4I2XB

Crystal structure of signal regulatory protein gamma (sirp-gamma) in complex with fabox117
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
229
structure length
229
Chain Sequence
EVKLQQSGPELVKPGASVKISCKASGYSFTSYYIHWVKQRPGQGLEWIGWVFPGSGNTKYNEKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYFCARGNYDRAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGKHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of signal regulatory protein gamma (SIRP gamma) in complex with an antibody Fab fragment.
pubmed doi rcsb
molecule tags Immune system
molecule keywords FabOX117 light chain
total genus 47
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i2xB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i2xB02
4X7DC 1CDJA 4FTVE 3VW3L 1INDH 1G6RA 4JO3H 5E6YA 3FO2A 1FL5B 2DYPD 4ZUTB 3FO2B 2DDQH 2ZSVA 4LARL 4HS3B 5DEFA 2NXYD 3P11H 4B41A 5IHLB 5EUOA 2E9BA 4JN1L 1FL3B 1P9MC 2G60L 3MRFB 4JPIB 2J8OA 5CZXD 5FHBL 5F6HI 3NFNB 1T04B 1T03H 1ZSDA 2Q76B 1YEHH 5M95B 1G1YA 4G6JL 1IGIH 1CWVA 3QUXC 5IROA 5JQ6H 3GSUB 4X9IA 1SJHB 3P9MB 2X9YA 3NIGE 3PL6A 1F58L 1RY7B 2ADJB 2BSTA 4PLKC 5C0FB 2X05A 3OPZL 2DQJL 4RFEB 4XZUA 1DUYA 1LO3H 4Q6YA 4DGIH 1QLRA 2DBLL 1FJ1A 2DQHH 2MWCA 3O11B 4PBVC 1MCKA 3BMWA 4MA7L 2JJSA 2P5EB 4DTGL 4Z7NF 3NBNA 5GJSL 2AQ1A 4NQEB 3RDTC 1SM3L 5BZDB 2OMBA 4JDZA 4C58B 1YC8A 1U8QA 2PKDA 4XP9H 3BZFB 3MV8A 3S5LA 3QCVH 3ZDXE 3FT3A 4JFPB 4LGSB 2FO1A 2HT4D 3DXAB 2VDKL 5T3ZL 2IWGA 4WHCA 4L8DA 3MRDA 3SCMD 2W9EH 4PRAA 2KZ1B 3UYPA 2KUTA 1RK0B 5ITBL 3Q48A 3QUZB 1A1OA 4H0GA 5F1NA 4P2QD 5I18H 2E8YA 3BFOA 4WI5A 5F9JA 4HIEA 1JN6B 4ZFZA 3QUMA 2XWTA 4OI8A 5ESAB 2P5WE 2NY6D 2ARJB 4NQCD 2FIRT 3UO1L 3RZWA 4NWTH 2IJ0C 3GGWA 3RWHB 4NQCA 4IRJA 1HXMA 4HIJB 1QR1B 2X89D 3LRSA 4JO1H 5EO0B 1HXYA 2RHEA 4JY6A 3L5HA 4G6KH 1NFIA 2VLMD 5JUEH 5FYLD 4RGNC 2AEQH 3GI9H 5D7IF 5FCUH 4H1LA 5DRNA 4YDLC 3LPWA 3U7AA 2FX8L 4MA8H 2ITCA 5FA3B 5IMMB 2FX8H 1T20B 3GSWB 3GO1L 1TQBB 4PPTA 3KJ4C 1CS6A 1OPGH 4M6OL 2BVTA 4Y5YA 4X5WA 3UDWA 1RZ7H 4P9ML 1NCNA 2Q6WB 3MJ7A 1AGFB 2YD7A 4OCRH 1OGAE 3REVA 3KHQA 5DMGD 4ZOBA 1DQQA 4NOBA 2MPAH 4RNRA 2YPLB 1FC2D 2MQCA 1K9TA 5FYKD 1E28A 5LCVH 1LEIA 1AD0B 4JRYB 4MAUL 2VXSH 4DKFH 5TF1L 1K8IA 3QCUH 3D9AL 1JZ6A 2D7MA 1AY1H 2C3VB 4JDVB 3V7AG 1QR1A 1JPGB 1G9NC 1ND0B 4B5EA 2OZ4L 3GMLA 3VD5A 4OZHB 1CFTB 3LQZA 4A2MA 5B38G 3KWWA 2IGFH 1UENA 5CJQH 3H3BC 4OZIF 1NLBH 2J6EL 1OM3L 4XP9L 4OLUL 2R29H 1WAAF 3MZTA 3L3HB 5I1GH 3BYYA 4JLRA 5FAAA 1PQZB 3IJSA 3D0VA 4X0KA 3UYOD 3UJIL 3DHJA 1BJ1J 3AXLA 3EYFB 1UVQA 5E24E 2PXYD 3L3JB 4B50A 3VXSE 5CGTA 5IHUH 4OGAD 2VZSA 1VEPA 1YNTA 1Z9LA 3C5SA 3I6GB 2NTSP 4FMFA 5KSBF 3BHBB 3DX9B 3V5KB 1WIPA 2FJFB 3ULUH 4ELKB 2SEBA 1MQ8A 1O0VA 1MY5A 3VXTB 4PTUB 5IEKA 1IC7L 3DMMB 1MLBA 8FABA 4L5FL 1T21A 1MCEA 1U3YA 5F1NB 3S88H 4FOMA 4MNQE 5F9OL 2G9HB 4K7PY 4QRPD 3UPAA 5BS0B 5I1JH 1C16A 4Y2DA 5DDHB 1FFOB 4C55A 1AQKL 5JORB 3ZDZE 1QQDA 4X7FC 2Y23A 1ZS8A 2V5TA 3LKQA 4YH6A 4QXUH 3WUZA 4RWHA 4ODXB 4WTWA 5BZDA 1CQYA 5C09A 1T22A 2UY6A 3RIAK 2I24N 3RUGF 4JFQA 3LKNB 1OARH 3PWLA 3CAFA 4QTHB 4XMPL 5DFVD 3CDYA 4NUGL 4HJGB 2I60L 5F7HA 5HJ3B 4WUUE 3E2HB 3VGBA 3FN0H 4HCRH 2ZZUT 3KYKH 4LSTH 4GXUN 2LQRA 4O4YH 1IQDB 4CJ0A 1ZVYA 4MJ5A 3MNWA 2WAHA 2JJVA 3G9AB 3MLUL 4GFTB 4OCSL 5D7LA 2DI7A 3QG6B 5GISL 1HHHB 5LGKA 3IKKA 2F54D 3ARFC 3U4EB 3LDBC 3ULSA 1JTTA 1BQLH 4GH7B 4GBXB 4NO0D 3BP7A 5F6IC 2VZ3A 1WLHA 4ISVB 1CFSB 3VXUA 3SDYH 2BVOA 3CFJB 3FO9A 5EO9B 3MRKB 1LD9A 4LVHC 5D7KD 3EYUL 5D2LA 1ORSA 1BF2A 3GJFH 4M43H 4HLZG 1IC1A 1WZMA 4NZTL 5D2LB 4H1LB 4DN4H 1U8JB 1AO7D 3QIBA 4YPGB 4GG6B 2OS7A 2DBJA 4D9QE 1FGVH 1NCWH 1QR4A 3L3HA 3MLRL 1WFOA 2CD0A 1PQZA 3IJSB 1CIUA 2FL5A 5DLMH 1DL7L 3TJEH 1IBGH 4ZXBD 1S8DA 2AABL 4PJXE 1RUQH 2DKMA 2VLKE 2KKQA 1L7IL 1FV1B 2IPKA 3MNWB 5EBMA 2XFXA 3ES6A 5JDSB 1TCMA 4MJIA 2AQ3A 2X44D 4JCLA 4P5TA 4NO3A 3ZYZA 3QUYA 1XCQB 4WUUD 4MJID 5FK9A 5HHME 4X8JB 4FQCH 3ZKXB 3H9YA 3PDOB 4KDTA 4PJAE 1AGBA 5DWUL 2DJ4A 5DEZA 2BFVH 4Q6IA 5DLML 2CRYA 1L0QA 4JRXB 3S98A 2PO6C 1GIGL 4PLKD 3U30C 5EOCJ 1OP9A 4XB8A 3KJ6L 2F58H 4M48H 2CRIA 4XB7A 4UNTA 3B9KA 3VJ6A 2W1NA 3CFDB 4U0QB 3VJ6B 4I0PB 4UDUB 2AP2A 5E03A 2VZVA 5FYKH 4DQOH 4ZSOE 1A3RL 4IHOB 4X5XA 4LDOB 1S3KL 2LV4A 4M1CD 3RPIA 2I9LB 4OKVB 4KZEH 3P9WB 3O6LL 4V1DA 3U82B 2FX9H 3GSVA 1NCBL 2OXGA 1OB1A 1FZKB 2GTWA 3UTSB 3LKRA 5KVFL 3DX7B 4WIQA 3PGCB 3C5ZD 4HUNB 5DVMA 1JFQL 3WUWA 1OTUD 1SM3H 4JO4H 2LAGB 3U2SA 4XBGB 1I3UA 5F72S 2WIIB 4N9GB 1YYML 5A3ID 3S96B 2VDNL 4ESKA 1F13A 2GI7A 4RGMC 1ACYH 3SDDB 1T1XA 5CD5C 1RU9H 4YXHL 4M7KL 1SJEA 2GY7B 1QBAA 1YEIL 1MWAL 1D9KB 4J6RL 5ETUB 5C7XL 4BYHA 2MCPH 5GZNC 1BVLB 1RUPL 4FTVA 3D69A 2EXYD 3HCVA 5D70H 3D3VE 5JOPE 4N68A 4WNQA 5FM5M 3STZB 1ORSB 4R96B 3ARSA 3HFMH 1ACZA 1G9EA 4F57L 2FJHB 3SE9H 4DN3H 4HCRL 4DZBA 4GG8A 3QFJA 4G6ML 4JQVC 3BQUC 2HTLC 1CGYA 4OFPA 5IW1A 2I60H 2P24A 3GBNL 5EZOH 4P4KB 1KIRB 2DMKA 4R6UA 1HHJA 4N8CL 1YMMB 5H8DA 1YA5A 4EN3C 4IDJL 2R9HC 5IBLD 1SMAA 3V6OC 3VRIA 4UNUA 4HUUA 2LU3A 4LVNC 1DQJB 4OKDA 2DIAA 4J1UA 3UTSD 2IPUG 3QXUA 1EERB 4KY1L 1KJ2L 1P1ZB 1KPVA 3RTQC 4MX7A 3UTOA 2NY6B 3QRGL 4HWEL 4KUZH 2M2DA 3PQYB 1KXQE 4P3WA 1XGRA 5DYOA 2QHLA 4PJ5E 2X89A 1WZKA 1G9NH 4G8EA 1D5BB 4G6MH 2C7UA 1JRHH 5BS0D 5KVGH 2VDPL 2B4CC 1TETH 2DQGH 4NHCL 4YBQD 4LDEB 1G7QB 3RY5A 2ARWA 3VE0A 4JHAH 3S97C 5KOVC 5FOJA 3LKSA 1JE6A 4L8BB 4Y19B 1PEZA 4PJBA 1RQ5A 3FRPG 4P3DA 5C0JA 3ZO0A 5I2IB 4BFBD 4DOHE 2IH1B 1FO0H 3CLFL 3SCMA 1QD0A 4W70A 5IHBA 1A6VH 2AEIT 2OL3H 2APWA 1T89C 1VKXA 1ROWA 2OP4L 1WK0A 4PJIE 4MLIA 2NXZC 1KUMA 2ZUSA 3TA3A 4S1RL 4ZFOA 3BVNB 5CIPB 1DBKH 4IM8A 5KVFH 2YMXL 1RZKC 1MHCB 1FZOB 2A6IA 1EEYB 4FFWD 4X6DE 4XNQB 1I7TA 1J88A 4XNYL 4Y5YB 2N1KA 1NCBH 4EUPH 3MACH 5FOBA 3BN9C 1EGJH 1ZGLB 1BEYL 5J7CC 4R4FH 4HX1A 4OT1H 1MEXH 4OJFL 4F9LA 4ZFFA 3HUJB 2CMRH 5CEZL 3GSOA 4OV5A 2I26N 3QUMB 2VXSL 3S36X 4DKFL 4X7TA 4NKMB 4MXQC 1A6WL 1XF2A 2HJLB 2LE9A 4ZODA 3RWHA 1T80A 2O5XH 3ARDB 1BX2B 4JFFE 3UAJC 3BP5B 2VDML 2V2WA 4Z7VA 3FFCB 4HJ0D 3QJHA 4K3GA 3VGAB 4PB0H 5IV2B 3P4OB 1FLRL 3TT3L 5J4MA 4GW5B 4PJXF 2FNBA 4XP5H 1N7ML 4R2GC 3W2DL 3TYFB 4QNPE 1JGLL 4XP6H 1A6UL 1K85A 3PIQA 4Z7VE 2CRMA 2H9GA 4WFGE 3WFCH 3N85H 4Z77B 2WQRA 4L9LC 3B4NA 2AABH 4NC1C 3ZE2E 3BKCH 1QBML 5C0RL 5HHXL 1JHTB 1JPFB 4YHPB 3MLYL 1G7HB 3QG6A 3L3OB 4KV5F 1D5IH 1DDHA 4LEXH 3QUXD 3VFOB 4MZ3A 4GG6E 3MROA 3A67H 5F3BA 4HMEA 4KI5C 5DD6B 2H32H 3V0WL 4LLDA 4PG9A 2EDQA 1EAPA 1A21A 3EYUH 1LE9B 4P9HH 2I9TB 2W9EL 3D6GA 2BCKB 2DQJH 1JGLH 4TSAL 2YD1A 4M61A 5D7JA 1EPFA 2P42B 4OZFG 1ZLWK 3P4OA 5K59E 5DS8B 3O8XA 1D5XB 4MNHA 5C0AD 3B8YA 3T0AA 1MELA 3CSYA 5F44A 3VWJB 4J8RB 3ZL4H 3OKYA 1AQDA 1F90H 4WWKB 5FYLE 1ZE3C 1HH6A 3KR3L 1HCVA 5C6PB 4QWWD 2IQ9L 1CBVL 3DYPA 3HG1E 4E5XA 3U4AA 3BDYL 2IH3A 2M26A 4OTXL 5JMRA 1YNTB 1HIML 4JFOA 3KG5A 3O3AA 4R0LC 3DROA 4HJGA 3T0DA 5DHVB 1AD0A 1F6AA 2ZSVB 3VFMB 4DGYH 5DF0A 5GS1A 4K55A 4PIRF 1F58H 4KK8C 3KPPB 1UADC 1IQWH 4FQJH 1MJ7L 1P4LA 2AJZB 2OZ4A 1ZHNA 2WZPD 1IMHC 4G8GA 4RCAA 4WVRA 5BOZG 5CMAA 1CE6B 3VFSA 4YHML 2DLTA 1A7PH 3BP4A 1DR9A 5F3HA 4Q9RH 3ISWA 2XWTB 4LRIA 1L4IA 4XVJL 4NQXA 5MENA 2EYRA 1C5DB 5ACZA 4JRWA 4NZRL 1R3IL 3GHBH 3I3BA 4NKOB 2ENYA 5DJ8A 1JGVL 1T83A 4ONGL 1BBDL 2YUXA 3LEXA 3BXNA 4ELME 1DSFL 4X5XB 5C0EA 2ICWJ 5A43C 1KXTB 5I66A 5DC4B 1R5IA 2BY2A 1A14L 4KMTL 1IC7H 4WU7A 2GUOB 3FQTA 3GMNA 4A6YB 1ZKAA 2R0WH 5IVXF 2PXYB 2P7TA 5TE6H 3VXNA 1IC4H 1JGUH 5JW5A 5IIEA 3HA0A 3D0LB 1LEKB 1X5GA 5A2JH 4YC2C 1GH7A 3F6IA 4XPHH 4F2MB 1NCTA 5BO1L 1D6VH 4X7SH 3T2NL 4L3EA 1T2QL 4Z77A 1U8OA 5KVGL 2OTPA 3L5XL 5HD8C 4AIXA 4TOYH 3QFDB 4JFFD 5D1QB 1QRND 2BK8A 2XA8L 4KQ3L 4OZGE 2IBBA 1U2CA 3LV3A 4F7EA 1JZ8A 5MP6L 2CO6B 2VZTA 3QHFH 1DCLA 4NBZB 2YC1A 3HI5L 3NAAH 1KJ2H 3BP7B 3FHQA 2DM2A 4XCFH 1A9EA 4S1SH 2LVCA 2R0WL 2J5LB 4QHLB 3MCKB 1KPUB 1I85A 1ZVSB 4XAKE 1MJ7H 5L2JA 4FS0A 2BSRA 2BMKA 3G08A 3QNZB 1BVKA 5KSAA 1WBZA 3G08B 2DKSA 1UKSA 3QIBB 4ODUA 5J11C 3DI3B 3RWCB 1SEQL 3CMGA 4ODTH 5EN2B 3QAZC 5EOTA 4RIRA 5HHOE 5L2KD 4JFHD 3HPJA 4NZUH 4JAMA 1Q9WB 1KG0A 1UB5A 1GHFH 2MKLC 3C6LC 4M9PA 1UFUA 3LQAL 5DVNA 1NDMB 3THML 4QOKB 5IVXA 1SVCP 3EJYD 4D0CA 4G9DB 4M02A 3SOBH 3WSQH 2BVQA 2V17H 4NRXA 1IQWL 3V4UH 4OCYH 4E41E 1X5LA 3HRPA 5KAQF 3WE6A 3O4LB 1MCQA 2ZPKL 4GSDH 4I2XB 3UX9B 3HMXL 3U2SB 3K3QA 1ZVHA 4ZAKB 2VE6A 3T3ME 5HHVH 3MCKA 4CBPA 4MAYC 4NO0B 4HK3N 3DHMA 2KQMA 1YPZA 4X4ZA 4HKJB 4XP1L 5IBUG 3R8BB 3LEVL 5IB2B 4LNRA 4HKJA 4F15B 3QDMD 3HZMA 4L8BA 4DVBA 4L9LA 4KK8D 1D5ZB 1S7RB 1OD7A 2GJ6A 4NC0B 2EEBA 4Q74A 4P0DA 4KAQL 2DB8A 4G6FB 2V5RA 4JPKH 4Y16A 4QXTA 2YK1H 4G5ZH 1I7UB 2R1WB 1QO3A 1Z2KA 4KZDL 1BZ9A 1Y18B 3VFRB 2BOCA 1QFWI 3QFJB 2ED7A 1NUNB 2VITB 1OAYH 5C09B 4P46B 5HGHA 3DUUA 4G9DA 3TZVB 2PYEA 1K3IA 4NRXB 5DMJB 4KFZC 3TT3H 5CP3H 5DJ6B 5I1IL 1OB1B 1H3TA 1FLRH 3VRJB 5I1CL 3WFZA 3LKRB 3RWIA 4P2OA 4HPOL 2WWMD 4DFIA 3H7LA 4RAVA 1FNFA 4ZS6D 4P2OB 3W5NA 3GM8A 1VESA 2YPLD 2BY3A 1MLBB 1KPRB 1V3KA 4Q9QL 1D7FA 5C8JB 3M1BB 1ZLVH 5BQ7A 5EZIH 4LLAA 3S36H 1AKJD 2XQBL 3O45B 1JZ3A 4G9FA 4M3JA 3K46A 2W65B 5I17A 2QKIA 3V7MA 2F5AL 1HNFA 4GKOA 2VB5A 3CFDA 3UYRL 4ODSL 3DUSB 4NFBA 5IJKC 4JEGB 1XGTA 2VDRL 2VR9A 2R1WA 1Z3GH 5JQ6L 4Z7VB 1K6QH 5TQ2L 4QHLA 2E7CA 3ZKND 3BEWA 1R3JA 3MLVH 5F6HJ 1DJSA 1P6AB 3T2OA 5FKPA 1T2XA 2VRAA 4I4WB 4Y4FB 3P4NB 3LKSB 1F3DJ 4D3CL 4NYLB 4JGUA 1ZLUH 1H3WM 1DBKL 1VADB 3WFDL 3MA9H 3TGXA 3TWCH 1QVOA 2VDLH 1REIA 1HOCA 1TZIB 3R0NA 2JF1A 3VCLB 2FR4B 1CQKA 2AJVH 4X99A 5LGJB 2PCPB 4WFHE 1YEFH 1INDL 2EDKA 1VKXB 5DD3L 1FFRA 4WGVB 2D03H 2WLZA 1HHKB 3P9LB 3PP4L 5E2JA 1ED3A 4S1SL 4ACPA 1XR8B 2W9DL 4MDJB 5D7LB 1FYTD 3V6ZB 4HK0B 1FCCA 2H45A 4QGYA 1B0WA 5ANME 1M7DB 1OAUL 2V9TA 4KK6C 3RWDA 2CDGB 2DLGA 3LZFL 4JDVA 1JNLL 1ORQA 4XXCA 4ZTPH 1T0PB 5IOPA 4LLUB 1YQVH 1S7SA 4HWBL 1LE9A 4K8RH 4LLUA 4ZQKB 1I8LC 5DFTA 3RWFA 1ZTXH 3OHXA 2P8PB 3AS0A 4Y4FA 3U1SL 2HA1A 2X4OB 2RCSH 4YXKL 5B38A 3DURB 2G2RA 4L4VE 3B9KB 4HWNA 4B7LA 4MMXC 4RFEA 4IIQA 3DGGA 4LSSH 2W0FB 3PWJA 3KLDA 1A1MB 3MLXH 2UUDH 5JR1H 1IJ9A 3OKKB 4XMLH 1BX2A 1YEEL 4MAYA 1FZJB 3V4PH 4FABL 3FQXB 4ZFGH 4I5BB 1ES0B 4YZFE 2JCCB 1VGEH 4GRLA 3D3VB 3VWKA 2ADIA 4A6YH 3QP3A 5IP4A 1IGYB 5E8DL 3JTSA 3MJGX 4ERSH 5DYOB 2AI0L 3MLTB 5LGHH 1SYVA 5J9PA 1G9NL 4R97C 4XNMA 4DZ8B 1A6TB 3N1QC 1T1WB 3SE9L 1D5BA 1SHMA 3WE6B 3ARWA 5IWLA 3OKOB 4TSBL 4MDIA 3DX6A 1S78C 3NIDF 2FLBT 3BZ4A 4BSWB 3ILPB 2E9JA 3VE0B 3K4DA 5F3HB 3BZ4B 5SV4A 5HGBA 2CGRH 3LH2L 3QCTH 4ZS7H 1D6EB 4BZ2H 3BWAB 1H9VA 4M7KH 5C0CA 3DTXB 1LE5B 1A6AA 1CXEA 3DLQR 2LTQB 1FFOA 1I9IL 3SO3C 1RUAL 4LP5A 2AK1H 1CXKA 5KBNC 3OXRB 5BV7B 4XPBL 5E7FA 5HYJB 1QTYT 1SY6H 2XI9A 1KB5A 1CD9B 4K3DH 5CILH 3UTZA 4IOIB 5HD8D 4FXGB 5JPNB 4EI5D 4MGXA 1H0DB 3WKMH 4HPOH 3D0LA 3TZVA 1MFEH 1OAZH 4J8RA 2ZJSH 5FM5O 5ILTH 3EDFA 3UMTA 3U7WL 4WCYL 4YXHH 1G84A 1I8KB 1RK0A 3VFGL 3TFKD 4R3SB 3G6AB 4LCCA 1RJZB 5T1KB 1BOGB 3C5JA 1RJZA 2DQUH 3BIKB 5IT2L 4RAUA 5F7FA 2APXA 5A2IH 3OKMA 4ZPTB 3SKJL 3MMEA 2JIXD 3GSRA 3VFTA 3RWDB 1Z0MA 1IFHL 3WDHA 5ISZB 1U92A 5JHDA 2X9XA 1FN4B 3L5IA 3O9WD 3QQ4B 4LSDA 5F7LB 3RTQA 4ZD3H 5AAWA 1N8ZB 1KULA 3EHBC 3PGDB 1NC4A 3FL7A 1ZMYA 4MZ2A 3RBGA 4X4YB 3BUTA 2XOTA 3WDIA 1YEKH 2QBWA 2YN5A 4GSDL 5IMMA 4HLJA 2HFEA 3FONB 3CFKA 5IJVA 4ODWB 3L3KB 2COQA 3TYFA 3SCMB 2WBJC 3C8KB 4BH8B 3SGJC 4NO2A 2VLRD 1CDGA 3GSQB 1JZ2A 2DTSA 1AGFA 3UC0L 4HUUB 3QWQB 3GI8H 2FJGA 4LKXA 1AGDA 3RVWD 4YPJA 3E6FA 5F1IB 3ULUD 2VDMH 2F5BH 3HR6A 4NT6A 4PJ5A 4H8WC 2UWEB 4Y4KD 1A0QH 4YHLH 3MYJA 5F88B 1CFVH 1SEQH 4ODTL 3MGAA 4YBLC 1A6WH 5DHVH 4FQCL 3O4LA 1UACL 2P49B 4G3YL 3GIVA 4HHAA 2CMRL 4RFNC 1OP5K 3RDTA 5CEZH 1UM5H 3HNVH 5MI0C 4MJ4A 3RDTB 4OJFH 3RZCB 5LBSL 2FHCA 1DVFA 5EU5A 4YXLH 3HG1A 4I18C 3V7AE 4PG2C 3NACH 1K2DA 2PTVA 4BJLA 2HKFL 3QEUA 5C0GA 2ZNXA 5FUZH 2YC1B 4X6EB 5HBBA 1WICA 1MHPL 3P0YH 4K3JL 5DJAB 4EUPA 1OF2A 1VHPA 4S1RH 5IB4A 3IDYB 4G8FB 5MP6H 4MNQB 2B7DT 3H3PH 1YQ2A 4NNPL 3UTPD 3V8OA 2GHWB 3OAYH 1VB9A 3GSQA 4D94A 1B2WL 2GJZA 3LPFA 1ZA6B 1P9MA 2BSRB 4MA1B 2XTJC 4D0DB 4XXDB 2ZUVA 1JUFA 1OD9A 2QSVA 1A64A 2X9WA 4NUGH 1U93A 3S35X 3AU1A 3JTSB 1OTTD 3QNXB 4TSCL 3T3PF 3VXMD 5CJXC 4M1DL 2FYYA 2RFXA 5I16B 1IEAA 3O8XC 4JQIH 4RGOL 5AUMA 5HHOD 4HAFA 1EXUA 4Y8DC 3Q6GL 4YIQB 2MHAA 2VQ1B 3ZDZF 2WLYA 5J6HA 3TT1H 2BOBA 5EH1A 4EI5C 3L3DA 1AQKH 4FXLA 5KTEH 1VACA 5HI4C 3VI4E 4PJBE 1ZV5A 3MMEB 2MSPA 4OCXH 4WUUA 4ODHL 4CVXB 3BH8A 3CZFA 3T65B 4PREB 4JO3L 2MTPA 2AV1B 5EFIA 2EDJA 1I3VA 3UBXA 1BFSA 3W82A 3G6JB 4ODVL 5FB8B 3LRSB 3HCVB 3TNMA 2ZG3A 2V2XA 1YJDC 2FEDC 2X4QA 1F42A 3O2VH 2JJWA 4RISL 4Z7QF 3MUJA 3MBED 4YFLF 5KN5A 2HJFB 3OJ2C 1AO7E 1NGPL 5CUSH 1T7WA 1EFXD 1DBAH 4FQIH 5EC1B 3CSYB 1GJIA 1DBBH 3G5YB 1W0VA 3WS3A 3ULVL 2VSCA 4FQPA 4PRHA 4G9FD 4F57H 3WLWC 1R3KB 4MD0B 3VXMB 5I76B 4NNPH 3VD7A 3O4OB 1GL4B 4YHNA 1TMCB 3L7EA 1NDMA 1XEDA 5C3TA 2YOCA 4JR9H 3MXWL 2Z31A 5JHDE 3HS0B 4LASL 2YSSA 4M1GH 3ARTA 4JY5H 2CKBB 3M17A 5D1QD 3QO0B 1UM4L 2JJTC 1EMTH 2X7LB 2IFFL 4K3HA 4D0BA 2DM7A 4JN2A 4QF1B 4KHXH 3OKNB 4X6FA 2YKLL 2OL3B 4R7DA 3FZUC 1ZGLP 4JO4L 1JFQH 2DS4A 4DWHA 2K7QA 2R0ZH 4PJAA 4NKIH 2NXYB 2MPAL 3QDGD 1D5ZA 1OF2B 1S7RA 3UTTD 4Z7UF 4EJ1C 3SGEH 2DQIH 3L7FA 1JHKH 3T4YA 1IAIM 2J2ZA 5L0QB 2IC2A 2IGFL 5CJQL 4Y1AB 1MHHA 1QSVA 3OBAA 1TJHH 4NBYB 1IAII 1DE4B 5EU6E 3QQNA 5CP7B 2OZ4H 2GYSA 1U93B 4IRSC 5I75B 4NC1E 1XCQA 4QHNB 2E9IA 2WIMA 5H37G 4QT5B 7FABH 1JI1A 1KEGH 1TNNA 5C0ND 5SWSA 4PV8B 4ZUWA 4F58H 2X1PA 2D9CA 3PHQB 3MLWL 4AG4H 2HVJA 3KJ6H 1PJ9A 3EZ8A 4XPTH 1G9ML 4KI5E 3RFZC 3WCYA 1CE6A 3P9LA 5DURB 1RZGB 2JB6A 1UKQA 3QIBD 4NJAL 5I74C 4H5SA 4MQSB 1R24B 1HINL 1T04A 4PGEB 1FNHA 2VLKA 3SJVE 5DK0B 3WO4C 3BZEB 1U3HA 3L3IA 5GZOC 3GO1H 5F8RC 3BOVA 1EBAA 5F1OB 3VD3A 4PP2B 1LNUA 3BRDA 1V7NL 2EDYA 4PRHD 4GS7C 5CJOL 3K1DA 3QUMH 3BYTA 3IXTA 2ICCA 1QFOA 3TJEL 4F9LC 1TVHB 3SKUD 4A6YA 4PS4L 4L1DA 3QPQD 3IETB 4XNYH 4LLYA 4FZ8H 4ENED 4TUJB 3QEGH 2P45B 3N1GC 4GAFB 1W0YT 2R69H 2XTJE 3FQWB 4C56D 3WIHH 1BFVH 2EH7H 3REWB 1YDPB 5CIPH 3KPLA 5KG9A 3O45A 3BRGC 4KI1A 1I8IB 2X70B 3RVXD 3HS0A 5FKAA 2NNAA 2VR4A 4U6YA 2ADGB 2EO1A 3QUKB 4ZO8A 5DD6A 3LB6D 3HTLX 3PHOA 1IGIL 2VSDA 3HN3A 2EYTB 1C08A 1NANI 4HS6B 1OAKH 3PQYE 1JBJA 4WI9A 3UPCA 1K3ZA 4KJQC 5CILL 2A9ML 1BAFL 2I07A 5GGQH 5GGTA 4MJ6B 1W2KT 4WV1C 1YMMA 3NCEB 2OJEB 4FZEH 4FFVD 5T3XD 1FC1A 4AIOA 1UXWA 3T4YB 1MAMH 3CU1A 1YJDL 4OZGB 3D39D 4DCQB 4GRMA 4KY1H 5DFWH 1NQBA 3FQXA 2QR0B 2YPLE 3NCFB 4POUB 4LSRH 5JPNA 2DLFL 4P46A 3WS6A 3BW9A 5KSBA 4QKXB 3HUJE 4NM8H 3IDUA 4C56B 3CFEB 3LKOA 1KCSH 4U6YB 4HV8A 1F2XK 5GS0H 3P11L 5EIIB 3PDOA 1JF6A 5I1JL 2IBZX 5TDNB 4Q9CA 1IEBA 2JJSC 4NN5C 1BOGA 2NY5H 5I30L 4RQQA 1MJJA 3A6CH 3DV4B 1OAKL 1XFPA 2VKXA 3SKOB 5DO2D 1DUZB 5HGBB 2A0LC 4JQIL 4RGOH 5GRVK 3V6FA 4MB3A 1M71B 3O41B 5TDOB 1QSEB 4TTDD 4ZS6C 1LK3H 4WFHD 3UEZA 5JR1L 3GMLB 2J12B 4W6WB 2HJLA 4LSSL 2BHZA 5J12C 4EUPG 1SBBA 4M7LT 4FNLH 3DIFA 4UINH 4WW2C 1RIVL 4M4RA 4R90H 1KB5B 2NY2C 4OKVA 4XRCA 5E8OB 4CMHC 2AXFB 3L5JA 4P99A 5AZ2L 3ARFA 3CFKB 4KI5D 3D2UA 4ZDHA 3KPOA 1E6JH 4FZ8L 3CH1B 1G7LB 4GRWF 2FYYB 2RFXB 1OM3H 3D39E 2P44B 4LVOC 4PJ7B 5H35A 3PL6C 4HFUH 2VQUA 4PJGB 1Y0LA 1WVZA 3G6JE 3O6LH 4X80L 3LMJL 1S7TA 5I1LA 3MJ8B 2DIJA 2DJSA 3DVIA 3JV0A 4ELKA 3SDCB 1OTSD 1OSZB 4PLJC 2VDRH 4WJ5A 2VTFA 1A3RH 4ODSH 5IESH 1V05A 3NIFE 5A1AA 2WWMC 1TQCC 3BI9X 4OUOA 3Q6FA 3RQ3A 1HNGA 2R9HD 4G3YH 1CL7I 4XCEB 2YR3A 4L3ED 4Z7VF 1A0QL 3L3IB 5DUPL 3IDXL 5E94A 3RKDC 5B3JF 3MFFB 3G5VA 4K9EH 1JWSB 1K5NA 3QJHB 4A2LA 3IAPA 3HG1B 4PJ5D 4Z7UA 1VERA 5CD3B 1R3JB 5D6DC 4PRPB 2OX5A 1T0MA 2CLVB 4ZPVA 5DSCA 5KSUB 4PRIE 5ESQB 4J7RA 1RZFH 3EOYG 4Q6IC 1F3RB 3Q5YA 4LAQH 4NBXB 1IM3B 1HHJB 3WYRA 1O5DT 3AREA 1L0YA 1A7QH 5INCA 1NH6A 4U1LA 5KZCB 1X5IA 3O9WA 2GK0B 3CMOL 4OLWL 1RIHL 3TPUA 4TYUA 4AK1A 5HYJE 1S9YA 4QRPA 1V8HA 1NC4D 4HUWA 2ZCHL 1YDPA 3V9FA 5F1IA 2J7LA 2NW2A 3U36A 1DEEB 2BVEA 1CN4A 3MLSL 2Z31B 4UTBH 1QSFD 4JVWA 4R26L 3WLWD 5ELIA 3L5WA 3K0WA 2NY0C 2QQLL 4ZAKA 3V95A 2AEWA 3GIVB 4HHAB 1TLKA 2WP3T 7FABL 4ZO9A 1UWEL 3U4BL 3VXSA 3ORJA 3GSNA 4DVRH 1P53A 1MLCB 4YGAB 5KANG 1VACB 4X4YA 4TPRH 4HQQL 1RZKH 3DXAE 2JKXA 3VXRA 1DFBH 3O2DH 3X3GH 1JWMB 5HHPA 4WTZA 3BE1H 3EOAA 4QRUB 2Q1EA 5L88L 3WJJA 1FZMA 3QCVL 1OGTB 1V3JA 4Y5YC 4F80A 3VU2A 3NCCB 4HS8L 4WI3A 3QDHA 1I1AD 2D3VA 4L3EE 4Z18A 2X4QB 4G8GE 5HDLA 2AV7A 3MRHB 1VGKA 5IGXL 4PY7B 1CFNB 3DUUB 4O9HH 4MS8C 2Z8VC 1J1PL 3DMMD 1WWAX 4XC1H 5SWSB 2NY3B 3G5YA 1YEDB 4IJ3C 1JNNH 3P30H 4LNVA 2AAVA 3LVEA 5F1KC 3MRDB 4GXVL 4UNVA 4Y4KB 3GMRA 3JVGC 2CGRL 3LH2H 4U4BA 3ZE1F 4JM4L 3S8WA 3V6BR 3T0VA 4YIQA 3G6DL 3SEPA 4WWID 4QXUL 1N3NA 2QADC 3TVMC 4EDWH 4G7YL 1K2DB 3OKMB 5L2KE 4X4MA 4LIQH 2G60H 3R06B 1B0RB 4JFFA 4ZNCD 2OM5A 4G6FD 1CICD 1JZ4A 4QRUA 1KCUH 3QYCA 4I9WD 1X3DA 4U1HB 3QIWC 1K8DB 3T0EA 1I1AA 1PY9A 2NZ9D 2X4NA 4GAGL 4ORZC 2VJXA 2N4IA 4KK9D 4XCYB 1KLGA 2X4NB 3I9GH 1CLCA 4NZJA 4DK3A 1BLNB 4APQB 3ZYJA 1ZVSA 5C1MB 2E8ZA 4JB9L 3X14A 1AXTH 5L2JB 3D85B 1N64H 1TNMA 4OZ4A 2P7TB 5JW5B 3H9ZA 5IMLB 2A9NL 5IIEB 4KKAC 2AJXL 1U8LA 4MXVF 2R4RL 1JGUL 4M1DH 3PABA 3QH3A 2XRAL 3I75A 1SQ2N 4TUJA 1PEWA 5CD5D 3QO1B 2HTKD 2RCSL 1CLYL 1KG0B 3OG6B 2E5EA 2BVPB 1HHKA 4YLQT 2CK0H 1I3RA 5CEYB 5J56B 1CG9A 1B2WH 2XFXB 2ICEA 1BBDH 1AR2A 3DRTA 4ZTPL 5TDPB 1IL1B 3H3PL 5I71C 5DK2A 3WMSA 1AHWB 2OJZH 1HYSD 2DWDB 4NQVA 3V5HA 3E0GA 1RFDH 1RIUL 2LAAA 3MRCB 4PRHE 3VI3E 1LILA 4JRYD 4KMQA 1MFDH 2KH2B 5ISZA 4KRPD 4CGTA 3RPKA 4YHMH 2AJXH 1A1NA 1XGQB 1P5VA 4YXLL 5E2WL 4BZ1H 1EVTC 2QSCH 5I73C 1DQMH 1MVFA 1T0NB 5HYJD 5DK0A 2R23A 3A6BH 5KSAD 5HDBE 2IEPA 1Q0YH 4L3CA 4ONGH 4UDUA 1PZUB 4S0TD 3WEXA 5J1SC 4R8WL 4YHLL 2VERN 1FZJA 1LDPH 3HC3L 1HH6B 2C1PB 1B0GA 2AXJA 4MNGE 5I8OH 4O58H 1MY7A 5JNYA 3V6OE 1BQSA 1FIEA 3I6GA 4M6OH 2C1OB 1CLZH 2N7AA 3T04D 5GSVA 5C09D 1Z3GL 5EOQH 5ICZB 5DHVA 1UM5L 3HNVL 3EYSH 1MI5E 5F70A 3SDCD 2DQTH 4LHUD 1BP3B 4KROC 1IEBB 1DLFH 1MWAB 3W5MA 2XTJD 4OGXH 2VQTA 4NNYB 1HIMH 3NA4A 5EZIL 2JJUA 4R7DB 4JREC 2YEZA 4FQLH 1MIEH 3S37L 3PV6A 3BWAA 5I17B 2VH5H 4MXWL 4FQHB 4ZO6A 4ONHA 1BGXH 3PWPE 1XGUB 1CTNA 5I6XC 2PXYC 3WN5A 5D6CB 2ZUQB 3WIFA 1T5WB 5HHXH 2G5RA 3OAUL 1DZBA 1IAOB 3CFCH 1LNUB 4F9PA 1A4JA 5F7DB 1J8KA 4NNXA 5F7DA 1DE4A 3LPGA 4NNXB 4KMLB 1PLGH 1NAKL 2GK2A 2VAAB 5GGUB 3LKNA 2NLJB 3T4AA 5BOPA 3QXDB 2ZJSL 3PABB 5ILTL 1OAZL 1XZ0B 4ZO7A 3A67L 4F2MA 1J11A 2EO9A 3C60B 3QIUA 2L7JA 4MD0A 4ZFOB 1EXUB 3FB5B 5C08D 4MJ5B 4MQ7A 1UYWL 4KKLD 1MIEL 1JHLH 2PW2B 5E8EB 2HN7B 2ZWLT 4Y5XA 4LEOB 4HH8A 3NMEA 4I48B 3QULB 2V7NA 3WLBA 1AFVL 1CFQA 4KK5C 3MRRA 4NSKA 2FIKB 5EIIA 3O6KL 3FQUB 3MRRB 3RHWF 2I25N 4MJ2A 5LXGL 2AKRA 5FDWA 1ORQB 1PSKH 2Z0BA 5C0DB 3NN8A 3BEWB 3WNKA 4JZJA 1KEML 3MNZA 3FO0L 2UUDK 1KIUA 1JWUA 4TSBH 5D1ZC 1A7NL 1TPXC 5DC0A 4WUKL 3SBWA 4NZUL 4WDIA 3OF6A 3GMQB 1EGJA 2G2RB 2XV6B 3BP5A 3MCLL 1RZ8B 5GGTL 5BW7A 5TFSH 2UZYB 2O5YL 4R0LA 3BO8A 2ZKHL 5DUPH 3BAEH 4Y2OA 2CR6A 5IF0A 4LKCA 1PKQA 3UCRA 5LGJA 4OQTA 4OM1L 5TE7H 5BXFB 4G80A 3REWA 1I9IH 3TIDA 5BXFA 1WAAE 1RUKH 2E6QA 4CN6A 1WCQA 1URLA 2ADIB 2BNUB 1ODAA 1PZ5A 3DSFH 3HMWH 2F19L 3IS1X 3KYNB 4R7NA 5I8CB 1J1XH 4HFUL 5BMFH 3HI5H 3NFSH 3SGEI 2DWDA 4NQVB 5BRZA 3L3GB 5F7KC 3SE4A 1WIOA 2P1YA 1JHTA 1JPFA 4YHPA 4YXKH 5GXBB 5IMKB 2BHUA 1KJVA 1J05B 2Q7YA 4G42B 5C0DA 1G6RH 1TETL 3EFDH 1ZTXL 4JDTL 4NHCH 4E42B 2J6EA 4KROD 4P57A 4JN2B 2BDNL 3BX7C 2EICA 4Z0BL 5T5FH 5I8EB 4XX1E 4PR5A 4UV7L 4HXAL 3TZVC 5CJ5A 3BZEA 4ZFGL 5E2UH 5EA0L 3MRQB 4U6XB 3HNSL 4WFED 5IQ9A 3HMWL 3MRQA 4U6XA 5SWQA 4XMLL 5DMYA 1AXSA 1A6ZA 4Z7NE 3Q1SH 2C1PA 1FYTE 4GW1A 1A8JH 1RAMA 3IXTB 3LQMA 5CINL 3C87A 1BQHA 1AXTL 3IU4L 1OP3H 5FO7B 1FJ1B 5JIHA 2AJVL 1DVFC 2VN7A 5FO7A 1KV3A 4WFFE 2VDLL 4LLWA 3B6SA 4JDTH 1HSBB 1XIWB 3QDAA 5BRZB 1XR9A 2R1YB 5TFSL 3IGAB 3TV3L 1KTDA 3DVGA 5IMOA 1WZ1H 4XWGL 3HHRB 4PGCA 5HPMA 4YDVB 2QQKL 1JV5B 3SGDH 4IIQC 4OBRA 2D7NA 4MVBD 3BMVA 1KTLB 4NGHH 1FLTX 3H9SD 3WKNA 4Y4FC 4WEBH 2BVYA 3HZVA 2QTEA 35C8H 3OF6D 1E4KA 4QGTA 4NSKB 1FVDB 3EYVB 1QOKA 2AV1A 3H9HA 3DVNB 3QRFM 1JP5A 5TF0A 5FO8A 4ZSOA 1I1AB 2AJ3B 4OTXH 3D5OF 3U46A 1ONQB 3HI1B 4NQXB 1YN6B 4TVPH 1KOAA 1GGIH 3STZA 5HY9A 3BISA 3W9DA 4MCYB 4EI6A 4YHYB 43C9B 5DHXB 3OGCA 3MSPA 3SDXE 2HLFC 1R5WB 3KPSD 1H0DA 1CGXA 1A7NH 4L1HA 5J6GA 4NYLA 5HVWA 4X9BA 4PFEA 3NTCL 1EAJA 3QT2A 2UWEE 5LQBL 1A4KA 1AGEB 1KTRL 3BKYH 3I75B 2I5YH 3T4AB 1ADQL 4HKZB 1HH9A 4NC2B 5I1IH 3MCG1 5B3NA 2UYLB 3MC0A 4O2FB 4LCUA 4JZJC 3I3DA 3AAZB 1QFWM 2ZOLB 2GK0A 4GO6B 4JPWL 4WI8A 3KAAA 1W8OA 2NR6C 4QTHA 1MNUH 4P9HL 3EO9L 1AFVH 3QUXB 1C8PA 4C83B 3S4SA 4BH7B 5MEND 3PF2A 3TH2T 5IW6A 1B4RA 2W9LA 4C83A 2MQ3A 3FMGH 5D72L 2JB5L 3PHSA 3CDGB 1T66C 1F2QA 4UILH 2CDFB 4Q9QH 3QXTA 5IFHL 1FFNA 2IFGA 5K9KA 2IAND 5CHNB 4IRZL 4PJ7E 4XI5C 3MFFA 4LSUL 4K23L 3IFPA 4HZLB 4JVPA 5EU5B 4X9HA 1TJIH 2GEEA 5I8EA 4PR5B 2HFEB 4TUOA 5TQ0L 2NY2D 1NCAH 2AXHA 2EH8L 1J0HA 1WJ3A 2IAMA 3V5DB 1IM3A 3BO8B 3RX8A 4HIIB 2CIKA 4MNQA 2BMKB 4RMRA 1RJYB 5EUOF 1T4KA 4Y5XC 4GW1B 3LQAH 4YHZH 4PB0L 4NT6B 4O58L 3VGDA 2Y7QA 5CKAA 2FL5B 3V2AR 5GRVL 1DBMH 3FQTB 4HCRA 5I15H 4KVCH 4DUVA 2A77H 3MLTA 5MENE 1S7WB 4HWUA 4UZGA 4QOKD 1EFQA 1FG2A 3UJTL 4DN4L 4PGBA 3W0WE 5C6WH 1XR9B 2R1YA 3T1WA 4CL7A 4MJIB 5BV7C 1RVFL 2OSLB 4Y2DC 4IOSD 2WQ8A 2QSCL 4HX1B 1NGYB 5IMKA 2FLRT 4WY7H 3HR5B 4XP4H 1CG9B 4RGNB 4MD4A 3BKJH 1CTOA 5E2VH 4Y4HB 4BM7A 1BFOB 5T5NG 5MEOA 1U41A 4NQDB 4PJXB 3N06B 1RI8A 2VLKB 3EDKA 3U48A 3K7UA 1E4XL 2OR7A 3UAJD 3OTTA 4JM2D 1KC5H 3KJ4B 2M8XA 4TRPH 5A2LH 4M3KB 3GSXB 4Q2ZB 5FFLA 4XT1C 1INEH 3UDWC 2CO7B 1HHIB 5E95B 1X4YA 5GGRY 4LSTL 2YXMA 2HJKB 4M8QB 4XXDA 2PW1A 4XBPB 3RL1B 5FYKU 2AXGB 1JUFB 1XF1A 4OFYD 4S11A 1E4KC 4MCZA 4X7SL 3LEYL 2QADD 3TVMD 2OK0H 1FO0L 2BSSA 1CD1A 3IF1B 4XPHL 1EMTL 2Q3ZA 4NN7C 2VLLB 2A73A 4RA0C 4XNXH 3RI5F 4N5UA 4LCUB 3MR9A 3RDTD 1NUDA 3R4DA 4OCSH 3WFEH 3S5LB 3RVXC 2ZOKA 1C12B 3EYQD 1ZAGA 1X9QA 3QZWG 1A2YB 3G5ZA 1PX3A 1B6DA 5HVHC 4RAUB 1QHOA 1F3JB 2H6PA 1UEMA 2WUBL 3GIZH 4FN0A 2EC8A 1BZQK 3CZFB 3D18B 5ESVA 3T2NH 5DMIL 3IS0X 4WU5B 5IKCB 5F9OH 3VFPA 3S88L 2QKIB 2Q87A 3RGVD 2XN9A 3C6LA 1GVIA 5H2BA 3R1GH 3RAJH 4PJBF 1JWUB 4LSVL 4NP4L 1HSAB 3KDMA 3IDNB 3B9VA 5DI8A 4ONFH 3HZMB 5FUCC 1D5XA 2XTLA 5DGQA 2OJEA 4OBSA 1KT2A 1RHFA 1CDUA 3FT2A 3Q5TA 2EE3A 1NMAL 4GAGH 4BH8A 3RHWK 5DMGC 4GKNA 5HSFA 2YN3A 6FABH 4QCIB 1MJ8L 4F7CB 5ICYB 1BIIA 1P84K 1C12A 1A9BB 2PO6A 4GQ9L 1XIWD 1A2YA 3G5ZB 1JGDB 1UJ3B 3W9EA 4V2CB 2GSIA 3H0TA 4UOW0 4NJ9H 3OKDB 5CFHA 3O6MH 3UJJH 4LLVA 3KNBA 2ICWB 4U05A 1J87A 5JDJA 4DEPB 1YEIH 1ZHNB 3UZEA 3VFPB 1Z9OA 4YHOH 3LIZH 5EBLA 3OKNA 1MJJB 1YYMH 2PTTA 3AREC 4MA1C 1U8PA 3RIFK 3QULA 5D8JH 3X12A 4L29B 1CFQB 1I1FB 3JBG7 5IOPB 4JZOB 1UYWH 1YY8B 3IJYB 4PJHE 1KELL 5IB3B 4C54A 2W0LA 1OGTA 1X4ZA 1OW0A 4KKAD 3E2HC 3PV7A 2FSEA 4L8CA 2GFBB 2HH0H 1RJYA 1B6UA 2HKFH 5FA4A 4H1LG 4UOJA 4OFDA 1DQLH 3EJJX 4WU7B 5AZEL 5LBSH 1KCVH 4RWYH 4WY7L 3IAQA 4WI6A 3GRWH 1M1SA 5GGUA 4DVRL 3QIWD 1HK6A 3AY4A 1RVFH 3UZQA 4Z78A 2IAMC 1XCTB 3LN4B 2FCBA 4N0FB 2UZIL 3PWNB 3AMKA 4LPTA 4AEHL 4LHUB 4GG6F 2DTML 1HHGB 2H26A 5EUOB 2B5IC 5FV1L 4Y4HA 4LCWE 5MEOB 2NNAB 4GW4B 4AL8L 5DWUH 5JPMA 4DGVL 3WFCL 4WU5A 4P2RA 4PJCE 1N5AB 3OSKA 1AC6A 4GKSA 3W2DH 3GRWL 1RD6A 3ARDD 1T0MB 3ABZA 4OT1L 1RZJH 5AZEH 4HWZA 4P23A 4WHYG 3O4OC 4L4VD 2J88H 4OIAA 3MRJB 1GZPA 1MCPL 1P7QA 5LVEA 4I2XE 2BXYA 1RZ8A 3EOBA 4MHHG 1Q0XL 5FV2A 3EFFA 3OKKA 4NRZA 4OCNC 4JHWL 2E6JA 1U42A 5F97E 1IZKA 4JFDB 5HI5C 4I18A 3B3IB 3IKCB 5L2KA 2DD8H 4P4KA 2PO6B 3B3IA 1ZT4A 3BGAA 1EHNA 5E2WH 5C08B 5MEPB 2ESVA 4R3SA 3KYNA 4GLRH 4R4FL 1HE7A 4FXKB 3TCLB 5FXCH 3LMJH 2CSPA 3REVB 1N2RA 4OV6F 1KPVB 1MFEL 5GJTH 1R5VA 5IBTH 5C3LD 1YEHL 4YK4B 3W0WA 1MAJA 5M7QA 5DEFB 4OFVA 2XPGA 1L6ZA 2D31B 4FQHA 1EUUA 4XMKH 2HVKB 4OCMC 5F9WC 3LSOB 4ETQA 2NY4D 2C7UB 1D5MA 4L8SB 2ZSWA 2BVOB 3CFJA 4WTZG 4YDJB 1W8NA 3RY4A 5D2LF 3PGDA 3QPXL 2XKNB 5IG7B 5C0AB 1KJ3L 2FECL 4YE4L 1XF4A 5CCKH 2FSEB 4L8CB 4GKNB 1BM3H 3OAZH 2IG2H 3BD5A 1FL6A 4BFIA 4HG4K 3ECBA 2Y7QB 3IVKB 3BSZH 3R8QA 4RISH 1FNSH 2BNUA 2MQ0A 2R4SH 4E41D 2EC9U 3IVKA 1QG3A 1NDGB 5JO5B 3O8XD 5I74B 3BDBA 4NQDE 5L7XL 5I30H 1ETZA 3F7VB 4P46D 2NY4C 3B6SB 3C2AH 3FCTA 1A7BA 4PG2A 5E6IC 4HXBL 5DUML 4HGKC 1LWRA 1RZIA 5GGQL 3QEQD 2DDQL 5FM8A 1KJVB 2Q7YB 4HPYH 2XKSA 4UOW1 2IALA 4FFYL 2E6PA 4P2OD 4WV1A 4NDMB 2OR8A 4ERSL 5D70L 3VXTA 4NM8L 1WAAA 4L8DB 2MCPL 3DWTA 3GBML 4UIKL 4M1CC 4JKWA 4QRQA 1VA9A 1VFBA 4HIHA 1UH3A 3BDXA 5CJ8A 4QRQB 1IGCL 5TE4H 3GNML 4I8DA 3MBEC 4XNZB 1F5WA 1U58A 1YN6A 2FATL 4NHUB 2P48B 1A4JB 1X5ZA 4H8WL 1MCOL 2D9QB 3B2VH 5DJ8B 5DR5H 3VXQA 5ANMB 3AS2A 2F74A 3ARVA 4CU7A 1DLHA 5DJZB 5EU3B 3BGFB 2GT9A 4HF5L 3I6LE 2C3GA 4I3RL 1ZHKB 2YBRA 3QEGL 4Q0XL 3NABL 1YEJH 3BP6B 4MA3A 4WO4C 1OAUH 3K2UH 3FQWA 1MWAH 2W59A 4YDVA 4LPXA 4I3GA 4K9EC 4X6CE 4PRDB 1N59B 5E2VL 1V7NH 5L9DL 3NGBB 4AT6A 3D9AH 2Z8SA 2FEEL 5JW4Q 2IAMD 3JUYA 4JM2B 2GCYA 3U9UA 4ONOA 5DK3A 2DQFA 2OTUB 2PYFB 3QCUL 3N1PC 1HI6A 2BJMH 5CBAA 3GKWH 2DQFB 4M48L 4ZSOB 4EN3D 5IHZA 4UDTA 2V6HA 4OF8A 1Q0XH 3CSGA 1AO7B 3U4EA 5HTSA 3DO3A 3GM0A 2A1WL 4CADB 1F4WL 3KXFD 2F5BL 4WI4A 5E7BA 5MERA 2YPKB 1IGJB 4QXGH 3DURA 4PJAF 4D8PA 3UC0H 1A4KB 1AGEA 2QQNL 1KB9K 2ZCHH 3SN6N 4OZIB 3LS5L 1FZMB 3BKJL 4PJIA 5ISZD 1RIHH 3O9WB 3X13B 5LWYH 3OR6B 5KVEH 3I02B 1B4JL 1MCWW 3WHE0 3ESVF 2YD8A 4YWGH 1I8LA 3VRLF 3SDXF 3IKCA 4N90E 4J3SA 5IK3A 4IRJC 3TBSA 3E6HA 3T3MF 2DM4A 4LCIH 5HDQH 3HB3C 4X4ME 3OKDA 5I15L 2ERJC 2FGWH 4LLQB 3KYOB 4KRPB 4XPTL 3MV11 1IEAB 3MOAL 4NKIL 4NN6C 5DJ2B 5CBAB 1NEZA 3RGVB 5FEBA 3VMOA 4O2EA 1NFDF 4NNYA 5C0CE 1ZLUK 4RBPH 1FNLA 4BQBA 5HHOB 4X8JA 5C9KA 4CMHB 3ZTJH 1LE5A 4OB5H 3LN9A 4D8PB 1EO7A 4JG1H 3MRKA 2VDKH 4R2GB 1RUQL 4UV4L 1BQLL 3AMLA 1CICA 2YK1L 2GIYA 2VZOA 3BUYB 4D9LL 3BP4B 2HP4A 1MQKL 3PL6B 5J1AA 5E1AA 3SGKA 4EIGB 1NGQL 2HFTA 3WHXB 3O4LE 4D9RE 1FGVL 1NCWL 2VKWA 4DVBB 1CGSL 2VH5L 5JXEC 4AM0A 1X5JA 5DDHA 4P5TC 3Q3GB 5JXAH 1QLRB 3CFIC 1J8HB 4MA7H 4FG6C 1T7YA 5ISZE 4M9OA 4HSQA 1LEGB 2J8UF 1SY6L 5GRUH 2BZDA 3B2VL 5ECJE 1CD8A 4UINL 2UYLA 1MHHB 1HSBA 3LIZL 1MNUL 2VITA 2XN9E 3WS3B 1ZEAH 3VH8G 1T22B 1LO5B 4CVUA 4O2EB 3DXAD 4LDLB 1OSPH 5FF6B 5EBGA 1JNHA 3WSQL 1MJUH 4G6JH 4GMTH 4LIQE 4U1JB 1AJ7H 1GAFL 4X5LA 3VRJA 3DUHA 4P5MA 3KS0H 3MBEA 4YHNB 1FZOA 2MKWA 4P5MB 4NRYB 3EZJB 1UZ8A 3QDGA 1I3GL 3QDJB 4N9GA 3VFTB 4Q6IB 1A1OB 1K8DA 2B2XL 2Z92A 3T0EB 1MCCA 1GGIL 1MI5D 3QXVA 1HHIA 1TQBC 5KTEL 2VXVH 3IDGA 4M93B 1DQML 4HJ0C 2K1MA 1NGPH 1JZ7A 4OD3L 3HC0A 1U0QA 5D9SB 2EXWD 1MCNA 3TO2B 2DLFH 3HG1D 4KJWC 1DANT 4R0LB 2HLAB 3HI6H 4BUHA 4OLVH 2Y5EA 1KPUA 3RPIB 3E3QE 3V0VA 1P4BH 2YBRB 3W39A 4OIIH 3HNSH 3LN5B 1B3JA 4U1GB 5FA3A 5ICYA 1I3RB 4YUEH 2WANA 5D2LE 4Y89A 1HOCB 3RWGA 1WISA 2HKHH 5LG1A 3MUHL 3FHAA 1E6OL 1T5XB 4LFHD 3EFDL 1FG2B 1LVEA 5GS2D 4HC1A 1VDGA 2HAZA 3C08H 4M62H 2AJYH 3MLZH 2YD9A 3WIIL 1WZLA 4Z7UE 4N0UB 1C5BL 4JJHA 4OAWB 1FNAA 4HK0A 3ULUF 4Y5VC 3RZCA 3ULUL 3SGJA 5EB9A 3VGHA 3ARZA 3MJ9L 5E99L 4XTRD 2EDLA 3ALWA 3PV6B 3BKML 4UI2A 2D03L 4HXAH 1RUKL 5FO9A 4MYWB 3HE6D 4JKPH 5C0BA 1MCIA 4L4JA 3RWFB 3TNNB 4WNQB 1NL0L 1JK8B 2YZ8A 3ULUE 4JHWH 4JFHE 3SDDD 1UQSA 1BD2E 5DXWA 5HVFB 4LNRB 5BCAA 2AK4D 3ECBB 5JNYB 4JLRB 1NLBL 4P9MH 1FE8H 3VFVB 5ADOL 3QQ3A 1A7PL 3P73B 2YA2A 4HFWA 4NM4H 2F53E 3G6DH 3DSFL 4WWKA 4XCNB 1CU4L 3E6HB 3EO0B 2ED9A 2QR0A 3U7YH 4XVSH 5JZ7D 1IVLA 1RZIB 3ZDYF 2JLLA 1LP9A 2EIZA 2OSLA 4EDXB 3DYOA 2BOBB 4I13B 3DROB 1CFVL 3DGCR 5KVDL 3QXAB 1KIQA 3VXUE 2A77L 2EE2A 5HHOA 5JOEA 1L6XA 5EU6D 3R06A 3JTTB 3ARBA 4P2YA 1F8TH 1YY8A 1X5FA 4Z7WB 1CZ8L 2PN5A 5D7IB 3GB7A 4YAQA 2EYTA 4P3CH 3VFNA 2BNRB 3SDDA 4LCYA 3C6LB 3V6FB 4H25A 4QTIL 1WIUA 5SX4H 2NW3B 3K4AA 5FYLL 2YZ1A 4TPRL 4GMSL 2F54E 4TVPD 2VAAA 1H3PL 5FYLH 3B9AA 4L8SA 5I1KH 1CF8L 3RNQA 3GMQA 2Z35A 3QJFB 2EKSB 5C07E 2VXUL 1RK1B 4NCC1 5DRNB 1JHLL 1EFXB 3B8SA 2HLFD 3BJLA 5IVNA 2X4SB 3BZFA 3MV8B 1D3CA 3D2UB 4ZDHB 5LAXA 1BZ7A 1FAKT 1KIQB 3TYGH 3ARXA 4G8IB 3FMGL 4LVHB 3H0TB 3RNKB 3MBXH 5T1LD 3I84A 1YMME 5ITBH 4ETYA 1LO3L 1H3PH 4KHXL 4KDVA 2ORBH 5KJRH 1U2HA 4ZOAA 3BD3A 4U6HA 1RJCA 1SBSL 4O2CA 4TNVF 2VN4A 4K7FB 4XVSL 1DDHB 3DJ9A 5EU6B 4F9PC 1YNLH 1XGRB 5KSBE 5J57B 4XWOC 5KS9A 1BWMA 1OT1A 3BPCB 5BV7H 3EUUA 1Q1JH 3G5XB 1X6NA 4HKXA 5E9DD 4P46C 3WS6C 5ITFA 2MFNA 5C0CD 3WXWH 1RJLA 1YPZF 1PG7X 3TNNA 4TVPL 4R8WH 5GIRB 3VD4A 2YD6A 4BSVA 1WBXA 4M7LH 2X4OA 5B38B 3GBLA 5EZJA 3MREA 5SX5H 1ZGLM 3KLHD 3E1F1 5D2NA 4JREB 4JFYA 1HQRB 5DZOA 1NBZA 4G8IA 2H2SC 5DGRA 1BHGA 1PW3A 1CU4H 1HZHL 1S7WA 2GSIB 2X4PB 4TVPE 5IFJB 4RMUA 4AZ8A 4HD9A 1AGDB 3UBXG 2IMNA 1FE8L 4GRWB 1QKZL 1N2RB 4ZXBC 3C5SB 3GJFK 2AJSH 2W0PA 2VLJA 4ODVH 5F7NC 5IMOB 1NFKA 4PV9A 1MFBL 3MUZ1 1EO5A 4FFZH 5BRZD 1H5BC 3QUYB 4HZAA 4KKNA 2R0LL 2YPVL 3QXAA 1H3XA 4PJ8A 5J06A 1R24A 5EULV 4R90L 3ZE1E 3WNNA 3F5WA 4WO4D 4YFEA 2OBGA 1ZT1A 5E8PB 2ESVD 3O6FA 4UT9H 3SKMA 3ILPA 4WFGD 5FUCE 3D25B 4UBDD 3HUJA 4E0RA 3DVFA 1RHHB 1CFTA 1S7VA 2BNRA 3LCYA 3LQZB 3QHZL 4WO4A 5EBWA 3SKMB 1EHLL 3C60C 3QEUB 1CVSC 2R2BA 5FUOL 3H6JA 1KJMA 3KYAA 2AJYL 3EDEA 2ZCKH 1E0OB 3HKFA 5IB1A 4O5LL 5IVZB 3CCHB 3HMXA 3VGGA 4M6ML 3ARUA 3EDJA 1LEGA 2VXVL 4CN1A 1GGBH 1NFIB 2R0LH 3EGSA 4JE4B 3SDDC 1MVUB 4D0DA 1MREH 5BVJB 3SGDI 1CIDA 5IV2A 15C8L 3S5LG 2VL5A 4F8QA 5GGVL 2D2OA 4JANA 3QRGH 4UB0L 5GRWA 5T1MA 5ERWA 3VXRD 4ENEC 2ZUXA 4OCWL 1GC1C 1NGWB 3NCMA 1HHGA 2H26B 3L9RB 3O3EA 3INUL 4LRNL 2DYPA 4IEFB 5K9QG 3RUGA 3STLA 3UTQB 4Y0GA 5DD3H 1Y6NR 1IQDA 4EVNB 5KSVA 2IMMA 4WRLA 3WNPA 5I1HH 3LV3B 4G43B 4RDQG 3UTPE 4UAOC 1JN6A 1UCTA 1QA9B 1B88A 3QFJE 3MRMB 1MLCA 1T89A 1CFSA 5T33H 3WO3B 3G5XA 1C1EH 1S7XA 3ULSB 3W0WD 5L6YL 4ETQB 4I0CC 3GGWB 4PD4K 3RGHA 4EIZC 1I1CA 1EJ6A 4XVUC 4JKLA 3KR3H 4G7YH 3RTQB 2VR5A 4P2QE 4EDWL 4Z7OF 2NY6C 1Q1JL 4J6RH 5DMKB 2CIKB 1R5IB 1DN0A 1CK0H 3VXOA 2VYRE 3S3JA 2OI9B 3MOBH 4NO5A 1ADQA 3ZHLA 5KJRL 1EHAA 4YEFA 1QSFB 2XNAA 5D1XB 3O0RH 5J13C 3MV9A 2YWYA 1J86A 2ORBL 2WBKA 3U4BH 3UZVB 2XQBH 5F7EH 3STLB 2LTQC 3MGOB 3UTQA 1UM6L 4XHQA 3PWVB 2R69L 1Q72H 5K9KB 3MJ7B 1KYOK 2CPCA 1CGSH 3RVVD 4OZFA 4AIZA 3CVIL 2UWEA 1J5OH 2VMFA 3H7BB 5AEAA 1WSST 1YUHA 3MV9E 2SEBB 2XWJB 4PLNC 1SJXA 4UQ3A 4XPFL 1S7XB 2BRRL 3LY6A 3NFNA 1AGBB 2V7HA 1OP3K 1FH5L 4PJGE 3WD5L 5FYKL 1EIBA 4I9WE 3B9EA 2V7HB 4PJIB 4ZQKA 1XIWC 3C2SA 4N5ED 4YDKL 2A0LD 1T1YA 1WBZB 4HDIA 2R2BB 2WBWB 1C5DA 5ACZB 3IYLW 1FL6B 4RZCA 2VABB 5E1HB 3PWJB 4MQXC 5MEQA 5FYKE 1ZS8B 3C5ZB 4JHBA 4TNWF 5MEQB 1G7IB 1LK2B 5DFVC 3BEVA 4LLWB 1FAIH 2BOCB 1ZA6A 1BIHA 4Z7WE 3KPSE 5BVJA 1L7TL 4XTRC 1NLDL 3ROLA 1G6RB 1CVRA 1A7OL 3GZKA 4QHNA 3FB6A 4PRIB 4XPAH 1FZKA 1HEZA 1NBYA 4KPHL 3RI5K 3KXFE 5FOBB 3FFCE 4YGVA 3IFNL 4Y1AE 5SWSD 5IEKB 2J1KA 3IDJB 4HMDA 4X80H 2HT2C 4UQ2B 5FGBA 2VL4A 4J4PD 2VLRE 1MUJA 2YA0A 5JHDD 5K9OA 1Z5LA 3ARQA 3AY4C 4RGND 4HF5H 4FQ2H 1FSKC 3JV4A 3L5XH 4JRXD 4NIKB 1KCKA 2NTFA 4Z95H 3OQ3B 2Z4QA 3EKCA 4Q58C 1KCRH 4X9FA 1I7UA 5FGSA 4JQXA 3FRPA 3TCXA 4BK4A 2YUWA 1JYVA 3BKMH 3ZE0F 1UC6A 3MRNB 3CVHA 4YQXL 3P4NA 1DN0B 4JPVL 2Q8AH 2R56L 1DANU 1ZHBB 4YPGA 1Z9MA 3TO4D 3NAAL 4KMTH 4Y5VA 5ALBH 3RZCC 3G04A 3KPQA 2PYEB 5ALCL 1EBPA 4LSPH 5DJ6A 1UH2A 1U91A 5C2BH 2FH6A 4YJZL 1GCFA 2HKHL 2EXWC 2NY5L 5T1KD 2R0KL 3GMMB 1T83C 3M45A 5CEZE 3FN0L 4BKLB 2BDNH 4JM2A 1JRHL 1FV1A 2Z31D 1JCKA 1T2QH 2Q8BH 1R3IH 1CCZA 3IDYC 3KPNA 4J4PA 4U6VL 1YQVL 1U8HA 2OQJA 2Z8RA 2D4DA 3C6LD 5DRWB 3C2AL 4X98A 3TFKC 1KCSL 4KUZL 1GGCL 2YSSB 5EU4A 2XTJB 2CDGA 3SE8L 3BPCA 3HC0B 4HKXB 4M00A 4GBXA 4LSRL 3T2PA 4HS6A 1JZ5A 4FQXB 4UIKH 3QQ4A 3G9VA 3JV6B 4KGLA 3SDAC 4Y1AD 5C0BB 4OZHA 5HDOA 1KJ3H 2P8LA 3BN3B 5TE7L 3QZWA 4MSWB 4M7LL 3TO4A 3B5GA 4PTTB 5GS1C 3DSNA 1AP2B 2PO6D 5IW1B 4PTTA 4NZRH 5JTWA 4O51B 1QRNE 1UWGH 2FZ3B 1AQDB 4P3DB 2AJSL 5C0JB 3DV6A 1TITA 1FNGA 4DCQA 3LDBB 1SEBA 3TBTA 4ZUSB 3OR7B 1XZ0A 3ZL4L 1DQJA 3TM6A 1MJUL 4GMTL 4PJ9C 4ZMAT 3PE9A 4WW2F 3GMRB 1ZEAL 2P46B 5DRWA 4UBDC 3QI9B 4GRWH 1XR8A 1OSPL 4AIZB 4YX2L 1LP9B 2EIZB 4H1LH 3TPKA 5CIPA 1X5XA 2AERT 4HS3A 4MD4B 3F7YA 5E9DB 3AFLA 3FTGA 3GJFB 5IQ7H 4I1NB 4NQTA 3F7YB 4BELD 1C7SA 8FABB 4TN9A 2YRZA 5I9QC 5DA0B 4Y4HD 3K81A 2KBGA 2A74B 1H3VA 3JV6A 4N8VG 3VDAA 4X4XA 3TH3T 8CGTA 3UJIH 2BVUA 3NIDE 1WFUA 2L4OA 1CI5A 2E3VA 4OSUL 3GHEH 5I1GL 3QEQB 1J9CT 3GSXA 4Q2ZA 3ZDYE 4LFHG 1NGQH 4MJIE 3EOTL 5HHMD 5C0GB 1FVEB 5JOFB 3QISA 5AYUL 2J88L 1P4IL 4JG1L 3N85L 2BC4A 4HWZB 4P23B 1NAKH 4QNPF 2V9QA 2DQEH 2K9UA 3AXLB 3EYFA 4KK6D 5D1XD 5HHQA 4I5BA 1CXHA 5A2KH 1WBXB 2EXYC 2V2TA 2ARJQ 1IC5H 2BNQD 3WIHL 1U3JA 3QI9A 1CDYA 2D4FA 3KPQB 4MB4A 2UVEA 5T1MB 1CZ8H 4KGJA 2AS5M 5C92A 2X41A 1D5IL 2K3TA 3U0TA 5F96H 4Y88A 1YMHB 2DMBA 3SBWC 3DETD 2NXYC 2IF7A 5MHSD 2ESVB 4PJHF 4NUJB 4LCIL 3Q0HA 4YWGL 1J12A 4FXKA 1JRHI 3QHTC 3BQUA 1K4DB 1RZJL 3O3DB 3KPLB 1U8HB 1ED3B 2OQJB 1N5AA 4HJJH 5D1QA 1N5YH 5J11B 5SX4I 1FHGA 1EUTA 4ORGA 2HFGH 1J8HE 2YPLA 3QAZB 3DTXA 5CZKA 4N0RA 1YEKL 1YECH 1M7DA 2OR9L 4L4TE 5EOCL 1L9NA 5MERB 3CVHH 2D31A 3DVNA 4ZUUA 3VXUB 1HSAA 1A9EB 3PJSA 4PRPD 4BQ9A 3LKQB 4GQPH 3GDBA 5D7JB 4U1IA 1SVZA 5K59F 2BXZA 4PY8J 2BJML 4F33B 4P5KA 2B0SL 2NY0D 5F89B 3MV9B 4NZTH 4P5KB 2VUYA 4U1KB 1QFWL 3CCHA 3SQBA 2DQUL 4L4VB 4R9HA 4DAGL 1S9WA 2FB4H 3F7PC 4E41A 5GSVB 4K07A 4BZ1L 3VFGH 4TULL 3IT8D 4DKEL 1UB6A 2QQQA 2BNRD 4CVZA 4V2BA 2NX5B 5T1LB 4N5EC 4PV9B 1UT9A 2DQCL 3NABH 2GTZA 2ILLA 3TBWB 3KPSA 4GAJH 3MXWH 4GRLD 5I1AB 4DK6A 1PKQE 3K2UL 5BZWA 2OJZL 5ID0B 2Y25A 2C3VA 3LS4H 2OYPA 4U1MB 1NCUA 4P4KC 3H9SB 3X11A 4JFEE 3TIEA 2DICA 3CXHK 1P6FA 3WJLC 1NMAH 4IOFD 4H8WH 2IFFH 3RJDA 3VXPA 3E3QC 3QZWB 3WHXA 5FHAH 5FA4B 2EYRB 3FFDA 5C0FA 2CLZB 1NGZB 1IC4L 2Z91B 4N0CC 5IFAL 2AEPH 2CIIB 3SPVB 1RULL 3AM8A 2Y06L 1XMWA 1GGUA 4ZUSA 1CGTA 5CP3A 4HPYL 3ZKSD 2F9BT 1KNOA 2FWOA 1XCTA 1MFNA 2AXFA 3LN4A 4LARH 5DVKA 3O3BB 3RX7A 3AU1B 5H94A 3O3AB 3T0BA 2IBGA 5H94B 1EDQA 1M7IA 3S34H 4NO3B 4OZFH 5EU7E 3KLAA 2QSQA 3B9DA 3GUTB 3T8XB 3C8HA 3BD4A 1V3MA 5ID0A 4L3EB 3DMMA 5E6ZA 2JELH 3CPLA 4TQEH 5HYFA 4X7CC 1NUGA 3MJ8A 1H8SA 1CT8B 3O6FB 4LSVH 4NP4H 1IEHA 1FNSL 4NQDD 3ZMRA 2AJUH 4Z9KB 4FZEL 4GXVH 5LKNA 2BY1A 4DGYL 5SV3A 2AGJL 2VDNH 3VXQB 3ULUC 1K8IB 5TGBB 4S10A 3GMPA 4U6VH 3TBVA 3G6JA 4RMWA 3L1OL 2BC4B 1RURH 3LEXB 1ZLVK 3VDCA 5KZCD 5DD0H 2QHRH 4GAYB 2BY0A 1RPQA 4ZNEA 3MNVA 5H37H 2EDFA 2H3NA 3QDMA 1INEL 2FBOJ 3P4LA 1RUPH 4HH9A 2HWZL 2AW2A 1VPOL 1S9VB 3ARBC 1KC5L 4KVNH 5ALBL 1MHPH 4PJCB 4JANB 5IROC 1AJ7L 4D9LH 5E0QA 5EN2A 4YK4C 5D2NB 4BFEA 3VWJA 3TN0B 3HC4H 4KQ4H 4NFCA 4N8VB 5IK3B 3SQOL 1HCFX 5DJCA 2WSKA 3S9DB 1AXIB 4U0RC 4X99B 4WHDA 3GMMA 3ULVC 5JHLH 2OTUA 2PYFA 1P5UA 1VCAA 2WNGA 1I4FA 3CDFA 1ZT7B 1FYTB 5BW7C 3QFDA 5DZNA 4MAUH 1QFUL 4PJDE 5DRZA 5JXAL 2X10A 5TPWH 2L7UA 1PYWA 1ZWIA 2VLJD 3I2CH 5EPMA 5GHWH 1QACA 1IGJA 2EIDA 3QB7C 1OT2A 1X6LA 1EZVX 2B1AL 2B39A 2DAVA 1JYWA 1G7QA 5D7SL 4F3FB 2NY4B 5IQ9B 1QYGH 3GSNB 2P8PA 3ZHDA 3TO4B 3ESUF 1BVKB 5KSAB 1Z5LB 4GG8B 5LWYL 3RVVC 2BX5A 2NY7H 4LHUG 1OAXL 4XBPA 4Y16B 4HJJL 1TDQA 2F8VA 2IH1A 4OGYH 3QUZC 5DJ0A 5FGBC 2HMIC 1P2CA 1UWXK 2HRPH 3OR7A 3D2UD 4Z7OE 3VGFA 3BEVB 4E5XB 4JHZA 5KW9H 1ZA3A 5B39A 3T77A 5D6DA 5D93B 1KYOJ 2O5XL 1QP1A 3TA3B 5CZVH 2NX5A 3FAXA 4OM0L 1H3UA 4UTAH 2IALB 5HGHB 3GMOA 2B4CH 1KEGL 1PYWB 1ZWIB 4NQCE 2GITB 4AEFA 3TC9A 4XNMB 3DX8A 2DF3A 4LPYA 2A6KA 4JCMA 1PVHA 4O00A 4YDLB 1EEUA 2A2QT 3TJHD 2MHAB 5C70A 3P4MA 1KCVL 4G9FB 3H9SA 4RWYL 5D7IA 4WCYH 4UQ2A 4I3SL 2JK5A 1BEYH 4KUCD 1KBGH 1N3NB 3GSUA 4KH2A 5CWSB 1PKOA 4AH2A 4HDIB 4OF0A 5IB2A 1YEJL 3I2CL 4JZOA 3O81A 5GHWL 3WNOA 1MI5B 3MLRH 4BUGA 4Y8AA 5TPWL 1Q72L 2AQ2A 4WEUD 5DT1L 2Z4QB 4XBEH 2D0HA 5DD0L 1DLHB 1P7KB 2VNCA 5EWIH 4LP4A 5D72H 1KLGB 4LU5L 2ZPKH 5F21B 2NY0B 4MSWA 3T09A 2FO4B 1UZ6F 2Z93A 1VSCA 1VADA 2ZOLA 3IAGC 5EUOE 2PXYA 1WCBA 2LVEA 3VXNB 3WN5C 1MRCH 4S2SA 1TCRB 1OY3B 1YYLL 4LASH 3T1FA 1JGDA 1UJ3A 4WHTB 1FDLL 1I85C 4QRRE 2APFA 3O3EB 2Y72A 43CAA 2R39A 3VRIB 5HGGS 3VXMA 5I76A 1WQVT 4U6HB 4QRSA 3VMNA 4UT7L 1KLUA 5GS3A 5ICXA 4FMKA 4HIEB 5FGRA 1NAMA 1IL1A 4FP8H 2F8OA 3SCMC 1G0XA 2AI0H 1T6WA 4XPBH 3GJFA 4NKMA 3VG0H 4DOHB 3QXWA 1MH5B 3VW3H 3FRUB 1S7SB 5E00A 5JHDB 3RJQB 5JW3H 4L3AA 4POZC 4YC2B 5JMOC 4OZIA 1WITA 2ERJB 4NGHL 3CVHB 3N1FC 1YPZB 4NWUH 4Z6AT 3IFLH 4NN6B 3SJVD 4H88H 2H2SD 2A83A 2W0FA 2IADA 2H32B 3DMMC 4PYGA 4UV7H 2X1WL 5D1QC 1Q9OA 4O51A 5ID1A 3RWCA 1PKQB 4FP8L 1MCBA 4TOYL 4Z0BH 1ITBB 2XWBB 4U1LB 3MYZA 1BZ9B 3HFML 4I18B 4XWOD 3HE6C 3ETBF 5E4IA 3Q6GH 3LZFH 1IKFL 5IBTL 3KGRA 3WFEL 3SO5A 4QOKA 5IVXB 4RNRB 1U8IA 5J8OA 1MRCL 2R56H 1A6TA 4JGJA 4ZTOH 4MNGA 2W9DH 3TF7C 4Z7QE 3GK8H 4PJXA 2F53A 1FL3A 4PBXA 4UUJB 5FGCE 3X11B 1MFAL 3E8UL 1LO0H 3LEYH 2WWKT 2G9HA 4P57B 3NA9H 2K7PA 1S7QA 2EDTA 5B39G 4I0KA 4OD2A 1C7TA 1BMGA 4P2RB 2ATKA 2JB6B 1I7ZA 3TWCL 3LSOA 4XZUB 5EDXA 4YNYB 3SY0A 3P0YL 2H32A 4WGWB 5DRXB 1NGZA 2JIXB 1BVLA 5I71B 1F02I 3RL2B 1AHWC 2BSSB 1UXWB 3SJVB 3B9KD 1ZHLA 1K6QL 1FVCB 5TQ2H 1NBQA 5C6TH 4BFIB 1LO4L 2ZG1A 5CJOH 1JVKA 1EFXA 1FP5A 3TN0D 4QYOA 4PJ8C 3T0EC 4RSVA 3ARFB 4K8RC 4QYOB 3O6KH 3BVNA 3CD4A 2X09A 1UACH 1AGCB 4W4OC 4M7ZC 2AK4B 1ZLWH 4LHQB 3GSWA 4KJQD 4Z8FL 4J3TA 4HT1H 5HI4D 3UJTH 3PNWB 3RNKA 1DTUA 1DBML 4WENB 5B8CB 1QRNA 3VA6A 4UUJA 1GIGH 1U3ZA 1BOYA 2ZG2A 3VMPA 3DX6B 2DLHA 3MV7A 1CT8A 5CMAB 3GB7B 3M1BA 3IU3A 2HRPL 1DUZA 4G7VL 3C09B 5CWSA 3O2WH 5D96B 3IDGB 2WINA 3NZHH 1OAXH 1MPAL 3TBVB 5EFIB 5TQ0H 3HPLB 1LD9B 1H15B 1QHPA 1ERNA 3HLAB 3FOMB 3ZTJG 4CU6A 1I9JH 1SYSA 4IRSA 1N8ZA 4LSUH 1L9MA 4XPFH 1NC4B 2HH0L 3BZDA 3DBXB 3ARPA 3KWWB 1GC1L 4LPUA 3ZKXC 4NWTL 3GHEL 4PJCA 3GMNB 3R0MA 5GZND 2V5SA 4Y5VB 2RGSA 1HWGB 1HH9B 4EBQL 1KIRA 3B2UD 3EJZC 3CH1A 4ZYKA 3LD8C 3T1FB 3C8KA 3HZKA 3QDGE 4L4VA 1T7VA 2FR4A 4PJ7F 3U30B 1BD2D 2DBLH 1TVDA 2HG5A 4NOFA 2PUQT 1G9MC 3RIFF 1K4DA 4GMSH 5IBUB 1UG9A 1IKNC 1MPAH 3O3BA 4LLMB 3RU8L 4X8XA 1IGMH 1J10A 1K4CA 1S78D 3O2WL 4KDWA 5EBLB 3OV6A 2XWJA 3LKOB 3CFCL 2GTZB 3TBWA 5FYJL 5C86A 1G7JB 1X5HA 3P0GB 2VAJA 1UH4A 4JPIA 3L3GA 1JPSH 5DC9B 4OSUH 3OKOA 1NFDE 2VE6B 2AJZA 4MDIB 5T3ZE 1RSFA 2R8SL 1UWGL 5FCSH 1BPVA 1JPGA 2X5PA 2ESVE 3D1MC 1SYSB 4IRSB 4OD2B 5I75C 4J23A 4IRJD 1CDIA 4DGIL 1T0NA 2ADJA 1I7RB 1C16B 5GGRB 1DLFL 4F33A 3MGTB 5TGBA 1I7RA 3ARGD 1Y6KR 1TTGA 1UZ6E 4ZYKB 4K7PX 1LO4H 5INCB 3O3UN 2CIIA 1W72B 1UB5B 2PYED 1YMMD 4KJYA 2IPTL 1F45A 3T77B 2EKJA 4FXGA 4PJ5B 2YMXH 1IM9B 2EE6A 4K71B 3PWNA 4PJ8D 3WJJC 1BREA 3GUTA 1TPXB 3B5TA 1CXIA 4UU9B 5C0BE 3B9KC 4GS7B 4YO0B 1A3LH 1XH3A 3E8UH 4M6NL 3F7RA 5HPOA 5IR1A 4OLEA 4JFZH 3TIEB 3V8CA 5BQ7B 2F53B 5J89A 2VDQH 3BQUB 3IU4H 5L8LB 4ZG1A 1RULH 3CLFH 4ALAH 2J8UB 1JF1B 5IFAH 3QEQA 5MENB 1SY6A 3BPNB 5FDYA 3RAJL 2Y1VA 3JWDH 4UT6L 5DQJA 3VWJD 2XZAL 2ZP0T 4V1DE 1WT5C 1ZLSL 3PL6D 3C08L 4M62L 4X6CF 1JYXA 1A14H 1VEOA 3N9GH 2DWEA 5AG9A 4DJMA 3FAWA 3MRJA 1CXFA 5J3HC 3AB0B 1N4XH 2EDEA 3FOMA 1E4WH 2R15A 3B2UC 4KWUA 5HI5D 3GIZL 3U6RB 3AS3A 2EIBA 2NX5D 5E9DE 3UBXI 1JNLH 1NMCB 3LS4L 3IB4A 4AMKH 5KN5B 4TRPL 1MF2H 1NC2D 2XZQH 4N0YL 3JWOL 3VWKD 1RUMH 1TTFA 5HDBF 3KHOA 1LO2H 1NC2A 3U0TB 5DJ0B 4NO2B 3MR9B 1WT5A 4ELMF 3DARA 3HPJB 3NCJL 1HN1A 4Y4KA 3OB0K 2CR3A 5B8CA 4ELMB 1S9YB 4QRPB 3I3EA 3E6FB 1R3KA 4PGDA 4CDHA 3WNMA 4ALAL 1I4FB 2G5BA 3MODH 3CNKA 3RVUD 1QBBA 5TDPA 2Q86B 2Y5TA 1TJGL 1JF5A 5D71L 2C4FU 3QEHA 1NAMB 1K4CB 4JY4B 2Y5TB 1I8IA 2X70A 5FECB 3T0XA 4PJDF 1QLEL 4FQ2L 2E9WA 3D18A 1E28B 1LEIB 2EYSA 4WW1A 4PJEF 1FORH 4FA8A 1CYGA 2CKBA 5IGXH 1S7UB 3HE7B 3NH7H 1KEMH 3LOWA 1IAMA 5ACMA 1SMOA 1XF4B 4MHHI 2XN9D 5J1AB 4PJAB 4OZ4B 3ILQD 4U6TA 5HHPB 4FQJL 4IIQB 4RFOH 3EDDA 1DFBL 3MREB 4MNHB 4IMLB 1U6AH 2FGZA 3V5DA 3PDDA 1F00I 1KFAH 1RZKL 3QFJD 1TZIA 3U9PL 2D0FA 1QO3B 2QJDA 5AAMA 4F7CA 1LK2A 1I1YB 5GGSB 4XGZA 5CP7A 2HG5B 2P4AB 1KNOB 2FWOB 1ZA3B 1IGYA 4OZFB 4L4TB 2IH3B 3W9EB 2R8SH 4EBQH 3MRGA 5F96L 4HUKB 1GSMA 4UTBL 4PJEE 3PP3K 2CRZA 1AKJB 3ZSSA 3MRCA 1FIGH 4YO0A 2A6KB 3FT4B 3VGAC 3DPBA 3F5WB 2GAZB 5AWNH 3RU8H 3QWRA 1FH5H 2GAZA 3CX5J 3GJEA 4GRLC 1A6UH 1WUNT 5ICXB 1MUJB 1U8KA 2AVGA 1FQ9C 4PRNA 5D6CA 5DQJB 3SHSA 2GJ6B 4PGEA 2CLZA 3MOAH 5IB1B 3BPOB 3MPCA 5LQBH 1VEMA 3D87B 3VDBA 4FFWC 2O93L 2Q20A 2E27L 3MNVB 2I9LA 4RX4A 3PWUB 2NXZD 5GGSA 1A5FL 4KTDL 4PGZA 1I9JL 3D85A 2VLJE 2DLEA 2NY1C 1QPXA 2FEDD 2Z93B 2E7MA 4HAGA 9CGTA 3GMOB 5I8KL 3ZHKA 3V4UL 4XP6L 4G6AC 4I0PD 4WTXA 3PGCA 4QEGA 1YNKL 2D7TL 3QIUB 2EZ0C 1G7PA 5EOQL 5FYJD 1Y0LB 3EO1B 3QA3A 2Y4SA 4ELMA 2B1AH 4PJGF 5AUMB 3Q5OA 3N0PB 4XC3H 3WDJA 4B0MM 4NM4L 4RMTA 1IBGL 1CDCA 2NYYC 1P1ZA 2PTUA 4GKZA 3VG9C 4OF6A 1LDPL 4CMMB 5L6YH 1U8IB 3CZJA 4JN1H 3MOQA 4X98B 1I8MA 1EX0A 1BQHG 1KN2L 2EYSB 4HT1L 1R3HB 3FQNA 5D1XC 3FKUS 3QR2A 1U3HB 2HTKC 1MOEA 1PG7H 4XCEA 3AC0A 1MH5A 3QNYA 3VXSD 4LLDB 1M6OB 4DUWA 2VUOA 1YN7B 2DWEB 1XGQA 4H25B 3KXFA 4X6FB 1YEGH 1OHQA 2H2PC 3UTTA 2Z31C 4LK4A 3NCJH 3DECA 4R96A 4WDIB 1DBJH 1MFDL 5KSUA 1LO2L 4YNYA 3G04B 1P7QB 3WNLA 3BH9A 4D9QD 1JGEA 4WEMB 1E27A 1W72L 3H3KA 3WIIH 4XAWL 3MLZL 1I9RH 3LB6C 1P2CB 3TP4A 5GS0C 4KJWD 2XA8H 1OLZA 4I3RH 2PR4L 2ZUTA 3EO1A 3QA3B 3QIWA 1I1YA 3EJYC 1P84J 3TH4T 5K9QI 1ZT7A 5T1KA 2HFFA 1F6FB 3RGVA 4OZHE 4C56A 1UA6H 4HMCA 1A6VL 3JWDC 4P4KD 4EXPX 3OKLA 2E7LC 1BECA 5FUOH 4FQ1H 1EEZB 1NGXA 1R3HA 1I7TB 1LDSA 2YRLA 3Q2CA 4UT6H 3C9NA 3IFLL 2ICWA 1EEZA 1NGXB 1LK3L 3RVTC 4JPVH 2Q8AL 3M17B 4G8GB 1DBJL 1N64L 2A9NH 2LABA 4OD1H 2H8PB 5K33A 3O2DA 2Y6SD 3OHXB 3I9GL 4JFZL 5CEZD 3CSBA 4RQQ