4I2XB

Crystal structure of signal regulatory protein gamma (sirp-gamma) in complex with fabox117
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
229
structure length
229
Chain Sequence
EVKLQQSGPELVKPGASVKISCKASGYSFTSYYIHWVKQRPGQGLEWIGWVFPGSGNTKYNEKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYFCARGNYDRAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGKHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of signal regulatory protein gamma (SIRP gamma) in complex with an antibody Fab fragment.
pubmed doi rcsb
molecule tags Immune system
molecule keywords FabOX117 light chain
total genus 47
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i2xB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i2xB02
4CVXA 4NUGH 2YPVH 3VWKB 1D6VH 4RMRA 3NZHH 3PDOA 4DUVA 4OLUL 4I77L 2JTDA 1CF8H 2G5BB 1ZT7A 4HC1A 4PJ5D 1XGPA 1E4JA 4QXWA 1BEYH 2AABL 5GS2D 2VITA 3DVGA 3WV0A 4DN3H 3DMMA 1EMTH 1M7XA 1LP9E 4QRSB 4K3GA 3LKRA 2IPUG 3PQYB 1A1MB 3OAZK 4BSWA 3S6CA 1LE5A 1OTTD 3MLVH 3LD8C 3QQ3B 4Z7VB 1XGRA 1ZA6B 1JNNH 4ZFOB 5CFHA 5I30H 4ALAL 4GG6A 1II4E 4YLQT 4WJ5B 5F8QC 2DWEA 1UJTA 4U1JA 3GMMA 2P5WA 3WE6B 5D9SA 5DD0H 3IFPA 1NGQL 4HJGA 1WF5A 1D6EB 4YHLH 2B1HH 1I1AA 1DBJL 4LQ1A 5EC1A 4BUGA 5E9DA 1YYLL 1JMZA 2DQIL 2BOCB 3GBNH 4PIRF 2EH7L 1JF5A 2W9LA 2XWTB 4ERSL 1CLYL 1KLUA 3LAFA 1I9IL 3KWWA 4M7JH 3HFML 2NX5D 2X1XR 2Z8VC 3FQTB 3PGFL 1JPSL 4LSVH 4M1CC 2CKBA 1RU9H 3EOBA 3I6GB 3CIQA 1TZIB 3UTQB 2EICA 4P5TB 2NR6D 3RL2A 3WS3B 3PHOB 3NH7H 1Q0YL 2R8SL 1P7HL 3CDGB 5F9AC 4HWBL 2FJFB 4GAGL 4OD3H 1T3FB 3STZB 4NQDA 1Y18B 4MAUL 1ULVA 2BSTB 2Z92B 5HY9B 4NT6B 2R0KH 3OX8A 3UYOD 1FG9C 4MJIA 4YDLC 5HGAA 3AM8C 3HZKB 3LOWA 4WEMB 2JIXD 1IGTB 4ZOEA 1JZ7A 5MEQA 5F1NB 3CLEH 4QHKJ 3S96A 3LEVL 3Q1SH 3TH3T 2BDNL 4IRZL 3BJ91 4XBPA 4POYA 4HFUL 1TPXB 1OSPH 1P69B 2IBGA 4P0DA 1NANH 2NXZD 3KPOB 4PRPA 1NMCB 4CADB 5IIEB 2OJZH 3DIFA 1H3PH 2NMSA 4K8RD 2O5YL 3MO1B 3LN9A 4NC2B 4TUOA 4JR9L 3QXVA 5DURD 2H6PB 1KYOK 1FFOB 1MEXH 5EFIA 3H7BA 2Z35B 4YO0A 3NA9H 5K93A 5H94B 4UAOC 4AL8L 5B39G 2IADB 1DBKL 3HRZB 1YDPA 1XR8B 4X4ZA 1NDMA 4JLRB 5GGQL 1JF1A 4XRCA 4KK8C 1KTKE 5DDHB 4QHKI 4DGYL 4EOWL 5LWYL 1ZHBB 4NFBA 4QHUA 1LWRA 3BP4B 1F3DJ 1HE7A 4QCIB 2R56L 1HSBA 3FB5A 1VA9A 4R0LB 4XPTH 5HVFB 4UTBL 1OGTA 2OLDA 4GUPA 2QKIA 3OR6A 3NIFF 3HC4H 4JFYB 2ZSVA 1SBSL 2P4AB 3QHZL 1T1YB 4X7DC 1JNNL 2KQMA 1BF2A 5MP6L 5MEPB 2ZUQB 1KC5L 2K3TA 5EU6D 4KK5D 4XMLL 1SEBB 4ELMA 2FGWL 4P23B 3ARSA 2A74B 1J1XH 2AJXL 4FXGA 3O3EB 2IQ9L 2G2RB 5GISL 3KPLA 2IG2H 2BFVL 3CCHB 2NY5C 4XPFL 3O0RH 4RQQA 5F7DA 1X7QB 4MSWB 4HCRH 1NEZG 2E7MA 2ESVA 5JUEH 4KRMB 1HQ4B 2E7LA 5D96C 5K9OA 3EJZD 1JNJA 2FGWH 3NA4A 4YHNA 1KEGL 1JNHB 4I5BA 2B4CH 4MXVE 3OKNB 3IKKA 1U8QB 4M8VA 4PJFA 4DEPB 3OKKA 2AXFB 4OLZL 3SDAC 1NBYB 5E2TL 3C8KA 1QLFA 3G5XB 1DBMH 3MFGB 4JGMA 4WWKB 4X4YA 4G8GD 5FYJU 5HD8D 4IS6B 4ZUSB 2B1AH 4X5LA 4BQ9A 1NLDH 2WANA 1P6FA 3FQXB 1NCDL 5D1QC 2H32A 1RK1B 1YYML 2FEEI 4LKCB 3KLSA 1MRCH 2E7LC 2VL4A 4U3HA 1Y0LA 5JDSA 4U1GC 4JN1H 2GCYA 2BNQA 1FSKB 1X5HA 2QSCH 1N5YH 1Z6JT 5DYOB 3U79A 2WUCH 4YX2L 1G7JB 2N7BA 2MFNA 4MA7H 1H3UA 2BSSB 5IVXE 2CLVA 1PG7H 1NCAH 2J88H 1JUFA 4XBGA 1KXVC 3RVVD 4LVOC 3TO4C 1PZ5A 4KJPD 4Z7QF 4MHHG 3QIUD 2I60H 4HIIB 3A67H 1HXYA 1AO7B 2CRYA 4CW1B 1CR9L 2E27L 3STZA 4NUJB 3VGEA 4EUPG 1AXIB 4PS4H 1YNLL 1WCBB 3PWPA 1QFUH 1S9WA 4LDEB 5FGRA 4PP2B 1OGAE 1NGWA 1FZKA 1IZJA 5ACMA 5IFHL 2R0ZH 2ZOKA 5HHMB 2DJUA 1QBLL 2ZNXA 5DJDB 1CU4L 3GIZH 2YPLE 3MRMB 2GYSA 4F7TA 4NO3A 3GKWH 1A7QL 1DANT 4OT1L 5TGBA 4NJ9L 3ULVC 4XMKH 4ZS6D 4HUVA 5EORL 1GZPA 2F15A 4BH8B 4DUXA 3PIQA 5FO8A 4MAUH 1MJUH 4WFHE 1J8KA 2P49B 5IB1B 5I74C 1F13A 1FFOA 3TCXA 5KS9A 1CDIA 3MRHB 1BFVL 4OJFL 5IJVB 4M93B 4QRRB 3NZ8B 5GRVK 1RZJL 5C08D 3P9LA 3EAKA 3ZT5A 3P4NA 2VL5B 4M6OH 2O93L 1QSEE 5EU4B 5CEZD 5E8NA 5HI4C 4MDIB 1DBJH 1HH9A 4FQCL 4F8QA 2K9UA 5GS1B 1A9EA 1PLGH 3JV4B 4LBEA 2ATKB 1CLYH 5BO1L 5DHYA 4RMVA 3MJ9A 5JW4Q 1JWMB 3VFWB 1ZLWH 1NGQH 2CLRB 5BMFL 4L8CB 3IDUA 5MEPA 3B9KA 4FXKA 4GRLD 1U9KA 4NQDE 5CMAA 3RI5F 4HJJH 2JB5L 3L5HA 1CLOL 2G5BA 3NH7L 3ZT7A 1MIEL 5TE6H 1DBML 4HUXA 5IMKB 1G9NH 2AV7A 3PWJA 3TESA 1JWSA 4GQ9L 3S3SA 3DVGB 2UWEB 2X4QB 4GAGH 2F53E 1K6QL 1LO0H 1TNMA 5BXFA 2H26B 1YECH 3H7LA 1R6VA 1Q38A 3T0ED 4G5ZH 2KZWA 3AMKA 3PQYA 1HHHB 3MNZA 3DX7B 1MIEH 3MA7A 4WO4B 2APTA 5B8CA 3V6BR 1UYWH 5KJRH 4JZJC 2FJFA 1MWAL 3RL1B 4LNRB 1SMAA 1RIHL 2HFEA 3QNXB 2AXFA 1NMAL 4HT1H 1F6AB 2OTUB 3B9DA 2R2BB 3ARFD 4FQ1L 4ZUWB 4LPCA 2HT3C 3BPOB 4XX1G 5D2NE 4RISH 2Q6WB 1CFVL 5HGBB 1W0WB 5EOCL 4M7JL 1WBXA 3FQWA 4C83A 5DJZA 3H9HB 3T1WA 4KROC 1PQZA 2O5YH 3WLWD 4XAKD 1N6UA 4NHCL 5F1OB 5I73B 1ACYL 4W4NA 1FVEA 4PJCA 4WU5B 2NYYC 3WJLA 5C0BB 1KSRA 4P5TA 1UH3A 4IOIB 5ESVA 1G84A 1NGYA 2YC1A 4YDVA 3IYLW 4R96A 5JR1L 5EORH 3W9EA 3MOAL 4NP4H 5JIHA 5HDBF 4UT7L 3FCTB 4KKCD 2YA1A 4JRYB 3GSXA 4L3CB 5D2NA 1FV1A 4JQIH 4OLWH 3O4OC 1BQSA 4XNUL 3SBWC 1KCLA 2BXZA 4CVUA 4K94L 4QCIA 3OKLB 3L3HB 5JOPE 3EYSH 2GY7B 1YN6A 4LLYA 2IPKA 4PJ9C 1F11B 3OR6B 1AY1H 3OG6B 5HYSA 4NKDA 5KSAC 4JFFA 2CDGB 3ALPA 1T1YA 5DJDA 3MRMA 1MFDH 5D7LD 2F58H 1KJMA 4YHZL 3MGAA 2X4SA 1ETZA 5C9JA 1HYRC 3QEGH 3DRTA 4R4BB 4U1IA 5T33L 4NBZB 3QFJE 4P2OA 3NPZB 4LU5L 2CDFA 3M17B 3PGCB 2AK4A 3IGAB 2V7NB 2EKSA 4TUJB 4UTAL 4LCWA 4H8WC 4YZFE 4BKLA 5C86A 4PJEF 2Z31C 15C8L 2NR6C 4MD4B 1G9EA 1WUNT 4N1CA 3EO0A 4RRPG 1MLCA 4K7PL 2EDJA 1ZEAH 4KDTC 5E4EB 2F54D 3HUJB 4Y2OA 3C08H 4JRXB 4M7KH 4R7NB 5DSCB 1UB5A 5IR1A 2ZSVB 4YR6A 4WWKA 3WFBL 4OCYL 4WWKD 4JPVL 3FFCB 2HAZA 4DZBB 2A6JA 1RZFL 4PJ9B 5HHVL 2KH2B 3BPNB 2APFA 2ICWI 4EN3C 5CUSL 2V2XB 1J0IA 2ZG2A 2PW1A 2FGZA 3DUHA 4L9LB 3WNNA 1V7NH 4YFDB 3TNMA 4MNGB 2QSVA 5FKPB 1J86A 2BCKB 5IHZB 1X7QA 4PLKC 2B5IB 4Z77A 4UOW1 4X6CA 3U0PB 1S8DB 3HPLB 5EULV 4Z9KB 1FO0H 4MMZC 4YDKH 2H2PC 4LEXH 2C3VB 3BKYH 3MRDA 2WQ8A 5C0FB 1IL1B 4R8WL 1KELH 2CIIA 4JFXA 3ZTNH 4R2GB 5A16B 3RWFA 4E9LA 1OPGH 1U93B 4JFQA 1X4ZA 3MGOA 1KPRB 3QNZA 4O00A 3UPAA 3QA3A 4ZUUA 4OB5L 4JG0H 3LDBB 4Z95H 4WGWB 3SGJA 3FMGH 4MQTB 1SM3L 3I75A 3BESR 3MV8E 4NNXA 4OI9A 3HUJE 1LEIA 4JB9L 2AERT 1D5IL 3P30H 4LRNH 4OCRL 1PG7W 1UACH 2VWEC 3CMOH 1UH2A 4V2CB 4WO4C 4EIGB 5A2JH 2P8PA 3T4YA 3TYFB 4FQXB 3ULSB 2YR3A 3MLWH 1X5JA 4OZIA 5KS9B 5TDOB 3VXRA 3WXVL 2J8UF 2BY1A 3VFUB 1NC2B 4P5KB 3DOSA 2JCCE 3QFDB 3U1SL 5F3BB 3BHBA 1E6JL 3HZYA 2BNRB 4G6AC 3O2WL 2IG2L 3CSYA 3LN5B 4PYHA 4X9HA 4EBQL 4MB5A 4YHIA 4R26L 1FYTD 2JB5H 1UJ3A 1CWVA 1U91B 3L9RB 3L3DB 5C0CB 4OQTL 3QWRD 3RVXD 2XY2A 4Z78A 1AR1C 5GRWA 3QUXA 1E6JH 1MWAA 1MFEL 3GO1L 1LO2L 4D8PA 3ARZA 4P9HC 2I9LA 4MDJA 5D8JH 3HRZA 2X4PB 4NQCD 2WNGA 4L1DA 1S7VB 2VTFA 3OGOE 3RKDC 4R4BA 4PY7B 4NKMB 1H5BA 4MAYD 1MHEA 2X44D 3U2SA 1IGIH 3WFCL 5FKAA 1UB6B 3OB0H 3KYKL 1N3NB 3RNKB 1JL8A 5E6IB 3VXUE 3MRHA 5IJVA 3PP3K 2DAVA 3MX0A 4WWID 3KXFD 3SGKC 1YMMA 4QHLB 3BEWB 1KTDA 1K4CA 2QHRH 5T5NF 4UUJA 3UPRB 1CQKA 4YHLL 2NYYD 1IEAB 4J3OC 2OCFD 3WIIL 3JXAA 1P4IH 2ATPA 3RWGB 4QRTB 3SJVD 1NCBL 5E8DL 2A0LC 3EO0B 1WFOA 4ONGL 1PEZA 1KGCE 4AMKH 3BRFA 4X6DB 2COQA 3VI4F 4MNHB 4MA3B 4JJHA 1J0JA 2ADIA 4UNVA 1KJVB 3BAEL 1MREH 1HIMH 3MA9L 2VC2H 4BQ6A 5I2IA 3EW3B 1AGDA 1HOCA 1MQKL 1MF2H 2F5BL 1QFHA 2FJHA 2MCPH 1KCVL 5CGYD 1HILB 3GHEH 5JO5A 1J12A 2X4QA 3MBXL 1INQB 4HUUB 2DS4A 4G8GE 4JB9H 3BW9A 7CGTA 4U7SA 1Q0YH 4RWYH 1PVHA 3KYNA 3QXTA 4K94H 5IBTH 5IB3A 4K3HA 1AXSB 1JK8A 2YRPA 3BDYH 4QNPF 1YY8B 3M8OL 5IQ7L 4QHMB 1TVBB 4YAQB 4U1GB 4IEFB 1A7OL 4XBEL 3WS6A 5HSFA 1AKJB 2GFBA 4NKOB 4YFLI 4K7FA 5F6HJ 1D3CA 2NW3B 1A7RL 4J1UB 4G9FE 4Q6IB 3TVMA 1AD0B 3HC3H 1NGZB 3CXDL 3OKDA 2SEBA 3EGSB 4KKBC 1CD1A 4QKXB 4OCWH 1EGJL 4ZYKB 3U6RA 3OXRA 5HYQB 3Q2CA 1A6PA 3MV7A 1MCHA 4K2UH 4U1IB 5HPMB 3ULUH 1UVQA 5LWYH 5DXWA 4XP9L 3ZHDA 5IWLA 3T1FA 4J3UA 3ARQA 2E8YA 4TSCH 3DV6B 1ACYH 1QRNA 4D94A 3ECBB 3PWPB 1I7RB 5LGJA 5E99H 2AEIT 2LU7A 1X5LA 3BD3A 3L7EA 3HRPA 1NLBH 1S7RA 5CIPB 3QFDA 5F3BA 4RIRB 2QQQA 3OHXB 1AC6A 5EN2B 4KY1H 2ADJA 3GK8H 3ZKMC 2JJSC 3P30L 2R69L 4PRNB 4F7TB 2R4RH 1FV1B 4JKPH 3VCLB 2DL2A 4ZUTA 4HIXH 3GB7B 3FONB 1VKXA 3TEUA 1S9KC 3BEVB 1G7LB 2CO6B 5EIIA 1V7NL 3OKEB 5ICZB 2Z91A 5E8OA 3THML 1RULL 4CVXB 1PDKA 1JZ4A 2VAJA 4E0RA 3L7FB 1IEBA 3ZDYF 3PDOB 1FQ9C 3UTZA 2DQTL 4AMKL 1DN0B 5DVLA 1XH3B 1DANU 4LCUA 1VACA 1ZA3B 4HWZA 3PXHA 4LGSB 5C6WH 5ETUB 2CMRL 3LB6D 3FKUS 5LCVH 4OUUA 4E41A 5KSVA 1B6UA 1I1YA 2YZ8A 4AL8H 5CZVL 4X0KB 2VDNH 3JV4A 2X4NA 3LRSB 1T80A 1D9KC 3EYUH 1CFVH 5DEFA 1I9IH 3EDKA 3SKMB 2OI9C 1T89A 3R06A 1UWGL 4JKKA 1FN4B 1A1NB 1ZGLP 3HG1A 4TULH 4PRIB 3TJEL 2P5EA 2O5ZH 1OW0A 1AP2B 3CDYA 2BSED 4Y1AB 3EYUL 3FRPG 1LD9B 4IDLA 4LL9A 2MCG1 3V0VB 3KPRA 1LP9B 3PWUA 5I2IB 4BFGA 3W11C 1VGKA 4P2QB 3MNVB 4FG6C 2FJHB 4G6FD 2R0KL 3BYTA 2AXJA 4MGXA 1SYVB 3BGFB 2DLGA 2H9GB 4EUPB 3W11D 3MRIA 4X6CE 3KPPB 3V5KA 3RGHA 1I75A 3BUYA 1JPGA 3EYSL 1EBAA 4PJ7F 1QSVA 3U4EB 3EOBB 4HFUH 3DO3A 4RGNE 3S5LA 1A6ZB 1TZIA 3UTQA 2IANE 3IFLL 5KG9B 5FYLH 1CGXA 5IESH 4H1LG 5BQ7A 2ZUTA 5E9DD 1DTUA 4ZO6A 1ZT4A 1KPRA 2NPLX 3IF1B 3QNZB 2XRAL 1D6VL 3P0VL 3WEXB 4KC3B 5HY9A 1PYWB 4ONHB 3DVNB 2FEEL 2GY5A 3QXAB 5F7MC 1MCPL 3BXNB 2F53D 2AJZA 1FO0B 1JE6A 3H9YA 4OQTH 5DJZB 1IAKB 1A6UL 4PD4J 3AY4A 1PQZB 4APQD 4JFDD 1RZ8B 4YNYB 1XIWC 3G6JE 4LSDA 3LMJH 2VLKB 2J7LA 4XPAH 4OZIE 3O9WA 4L4JA 3MJ9H 4LF3A 2IPTL 4QRUA 3D3VA 5D1XA 5AZ2L 1HN1A 1NCUA 4OLYL 3O3DA 4HHAA 1OF2A 1I7RA 2YD6A 1RQ5A 3CFEB 3L3HA 4OD2A 3U7WL 4HX1B 2D0GA 3O6FD 1BZQK 4R7DA 5JTWA 2FH8A 4NN6C 3EZJB 5T1LB 4Z7WF 3C6LA 2J8UE 1XGYL 4ALAH 4U6YB 1T0MB 4WHTA 2VYRE 5EU6A 4U1NB 1NGXA 1SJVA 4PJBA 5GZOD 1Z3GH 1BJ1J 3GI9H 4PGBA 4WW2A 4Z0BH 1G7MA 4NBYB 2CIKB 2UY6A 1ZLUH 3IB4A 4LEXL 4M8QA 5EOCJ 4KPHH 2FX9L 1P4LB 1FRGH 1IC4L 1BOYA 4PJXA 4G8EA 3VRLF 3LPWA 4JY5L 4LHUG 2MCPL 4ERSH 4P57B 1GOGA 3RY6C 2Q3ZA 3C60A 1JV5A 3P0GB 2C5DC 3O3EA 1DVFD 4HF5L 4D9RE 3LPGA 3DXAA 3GBML 3HE6D 1W72B 1FGNH 3D87B 2VDQH 1KLGA 5HI5C 1ZLWK 3WBDA 1FG2B 3X3GH 4JEGB 2EDLA 2R23A 5D7JD 5FGBC 4X6EA 2AW2A 4RFEB 5C7XH 3VFMB 3C6SA 5DSCA 1RZJH 1FYTE 4FQ2L 4JANB 4QHNA 5ANMA 5H37H 1G9NC 3MV7E 1IAOA 2A6JB 25C8L 3WFCH 5IOPB 1Q1JH 1QFPA 3OKNA 1I85C 2J88L 4M61A 4QY8A 2KL6A 4TTDC 3FFDB 4U0QB 4ELMF 1A4JA 2JKXA 2QHRL 2NTFB 5I73C 2AJSL 4HXAH 5IVXA 1CI5A 3BN9C 5BV7B 3UJIH 1ZVSA 4HS3B 5LXGH 1CD1B 1YN7B 3D9AL 5DZNA 2YWZA 1JRHH 3HI6H 1Q0XH 1WZKA 4U6TA 4GOSA 1U92B 2NNAB 3A6BH 4BSWB 4FTVD 5GSRA 1VENA 5CJQL 3RWFB 5A16A 4NCC1 3T1FB 2HA1A 1FDLH 1FNEA 1VADA 4JKPL 1YEDB 3DV6A 3H9ZA 4U7KA 4Q9QH 2ZP0T 4NRZB 1U3ZA 3KYNB 5D1XD 4X80H 4PJFF 4H26A 4I18C 4E5XB 2QHLA 1EO8H 1SYSB 1NLBL 1S7RB 2MKWA 5DMIL 3O9WD 3HG1E 2BRRL 4CW1A 3QQ4B 3PV7A 5KSBF 5DQDH 4N68A 1Q72H 2D3VA 2UWEE 4ORZC 5EC1B 4KUCD 1SJEB 3KVQA 5CGYC 1XFPA 5DJ6A 1BF8A 3MSPA 4CUCA 1N6QH 5GS0C 1TZGL 1FE8H 4OZ4A 3KWWB 1RZKL 5FV2A 3CGTA 5F9JA 4FQ1H 3OKDB 5IQ7H 1PG7L 5E8OB 3SJVB 2PW2A 1JHLH 3I6LD 3LEXA 4A6YB 1JZ2A 2BOBA 4DFIA 3VFVB 3IS0X 3L5XL 5DO2C 3U6RB 4URTB 1YEEL 2X9XA 2HKHL 1G6RB 5I8CB 1UXWB 2DOCA 2DMBA 1GZPB 2CR3A 3PIQB 3Q1SL 1Z2KA 2BNRA 4HGMA 1KEGH 4LF3B 3GGWA 5E2VL 4UILL 3L3IB 4TVPE 1QRNB 3VXMD 5IHUL 3QDJD 3MA9H 2FCBA 1JHLL 2V2WB 3HB3D 1QSZA 1BOGA 3T08A 4X4ME 3Q0HA 2XTJD 3GMRB 3MLXL 4HWNA 3J8F7 3TBSB 2A6DB 3T65B 2XG5A 3B9VA 2HG5B 5KVEL 3TN0B 3K4DA 1JPSH 4POZD 4PRIA 1YYMH 2ZCHH 5D6DC 1IT9L 2EC9U 3GMLA 4Z7OF 1MEXL 5E7FA 4JDZB 4U1LA 4PV8A 4TOYH 1OAUH 1X9QA 2VWEE 5B21A 4GW1B 4ZQKA 3LKPB 1K8DB 3MJ7A 4RDQF 3W0WE 4YXLL 1JYWA 3L1OH 5F71A 1F8TH 1I4FA 2XA8L 1AQDB 4HLZG 1HCFX 4YO0B 4L8DA 4JFDB 1RMFL 3OZ9H 4Y16C 1YMMB 3CFBB 3BEWA 1HCVA 3QEUA 3UPRA 3X11B 3SDXB 1MH5A 1UM4L 4H88L 2ARWA 4XC3L 4A6YH 5KANI 1XCTB 3LVEA 1N5AB 5LJYH 2XWBB 5C2BH 2HTLD 4KWUA 1QR1A 1WFTA 2VDNL 1XAUA 3JV5A 5JIIA 2EDKA 4JFYA 3STLB 5HI4D 3WFDH 4YJZL 4DAGH 1FRGL 4P4KC 2FEDC 3MA7B 4WO4A 5JHDE 1IAOB 3NIGF 2CK0H 4MQXC 3STBA 5C2UB 2DQJH 2VLME 1ITBB 2WAHA 3ZE1E 3R8QA 5EBMB 1F6AA 2OTUA 5IROC 5JMRA 4OZGE 1S7UB 1G9MH 2X1QA 1RK0A 4UI2A 4GAYA 4C55A 4F33A 1WBZA 2NY7H 4OCRH 5TF0A 2FX7H 5F7DB 2OSLA 4KKAD 5D70L 1N59B 2ZUXA 5J57B 1PZUB 4EN3A 1REIA 1X6LA 3DUUB 2XTLA 4LLQA 3BH8A 2NXYC 4R26H 4IRJA 3UTOA 4KUZL 3LEYL 1G1YA 1OAYH 3Q3GB 2DDQL 3MV11 1M4KA 3BGMB 4LRIA 5FYLL 3QP3A 4FFZL 1IGTA 1DEDA 2YPVL 2DD8H 2IBZY 2E6PA 1RZIA 3MODL 4PRAB 3DROB 1OP3K 3GSVB 1PYWA 4M6MH 3M1BB 4RSVA 3N1PC 4H25B 5GHWL 4PGEA 4AENA 1CDJA 1WGOA 2MHAA 4G9FA 5IESL 1F11A 4LVNB 5ESQB 1NCWL 2YN3A 4HC1H 5A3IC 5HYSB 1FFPA 1KB9K 1WWWX 3C5ZC 4JFFB 4I0PB 5K9KA 1R24A 3MO1A 3EYOA 3HAEA 3TBWB 5D7KE 2H6PA 4WFFE 2VQ1B 2Z35A 4ENED 2X4UA 1BEYL 2AABH 4RNRB 3C60B 3RJQB 3WFBH 5J12B 5HDBE 3CZJA 4I18A 5I66B 4NUJA 2B1AL 1WIUA 3QFJD 5E6IC 5SWSE 2WLZA 4UT6H 4RAUA 1P5UA 4MXWH 4W70A 3BIKB 1VKXB 4UV7L 1HIML 4LNVA 1B4RA 1R5WB 4Z7UA 2L7JA 4G8GB 4X9BA 1TTUA 1UYWL 4A6YL 4IMLA 2XN9E 1NCCH 2H2SC 3QUXC 4PUBL 2DQIH 3GBNL 1PKQB 3FAWA 5L8JB 3PUCA 4JHZA 1KCVH 3HR6A 2MQCA 1QPPA 2ARJA 4NOBA 4Y5XC 5EU6B 5EOCH 3RIAK 5CILH 3C8DA 2CXGA 1QSFB 3HMXA 5EH1A 1S5IH 5IR1B 4YR6B 3VJ6B 4R8WH 5M94B 1H5BC 1D5BA 1GGCH 4M6OL 5I6XB 1M7IA 5KS9E 4F37F 4GT7A 2VZTA 3MFFB 4HPYH 3NZHL 1EPFA 3FZUD 3FRUA 4Q9QL 4CU8A 4AG4L 4PLOB 3QEQD 3KLHC 4Y5VA 4Y4FB 4HH9B 4S0TD 5D7LE 2IBZX 4RGND 3IAGC 1DE4B 3S8WA 4PB9H 4YUEH 5EU4A 2DQHH 5E8NB 2BY0A 4OLWL 1T04B 3WNLA 1IMHC 5ID1B 2FECL 1VFUA 1AP2A 4HKBA 5SX4I 4ZODA 5FHAL 1INEH 4XP6H 5J12C 5BVPH 2KDGA 3IU3B 5CD5D 3AB0C 1FGNL 3U0TA 4XXDB 2FR4A 2X09A 5TE7H 4NQTA 4UMGA 2BY3A 1AD9A 4AEHL 1G0YR 3T2OA 5D5MF 1AGEB 4JR9H 1J8HE 1U8LB 2P24A 1NAKL 5T3XH 5L6YL 4WFGE 2X05A 2F58L 5I16A 2PCPB 3L5WB 4GRLC 4JQVA 3SKNB 1I3RB 1GC1C 1FVDA 3BP6B 3MR9A 4G9DB 2R4RL 4S1RL 4DVRH 1P9MA 2J3SA 4KK9C 4OZGF 1QQDB 1QLEH 4ZFZB 2DICA 5IKCA 2JIXA 3T0EA 1OAZL 1YPZA 5JPMB 3UAJD 4J8RA 5F1SA 4MJIE 2X1OA 4ODBD 5KN5B 4OV5B 4G7YH 4N8CL 2NX5B 3QG6A 4OD3L 3EFDH 4MJ2A 4JM4L 4MNQB 4OF3A 4M5ZL 1R5IB 4JO4L 3V6ZB 1KYOJ 5F89A 3MGTA 4NQVB 2XKSA 4JDZA 4U1LB 3WFEH 1H3VA 1U91A 4C4KT 2DM2A 3LRHA 2W0LA 3BISA 1MUJA 3VXUB 3CLEL 4Y4KC 2P44B 3TGXA 1P4IL 5F93C 4Q97A 4CU7A 3X13A 3K4AA 4EDWH 4OTXL 4XVUC 1AQDA 2DQEH 2Z4QB 5A2FA 1F4YL 2P7TA 3ES6B 3RWDB 5FCUL 3QJFB 1UT9A 2X4PA 1XZ0B 1JI1A 2HFFB 4YHMH 2B4CL 4UIKL 3FCTA 4JDTL 4XC3H 3QDGE 4DKAA 4ACPA 1CTNA 5E2TH 1RUML 1K8IB 4L4VD 3JTTB 5IM7B 4WTZG 2HVJB 1I8LA 3BIKA 5A2IH 4GKSB 1KJ3L 1T7VA 4PGBB 4WW2B 3T65A 5B4MC 4HIJB 3V95A 2G9HA 5EUOA 2CLRA 1Y6MR 1S7TA 4UINH 5GS3A 4LKXA 4JRYE 2R0WH 4N0YL 1K2DA 1KEML 1WISA 3QEQB 4TYUA 4XPTL 3VFOB 1YEJL 3RGVA 3WIFB 3GSOB 1AH1A 4P3WA 4FQQA 2ZCHL 2YRLA 1YEKL 2VXVL 4PG2C 5DVNA 1IAIM 5E5UB 4ZS7L 1A02N 4PJDE 1I8LC 4P48A 1BM3H 4FFZH 1FZMA 1E4XL 2Y07L 5E8DH 3CUPA 3KLDA 1RZFH 1LDPL 4L4TE 4EBQH 1T7ZA 2QJDA 2XA8H 1WV7T 3Q3GA 4OCLC 3RQ3A 3U7YH 5HYIA 2CK2A 4QRPA 1U2HA 4KJYB 2DLEA 3D39E 5EB9A 5BZDA 4OZHA 1IE5A 1Z9LA 4KJQD 5C09A 4Q0XH 5I71C 3AC0A 4Y5XA 4OT1H 1MHCA 2J8UB 3W82A 5DJAA 3AUVA 1T20B 1R0AL 3BWAB 4L4VA 1IKFL 2ILLA 2I26N 1HXMA 3C5SA 2YA0A 1CGSL 3GMPA 3D2UB 1YEGL 3WHE0 3TNMB 3B2UC 2FBJL 3NCCB 1Z9SA 3L6FA 3ME0A 5CKAA 5J7CC 1ZGLM 1Q9WB 2P24B 3EUUA 1PG7X 4AK1A 3O4OB 3MXWL 1QKZH 3WNKA 5DWUL 4XP6L 3D39A 3I85A 5BVPL 3MV7B 2VKWA 3AAZA 2XPGB 1UZ8A 4U1KA 3DUUA 4I8DA 4O2CB 2Z8RA 3BH8B 3I50L 3MYZA 4RWHA 1CDYA 4U3XA 3DX8B 2Q20A 4I18B 4M5YL 3O2VL 2PXYB 4WHYG 3V5DA 1MIML 1BQLH 1IGYA 2MQ3A 2DF3A 1DQJB 1NCNA 4UDTA 1NMBL 1WZ1H 4ZD3H 5EN2A 5C0AE 3U0WH 2G60H 1X5ZA 3OJVC 4EXKA 4HG4J 3U46A 4XMPH 4QRPD 5HJ3A 4Q9CA 3VWKC 3H3PH 5FFLA 2FB4L 5ESQA 5EUKB 1WWCA 4I0PD 2VLRB 5EU3A 4I0PA 1A6UH 3JWDL 4F3FA 4DAGL 3VXQB 2X4RA 4WI2A 1IEBB 1A6AA 4PLJD 4RWYL 4KROD 5TDOA 1FC1A 2O5ZL 1RZKC 4JKLA 3UYRL 3D5OF 3WO4B 1JRHI 4BKLB 3FMGL 3UO1L 3D85D 5KSBB 1VACB 1ZA3A 4HWZB 3B6SA 3ALXA 4NO2A 4PJAE 2HG5A 3VGFA 4PB9L 3H42H 5IVZB 1ZLUK 5GSVA 4ELKB 3SN6N 5KSAB 3GSQB 5EO1B 1HHKA 4XI5D 2GJZB 3MRFA 2W0FB 4GRMA 1NBVH 4Z0XA 4QTIL 3L3DA 5C0CA 4PP1D 3QQ9C 5A43C 3UX9B 2AJYL 1A1NA 1KN2H 3S37H 4XXDA 3EYQD 4PRIE 3ZZ1A 4F2MA 4O2EA 2QEJA 4Y4HD 3UBXB 4WUUA 3NCFB 3RNQB 2BHYA 5I15H 1ZTXH 3WYRA 3VXNA 1AO7E 1CE1H 1A47A 1MFAH 1V3KA 4PY7A 1H5BB 3W9DB 3HLAB 1UZ6E 3FO9B 1VGKB 1IAMA 5JQ6H 4Y4KD 4QWWC 1IKNC 4IOFC 2BRRH 3EOAA 1KTDB 2BNUB 4L5FL 4S10A 3DX9A 4HKJB 4HF5H 4ZPVA 1FZMB 3FB6B 1JPGB 2YK1H 2LV4A 3HCVB 4YE4H 1QQDA 2H1PL 3JWOH 4DZ8A 4KZDL 3OAYK 4U4BA 1B3JA 4EDXA 5BQ7B 1KACB 5DRZA 4G6KH 2VO5A 5C0CD 4K8RH 4QXUH 3U9PH 1Q94A 3MACH 3PDDA 4U1SB 3WUWG 5BW7C 2CR6A 1MHCB 1YMMD 1KCRH 2J8UA 2WW8A 1EHXA 5HHPB 4HBCL 3QEGL 1Y6NR 4OFYA 3F7QA 4OM1H 4H20L 4Q74A 2HT4D 3DYOA 3FN3A 4LMQI 1OOAA 1PX4A 3SY0B 1LDPH 4OF0A 2LTQB 2ZNWA 3NFNA 4Y16D 3RDTA 3I9GL 5CAYB 3D48R 3RVUC 1Q9WA 2PUQT 3MRRB 2FH6A 3GSWA 3MV7D 2C26A 32C2B 3MRKB 3RWDA 2E6JA 3MCKB 4Q0XL 1G0DA 4P5KA 5FYJD 4NO5A 4N5EC 2O26U 5EUOF 1RZ7L 1OT1A 2D0FA 1W8OA 5L2KE 4YQXH 3EO9H 4NQUA 2ERJC 3QCTH 1ZWIB 1OF2B 2DYPA 3H0TA 5C3TA 5IMMA 1CLOH 4KUCF 2MHAB 3PWLA 3K2MC 4M48H 1LE5B 3SHSA 1WQVT 1GGBL 4P9ML 4E41E 3NCYP 4YXKL 4KDWA 4M5ZH 3V6ZA 4N0FB 3EOYG 3SKUD 5I9QB 3ARVA 3ARED 4LLMA 3AB0B 4XNYL 1NBVL 2HVKA 3PL6C 2LU3A 2MTPA 3LEVH 2EDFA 4OFYD 3C60D 4H0IA 1B0RB 4F7MA 1G7MB 4H1LA 43CAA 5CJBA 1NLDL 1LO5B 4X5WB 2V2TB 5JXEC 1QNZH 3IJHB 4JDVB 1KCUL 3E8UL 3SGDI 3QISA 3QO0B 3VD3A 3K8MA 5LGJB 5EC2B 4HT1L 5AWNH 2NLJB 3P4OB 5D5MA 5ADOL 5C0JB 1JYNA 5IV2A 1NFDF 4LLVB 4M43L 5JNYB 4LU5H 1HDMA 4P4KB 1EHAA 3RBSA 2F19L 3MOQA 2I07B 2ZSWB 1I8KA 1NAKH 3OSKA 5I6XC 3OJDA 7FABH 3N85L 1J1PL 5MENA 4JHAH 1JBJA 5DR5L 4Z7QE 1FNGA 4X7CC 4XGZB 1H15A 1PKOA 2IH3A 1FH5L 4I9WD 4PBVC 4JDTH 2NXYB 4Y5XB 2M1KA 5EA0L 3KPSB 1MRFH 2XWJA 4J3SA 2AGJL 5T1DL 2WM0A 1YPZF 1MCOL 2Z31A 5DJXA 1RJLB 4Y19D 5FGSA 1ADQH 2GTWA 4KVCL 3HZKA 1OAUL 1ED3A 3P9WB 4P3DB 5FUCE 3MBEA 4ENEC 3LQAL 4U2YA 1T1XB 5IVXB 4YXLH 3O6KH 5I1HL 3HLAA 5AUMB 1AHWA 3GM0A 4LASH 2ZUVA 5E1AA 5FYJL 5E9DE 2P42B 1U95B 1UA6L 5T1LD 1N2RB 1KFAL 5IB3B 1AI1H 4GLRI 5E2JA 5DI8B 1U3YA 1AY1L 1G0XA 2QQLH 3DVIA 1HINH 3ZTJH 5JLZB 4GKZA 4M6ML 3SE4C 4M5YH 2DDQH 1ZK9A 3O2VH 4M6AA 1U8QA 1Q8MA 4NZTH 4PJFB 1WBYA 4MA8H 4KK9D 2HKHH 4PGZA 5DVOA 2YZ1A 3GKZA 3GHBH 4W6WB 4WVRA 2QQLL 1FCCA 4FQCH 4Q2ZB 5IHUH 4QHUB 3BWAA 4L4VB 5D8JL 3MNVA 3EIFA 3IKCA 3AM8A 2CGRH 3OXRB 1ZS8B 4Y16B 3VGHA 1U3JA 4U1HB 2ZUYA 3MRIB 1BIIA 4N8VA 3TJHC 3EDEA 1JPFA 3PQYE 3KXFA 3TO4B 5DGQA 1ZT1B 3QCVH 4FXLA 4ZS6C 4M7LL 3M07A 5C07E 1CIUA 2FX7L 3OQ3B 5C0BD 4K3JH 3RX5A 2JIXB 1RIUH 2F8XC 3C2AH 1YPZB 3PL6B 5IT2H 5DWUH 5DD5H 1TJGL 2BHZA 1G6RA 5I8CA 4YEEA 1B2WH 1YEIH 4JVPA 4RIRA 1QBMH 4O2CA 3VXUD 5BOPA 4JRWA 1FLTX 1T5XB 4DKFL 3ABZA 2EO1A 2VZOA 5HYJA 3FN0H 3LEYH 3O41A 1OL0A 4GMTH 1RIVL 4PG9B 3G9VA 3P77A 1RIUL 1NGWB 1Z9MA 1NCCL 2GK0A 3VFTA 3S5LG 2P5WD 5EWIL 3ULVE 2IPTH 1QFUL 4ZFFA 4NQCA 3CNKA 1I1CA 1KIQA 2FNBA 2YXMA 3OKKB 4JO3H 4N8VG 2VB5A 1DBAH 3UTZB 3MLTA 1DN0A 4PJHF 1Z0NA 4ODHH 4GW1A 4HKXB 3PL6D 1RJCA 2YK1L 5CINL 2ICCA 2F5BH 5B38G 3MLUL 2X4RB 2VE6B 2WZPD 4E42A 1MFEH 1A6AB 1J8HD 5TDNB 3V6OE 2BC4A 4MA1C 5J06A 3QXWA 5C70A 3KPNB 3VXPB 4RDQG 4HAGA 3EJYD 5JDSB 3G6DH 2VZUA 4MD0A 1EUTA 4X99B 5CEYA 3TBYB 4F15C 1ES0B 2NXZC 2B7DT 4YUEL 3CFDB 1IGIL 1H3TA 1C7SA 3CC5B 2ZUQC 3C6LB 3HG1B 1U42A 5E7BA 2OTWB 4YZFF 2ZSWA 1A9EB 4YEFA 2A9NL 3SDDD 2XQBH 1NC4B 3OJDB 2V7HA 4PLKD 3DBXB 2YD1A 5IGXH 3CSPA 1TCMA 5I1DA 1U8HB 1QBBA 3NAAL 4OZFG 2Y1VA 3KPRB 1SY6H 1WFNA 1WCBA 3IFOB 3X3GL 3CFKB 1LMKA 2QV2A 3L95B 2GTWB 4X6FA 2AKRB 1L7IL 4L3EE 4L3AA 4TSBH 2JK5A 4PBXA 2F19H 3W9DA 5BVJB 1MFNA 25C8H 3NA9L 2HH0H 5E5MB 4OIIL 7FABL 5KVGL 1QEWA 3B8YA 5IBUG 4B41A 4N0CD 3UC0H 4B50A 2BNQE 3V8OA 5T33H 2CDEB 3B83A 3REWB 2GQHA 4HIXL 3SDAD 2APXA 3V4UH 5DJAB 4TSAH 4N0RA 1WBYB 4CVWA 2HFGH 5IMMB 1SBSH 3MUGA 4A2LA 3RWEA 2R2BA 3WL9A 1BLNB 2MWCA 1XIWB 2NY6D 3I6KA 2XN9A 5FM4A 2EDOA 4MDIA 1W72L 4KAQL 1P7QB 3TZVB 2OTPA 3QRFM 3WLBB 4KZDH 1U8PB 1ZHLB 4YNYA 4LLMB 4OV6F 4YHML 3AREB 4U1HA 4WW2C 1O5DT 1A2YB 4Z7WA 1JPFB 1B0RA 2VABA 5DHVB 1ZAGA 4QXUL 3MRRA 2DQEL 1RAMA 1J5OH 1I1AC 1S9VB 3PWNA 2VUOA 2NZ9C 3LDBC 2YD8A 4JZOA 1Q1JL 4H20H 4PRHD 3TZVD 4HQQH 3IU4L 3HAEG 3K3QA 4FTVA 2VJXA 2CK0L 2AJSH 2XKUA 3GSXB 3WDJA 1SJEA 3O41B 1AGBB 3PWPD 2FSEA 2X4OB 5JDJA 2AI0L 3TIEB 3CVHH 4R97B 1R5WA 4Z7UB 3TIDB 1ERNA 5ISZE 1UFUA 1AXTL 3D69A 5FK9B 1J0ZA 2R0WL 4ZS7H 4LASL 5FYJH 2YBRA 4LNRA 4JG0L 1MCOH 1GOHA 2H1PH 3JWOL 2R1WB 2EO9A 2ZOLA 3BPNC 5GJTL 2RCSL 3C9NA 2R8SH 5J13B 4F7MB 3B6SB 2VQTA 3MBEB 4RFNB 1EO8L 3WN5A 4Q9BA 3CK0L 1OWRM 2D0HA 5LBSL 3ZDXE 4JAMA 5TDNA 3GSQA 5EO1A 1L6ZA 2BC4B 4HULB 1BVLA 4WFED 1YQVL 4V1DB 4YC2C 3E1F1 3D3VE 5AWNL 3NTCL 4Y5VB 1VCAA 3W39B 4HLJA 4YIQA 3H9HA 4LP4A 1BVKB 1NEZB 1FL6B 1RZKH 4Y5YA 2XTJC 4WRLA 3ZT6A 5IJKA 4EQ3A 2DIAA 5F72S 3QWOB 3ROLB 1DQTA 5LBSH 3GMLB 4KQ3L 4TUKH 3RX7A 5L88H 2G5RA 2DJSA 3O8XD 3W2DL 1EO7A 4UT9H 4P2OD 3LKNA 3QPXL 4G8FA 2JJWA 4U3CA 1MFCH 4QXGH 1CT8A 4HPYL 2L0DA 4DUWA 4Z76A 3WXWH 1ZEAL 5DMJB 1TFHA 1TLKA 4GKNA 4LQFL 1RJLA 4BQCA 4FABH 2X41A 3IKCB 4PREA 4UB0H 3ZYJA 5L88L 5DJ2B 3VDCA 4ZPVB 5AZ2H 1GC1L 5IQ9A 2DMCA 5IJKC 1MFCL 3QUYA 5AUMA 4OJFH 4XP5H 5DMGC 1FNEB 2BJMH 4MNQE 1JGEB 4P5TD 1XGTB 5LKNA 4KTYA 1UKTA 1MJUL 1H0DB 3TPUA 2NY7L 3T0AA 3P0YH 5IKCB 4PJXE 5ILTL 2VH5L 3CH8A 3F5WA 4MA8L 5E00A 1D9KB 2NY3B 2HLAB 3RWEB 1IC5H 2DN7A 4WTZA 4WNQA 1NGPL 3VXME 3U0WL 3B3IA 4XNXH 2YMXH 3QDHA 3K46A 2EIDA 4NQCB 1P7QA 1XCQB 4LAQL 4XCEA 3UTTE 4KUZH 4O2FB 3IDNB 2XXCB 4S1DC 3U36A 2OR9L 3MV9E 4HPOH 5F8RC 3GSUB 4HZLB 3B9KD 4GQ9H 3BPOC 3MCKA 2IANB 2ED7A 4N8VB 1MHPH 3F62A 1QLEL 3JZ7A 1P7KA 3EOTL 4DZBA 3SDYL 5IHBA 3VWKA 5D2LE 5GS1C 3X13B 5EG6C 1FSKC 3IJYB 4QF1A 1CFBA 3S4SG 4NFDA 4G43A 1QSEB 4AG4H 4KKBD 5B4MD 1ZT7B 1FIEA 2YN5A 2QL1A 3TO4D 4GXUM 4IRJD 3CFDA 1RIHH 2CRMA 4ZUVA 1I3UA 3L3OB 2BCKA 4FHBD 3BGAA 5E6ZA 1FFNB 4Y1AE 4WWKC 1CVSC 5SWZE 5IT2L 4D3CL 5K59E 2UZIL 3BN3B 2GIYA 4FQHB 4DEPC 4F8TA 1IL1A 2WV3A 1UCBH 4ZQKB 5LXGL 3VFTB 3DSFH 2NY1D 3ARWA 3S36H 2WUCL 3D69B 3QIBD 4Y4FC 4L8SA 5EIQA 3HNTL 4HMCA 2YOCA 2XV6B 1WFUA 5DTFB 2EYRA 1MHHB 3UJJL 2FYYB 4MXWL 5BO1H 4GAJH 1P7QD 4M1DL 3ZHKA 1S9YB 2RFXB 5D1QD 3OF6A 1L7IH 4TSBL 4PRPE 5IV2B 2GK2A 1MH5B 4KPHL 4RAHA 1IM9A 5JQ6L 1XCTA 4N5ED 2H8PB 2NY2D 4PV9B 3F8UB 1A4KA 3KPNA 3QIUB 4M6NH 3FT3B 4TPRH 3QUMA 4Q6YA 1CVRA 4UUJB 1CDBA 2DTSA 1HI6A 2IH3B 3CUPB 3K4ZA 1FL6A 3N50A 4DQOH 4QTHA 1Z5LB 4LDOB 4XWGL 3VXRB 2I5YL 3L3JA 5F96L 1GOFA 3BMWA 5I74B 3NGBB 4OZGB 1ED3B 1S7UA 5I1DB 1U8HA 3D39D 4KY1L 2C4XA 1FZJA 5GRVL 2OR8A 3GJFB 1LK2B 3NFPA 5E03A 5FYLD 1U3HC 4P2RD 2YD9A 4CMHB 4X4XA 4DQOL 4J3VA 1S3KH 5E95B 1DR9A 5FECB 1F4YH 2MKLC 3LKOA 1E4XH 5SWZB 4Y4FA 1D5MA 4HK0B 3CVIH 4JCMA 4ZSOB 5JO5B 3C5ZB 4Z78B 3SBWA 4XNXL 3HAEH 4TNVK 3ARDD 4F7PB 3HMWH 2CKBH 1XR9B 1JGEA 1GPOH 2PO6D 4X6DE 2M8XA 5FCUH 4ZNEE 2P48B 1JK8B 3DGCR 3QB7C 3WXWL 4UNTA 3PXJA 4S1SH 2DI7A 4P99A 4HUWB 4YHKL 4OCXL 3UJTL 3VXSE 2ADGB 1A6WL 3E0GA 5EO0A 3DX8A 5IBTL 5CINH 5ELIA 4HFWB 4X7TA 4EI6B 4CNIA 5JHDA 5DFVC 1RSFA 2HFGL 3LV3B 5I1CH 4RMSA 1U8KB 4Q6IA 3TVMB 1KJ3H 3NVQA 3MOAH 3GMNB 1QNZL 1IEAA 2A38A 2H2PD 3KXFB 3FJTA 1XGRB 1ZA6A 4OZFH 4P59L 4K8RL 2XN9B 5DD6A 5DQDL 3BZFB 1JI2A 2XT1B 3VI3E 3K0WA 3WO4C 5DD1H 5AAMA 1YZZA 5CJ8A 4OGYL 1YQVH 5I16B 1EJOH 4MNHA 3BQUC 1I3RA 3CXDH 5HGHB 2QKIB 1VSCA 4MLIA 4KKAC 5HPMA 3JUYA 4YGVA 4UIMA 5EU3B 4ISVB 3ARBC 1KPUB 1ND0A 1DP0A 3QNYB 1T4KB 5C0ND 2ED8A 1G7PA 4LVNC 3BRDA 2MQ0A 3GDBA 2BXYA 3ARDC 4GH7B 3Q6GH 1BVKA 2XQYG 1IQDB 5BRZB 3BH9B 3HNSL 5IVZA 3ROLA 1R5IA 1HYSD 3N85H 5L2KB 3RL2B 1HQ4A 2ZJSH 1KELL 3GNMH 1G7LA 1NMCC 2A77L 4KGJA 1YY8A 5HHOB 3PABA 3VJ6A 3ARRA 4JFED 4QGTA 3QI9B 2B39A 2FJGB 4FQXC 3RVWC 4U6HB 2F5AL 4RBPH 3VFPA 3JWDC 1AKJA 2GFBB 1SM3H 2P7TB 1QOKA 5J3HC 4BUHA 3O3BA 3CPLB 1YY9C 1FBIL 1A21A 3PDGA 4KI5D 1OAQL 3TBYA 3WD5H 2XFXB 1FFRA 4NM4L 1IM9B 1FNHA 5GXBB 43C9B 5DVKA 4KRNA 1BREA 4ZOAA 5HYQA 2RB8A 2X4NB 3LRSA 3LMJL 4YBHA 4BH7B 4HSQA 4NZRL 2BNUA 2CRIA 4GMSL 5JQHC 3X14A 3FB6A 5IFJA 5I1AB 1HHGB 5TH2A 3RHWK 4X6DF 1Z5LA 1JUFB 4JO2L 1J5OL 1IILE 1NAML 2IMNA 1DQLH 3L95A 3L3GA 4HC1L 5GRZA 3SE4A 4OZGA 1J11A 1MHPL 3IDGA 4YQXL 4OCXH 5E24E 1M71B 1MRFL 2Q8BH 2YPKA 3RY4A 4NRYB 2GJ6B 1TTFA 3R8BB 1GCFA 2C3HA 3K1KC 1FYHB 3C5ZD 2ICEA 1FZKB 5SWZA 4MWFA 4FZEH 2JF1A 3QZWA 2A6IB 2X7LA 5E56A 3ZKXB 4NUGL 2V5SA 4YBQD 1U8OB 2P8MB 2OMBA 4NC0B 1GZQB 1U8IB 4YPGB 4BM7A 4JRXE 2JELL 4UV4L 2Q3AA 1EAPB 3SE8H 4F9PA 1QBML 4PJ7B 4Y19E 5C8JA 5GJTH 3V5HB 3NIGE 1EUUA 2YEZA 3FQRB 2JJTC 5CD3B 4JFEE 2CXKA 4MSWA 4NIKB 3VFGL 3F5WB 1RZGB 3UMTA 3WLBA 1YEFH 1D9KA 5C0IA 1XT5A 4I48B 1F3JA 3AREA 5DD3L 5KSBE 1CE1L 1U8KA 2C1PA 3AS2A 4JO1L 4LOUD 1B0GA 1VEPA 4KK5C 1VFOA 1MUJB 3VXUA 3NTCH 4KV5F 1IAKA 3OKMB 1T0NA 3PHSA 1CN4A 3NFSH 3VH8A 5D5ME 3RZCA 5BV7C 4NN6B 5J9PB 1DLHB 3BAEH 5EU7E 2RFXA 1XF3A 4WFHD 3MLUH 4LVHB 3W2DH 2VC2L 1FORL 4ISVA 2DKUA 5SWZD 1LDSA 1Q9KA 3TP4A 2WIMA 4LKCA 3NACL 5BRZE 2Y06L 1ROWA 3BPCA 4KI5F 5IM7A 3QO0A 2EDHA 1JGVH 4P4KD 3P4OA 3LN4A 2FSEB 4TVPD 3HZVB 3NAAH 1MCDA 3B5TA 4ZFOA 2BSRA 2IH1B 5TE7L 4LCYA 4XBGB 2EXYC 1P84J 4ZFGH 2Q76A 2P8LA 4D3CH 4MXVF 1YNTB 4OZIF 1MRDL 3EYQC 1JCKA 3PP3H 3K74B 4OGZA 3RTQB 1F42A 4RGMC 5LAXA 5JIPA 3KPRD 4PJCE 3MACL 4ETYA 3SDDA 2Z31B 4V1DA 4BFIB 5GJSH 1Y6KR 1KCKA 35C8H 3IFNL 1EFXA 1MRDH 5ICYA 4ZPTA 3GSNL 2KUTA 4KI5C 5J6HA 2Q86B 3ZDXF 1TITA 5GSVB 4ELKA 4L8BA 2VDML 1E4WL 3FN9A 2DJ4A 3RIFK 2GJZA 3GNML 5EOTA 1I7UA 2ITCA 3L5XH 4Q9RL 4HPOL 4AIZB 3VFMA 4M48L 5EU7C 1LO0L 3OJ2C 3FQUA 1QG3A 5AYUL 4J23A 3CFJB 1T5WB 4EI5C 3NCJL 2Z0BA 5IW1A 4PP1C 3JWDH 4Y4KB 3UBXA 4GXVH 1X3DA 3RNQA 1W0VB 2X9YA 3MLRH 4PJGA 1KIPA 5IB4A 1U6AH 3ZHLA 2IPUK 2R69H 5FO9A 1XF4B 2NXZB 2F53B 3L6FB 5T1LA 2AK4E 2NW2A 2W9DH 1HH9B 2Y36H 4I3SH 4L3CA 5EZOH 4P23D 4AEIH 1KJ2A 4X4XB 4I0CC 4EIZC 4MA1B 2UVFA 3WKMH 4Y8AA 5F96H 3KPOA 1YEHH 3AAZB 1QBAA 5CHNA 3RHWF 3JWOC 4NO0B 4OCSH 1MPAH 1PAMA 5ABDE 3RJDA 1RUQL 3DYMA 4L8CA 1ORSA 1U6AL 4G8EB 1KCRL 4YWGH 3A6BL 4JO3L 3W5NA 3OXSB 2W9EL 3TT1H 1G1CA 4CN1A 4H5SB 1UWXH 1XR8A 3TA3B 2B20A 3UC0L 2HLAA 4IMKA 1JF1B 5ERWA 5INDB 1QRND 3GIVA 3M17A 3QQ4A 4LVOB 1XF1A 4YHKH 5D1XC 3UJTH 5DRNB 5MHSE 2BERA 5BXFB 5C09E 3VD5A 4MQSB 3U46B 2EH8H 4X6EB 1QFWI 5D7IA 2FIKA 4RZCA 3WJJC 1FZOA 2ID5A 3FT4A 3QBTB 3KGRA 3TLRA 4L4VE 3TCLB 5D7SH 4ZDHB 4LSPL 3O6KL 4U49A 4JZJB 1YJDL 1LQSR 3RL1A 1MCWM 2BOBB 4NDMA 4RAVB 5D6CB 2WMPA 1OB1A 5FA4B 3TNNA 3KG5A 5I8KL 5IK3A 4JN2A 2J8OA 4KVCH 5T1MB 3O3BB 1DQQB 2NTFA 2E7HA 4B5EA 1NCDH 2DLIA 1CDGA 4GFTB 3EJYC 1B9ZA 2VE6A 4Q7DA 4WHCA 1KB5B 1HHKB 1OT2A 5JHLL 3BPCB 1AFVL 1R3HB 1TVDA 1W0WA 2LE9A 2R9HC 1BD2B 4RBPK 2P45B 4XTRC 3SCMD 1A22B 3LN4B 1ORQA 3HC3L 5FDYA 4FQJH 4LCIH 3GM8A 3IT8D 3WKNA 1INDL 3T2NL 4ZMAT 3U7YL 5D2LB 5DK3A 1KCUH 1KULA 5B3JE 2W07A 4N0FA 4NZTL 5JW5A 5FM8A 2ZJSL 2DTMH 4KKLC 3B2VL 1AFVH 3G5XA 1JHTA 5GRUL 1X4YA 1BJMA 1OLZA 3SDCB 5FO7A 4OGXH 1RZ7H 2APVA 3BKJL 3DHMA 3VFPB 3UEZA 3T2NH 3EO1B 3G6DL 4X6FB 3BGFC 1P2CB 3JWNC 3T2PA 1OARH 3FO1A 3VWJD 4RGNB 2BZDA 3X11A 3OPZL 1BPVA 1AC0A 5JNYA 3KPSD 1TQCB 5EZIL 1MY5A 3SJVA 3WNOA 3MXWH 2YSSA 2KPNA 3G08B 1A7BA 1BQLL 1CFSB 1EZVY 3ZMRA 4J4PD 1YEFL 2G75A 1UGNA 4J4PA 3WFEL 3VG9C 3MJ9L 3MROA 4HGWA 5CGTA 1QA9B 1NFKA 4OZHE 4PJ7A 3MREB 1TQBC 4W6XB 1SVCP 1FNGB 1CFQA 2VLJA 1VB9A 2OR9H 1PSKL 4P4RB 3L3IA 2WBJB 3RU8L 3RWHB 5HHME 2WP3T 3O4LA 5FDWB 4UAOB 3QSKB 1KFAH 5CZXC 1OGAB 2HFTA 3DUSB 2HJFA 3ZYZA 3VDAA 5MEND 1R3LB 1K5NA 4MD4A 2F53A 1J18A 2VDMH 3HN3A 3V4PL 5D2NC 1ZGLA 3QDJA 1U95A 1UJ3B 5D4QA 3HE7A 5ITFA 2IJ0C 1JPST 3UROR 4UB0L 3HE7D 4JRXA 3WMSA 4HWEH 5I1IH 5IFHH 3LKPA 4AQ1B 1FL5B 3MUHL 5EU6E 1YJDC 1O7VA 1I4FB 1U8IA 2OMNA 3VFNA 3NBNA 5F7FA 1VEMA 2AGJH 3F65A 1WICA 3MLRL 3S4SB 1FIGH 2OR7A 4IJ3C 4R0LC 4L9LA 1S7VA 3S36L 3S37L 4IOFD 3DYPA 4HWEL 1OP3H 3SGDH 5GRXG 5ECJE 5C0EA 4M1DH 1YEKH 1YC8A 4XNQA 5I1HH 4QXTA 3SDAB 1A1MA 5KJRL 4Y89A 3RKPA 4FQJL 3STLA 3BP5A 3TIEA 5CIPH 3HI6L 1HINL 4LGRB 3DV4B 4ZO9A 1TMCB 1UWEH 1N4XL 4NN7B 3RUGA 1OB1B 2HP4A 3PV6B 3VFSB 2YD5A 4APQC 3KPMB 3PL6A 1CICD 4M1CD 1OD9A 5C0JA 4Z0BL 1JWSB 5I1LB 3EKCA 3IFPB 1RK0B 3WHE1 2FD6H 1IQDA 4I2XB 4F7CB 1LEIB 4MYWB 5DZOA 1Q9KB 4WDIB 4M6NL 3T3PE 1D7FA 4L8BB 3RKDD 2DQFA 1KJ2L 4P23C 4MXQC 1BX2A 4YDLB 5EZLB 2FO4A 1EV2E 5DHXB 5FXCH 4EN3B 1L7TH 4S1RH 3T4YB 3RAJL 4L8SC 2EDQA 3CAFA 3HR5A 2R29H 1LE9B 2HFEB 1BZ9B 4MX7A 1JWUA 3PHOA 3MLVL 3RRQA 3Q5TA 1L0YA 1SHMA 1QSFA 4FQ2H 5I17B 3DURB 1NFDE 2VIRB 3P0YL 1MI5B 4E42B 1AHWB 1IC1A 2OZ4A 4YWGL 1S7SA 3EO1A 2K7QA 5IEKB 4POZC 1X44A 3I3BA 4ZXBA 2ENSA 1AD0A 1INDH 3IAPA 1XEDA 3MNWB 1R5VB 4UILH 4CDGC 5BCAA 3ARTA 2GSGA 3BT2H 1TDQA 2V17H 5DJ0A 1T83A 2NZIA 3TBWA 4PJDF 4FQIH 3O6MH 5FIEA 1VGEH 4LVEA 4GAFB 2W9EH 3KPTA 4Q9RH 2JE8A 2X4UB 4JM2D 1NAMB 3BIAX 5J1SC 3AMLA 4NFCA 3S98A 4LSTH 3QH3B 1I7TA 4LHQB 3GSNH 5FA3B 2HWZH 5BW7A 5I76B 2WBJA 3ECBA 2FEDD 4WIQA 4BZYA 4FQXD 4JREC 3VXSA 3BE1H 1EJ6A 2LAAA 1S7XB 4WNQB 2EYTA 2CDGA 1AO7D 3SGEI 1QSFD 1HEZA 1N6VA 1JGLH 2VLLB 5GGRA 3T3MF 3O11B 3QDJB 1X4XA 3W0WB 4CRPA 5A2LH 1VESA 1OQXA 2XQBL 4R6UA 2ADIB 5EIIB 4NO0A 5C71A 1FVDB 3BP6A 5E8PB 2V5TA 5ACZB 1HZHH 3BO8B 3PGCA 3V52H 4L29B 1D5ZA 3NCBB 3QJHA 4PJ8C 3LRGA 5GGVH 4KGLA 3QFJB 4R2GD 5TQ0L 1H3PL 3P77B 3ARBA 1YNKH 2XY1A 4PJ8D 1PY9A 2C1PB 5IB5B 3KPLB 1UM6H 3REVA 2DQJL 1GGYA 2B4CC 1INQA 1K3IA 5TJWK 5D1QA 5ID0B 1GGIL 3A0OA 3O8XA 1IGFH 2ORBL 1GIGH 4PJBF 1J1PH 1IQWH 1OAXH 2OYPA 5E2UH 3GEWB 3ARUA 5K9OB 3ARPA 4MJ5B 4U1JB 1RI8A 1KENH 4P2RB 1MCIA 1JNHA 3D25A 4I5BB 4PBWD 1ADQL 2JCCB 4KKNA 5AZEL 5ADPL 1NBYA 4CVZA 2C4FU 4GMSH 1GIGL 5CJXC 4J1UA 3O4LE 1DQQA 5DO2D 3S88H 4P2YA 5I1LA 3MZTA 4LSPH 3L1OL 1F8TL 1M7DA 2X40A 2EIEA 4PRBB 5C9KA 1VFAA 3ULUD 5DRWA 12E8L 2UZIH 2EIBA 3JTTA 3H9SB 1YNTA 1Y0LB 2VXQL 1X5YA 3DBXA 1IGJB 3BUYB 4OSUL 1HI6B 3QDMD 5IEHB 4LSQL 5SWQB 2VLJB 4Z7NF 4LLAA 5TDPA 2P5EE 3O6ML 1HHJA 3BP7A 4ONFH 3S97C 3O4LB 1BD2D 4MJIB 4F9LC 2NY1C 2DQUL 4ODSH 5IBLC 4FFYL 5DK0A 2R1XB 1BECA 5F1NA 3H3BC 4HQQL 2PO6A 3EYVB 3SDYH 5D72H 2BVQB 1KGCD 5F9WC 4NKIH 1A3QA 1LK2A 3NFPB 5GHWH 5FGCB 1TJGH 4ONHA 4NQVA 2ITDA 1KLUB 1P2CA 1E28A 3CSGA 2AJZB 3LIZH 2EH8L 1SJHA 2IGFH 2Z91B 1R5VA 4M7LH 3VW3L 3RPIB 5KVEH 1BBJA 3CLFL 1J8HB 3MV9A 3SE8L 5DD3H 2MJWA 4XNYH 5DUMH 1FCGA 3F58L 4KJYA 3P40A 1EH9A 5BRZD 1ZLVH 4OCNC 1T2QH 4GRWF 4WFEE 3CU7A 3HS0A 4PGDA 2ICES 4C58B 2W38A 3WNMA 4LEOB 2OI9B 2W65A 1MVUA 4LHUA 1K8IA 4X0KA 3WXVH 4I4WA 3SPVB 4GAJL 4NM8H 4PREB 3NZ8A 3QDJE 3H9SE 5IP4A 5DRXA 2XRAH 3HMWL 2CKBL 4QLRA 3ZDZF 2PYFB 1R0AH 3O2WH 3QUXB 1IKFH 1A7NH 3BOVA 3GBLA 3E2HB 2UUDH 4M1GH 5LQBL 4WUKL 4I2XE 1I9RL 4LBEB 2NY3D 2VZ1A 4G6JH 3RGVB 1MREL 3KS0J 5KW9L 3WIFA 5HYEA 4CL7A 1GAFH 4QRRE 3VXOB 1A8JH 4L4TB 4BJLA 4X7SL 4ZOBA 5EA0H 2K1MA 1MLBA 2GAZA 4QXGL 3DMMB 2IFGA 4ZSOE 4FXKB 3GO1H 4P2QA 4YBLB 2VR4A 1QLRB 3KAAA 1MNUL 2WBKA 2FRGP 3QFJA 1QZ1A 1A64A 2NY4B 1W0YT 1DJSA 3GMQB 1DQJA 1FZOB 3OAZH 4XVTH 5IB5A 4OLYH 2H41A 2R1YA 2KKQA 2C1OB 3FOLA 1BFOA 2A9NH 1CD0A 4PJIB 2AQ1A 2E7CA 3IDNA 4KMTL 2V5RA 1WZMA 5GRYA 4AEHH 2I24N 4QXTB 2R1WA 4KRPD 1OGTB 1F4AA 4AYFA 3C8KB 4QT5A 3P2TA 5SWSB 2PR4H 3WE6A 2W60B 3PABB 4P2RA 2N1KA 5D9SB 3TO2A 1E0OB 3QHFH 4HJGB 4KROB 3BMVA 2D03L 2YUWA 4KTEH 2BMKA 4O02L 5SX5H 1WK0A 2QR0A 4G43B 4EKXA 3ULUC 2B8OT 4HKZB 4ZXBB 5FEBA 4KVNH 5KVDH 1LO3H 1BBDL 3DGGA 5C08B 1OP5H 2DKSA 1K85A 3ARXA 1JZ6A 1M7DB 3QWOA 1N4XH 1RZ8A 4WI5A 1PZ5B 4GRMB 5EZLA 1JGVL 1XGQA 4G7YL 4N8CH 1XGUA 1CD8A 2J4WL 1BD2E 1QHPA 4XB7A 3GJEA 1S7QB 1TVBA 4JM4H 4QRUB 5FO7B 5FOBA 3TBVA 5MI0C 3EO9L 1G7QB 1HHGA 4NQEA 3MV8A 2PXYA 3DNKA 1N0XH 3V5DB 1YEHL 1UXSA 1IGYB 1IRAY 1NDGB 4MCYB 3L3GB 5DQJA 1QLFB 5I17A 1FAIH 1S7XA 3S96B 4PJAF 2VDLH 2PO6B 1YPZE 3ZE0E 4P59H 4GKOA 4N0UB 4JO4H 1HEZB 2EYSB 3RZWA 3TH2T 1C5BL 3B9EA 4NO3B 3G08A 3V52L 1S7SB 1T0MA 2EDXA 5JZ7D 3ORJA 1DL7L 1NANI 1KT2B 5EIVA 1MCRA 3RVXC 3B43A 3LHPL 3LZFL 1EJOL 5ENWB 4MCZB 1P6AB 2GCYB 4NKDB 3DJ9A 3SDDC 3IETA 4GW4B 1XF5A 3UP1A 1VPOH 1Q0XL 2VDLL 3B9KC 4TUOB 2Y23A 4S1QL 4GLRH 4KDTA 3RY6A 4P57A 4PRHB 2X2YA 3BZ4A 3F7YA 5CIPA 1GAFL 4NHUB 1CK0L 2DLHA 2OBGA 4UTBH 4NHCH 3GGWB 3VWKD 4NYLA 4MB3A 3VD4A 2V17L 1HK6A 3OL2A 5F9DC 1KB5L 5EZJA 5C0IB 4K3EL 3VW3H 4JHAL 4MHHI 2NQCA 1NUNB 4NM4H 2X4TB 2Y25A 4JFFD 2NY6B 2XXMB 3C60C 3LH2H 4KZEH 1CXEA 1BQUA 1ZHNA 5IG7B 5CGMA 2CD0A 4X83A 3ARBD 2X70B 3BE1L 4HCRL 2Y07H 4C56B 3CU1A 3RVUD 3W81A 5FHAH 3B4NA 1I8IA 3PWJB 3R4DA 1WAAF 2E6QA 1CCZA 2R2EA 4OUUB 5KSVB 1FNFA 4NRXB 1D5ZB 2B0SH 2H26A 2D7MA 4C54A 5KVFH 1NAMH 2AK4D 3QPXH 2NNAA 2WQRA 5DURB 5DGRA 4GRLA 2VISB 3EJJX 4K3DH 3GMQA 5E94A 4EEEA 5GSRB 3GMNA 4QOKD 2IALB 3BZFA 5IWLC 2OZ4H 2J8HA 4LCYB 2WWMC 1J88A 3PJSB 2LTQC 2XZZA 4IRSD 3VRJB 3MCG1 1ZSDA 2YA2A 2Q76B 3PV6A 1C1EL 3MV8D 2IF7A 5B3NA 2HVKB 1WJ3A 2AI0H 1FNSL 4O9HH 1G6RL 2AJ3A 2VMFA 5F3HB 1AXTH 5GS2H 3T0DA 3EDDA 1MNUH 3QNYA 2H8PA 4ODVH 5CMAB 4IHOB 1H8NA 1G9MC 3QIWC 2BK8A 1X5IA 3WNPA 4OCYH 2RCSH 5I8EB 4EZMA 1KENL 1CG9B 1FLRL 1G7HB 3QCUL 4C83B 3MRGA 4NNXB 3L3KA 3RFZC 4P5TC 1EEYB 2DLTA 3DWTA 3T0EE 4A6YA 1QHOA 3HR5B 1M05A 4K3JL 5GGUB 1YMHA 3RWJB 3FRPA 1HHHA 4M7ZB 1NGPH 5IVNA 1HXYB 4NNYA 3K8LA 3QXUA 3ULUF 3DHJA 1KBGH 3V4PH 4YXHL 1IAII 2FJGA 2R0ZL 1FZJB 4U6HA 2MMXA 4S1QH 1T5WA 3HE6C 3U7WH 1HZHL 1AJ7H 3DVFA 1UXSB 1BMGA 5I1IL 5D7IE 3WFDL 1NMBH 1WZ1L 4ZD3L 3EOTH 1A7QH 1FO0A 4Y7MA 4Z7NE 4JO1H 4FN0A 3OGCA 4ODXB 2WWMD 3BRGC 3HZYB 4KDVA 3ESUF 5I18L 4G8IB 3QUYC 1KBGL 1RJZB 3M1BA 2JCCF 1DQLL 1PD6A 4D0CB 1A3LL 3AS1A 1KTLA 2R2CA 3IXTB 4TTDD 3NN8B 4P2OB 1FFPB 2DQCH 1HHIB 1R24B 4LPXA 3IRZA 5D72L 5EZIH 1F90L 1JN6A 2X9WA 3WIHA 3U48A 3QEHA 2C9AA 1JFQL 2Z9TA 2ESVE 3LKSA 4JDVA 2YD4A 5M95B 1UACL 2Q87A 4N1EA 2P5WE 1NGYB 4YDVB 3KYOA 4OZFB 3OB0K 2R15A 4JPIA 5JW3L 8FABB 4CJ1A 4JRYA 5FF6B 2VLLA 3RU8H 5EBLB 1TCRB 4AM0B 3O11A 4TRPH 2C7UA 2YPLD 4JJ5A 5DJCB 3VXTA 1C12B 4O5LH 4Y1AD 1IAIL 2AJYH 2CIKA 4XCNA 1UADC 2EZ0D 1VFMA 2XWJB 1K9TA 4J12A 3HNVH 4IBLT 1CICC 2Y5TA 1E4WH 4Y2DC 4WEBL 5IG7A 1C5DA 2X4SB 3BQUA 1IM3B 5E5RB 5GIRB 2M2DA 1MCCA 1XGPB 5KVDL 3IFNH 2ZCLH 2FD6L 4MNGA 4OKVB 2J6EA 4XPBH 5CD3A 3WS6C 2E9JA 1MWAH 2EKSB 2K7PA 4LCWB 4YFEA 5HHNB 4PG9A 4XC1H 2AEQL 3D2UD 1HILA 5DI8A 4GRWH 2AP2A 1YJDH 4Z7VA 4YDJB 3SGJC 3FOLB 1JGUL 2IALA 3TBVB 4X80L 3KJ4B 1F02I 2LFGA 5HVHC 1NEUA 1EZVX 4LMQE 1NUDA 1ZSDB 4UV7H 4QY8B 4X98A 3VRJA 3ULVF 4XHQA 4QTIH 4ODUA 4G6ML 4H0HB 1XF3B 4Y19B 3G04B 3T0XA 3HMXH 1QFWM 1C7TA 2N7AA 5GZOC 2DQGH 1L9NA 2DLFL 1VFAB 43C9A 1X5KA 1UWEL 5DT1L 2D31B 4X6BB 1N6QL 1MIMH 2BVUA 2NX5E 4WV1C 2FL5B 3G6JB 4JM2F 4U33A 3VFGH 5ENWA 1EEZB 4KVNL 5D7JB 1AGEA 3MRGB 3V7AE 3EYFA 4N90E 4R9HA 5SX4H 3VU2A 4H0GA 2FWOB 1CL7I 3D9AH 5CZXD 5DA0B 1J9CT 1ZKAA 4XVJH 1DVFB 5HI5D 4NN5C 5EO9B 4JQIL 3H3PL 4PJHE 4E5XA 2YC1B 4G80B 4S1SL 1SYSA 4XI5C 1CK0H 4QGYA 5KZCD 1S7QA 4TNWF 3LKQA 3BUTA 1DN2A 4HUKB 1F90H 4NYLB 4OGYH 2F54B 1IJ9A 3R0MA 5FGCE 1GL4B 1KLFA 2J1KA 4LRIC 1QRKA 3M8OH 5JA8B 1FAIL 4MWFB 1KIUA 5MEQB 1YUHB 1JGLL 1R3LA 4Y8DC 5AYUH 1BIHA 1OQOA 4N1HB 3D1MC 3C5JB 2Z93A 1WIPA 1ZHNB 5KAQG 4OM1L 3D6GA 2AV1A 3ZE2F 4NCDA 2GSIA 2EECA 4CN6A 1J7VR 3KHOA 3CK0H 3I3DA 2ZZUT 1MHEB 4XT1C 5BV7L 4D0DA 3HNTH 2OJEB 3IDIB 4PTUB 3FRUB 4O58L 3OTTA 4TUJA 2CO7B 2MNUA 1A3RH 1NFIA 1YDPB 5JXEA 1NDMB 4JLRA 4HXBL 2X5PA 3ZDYE 8FABA 1A6WH 5CSZA 3RA7H 5FF6A 4MS8C 3CFIC 1T0NB 4YHIB 3QUZC 2VXTL 5ID1A 3S88L 5DC4B 5J9PA 5DEFB 3T0VA 3RY5A 2W0KA 4MA3A 5CP7B 1UB5B 1QSFE 3GMMB 3OMZA 5E8EB 3UTTA 2CUHA 1JGUH 2VN7A 5J11C 3DV4A 1TZHA 5DD1L 5TPWL 5EDXA 3RA7L 2WIIA 3VI3F 3QHZH 4F9LA 5FUCC 1PJ9A 5ERWB 2HT2C 4KI1A 1CIDA 4GW5A 5DUBA 3ZTNL 1KOAA 1N3NA 3RNKA 4Z7VF 5FB8A 4GBXB 4I3GA 1M05B 4Z77B 4J6RH 3JTSB 4M4RA 4Z6AT 4GG6F 3P4LA 1J1OH 3L5WA 3SKNA 4GRLB 4QT5B 3QUXD 4K7PX 5SWSA 1MOEA 4LIQH 4YAQA 2CDEA 3REWA 2MSPA 2Q7YA 3MUY1 5ILTH 3MRBA 4AEFA 5FA4A 2LAGB 4PJ7E 4JN2B 4PJXF 4K7FB 3MUGB 5E2UL 5FYLE 2X42A 5BZDB 5DR5H 4LCWE 3MV01 3ARGA 5GZND 4Y19A 2EE2A 1PGRB 5F3HA 1ACZA 3SO5A 4JM2A 3DGGB 4TULL 1A5FL 4HV8A 4N0YH 1LGVA 4ZTOH 4D2NA 5HHOE 3KLHD 1QO3B 2OSLB 4P2CG 3MGTB 1HXMB 4PJGF 1N59A 1HWHB 2PTTA 4WI6A 2VRAA 3BXNA 5EUOE 4NQDD 4MMXC 4Z7WB 3MNWA 4L3EA 4PJFE 3RIFF 1OSZB 3QIWB 4L9DA 3TYFA 1MCWW 4NPYA 4YXKH 4GMTL 4AEEA 5CJXA 4MJ6A 4Z5RA 3ZE2E 4KZEL 5D70H 1FIGL 3NPSB 3QJFA 5DQJB 3LQZB 1IAIH 3CDGA 1BVZA 2NY2C 4BA8A 1I7TB 3A6CL 1RVFH 5E08L 5J1AA 1JGDB 2X10A 5F6IC 1N7MH 1DBAL 1WIOA 4GKNB 4JFZH 2VDPH 1KF9B 1KUMA 4OD2B 1BJ8A 3VA2C 1MCLA 3FO1B 4XVUD 3S35X 1F4XL 4GW4A 3IETB 1WZLA 1TJHL 4LSRL 2DWDB 5DC9B 2Q8BL 4XNMA 1V3JA 4FABL 4FP8H 4N0UE 5LVEA 5E08H 1K2DB 1XGTA 5K9JL 1OW0C 2CGRL 4LLUB 1XH3A 4PRPB 3ZYIA 3IDYC 1QA9A 4FZEL 4HMEA 4Z7WE 3FO2A 3PWPE 2DTML 2WBJD 1RD6A 5CP3H 4I1NB 3CZFA 4WUUE 4PJXB 3H7BB 3RWCB 3H6JA 4NBXB 5MENE 1F2QA 5TQ2L 1WTLA 4ONGH 3HI1B 4KHTH 5KSBA 4P2QE 5DC0A 4XRCB 2CJUH 1TJIL 3OHXA 1J10A 3B3IB 2ATPB 3RWGA 5D1QB 4MJID 1JYXA 1FG2A 1EGJA 12E8H 1QPXA 2FX8H 2R23B 5IUSA 3N1FC 3TNNB 4AQOA 2Y5EA 4YHYB 1AE6H 1CFTB 5JOFB 2VLJD 4OZHB 4XXCC 1X5XA 4UBDC 1DUZB 5L2JA 3GHEL 2JJVA 3L7FA 5ALBL 4FQIL 4WUUB 1T20A 2I9TA 2YPLB 4P46C 5TQ0H 1RU9L 1IEHA 4G6JL 1QSEA 2H9GA 4EUPA 1UM6L 4P46D 4UOW0 1QR4A 2O5XL 1ZVYA 2YD2A 1N8ZA 1TIUA 2OQJA 4UQ3B 4GW5B 5DUBB 4UDUB 1IQWL 1OAXL 2BSSA 1GHFH 2J5LB 3Q5OA 5C0CE 1GVIA 1OTTC 3SDAA 1ZANH 4XP1L 5SX5K 3QIBB 1I8MB 3GBMH 1B0WA 1OAKL 4NQSB 1A3LH 5L8KB 2EE9A 2FBOJ 5TPWH 4TSAL 1SJXA 1N0XL 1YECL 2IBBA 5EPMB 3U82B 1VADB 3TC9A 2CLZA 1S9WB 1CXFA 4H26B 2V9QA 1KPVA 4OCSL 2RGSA 3G04A 3AU1B 3FZUC 3CFCL 1YUHA 1W72H 4JM2B 5F21B 1LD9A 4W81A 3V0VA 4ZUWA 2YS4A 4BFBD 5HVGB 4J3WA 5C6PB 1QFWH 5HHPA 2DQFB 2Z93B 5J4MA 1SYVA 1E28B 3K80A 1LO4L 3KYMA 4GS7B 4Y2DA 2APBA 1JPTL 4PJHA 5E99L 2IAND 4ZFZA 1JF6A 2EKJA 4RFOH 1Y18A 4WU5A 1DVFA 2ZUUA 4MAYC 4L9LC 3WUWB 1OGAA 3DUSA 1NFIB 4MZ3A 4XB8A 4YK4C 3ETBF 3BX7C 3LD8B 5I8OL 1AIFA 5C6TH 3QZWG 1BGXH 5C08E 1JGDA 1RJZA 4GXVL 2W0FA 5GGTL 3QDGD 3OKLA 2ATKA 4XMLH 5JPNB 1P4BH 1C08B 2GJJA 2Y7QB 4QYOB 3CLFH 4ZSOA 1E27A 4EN3D 4G6FB 2GSGB 4YH6A 4YPJA 3VXMB 4HBCH 3TN0C 3ZO0A 3G5ZA 3HTLX 4MVBC 3MXVL 3VFNB 4KHXH 2C3GA 3ULVD 5JXED 1G7IA 1IFHL 1ETZB 3SJVE 5C9JB 3JV0A 3QDMA 3J7HA 2HFFA 43CAB 4Y2DD 2Z8WC 3U30C 4CMMB 2CDFB 2VXVH 1SY6L 3NIDF 3SCMC 3VE0B 5ANME 5EBLA 2AK4B 3IGAA 1QLRA 3V8CA 3O45B 5IROA 4NSKA 4ONOA 1FN4A 5F1IA 3RVTD 3SDXA 4K9EL 2V5YA 1NUFA 4JZNB 1UC6A 5EUOB 2FZ3A 1P84K 5B22A 1B4JH 3ZL4L 5IOPA 2Q7YB 1TPXC 3G6AB 4IMKC 1BQHG 5C1MB 2QADC 1AR1D 2E9WA 3VXSD 3C2SA 1CGVA 1OWWA 2GT9A 4UU9B 5CBEA 4LSSL 2PKDA 3FFCA 3TO2B 4BSJA 4MLSA 2GUOB 4U0RC 3SKOB 1A6VH 1I7ZB 3ZL4H 4PJDB 2DBLH 1YEJH 3B8SA 3OPZH 4P3DA 1OM3L 3E6FA 5HHVH 5GRJH 3N0PB 5F7UA 5BRZA 2I27N 2PYEE 5FB8B 2W92A 1OTUD 4MJ6B 1YEDA 4TVPH 1AE6L 1FVEB 4PJCB 3EDFA 4MX7B 1DDHB 1IARB 5DUPH 4HUNB 2UWEF 3Q6GL 3TH4T 3ET9F 4JFXB 3DURA 4R2GC 1RFDH 4WY7L 3M45A 3V9FA 5JLZA 1QD0A 5HDQL 3MRBB 3VGBA 3H0TB 5KBNC 2B5IC 5HYFA 3FB8A 5A3ID 3ARYA 4NM8L 1NDGA 4MCYA 4U7MA 3H8NA 1GGTA 3CPLA 2V6HA 5DMKB 1ODAA 3GZKA 2EXYD 4NJ9H 5F9JB 1XF2A 4JVUA 2OL3L 2WINB 4X8JB 1T6VN 4XMPL 3LEXB 4KV5E 2MOVA 2V9RA 1KJMB 4PJ5E 4QOKE 2FB4H 5K9JH 5TQ2H 2FHCA 3D39B 2VLKA 3V7AG 4RGOL 4R4FH 1KXTB 1QVOB 3O2DL 3PHQB 4L3EB 2HRLA 3IDXL 4H1LB 5HGDB 3RDTC 3X14B 3QIWA 5IEHA 2VLJE 5FYKU 4HDIB 5LGKA 2V2TA 4LSUL 4F80A 3F7VA 5M7QA 2FX8L 4RMUA 3KPRE 4JFOB 4QO1A 5E4EC 4IOIA 3MRNA 4A2MA 5F70A 3HB3C 4HIEB 3W9EB 3UYPA 2CJUL 5LGHH 1I1RA 4LGPB 3I50H 1X5GA 1MVFA 2J6EH 3TWCH 5FYKE 5HYJB 2VH5H 2ZCKL 2Y6SC 4O5LL 3WO3B 3ZKND 1CF8L 1NC4D 6FABL 5CS7A 3F12A 1YN6B 3PWVB 4LLYB 3TV3L 3DX6A 4G8GA 4W4OC 3RPIA 4IMLB 5IBLD 4JRYD 4PJ9A 4LSQH 3S9DB 2OJEA 3IDIA 1T7YA 5J6GA 1MCQA 1BWMA 1V5JA 2J4WH 35C8L 5GRUH 4ODSL 2XFXA 5DLMH 3REVB 2Y9RT 3KDMA 4U0RB 4XWGH 4FP8L 2R2EB 1N5AA 4LQFH 2XOTA 1BOGB 4NKIL 5DHYB 1OY3B 5KS9F 1P53A 2C3VA 2AEWA 3WDHA 4JY4B 5DQ9B 4YE4L 5GRJL 3VFWA 3VI4E 2CIIB 5E70A 1S9XB 5IF0A 2PYFA 1NQBA 1CICA 3RVTC 4J2XA 3D25B 4BSVA 3G6AA 3NCJH 1EA9C 3UXFA 3FOMA 2XZQL 4MQXD 2CLZB 4WCYL 3LHPH 3LZFH 4WJ5A 4XAKE 1CFTA 3WIIH 1S7WA 2DQGL 3U4BH 1RUPH 1UENA 3HFMH 5IMKA 2P5WB 4WU7B 4LPYA 1WAAA 4HZAA 3NFSL 2L4OA 1VGEL 3ZYOA 1AGDB 4JFEB 4NKQB 3KPSE 1CQYA 2ZKHH 2V2XA 5C07B 3ZE1F 5I15L 1S5IL 4KRPB 2VDPL 4WCYH 1F6LL 4X6CF 3QZWB 1CDHA 1IGJA 3HZVA 4BK4A 3FQTA 1RHFA 3UTSA 5I8OH 4WI9A 2VSDA 1RUQH 1M6OB 2OXGA 2C1OA 4M7ZC 4LAQH 3OR7A 2WSKA 5I30L 3D0VB 1DDHA 3GRWA 4EDXB 4WUKH 3V0WH 2W0PA 1LNUA 2V5MA 3BHBB 1FE8L 1U93A 3BWUC 4JFQB 2BVQA 4ZFGL 1EIBA 1RZIB 2R29L 1SY6A 4KI5E 1A9BA 5H35A 1H3WM 4H25A 1CBVL 1YYLH 5J8OA 1GGBH 1V7ML 4FFWD 4G9FB 4OV5A 1BLNA 3NFNB 1EFXB 2JLLA 4KH2A 4OIAA 3U9PL 3EBAA 3TA3D 5I75C 5J6HB 1MFBH 4X8JA 3T3PF 3BPLC 1RJYB 32C2A 4FQPA 4LP5A 1QP1A 4GXUN 3KYMB 5F7NC 1UXWA 4FA8A 1CGTA 3LQZA 5FHBL 3CVIL 2HH0L 5BV7H 4QRQA 2HKFL 3BT2L 2LU4A 2M26A 1EGJH 4OFKA 1QFWL 1ZE3C 5C0AA 5EFIB 3LPFA 5CCKH 3O3UN 3IXAB 4QRRD 1GPOL 5CEZE 5CEZL 3KYAA 4LSTL 2R2HB 1FNSH 4JCLA 4O9HL 4X99A 5CEYB 1JPTH 3MLPA 2OS7A 4JPIB 3T77A 2F74B 3ZSSA 5ADPH 5CZKA 3MYJB 5BJTB 3B2UD 4M93C 4IDJH 2AJUH 4IRZH 1T22A 2JB6A 5D1ZC 4PGEB 2HVJA 4X8XA 4G6AD 3GB7A 2ADFL 5JPNA 3B2VH 4HS6A 5CKGA 5T5FL 1E27B 4KAQH 2D2OA 1SMOA 4JKWA 4Z7OE 1J0YA 3RAJH 3CZFB 1JYVA 4JKMA 2GUOA 1OD7A 4PR5B 4NZRH 3BD4A 5EC2A 1HNFA 4OSUH 5DFWH 2A74A 3QEUB 1RUPL 4XH2A 2G2RA 1MI5E 4F7EB 4KJWC 3FHQA 5D93C 5FYJE 3TVMD 3VA6A 3LCYA 4XCYA 3SGEH 1NJ9B 5HTSA 1MLCB 1I1YB 4GRWE 1E4XI 1A3RL 5K33A 1JZ5A 4R90H 4NSKB 3OKYA 3W39A 4NZUL 3MUJA 2P1YA 1J05A 4MXQD 3O2DA 2EXWC 2J12