JKLA 4C57C 1Q8MA 4HAFA 2H8PA 3HAEB 4WFHE 3OKNB 4NQEA 1RIVH 1G7JB 3QDMB 1S7XB 1J0YA 3W2DH 2B2XH 3QIUA 4WFHD 1YMHA 3MLUH 2FATL 4N0UE 5GISH 2R2BA 3IDMB 3VMPA 5CKAA 4PBXA 3JWDC 4P46B 2Z92B 3ZYJA 5F1IB 4FQHA 4F7TB 2VLRA 1CFQB 4ZO7A 2P24A 3VG9B 1M7IB 4F9LC 3HPJA 1WF5A 3QHFH 3MACH 1S78C 5JOPD 2H8PB 2QQQA 4H0IA 4X7FC 1KB9K 3L3OA 1TQBC 5DLMH 4NQEB 1TFHA 3K46A 3WO4C 3C09B 2NXYB 3QIUB 2UWEA 1YMHB 3VU2A 1FC1A 2FD6H 2BVEA 2R2BB 1XGYH 2BVPA 4S1QL 1RK1A 4FQHB 2H32A 1KENH 3RIAK 2VLRB 3BEWA 3NH7L 3OXSA 4XNXL 1JIBA 2P24B 3GIZH 3HPJB 2QHLA 5CEYA 1CL7L 3D0VA 2R0KH 5DJZA 5I1EL 3L3OB 4LKXA 2J6EL 2E6QA 5DK3A 3GMPA 3IAPA 3PABA 2UWEB 4G8FA 4LVHC 4M02A 5FO8A 2UZIH 4GRLA 4L3CA 1NFDE 2BVPB 4QNPF 1HCFX 4YFEA 2C1OA 3W0WE 5T3ZE 1RK1B 2AP2A 2H32B 5ECJE 3I9GH 3BEWB 1JNJA 3OXSB 1MFNA 4HUUA 3W0WD 5T3ZD 5CEYB 1XGUA 5D7SL 3D0VB 5DJZB 4AEHH 2PXYD 4LKXB 3G5XA 2NX5E 1BBJA 3GMPB 3PABB 4G8FB 1V3LA 5TH2A 3D2UA 5FO8B 2NX5D 4GRLB 3QCVH 1WWAX 4L3CB 5I74B 3T09A 2VZSA 3MXWH 5HPOA 3GI9H 3GEWB 2C1OB 2JJTA 4DW2H 4L3AA 3B9KC 4XHJD 2FO1A 4Q9QL 3CMGA 1VSCA 4G6KL 1WK0A 3EIFA 5IG7A 3EHBC 3HE7C 4HUUB 3IGAA 5DMGD 3PIQA 4PJDF 4EZMA 1XGUB 4M4RA 3VD4A 2DQIH 4LSTL 3MXVL 4G7YL 5BO1H 1ZS8A 1JNLL 1KELL 1KBGL 2J8UA 2GIYA 3G5XB 4M7ZB 1BBJB 4PJIA 3SCMC 3T3PE 5GGVY 5FYJE 1XF1A 3WNNA 5EIQA 3C08H 5TH2B 5SX4H 1FZOA 1RZJC 2ORBH 3D2UB 4RGNB 1ZGLP 4DZBA 5FYJH 4P9ML 2QSVA 5FYJD 1LE5A 3TO4A 2NR6D 5F1KC 1BQLL 1XCTA 4JPWL 5IG7B 5DFVC 1RUKL 1Z6JT 4BFEA 4EI6A 3IGAB 3G6JF 4HKZA 3PIQB 1WBXA 5IVZA 4WTZG 1EO8L 4E42A 1DJSA 1ZS8B 4Y16C 4OGXH 1NAMH 2D31A 2J8UB 3VH8A 1BJ1H 2QJDA 2F8XC 5F7MC 4PJIB 5DRXA 3FQWA 4R7NA 4X0KA 1FZOB 3E1F1 4DZBB 1QP1A 5CBAA 1LE5B 3O3DA 3DV4A 2AXHA 4X8JA 3TO4B 3IDGA 1IC5H 1XCTB 2ZUQB 4XB8A 5F93C 2RAMA 1A7RH 1H8SA 4EI6B 2E7MA 1TQBB 3HNSL 4HKZB 3SE8L 1R5IA 1WBXB 5IVZB 3WD5L 4D3CL 3I2CH 4JPKH 4L4TE 4E42B 2J5LC 4F8TA 2DTML 2NY7H 2NY4B 4M48H 1HXMA 2D31B 3VH8B 3E0GA 1QFWL 2XG5A 4L4TD 5E56A 3WFEH 3FCTA 5ICYA 5DRXB 3HNTH 4A6YH 3FQWB 4R7NB 4U7SA 4M62H 4X0KB 5DEFA 4UUJA 1MIML 3V5KA 5CBAB 4QRTA 3O3DB 3DV4B 3DMMA 2HT4D 2NYYD 3OV6A 4X8JB 3NCYS 3IDGB 1OAUL 3C8HA 1NFKA 5E6ID 5C0EA 1R5IB 2Q86A 4X9HA 1N59A 4Z9KB 2WMPA 1IGIL