4I2XB

Crystal structure of signal regulatory protein gamma (sirp-gamma) in complex with fabox117
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
229
structure length
229
Chain Sequence
EVKLQQSGPELVKPGASVKISCKASGYSFTSYYIHWVKQRPGQGLEWIGWVFPGSGNTKYNEKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYFCARGNYDRAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGKHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FabOX117 light chain
publication title Crystal structure of signal regulatory protein gamma (SIRP gamma) in complex with an antibody Fab fragment.
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i2xB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i2xB02
1J8HE 5IQ9A 2BSSA 3EOAA 4QXUH 4KRPD 4WI9A 4GKNA 4M1DH 4PJ9D 3MV9A 3I6KB 3LKRB 4F7TB 3PWJA 1Q72H 4P46B 3DYOA 5LCVL 4NHCH 4WJ5B 2G5BB 2AVGA 2B5IC 3ARSA 1FL6B 4X98B 5D1ZC 2OR7A 2IADA 5D7JC 1J0KA 3LN9A 3O6MH 1EMTL 4FFZL 2X4UB 5AUMA 2ZSWA 5I74C 3ELAT 5HHOD 1D9KB 3P2TA 5C0FA 1EEYA 2BNQB 3WNMA 5FA3B 5T3ZL 3MRBA 4CW1B 4NZJA 2YD5A 4NZTL 2WP3T 3C6LC 2J1KA 2JTDA 3CD4A 1SVCP 4BZ1H 2BZDA 1NPUA 3QUZD 4OUOA 2O61B 4HV8B 4K94L 3HR6A 5I73C 2C1OB 5C0ND 1INEL 5FV2A 1P4LA 3UTQA 1BP3B 1KYOK 1MRFH 2MOVA 4UAOB 2X42A 4WI7A 5B8CC 2R2BB 1L7IL 4M7KL 4HMDA 1GC1H 4FP8H 3OWEA 4QHUB 4JO4H 4YHYB 4PJFE 4JFEA 4PTTA 3KYKL 4U6XB 1MIEL 1ITBB 2F5BL 2HTKC 5CEZH 4C58B 4I0KA 4WDIA 3O2DH 5E8NB 2D0GA 3GDBA 4ESKA 4Z6AT 1KNOA 1MWAL 3DWTA 5F7EH 1I1AC 3W39A 3HNTL 2IBBA 5IV2A 3MLRL 5ECJE 3UJJL 3LV3B 4OFYA 5D1QB 5IVXE 4JFQB 1MI5A 2VDQH 4Z5RA 1WICA 4Y19B 5IIEB 1CXHA 1EO7A 1IGCH 4J4PD 5EO0B 3WFHB 3B5GA 4JGJA 3DVFA 2VDRL 1S7SA 5T1LA 4F7PB 4M1CC 5T3XE 3ARWA 2GK0A 1S7UA 1A21A 1GL4B 2DMKA 1EZVX 5MP6H 1KENH 2Q8AH 3F58H 3NPSB 3C6SB 4ZAKC 3FRPA 5FYKD 1B0GB 4YUEH 4ZNEE 4D0BB 2FNBA 4EQ2A 1LE9B 2H26A 4OZ4A 3M1BA 3CLEL 4HLZG 2AP2A 1EBPA 2BVEA 3GMMB 3KYNA 1WAAF 3GNMH 1F3RB 3VFNB 1AP2A 3WO4C 43CAB 1K4CA 4M03A 1MEXL 3BH9A 3IXAB 4CN6A 4HIIB 1JK8A 4PD4K 2R0ZL 3VFGH 1XFPA 4OGXL 1J18A 4PJDF 5LXGL 2LV4A 5DJYB 2FJFB 1YNTB 1X5HA 4I0PA 4KRPC 1VEMA 2K7QA 4NQCE 3K0WA 4K8RL 4WHYG 2C3VA 2D0HA 4V1DE 4E41A 4DGIH 3IGAA 2H3NA 1X5IA 3T4AB 5K59F 2P8PB 4UQ3A 4DEPC 5BRZD 3MRFB 1V7NL 4HK0A 5SWSB 2XG4A 3GSVB 5TPWL 4BSWB 1SJEA 2VXSH 1LEKB 2OCFD 1E4XH 2GJ6B 4XP4L 5IHZB 1P7KB 4IS6B 1FNHA 2AJZA 3LEVH 1SJHA 4U1HB 3L3HA 3NBNA 1P4IH 4WFHE 1ZHKB 3EYQD 3OAUH 4Q9CA 1ONQA 3BGFB 1G0XA 5F9OH 3GK8H 1U3HD 4GRMB 1HH9B 5BVJA 3RU8H 3WS6A 4OBSA 5GRZA 3QUZC 2IF7A 5HHQA 3ZE0F 2OJEB 5ISZB 3ULUD 1GYAA 3K2MC 1WT5A 5DJDB 1JYXA 4M7LH 1EUTA 4P3CH 1DBAH 1TJIL 3SQOH 1LEGA 1I3GH 4HKJA 3TVMB 2ZSVA 3D69A 2JB5L 5IMKA 2OTPA 3CX5K 1EXUA 3ZO0A 1JRHI 3GSRA 3DTXA 4ZFOA 3ARGA 4GAGL 3T8XA 1D5BB 4O00A 2HP4A 4LCYA 4E5XA 4XPGH 1ES0A 4FQJL 4X7FC 3C5SB 4FXGA 3RNKB 3KPRD 4B5EA 2YK1H 4O2FA 2PETA 5EPMA 5F96H 5F7DA 5D8JL 2HG5A 5JQ6L 4DKFL 1N5YL 3WN5B 2CLVA 1TTGA 4MA7L 3MOBH 3N1MC 3KLAA 2HLAA 1CK0H 4HWBH 2FJHA 2DDQL 1LEIB 3H9SE 1RMFL 2LE9A 4QGTA 2HWZH 1ZTXL 4ODXA 3O9WD 4A6YB 5JHLL 1ZLSL 1IM9B 4MMZC 1KGCD 2CIIB 2YN5A 4N0UA 3RWGB 4ZUVA 2YPLA 3BISA 4WU5B 4EBQL 5CZVH 4WENB 1FNAA 1X6LA 3FFCD 1PYWB 3AM8C 2PYEB 3MCLL 5DRXB 2WBJA 3G9AB 5EU6A 4NO0A 2R0KL 1CGUA 3LDBB 4ODUA 4M8VA 3V0VB 3Q5YA 4IRSD 4L3EB 5ID0A 4ONFH 4RCAA 4FABL 3DOSA 1UEYA 2NTSP 4X5WB 4NRXA 4H8WC 3CXDL 3NOIA 2DWDA 4KJPD 3LKPB 2OMNA 5HDBE 2PW1B 3HR5B 3QYCA 5F1OB 4PRPA 3HZKA 4G9FA 5GRJL 2C3GA 5I30H 1FRGH 3BP5B 1KF9B 3CFBA 1BFTA 3TNNB 3U4BL 5C0AD 3HTLX 1MSPA 1V3KA 1TZHA 4JY4B 4WIQA 5DWUH 1X5GA 4DFIA 2EDJA 2ARJB 1QD0A 4LPUA 5F89B 2DWEB 3T04D 4XGZA 5TQ2H 3SQBA 3FTGA 1DUYA 1B9ZA 5E99H 3O4LD 2OR9L 5DQDH 4FQIL 1KT2B 3TN0A 4K7PH 3AU1B 5I8EB 1JGUL 1BBDL 2AK4E 3EYQC 4X6CF 4G43A 1CTOA 4M1GL 3SDDD 1T22B 4RGOL 4TSBL 4HC1A 2BK8A 4HQQL 3P9LA 4KVNL 5FUCC 4XPBH 5GHWH 3ULVL 4P23D 5MHSD 4PJ7E 1T0MA 3ZKNC 1WC7A 1XIWB 3TBSB 4OCWL 4BH7A 4J3SA 5TF1L 1AD0A 3QWOA 5C8JB 5F1NB 1UZ6E 4C4KT 2YRPA 2CKNA 3HC0A 1D3CA 1N2RB 3RZCB 1YN7A 3O6KL 2JCCF 4X8JB 4JM2A 3BZFB 3WXWL 5I2IA 3CSPA 5IGXL 3N1PC 2DMCA 4GW4B 2FIKA 3HA0A 3I3EA 3E6HB 4P59L 3OKEA 1DSFH 4U1SA 4PRIE 1SJVA 1UGNA 5KJRH 5SX4H 1HHIA 4XRCA 4B0MM 3W9EA 3NFSL 1VGKB 1IMHC 5MEQA 1VPOL 3EOTL 3ROLA 3TJHD 1WWCA 3CFKB 2P5EE 4RMQA 4Y4KD 3L5IA 1S7QA 3SKJL 1FQ9C 3O9WC 3FQRB 1V7ML 1FFOB 4PJDB 4X7DC 2QADD 4L4VA 1CGSL 4Z7WE 2GFBB 3GJFH 3SCMD 3ZKMD 1RIVL 1IM3A 3RNQA 4QEGA 5F6HI 5KSUB 5F1IA 2HVKA 5LCVH 5L7XL 4LCUA 4PGZA 1BD2B 5HHMD 2UYLA 3MZTA 5CEZD 4OZHB 4IRSC 4L3CB 3CCHB 1EMTH 3PQYD 3PWVA 4FFZH 2R1WA 4HEPG 4LVOB 3IDNB 2DLIA 1UA6L 5FGCE 1FORL 3D0VA 3QISA 2X1PA 5D7LB 2C7UA 3MUGA 3VFOA 5T3ZH 3MRNA 4NZTH 1GRWA 4S11A 2MWCA 4KJPC 3S35L 3L3OA 5CJQL 1XGUA 3OKOA 4HW6A 4QRPE 1FLTX 1OAZL 2EH8L 3KPQA 2VZOA 2BSRB 5AZEL 3ET9F 4K94H 1IL1A 2D03L 4OKVB 4LHUD 4POZD 5F7WC 3TZVB 2GIYA 3Q3GB 3FHQA 1L7IH 4M7KH 4YHNB 3HFML 5BZDA 1U91B 2CRYA 4EVNB 3KYKH 1MIEH 2F5BH 4C83B 1IAOA 4NQEE 1RZKC 1WIUA 4AQOA 3O6FB 5FM8A 1DE4A 3S4SG 3ARBA 3SDDC 4BK4A 1CL7H 5FDWA 1MWAH 2BHZA 4K7PX 3HNTH 2FWOB 4P23C 3MLRH 3HI6L 2AJVL 1F00I 3UJJH 3B9KB 4DUXA 3AREA 4MWFB 3V5HB 5MEND 4M93B 5F6HJ 1ND0A 4LPYA 2VDRH 1FFNA 5D5MA 5EZLA 4X4ZA 4S10A 5DS8A 3GMQB 3GSNA 3OTTA 4NN5B 5AZ2L 1JPST 2H2PC 4MA1C 4N5EC 4KXZH 4NUJA 2M2DA 2AJSL 1BIIA 5TDNA 4G6FD 1PD6A 4J6RL 5EA0L 3CLEH 3TFKD 2GQHA 4JY5L 4BFIB 1A6TA 4JQXA 3SGDH 2GSIA 4HKXB 3TJHC 3KPNA 3GJFB 1MEXH 2DQUL 5HYSB 1EVUA 1XGTA 4KRLB 4Y4KC 4EEEA 3P4OA 3RWEA 2IBGA 2R0ZH 3RIAF 4OGXH 5DQ9A 1UC6A 3DXAD 5IFAL 2A6IA 4K8RH 1YQ2A 3SE8L 1QSZA 3DUSA 4U6HB 3IXTA 5IEKB 2QADC 1UXSA 3SCMC 3QQ9D 1R24B 3ZKMC 1TZIB 2GY7B 1CDHA 4LVEA 1RU9L 4PYHA 3BN9D 1GC1C 2YXMA 3TLRA 3MJ6A 5H2BB 5DR5L 1M7DB 2W60B 1V7NH 2RJMA 1R5WB 4LSQL 1CWVA 3RY6C 2C5DC 2XWTA 5B38B 3AAZA 3EYVA 1IC4L 4P2OC 4OIBA 4PRAB 3QUMA 5I1CL 3RL1A 1AQDA 1UVQA 1A2YB 4KUZL 3R4DA 4FHBD 3G6DL 2RR3A 3NGBB 2UZYB 4LPCA 3VI4F 1BECA 1X3DA 3FQXB 3F7QA 5J6HA 1DDHA 4P4RB 3VXTB 1K4DB 4NJAL 3WXVH 3MNWB 5EU7C 1AFVL 1JNNL 4POZC 3KXFD 4TQEL 1TJIH 3T0VA 2PYFB 4RX4A 3BRDA 1OQOA 5E9DE 2JB5H 3VFMA 3ULVF 2NLJB 2JCCB 5I76B 4GAGH 3GSWB 4OV5A 4OT1L 5ESQB 2FLRT 3VXSA 5SWZD 4FQJH 1IVLA 4J12A 1LVEA 4PJGB 5FEBA 4PJBA 4NKOA 1ORQB 5GZND 2WINB 5JQ6H 5D8JH 4R7NB 4TTGA 3D39A 2AK1L 5CSZA 4DKFH 2HLFC 3MSPA 2ZPKL 1N5YH 4NSKB 1FNLA 4MA7H 5FB8B 3G5XA 2DDQH 4MJIA 1RMFH 3PWPB 3EYOB 1ZTXH 5JIPA 4PJ5E 4F33B 3LPWA 1ZLSH 3SJVD 5JHLH 2Z0BA 1QSFD 4FQCL 2X1WL 1Q0XL 3WDJA 1I7RB 4P2CG 4MA3A 4EBQH 4O2CB 2G9HA 3SDAD 3DV6B 4NFBA 5F9WB 2NR6D 4XMKL 5IBTL 5SWQA 1HCVA 1DQTA 3T1FB 4IHOB 4X6EA 2NX5A 3MCLH 1EDQA 1QVOB 5F1KC 2E7CA 4Y1AE 2I60L 3RWCB 3RWFB 3V5KA 3VWKA 2R0KH 4WV1B 3P0VL 5TH2A 5KSBB 2EYSB 4LSUL 2Y7QB 3DHMA 1KG0B 1P53A 3TFKC 3MLVL 2BX5A 3FONA 2AQ3A 3LQZB 3D85B 5ACLA 4P2QA 4NYLA 5DI8A 5IW1B 4JFDB 4HD9A 2FIRT 3RA7L 3IFOA 4FZ8L 3QEUA 2E7LA 4HC1L 2NQCA 3CXDH 2W1NA 3EGSA 2YD7A 1XH3B 2XT1B 5IB4B 4ZXBA 3KS0J 1NDGB 3MO1B 3MRQA 1QZ1A 3MRPB 3QQ9C 4FXKA 2EE6A 3QDGB 5GRJH 2BVTA 1CG9B 1X7QB 3VWJD 4MVBD 1OW0A 4XBPA 3U4BH 5D93B 5E08L 3WUZA 4XNXL 1IZKA 1U8IB 4IRJB 4U33A 5DEGA 2OR9H 2D9QB 4FQIH 1H3VA 4JPWL 5HHOE 4HWUA 1JGUH 5D7IA 1BBDH 4AT6A 3NCMA 3DX8A 4XVUD 1EH9A 4M1GH 1DQJA 4GRWF 4OAWB 4RGOH 4UNUA 1R3JB 2X7LB 4IDLA 4KVNH 1JGEB 4GH7B 2XQYG 3ULVH 1JYNA 2VQTA 2W0FA 3PWLB 3TBTA 5EO1A 4LKCB 2V6HA 1YPZE 4B50A 5TF1H 4I18A 4KH2A 4WY7L 3HRZB 3ARDD 1N8ZB 4BQ9A 5C09E 3A67L 3O6KH 2DQHL 1NFDE 4YDJA 1KIQA 1AGFB 5HGDB 1NCWL 4OZGA 1SYSA 5IGXH 1PFCA 3FKUS 3LRGA 3RKDD 5HPMB 4P59H 1ZHLB 4DOHB 2Q3ZA 1MCWW 1UYWL 4KZEL 2X4PA 4CMMA 3LN4A 1PKQE 3QUYB 1H8NA 3QG6A 4RA0C 4AQ1B 3NFSH 3VFWA 1VPOH 3EOTH 4CAGA 1CE6A 1GJIA 5INCB 4GAFB 2FO1A 3BVNB 3SKJH 1FCGA 4NQDD 2XV6B 5HVHC 3JZ7A 4UT9L 5C0BD 3IJHA 2GAZA 1V7MH 2F8VA 2HKFL 1B2WL 2D7MA 4QRRB 4HJGB 4B41A 5JXAL 1CGSH 3RTQD 1T2QL 2EDLA 3SDAC 4WFFE 3QULA 2MQ3A 2NR6C 1RIVH 2OSLA 1LNUB 4EI5B 1D5IH 4QRUB 2R1XA 5JHDE 2VL5B 3O8XD 1FYTA 5C0CA 1MJ8L 5C07B 1V5JA 5L7XH 5FYKE 4GT7A 4XXDB 1CS6A 3CSYA 4G8GE 3U2SB 1BVLA 4QT5A 1ZE3C 1BIHA 1DBML 3D48R 1UA6H 2Z8VC 4U1GB 3ESVF 4HIXL 7FABL 5D2NC 5K33A 1ZV5A 2V2WB 3BSZL 1ZVSA 3OKNA 4Z7UB 4PGDA 5IKCB 1HQRB 2DQGL 4YR6A 3BRFA 2XFXB 4BELD 3O45B 1WBZA 3S35H 1A1OA 3C5JA 2FBJL 5CJQH 2EDXA 2PXYB 4CMHC 2EH8H 4K71C 4PRHB 5AZEH 1Q94A 2D03H 3FO2B 1MY5A 3QIWA 1ZT7B 3UMTA 4XXCA 5J9PB 2ZOKB 4U0RC 3OXSA 1C5CL 2A73A 1KYOJ 1NCAL 25C8L 3VXNB 2EO1A 4GRWH 4I2XA 2RCSL 3HFMH 1RFDL 4LF3B 3GSNL 5CZKA 3WHE1 3VXRB 4G9DB 5DK3A 3V4UL 4XVUC 3EOAB 4M6ML 3TA3B 1QBLL 4GRLA 2CXGA 4GKNB 3MA7A 3SGJA 4QO1A 3MV9B 4L3AA 5FUCE 2QSCL 3PWJB 4LLDB 1CD1B 3HI6H 4UNVA 9CGTA 1F11A 1TTUA 3UYOD 5B39B 1UJTA 4WWKB 4PG2C 4L8DA 5ILTH 3ARDC 1MHHA 2D7PA 1CLZL 1D6VL 1QBAA 2IADB 2GHWB 4M43L 5HGGS 1CLYL 3B9VA 4I77L 2DLHA 4DK3A 3RKDC 4NOBA 5AUMB 3D18A 3KGRA 2EDNA 5DMJB 5BJTA 2BNUA 1S7RB 5AZ2H 3KPRE 5DJ8B 3W11D 2QSTA 3MYJB 4CNIA 3U9PL 2AJSH 4OCYL 3IDUA 1P7QB 5EA0H 1BMGA 3ZT7A 2CIKB 4JY5H 4X0KB 4EQ3A 4PB9L 3QUML 2DQUH 4OCXL 1UZ8B 3ILQC 5DC9B 1KGCE 1WCBB 4Z7VE 1P4LB 4TSCL 5IFAH 2EDOA 3QIBB 1J7VR 1WBXA 5JNYA 3DSFH 1XR8A 3SE8H 1WBYA 1J9CT 4JZJC 1MFBH 4X83A 4OFDA 3FFCE 1RU9H 3BJLA 3QUXB 5T5FL 3OGCB 3O8XC 4ZFFA 1FGNL 4J8RA 3IU3A 2VLKD 1RZ8A 5DR5H 1ZA6A 2E9WA 4WRLA 1OGTA 3LKSA 4LSQH 3L95A 2YD2A 3DVNB 1MUJA 4JREB 4K2UL 2QTEA 3W39B 5EUOF 2YWZA 4F7CA 1IC4H 4HSQA 4JR9L 5K9QI 2ATPB 4QKXB 5I1CH 3WLBA 2YD6A 2R15A 4O5LL 4KUZH 5L2KD 2X4QA 2X4OA 3G6DH 5DEFA 2A77L 4JM2F 3BKJL 2C3HA 3VXQA 1G0YR 4Y2DB 4EXKA 3DARA 2X70A 2GK0B 5D2LE 1S7UB 4JKWA 4NJAH 4D0CB 2PF6A 4P5TD 4QXWA 5B4MD 4BK5A 1AFVH 1JNNH 1Y18B 1ZANL 5C0AE 4OF0A 2Y25A 3S35X 4YDLC 1EUUA 1MY7A 3QEQD 2GITA 4IOFC 3M1BB 5DUBB 3CX5J 4KMQA 1YDPA 3S5LB 3KYNB 3FT3A 3V7MA 3O4LE 4P5MA 2EICA 1N0LA 3C87A 4MCZB 4OT1H 4LIQL 3QZWG 3KJ4B 2IQAA 4I0PB 2JJUA 2ZOLB 2X4TB 4ZUUB 1TVHA 1WFNA 2P5WA 3Q5OA 2AK1H 1T6VN 3W0WB 2ZPKH 5MHSE 4PJAA 5MEOB 2A9ML 2H3NB 1NC4A 4UDUB 4FFWC 4QYOB 3SKNA 3RI5K 2Z35A 1V3LA 4FQCH 1Q0XH 2W65A 4DCQA 3UZEA 1SJEB 4KKBD 2R2EB 4KFZC 1B0RB 4UQ2A 3OB8A 1N6VA 4XMKH 5IBTH 3VXMA 1NAMA 3L5WB 1HSBA 4LASL 3QR2A 4Y4HA 3DRQB 5HXMA 3KPOB 3QDMA 2MQ0A 2I60H 2HN7A 5EZJA 2GCYA 3W11C 3R06A 3P0VH 4XMLH 3IT8D 1YQVL 3FQTA 3TPKA 4LSUH 4XNZB 2X10A 1UENA 3MLVH 5BVJB 3U46A 3UXFA 1NGZA 1QLRB 3RA7H 1OSZA 1BHGA 2EIZA 3P4NB 3VXOA 4ERSL 3HI1A 3MRGB 3CVHB 1LEGB 4FZ8H 4YK4B 2AKRA 1I8LA 1OAUL 4KKCD 1HYRC 4HC1H 4HKJB 4L4TA 4YLQT 1OWRM 1G7QB 4YEEA 4MAYD 3B6SA 1F6AA 3S37L 3DTXB 3CXHK 4HHAA 1QHOA 5F7KC 5F88A 4LCYB 5CKAA 3LRSA 1C12A 5CEYB 4FXGB 4LLMA 5C0DA 5E08H 5F8QC 3LKQB 2R23A 4NT6B 4XNXH 3MBEB 3SDCC 5FGRA 3ARRA 1CDUA 3DBXB 5EPMB 3RGVB 3RL2A 5CEZE 5F7DB 5F7UA 3DUUB 1ZVHA 4J1UA 3MLZL 3ZYIA 4F7MA 2Y4SA 3PQYE 5I8CB 2CLVB 5KVFL 1J12A 1U3YA 2HLAB 5J12B 4JPWH 3NA9L 4U1LB 2LFGA 1PY9A 5HGBA 1W0WB 1I7ZA 2GTZB 5FK9A 4K3DL 4AIZB 4NQUA 5KSAB 1C7SA 1ZLVK 1XR9B 1FHGA 3MLSL 4JRXD 4OLXL 3SBWA 1ORSB 2EEDA 4WO4A 3VCLA 3B2VL 3ABZA 5EU7E 5B4MC 2PTVA 1U8KA 4LCCA 4KJYA 2WBJB 2BVOA 2OJZL 2YKLL 4WY7H 3I6GA 2BERA 4HCRA 4K3JL 5GXBB 4M48L 4MNGE 1NGYA 3A67H 3RVTD 2FDBP 3PHSA 2DQHH 3QG7L 3DECA 1NCWH 3FO9B 3EO1B 4S0TD 1E28B 1T1ZB 4WI4A 1NCCH 2HJFB 3PL6A 3OZ9L 3CZFA 4JFED 5CJOL 4A2MA 4KZEH 3WNLA 2MSPA 5FKPA 1J0IA 3L7EB 3PIQB 4I9WD 4YFEA 2PO6A 3I3BA 3H42H 2Q7YB 1O7SA 4D9LL 4PRPB 3FQUB 4HLZH 4G9FB 4NFDA 3IETA 5KG9B 2AERT 3DO7B 1GIGL 2P8MB 4JCLA 5EU4A 4UT9H 4OFYD 1L9MA 2HKFH 4MNQB 1B2WH 1CFVL 4KKBC 4L8CA 5C0JA 4XGZB 5L0QB 1T2QH 1DUYB 1XT5A 4WHYH 3DV4B 1NGXB 4FQXC 1C16A 3QCTL 2FX8L 5I1IL 1MJ8H 1A7OL 3TN0B 4J23A 5DRZB 5HYJA 3C8DA 4G43B 3KYMB 3G6JA 4WTWA 2F53B 3P9LB 1DBMH 4IOSD 3GUTB 4GG6B 5CAYB 5T1KA 1P6AB 4PRBB 7FABH 4HIXH 2VMFA 1WC7B 1AD0B 1XF2A 3ULVC 1JPFA 3BSZH 4OSUL 1IEAA 3NCFB 5A2LH 2DQGH 4KKCC 4PREB 3HAEA 5IM7A 3UTSE 3FB7B 1KACB 1AH1A 2IALA 4EOWL 2FBJH 3VRLF 4IIQA 1S5IL 5I2IB 2WP3O 2IPUK 3LIZL 4E41D 1KB9J 4PJBF 1BLNA 2NZ9D 2YPKA 1BREA 5IB1B 1C5CH 4O2EB 1NCAH 3IFPA 1IGJB 25C8H 1HHIB 4XRCB 2RCSH 4NN6C 1DP0A 1RFDH 3HC4L 5MEQB 1LP9A 3GSNH 3JVGA 1L0XA 4U2YA 4PJ8A 3X11B 1EAJA 3V4UH 1JMXA 3IJYB 3LPFA 4M6MH 1QBLH 4NQCA 2QSCH 3LN5A 4L4VB 1DLFL 3RNQB 4LLYB 5JQHC 4LQ1A 3RHWK 1K3IA 1UADC 1JE6A 1WAAE 3KXFE 4LCUB 3L3JA 3TH3T 5GGUA 2UYLB 1U8OA 3MRJA 1CLZH 1D6VH 4YXKL 3BW9A 5ID1A 4M43H 3B2UD 1CLYH 2ARWA 5CEXA 4I77H 3OJ2C 3QCVH 3FT2A 1ADQA 1B88A 4WTZG 4GKZB 2XTJB 5SWZE 5BQ7A 1FFPA 1MHCB 1U92A 3MUGB 2CK0H 4GQ9L 5HGHB 5TDOA 3U9PH 1DEEB 2H41A 4RDQG 3EJYD 4OCYH 2HJLA 4UV7L 3B83A 1Z9SA 3E6FA 3L3OB 2KBGA 4PB9H 3QUMH 4OCXH 1CT8B 4XH2A 3QDJB 2NY4B 5ANME 4R9HA 3SJVE 4NNXA 1QSFE 5C70A 4TSCH 1FC2D 1QA9A 2FEEI 1EEZB 5LAXA 4Z78B 4A2LA 5GGVL 1RZIA 4MQ7A 1P5UA 1VACB 2O26U 4U7KA 1J1OL 2YPLD 5EIIA 1I3VA 3IRZA 4YBHA 5D7IF 1Z0NA 3ZTNL 4JZNA 1FGNH 3WFZA 1QOKA 3C5ZD 1IAOB 4HX1A 1FO0B 4F15C 3RDTD 4RAUA 5EU6D 1MCHA 1QUNA 4K2UH 5FDWB 3OL2A 1CYGA 3NCBB 1YNKL 3KLSA 4J7RA 4KROD 2A38A 3BO8A 3DHJA 4JR9H 5F93C 1KIPA 5D2NE 5J1AB 4S2SB 4O5LH 3K3QA 1JJUA 1X5AA 3K1KC 2A77H 5TJWK 3BKJH 1ND0B 4UI2A 2VQ1A 4OGZA 2RBLA 3EJJX 4GXUM 5D5MB 1RV6X 1CTNA 5I75B 4XBGA 1VFMA 5EZLB 3P11L 3IAPA 3BPCB 3SKMB 5DS8B 5ITFB 4GKSA 3GSNB 1D9KD 2NZ9C 4J3TA 1ZANH 4Z77A 4MDJA 2NW3A 1BIIB 5IVOA 4DFHA 3T3PF 3ECBB 3HNSL 1NAML 5GQBA 3QDAA 1RJLB 3KPNB 1BF2A 3ORJA 1H3WM 4EJ1C 3G08A 3LH2L 1BOYA 2LVEA 3JTSB 4LIQH 5I17A 5JOPD 3T2OA 1CFBA 4N0FA 3TPUA 3STLB 4W4OA 3ZZ1A 5FO7B 4ZMAT 1U8LA 5DVOA 3IXTB 4H25A 4LLUB 2Y6SD 4UOW0 4PY8I 3W81A 4AJ0A 3WS6C 1IGFL 1VENA 2FYYA 3WIFB 3GZKA 1WT5C 2YUXA 4RZCB 4WGVB 1Y0LB 3B2UC 3UYPA 1V3MA 2YXFA 1CD8A 4YHZL 2XWTB 4NWUL 3UROR 3NN8A 4F7EA 4TNVK 3AAZB 3FQWA 4JM2D 4LASH 1ODAA 3SOBL 4NO5B 1AQDB 3QFJB 3ARGC 4GLRI 2BDNL 1MLBB 4I0CC 4QTHA 2AK4A 4JRYE 5A2KH 3GSUB 1KFAL 2A74A 4LOUD 1X9QA 5DJCB 4C56A 1IGYA 1YQVH 3EJYC 1S7XB 3U36A 5I1KL 5T3ZE 2SEBB 5F9DC 4YNYA 3TYFB 3NCEB 2YBRA 2NXZB 2EDQA 2NPLX 4I1NB 4JY6A 1XGRA 3BYYA 4IDJH 1ULVA 4NQDE 5DVNA 1FZOB 2Y36L 4ERSH 5C0BE 5I1DB 5ESVA 5KAQF 5EU5A 2L4OA 1OAUH 4MS8D 2AQ2A 2HTLC 3VA6A 1JFQH 5BS0A 1IC1A 1BVKA 1ZXQA 3VH8A 3S37H 4X6CE 1NMCB 1A7PL 4ACPA 3T0EA 1IAIL 4DAGL 1A5FH 4LSSL 3RDTC 3MJ7A 2FD6L 3W2DL 3D39B 3Q6FA 1D5ZB 3MLZH 1NMBL 5KVFH 4KROC 3HG1E 3B3IA 2OZ4A 5CBEB 2VN4A 3MRDB 3AXLA 3CDGA 5J06A 3G5XB 3NA9H 1IC7L 5SX4I 3OR7A 4AENB 1RHHB 2XZZA 1LO3L 4GXVH 4PY8J 4K3DH 5SWSD 3U1SL 3I75A 3U6RA 5HTSA 4MA3B 2ATKB 4Z7WA 4MJ4A 4OLXH 2G9HB 2GJ6D 3B2VH 2X6MA 1YEKL 4BH8B 2VXVL 5DGQA 3WHXB 2NX5B 4Q9RL 1S7WA 1TQCB 5JO5B 2HFFB 1NEZG 2OJZH 2YKLH 4K3JH 1L0QA 3QJFA 2XRAL 4M48H 5TH2B 4R97C 4JFFB 4HUXA 4LCWD 1JF1B 1GGTA 1DN0A 4NCDA 4Y5YA 5IVZA 4FXLA 4LHQB 5JIHA 4C4KO 1WFOA 2FRGP 5ALCL 2NYYD 4MQXD 3Q5TA 3BIAX 3U7AA 2D31B 3OZ9H 5CJOH 1UB6B 3QEUB 3MJ9A 1MH5A 4BA8A 2ORBL 1BBJA 1A6VL 3ARBD 3MRQB 2Y6SC 3V95A 1LK2A 5E2UL 2ZUQB 3FFDA 4D9LH 2V5RA 4QRPA 5IW6B 4OLUL 3WS3A 4MD4A 4D0DA 1GIGH 4CU8A 4Y4FA 4LGPB 1JRHL 1RPQA 2DQTL 2XXMB 3MGTA 1J05B 5EC1A 5T33L 1CFVH 1YA5A 5LG1A 3TBYA 5T3XL 2AJ3A 4R26L 4OI7A 1BQLH 3B43A 4GXUN 4YFLI 3SGKA 1D5MA 1U6AL 4JM2C 3QCTH 2FX8H 5I1IH 5KOVC 1A7OH 4XCYA 1UKTA 4GBXA 4AT6B 3OB0K 2X5PA 3IFNL 4WTZA 4G8IA 3MRHA 1UCTA 2X40A 4H88H 4OTXL 1KCKA 2W0FB 1BF8A 2DJ4A 3TBTB 5EO1B 2DI9A 2PYED 1CL7I 4HS8H 4M7ZB 4OSUH 3T0AA 2B4CL 3BKML 1QO3B 4MS8C 3MLXL 1F2XK 4EOWH 4OCNC 4FMKA 2APVA 1RIUL 4EN3B 3PP4L 4YDJB 4HWZA 4OZGB 1SYSB 5DMGC 3LIZH 2BVUA 2VLKE 4ZO7A 3S37X 3C2SA 1J0HA 2HT4D 1ZHBA 4CL7A 1RAMA 4PJAF 2GK2A 1ADQL 2R39A 5I0ZA 3HC4H 1HQ4B 3K7UA 3KLDA 4ALAL 2Q86A 3S4SB 3H9YA 3VFRA 5CJ5A 3WEXA 1B6UA 3HZYA 3JWDC 3ALPA 4PLKD 5L2KE 1DN2A 1C08B 3CFJA 5E24E 5L8LB 5D6CA 2QQKL 5CP7A 3GM8A 1AE6L 1CD9B 1DLFH 3IFLL 5IFJA 3QULB 4LQFL 1AO7A 4M7JL 2R1XB 2NY6B 4R96B 1EFXA 3FB8A 5K9QG 3EO0A 1JGVL 1K8DB 3QEQE 2ZUXA 4LP4A 2J12B 1YMMA 4YXKH 2YRZA 5FUOL 1IGTA 5CP3A 2LAAA 1NL0L 4DTGL 1AY1L 2NYYC 2HT2D 3PDDA 1C5BL 1ZSDA 1XIWD 4OM0L 4RRPA 3U4EA 3LKNA 3KPSA 1G0DA 4GQ9H 1ZVSB 4RIRB 1NBYA 2WLZA 4AM0A 2YSSB 3VXSD 4XNQB 12E8L 5IB5A 1WIOA 3C6LA 5GIRA 3RZCD 4W6WB 1VFAA 4OFPA 2DF3A 3ARBC 3UTTD 4K3EL 2VXQL 3MV7B 2ZUVA 1J88A 3PWNA 3VRJA 2H6PB 4JPIA 4UUJA 3AREC 2JE8A 3C8KA 3MX0A 4PPTA 4JVUA 5IFHL 3BUYA 4BZ2L 4P2RA 5GGVH 5ICXA 1EBAA 5JUEL 1J1OH 1OLZA 3QO0B 3ZTNH 5FYLL 3VI4E 5C08A 4JFPA 4X6FA 3G5ZA 1BX2A 1HEZB 4GRLB 4JPVL 3JV4B 3QB7C 3VWKD 4NN7B 2LTQB 1I1AA 1YNKH 1HHJA 3ZKXC 2OQJB 3V5DB 2BCKA 2J5LB 3GRWA 4JQXC 2VLJB 4JFYB 1KC5L 3ULVE 4YHKL 3RWDA 1M4KA 1HINL 32C2A 1FIEA 1NC2A 1BD2D 3QNYB 5BOPA 5EBLB 1JZ6A 1H5BB 5I71B 4N9GA 5EIVA 4ELMB 3NFNA 5SV3A 3L6FB 1RK0B 3P11H 2GSGA 5DD3L 4ZXBD 3AY4C 3D18B 1Q0YL 1IGIL 2QQLL 4GAYB 4Y1AA 2BXYA 3C60A 2BNUB 4N8VA 1U95A 4XI5D 2HT4C 4CNIB 2R0WL 3GGWB 3H9ZA 3WL9B 2DBJA 3L5XL 4RFNC 4HPYL 4HWEL 1E27B 2DQFA 3NIDF 1K85A 5HHPA 3HNSH 4CGTA 1NAMH 5BV7L 5J6GA 2GTWB 2YUVA 3VXUA 2UY7A 3LH2H 4Q2ZA 1UM5L 4PLKC 4PJXB 4OZIB 3U9UA 4PJ9A 1WBXB 1AKJD 2ESVB 1S9WA 3TBVA 3H3PL 3ES6B 4EIGB 2B0SL 3PG2A 2CRZA 2Z92A 3QEHB 4QRQA 5DK0A 1IGFH 4ZFFB 2MCPH 4OZFA 5JW5A 2QLVB 4CVZB 3IVKA 1U36A 4X8XA 3GHBL 4U6YA 1S5HA 2VAAA 4LU5L 5EIQA 1BQHG 5DO2D 3G6JF 3LKSB 3O6FD 1CGYA 1U8HB 1FNFA 3RVXD 1TIUA 2EKSB 1M7IB 2B2XH 2HT2C 4NWUH 5LGHL 3FN3A 1YN6A 1IAKB 3DX6A 2PW2B 2Q6WA 3OSKA 3SOBH 4R0LB 4JFEE 2AQ1A 2BDNH 4IOIA 1IZJA 2X4QB 1KFAH 2KH2B 5DEFB 1ED3B 4PUBL 3VXPA 1KEMH 3VXQB 2R1YA 2DYPB 4X9IA 2BVPA 5I1KH 4I9WE 3MQIA 4P3DB 5ETUA 4MXVF 5JXED 2OZ4L 3HZVA 2P8LA 5LVEA 2NY1B 1OB1A 1YPZA 2EO9A 3QQNA 3IDXL 4HUNB 2Z31A 1PQZB 3IRPX 3QAZB 2Y36H 5GS1B 1MI5E 3VD9A 1LP9F 2PKDA 4MJ5A 1IRAY 5DURD 1A1NA 3EZ8A 3O11B 2WWKT 1UEMA 4GRWE 3U30B 5AYUL 1A7PH 4XMPL 4HK3J 4YHLL 4EDXB 4HCRH 1UH3A 1IAIH 1FYTD 4I5BA 4DAGH 5C0CD 2CGRL 5F9AC 2IQAB 2NY7L 4TNWK 1PKOA 1UXWA 3WE6B 3S8WA 2FD6H 3W2DH 3VWKC 4HIEA 3X3GL 2ED9A 2XN9A 4PJCB 1NMBH 5AYQA 1NGWB 1R3LB 3EOBA 4KI5D 4LCIL 3QQ3A 1L7TL 4B7IA 1WTLA 2FGWL 1K2DA 1G1YA 1IC7H 3HPJA 1ZA3B 2XACC 2EDRA 1LO3H 3MJ9L 4J4PA 3SKNB 2Y5TA 2Z35B 3U1SH 3D0LB 3UC0L 1TITA 2R56L 3IKCA 3O4OC 1I1RA 3T3MF 4WTXA 4JB9H 1YEKH 4P57A 1NAMB 2VXVH 4HS3A 2B39A 4ZXBC 3AM8A 4E41E 4Q9RH 1ACYH 5KVDL 1UM6L 4YPJA 4MX7B 1SEBA 5CINL 3L3DA 2J88L 4K07A 4XI5C 2XRAH 1OW0C 2P7TA 1G6RA 1RZGB 1GZPB 5FYKU 3RVWD 5ALCH 1Q38A 1MQ8A 2X4RA 5KW9L 4DZ8B 1XEDA 4JPKL 2Z4QB 1OD7A 2AW2A 3V79C 5FDYA 5H35B 1UCBL 2EIZB 3HI1B 4YE4L 2P4AB 2ORBH 4PGEB 5IT2L 4LHUG 4CJ1A 5DFWH 4HMEA 1A6VH 4NC2B 4KJWD 4HGKC 5E2UH 2BMKA 5HGAA 4OLUH 3CUPA 5C71A 2DJUA 3LHPL 5BRZA 3O3BB 3P3YA 3LRSB 4N68A 4NZDA 5EBWA 3MFFA 3O3AB 2UUDH 4ZTOL 3DUHA 1JRHH 2DQTH 3PNWB 3HAEH 5DO2C 1INQA 3RPIA 3MMEB 1A9BA 5T33H 3QXTA 3MNVB 4I18C 5T3XH 1UWEL 5ENWA 5FM5M 4F7MB 4R26H 5F7NC 5GSVB 1U6AH 2NY0B 2MKLC 3LRHA 1IEHA 5JW4R 5GGQL 1J8HB 1I7ZB 1BFVL 3P30L 1DQQA 3TH4T 3IFNH 4G42B 3QUKB 1U3HA 2XWBA 4QCIA 4ODWA 2IG2L 5JXEC 4OTXH 1Y6KR 3C8HA 3MRIA 4Y0GA 1PZUB 4NFCA 2EDTA 2BVOB 3EDFA 3T2QA 1XZ0A 3K8MA 1W72A 2B4CH 3BKMH 3I6GB 3MLXH 1NGYB 5DFVD 4YHPB 1RURL 3BE1L 3T65A 4N0UE 1RIUH 3PP4H 3EJZD 4P4KB 2YPLE 3D85D 2VZ1A 4LEOB 2CDFA 5FO9A 3MRKA 3PL6B 4S1SL 3KPRA 2N7BA 5DHVB 2ZG2A 1EHLL 5EU6E 5FKPB 4OGYL 2DTML 2BRRL 2OI9C 3TWCH 4R4ND 1ADQH 1LILA 3P9WB 4KI5C 2PO6B 3SKOA 4ALAH 2DLTA 4X9FA 4U3XA 3QDGD 2OTUA 5D7KD 3IETB 4O51A 1VADA 3O9WA 1T5WA 1HN1A 3BKYL 1CDYA 3RIFF 1R0AL 5ADPL 5EBGA 1WCQA 4QF1A 2QQKH 1AE6H 1I9RL 5C0JB 1LGVA 2VKWA 4APQD 3IFLH 4LQFH 3GB7B 1SBBA 3FFCA 5E4EB 4PJFB 4XCFH 1FNEB 1C16B 4M7JH 5E7FA 5ERWA 2J4WL 4ODBD 1QKZL 2VZSA 1JGVH 5J56B 2ZCKL 2C1PB 1JHTA 3QIWC 4YPGA 3WSQL 5CIPA 1FZKB 4XXCC 3GIVA 5HJ3B 5FUOH 1L9NA 1NL0H 3REVA 4DTGH 1AY1H 4Y5VB 1C5BH 2D7QA 4HMCA 1UZ6F 4OM0H 5IVXB 4GW5B 5E8OA 4N9OB 1LO2L 5JLZA 1XF2B 1JPFB 1S8DB 4Q6YA 3I02A 12E8H 1F5WA 5E00B 1R5VA 2O5ZL 4LLWB 2IALB 4K3EH 4R3SB 2VXQH 3GRWL 3BPLC 3UTOA 5D2LA 3QHZL 1T1WB 3OKMB 1BLNB 2EIBA 1EZVY 2YPKB 1NC4D 4UU9A 1FH5H 5IESL 5EUOE 1P69B 4XCCL 4YFDB 4O58L 3UDWC 1ROWA 4MA8L 5IFHH 3IFPB 4BZ2H 3H0TB 2W91A 3RZWA 4HS6B 3ZYZA 1BQHA 1PX4A 3MGAA 1HI6A 5FYLH 5EUKA 3VXMD 5L88H 4PTUB 4Y4HD 2EDWA 3QDMD 3U0TA 4JPVH 3SDDA 4MD5B 1J0ZA 1QFUL 4NQCB 2W9EL 5I66B 3QXDA 4R4BB 4RQQB 4V1DB 3E2HB 4LLVB 5DMKB 1NFKA 3S6CA 1ZHNB 4YHKH 5C07D 2GI7A 4TOYL 3BEWA 1JIBA 1HINH 5DJ6B 3G5YA 3WV0A 1JCKA 3L3JB 3RY5A 1JI2A 3L9RB 5IEHA 4FTVA 3LS4L 4ISVA 4L4TD 3EJZC 3MUJA 3PGFL 2BOBB 1CFNA 3MUZ1 1RY7B 5DD3H 3VU2A 1Q0YH 1IGIH 2QQLH 2BNRA 5TDOB 2R0WH 4HUWB 1LO0L 3X3FL 3QP3A 3L5XH 2J8UE 4HPYH 4O4YL 35C8L 4HWEH 4R4NC 3QZWB 2L7JA 5BV7H 3IDYB 2GT9A 2IPKB 5J13C 4XH2B 5LBSL 5DD5L 1UM5H 5CSGA 1ZWIB 3ME0A 3H8NA 1KPUA 4DVBB 4NNXB 3ARFB 3UTZA 1DVFD 2FHCA 1H3GA 1QP1A 3RAJL 1J0YA 3SO3B 4JAMB 3H3PH 5SX5H 4JHAL 2B0SH 2WNGA 3MODL 3SCMA 3IDMA 4NRZB 4OF3A 1HILA 3OKLA 4APQC 5J11C 1BWMA 4JN2B 5EIIB 3RFZC 2H2SD 2VTFA 1JUFA 4JZNB 4KKAC 3K8LA 3OKDB 3SPVB 4DN3L 4NUGL 3GHBH 2FO4B 4HF5L 3TA3D 4RAUB 4LCWE 2XIDA 3I84A 4JJ5A 3BD4A 2W59A 3MA9L 3RY6A 5LGHH 4MCYA 2YN3A 5H37G 1GOGA 4YDVA 1LD9A 1F6FB 2EYRB 3G6AA 3H9SB 1B90A 4JFHE 3CFCL 4M9PA 1U8MB 5JMRA 3BP7A 4PUBH 3S36L 3WCYA 3BIKA 1Q9KA 2VQ1B 2OZ4H 2GUOA 3PV6B 4NO2A 4YIQA 4Y89A 1FVCA 3IDIB 3IDXH 5CMAB 4GKSB 5IBLC 4LHUA 3GSOA 3LSOB 1FSKB 3BEVA 3NZHL 1TCRB 3RPKA 5E1AB 2QQQA 4MNGA 4NCC1 5IK3A 1P7QD 3K8KA 4KQ3L 5I16B 4W68A 2EE9A 5DK2A 4BUHA 3PGCA 2VZUA 5JPNB 4CJ0A 5EULV 4XMPH 5AYUH 1W0VA 3G08B 4OF6A 1M6OB 5FYKL 4YHLH 3F65A 4Y4HC 2CGRH 2NY7H 3A6CL 3QNXA 1G6RL 5MI0B 3QIBD 4F8QA 4NKQB 1IQDA 3X3GH 2F54D 4L9LA 4BJLA 5FOBB 4LCIH 1L7TH 3RBGA 2FGWH 2X2YA 4FQHB 1HXYB 5F6IB 3SDYL 1FNGB 5T1KD 2RHEA 4ORGB 5GGSY 5MENA 3WFBL 4LMQE 2K9UA 1BZQK 3MJ9H 4UNTA 3SY0A 1N59B 2R56H 2EDFA 2YUWA 5MEPB 1I8LC 1S9KC 2XKUA 2YPVH 4F7EB 1N3NA 3S3JA 5BV7B 4UDTB 1J1XL 3LEXA 5KVDH 1UM6H 1J0JA 1JBJA 2WIIB 2AK4B 5CINH 2J88H 2QQNL 1MJJB 3D25B 2VDOL 4DKEL 3VD3A 5GPRA 4Y2DD 5B22A 2WBKA 3AC0A 2PCPA 4IMLA 4YNYB 2MQCA 1E6OH 4PJ7B 1M71B 4MXQD 5KW9H 1YUHA 4JPKH 1FL3A 5H94B 4JY6B 1CFTA 4M4PA 2Q76B 5J8OA 3VGEA 1UCBH 3DXAA 2EYTA 2NY2D 3GJEB 4PJ8D 1QLFB 1CICB 4YE4H 1DVFC 1MCDA 5IT2H 1NEUA 3ROOB 4E0RB 2LAGB 1BJ8A 3G5VB 3ULUL 3BJ91 2W9DL 3OAZH 5LGJA 3LHPH 4WO4C 3EFFA 1W72L 4ZTOH 4LCCC 4OLWL 4JCMA 2G75A 3CH1B 4PRIB 3OX8A 5FECB 1KULA 1UWEH 1R3IL 3QWRD 4G8FA 3W0WD 3E1F1 5EU3B 2R2CA 3B3IB 1E0OB 3AXLB 2P5EB 4LSRL 1TQBC 1ZLWK 2Q8BL 3VRLE 3OR7B 5GGQH 3VXSE 3P30H 4X80L 3BZEA 5B3JE 1EVTC 2Q1EA 4PJBE 1TZGH 5ESAA 1T83A 3UTTE 2IG2H 4Z7WB 1PG7X 2QHRL 1XGQB 3S98A 1WAAA 2FL5B 3C09B 4MJIE 1YZZA 2IANA 4LMQI 4WGWB 1FPTL 1MAJA 4YH6A 4FMFA 3FB5A 1FG2A 2J8OA 4JKPH 5HYQA 1RURH 2AEPL 3BE1H 4Y5YB 5JW4Q 1CDCA 2Q20A 1CQYA 5E2WL 2ZUTA 1G7HA 3M17B 4N8PA 4XP9L 5FGCB 5CZXC 4S1SH 3L7FB 4TTDD 3WBDA 1EHLH 3F6IA 4JDZA 3NH7L 4OGYH 5CP3H 2DTMH 3LKOB 2BRRH 3QQ4B 1NCDL 3OHXA 4KK8C 1LK2B 1I75A 3FZUD 4KK6D 5DJ2B 3QI9A 3T0XA 4QRPB 5I8OL 2RB8A 5ANMA 4MD4B 4P2QE 4Y4FB 1WVZA 3BKYH 3WUWG 1R0AH 1QSFA 5ADPH 3H9HB 2FSEA 3MGTB 3F12B 3MBED 1A6AA 3RGVD 4XC1L 1I9RH 4MGXA 3JWNC 2AJ3B 4GS7B 1KN2L 1HSAA 1NFIA 3VDCA 5DD6A 1MCJA 4IIQC 4BSVA 5IMOB 4XHJC 2J4WH 4XCYB 1T89A 2ZUSA 5I6XB 1QKZH 2VR9A 2WAHA 4NQEB 2ZCKH 5FYLD 1ZT1A 3MPCA 3WSQH 3A6OA 5J3HD 2EEAA 3TT1L 3O2WL 1OY3B 3QFDB 5GRUL 1YPZF 3PF2A 1UWGL 2OTWA 4K7PY 4MXQC 2OM5A 2FBOJ 2AABL 5D1XB 4H0GA 2D2OA 1LO2H 4D9QD 3JVGC 3X13B 2NY2C 3LVEA 4PJ8C 3OBAA 3MV8A 5D7IE 1GH7A 5EWIL 3I2CL 1G7IB 2O5ZH 5DD1L 4RMVA 3PGDB 3GRWH 2B4CC 1CVSC 4X7CC 3RX5A 3MCKB 3QHZH 4ZUWA 1OGAD 2VLMD 1DZBA 5IBUG 3VWJA 5AEAA 2BOCB 2NTFB 5IESH 1KTLA 2R0LL 4O58H 3M07A 2HH0L 4MA8H 4PJEA 2P48B 1P1ZB 1FFQA 5FCUL 4DK6A 4LGSB 3G9VA 3QIUA 2Q86B 3KDMB 1MFAL 3HNVL 3HZYB 5EOTA 5CUSL 3QSKB 4FS0A 5K9OA 4I48B 1H15A 1QFUH 3G04A 4PLJC 2W9EH 3V6ZA 5LGKA 4C56D 4R7DA 2JK5A 1DL7L 3BUTA 5JDSA 4PLOB 1KXTB 1P84K 3T3PE 3MCG1 1LQSR 4TOYH 15C8L 1KXQE 4PG2A 3EO0B 5IHUL 1NBZA 4OLEA 3ARDA 1S9XB 2B5IB 5D1ZB 5D7JB 3IF1A 1N4XL 3LS4H 1QFWI 3PGFH 5CWSA 5BS0D 4JVPA 3Q1SL 4OZFH 2VXTL 5I74B 4JO4L 1DCLA 4GKOA 2MFNA 4ZPTA 2QJDA 4TTDC 1FYTE 3QNZA 5C0CE 1NBYB 1LO0H 3X3FH 4F80A 4O4YH 3C6LB 35C8H 1P2CB 1VFAB 1HHKB 1IGML 2KZ1B 4KI5E 1FGVL 5DJZB 1LE5B 5F7EL 2DAVA 5FGBA 4F3FA 4PGCA 3IDGB 5LBSH 2IMMA 5DD5H 3VRJB 5I73B 1F3JB 3HN3A 4JGMA 4UUJB 1BZ7A 3CZJA 3V2AR 3QEGH 4D94A 5B8CB 2R8SL 5E9DB 3BUYB 3RAJH 2ERJC 1JNHB 4YJZL 5IG7A 3VFUA 4H1LA 5ICXB 4CVXA 3RTQA 4JHAH 3MODH 3BP6B 4QHMA 1NANI 1RJYB 4NNYA 3O8XA 4HFWA 4JO1L 4JFPB 3H7BA 5CCKL 2EECA 4UIKL 4DN3H 4NUGH 4X6FB 3G5ZB 1ZGLB 4HF5H 1A3RL 3MOAL 4PV8A 4CADB 1PEWA 5J3HC 4LBEA 4L8SC 3ULUF 1WK0A 1I1AB 4HG4K 3MA9H 1I1YA 1QPXA 4I2XE 4NRYA 3TO4A 4XZUA 4PJ5B 4X4YA 3CFCH 4ZQKB 3OAYK 5FA4A 1HDMA 3S36H 3QA3A 1URLA 3D2UB 3CSGA 3P40A 4N9GB 4W4OC 4WNQA 2UVFA 3NFNB 1A6UL 1OAYH 1WZ1L 2XPGA 1BJMA 2GSGB 4HKBA 4Y1AB 4ZAKB 2OL3B 3P73B 4AEHL 3V4PL 3NZHH 3MR9A 5DVMA 5DC4B 2YMXL 3WFEL 1F45A 4Z0XB 4L1DA 4KQ3H 4JFZL 3O3DB 3OJMB 3WO4B 3KPLA 2DM7A 3QDJD 5FYKH 3DJ9A 4QY8B 3U9UB 1KPVA 3SDXA 5ACZA 4KRPB 3A6CH 1P4IL 1G6RH 4GBXD 1ZS8A 1N5AA 3TEUA 2P45B 3TBVB 5IR1B 1F4HA 1AGCA 5AWNL 1H0DA 4CVWA 3QRFM 3WKNA 1OHQA 4U4BA 3O81A 2FEEL 5DK0B 4DEPB 5JW5B 3WFBH 5IB3A 2ICWA 4U6YB 1JZ2A 1QG3A 2XY1A 1HKLL 2RIKA 5MERA 3PXJA 1YY8A 3MFGB 1NEZB 3OXRA 3TESA 4KI1A 3ARYA 5C2BL 3FRPG 1J1XH 5HHOB 4OF7A 1K5NA 3EIFA 2HT3D 3L5JA 2QQNH 4NWTL 4JZOB 1KTDA 1TTFA 2VDOH 4X99B 3T0EC 3VXPB 4DKEH 3QO1B 5D2LF 5ETUB 5JPMB 3HZVB 3QUZB 4ONHB 1CN4A 1OB1B 1YPZB 5D7KE 1RUQL 2W92A 3VJ6B 2VABA 3IU4H 5CLTA 5TGBB 3TNMA 2XWJB 2ZG1A 2W07A 3MRRA 1A0QL 5C09B 4ELKB 2OXHA 3T4YA 1I9JH 3VRIA 1NFDB 3ULUH 4NCC2 3RUGA 2W9DH 2X05A 4M02A 1BGXL 3CMGA 4DWHA 1AO7D 1W72H 1Q9LA 4OLWH 3LQAL 3JUZA 1RI8A 4Q6IA 1UXWB 3OR6B 1PKQB 2APTA 4Y16D 2YRLA 1MCNA 4HBCL 4HIEB 5C0EA 1R3IH 1YMMD 1I7TB 3QQ3B 1VEOA 1A6ZB 3RBSA 1QQDA 4LSRH 4GW1B 2BSTA 3HPJB 1BVZA 5DQJA 2Q8BH 1KLUA 3D9AL 3ULSA 2Y5TB 4X80H 3KPSD 5KTEL 1MLCB 3STZA 1AJ7L 1KUMA 4HAFA 2QHRH 1EPFA 2P5WE 1HNFA 1I8MA 1CU4L 5JOEA 1WZLA 4HAGA 4P5TA 3BWUC 4PJAE 5JHDB 5KSVB 5C7XL 1MRDH 1QEWA 3QFJD 1U3JA 2VQUA 1SEBB 3GMRA 4ZO8A 3L3DB 1VKXA 4OUUA 1FPTH 4G8GB 2KKQA 4KKNA 3I50L 4ZUSB 2AEPH 3GMNB 2VYRE 4Z76A 4G6AD 3GMLB 4XVTL 2G60L 2IMNA 4YGAB 5E2WH 4NKDB 5JORA 4MLIA 3U0WL 2ZP0T 4H5SA 4XP9H 3VXME 4ORZC 1I8KA 5DZOA 3GMPB 1G7MB 2ZKHL 3HZMB 5CIPH 3FT4B 3QDME 4GBXC 2VSDA 1EK3A 3NH7H 4ZO9A 5E2TL 1NCDH 4LL9A 3BESR 1YYLL 1JWSB 3RWJA 4NBYB 5C0RH 3WLWD 5I8OH 3HPLB 3QPQD 3CUPB 5JA8B 1UH4A 4K9EL 5F3BB 3L3KA 1S7VB 1JF6A 5IB2A 4LDEB 1A9BB 1FZJB 2YEZB 3GMOA 4XC1H 4X9HA 3BZDA 1NC2D 3EYFB 43C9A 4L4TE 1KN2H 5HI4D 4WWID 4CVUA 2XNAA 2GYSA 5K9KB 1YJDC 1XGPB 4WHTB 2DKSA 3CFEA 4ETQB 5EO9B 2Z93A 3TC9A 3C60D 1NJ9B 3TT1H 1Z9OA 3O2WH 3UTPD 4M5ZL 1F13A 4ODWB 3U0PA 1QSED 2CKBA 1AR1C 1UWGH 4ZS6D 1LWRA 1JWUA 2AABH 3BYTA 3LEYL 3MRIB 5E6ID 3VG0L 4ZUTA 4JFXA 2NNAA 5JMOC 4I4WA 3VXUD 1D6EA 4YO0B 1MCWM 1W72B 5EWIH 3I2CH 2C4XA 2DQCL 1IKFL 1F58H 5DD1H 3NIFE 1D5XA 4MAYA 3T65B 4MSWB 2Y06L 3KLHD 4W4NA 6FABL 1AC6A 4LVHC 3CFDB 5FO9B 2XKNA 2D9CA 1CVRA 4ETYA 3KPRB 2R0LH 2HH0H 5DRNB 1XCQA 4Y16C 4IJ3C 1NH6A 3DX9A 1G7JB 5FCUH 4PJHA 1NKRA 1QR1B 1HZHL 3KWWA 5BW7A 5FAAA 3VGAC 1MFAH 3HNVH 1VADB 5C3TA 5CUSH 1YNLL 2I26N 2G2RB 3O9WB 1T5WB 1JVKA 2H32B 2JIXD 1K6QL 4Z7VB 2ENYA 1MPAH 1HOCB 2IAMD 3JTTA 1DL7H 1SYVA 4JRXA 1T20A 5GS2H 3MYZA 3FFCB 4RGND 4F37K 1XF5A 3MRLB 4WU7A 3NIDE 5JDJA 3ZDZF 4TSAL 2DQIL 1FVEB 3O6LL 15C8H 1F02I 5IHUH 4G6JL 5I19L 2Z31D 3MRMA 5EN2A 2A6DA 4OF8A 2CRMA 3GIVB 2O93L 2CXKA 2AXFB 1N4XH 4IRSB 4G6AC 1R5IA 1FVDB 3MNZB 3KYOB 3Q1SH 5DYOA 2VXTH 4WUUD 1BJ1H 1LDSA 4Y8AA 4P48A 5E95B 5E8OB 5C9JB 1M7XA 1FZMA 1MQKL 2DB8A 1MCBA 2DM4A 1OTSD 5HYJE 4AIXA 4JKKA 1RQ5A 2F54E 1IGMH 1FL5B 4LPXA 1CL7L 3G6JE 5F8RC 4EN3D 1FGVH 5D2LB 3WLWC 5LWYL 2XN9D 3QPQC 4ZOBA 5E8DL 1JHKL 2FGZA 4UU9B 1CFSB 5C0AB 3X12A 5DDHB 4XT1C 4PRDA 1JHLL 2R8SH 3O41A 2F8XC 1KJ2A 3O4LB 1BQHB 2RFXB 3ARUA 4PIRF 3GI9L 1FNSL 4JO1H 4JLRB 1SQ2N 5CCKH 4UIKH 5DF0A 2Z91A 4MXVE 2OYPA 1DANU 3TIEA 3AS3A 5L6YL 3FOMB 1T66C 1A3RH 3MOAH 5J0BA 4RFEA 3C60C 1EJ6A 3SDDB 3U0TB 3AGVA 1HIML 1A4JA 1AHWA 4NO3B 3QXDB 1A1MA 1EO5A 3KYAA 1OLLA 4MJ6A 4P23B 4ZS6C 1U41A 1IAII 2FX7L 5E6IC 1U93A 3R0NA 3DMMA 1LP9E 2ITDB 3RRQA 2AV7A 4YAQA 2EH7L 4X7TA 4KTDH 5HDQL 3F7VB 4V2BA 5EBMB 4X6DA 4PJ9C 1BOGB 4X4XA 1A6UH 1WZ1H 8FABB 2J8HA 5IOPB 2E8YA 3OF6D 1CFNB 3KLHC 1UT9A 3RJDA 1U2HA 3V4PH 4AEHH 4MA1B 1N26A 3TBWA 4JFOA 1WQVT 2R2HA 4JE4B 2YMXH 3DGGA 3KHOA 3WFEH 4QHKI 4JFZH 3C9NA 5IMMA 1F4WL 5KS9E 3MV7D 2GT9B 3MLTA 4Y4KB 5F3HB 4XC3L 1AGDB 3T3ME 2YUZA 4ZYKB 2VL4A 4TUOA 2WWKO 4XP5L 5ITBL 4XCEA 1KPRA 2IAMC 4HH9A 2QADB 1RULL 5AWNH 5DHYA 3F7PC 1T7ZA 3SCMB 4EUPA 4RGNC 1JN6B 3WXVL 3ARQA 4YDKL 1IFHL 4MDIA 3AMKA 1UB5B 5C0NC 2Z31C 1HKLH 1ZKAA 5IJKA 3VFSA 2KQMA 3RWIA 1Q9OA 3WIIL 3MOQA 3PQYB 1F4AA 5C2BH 1RK1A 2EDKA 5T5NG 2VLJD 4P2OB 4L5FL 5DMIL 1UQSA 4NWTH 4DVRL 3PDGA 4LLAA 3BIKB 1Q9KB 2LQRA 4QXTA 2VSCA 3DRTA 3MJ8B 3UYRL 5I1AA 3CFIC 3FCTA 3NFPB 1RUQH 4N1EA 4HH8A 3L3GA 4LHUB 4NZRL 3KPMB 4PJEF 5DHXB 2FATL 3PHQA 4FZEL 4I13B 4NC1C 1A0QH 4MNGB 4TULH 4J4PC 1T21A 5F7HA 2A83A 1NUDA 4NPYB 5DK2B 2FB4L 4U3HA 3LY6A 3PGCB 4U6TA 2WM0A 3K4ZA 2APXA 1W0VB 2QKIA 4QHKJ 1BGXH 3MLUH 3C5ZA 1DLHA 2IFGA 3F7RA 3H3BC 3JV6A 4XNUL 2MPAL 1T1XB 2BFVL 2VE6A 2ADGB 3LQAH 5FYLE 4XNMA 3RDTA 3QNXB 4RGMC 4HBCH 4F7TA 5GGSB 5LKNA 2F8OA 3OJDB 3TCLB 1RZFL 3H3KA 4P46A 1JZ4A 3QBTB 1M05B 3FO1B 4G6ML 2HVJA 5C0GA 1PEZA 2BHYA 1KB5A 2CLRA 3D9AH 3F7YB 3SY0B 2LU7A 3O3EB 2YD9A 5KTEH 4BFBD 1FL6A 4X98A 1I7UB 1AJ7H 2HKHL 5FF6B 4P5KB 5E0QA 1ZAGA 4OJFL 1CU4H 1OGAE 2VLME 3FAXA 1G9EA 5C7XH 1BZ9B 1D9KA 1P4BL 4YXLL 1IKNC 4KUCF 4MNHB 5FA3A 5D96C 5CJ8A 2D4DA 2YD3A 4G6FB 3I50H 2DYPD 3AB0C 3T0DA 4XVTH 2G60H 4HIJB 4GLRH 4RWHA 4Z8FL 2O61A 3U0WH 1YUHB 3UBXB 3DI3B 2HRLA 2C1OA 2DQDL 2ZKHH 4YFLF 3OJVC 3UTSB 1DBBL 4I3RH 5E2TH 4C56E 2R2BA 1YYLH 2CKBL 3UP1A 4BKLB 5IHBA 1U8NB 3ARXA 4U1MB 1U3HC 4U31A 5FV1L 4QHUA 1U8PB 5LGJB 3SHSA 1T1YB 4U6XA 4NKMB 1MFEL 4K9EH 1U2CA 3ULUC 4NOFA 4X5LA 4KRNA 5EUOA 2G75B 3DI2B 1HK6A 2CDEB 2UWEE 3P9MB 1R3HA 5BS0E 1Y6MR 1S9YA 4FTVD 4JFQA 2V5TA 2C26A 4Y19A 5IIEA 2PUQT 4M6AA 5F44A 5E8PB 3T0EE 2DIJA 2BNRD 4G6KL 5A16B 5ESAB 3DVIA 4M5ZH 4F7PA 1JPGA 1I3RB 3LEYH 3VG0H 5GS2D 5HHNB 2JJVA 3C6SA 2HYMA 2YC1B 3KXFB 5EOCL 5H37H 1B0GA 1MNUL 1N7ML 4F58H 4D0BA 5IMLB 2DQCH 1IKFH 1FG2B 4PGJA 5HYQB 1R3KB 1VDGA 4LFHD 3BQUD 3N50A 4XAKE 5E8EB 2Y06H 4LARL 3VFNA 1RHFA 43CAA 6FABH 1C5DA 1G7HB 1A6PA 4U1IB 3IXAA 3SDXF 4HIIA 1WITA 2CLZB 5SWZB 1D5IL 4U1NB 2FHBA 1KELL 4G80B 3UPRA 3IJSB 4JDZB 2J8UA 2V7NB 2UZIL 4WI2A 2GJJA 1HZHH 3HUJE 3T4AA 1TVDA 1NDMA 5B3NA 2P8PA 3DVGB 5ANMB 3PXHA 4KMTL 1FV1B 2IGFL 1YNLH 3TJEL 5HVHB 3SJVB 3PV7A 1OP5K 1QSFB 1A4KB 3KPPB 3MRFA 1K6QH 1OAXL 5SWSA 4RMTA 3GSVA 5JOFB 4BSWA 1LEKA 4HXBL 1Z2KA 3WDHA 2GJ6A 3SDAB 5IHZA 1P7KA 1EHAA 1NFIB 4IS6A 3Q0HA 3EUUA 3NZ8A 5DD6B 2YWYA 4TSAH 2DQIH 1QR4A 3O6LH 4G6JH 1B6DA 1ZHKA 5DMYA 5KVMC 2NXYD 5I19H 4HEME 5I15L 1ZT1B 4JN1L 4LCWA 4PJIE 4H1LH 4JVWA 3VGGA 4LPVA 4GRMA 1HH9A 4YXHL 1KJ2L 3ZMRA 4ZPVB 4J3UA 2FH6A 4Q74A 4OFKA 4GAJL 2XQYK 2ZG3A 1EGJA 5DJ0B 3S97C 3PP3K 5D2NB 5DJDA 3SO5A 1CF8L 1MQKH 5TE7L 5J1SC 1BWWA 3RI5F 3EYSL 3VFTB 3RUGF 3ZE1F 2P42B 4P4KD 4CMHB 5LWYH 4ZUWB 1T2JA 4K71B 1A7RL 1D5BA 5E8DH 5ABDE 2CD0A 1JHKH 4LNRA 3ILPB 3CU1A 3BDBA 1U42A 3O2VL 2CO7B 4XCNB 3RNKA 4U0RB 1EHXA 1W8NA 1EV2E 1JHLH 5ILTL 1GGBL 4TVSa 1TPXC 2YHGA 3WN5A 2DQEL 1G6VK 1DFBL 3GI9H 4Q9QL 1FNSH 3VG9C 5EOTB 1LEIA 4OBRA 5L6YH 1G9NH 4A6YA 2HFEB 5ACMA 1H15B 3IDJB 1HIMH 5ICYB 1K8IB 2ILLA 4WU5A 5HY9B 4KDWA 3QDHA 1PYWA 1QRND 4OM1L 2FX7H 1GSMA 2PYEA 5DRXA 5CFHA 1I9IL 5BZWB 2EH7H 3P4MB 3U79A 4NC0B 3ARDB 5HDQH 4AH2B 4BQBA 4U7SA 2XA3A 4I8DA 3BQUC 3RQ3A 3DSFL 3D5OF 4O02L 3D3VD 1C8PA 3H6JA 4C54A 3VGFA 1KSRA 3AY4A 1MFBL 4LPWA 3TIDB 1CI5A 1OM3L 1AO7E 4ZDHB 3VFVA 4X5WA 4JRYB 5KAQG 1BFOB 4CN4A 2MNUA 3OPZH 4LPTA 3V6FA 3LKPA 2PW1A 3HR5A 1YMME 2RAMA 1F4WH 4ZFOL 4F3FB 2I9LA 4NM4H 1PLGH 3LCYA 3VA2C 3S88L 3BP5A 4XC3H 4NQDB 5KOMC 4POUB 3TNNA 3ZDYF 6CGTA 1UM4H 4G8EB 5GJTL 5C0BB 4XP5H 5ITBH 2VDPL 1OTUD 3KPSE 3GSQB 4JY4A 5JIKA 3DIFB 2ARJA 5F89A 1RZJC 2DWEA 2KL6A 1KLFA 4GG8B 1RULH 2E27H 4JZJB 3VFUB 2E5EA 2E8ZA 1KN4L 2Q3AA 3R1GL 4X6CB 5L8JB 4FOMA 1QACA 2BSED 3O8XB 4OCMC 3T77B 4HFWB 3U48A 1YMHB 1KT2A 3AU1A 5I8EA 4YDKH 1IFHH 3WJLA 2NXYC 1YEDA 5HDOA 1IT9L 3HE6D 3SE4A 1FJ1B 4Z9KB 3TT3L 3OKKA 2B7DT 2IAND 2UZXB 1PZ5B 2E7MA 4YDIL 1G1CA 3WIIH 4U6VL 4V1DD 4P2RE 3RVVD 4R4FL 5D9SA 3BH8B 3HG1B 5DRWA 1AGBA 4L5FH 1XIWA 5DMIH 4NDMB 1MWAB 5FKAA 3TBSA 4XZUB 5C8JA 5C08E 2NY3D 3N1GC 4U1JB 5F1NA 4XPAL 3ZHLA 1GHFL 4DVRH 1N2RA 3RZCA 3BP4B 3QA3B 2VLRD 4X8JA 3UTTA 3UYRH 2XPGB 4L9LC 4QHNB 5I0DA 3QI9D 1KB5L 4NZRH 3E6HA 2ADIB 4YDLB 4M7LT 2FATH 4FZEH 3DURB 5F21B 4PJHF 4P99A 1J1PL 2M1KA 1VGKA 2OX5A 3MROA 2FB4H 4ENED 5E94B 1HKFA 3CFKA 4NQTA 3DROA 4QOKD 4XNUH 2MPAH 1A7QH 2BFVH 2W38A 2ZWLT 1TVBA 1OSPL 1T7VA 1N5AB 3HS0A 1CIDA 1T5XB 2XICA 4LKXB 4XMLL 1QSEE 2GFBA 1H0DB 1RZFH 2V7HB 2XQBL 1YEFL 1WLHA 1O5DT 2YA1A 4OCSL 3TH2T 1N6UA 3V6OA 1AD9A 5KSUA 4G6MH 5D72L 3VXUE 2Z8SA 1F8TL 1HHGB 1BD2A 2BVQB 2QSQA 4N8CL 1YY8B 3SE9L 1UWXK 2HKHH 4OZHA 3MV8D 1ZLVH 3OXRB 3CCHA 4L3CA 4OJFH 1CBVL 3T2PA 3ZL4H 4HUMB 3SEPA 4QNPE 5DA4A 4OLVL 5T1MB 1P4BH 5IJVB 4YXLH 3BN9C 1W8OA 1T0NA 2GKIA 2VERN 2PTTA 2F19L 1ETZA 3QH3A 4Z8FH 4GQPH 3MTRA 1OP3K 1MCCA 2BSRA 2DQDH 4OKVA 3DETD 3QIUD 2VABB 1SEQL 2JJTA 3RHWF 3A0OA 4YQXL 4CN1A 4L8BB 3TNMB 1OTUC 1AKJA 3Q3GA 2VUOA 5C0IB 4XAWL 1DBBH 4OGAD 5M95B 5DZLA 2CKBH 1Z5LB 3VRIB 5DUML 2VIRA 3WUWB 1EIBA 4KJQD 4RGNE 1T83C 2ICEA 4EVNA 5FHAH 4URTB 4NP4L 3HKFA 1MFEH 2VLKB 4DJMA 3REWB 2Y5EA 2OXGA 3O6FA 3SDCB 3HE6C 5EG6C 3ZDXF 3BDXA 3LQAC 4G3YL 4DN4L 1FG9C 4WUUE 2A6JB 4BQCA 3B9KA 1QQDB 4MWFA 4ZFZB 2BSTB 1GZQB 1AXTL 1KLUB 1NCCL 2NY3C 5L2KB 2NY5L 1WFUA 3QXAB 3VI3E 4X6DF 4UIMB 4G6KH 4LP5A 3DSNA 1E4JA 3STZB 4HKZB 5GZNC 5JXEA 3VDAA 4KUCD 3JWDL 2XN9E 3PHOB 1AIFA 5KN5B 1H8SA 5EFIB 5INDA 2DIBA 3H42L 3QI9C 1DQLL 5EOCH 3GMRB 1MNUH 1N7MH 3QEQB 1KLGB 4OUUB 4NC1E 5IBUB 1B0WA 2H8PA 1DR9A 4BFIA 1AGEB 2V2TA 4HKXA 4RAVA 5CGYD 4LARH 4TVPD 3RWHA 4ENEC 4HWNA 5HYSA 2X4NB 3K74B 1KELH 3PDOA 2V2XB 2WUBL 2X1OA 5DVLA 1T89C 1E4WL 2EIDA 1EFQA 2UZIH 4U6HA 5IEKA 2VDML 4YGVA 2E6JA 1R24A 3K80A 1EGJL 3LPGA 4MJ2A 1LO4L 7CGTA 4KMTH 2IGFH 2Z8RA 3GFUA 4TYUA 1MCFA 3TJEH 5H2BA 1WFTA 1AQKL 3MGOB 1M7DA 5CS7A 1JPSL 5IB2B 1OAXH 1VFBB 3TO4D 1R5WA 1FIGL 4OD2B 4K9EC 3GMOB 4PRID 1S9VB 2DN7A 1RSFA 2P24A 4HXBH 4L29B 3TO2B 3QXVA 4K7FB 3CH8A 3NCCB 1HHHB 2NW2B 1T03L 4FQXB 4YHIB 2IH3A 2DKUA 5I1JL 4JM4L 3C08L 2B8OT 4PRAA 2P5ED 1CLOL 3VWJC 4FA8A 1WEJL 5BRZE 1A2YA 5I15H 4MVBC 1JZ5A 4JN1H 1H3TA 5GRVK 4YXHH 1KJ2H 3FQXA 4UOW1 3U0PB 4FQQB 1JV5B 4P4RA 3VXTA 1K4DA 4GAJH 4PG9B 3MNWA 5E56A 4A6YL 4ZUTB 3S7GA 5DJXB 3DETC 3GBML 3QIUC 2QR0A 3CK0L 4I4WB 4PV9B 1CF8H 5TE7H 2PYFA 3MV01 3EYSH 5FCSH 2BSSB 5IQ9B 4OGAC 4NBXB 4YC2C 5EORL 3EAKA 1UH2A 3EHBD 4KJQC 2NLJA 5I76A 1S3KL 1A7RH 3GSWA 5L9DL 4TNVF 3CLFL 4F9LA 3ULUE 1T7WA 3CIQA 3ESUF 3C2AL 3O2VH 2X89A 4PJGA 2I24N 3UDWA 1ORQA 2WINA 2DLGA 5IVNA 4R7NA 5A2FA 3DX9B 1GGBH 4NN6B 3EOYG 4NSKA 2DQEH 2VZ3A 1DFBH 4Q9QH 5FB8A 3NIGF 1P6FA 3QCVL 5HHXL 4HPOL 3PWPA 2ZSWB 1AC0A 4F33A 2FLBT 5C0FB 2CK0L 1EEYB 1I7RA 3JTTB 3MRBB 5C6WH 4W6XB 1MVUA 5JW4M 3DV6A 3T1FA 3TV3L 4IHOA 1EEQA 4OM1H 2ZJSL 2J3SA 2YZ1A 1AXIB 1QVOA 3CDFA 2COQA 3AVEA 5FGBC 2Q7NA 2VR5A 3M45A 1I9IH 3HAEG 1QFHA 3RWCA 2QV2A 3RWFA 4WW2C 1AR2A 3MRMB 4PD4J 4WV1A 4R2GD 5KSBA 1G7LA 2Y7QA 3UTQB 1KG0A 4EUPH 1OP9A 4O02H 3LQZA 1R5IB 1UJ3C 3D85A 2VKXA 2YS4A 5DYOB 3RTQC 3FO0L 1OM3H 5IW1A 4JFDA 4JFEB 4PTTB 3MC0A 4WDIB 1XH3A 1MFCL 5IWLA 5IB4A 1NDGA 3MRPA 1KNOB 3QDGA 3JWOL 4OD3H 1DQML 1K3ZA 2MTPA 3S88H 1CG9A 1Q1JL 1X7QA 5IV2B 4QLRA 5GJTH 2CDGA 1L0YA 1MI5B 3TO4C 2VDPH 4Z5RB 3O0RL 3BHBA 5I1HL 4APQA 3R1GH 3ZKQD 1KN4H 4K23L 1S7SB 5T1LB 4HDIA 4GRWB 1MCEA 4B7LA 4F15B 2KQNA 2IPTL 5GGVY 4RFEB 4EXPX 1IT9H 4AEIL 3TT3H 4OAWA 5CGMA 2X7LA 1G9NC 4YDIH 4WW1A 2H26B 4U6VH 4OZ4B 4R4FH 1BEYL 1C7TA 1V05A 2R4RL 1AP2B 1K4CB 5J4MA 3BH9B 5CJBA 2C3WA 3CX2A 2P47B 5TE6L 4AG4L 5I9QC 4XPAH 1JK8B 1GHFH 1MCPL 1KCRL 1N8ZA 2XZAL 2QHLA 5D1ZD 2AAVA 4JKLA 5D7JD 3EHBC 1AGFA 2C3VB 5HGDA 2EXWD 5HVGB 4E41B 1A8JH 3IGAB 1KB5H 3T1WA 1JMZA 2J8UF 2RQ8A 4UQ3B 1QFWL 3UCRA 4P2YA 1A9EA 4ZSOE 3QUYA 3FOLA 4HK0B 1J1PH 5GGRA 3C9NB 1QLEL 5IMMB 3EBAA 4FTVE 5INCA 3V8CA 5GGRY 2B1AH 2AJZB 3BKCH 4OF5A 1SJHB 4D9RD 2H9GA 1FP5A 3L3HB 2BNRE 1OSPH 4XCEB 1ONQB 4XTRD 1DJSA 5IUSA 3T0BA 5DHYB 1PY4A 5KANI 2XQBH 3F8UB 5DUPH 1LNUA 4LSPL 4EI5A 1YEFH 4OCSH 4QRUA 2VL5A 5HHQB 2VC2L 1ZEAL 5D72H 5F97E 5C07A 1A64A 1F8TH 4IDJL 4ZODA 4XXDA 4N8CH 4R2GC 3U2SA 3VFSB 4H26A 3SE9H 3HI5H 3CMOL 2ZNXA 3V52L 2ZSVB 3D69B 1JFQL 5IMKB 1CBVH 1EXUB 3GSRB 4ZFOB 1VEPA 4OLVH 1J5OL 3ARGB 3T8XB 2V2WA 4OKDA 4Z7UA 4E5XB 2Z8WC 1HQRA 4G7YL 1ES0B 1WTGT 4DW2L 2F19H 4O2FB 2IBZY 1A5FL 5HHME 4Q6IC 2HG5B 1IQWL 1I1FA 2PXYA 3NA4A 3FCTB 5DXWA 5AAWA 3FO2A 3KLAB 1SEQH 1ZT7A 4YQXH 4WI3A 2FJHB 5J9PA 2ZOKA 5FIEA 4ODXB 1DVFA 4XAWH 4GXVL 4XWGL 3VXNA 4N0UB 2A83B 5DUMH 3QHFL 4ZUVB 2YPLB 2CJUL 4LF3A 3SE3C 5JW4N 2BC4A 1RUKL 1NCBH 4NP4H 2HFTA 1F6LL 4P5TC 5T5NF 5CKGA 5IROA 3GO1H 4XNMB 3TA3A 1J86A 2BRQA 3RDTB 5EU6B 2F5AL 4NO0B 1HWGB 5FYJH 2AJYL 4LLDA 4BQ6A 1CD1A 4G3YH 4KROB 4NQVA 4ODUB 4DN4H 2AS5M 2AI0L 4MHHI 2QEJA 4HXAL 5SV4A 5ID0B 1I4FA 2HVJB 4JKMA 5B39A 5C0GB 1ZGLP 1AXTH 1KB5B 2CLRB 4WWKA 3HE7D 2NY5H 4YBQD 2DQJL 3STBA 4NRXB 3OB0H 3DYPA 4TPRL 2DWDB 4BFGA 1JTPA 2EXWC 3JWDH 2DJSA 5FUZL 4OI8A 3V0WL 2VZVA 4ONOA 4Z18A 3N85L 2A6KA 3QWQB 1DQLH 3HZKB 1S7RA 1E6JL 3CFBB 5HBBA 4D2NA 5DJ8A 5MENE 3MYJA 2MCG1 3VH8G 1RJCA 4R97B 2BHUA 1P7QA 1YC8A 2CIKA 4Y7MA 1TZHB 1A47A 4HLJA 4X0KA 1FCCA 3FTGB 1BQLL 1UZ8A 3MV11 1XCTA 2WUBH 1WCBA 3GKWL 4LSDA 3QIBA 1E4WH 2C4FU 4XTRC 3ZDZE 1A3LL 5C09D 2F54A 4PR5A 4U3CA 2VDMH 1EGJH 1QRNE 1KOAA 1LO4H 3QUXA 4H88L 3OGCA 1T0MB 4BH7B 1AQKH 1JPSH 3DMMD 3CJJA 3QWOB 1FIGH 5EUOB 4HS8L 3DXAE 3DVNA 3NCJH 3HC0B 4CU7A 2R4SL 2FH8A 2FX9L 3D3VE 1R3HB 4YX2L 1YN7B 1T03H 4Q9BA 5E70A 1S9YB 4JM2B 4MAYC 5I1JH 1TFHA 4JM4H 3B9DA 3C08H 2ATPA 1CLOH 2OBGA 5B3JF 1WEJH 2FIKB 4MMXC 3OKEB 1NUNB 4AMKL 4XNYL 4Y2DA 4U1SB 2N4IA 1CXLA 3THML 1SHMA 1JPGB 4WFFD 4D0CA 5EH1A 3W9EB 1NSNL 1NCNA 5JHDD 1UKQA 4A6YH 3ROLB 5BW7C 3GBMH 1Y18A 2R9HD 3CK0H 3ZKSD 1S7QB 2VDNH 1RUAL 4G8GD 5DUBA 3PUCA 5EORH 3NAAL 3S5LA 3WNKA 5GISL 1S3KH 3D6GA 1C5DB 5L9DH 1EJOL 3CLFH 4MCZA 1IM3B 3C2AH 3UPRB 5F1IB 2J7LA 2HVKB 3W5NA 2ZOLA 3BFOA 1DANT 2X4TA 4ZUUA 2J8UB 3V4VL 2IANE 3QWRA 3W0WA 5AAMA 3RVTC 4OCRL 5KS9A 5MEOA 1CQKA 1UACL 1NDMB 3PWVB 2R1WB 1BJ1J 5HHXH 4UDUA 3RKPA 4HPOH 4QYOA 5HI5D 3D0VB 3HE7C 1UG9A 4YBQC 1OQXA 4Y5XC 4J2XA 4OZHF 2C7UB 3VFOB 2VLRE 4N0RA 3TCXA 3BPNC 2R2EA 4OQTA 3MRNB 5IP4A 1B0RA 3SGEH 2YD4A 3TV3H 1G9ML 2ZJSH 3L5WA 3NZ8B 3OKOB 1VA9A 1WISA 1XGUB 1JGLL 2VLLA 3DRQA 3KPQB 3KPOA 5JTWA 1IL1B 4AIOA 3BAEH 4LCWB 4TNWF 4ODTL 5CGTA 2EC9U 1CIUA 3ZKND 1NUGA 3FO0H 4QOKE 5BZDB 2XY2A 2IH1A 1QLRA 3P4NA 1MAML 3MRGA 3CVHA 1U0QA 5CLWA 1QPPA 5BOZG 1OD9A 4WEBL 4XBEL 1JTOA 1MFCH 1DE4B 1G7QA 3ARBB 2D0FA 1AHWC 5FHBL 3JWOH 4YBLC 1DQMH 1Q1JH 4LNRB 4P46D 1KTRL 5CEYA 4XVJL 1XMWA 3AREB 2ID5A 3DMMC 3LKQA 4NT6A 3O0RH 3MBEA 3DBXA 3RGVA 4FQLL 3MV8E 3DUUA 4KGJA 5I1HH 1T7YA 4K23H 5I8CA 1FFNB 5F70A 3BGAA 1B4RA 4LLQA 4OIAA 4U1LA 5I1LA 1W0WA 2ADJA 5TDPA 2GTZA 2IPTH 4P0DA 4AIZA 4AEIH 4ZD3L 5IHLB 2BNQD 5KSAA 4L8SA 4NUJB 5TDNB 3ETBF 4PJEE 1XR9A 3ZKXB 4D3CL 1ORSA 3TYGL 4RRPG 3V0AC 1BEYH 1A6TB 1MCRA 2GSIB 2DS4A 2R4RH 1GGIL 2CQVA 2R9HC 1XGTB 4AG4H 5TE6H 3P4OB 4FNLL 3RWEB 1MCPH 1KCRH 2WSKA 2XZAH 4KPHL 5DQ9B 2E6PA 2A6IB 2AJUL 1PSKH 4KC3B 3DUSB 5JZ7D 3FO9A 1OGAA 5CJXC 1UXSB 3EO1A 4OFIA 1ZGLM 1E28A 2APFA 5DLML 1T1ZA 2HJFA 3VFVB 2X09A 3WDIA 4GMSL 2MCPL 1QFWH 3LD8C 4HULB 4RFNB 4KI5F 3V6FB 3L7EA 3PIQA 5IJKC 3JV5A 1QLEH 2Q7YA 4RSVA 2EDDA 1YEJL 1IEBA 2B2XL 2I9LB 3FQUA 5KG9A 3U83A 3EYVB 4JHWL 3DO7A 2P8MA 5HI5C 3QUMB 5D1QD 3RL1B 2W0KA 4LVNC 2ZUUA 3CPLA 4Y19D 4MNQA 1UVQB 5M7QA 4KHXL 4XVSH 1KEML 5CBAA 2E9BA 1A7BA 4LSPH 3DV4A 5J6HB 1NGXA 1DDHB 3BPOC 2VC2H 4OLYH 3E8UH 1ZEAH 1II4E 1HXMA 5DRZA 3B4NA 4PP2A 2VRAA 2I9TA 1YEDB 4S1DD 3VGHA 1NANH 5C6PB 2APWA 3KYMA 3OKKB 3CMOH 5IW3A 2F53A 2UWEA 3V52H 1WUNT 3GUTA 2HA1A 4GG6A 4TVPE 3VFMB 5D9SB 2MKWA 2VR4A 4PRBA 5D6DC 4HUVA 5DRWB 1AGBB 2P1YA 4N8VG 5FKAB 4NQSA 5FYJD 1J5OH 5C92A 4OV5B 1IBGL 3VXSB 4G7YH 3C5ZC 1CCZA 4HCRL 4Q58C 3VD5A 4DW2H 5L2JA 4PREA 4PJBB 3FB7A 4C57C 1CGXA 4NKOB 3UTTB 5GGTH 1IQWH 5D7SL 5CSZB 4PJGF 1MIML 4P46C 3MLPA 1FDLL 4MB5A 2H2PD 4MJIB 3W9DA 5IB1A 4N5ED 4O2EA 5F72S 1IGJA 4XWGH 4QTIL 5EDXA 4OZFG 1MAKA 3QHFH 2CJUH 3MROB 1RUKH 4JB9L 1DBKL 5SWQB 3DROB 3FQNA 3BXNA 4UV4L 5HD8D 3X11A 4X6EB 3MZGB 5DA0B 1ACYL 2AV1A 3CVIL 3AS0A 3IJYA 1D9KC 3ZSSA 1TVBB 4KMLB 4ODHL 2F5AH 3HS0B 3V5KB 3VWKB 3QJHA 3MUY1 2AJYH 1LO5A 3HUJA 3FHAA 3FONB 4GOSA 2AI0H 5ALBL 4LLYA 4HXAH 1AD9B 1OCWL 3E0GA 4P2QB 5ISZD 5KSBF 4NYLB 5DI8B 3AMLA 2DQJH 1ZOXA 3IFOB 3SDXE 1EO8L 3O4OB 5E5MA 1NUFA 2X9YA 4TPRH 2OK0L 4ODVL 4UAOC 3EGSB 3TVMD 4EKXA 5JZ7C 5FUZH 3GIZL 4ZXBB 3V0WH 2D7NA 4FXKB 3N85H 4GKZA 4P2OD 2WUCL 4YHYC 5BXFA 1MHCA 1E6JH 5HGHA 1T0NB 3HCVA 2CUHA 3DGCR 3K46A 2VUYA 1DEEA 3AROA 2PTTB 4XBPB 3WD5L 4PJIA 1I85C 1ETZB 2OLDA 4KAQL 1V3JA 3QH3B 5GJSL 2GY5A 1A3QA 1CT8A