4I2XB

Crystal structure of signal regulatory protein gamma (sirp-gamma) in complex with fabox117
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
229
structure length
229
Chain Sequence
EVKLQQSGPELVKPGASVKISCKASGYSFTSYYIHWVKQRPGQGLEWIGWVFPGSGNTKYNEKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYFCARGNYDRAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGKHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FabOX117 light chain
publication title Crystal structure of signal regulatory protein gamma (SIRP gamma) in complex with an antibody Fab fragment.
pubmed doi rcsb
total genus 47
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i2xB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i2xB02
1QKZL 4GW1B 4NQEB 1YEIL 3ZTNH 4JKKA 1YEDA 2YHGA 5DHYA 1E27A 5K9JL 2YA0A 2EE9A 2AJ3A 3BPNC 5F21B 4RMUA 4HX1B 5CBEA 4RA3A 4X9GA 5J0BA 2K9UA 5F9WB 1C12A 4OTXH 4PJIE 3TVMA 3B9KD 3JV5A 2VDNH 2Y07L 4EJ1C 2ICES 1J7VR 3FFCB 1FE8L 1IZKA 2VLRA 5JNYA 5TQ0H 1OAKH 2MKWA 4TVPD 4FQLH 3FRUB 3OXSB 2FR4B 3BJ91 5SV3A 2ICCA 1INEL 1LK2B 1RIHH 2FWOB 4LPUA 1FVDB 1PG7W 5IGXL 4G8GE 3BGAA 1VACB 3QZWB 4QOKE 4NBZB 3MX0A 3WL9A 1M05A 5IT2L 1QBLH 3VFUA 1ZGLB 3A0OA 3ARDB 1IEBA 3UXFA 2Q8BH 4G6JH 1EVTC 3T0DA 3UPRA 1VGKB 3L3IB 5TF1H 3OAYK 3BP7B 2FH6A 1QBBA 4L29A 5C0JB 3S8WA 3VCLA 4DK6A 4PYGA 5IHLB 5ADOL 3QWOB 5DJYB 1JNJA 4XP5L 4ZTPH 1I7RA 2OLDA 1IL1B 1AHWB 4GMSH 4JO2H 1EMTH 3T09A 4OZGA 4XPFL 4Y4FC 1HK6A 5E8NB 2I07B 2Y1VA 4WFHE 3FT3B 1V7MH 3EDFA 1BOGA 2HLFD 4NO2A 5DWUL 3EZJB 1CS6A 1MCOH 1WT5A 1RJCA 2CXKA 1U8MB 2R39A 4RGNC 3ULVL 3NFNB 5FYLH 2RGSA 4DVBB 1MHPH 1DQMH 3O3EA 1V3LA 2M1KA 4JRYD 4PRPD 4XWGL 4XCFH 4XBPB 3L7EA 5I1AB 4ZFGL 4YFDB 2P7TA 3CSYB 5CAYB 1V8HA 4U1HA 4FMKA 3VFSB 5B39G 1QFWM 4QRQA 3OR7A 4WFFD 5ILTH 4YPGA 4WTZA 4LFHD 2PYEA 1NC4A 2XI9A 12E8L 5DK2A 2X1WL 5C07D 3PQYB 5IK3A 4Y7MA 3T0EE 4DEPC 5KTEH 5F6HJ 3QDMA 4NRXB 3I6GA 4WV1A 1MLBA 4E42A 1XGQA 4LOUD 4I3GA 3RWCA 1KTLA 4HEME 3D25A 2O5XL 2OXGA 4GRLD 4OZGF 2O5YL 4X4MA 1WBZA 3VD5A 4Z76B 3MODL 4JZOA 3A6CL 4JFOA 1JUFA 3KPPB 5I1IH 1VFAA 4A6YA 4U1SA 5IR1B 1JHKH 5C09B 1ADQH 4HIHB 3KLDA 4LPWA 1V5JA 2D31A 1F8TH 4KTEH 3C60D 3LQAL 4RGOL 2Q3ZA 1A64A 5JR1H 1IT9L 3OJDB 2XY1A 1N7MH 3H0TA 4DK3A 5HGBB 3GMMA 4P4KA 3SE3A 4PJDB 1HHIA 4QRRB 3RWFB 4M1CD 5TE7H 3QULB 5CLTA 3I75A 2OXHA 4F2MB 5M95B 2G5BB 3WXVL 4XC3L 4ZAKA 3TH3T 3RPIB 2XYCA 1E4XI 2GK0B 4YDIL 1T83C 1UB5B 2QTEA 1QLEL 4Y1AE 2JB5H 4ZXBB 5T1KA 4TQEH 1IM9B 1T03H 1SY6A 1U8JA 1OY3B 3U1SL 5GS1C 1T0NA 5EFIA 1KTDA 2YPLE 4KK6C 4P3CH 5HDOA 1R5WA 3MZGB 3O41A 3VXOB 3TBSA 5TQ0L 1NGWA 1OAKL 2CDFA 3QIBC 1YMMA 2A6JB 2CR3A 3JZ7A 1QFOA 2FH8A 5M7QA 1DANT 5JXAH 4PLNC 5LWYH 1EZVY 4HWBA 1TTGA 2W92A 2ESVA 5EBLB 4PJXB 1QEWB 3CUPB 3T0BA 4FNLH 1J10A 3RTQB 4LLVA 2EXWD 2A2QT 3H7BB 1IGYB 3O6KH 3R0NA 4JN2B 4JDZA 1AQKL 4TSCH 2ICWJ 4U6YB 5HYSG 1SJEB 5GHWL 4U1NA 3M17B 1M6OB 1ZGLM 43CAA 1Q38A 2YS4A 3PJSA 3LKNB 4Y19A 5E2VL 1T7YA 4P57B 5ERWB 4OFKA 5H37H 1KPUB 3FT2A 1FFPB 4XC1H 2W07A 3KG5A 1X5IA 1C7TA 1AD9A 4DGVL 5HHPB 1K6QH 1OOAA 4PJCA 2ARJA 5DJXA 1DDHB 2V9QA 1TTFA 2WNGA 3G9AB 4G6MH 1FGVL 1DQML 3RIAK 3MRCA 4XCFL 4PLJC 4GRWB 2RIKA 1O0VA 1F97A 1RAMA 4YBHA 5I1EH 2EIDA 2B1HH 2L0DA 1EGJA 4PJ7B 5IBTH 1ZT1B 1MVFA 2NXZD 3PHQA 1GHFL 3QDGB 5CMAB 5J3HD 4KKAD 5B8CA 3SE8L 2X4OB 4H5SB 5EU4A 3V6OE 1U8OB 4RAHA 1F02I 4ZSOE 1RZ8B 1BVZA 3VWKB 4A6YL 4GAJH 3NFPB 1L0QA 3ULUD 3ZKNC 3OR6B 5FHBL 3KYOB 4XWOC 4YAQA 5E00A 1S9VB 2FEEI 4CN4A 1LO4H 3LRHA 2XRAL 4IOIA 5ENWB 3MLSH 2JK5B 3AMKA 5C71A 5D1XD 2FATH 1P2CA 4WNQB 5FKAA 4PJCF 3ZL4L 4BFIB 4GKNB 1W0WA 2DWEB 5ITFB 2R0WH 3ARZA 1RIVL 3O6FB 4C55A 2B5IC 3IVKB 3SPVA 1KJ2H 1JF6A 2GTWA 4JM2D 5GGUB 3QYCA 3OX8B 5AEAA 3T2OA 5E70A 4RSVA 4QXGL 4MNHA 3EW3B 3P0VH 4S1RH 4XP4H 1R5VA 1T20A 3Q48A 3NAAH 1PGRB 4NKOA 4OD1H 1X5ZA 5B4MC 5TE7L 1S7WA 1HSBA 3FQUB 3IU4L 4XNYL 4X6EB 4QHMA 5HGHA 1SY6L 2ZG3A 3QUMB 5HY9B 5AUMB 3HAEG 4XXDA 1I75A 4JFFE 3DECA 4QRUB 1B6UA 3ZTJG 1FN4B 4G9DA 1IQDA 1NFIB 1Q72L 4NC1C 5C2BL 3LEXB 3MV9E 2KZWA 4HLZG 1WCBB 2WWMC 5C0CB 1T03L 2E9IA 2H8PA 1MRCL 1A3RH 5KSAD 1BZ9B 4G7VH 2QHLA 4HWBL 1CE6B 3O4LA 1IM3A 5CEZH 1P6FA 4XX1E 2NW3B 3BPOC 4FFVD 5E94B 1H5BC 2ZZUT 5FCSH 4L8CB 1F13A 1I1AC 3NPZB 1G6RH 3PWJA 1KN2L 3TZVC 4TULL 5I1DB 5E5UB 1XCTB 4PJ9D 4X9IA 1W72H 4JE4B 2NY1D 2R2EB 4Y5XA 3LPWA 4FNLL 2D7QA 1AC0A 2H6PB 4YHLL 2VLJB 5EU6B 5DJ6A 3SQBA 3QQ9D 3BGMA 3QXUA 4Q9RL 3MXWL 1FL6A 5CZXD 3FHQA 5HHMD 2ZPKL 4EEEA 2GITB 2V5RA 4C4KO 5FO7A 4YC2B 2IH1A 2VXSL 3BP4A 1I4FB 2WUCH 3DUUB 4P3WA 3UTQB 5J06A 1EBAA 3VFVB 2ZWLT 4OJFL 25C8H 2PR4H 3UYRH 1MFAL 4PP2A 4JO3L 3OKYA 4NKDB 4TTGA 4DZBA 4M1DH 5IW6A 1BBDL 1A4JA 4M7LL 4R3SB 4XC1L 4JY4B 3WFCH 4Y0GA 5DUMH 5HHNB 3I2CH 3TBVB 3BSZH 4ISVB 1EGJL 3VXRA 3LKQB 4POZD 2WUBH 3V5DA 1QO3B 5EOCL 3CMOL 4HUUB 1MFCH 3MOQA 5TPWH 4J3OC 4NRYA 4UILL 1FDLH 1MJJA 2VZ1A 4ONGH 2VC2H 1G9NC 2CIKA 3KHOA 1EFQA 2L7JA 4X7FC 3D6GA 1F45A 1DLHA 3UTTD 1CN4A 4GXUM 2W0FA 2R29H 3DXAB 1ZKAA 2EXYD 3NA9L 3HS0B 3AREA 3ZZ1A 4AMKH 4QRTA 4CDGC 1REIA 1CD1B 1ZXQA 2PCPA 3UPAA 1SEBA 4NO3A 4Q6IA 4WI2A 3SGDI 1JZ5A 1UGNA 1B4JH 3VWJA 5IW1A 5T5NF 3VD4A 4J4PA 2V2WB 2VLKD 5FCUL 3DTXA 4YE4H 3MTRA 3FQXA 4MQXC 3GHEH 1U92A 4OCMC 4PRIB 5CSZB 3IDMA 1AO7B 3MRGA 4I9WD 2DWDB 1RMFL 4G5ZL 2N7AA 4F3FA 1A14H 1WZMA 2VL5B 1S7TA 3QQNA 3X14B 4G80B 1FG2A 4NGHH 3H9HA 4BUHA 5C9JA 3D5OF 2QSCL 3OQ3B 4FZ8H 2I5YL 3BRDA 2Q6WA 1KOAA 3EOBB 3FO9B 1A6ZA 4S1RL 1BIHA 1TZIB 1FO0B 4Z5RB 3KPMB 1QG3A 3P3YA 3VA2C 1IE5A 4L4TB 3TP4A 4M6AA 1HI6B 1UWEH 3KWWB 3QFJA 4KGJA 4BH8B 3HC0A 4YIQA 3W82A 3JVGC 3ECBA 1CFVL 3IJHA 4QWWC 3GSXB 4G7YH 1YY8B 1R3JB 3LS4L 2JCCB 4RWYH 3L1OH 3HZKB 3E8UH 4OFPA 3X13A 1PEZA 5ID0A 2Q3AA 4NUJB 4KK8D 1CD9B 3QEHB 4G7VL 3RI5F 3ABZA 1T2QH 4HKBB 2VN7A 4JDVA 5KVDH 1HYRC 3NCFB 1I1CA 3O9WD 3QJHB 4K94C 1FAIH 4Y16A 1OTUD 4GLRI 4J3VA 1CBVL 1ACZA 4R90L 5K9QG 1S9YA 2VISA 1FSKB 4IRZL 3VRIA 2AP2A 1HEZB 1E6OH 5A3ID 4PJFE 3CZFB 1D5IL 1IC5L 5I18L 5SX5K 2R56H 3DIFA 1F5WA 3OG4B 4GO6B 4UQ3B 2LTQB 2FBJL 4G8FB 4XPBL 3EUUA 4LCWD 1S7UA 1HINH 3BXNA 1BQUA 4WWKD 3TLRA 4BKLA 4BSWA 4JFYB 5FB8A 1BP3B 1EX0A 3NH7L 2HWZL 2YRPA 1VDGA 3EZ8A 5I1LA 3V4UL 1RHHA 3H9SE 3V0AC 3DV6B 3FN3A 3MRIA 3DMMA 4R2GC 5L2JB 3TT3L 3N1QC 5FK9A 1BD2B 1EIBA 2WUCL 2DJ4A 1CLOH 3HZMB 1CK0H 4H8WH 5F9OL 5EOQL 3SE4C 5E5MB 1MLCB 1BX2A 3HB3C 4P5TA 1T2JA 3H8NA 3TA3B 3VD7A 1NKOA 1RZIA 4J7RA 5KS9E 3QP3A 4ONOA 3H7LA 4P46C 1R0AL 2MFNA 3AM8C 1NSNL 2MQCA 1AGFB 4TN9A 3RUGB 5KJRH 4FQXB 3MJ8B 1CXEA 4PJHE 3L6FB 1EZVX 2WUBL 5DRNB 1WWAX 2IMMA 1TVHB 2VNCA 1RUKH 3NVQA 4P3DB 4LDEB 1MFCL 4XVTH 3KPNB 5TPWL 3W5NA 4DGYL 3P0GB 1J0YA 3NCBB 3T0VA 4ONGL 2BY3A 4UDUA 4NT6B 1G7HA 4O2EA 3NN8B 2EYSA 1M7DA 2Y5TA 3QR2A 5CSBA 3B3IA 4GG6B 1J9CT 2VDML 2AQ2A 2R29L 2BNRB 1YNKH 1HHHB 2ADGA 3R06B 4MD0B 2AGJL 2OZ4A 3MR9B 3B9KA 1OSPL 1WQVT 3NPSC 1OTTD 4EI5B 4KVNH 1KB9K 3IFNL 3JWNC 4HLJA 3QPXL 4JEGB 3FT4B 2XXMB 1NGXA 3ISWA 4WIQA 1YNLL 1JWSB 2KQNA 1J5OH 3IDYB 1EHAA 1XR9B 4NQVB 2X4NA 2CKBA 2A6IB 3GO1H 4U1MB 4XMLL 1F11B 3JSSA 4X6CA 2P47B 5SWZB 4KRLB 4HUMB 1NAMB 1IGIH 4NGHL 3TYFA 3QUYD 5L0QC 2H2PD 4EXPX 3DVFA 3PHSA 4K8RH 3I02B 5BVJA 3VG0H 4M7JL 2UWEB 1ZVHA 1HQRB 5HPMA 4JZJA 2IQ9L 4MA8H 4R4NC 2F54E 3CLEH 5C0EA 5ID1B 1MY5A 3L3DA 5H35A 3S88L 3TNMA 4K3GA 3RA7L 1NMCB 1L7TH 1WZ1L 3CFDB 3AROA 1AGBA 3EO1B 4OZGE 1VPOH 4O5LL 4Y89A 3U0WH 3SGJC 5DURB 4EBQH 5I9QB 4WCYL 4EUPG 1AXIB 1UA6H 4P5MB 1QSFD 5IB1A 1CDIA 1OP3K 1NBQA 2VDKH 3RZCB 3D2UA 1A6WH 5F7DA 3W11C 4ZNEA 5IBUG 4PY7A 2X4UA 1AR1C 4CU7A 4PRPA 3L7FB 1PYWA 1X6NA 4JRYA 4Z7QF 1P53A 2NZ9D 2R4SL 5D7IB 3MNZA 3PNWB 4EDWH 5DEZA 4X6CF 3RDTC 5ACLA 5IB4B 1G7QA 2NY3B 2C3WA 3MACL 3ZSSA 2ZSVA 3ARQA 1TQBC 2DTSA 5FYLE 5GSRA 4I0CC 4KHXH 4URTB 4IRSC 1LNUA 1F6AA 4OZFG 3KLHD 3BKMH 4KQ3H 2G9HB 5GSVA 2EDYA 2PYFB 4H1LB 5C07A 3GI9L 1YECH 5FKPA 3I85A 4NHUB 1FC1A 2DIBA 1CCZA 1YJDC 4KGLA 4Q97A 2N1KA 4X4ME 1CFSB 2ZUXA 1CICB 4GRLA 4LFHG 4YDKH 4I4WB 1DVFB 1QLFB 1RUQL 3RI5K 3MREB 1FYTA 4EVNA 1Q9KA 3LV3B 3VW3H 1CDUA 5IMOB 5FA4B 1CLOL 1QBML 3OKKB 2VDLH 3KPRD 5JHDB 3JWDC 5FGSA 4FQQA 4KROD 3JWOC 2BP3A 4BELD 1T1XB 3C60A 1HXYA 1CFNB 4UT9L 4OB5L 5ESAA 3MV7D 1DN2A 4KTDL 4O9HH 4KMTL 1KCUL 3Q5TA 3N85H 4NSKB 3T0EC 1K8IB 1RURH 2QJDA 4PJGA 4K9EC 3QI9C 4D0DA 2VKWA 3WS3B 3HRZB 3SDXB 4MS8C 1QYGH 2OZ4L 4XVTL 3NCEB 3D85B 3QNZA 4QTHB 4GXUN 2V5SA 1I9EA 3GFUA 4WWID 3ZE0F 3LZFH 4YHIB 1T66D 5JIKA 1RUPH 2KBGA 4JFEB 1OARL 5ALBL 2RJMA 4JVUA 4TVPL 1UC6A 3NFSH 4YBQC 4U1LA 3QJFA 3KR3H 3LOWA 5F44A 3BYTA 4NQCE 2CKBL 1U8NB 3OB0K 2R0KL 5BW7C 4UBDC 4KY1H 4KVNL 5EOCJ 3BPNB 1D9KC 3FCTA 3CFBB 2HMIC 1JGUL 3EO0B 5KVGH 4XX1G 3QEGH 4L4VE 4L3AA 4CADA 4JY5L 3OG6B 1WGOA 2R4RH 1J5OL 3U9PH 1JMZA 3ARPA 4WFED 1AGCA 2QQKH 4N1HB 4XMKH 4LRNL 4U1GC 1AXSA 5C3LD 4HXAH 4JKPL 3BKCH 3QUZC 4PJGF 1NKRA 1QFPA 5C0BE 1UFUA 1FL3B 1DQTA 4X0KA 1LD9B 4S0SD 2E6JA 1D5ZB 3VDCA 2D7MA 4OLZL 2QADB 2Q7YB 3MOBL 4NNYA 1G7JA 2XQYG 1T1WA 4L8DA 4MA8L 5FO8B 3CLEL 3LN5B 1SYVA 2D03H 2DBLL 5F6HI 4MQ7A 5JW3H 2NXYC 4M7LT 1U8KB 2VLLB 4M5ZH 3SQOH 4FTVB 1U8LA 1L6ZA 3FB8A 4J23A 3U0WL 4S0TD 2JJSC 3CNKA 2F5AL 1D5XB 1UXWA 4PB9H 4RMSA 1GGBL 1S8DA 3OL2A 4I0PB 1RZGA 4WI8A 1NBVL 3RAJL 4MB4A 2DM3A 4KK5C 4PJBA 2W0PA 1DBAL 8CGTA 3KYMB 1AIFB 1P4IL 4YDVA 1BAFH 5LG1A 4OGAC 4RGNB 1VGEL 5D2LA 2H1PH 3HZYA 4IMKA 1DBML 4M6NH 4XTRC 4XAWH 5FUZH 4M48L 2I9TA 3I3BA 4FQ2H 4W4OA 3FQWA 1LK3L 1CGWA 4MGXA 3DX6A 3E6HA 4AL8H 4TUOB 3THMH 2X4TB 4NN5C 2DYPA 1A7RL 4JPKH 4ZOAA 3BWUC 2QHRL 2LU3A 1YECL 1YNTA 5KBNC 3SCMC 2P5WB 4U3XA 5DQ9A 3R1GL 1MH5B 4LLWB 3GMLA 1AP2B 3ZSTA 2DLTA 1OAXL 4DEPB 1DL7H 4LP4A 3HI5L 1Z6JT 2HLFC 5D1XA 1CU4L 2CRZA 2ZCKH 2VDLL 4IOFD 4X4ZA 1X9QA 2VR5A 4LCYB 4WHCA 2V2XB 2R1YB 4X6FB 4ODUA 1FNEA 1LMKA 5E95B 4PJBF 2PXYB 2MQ3A 3AS0A 5C8JB 4JM2A 1E4WL 3V6OC 5D2LF 4HGWA 4RAUA 5SWSE 2BJMH 4DVRH 1WBXA 1UKQA 2EZ0C 3BQUB 3M07A 3Q2CA 4YDJB 3CFCH 1R6VA 3SDYH 2PUQT 2XA3A 4OUOA 3B2VH 5CJ5A 2AKRA 1PKQB 4WHTA 4H0GA 4P2OC 3WN5B 1KEMH 2ICWI 5EO1B 3PV6B 4M9OA 3WLWD 1CI5A 5ISZD 3OKDA 2EDXA 2XQBH 2R69H 2X9YA 4YXLL 4HJJH 3GMOA 1YN7A 4HHAB 1X44A 4ZD3H 2PTTB 3S36H 5KSAA 2XWJA 1SBSL 3BPLB 1F3DH 2EDKA 3QEUA 2C1PA 2HTKC 3IS1X 1N8ZA 2E9BA 3FN0L 5I8OH 2NY6B 4YHOH 1KG0B 1G7IB 4L5FL 3REWA 2DQCL 2Z91B 4JFPA 2V7HB 3QEGL 4U3CA 2FO4A 1CTOA 4P23D 3BRGC 5CEZE 4JM2F 2V5MA 3IKKA 2Z8SA 2QQKL 1RHFA 5I1JL 1NFKA 2VDRH 4Z7UB 1U3ZA 1X4ZA 4W70A 2MTPA 4N8CL 4X83A 4Z7OF 4JVWA 1KJ3H 1ZVSB 2P44B 3BEVB 4MB5A 3BO8B 5DD3L 1XCQA 2CDEB 4MQSB 3VXTA 3WNOA 2DQDL 1HDMB 4FS0A 5DEFA 5BOZG 4JFXB 4FQ1H 2WQ8A 1Z3GH 1EEYB 3P4MA 5L7XH 1QA9A 4M8QA 3MRRB 3TN0C 5GQBA 5JW3L 3ZKXC 5SWQA 3FB5A 1KENH 1E4KC 4M5ZL 4GXVL 4OZHE 3NZ8A 5DHYB 1T5WA 1E27B 4ZG1A 1YYMH 1N4XH 2AJ3B 5CBEB 5D7JD 4PGBA 4P59H 5CIPA 1TVBA 1I1YB 3S34H 4PB9L 5MHSD 3U7YH 3QG7L 3GJFH 3VXRE 5L2KA 2IF7A 4HUNB 3O8XD 5TE6H 4Y4KA 2XZCH 1UADC 4NKIL 5EIVA 5JW4Q 1LP9E 1BOYA 2VLRB 3T65A 2OYPA 5CUSH 1UXSB 5CEXA 3ES6A 1F6FB 5F6IC 2NY0D 4HV8B 3MV01 3QXDA 1SQ2N 5KW9H 2OK0H 3SJVE 1KC5H 3MRDA 1MQ8A 5CWSA 1UYWL 3AS1A 3G6AA 1MJ8H 3UTTA 2DQFA 2H32A 2IBGA 2P5ED 1CQKA 2B0SL 3IDIA 5DJCA 3V6BR 4F7CA 1NUFA 3TWCH 1MJ7H 4JRXD 2FJFA 2HRPH 3D0LB 3A6BL 3HC3H 3VFUB 4X7SH 2QEJA 4QHNB 5CJOH 1IEBB 1G9MH 4LASL 2W59A 1U2HA 4MSWA 3UPRB 2EDWA 1XIWC 4G6AD 4KPHL 4NO0D 3HE7C 5EA0H 1ONQB 3PL6C 1EUUA 1MFBH 5ANMA 3W81A 4K07A 3NGBC 4Z7VA 4PIRF 4BQCA 2XIDA 2ZCKL 3FTGB 1I7RB 4TNVF 1Y6KR 2DS4A 1RZ7L 4IEFB 4DFIA 5HYJD 1IRAY 1QTYT 4HUWA 2BZDA 2CUHA 4JZNB 4QHUA 5LGJA 3W2DH 4NO2B 3CVHH 3TNNA 3PGCA 1F4YH 3DURA 3C5JA 1GPOH 3CK0L 3O3EB 2NY5C 2BVPA 2XTJE 3NIDF 3CXHJ 2ED9A 1UT9A 2Y6SD 5FYJH 1A6PA 2EDBA 2GIYA 3B2VL 5EH1A 4U1HB 4YQXH 4PJ5D 3K4ZA 2YA2A 3CVHA 4QRQB 5GRVL 3OR7B 3STZA 5D5MA 1T1ZA 5E8EB 3P2TA 1HWGB 4OM1H 4YPGB 4CVZB 1MAKA 5DVNA 3RX5A 2R0ZL 2CRYA 5EO0A 4JJ5A 1NC4B 2FX7H 4HJJL 5I8EB 3SDCD 5IK3B 4MA3B 3VRJB 3NCYP 2OR8A 3RVUC 3QDMB 5EUOB 2BVTA 4WV1B 1MLBB 1XGQB 1T5XA 3Q5OA 1JV5B 3AY4A 3BH9A 3C08L 2CUIA 4YR6A 3O9WA 3I84A 4RX4A 1L7IL 1T7XA 4NO5A 6CGTA 1WBZB 3TO4D 1CR9H 1JUFB 1VFAB 4PJ8C 4A6YB 3TEUA 4U1SB 3SKMA 2R1WB 1UEYA 3RVTD 4KZEH 3MNVA 4I2XA 3MUY1 5DJ2A 1S5HA 4FFWC 4KU1A 4Y8AA 2ZUQB 1ZHLA 2Z35A 4LCWA 3TZVB 4WWKA 3WJJC 4TYUA 3KAAA 1XF3A 2P42B 3VGGA 4YGVA 3H0TB 1ZHNA 3A67L 3UTSA 4YHML 2D7NA 3QEQD 3GMMB 4P4KB 2W38A 3HNSL 5KAQF 1HHIB 5D5MF 1BQHA 5FUCC 5D71H 3EFDH 5LJYH 4ZOCA 1IM9D 1UJTA 3I75B 3QXAA 1IAIH 43C9B 5I6XC 4S1SH 2GY7B 5E08H 2JELH 4FXKB 4F8TA 3RNKA 5EC2B 4DZ8B 1KENL 5DYOB 4M3JA 2GQHA 3PP4H 5F3HA 4O00A 5T1KB 1R3HA 3UBXA 4P59L 1LE9A 5F7MC 1T0NB 5EFIB 2ED7A 1MRFH 4F37K 4I48B 1KTDB 5TE6L 3IXAA 1O7VA 2X70A 3DX8A 4GKOA 3GK8H 4WHDA 3O41B 1CDHA 3TBSB 3FOLA 1NGWB 2CDFB 1YMMB 3HPJA 4ELMA 4P99A 4HS8L 3UYOD 4MJ2A 1MREH 5E03A 1MHHA 3PDDA 1QNZH 3PXHA 2J3SA 3UDWA 4GFTB 1N5AA 2ESVB 4L9LA 1JGLL 3PP3K 3ZDZF 2DB8A 5I2IA 4UTBH 1UB6A 1OM3H 4JDZB 2HT2C 3IKCA 4AEHL 5D2NA 5IB3A 1FAKT 5GRVK 4BZ1L 2OS7A 4G6FD 1NGYA 4IBLT 1A6AA 3K74B 1TZGL 4HIJA 5GZOD 4IRJD 4HIEA 3RWDA 43CAB 5CJQH 5EA0L 3WHXA 3OJMB 1MCPH 3PJSB 2VDPL 4Y19B 2J8UA 3CXDL 5FIEA 4J3WA 5CILH 5EZOL 3MLUH 5FEBA 1RFDH 1MEXH 3MMEA 2O26U 3RL1A 3FT2B 3CVIH 4XBEL 1CFQB 1AD9B 2I9LA 3KXFE 4ELMF 2ARJB 3QUYA 3CVHL 4XCNA 5DJXB 3TVMC 4NWUL 1CXIA 4K71C 3WSQL 4EN3D 2W9EL 3ZKMC 4OZIE 4WTXA 3LY6A 2EDDA 4MMZC 4OCWH 5FYJL 5AG9A 5DGRA 3VWKD 4MJ6A 2ZKHH 2A73B 2VXQH 2CGRL 3PABA 3I6KB 5I30L 4OD3L 5E7FA 3H42H 4OM1L 3VGEA 2O61A 1GGCH 1QSFA 3V6FB 3MRFA 3BD3A 5EU4B 4JO4H 1QSED 4TNVK 1QRNA 2J8UF 3NABH 4NOBA 4U33A 1QR1A 3VDBA 4YAQB 2E9WA 5E00B 2MJWA 3O6FD 1MCSA 5TQ2H 5J1TC 5DRWA 5H37G 4IOIB 1JZ2A 1XH3A 1F4WL 4QCIA 1MCLA 5J9PA 3MJGX 3HUJB 1IVLA 1JWMB 1J8HE 5FKAB 2EIBA 3MYJA 3TJHD 1JHLL 2UYLA 4M1GL 4EIZC 5GRXG 3MRKB 4B41A 3SPVB 1R3KA 2FJHA 3I3DA 3D39B 4K3DH 1Q0YL 2HG5A 4XXCC 3TFKC 1NH6A 5KZCB 4PLKD 4WFGD 1T20B 2IH3B 3CX2A 4NKOB 1S7WB 1HSBB 1CYGA 4MAUH 1FYTE 1NLDL 2CD0A 1IAIL 5E6IA 4XXDB 1ZANL 3P4LA 1E6JL 2DKMA 2JELL 1X5XA 1E4JA 4HUVB 3NCYS 2EH8H 3KPRA 4U05A 3MBXL 1NGQH 4G9DB 1IQDB 5I1CH 4LNVA 6FABL 3QIUD 4NKMA 3PHOA 1SYSA 2LVEA 3NCCB 4XNQA 4UMGA 3BESR 1OCWH 4AH2B 5KN5A 2H8PB 3MV7A 1M71A 4N8PA 4PJGE 3GBMH 3O4LB 2ZSWB 4LCUA 1IM3B 3HR6A 1JPFA 5IESL 4DKFH 3MRBA 2GY5A 4OGXH 2B20A 4MMXC 5FYKH 1NJ9B 3MGOA 5JIPA 3EYUH 3ARFC 1A1NA 5EU6D 4DW2H 3PWJB 2FCBA 3FZUD 1J1PL 3QDJD 5TFSH 5J56B 4XNZC 3RX8A 3SO5A 4MAYC 1E28A 2YD6A 2ZUTA 5HBBA 5DJ6B 3DX7B 3MV8E 5GS0H 4UT7H 3PIQA 4ZPTA 2G2RB 1KACB 1KF9B 1FL6B 3BOVA 1EJ6A 4XT1C 3WE6A 2ZUYA 3T4YB 1FGNH 1WIUA 3BIKB 4N5ED 5BRZD 3UTPD 5IVXA 5DLMH 2IH1B 2VITB 3BP4B 2NY4B 3AFLA 5CILL 3EJYC 3FQRB 3UCRA 4PP2B 5HVGB 3E1F1 4DZBB 4O2CA 1KLGB 5BZDA 1PQZA 1U58A 5IW6B 5FGCB 2R2BA 4N1CA 3GBNH 1LO5A 1B90A 1GL4B 5HVHB 4S1DC 4X4YA 4W6YB 3V5DB 3CLFH 1S7VA 5GGRY 2CJUH 4JFQA 1OGTA 2NCMA 3FQTA 2DMBA 1MJJB 5B3JF 2WAHA 4OCWL 5L0QB 2CIKB 4NC2B 1DLHB 4Y2OA 3QPQD 1H3PH 2J8OA 4YNYA 2W0FB 4NFCA 5T5NG 3U30B 1RZFL 2CLVB 4ZUWA 1FPTH 2GHWB 4YEFA 3MLZL 3DO3A 2DQEL 1R24B 4QY8A 4HBCH 4LVHB 2PCPB 2IBBA 3STLA 1M1SA 4NO3B 5IVXF 3RVWC 4LCIH 2UVFA 1JPTL 3S96B 4H88L 3VWJB 5IW1B 5ACZA 4U6VL 4G8GB 3IAPA 3G5ZB 3KYKH 3V95A 3FQXB 1ES0B 5F1OB 1U92B 5D2LE 4K55A 3ARWA 2EC9T 3IDMB 4GAYB 3VXMB 4F3FB 1J12A 3BKJL 5DMIH 3ZDXE 4NQSA 1OAQH 1YZZA 5D7LD 4UIKH 5DO2D 1SMOA 4YDLC 5A16B 3GSNH 1N0XL 1GC1H 5C9JB 4OQTA 3MCKB 3OAZK 4RGMB 1C5BL 2YD2A 4MYWB 1XGPA 3OF6D 1F3DJ 5TE4L 4UOW1 3BD4A 1A6ZB 3QH3A 4Y4HC 1MRDH 2J6EA 2ZNXA 3B4NA 2XN9A 3PWPD 3VFOB 1T6VN 4Q0XH 5JPMB 3QFJB 1T3FA 4Z9KB 2W1NA 3MLWL 1ED3A 4LMQI 4NQTA 1N6VA 2D2OA 3HC0B 4L9DA 4F58H 4YIQB 4FXGA 4NN6C 3ARGD 1W8OA 5F9JA 2JJUA 1FLTX 1CT8A 5K59F 1QLRB 5DRZA 1I8KA 1U95B 1TPXB 4MA1C 2AXFA 1AY1L 4PJAE 4GBXD 5EIIA 5CLWA 2BSSA 4JDVB 2HFEB 3SKNB 3TIEA 3MLXH 3U9UB 1MPAL 1YMHB 3LB6D 1K9TA 4WY7H 1S9YB 3WNNA 2VISB 5C0FA 3O6LL 3GEWB 3SDDD 4GS7B 3VI3F 5DMKA 2VL4A 1J1XL 1C7SA 4OF3A 5ISZA 4PJEE 4OGYL 4NWTL 5F7EL 4BK5A 3MSPA 1X3DA 1H3XA 1Q94A 5ECJE 1OGAB 1KCSL 1BF2A 5GJTH 4NRZA 1BQLL 2F58H 1S7UB 3BXNB 3VFMA 1JYNA 4BKLB 3MRJB 2AK1H 4HXBH 1C1EL 5FB8B 4OCXH 1P5UA 1A1OA 5HHOB 1U3HD 5HDBE 1MVUA 2E6PA 1RHHB 3EOTL 1RU9H 4OM0L 5I1LB 3OPZH 1KCRH 1SEQH 2NTFA 5FO9A 4D9RD 3MRIB 3DMMB 2Q76A 5FK9B 4NYLA 4JFDE 2A0LD 2IANA 1TVDA 5BS0E 4OI7A 5CJXA 5HTSA 4XNMB 3VXPB 2HTLC 4OQ1A 3CH1A 4AQ1B 5JORA 2OTUA 1BX2B 4P5TB 1IJ9A 3S35L 4N8VA 1BGXH 2DQJH 4KZDH 4JDTH 4LPTA 4YWGL 4MD5A 4RBPH 1JE6A 3F5WB 4H20L 4FABL 5C0AD 4UINH 3DVNB 4NQEA 5IJKA 5HHME 2Z31C 2B7DT 3O2WL 5T3ZD 2C4FT 3FAXA 1JL8A 3KPQA 3O4OB 4HX1A 3ZT5A 3PUCA 4UOJA 4ZS6C 1DBJL 1NMAL 4UDUB 1G7HB 4O2EB 3S4SG 3KPSE 1CDYA 4X6BA 3ARRA 1M7DB 2HRLA 2Y5TB 4EI5D 1OD9A 2Y25A 4LK4A 5FGBA 2R9HD 3MO1B 2FHFA 2GSGB 5FV2A 4IHOA 4KKBC 5D7JA 5C08E 1MCBA 1RSFA 4Y5XC 3OZ9L 5L2KE 4BSVA 2O5ZL 3G6JA 4HBCL 4N0FA 3B9KB 5I15L 1LK2A 3O8XA 4LCIL 5JDSA 4Y5YC 2E6QA 5E5RB 1VACA 2Q7NA 2Y72A 2BXZA 4F57H 1NCWL 3HC4H 3L5JA 4YXKH 2QQQA 5JOPD 3LCYA 1NBYB 4PD4J 4UIMA 1V3MA 2J5LC 4OQTL 1ACYL 3AB0C 3UTTE 4BZYA 2CKBB 1CLZL 1N64H 3SKJH 3L3IA 4N0CC 2P5EA 5AD0B 4X6CB 1NGPH 1OAQL 3RY5A 2J6EL 1K2DA 1SJXA 4JRXA 5DD5H 5C0JA 4XVJL 4XPAL 3TYFB 3DJ9A 3RY6A 1CGSH 3QWOA 5DJYA 5SX4I 3LN4B 5DFWH 3U36B 3GKWL 5GGRA 1G0YR 1QFWL 1KLFA 3BH8A 1WK0A 2BY2A 4L3ED 4Z0XA 5D9SA 5E8NA 2I07A 3H2WA 3LIZH 4NO0A 3L3DB 1F3JA 4LP5A 2DL2A 3TNMB 3X3GH 2YK1L 2VERN 1MI5D 2EIZA 5I75B 3LMJH 4XP6H 2ADIB 1AGBB 3G6JF 4U1IB 4DVBA 4HG4J 2FL5A 4F58L 3DETC 2VTFA 5BV7L 2DF3A 1OW0A 4ODWA 1K5NB 5IB1B 1N6UA 2DI9A 3AREC 1NFDE 1JK8A 5F7DB 1AXTH 4X80L 5INDB 3VFSA 5IQ7H 3HNTH 5CCKL 3ALWA 4PY7B 4Z8FH 4NJAH 2X4UB 1INQB 3DUHA 4PRPB 4G9FE 4JRYB 1ND0A 5DQDL 4J4PC 4PREA 3RP1A 1IC4L 5BQ7B 3L9RA 5D5ME 1B6DA 4GSDH 3QUKA 2ZSVB 3HFML 5GSRB 1LNUB 1F6AB 4LDOB 3V4VH 5FYJE 1DVFD 1K4CB 4GMTH 4MD4A 3SDCA 4ZTOH 5JZ7D 5C07B 3RKDC 4HQQL 5FKPB 2DLGA 2AK1L 5EZJA 4OBRA 4HIHA 4ODTL 2OMNA 4UNTA 1KLUB 1RU9L 1JWUB 3I6LE 1AE6H 4GRLB 4HULB 3D3VD 1WZKA 3TO4A 2XTJC 3SE9H 1Q9KB 1KCVH 5D1ZC 5HGBA 2DICA 4P2RE 1VKXB 3QIWD 2DKSA 3RWFA 4FQQB 1UJ3B 4AIZA 3QULA 1XGTB 1HXYB 4KZDL 2FEDC 4A2LA 1ZSDB 1CTNA 2V9RA 3HKFA 2G5BA 5MERA 3O81A 4FZEL 5ESAB 4M6OL 3ZDZE 3BJLA 3UTSE 2C26A 3C5SA 3LEVL 1JGDB 1WF5A 2GK0A 2HFGH 3QEQA 4JFED 4RFNB 4D0DB 1GRWA 4I18A 1BEYL 3P9MB 4XBGB 1BIIB 2VZOA 4HF5H 1RJZB 3G6DL 1IM9A 3VXSD 3QNZB 1II4E 5D6DC 3NIFF 5IMKA 3TF7C 1A7PL 1A1MA 3NTCL 3WS6A 5MP6L 2ATKA 2VZVA 3P73B 5KVMC 5BCAA 4OLEA 4NM8L 4RIRA 2XWBA 5LCVL 3QT2A 5H94A 4WI5A 3QJFB 5KG9A 3MRNB 1H8OA 1F58H 5F7NC 3ZKXB 4MA7H 1WC7B 4PG2A 1NEZG 1QEWA 2V9TA 3CUPA 4MZ2A 5HD8C 2AJSL 2OR9L 4PJDF 3FCTB 4G43B 4YXKL 2PNDA 2E7LA 1BREA 4CADB 5A2IH 1A7OH 3MYZA 1NBZA 4AT6B 4JB9L 1Z9SA 4WDIA 1AXSB 1N64L 4H25A 4D9LH 1SJEA 2PN5A 4ZO7A 4PTUA 3EYFA 5DQJA 1XR8B 4X0KB 1INDH 2ZNWA 5DD5L 2D9CA 3V4PL 5D2NE 1MELA 3WIHA 3NACH 1AD0A 4WEBL 4P4RB 4FTVD 4NNYB 1G7JB 1ZTXL 1N5YH 1MCDA 1OP9A 3QNYB 1RJYB 4H8WC 4L8DB 4UZGA 3C6LC 1SYVB 4HC1H 4O4YH 4AEIH 2WQRA 3LKSA 1OTSC 1VFMA 1Y0LA 4HH9A 1J0JA 4Y4FD 1LHZA 1FIGL 4IOSD 1HKLH 1U8LB 3FB8B 4YHKH 4POYA 4LHUD 3N1GC 1FNSH 3P77A 5HPOA 4HWEH 5CGMA 4RGND 4HH8A 4KUZH 2G75B 4Z6AT 4ALAH 4JCLA 1UKSA 1BJ8A 1N59B 1RZGB 4EN3A 1ZT1A 2JKXA 4JG0L 1IKNA 4GLRH 2VQUA 2VAAB 4ODSL 5FM8A 4JGMA 3PE9A 4PJBB 5BJTA 3B5GA 1TITA 4FP8L 1QR4A 4YDVB 3VWKA 3NFPA 3F7PC 3HZYB 3UTOA 4NZRL 2NXZB 2I9TB 2K1MA 3FQWB 1EUTA 1PJ9A 4NQDE 3E6HB 2JK5A 2NPLX 2Y06H 1IEHA 1QRNE 5K9KB 1QSEA 1X4XA 5I71C 2UY7A 3KDMB 1YNTB 4L8BB 3VE0A 5DQ9B 1OL0A 2CR6A 2DWEA 3WFDH 3GMLB 3O6FA 3RU8H 5HXMA 3QUMH 4JZJC 1XEDA 4WUUD 4D2NA 4O02L 3IVKA 4HKJA 4GRWF 5EC1A 1JRHL 4U1JA 1UACL 4S1QH 5JO5A 5D1XB 2AW2A 2IG2H 5IBLC 35C8L 5J57B 3NOIA 4K8RC 2G5RA 4ONHA 4ZS7L 3S37L 4ODUB 2AEIT 4X6EA 2YN5A 3QUMA 3BW9B 4ONFH 5AUMA 5T1DH 3S37X 2UZXB 2KKQA 5E9DE 2HLAB 3U7WL 4JM2B 2PTVA 3MGAA 4QRUA 5I1HH 4E9LA 4MJIE 1NFIA 2W60B 4HGWB 1BF8A 4RAUB 1WBXB 2ADFL 4D9QE 1WCBA 3DRTA 2AKRB 5C0CA 4WHTB 5E1AA 3S98A 5KVFH 3ET9F 1BZ9A 3OHXB 4H26B 4NZUL 4LSVH 4G6KL 3OKDB 4LAQH 4NCC1 1ZLVK 2NW3A 4J3TA 3QIUA 1RUAL 5L8KB 3GMOB 3L5IA 3E0GA 2A1WL 4L8CA 1FORL 3MV7E 2BY1A 5C0RL 4JQXC 5AZEL 3PGFH 3MOAH 4KK6D 3B6SB 4PB0H 5KSAB 1WEJH 2XWJB 4HUKB 4CNIB 5I1DA 3QEUB 1CIUA 3QIBD 4KAQH 1N8ZB 5BVPH 4LEXL 1A6TA 1EA9C 5ALCH 5HHVL 3LDBB 2H6PA 1VENA 1IGMH 4MNQD 5F7LB 4JFPB 4YHZL 2AV7A 5EU6A 3WIHL 2F8OA 2FO4B 2UZIH 1A7OL 1RIUH 2P24A 2FJGB 3QDJA 1LDPL 4PJ9B 5D7SH 4LVOC 1NAKL 2GITA 3WUWG 4M62L 1F90L 5FYKE 4QXUH 2NY1B 4XGZB 2AV1A 3U4BL 1JMXA 1I4FA 3UTQA 2KL6A 3VFTB 3BPCA 3VFVA 2NY2C 4FFYL 4NJ9H 3MCLH 3J7HA 1XCQB 4NKDA 2AJYL 4NOFA 3TT1L 1H15B 1I85C 1WISA 5IVXE 4PBXA 3OKLA 3GI8L 5BRZA 5KS9B 4GT7A 5MEND 4Q9CA 4O4YL 4AEIL 5B22A 5SWQB 4F15B 3NZ8B 1IGCL 4HUUA 5EPMA 2HFTA 1T5WB 3M1BB 3QQ4B 1D5BA 2UUDH 1T04A 1FNSL 1A5FH 1DQDH 1U8HA 3EHBC 5T33H 1LO3L 4PGBB 5CIPB 1TVBB 2VSDA 1I3RA 3PWVB 4HJGA 1KV3A 4WW2A 2OJZH 3QXWA 1UM4L 4KJPC 2VXTL 2XZZA 4V1DD 1LO2H 4RRPG 3ES6B 5TDNB 4WEUD 3V8CA 1CD1A 3UMTA 1KJMB 3QXDB 4N0UA 4D0CA 2FIRT 3MRDB 2MOVA 3VI4F 4OCYL 1KELH 5TGBB 3MRPB 5BMFH 1KPVA 2DQFB 2H32B 2YMXH 3GNMH 5EBMA 3WJLA 3IDIB 5DJCB 1JZ7A 1K4DA 2YD5A 3BP5B 2FJFB 3CX5J 1P4BH 3ZKND 3O2DA 4PRIA 5CSZA 2BOBB 4XWOD 2NLJB 4M43L 3QCTL 4MSWB 4A2MA 4JLRB 2JJTA 5JOEA 1FO0H 4G80A 3RU8L 2XWTA 3QUML 2VLKB 5ANMB 1HQ4A 1B88A 4JHWL 3QAZC 4Z78B 2D0HA 4Z7VB 4PS4L 3T04D 4GKZA 2ZUSA 4WW2F 3ZMRA 2J4WH 2F53D 3MJ7B 1DTUA 4RFOH 2XZQH 5D7LA 4K2UH 2RCSL 4L4TA 5LGJB 1BQSA 1EHNA 5T1DL 5F96H 1I9IH 1NEUA 3DURB 2KUTA 3C5JB 4UT6H 2PW2A 4R0LA 5B4MD 5I1HL 1CG9A 3OF6A 4AJ0A 4QRPD 2BVPB 2XXCB 3W0WE 1OSZB 2XN9E 3HZKA 1ZLSH 4ODVH 5KVFL 1AFVH 3QEHA 1WFUA 1PG7H 5EU5B 4WUKL 2MCPH 3LEYL 3SHSA 3STZB 1T1ZB 2VXVL 3UJIL 1RVFH 3F6IA 2ZOKA 3QJHA 5J12C 2IC2A 2AJZA 1JVKA 2WWMD 4KXZI 3ARGA 4P2QD 5AZ2L 5JQHC 4JJ5B 1F4XL 2OP4H 1PLGH 3QG6B 3S5LG 3VRLE 5M94B 2EDEA 4GBXA 3KS0H 3K81A 4NZJA 4UQ3A 1B9ZA 4YR6B 3O9WB 5BVPL 1KYOK 4PV9A 1WJ3A 5EG6C 1I1AD 4NO5B 5JA9A 4AENB 4KJQC 4WGWB 1CDCA 2FECL 2Q1EA 3TZVD 5C6TL 5AYUL 3WKML 1VHPA 3BDXA 3BRFA 3BMWA 1GYAA 1RIUL 3HHRB 4DCQA 2GJ6E 5CP7A 4LSRH 3MNVB 4I2XB 1J11A 3D0VB 5DJ2B 1S5HB 3ZYJA 5L2JA 4ODBD 5DUPH 1ZHLB 5ADPL 2Z35B 4LCWB 4WWKB 5DD0L 1XF3B 4C58B 4YGVB 5C0IA 1PVHA 1ZHNB 3LQZA 3X11B 5GGSY 4ORGB 3QXVA 1MLCA 3X3FH 3TA3A 2N7BA 1BQHB 4MAYB 4DKEL 3QXAB 3EDJA 1I8LC 5D70L 2IANE 1ZEAL 5E2UL 1AGFA 3V2AR 4FQXA 3IDGB 4JFZL 5HGGS 5F97E 5JQ6L 3L6FA 3RNKB 2D4FA 4FXLA 4LGSB 4HK3J 4TSAL 3NCJH 4CJ0A 4JQIH 3ZE1E 3VG9B 4UI2A 4FFZL 4B0MM 2F19H 5L9DL 1A5FL 1NUNB 1R3HB 1HZHL 4J3XA 3UYPA 3UBXB 5HDQH 5HYIA 1LE9B 4NQEE 4NN7C 4XAKE 5C0AA 3JTTA 4DUWA 2AI0L 4GG6A 2APWA 1JBJA 3IXAB 3FZUC 2X70B 3DX8B 4ESKA 4OCSH 4Y88A 4MD0A 3HPJB 4ELMB 3KVQA 4U0QB 2ATPA 3O2DL 5DA0B 4JN1L 4CL7A 4E41E 3MLVL 3FFCE 1UENA 2P8PB 4EI5A 2R2HA 1UQSA 1N5AB 1ZLUK 4L9LB 1DBBH 3V0WH 5E99L 4XPTL 5I2IB 4JY6A 3WIFB 3GMPA 3JUYA 3OKNA 5F1NA 1JWSA 4MZ3A 3IKCB 1S9WA 1XR9A 4RAVA 5IB3B 4TSBL 4KRPC 4U1MA 3PV7A 2AK4D 2BRRL 2OI9B 4XP9H 3G04A 4GUPA 1A6AB 3ULSA 3K8KA 4HIJB 4MQXD 4Y2DC 5ETUA 1NAMA 4LIQL 3RWDB 3WHXB 3RKPA 3RWHA 5L6YH 1HH9A 2C5DC 4KI5C 3GDBA 2J8UB 5DMGC 2NY7H 3LHPH 4AIXA 2UWEA 4KKLC 1HQRA 5IFAH 4GG6F 3RL1B 4IMLA 4OV6F 5HHQB 4CAGA 1OB1B 4KKNA 3L5XL 3AS3A 2BOCB 3QUYB 1C5DB 4O51A 2VABA 1IZJA 1AI1H 1FRGL 4XMPH 2V17H 4J2XA 1HHKA 1X7QA 4L3EA 3QPQC 5GS2H 2EO9A 3BKYH 3U4EA 3RZCA 1JPSH 2DQGL 4KUCF 4BA8A 2FHBA 1MI5A 4MJ6B 2W9DL 3IFLH 2D9QB 2MQ0A 2Q8AH 3PABB 5DZOA 3K1DA 3O0RH 5CBAA 4QWWD 5CJBA 1JIBA 4I3RL 1U3JA 1RVFL 3HE6C 3L7FA 4Y4HB 2O61B 1QSFB 5D7IA 4H1LH 1OP5K 3MRFB 2QSQA 3ARVA 2OP4L 2NQCA 2Z9TA 3ILQC 4I5BA 3LH2L 2CMRH 4WW1B 1QR1B 4G8IA 1KEGH 4WEMB 2UWEF 1T89C 2L4OA 1CE1L 4HMEA 5DRWB 3MQIA 3PQYE 1XH3B 3QDHA 2PYFA 3GSOB 4QHLB 4W81A 3D39D 4MA1B 3SO3C 4NHUA 1UZ6F 2IQAA 3MYJB 3Q1SH 4LVNC 1G9MC 3NIFE 5ACMA 2UYLB 2VDQL 1CICA 4XB8A 1RZKL 1Q1JH 5E4EB 4I4WA 1DVFA 3BZFA 2FJHB 4UAOC 4LKXA 5IMOA 5C09E 3MUGB 3WO4B 2NX5D 3VH8G 3VXUD 2HG5B 4XP1L 4OIAA 4R2GD 3X3FL 3HI6H 1YYLH 4JGJA 2X2YA 4BQ6A 3K2UL 3OGCA 3NMEA 3HG1E 4HIIA 1FLRH 2EKJA 3D3VA 5D7IF 3KYAA 2AABL 2BNQD 3TJEL 3KJ4C 3K8MA 4CW1A 4K23L 4HPYL 4PJDE 2GJZB 5GRYA 1G7MA 4QRRE 2I27N 2GJJA 2P48B 3HB3D 3KPRB 3HRZA 3BDYH 4JHAL 4KROB 4NPYA 3PHOB 4P46D 1P9MC 1SYSB 3PWNA 1WTGT 4ZNCD 1T22A 7FABH 2Y36H 4F33A 5KN5B 4R9HA 5DJDA 3QO0A 5I0DA 4XNUH 1JZ4A 1M71B 1YPZA 5B21A 1ZS8B 4LCUB 3SDDC 4JPWL 4U0RC 3LPFA 3OAYH 4JFEA 1JPFB 2XT1B 3ARBC 3BUYA 2YR3A 2FDBP 4WVRA 1YEHL 2DI7A 3VXSA 1A1NB 2XZAH 2VH5L 5DK0A 1DEEB 4NBYB 3CDFA 3F62A 4N90E 3FONB 5DS8A 3QNXA 1WCQA 5I1KL 3HTLX 4DGIH 3S6CA 3V0WL 4Z7WB 2A9ML 3KPTA 3CFBA 4UNUA 1NAML 5LKNA 1KYOJ 4MLSA 4X9HA 4YX2H 1E28B 5F88B 2EDFA 4BFEA 4X7TA 3SDAC 4XCCL 4QNPE 3AUVA 1DN0B 4ODHL 5GGSA 1FFNB 2A9NH 3PIQB 3UZQA 4ZPTB 4PJXE 2EDNA 4XP9L 3N1PC 5T3XH 3WE6B 5C7XH 1FL3A 5D72L 2VO5A 3P0YH 4DN3L 5F7HA 3IDUA 1LD9A 3DSFL 4DWHA 1YDPB 2V5TA 4Q9BA 3NIGF 3CMGA 2AJXL 3MLYL 3LHPL 1YPZF 3RVVC 5BZDB 1PQZB 1U58B 2SEBA 2R2BB 4LBEB 1KSRA 2HYMA 1LO5B 2JJWA 1CD8A 2GSIB 3UBXI 1GGTA 4RDQF 2VUYA 3VFPB 1IAII 5F93C 3AB0B 1QKZH 5B38G 1U8KA 4X4YB 3WD5L 5FOBB 3W9EA 1V05A 3QHFL 1YEIH 4R4ND 5I8CA 4FTVA 1TENA 1S7VB 4XMPL 1EDQA 3FB6B 1OGTB 3FQTB 2E3VA 5IWLC 1D5XA 4KKCC 1ZK9A 4X7CC 5LBSL 1EO5A 2X1OA 5FF6A 3CPLB 4KC3B 4I0PA 1FE8H 2P8LA 4IJ3C 4UV7L 3TIDB 5IMLB 4X5WA 4Y4FA 3BMVA 4YNYB 1BVKA 5IROC 4GRWE 3JV6B 4LHUA 4G8GD 4E0RA 3KYMA 2B2XL 4F9LC 3PGDB 5DJ0B 2AVGA 3W11D 1RZJL 2BC4A 1PAMA 4PJ7E 3RHWK 3STLB 1INEH 2XKNB 4KVCL 1RPQA 5EUKB 1AR1D 2ARJQ 3QDGE 4GQPH 5IGXH 1JNLH 2H26A 1V7NH 5ACZB 3T2QA 1MHCB 1C5CH 1YQ2A 3RDTD 4LQFL 5IT2H 2X4RA 4WO4C 3B8YA 2JIXB 4JANA 3FQNB 2QL1A 3EYSL 4IRSD 3RBSA 1P7QD 2MWCA 1NUGA 1ROWA 1IEAB 3BE1L 4LLWA 4NQSB 2QQNL 2F5BL 2C3VA 4WFHD 5EORH 3K4AA 3MV11 5D93C 1CFTB 5ADOH 2E7CA 4XP5H 4MXVF 2YOCA 2AERT 4XPFH 2V2XA 2R1YA 4OBSA 1X5LA 5DWUH 1QUNA 5C8JA 1DQLL 1Z5LB 5DVOA 3IRZA 1MCJA 3TCLB 1PSKL 3UZEA 1ORSA 3ULVH 1ED3B 1HILB 4XWGH 2CK2A 5A43C 1UWGL 3ARUA 4YDJA 4ZFGH 5F9JB 3CCHA 1FZMA 4GJTB 2J88L 4LPCA 5DRZB 7FABL 3IDXL 4L8SC 3T0ED 1I8KB 4M4RA 1S7QA 3QI9D 3PV6A 3GSVA 1G7LA 2H9GA 3TIEB 4MS8D 1NGZB 5D6CA 3BAEL 1OGAD 12E8H 4Z7NF 5C0CE 4MJ5A 5BV7B 5GRWA 3C6SA 5C0FB 2BSTA 1T83A 5DMKB 5JZ7C 5SV4A 2DD8L 5HHOD 5ISZB 1FBIL 4YBQD 1EBPA 4QTIL 4C83A 1WBYA 2O5YH 1KG0A 1G7IA 2GCYA 3MODH 5GS1A 4MVBC 2Z91A 2X4QB 3A6CH 2V7HA 1S5IL 4NRZB 5CP3H 5HVFB 4UBDD 2ZCLL 1D9KD 4NZTL 1A1OB 4Z7UA 3DLQR 3QIBA 4R4FH 2HMID 1MVUB 3BWAB 3LQAH 4WI9A 2NTFB 5FO9B 2VLJE 5EU6E 2Q76B 4M93B 4MNQA 4HS6A 4NYLB 1IT9H 1ZVSA 3BEVA 3BO8A 3QUZD 4P23B 3RX7A 4NHCL 5TH2B 4G8EB 1ITCA 3CH1B 5JORB 5DT1L 1VEPA 2OTUB 1S7RA 5HVWA 1GZQB 3KYNA 4Y1AD 4N8VB 2EH7H 3G5XA 4TUJB 1EEYA 3T2PA 3WXVH 4XC3H 1MSPA 5GISH 3EIFA 4YDIH 3QRFM 1RULL 2YPLD 1QLEH 1DFBL 3RGVC 4PRHB 5T1LD 3KPQB 2DLFL 2GTZB 2C9AA 1G7PA 4WGVB 1A7QL 5IKCA 2NXYD 3AU1B 1I1YA 3U1SH 5HJ3A 5MENA 4OLUL 5FOJA 5AWNL 4HCRA 1X6LA 4X6BB 1YEFL 5IEKB 1FVCA 5T1MA 1CXFA 3BUTA 1UXSA 3QUXC 2ZUUA 4Z7UF 4IHOB 1PFCA 5D7JB 4HV8A 4IM8A 5E6YA 4BSVB 1HE7A 5LAXA 3G6JB 4N0FB 3QDAA 4UV4H 3O8XB 3DXAE 4KK5D 1DUZB 5JDSB 5DF0A 1I3GL 1Q9OB 3HI1B 1JNLL 4V1DA 1V7NL 3WIIH 1HIML 1M7XA 4ZUSA 5IB5B 2FIKB 1C5CL 3OAUL 4LEOB 1P84J 4PGZA 4OGZA 3RIAF 3D0LA 4OGAD 5C3TA 3T3MF 2NY0B 4UIMB 1AQKH 1MFEH 4QHNA 4XTRD 1CXHA 2A38A 3K2MC 5CD3A 3Q6GL 2XA8L 3CSGA 5GS0C 5GHWH 2P5EB 5DJ8B 1ONQA 1K2DB 4JRXB 5E2VH 4PRIE 5EORL 1AO7E 5IVZB 3SCMD 1S7XA 4KQ4L 5GGRB 1DJSA 3FTGA 2A83B 3BEWA 3BH8B 4Z0XB 5D9SB 4LGPB 5MI0C 4DGVH 1CL7H 3KS0J 4NO0B 4DN4L 1F3JB 3QZWG 1XF4A 1UM5L 4JZNA 1UEMA 3L3HA 4U4BA 5B39A 2X6MA 5I71B 2EIZB 3VMPA 2AJVL 1FGVH 1XGRA 2F53A 2FL5B 5H8DA 4L4TE 4ODWB 1DSFL 5HYJB 5IG7B 5I1GL 1JK8B 3I9GL 3BZ4A 2FZ3A 3HR5A 1E4XL 5E8EA 2EZ0D 1PZUB 3WDHA 1GHFH 4CVZA 4LCCC 1FNLA 2JCCE 1CGVA 4QRPA 5IJVB 1ND0B 3SE8H 4P2OD 5I8EA 4PREB 4HKXA 4MA3A 3VRJA 4K7FB 4A6YH 5EUOA 1PY9A 3L9RB 4PJ5B 5FHBH 1BBJA 1UH3A 4UNVA 2RBLA 3QUKB 5F1IA 4LSTL 1FV1A 1JV5A 5JLZB 2XRAH 4OCLC 1NUDA 5J13C 3M8OL 5FYJU 4P2QA 3BVNA 4MD4B 3SDCB 3U79A 2XNAA 2IGFL 2HTKD 2YN3A 4WHYH 2R1WA 4MX7A 5EZJB 3ZL4H 2XKUA 5KANI 4GOSA 5EWIL 4FOMA 1RIVH 4R4FL 1H5BA 5KOMC 2KQMA 3CC5B 1A8JH 1KFAH 3TO4B 1YUHB 3TZVA 4JFFD 3GMNA 4QXGH 1GC1C 1QFWI 1HKFA 2F8VA 3WXWL 1PX3A 4I77L 4AIZB 3IU4H 4XNYH 1BD2E 1SY6H 3JXAA 43C9A 2EH7L 1Q0XL 5I16A 5MERB 1N6QL 3VMNA 4HCRL 4FXKA 1GZPA 1YN6A 4MNGA 5EC2A 1U42A 3C5SB 5GISL 4DZ8A 1FVEA 5EUOF 2Z8WC 1FIEA 5DYOA 3BN3B 4ZUUB 3QEQB 1Q72H 5C2BH 4I18B 2NYYC 1A7NL 3TN0D 3RUGE 4LSPH 1RQ5A 1MFDL 1MRCH 4QEGA 5IMKB 2VE6B 1FJ1A 4HWBH 4M7KL 1A1MB 4I48A 1KTKE 3T08A 5ICZB 1NANI 2ATKB 4RIRB 2XWBB 2X1QA 5H94B 2EO1A 5KG9B 4FA8A 2D7TL 1KN2H 4HK0A 1SM3L 3MLTB 5DMJB 2B39A 4TULH 4DOHB 4Y5VB 4RMQA 4UV4L 2BNRE 4X98A 1U93A 3T1FA 4O2FA 4HJ0C 3WIIL 4YHLH 3GB7B 3OKOA 1GSMA 1NC2D 5F7UA 2C3HA 1MFEL 2ITDB 4Q9RH 4LLMA 3MXWH 1NBZB 1OAYH 2OJEA 2D0GA 4WDIB 2ZPKH 2FEEL 4H25B 3FO2B 2RFXB 4PTUB 3EYFB 5DQJB 2WZPD 2VXSH 4CKVX 4OJFH 1GVIA 4OCRL 1MFAH 1AD0B 4JO3H 5DDHA 1HCFX 1XIWD 2CUMA 2P1YA 5SWZE 4G6FB 1BBDH 2MMXA 3HE7D 4M7LH 3PL6D 1CFQA 3HLAA 5JOPE 1CFBA 4IRJB 5GRJH 4C56B 1CL7L 4QGYA 3DOSA 4LLUB 1XGYH 1JF1A 1EGJH 32C2B 3MFFA 3LKSB 3VFGL 1Y0LB 4HH9B 5EOCH 2UWEE 2Z92A 3CMOH 5HHXL 5SX5H 4R7NA 2DLHA 2YWZA 4M7ZB 5E2JA 4UILH 3AC0A 1OF2A 5C0NC 3P77B 3QAZB 3TBWA 5CEYA 2A73A 1T21A 3I6KA 4PGEB 5JHLL 4YZFE 4EN3B 3UJTL 2BCKA 4YEEA 1QHOA 1YEGL 1Q9LA 3NA9H 3V6FA 2D4DA 4R7DA 5BJTB 1DLFL 1UM6L 3W39A 1U8QA 4RISL 5I8KL 1NCAL 3ARDC 5LGHL 3JVGA 5HYEA 3E6FA 5TF0A 2GKIA 2H45A 5D7IE 3FO1A 5FCUH 3CFJB 1KPRB 1TCMA 3RVUD 4MXQC 2PO6C 1GAFL 5E2WL 3HUJA 1JWMA 1QSEB 1RMFH 4G5ZH 1AKJD 1TQCB 3RY6C 4P48A 3VE0B 1W2KT 4NNXB 1NCDL 1YY9C 5I73B 5DD1L 1L9NA 4MCYA 4QO1A 1AHWC 2EDRA 2EE6A 3OJVC 1QFUL 4DKDC 3VFWA 1J0IA 1EO7A 1F3RB 1WFTA 3MRKA 3HAEA 4IDLA 4QRSA 4WU5A 4PJ8D 4HKJB 1IBGL 5EC1B 1KFAL 1TXKA 3D39A 4LPYA 4U1JB 2QSCH 2I5YH 5JO5B 3F7RA 1IKFL 2G60H 4PGCA 4WI3A 1S3KH 4FFWD 2IH3A 1T0PB 5JXEC 4ONHB 3PDOB 3ARYA 4GKSA 4R96A 4POUB 1T1YA 5JHDE 2NX5A 2P4AB 1CLCA 4HUVA 4X4XA 1CFVH 3DO7B 3LS4H 4FG6C 2C7UA 4KHTL 3DRTB 4AH2A 1P5VA 4LSPL 4P2CG 5E1AB 2BNQA 5ELIA 2VB5A 2ZSWA 3SE4A 3HUJF 2AJUL 1BFTA 1LGVA 5DSCA 4YLQT 3SDXE 1CBVH 3F58L 3QIUB 1JN6B 3KGRA 3NZHH 4R90H 1G9NL 1NJ9A 4P46A 3NIGE 4J6RL 3AM8A 1H0DA 1EFXD 4X6DA 4IRZH 3F7VB 1GGYA 1UG9A 4UQ2B 4KDTC 1D5IH 1IC5H 1P6AB 5I18H 3ESUF 3WUWB 1VFBA 1JF5A 1FZOB 5HGDA 1A6TB 2FBJH 3H9SD 4XPBH 5DVMA 4NN7B 2AV7B 3DX7A 4F7EB 2DQUL 2P24B 4TPRL 2G2RA 3NH7H 3S3PA 3QDJB 1OAYL 2HWZH 1NCCL 5FXCH 3V4UH 4YO0A 3T4YA 5FYKU 1OP3H 3MROA 3TT3H 4FHBD 2HT2D 2AV1B 3BIKA 5KVEL 2VITA 3FAWA 1JRHI 5SX4H 3BPCB 4D3CL 4LPXA 3O3BA 4OFDA 3FQRA 4Z95L 5F9OH 5EOQH 4U2YA 2WIMA 5BS0B 3EYQC 3T4AB 2IAMC 4UDTA 3WCYA 1KLGA 5TDPB 3ZE2F 2DTML 1R0AH 5GRJL 2Q20A 3OKLB 2J7LA 1NSNH 2VYRE 4U6HA 4ZXBC 5BRZB 4XVUC 1XGYL 2B4CH 2E27L 3MLRL 4HIXL 4X6DF 2DM7A 2YKLL 2J12B 1QP1A 1YEJL 3QQ3A 5EPMB 4Y2DB 2X9XA 3D48R 5T3XE 1V3KA 4RNRB 1D5BB 4DGYH 5MEPB 5FDWA 1T04B 1U8HB 1ORQA 4YFLF 4Y8DC 3TVMD 1I3RB 1EAPB 4HJGB 3NA4A 4WW2B 1T4KA 4PJIA 3CDCA 4HFUL 4M5YL 2VDMH 2CK0L 3ZKMD 4CJ1A 1BLNA 1HNGA 2CLVA 1ZLWK 5DUBA 4QXTA 2AGJH 3UAJC 3RTQC 1R24A 4N9OB 1OSPH 1HCVA 4N0UB 4D0CB 1JI2A 2FSEB 3S96A 2EDOA 3MNWA 4K94L 1LEGA 1CD0A 3IFNH 3SGJA 4DTGL 1KPVB 3BP6B 4PYHA 1I7UA 5EBMB 5CKAA 3QPXH 5I66A 4G8GA 1JTOA 4LLDB 1K4DB 3G5ZA 4LGRB 1GGUA 1EO8L 1ES0A 1YNLH 4CU8A 4YJZL 1DE4B 3VXMA 4GAYA 3LQMA 2FO1A 3S3JA 3DVGB 3GMQA 4XMLH 3EJZC 3MRMB 1A6UL 3Q5YA 2W65B 4HPOL 4Q6YA 1YEKH 3HMWL 5CINL 2F54D 2XWTB 3RDTA 1O5DT 3PWUA 5A16A 5C6PB 1HQ4B 4YUEL 4RA0C 2QR0A 2P5WE 3MCKA 3J8F7 4GKZB 2XY2A 1LQSR 4IRSA 4M7JH 4Z7NE 4J1UA 4YHNA 4PJIF 1X5FA 2G60L 1DZBA 1S3KL 2IQ9H 4K3JL 2E5EA 3B83A 1UH4A 4QF1A 3S88H 2X4PA 5D7LB 2FRGP 3RA7H 1EHLL 3VFOA 4XHJC 3N9GH 5JPMA 1WZ1H 3OB0H 3TFKD 1ZGLP 2WP3T 2PW2B 4O5LH 4R0LB 1CG9B 2DIJA 4WCYH 5D8JL 5KOVC 1N26A 5DJZA 4PRAB 4N1EA 4PPTA 2BERA 2MHAA 2VLME 1QLRA 2LFGA 2LE9A 2VRAA 1U95A 3PWPB 4I3SH 5EU3B 5FFLA 1RUML 1P4LA 4Q9QL 1NLBL 4X5XB 2HFEA 3SKNA 5JMRA 3IAQA 3U9UA 2ZOKB 4YHYB 2OX5A 5FYLD 3P9LA 2AJZB 1YMHA 2GFBB 1C16B 2R4SH 3ARGB 3PWLA 1PKQE 3NZHL 3MACH 3T0EA 3C09C 3ULVE 1MWAA 4GBXB 4OT1H 1OAUL 5DVKA 2DMKA 3ARFD 2EE3A 4PV9B 3MUHL 1OGAA 4HWZA 3GI9H 3MRJA 2IPUG 3QHZH 4NFBA 1F42A 2BVOB 3SDDB 2HJKB 3DYMA 4DCQB 5CP7B 5HHOA 4CMHB 1KJVA 2QSVA 4MAYD 5IF0A 5BO1L 5I19L 4OSUL 1RUQH 1LILA 2VAJA 3CU7A 5JDJA 5BW7A 2DQHL 3IU3A 1QBMH 4ZFOA 5C0IB 4XZUA 3LQZB 4XNMA 3VXPA 4HK3N 4DFHA 1U3HB 5FUOL 3B9AA 4UT9H 3SDAB 4OB5H 2UZYB 1IC7H 1TDQA 2VDOL 1GIGL 3F5WA 4GQ9L 3EJYD 3UZVB 4KTDH 4KMTH 1KCUH 4JO1L 2B4CL 1MUJA 3DVNA 3QUZA 4MQTB 5IB2B 2OR7A 1J05A 3T3ME 2OZ4H 4M9PA 3WFBL 4Y1AA 4S1DD 4JAMA 3TCXA 1CZ8L 4W68A 4OCNC 5A2LH 2DJSA 1A7BA 5C0AB 1Y18A 3JTTB 4NQCD 3FJTA 1OARH 3MO1A 5ALBH 2GSGA 4TVPH 4DUVA 2FB4L 5T1LA 1W0VA 5E8OB 1GGIL 2ATPB 4PGDB 4L4VD 1XGUA 2CKBH 2R0KH 4Z0BL 2VLRE 3ROLB 2R2HB 1UQSB 1J1OL 2JJSA 5CJ8A 4UTAL 3K4DA 1MAJA 2EDJA 2V7NB 1JGUH 2J2ZA 4JY6B 5C0BD 1NBYA 3GMPB 3RVWD 1KGCE 3OKNB 2FECI 4JY5H 5F1NB 4YC2C 5F7WC 1S9WB 4IJ3B 4RAVB 4LRNH 5DHVA 4JKPH 1FH5L 1KBGL 5K9OA 3G04B 4GUPB 5AD0A 1YEKL 1EPFA 3ULSB 5ETUB 4PLOB 1OLZA 1KXQE 2YD8A 1EV2E 4S2SA 3IGAA 3RWHB 1HH9B 4OLZH 4CRPA 1RI8A 1XF2A 4AK1A 3LN4A 1YJDL 3U36A 3MOBH 1EAJA 4EUPA 3RL2A 2W0LA 3LKOB 4IMLB 2X09A 4WO4B 2DBLH 3C8KA 4X9BA 3QCUL 4Z18A 3N9GL 3SCMA 3B43A 2ADIA 3JWDL 5HDLA 2Y9RT 2VABB 4O51B 4U1IA 1HHKB 3VGHA 3M45A 1X7QB 3H3PH 4L3EB 4P2YA 4XPGL 4Y4HD 3U46B 3UC0L 3NBNA 2F5AH 1K5NA 3U4EB 4FN0A 5D93B 1GGBH 1MI5B 5INDA 2HT3C 4K9EL 4I3SL 1MWAL 1NBVH 2X44D 3RAJH 5CBAB 3UTZA 5F9DC 4ZYKA 4OZFA 3RWGB 3MBEC 1INQA 2ENSA 1K8DB 4BZ2L 1DBAH 1I8MA 2AEQH 3B5HA 5HSFA 1P4IH 1NL0L 1VFUA 5BQ7A 4HW6A 3V6OA 3HRPA 1VGEH 1WV7T 5CD5C 4ZSOA 1DBMH 4I5BB 4DAGL 4M4PA 4M48H 4G8IB 4OT1L 3IAGC 1QHPA 1BVLA 2PYEE 3E3QE 1PY4A 1LK3H 1JCKA 1WUNT 4P2OA 1K4CA 3FO0L 3QDME 1A7RH 4L8SB 2QHRH 1J8KA 4PRNA 1UWXK 3O11A 3QRGL 4ZFOL 2IQAB 3QHZL 3R1GH 1Y6NR 5HYQA 2XOTA 1KLUA 4RQQB 1JWUA 1OAXH 1IARB 4JKMA 2MPAL 3HI5H 3BZFB 4LKXB 4APQC 1CU4H 5IV2A 3V79C 1S9XA 4R97B 4BQ9A 1VKXA 4OLXL 4IIQB 3IXTA 4X7DC 1UJ3A 4ODXA 5SWSD 1XGTA 2EICA 2Y5EA 3OGCB 4HIIB 4HEPG 1ZSDA 2ZCHL 4ZO8A 4YXHL 3D3VB 1IC7L 2PF6A 1FC2D 1UVQA 4OI8A 1E4WH 4H1LG 2HTLD 4CW1B 1JGDA 3WBDA 4JFFA 4M6ML 5DR5L 1G7MB 3SKUD 4K3HA 5GGQL 3QIWB 3P9MA 4XBGA 1BIIA 4NPYB 1BJMA 2HN7A 2OSLA 2DMCA 1RJZA 1BFOA 3PWNB 1T22B 3OSKA 4F33B 5DJDB 2Z31D 3QO0B 1SMAA 1FSKC 1YPZB 1IQWH 4HKZB 4LSSH 5A40E 5IEHA 1RJLA 3F65A 3P73A 3S3SA 5KSBB 5EZIL 4ZS6D 3BUYB 4YXLH 4PR5B 3TYGL 1FZKA 3PXJA 3K1KC 2HFFA 2WBJC 2LTQC 3TN0A 2KPNA 3MRNA 3VXSB 1WICA 3VMOA 2X41A 1M4KA 1E4KA 1SBSH 5DK0B 1WC7A 1JFQL 4R8WL 5HI4C 5FHAH 5CEZD 5DS8B 3QNXB 1YMME 3FN0H 1F6LL 4KKBD 4PRBA 5TJWK 4G43A 4L5FH 1TJHL 2DQCH 5J7CC 4JR9L 4X7TB 2YZ8A 1U8IB 4XHQA 4ZOEA 5GGSB 4AT6A 2ESVE 5I1JH 4RMWA 5GGVY 5IW3A 2YD9A 4N8CH 3O6ML 1D6VL 2ITCA 1XR8A 4NC0B 3L5WA 1HWHB 3HCVA 1I9JL 1NC2A 4OF8A 2FGWL 1MY7A 1JNNL 5EN2A 5DD3H 2ERJC 4N0CD 4P4RA 2DQDH 3WYRA 4RWHA 5CZVH 4OFIA 3QNYA 1RJYA 1G0XA 2SEBB 3EYOB 4Y19E 5FDYA 5LQBL 4X99A 4ERSL 2CLRA 2P8MA 3VXRD 4CVWA 3W9EB 4GXVH 1XIWA 2GAZB 5I8CB 3HE7A 3H3PL 4PBWD 3ELAT 1MF2L 4ZQKA 4JQVC 1TTUA 4PJCE 3QG7H 3INUL 2X10A 1S78C 3RWEA 5FF6B 1A0QL 2G75A 1KB5A 4FQJL 4NKIH 1N59A 1QFHA 2P8LB 3SJVD 3DETD 4X5WB 4Y4FB 3LKPA 1S7SB 1BVKB 4WTWA 1BWMA 4KXZH 2VAAA 4LHUB 4E0RB 3ARED 2X9WA 3IETA 2AEQL 4N0YL 5ICYA 2JIXD 2BC4B 3ULUH 5D1QC 4LMQE 1UYWH 3IDYC 1S9KC 1TJGL 5F7FA 3MGTA 2Z93B 1KB9J 4HSQA 2B0SH 2H26B 4QYOA 3HMXA 4J4PD 4AEFA 3VD3A 3EFFB 3A6BH 1P7HL 3W5MA 2X4RB 5JUEL 3JV4B 1VA9A 5K9KA 5F7YC 2C3XA 4JANB 1YA5A 4LASH 3KDMA 4L8BA 3VA6A 4LLQA 1MNUL 3MJ9A 4KPHH 4MLIA 1SVZA 4BUGA 2C3VB 2GEEA 3RKDD 5IQ9A 2NZIA 3RVXC 1GXEA 3SN6N 4MCZA 3SBWC 1NMCC 1AKJA 4JG1H 1NCBH 1RZ7H 3MRHA 3CH8A 1KIPB 4YHPB 2AEPH 3IB4A 1L4IA 5I9QC 3ILPA 4M02A 5LVEA 2XTJD 1T0MA 4WUUB 1G1YA 3BW9A 3D39E 4LSUL 4WJ5B 4PJ8A 3C5ZC 5D1ZD 3RZCC 2HLAA 5IVNA 4GRMA 4NCDA 1BM3H 3V7MA 3WMSA 1ORSB 2YPKA 3PP3H 3CK0H 4G3YL 5C1MB 3DROA 2W60A 1KN4L 2EYRA 2K3TA 1BFVH 2HA1A 2FEDD 4B50A 1OAZL 3CCHB 1FZMB 1CGXA 5AAWA 3WJJA 2HT4C 3D18B 3U0PB 5DTFB 3QISA 3MXVL 1S7QB 4IS6A 4NDMB 3OHXA 4H26A 2NY3C 3U2SA 3GSVB 1IQWL 1G7LB 5DC0A 4LSSL 2H9GB 4PUBL 3ULUF 2R0ZH 4Y16D 4NM4L 2R23A 2NW2A 5D6CB 3FMGL 5HI5C 4EZMA 4MJ5B 3QHTC 3LD8C 3QA3A 3C6SB 3FN9A 3O4LE 2CKNA 3B6SA 5CHNA 2IADB 2BSTB 4CNIA 3HNVL 3C08H 4PJFA 5FHAL 1CF8L 1L7IH 4C83B 1WBYB 1ZA3B 1TNNA 2GCYB 3IF1B 1IGFH 4JFHE 4XNXL 5GS1B 3CDYA 1CICC 1EFXA 1MQKL 3CU1A 2FJGA 4MJ4A 2EKSA 2FHCA 5HD8D 4F37F 4TRPL 4OLYL 3QIBB 4PJ9A 2FX9L 2DIAA 2VZSA 4XGZA 5DC9B 3H9SA 1Q9WA 1QPXA 4MNQB 4HS6B 3GHBL 15C8L 3VFTA 3L3JA 2OL3A 2B1AL 4HAGA 3A67H 4YHMH 5KSUB 2YWYA 3HNSH 4UB0L 4RMRA 1DQQA 4JKLA 1H15A 4PRHD 2DLEA 3B9DA 5CZVL 4OUUA 1S7RB 5CIPH 3KYNB 3G5XB 4MXWL 5KS9A 2JTDA 4JREC 1KB5L 1HYSC 2FX8L 1MIEL 1WFNA 1H3UA 4PJHA 1HXMB 5FGCE 4LRIC 3M1BA 4O58L 3QQ4A 3C6LD 1AQDA 4F9PC 2IEPA 1AGEB 4PJFF 3GKZA 4HFWA 5JW4M 1G7PB 5IKCB 3BYYA 1OTSD 3P40A 5HJ3B 5IFHL 3PWVA 3O3AB 4UU9B 3AS2A 5MENB 1FCGA 4JRWA 2H32H 2NY5L 1FVCB 5T1MB 2P49B 3HMXL 3ORJA 1P7KB 1LO0L 3EO9L 5TDNA 2IPTL 4HS8H 2NR6D 1KJMA 5LAXB 4NUGL 3ULUL 3UO1L 3EJJX 5TGBA 4E41B 3MRPA 3MJ9L 1JGLH 4NP4L 5J6HB 1I7TB 4V1DB 4ZUSB 1U41A 3BP5A 4F7TB 4AEHH 4HWUA 3WLBB 2BOBA 5KS9F 4BZ1H 3P30H 2QADC 2NLJA 3T2NL 4MB3A 5CD3B 3SGKC 4JLRA 2JB6B 1TZGH 4PJHF 3SKOB 1A3QA 4X5LA 2K7QA 2VLKA 2VDPH 2YSSA 5FECB 3CXDH 3VXME 5EZOH 3QO1A 4AG4L 4Z78A 5LXGH 4I8DA 3KXFD 2XQYK 4DKAA 1S7XB 3GUTB 4JG1L 2BXYA 3MJ7A 3BEWB 1NCBL 4XVSL 4GAGL 4XBEH 8FABA 3O2VL 4L1DA 2AEPL 1IILE 3U48A 3RPKA 3LSOB 2XACC 1XF4B 2F54A 1HHGA 2PO6B 3AAZA 3L3HB 3KPOA 5B39B 4JGUA 5IBLD 4NWUH 2ZJSL 3C8DA 3WSQH 4EQ2A 1BM3L 2W9EH 4K8RD 4I0PC 2F53B 1XGRB 2BMKB 2N56A 1LEIB 2B5IB 1BFVL 1OSZA 4GH7B 3D2UD 4JPIB 2YA1A 3QFJE 4DJMA 1VADA 5D4QA 1WITA 1U6AL 2CGRH 4LLYA 5EZLB 4OLWL 5EU5A 3BZ4B 4XXCA 5E2TL 2FZ3B 3HR5B 5I30H 4OD3H 5D7KE 2BHZA 1J86A 2Y7QA 3CGTA 4QRPB 2J8HA 4CMMB 1A21A 3H6JA 4HKXB 5F9AC 4V2CB 3QG6A 3GSWA 1BBJB 1J8HD 1CQYA 4Z7VF 5F1IB 3WKNA 1FV1B 4TUKH 1B2WH 3V7AE 4NNPH 1F4WH 4AENA 4FQHA 2QKIB 4P2QB 3BZEB 1IGFL 3BVNB 2OL3L 3MA9H 1OWWA 2XNAB 2V2TB 1N2RB 4MX7B 1JHLH 1IAKB 3ALXA 3D0VA 1OGAE 3BPOB 4M1GH 4DQOL 1TZHA 3ETBF 3TPKA 1H5BB 2DOCA 3ARFA 2EYTB 4WTZG 1I1AB 2X89D 1FYTD 3STBA 5GXBB 2PXYC 5E8PB 3GMNB 1Q0YH 5HHOE 4ORGA 1YEEL 3X11A 4U49A 1O7SA 5E0QA 4MAYA 3K0WA 3BQUC 1NLDH 1SJVA 2NY2D 5I16B 1ZANH 3HG1B 1E6JH 3IDGA 3P4OB 1Z0MA 5GIRB 1GZPB 3WN5C 1YN6B 4GW4A 2BVYA 1FNGA 4LU5L 4MNGB 4U6XA 1LE5B 1FVEB 2IALA 1BPVA 3MBXH 5FA3B 6FABH 3CZJA 1ADQA 2YXFA 3ULVC 1HOCB 1MJUL 1A4KB 3L95A 4RZCA 1FJ1B 5GGVL 2VZTA 2IAMB 3BPLC 3X17A 4GW5A 5IESH 3ZTNL 3EHBD 1I7ZB 4WHYG 3U6RA 4LARH 2NY6C 1JTPA 3WNMA 5DC4B 1R3IH 4PG9B 4R4BA 4KK9C 5IM7A 4HK0B 3OAZH 4OTXL 3U7AA 5HYSB 4KJPD 1J1PH 2P8PA 3MV8D 2LV4A 2VDNL 4NQCA 4X98B 3V5KB 1U93B 3KPLB 4P9HH 3T1FB 4O2FB 1PEWA 1ZE3C 2XKSA 4U2ZA 2MKLC 3B5TA 4HS3A 4FQLL 3OKOB 4LKCA 4KMQA 3WIFA 3MC0A 1NDGB 4L4VA 1CWVA 4LLMB 2X42A 3ZHDA 1MAMH 3P30L 1RIHL 2OJEB 5MEOA 1DANU 2D3VA 4TVPE 4ZO6A 2FLBT 4OZ4B 4C56D 2X40A 5C0BA 3SGEI 1IGJA 3LQAC 1QBLL 5LXGL 4Z7QE 2R1XA 2Q8BL 5DDHB 4G6JL 4HD9A 3GIVB 4X6CE 2AK4B 3EDDA 3OMZA 1ZT4A 3HLAB 5TF1L 5HHQA 3S97C 5F8QC 1OB1A 1G0DA 1JF1B 2W91A 2BOCA 4L4JA 1C5DA 1XZ0A 3MFFB 3F6LA 1MHEA 2Z92B 3ARSA 4R7NB 4ZTPL 4GMSL 4JO2L 1EMTL 5GJSH 1OF2B 5L88H 5DZLA 1V7ML 4E5XB 4QHKJ 4X9FA 2IMNA 4KJWD 3TBWB 5CEYB 1BHGA 1MCOL 1T21B 4PFEA 5JOFA 3U0TA 4WRLA 1QD0A 4TNWF 2BCKB 2CIIA 1G84A 1RZFH 4NFDA 1BZ7B 5FYLL 4Y4HA 1MHPL 1Q9LB 4K7PY 4EXKA 1XMWA 3MLZH 5AYQA 4R7DB 1X5YA 2DQEH 1KULA 3W39B 5DD6A 1U8QB 5IIEB 1NDMA 4ZNEE 2UV3A 4ENEC 1JPTH 4H88H 3W9DA 4WW1A 2KH2B 5JW5A 4PRPE 4JRYE 5ILTL 1EH9A 1JPST 3E6FB 4TUKL 5EULV 1B2WL 4U6VH 3FO1B 4CVXB 4NNPL 1QVOA 5J89A 3DGCR 2DYPD 3GSOA 4QHLA 5KTEL 3MA9L 1KCKA 3H3KA 5C9KA 4WFFE 3VDAA 3BKJH 1URLA 3WV0A 2ZUWA 1BMGA 4MCYB 4YK4C 4KJQD 3GSQA 1I8IA 3VFWB 2E7MA 3ZE0E 1CLYH 4QRSB 4WU5B 3HAEB 5C07E 1N0XH 1QOKA 3C09B 4U1KB 3MUGA 1XT5A 5GPRA 1D5MB 1C5BH 5I1IL 3H9YA 1WT5C 1JHKL 5TE4H 4PGCB 1ADQL 3L3KA 1F8TL 4KTEL 1CL7I 4OD2A 2WINA 4J3SA 1A22B 5JR1L 4GKSB 3P11H 4R96B 2GJZA 3MLWH 1T1YB 2NX5B 5JW4N 1N7ML 2F74A 3VXUB 4X4XB 3FOMB 1A3LH 4R2GB 5SWSA 1IGTA 1ZWIB 1SBBA 5FAAA 2C7UB 5INCA 3E3QC 3IFPB 4BFBD 1KJ2A 1AY1H 2BNQB 1ZS8A 4WV1C 5DSCB 5DI8B 1MPAH 2MSPA 5JMOC 1FFQA 4F8QA 4P46B 4LARL 4ZPVA 2WM0A 2JB5L 4PV8B 1H0DB 3O6LH 3OJ2C 4TQEL 4X6DB 1R3IL 1DEEA 2Z31A 1A2YA 1J1XH 3CFKB 3FONA 4OGYH 4NWTH 4P3CL 1VFBB 5F7EH 5HGDB 5GGTH 2W9LA 1B0GA 4Z7WA 4P9HL 2OTWA 1KCSH 1BQLH 5F88A 4BQBA 2APBA 5E8DH 2ZUQC 1G6VK 1DN0A 4JFDD 4EOWH 1FFNA 5JXAL 1C1EH 1KIQA 5BS0D 5FM4A 5LWYL 1MAML 3EOTH 2LAAA 2WK2A 4OM0H 4YO0B 4P4KC 3SE3C 5IHBA 5GGTA 2X05A 5A2FA 3MROB 5GZND 1R3LB 2N4IA 5I74C 2VQ1A 1YDPA 3NPSB 3O6KL 1ZT7A 2R2CA 4OFYD 4KRPD 4Y5YA 1G6RA 3O3BB 2YC1B 4TSCL 4N68A 4ZAKC 5C0DA 4Y2DD 4UDTB 4YFEA 3S35H 4LBEA 1ZA6A 3G5YA 1W72A 4KI5D 1P1ZA 5J11C 4YWGH 2GSIA 4FABH 4H20H 3VFPA 4U6HB 5DMGD 2DN7A 5FOBA 1D3CA 4KKLD 3KPSD 5CFHA 3ZHKA 3O2WH 1DR9A 1LEKB 3QQ3B 1F2XK 4OZHA 3FB6A 5GJSL 2UY6A 4TOYH 5FDWB 3REVA 1DBJH 4Z7WF 5L88L