3VW3L

Antibody 64m-5 fab in complex with a double-stranded dna (6-4) photoproduct
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
215
structure length
215
Chain Sequence
VLMTQTPLSLPVSLGDQASISCRSSQNIVHSNGYTYLEWYLQKPGQSPKLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFRGSHVPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a double-stranded DNA (6-4) photoproduct in complex with the 64M-5 antibody Fab
pubmed doi rcsb
molecule tags Immune system/dna
molecule keywords Anti-(6-4) photoproduct antibody 64M-5 Fab (light chain)
total genus 42
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2012-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vw3L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vw3L01
1I7TA 5JORB 4F37K 1C5CL 4NCC1 4GW5B 3FQNA 4XC1H 1LMKA 3KPQB 3IDJA 4J3XA 1N26A 2XWTB 2BVTA 5C0AA 1NFIA 5LWYL 4YH6A 4F37F 3G08B 2FB4L 4Q9BA 4MJIB 1FG9C 4U1KA 5C86A 5HHME 3EJZC 3V6OA 4R3SB 3S34L 1JF6A 4ZAKA 3DXAA 1N6UA 1BAFH 3OKMB 4D94A 5J13B 4MB3A 5KS9A 1DEEB 3S36L 2CK0H 4X6DB 4NSKA 5IVOA 4JCMA 1D6EB 4M48H 5FOBA 4L3CB 4MLIA 4WNQA 1JTTA 4AQOA 4Q74A 2HVJB 3H7BB 2G75B 4YIQA 5DGRA 3VH8B 5GJTL 1HHHB 2B7DT 1D3CA 2VJXA 4PR5A 5C0DA 5MENE 4WO4A 4AY0A 3QEUB 5FHBH 4DKEH 3IDXL 3SPVB 1OAQH 2EDEA 1DFBL 1N59A 1G6VK 4MB4A 1OF2B 1NAML 3WXWH 4N0YH 3MV8E 3ULVD 3HI1A 1FQ9C 4BH7A 3RWDB 1MH5B 3MROA 5FCUL 4M02A 4JO3L 4PG2C 5EU7E 4RMUA 4YXHH 3ZYOA 4K9EC 4K23L 5CJQL 3QUMA 4DAGL 4P2QB 3P9LA 4L4VB 2RCSL 5C0AD 5CJXA 3VXMD 4LEXH 3MRBB 1XIWA 4Y2DB 4PJ9D 5KSAD 5IFAH 4Z7NE 3JTSA 3B6SA 3QNXB 1Y0LB 1E28B 1M7IA 3GSXB 3ARUA 1ZT7B 3ZTJG 4YHLL 1DE4A 3CH1B 1INEH 1QP1A 4OKDA 3QQ9D 4QYOB 2F58H 3V52L 1O5DT 5A2FA 4HW6A 1W0WB 4PJAE 1ZT4A 1KCRH 4GG8B 2BY3A 4KVCL 3UTTA 4GLRH 1A7OH 3QFDA 4G9DA 1GC1C 3MYJB 4MLSA 4OB5H 3TVMD 1KJMB 1CD1B 2N7AA 4IRJB 4NUJB 1JZ3A 4TNVK 3LQZB 2XKSA 5F9JB 3EOAA 1A4JA 5FF6A 2VLJA 4X4MA 4RMWA 3RY6C 3V2AR 3AGVA 3LIZL 3BEVB 3RTQB 3ULVH 4PV9A 3QEHB 2HLAB 2Y72A 2QLVB 1CICB 3BH8B 3FO9B 3BO8A 4ZTPH 3PQYD 3P30H 2XN9E 4PRIB 3WEXB 2P44B 5HHXH 4P3DA 4P2QD 3S37L 5E4EC 3M17B 1FO0A 4JRYE 5FYJD 1PX3A 3ZE1F 3M8OL 3MJ7A 4Z76A 3U7AA 5IB5B 3U82B 2HVKB 1IZKA 1HEZA 1T03L 4LCUB 1EZVX 2WUBH 4PJBF 2I27N 5IMLB 4NDMA 4P5TD 5CD5C 1HYSD 1RZFL 1R5VB 1U9KA 4JRYA 5DJ6B 4HS3A 1KIPA 2HMID 4OKVB 2J12B 3Q6GH 4K7PH 3STLB 3WE6A 4AENB 4JM2A 3PWJA 1K2DA 1QSFD 3BT2H 3PHQA 2C3VB 3GBML 5EPMB 3EYUL 4WTXA 3QUXA 5GRWA 2Y07L 2ZCLL 3QO1B 4U7SA 1P4BL 2IH1B 3TIDA 2XQYG 1JHKH 3OWEA 5BJTB 3ULVE 2J5LC 2QSCL 2I9LA 4LP5A 4U1IB 1AIFB 1G9NC 2A2QT 2XICA 4NRZB 3TLRA 1CFVH 3BD4A 3BZDA 4HLZG 2C1OA 1MQKL 3E0GA 2GJ6D 2MQ3A 1LO4H 2NR6D 3K4AA 4Q2ZA 1FYTA 1J0ZA 3KNBB 4GMTH 4OCRH 3U4AA 4UIKH 5DJXA 5E2TH 1MRFL 4KI5C 2DYPA 2X2YA 1SYSA 4ODVH 1I1AA 4LLMA 2LABA 1LP9E 1JV5B 3MMEB 5L8JB 5LQBL 3I02A 1DN0A 4MMXC 1A1NB 1Z2KA 2Z93A 4MQTB 2EEDA 2XG5A 3SKMA 2NY6D 5LGHH 2JTDA 1T0MB 2CLVB 2ZKHL 4I77H 4OGXL 4FXGA 3MV8A 4KK9D 4OT1L 5EBWA 3AS1A 3PWLB 2MMXA 3FTGA 3UTZA 3VFMB 1J0HA 3O3BA 5FYKL 3C6LA 4FABL 4KXZH 3P9MB 1FG2A 5EULV 4PJXF 4U6XA 3C60A 4PJXB 2NX5A 5DD1L 5DGQA 3HKFA 2CLVA 5IJKA 1N5YL 2IJ0C 2PTTA 3D39B 2OP4H 3KPMB 1Q9OA 2NY5L 5T5NG 3MV9A 2HH0L 3V6ZB 5MHSD 4QHNA 4DVBA 3KPSB 1UB6A 1UWXK 4XPBL 1UFUA 3GSRA 5BQ7B 1D5IL 1EV2E 4M9OA 3MNWB 2CRMA 4WCYH 5FUZL 5ALCH 1FLTX 2XTJE 4ERSL 2D9CA 2R2HA 1QLEH 4Z7WB 5DJAB 1AQDA 4EXPX 5MHSE 4QRPD 5GRJH 1SYVA 1X4YA 2OI9C 2HG5A 4MXQD 1PBYA 2DM3A 1ZHKA 1MLBA 3QH3B 5FM8A 4D8PA 3NIDF 4ZUVB 4QO1A 1MCSA 2ORBH 1JPTH 2Y7QB 3B5HA 4YX2H 1X5LA 2OYPA 4LLQA 2RJMA 4ZDHB 1MRCL 2VH5L 4HMDA 2VZSA 2XWJB 4KKCD 1A6UH 2GSGA 4L8BA 3MPCA 3D1MC 3HC3H 3UTZB 3SDDB 3IDYC 1X44A 1ZANL 4GXUM 1F6FB 4IIQB 1KC5L 2W07A 4MXQC 4ONGH 1G0DA 3HG1B 2Z92A 4H20L 4X99A 3TT3L 1F4AA 3UTQA 4L4JA 4K9EL 1YJDH 5DK0A 4IOIB 3H6JA 2IPTH 1F3DJ 1UCBH 1F4YH 4XRCA 2QSCH 3HE6C 4DOHB 1JGVL 4RDQF 1EO5A 3QHFL 2DLHA 5I16A 1IC5H 3ZHLA 3KYKL 5DJZB 3VXOB 5F93C 5J11B 4P4KD 2A83A 2YK1L 3EUUA 4UBDD 1YMHB 4DFIA 4RFNC 3ARBA 4GKNB 4M6NL 4PLJD 4ZS7H 5F72S 3VW3H 1YEKL 4M6ML 4JGJA 2B5IB 2QQLH 4G6ML 2NYYC 4G6AD 3MRDA 2RB8A 5TE4L 1V05A 4K7PY 4QRUA 5E95B 5SWZD 3S6CA 1KNOB 5EUOE 5EBMA 1LO3H 3T1WA 2W0PA 5HGHA 1EFXB 3TO2B 2V5RA 4P2OD 1ZTXL 1EGJH 3O4OC 3OB0K 1U2CA 1S7QB 3ZT5A 1BAFL 2XXCB 2DDQH 2H2SD 3F12A 4I9WD 4EEEA 5E03A 1HCFX 4PB0L 4G7YH 3ZE0F 4G6JL 1SVZA 4I48A 4GRLB 2MCG1 1WBZA 3L3JB 5GJTH 1KT2B 4BH7B 1JPFB 1DVFD 2VQ1B 5BMFL 1MJJB 4Z7UE 3V0AC 3SPVA 3CSYB 3FO0L 4XNUL 4LHUG 4LFHG 4JFDB 5DDHA 2H2PC 2W92A 5FYJE 2E7MA 4Y5XC 5EO9A 3KPRA 1D6VL 1XF2A 2H3NA 1II4E 3QO0A 1T5XB 3I85A 4EI6A 2Y6SC 4Z7NF 3JV0A 1P2CB 1MJJA 4LSVH 4ELME 3IF1B 1MQKH 3REVA 1IC4H 1U8JB 4UDTB 5CKGA 2MOVA 3G6AA 2CRYA 1A6AA 5J11C 5BZWB 1I8KB 4IRSB 1HHIB 4G8GE 3T0AA 4DWHA 2BNRD 1HZHL 3V6BR 4QWWD 4YAQA 3KS0J 3WNKA 4FMFA 4PRAB 2XZZA 3L6FA 2WBJC 5F3BA 4DN4H 1J11A 2XNAB 5IJVB 4QHLB 5FHBL 4X9GA 4NO2A 3UZVB 5CEZE 3QI9C 5CBEB 2LU3A 2EYTA 3FMGH 2W60A 1BGXL 1HHHA 2P49B 3EO9H 1DBKH 5D1QB 4F7TB 1NGQH 4M1DH 3OAZK 4RWYL 5DJCB 5J3HC 2VZTA 1BLNA 1X5HA 2YN3A 3Q6FB 1CLCA 4NQVA 3EHBD 3IDJB 4O5LL 5DJ8A 3QNYB 3LKNA 5D7JC 3VXUA 4CVWA 4YK4C 2YRZA 4ZXBB 1BBDL 2NLJB 3MRCA 1PZ5B 5CGYD 4UDUA 4OF3A 3KYKH 3CFJB 3GIVB 3C8KA 4LOUD 3SGJA 1P5UA 3H3KA 5LG1A 2DRUA 1KENH 1I8IB 2NY2B 3IDMB 1M7DA 4FZ8H 5DR5L 1ORQA 4Z0BL 5KS9E 2NY5H 3CZFB 5DHYB 5I1LA 4G8EB 2CKBA 3MLYH 3HUJF 3D3VA 4DK3A 4ZFOL 1CQKA 3TNMA 1H5BA 1RUML 3O2WH 5I9QB 1G7JB 3QCUL 3GEWB 4L8DA 5FYKH 4R0LB 2O61B 1X6LA 2FHFA 4PJEE 3ULUF 4UT9H 3DETC 1G9MH 4TPRH 5BCAA 1F4YL 4WFEE 4WFGE 4YX2L 1JCKA 2NY6C 3SJVD 1BZ7A 3ZKNC 5FK9A 2R1XB 3I02B 5CZXD 3L5XH 2OXGA 4ZFGL 4FFWD 5BOZG 1Q0XL 3NN8A 3HCVA 4N0FB 4UV4H 5IEHA 3SDAD 1KFAH 4Q58C 1MWAH 3R8QA 4M61A 1G1CA 3VI4E 5FB8B 4NQUA 5IQ9B 4V2CB 2A6KB 4YBLC 3RP1A 5F21B 4TNWK 2IPUK 5C09B 2KDGA 1JHLH 3O6FC 2BSTB 1AGFA 3RWEB 2LVCA 2NY1C 3BVNB 4Y2OA 2DQCL 1KCSH 5DC9B 5I73C 5D7IE 2P8MA 1MVUA 1Q38A 4P3WA 3V6ZA 5L7XH 1BPVA 5C6PB 3MXVH 4PRID 3ALWA 5FYJU 4FFWC 3HNSH 4PJGF 4PJDE 3MLPA 1N0XL 1HK6A 3QBTB 2OTPA 1M05A 2VDNL 5IGXH 4OD1L 1A7PL 1Z6JT 3G5YA 3LKSA 2EEAA 4PJ7A 1P7HL 4OCWH 5DD0H 3IFLH 2FL5B 4PRPE 4M7JH 2H26A 3DNKA 4JFPB 5EO1B 1M1SA 4PV9B 4NSKB 2XY2A 1Z9LA 2IADA 1IEBB 4X7CC 2AJSH 4A6YH 5IW3A 4HEME 4TTDD 1RIHH 2FBJL 1U92A 2VDLL 4BSVB 4UDUB 3VXRE 2OZ4L 2PYED 1MCKA 4U6YB 4Z0XB 1AQKH 1FFPB 4ZOBA 3NH7L 5E0QA 4UQ3A 2ICES 3FONA 4GRWE 2HKHL 5FYLH 2IFFL 1GH7A 1GOGA 1BQLL 2D7QA 1B88A 4XBGB 2D7TL 3V95A 3X13B 3O3EA 3BPOC 3WMSA 4ZS7L 1VKXB 5ESVA 5KZCB 3FO9A 2QHLA 1PEZA 4AIZA 3UJJH 1BM3L 1FIGH 5LVEA 1T80A 5DUBB 5EO0A 2AEWA 4L8DB 1SBSH 4P5TC 1AGEA 2FLBT 3QDME 3ULVF 1WBXA 5DTFA 1MFBH 1MELA 2X4RB 1IM3A 1WFUA 3K1KC 1R0AH 2EZ0D 2V5MA 4YHMH 1IAKB 2VB5A 1QSFE 3PL6A 5D7SL 5DSCA 5GSRA 3A67H 1YN6B 4I0PA 2WIIA 4L4VD 3HZYB 5IMOB 3HE6A 2HTKD 2V5TA 4OIBA 1H3XA 3G6JA 2IG2L 5AD0A 5CEXB 4HF5H 3FT3A 6CGTA 1ACYH 2DWEB 4LSRH 1E6JL 4UV7L 4NFCA 3BGMA 3TIEA 5ID1A 4RGOH 3I6KA 4HPOH 1ED3B 4U33A 4Y5VB 2R23A 4KH2A 4HFWB 1MI5A 3WL9A 4PP1D 4ODWA 4XBPB 5D93C 2NY2D 3U2SB 1A3QA 1KTRL 1QFWH 2CPCA 3CFKB 4RISL 2H2PD 3RRQA 3HR6A 4M00A 4BA8A 5FDYA 4G8FA 5DVKA 5KAQF 1UT9A 3QJFB 4FHBD 4Z9KB 1HWGB 3GGWB 3DRQB 5HI5D 1R6VA 5BV7H 1E4XL 1QFUL 2GAZA 2DQEH 4OCNC 1EO8H 3P11L 4XCEA 3LMJL 3OQ3B 2Z9TA 1JWMA 2X05A 4M6AA 4ENED 4QEGA 4P57B 5C07D 4JQIH 3AMLA 5I76A 1QYGL 5IG7B 3JWDC 2IGFL 4IS6B 1M71B 2VQTA 3CFEA 1U8OB 1U36A 1XR9B 3U46A 2CJUL 4NZUH 3PWUA 2VN4A 3KJ4B 1JL8A 1SEQL 2DI8A 1F58H 3ZKMD 2V17H 5HYJE 2GSIA 1CDYA 3DMMA 4PRBB 4YHIA 1ZLSL 4PJBA 5TPWH 3OZ9H 3QDGE 4N9OB 4ZO8A 5E24E 3HTLX 5AUMB 1FL6A 5IK3B 4EOWL 4NZTH 4JKPL 1NCAH 1OGAD 3SBWC 4Z0BH 1SYVB 4AIXA 3VXMB 3MLTA 4BSVA 3IF1A 4PJ8C 5CILL 1CGTA 4UILH 4XWGL 5IW6A 1S9YB 2W9LA 1TENA 4YHYC 1Q9OB 1NBYB 2JELL 1AFVH 4PGDA 2FJHB 4M7LT 3QUMH 3O8XD 5T1KD 1MCRA 1ZLVK 2MHAA 5GSVA 2DQFA 5I1JL 3TBVB 1B4JL 3CDFA 3B2VH 2R8SH 4H1LG 3IDIB 2C4FT 3BPOB 4N5UA 3UZQA 1ACZA 1BEYL 4M5YL 4Y5YA 1YEEH 3VFVA 3S35H 4QRTA 5IF0A 2A74A 4KVNH 5I1DA 5E9DB 5IB1B 2EYTB 3RY4A 2BNRB 4WWKA 3ZKQD 4ZD3H 3CH1A 3SCMC 4UT9L 1HH9A 2MQ0A 4HPYL 3HMXA 4OCXH 5I71C 1FRGL 2WP3O 3MBXH 4YQXH 3DXAB 4OFIA 4UT6L 3IDXH 4EN3C 4LEXL 3MRNB 1TZIB 1ONQB 3KXFB 4OLZH 2VXUH 3HI5L 4NZRH 3NPZB 5DQ9A 1NGWB 3HC4L 5SWZB 1I1FB 4IMLB 1VFAA 1IC4L 1T21B 3LPGA 1CGUA 5EZLA 4EUPB 3IVKB 4P4KC 5F7FA 3GDBA 2YHGA 3OR7B 1N7ML 3BSZL 3WN5A 1N59B 4PJAA 5CSZB 2RR3A 1WC7B 4JFED 4S1RH 3VFSB 4HWEH 2J88H 1CCZA 4XNQA 3MACH 3NCBB 5IVXE 4CNIA 1IGJB 1R3HA 4G5ZH 3TA3B 1A1NA 2Z93B 4JZNA 5EU4B 5DRNB 4HMCA 1ZGLM 3SDXF 4JY4A 5J6HB 3D0LA 2GITB 5JW3H 1HKFA 3QIBA 2AJ3A 3QCUH 3V5HA 2FBJH 3H0TB 2D4DA 3MRHA 3TA3A 1I9JH 5AUMA 2YWZA 4V1DA 4N68A 1OARH 2BZDA 5CUSL 3SCMB 3LZFH 1ZHBB 2RCSH 3MOAL 1EA9C 4Q97A 4CADA 3CVHB 1MCLA 2R1YB 4G43A 3HNTL 2B1AH 1A6ZA 4MA7H 4X98B 3D0VB 5C08B 3ULSA 4JO2H 2FIRT 5DJAA 1I7ZA 2F15A 1DFBH 2LFGA 5HHQB 5C8JA 4HJJL 5IWLA 4JREC 1TCRA 3QCTH 4NQCB 4PJ8B 1ZOXA 3BH9A 1SEBB 1L7TL 3BH8A 3VFPB 1J12A 4OZFA 3CX5K 5B22A 1V3JA 4Z6AT 5LGJB 5TH2B 4I3SL 1TTUA 1YC8A 3PGCA 1Z0MA 4UAOB 4NQCA 1ADQH 1NLBL 3VGAB 4GO6B 3LIZH 3DURA 4FS0A 4HX1B 2DBLL 1DBML 3W39B 1KYOJ 5F44A 2APVA 2DM4A 2YUXA 4XPAL 3OHXA 4ETYA 1FJ1B 4JN2B 4E42A 2G5BA 2CJUH 3ARSA 1BQHG 4S1SH 4KQ4H 5DRXA 5IMKA 3TBWA 4G7VH 3T0BA 1A6PA 4RCAA 4X8JB 3FFCB 1EBAA 4Z95H 3TT1L 4OUOA 2X9YA 1VEPA 4I4WA 3MLZL 2CDFA 1A9EA 1B4JH 4GBXC 2BNQA 2CDEB 5T3ZE 3B9AA 5DQDL 3ECBB 4MWFA 3TESA 2ZUQC 3EZ8A 4YXLH 3I50L 3RWDA 2OXHA 1OTTD 4HXAH 3SQBA 3VFTB 3QUKB 4OCSL 2A77H 5JZ7C 4KK9C 4KRNA 4MA8H 4PJFB 5C3TA 1AY1L 3LRSB 3TN0B 1D9KA 4NO3B 1W0VB 2CGRL 1LO0H 4EIGB 1HKLH 3QJHA 5FKPB 3O3EB 3VI3E 3VW3L 2MFNA 3T3ME 2I60L 1JP5A 1A6TA 4I0PC 4ENEC 5GHWH 5D70H 1U8LB 4GS7B 4DKFL 4W70A 1J18A 3RHWF 5EC1B 4OZHB 1DSFL 3ZO0A 4P23A 3VWKA 2EH7L 1AXIB 5DLML 2E7BA 4MNGB 3HLAB 2WQ8A 2GYSA 4LLMB 4LFHD 2JJVA 1AXSA 4IJ3C 2IMMA 3ZTJH 2QADB 1FN4A 5DJDB 1G7QB 4AMKL 5JIIA 4LLWA 4PB0H 2BNUB 2DTML 2CUMA 5F1IB 3PF2A 1BFVL 2X4OB 2YZ8A 2VLKA 1A9EB 4NPYB 1G0XA 4I0PD 2AV7B 1MJ7L 3VRIB 2UYLB 4EQ3A 4FQJL 2VH5H 2OTWA 2PKDA 3P4MA 4NZUL 5SWSD 5CILH 1IGML 1MI5B 2X10A 3O6KH 2OZ4A 3KPRD 5IM7A 4E5XB 3QWRA 1EEQA 4ZFOB 5D1QA 2XQBH 1V3KA 4QRSB 3VFOA 1K4DB 3GB7B 2R8SL 4OLXL 5HDBF 4ZUSA 2EO1A 4X8XA 4NHUB 2Q7YA 1NMBH 1YYLH 3AVEA 4GQPH 2YXMA 5F3BB 4GW4B 3E8UL 1A7BA 3G5VA 1ZS8A 1S9VA 3HPJA 1DQQB 5J0BA 5D1ZC 2P8PA 2V2WB 3CDYA 1H3PL 3GMMA 3M1BB 5D7KE 1EXUB 4XPBH 5GIRA 3PDDA 3CLFL 3O41A 1MLBB 3QH3A 2RFXB 1I1RA 1V3LA 3QCVL 5CIPA 3D25B 2BX5A 1E27A 4MJ2A 4ONGL 4KQ3L 3LKRB 5I15H 3B3IB 1WWCA 4NGHL 5LBSL 4HMEA 3ZE2E 4WFHE 1RD6A 4G6AC 1KCVH 2ITCB 3MJ9L 4ZODA 3VXUB 1AD0A 4PJ9B 5SX4I 1JN6B 4OIAA 2JJUA 3I2CH 2F53D 4ERSH 5JXED 4OFVA 3GKWH 4CVUA 3I3DA 5IV2A 1BVKA 3U1SL 2FATH 4ZD3L 2FX8L 1MLCA 3HZKA 4JJ5A 1ES0A 2ZOLA 1X3DA 5KSBE 4UQ2B 5GRVL 4JANA 1AH1A 3T3PE 3ZKXC 3TVMB 1FORH 2B1HL 3SGEI 5FV2A 3CDGB 3H2WA 2VSDA 4WUKH 3U83A 4NHCL 4DGVH 1KJ3H 3OKMA 3BGAA 4CAGA 4HUMB 2BY2A 1OSPH 3EDJA 1XGQA 2EECA 3ARFC 1T0NB 3T4YB 1U8PB 2F8VA 3UJTH 3TT1H 4R7DA 2I5YH 1Q9KA 3VFSA 1K6QH 4OQTH 3N1MC 2EDJA 3MFFB 3IFPB 4PRDB 3BAEH 5EFIB 4F80A 4EOWH 4GRWF 5E08H 1U95B 1VGEL 35C8H 2R23B 4OD3L 4KMQA 1BF2A 1QPPA 3U6RA 1WQVT 1FSKB 4MNQE 3QUYA 4XVUD 4QF1B 1DBMH 5C09A 2VLLB 1BFVH 2EDYA 5K59E 3SDAA 3VFNA 2YBRA 3BP4A 2V7NA 1DQDL 2N1KA 4OF0A 3F7YB 5E5UB 1UB6B 4FFYH 3T2NL 4Y88A 3WHE1 4WRLA 3O6KL 4B50A 3HC0A 3FQNB 3LS5L 4J4PC 4XNQB 1OP9A 4P4RA 2V7NB 1NMAH 3UEZA 2Z35B 1CDCA 1RK1A 1FGNL 4I5BB 3VFRB 1QNZH 2NZ9C 1VKXA 5BVPL 2PYEB 1C08B 2CDGA 2FO4A 3T0WA 4HGMA 1N3NB 4PJBE 4AMKH 5FKAB 2JK5B 1P7QD 3IRZA 2V2TB 1KJVB 5ANMB 1MCPL 5D7LD 3VH8G 1T1ZB 5FGSA 3MFFA 3D2UA 2VXUL 3HI5H 4GQ9H 5FOBB 1JPGB 1R5IB 4OCWL 4H5SA 3JUZA 5HYQA 2FHCA 4DZBB 2AV1B 1AGDB 3AY4A 1DANU 1F3JB 3MNVA 1DQJA 1C8PA 2BDNL 3NZ8B 4O2EA 4MQSB 3L1OL 4Y5YC 1T83A 3MLTB 1PKQE 3ESVF 1WFNA 1NANI 2IC2A 4F2MA 4YO0B 4MAYC 1CICD 3QWOA 1O0VA 3L3OB 3K2UL 1P84J 2EYRB 3OPZH 1U3HC 1JGLH 1BD2D 3GSNB 4KTEL 2YPLB 3TBSA 1VDGA 4HIHA 3VXRD 3VD5A 1KN2H 1FFQA 4JANB 4YXHL 4Y5VA 5EZJA 4D3CH 3O2DH 1C5CH 3VFVB 4OZFH 2NY0C 5EU7C 2GT9A 1IAMA 2W9EL 3U4EB 3QIUA 3SBWA 1JFQL 2Z35A 3OB8A 4LLUA 4HEPG 5SWSB 2PO6A 3MRLB 5CD3A 2IEPA 3RWFA 3MA7B 3L9RA 1RZIA 3U36A 1OP5K 3BP6A 5JPMA 4NOFA 4Q6IB 2NY7L 3C5JA 3V0VB 4P5TA 1IQWH 1K85A 2ATKA 4APQB 1ZGLA 1W8NA 3BD3A 2GCYA 4HGKC 4DCQA 5D7LA 2NY1D 3VXTB 1CR9H 2C7UA 1Z9SA 2ZSWB 1CIUA 3UPRA 3ZDXF 5B39A 3SJVE 2E9BA 3RIAF 4RZCA 1PLGL 4C55A 2PF6A 4TSBL 3NCFB 3MRQB 3D6GA 3O4LE 8FABA 4EVNA 2YD5A 4PJEA 4Y4FD 3QFJA 1Y18A 3VWJC 4LLVA 5DRXB 3T08A 1XGYL 2BJML 2NPLX 3IJHA 4GKSA 3TPKA 1PAMA 3GHBL 4ODXB 5GGUA 4YHLH 1Q8MA 3MV11 4Z7OF 1R3IH 3ARVA 5MEOA 3QFJB 2WBWB 2X4UB 2XKUA 3ROOB 2VE6A 3DUHA 4P46C 2GAZB 4N90D 3VG9B 5F71A 1ADQL 4C56A 4Z5RB 3C5ZD 1LE5A 4N8PA 1GXEA 3KPNB 3C60C 4Y4FC 4YFEA 5BRZE 1QRND 1I7RA 2A6JA 3O3UN 2DJSA 1CE6B 1RPQA 4LF3A 3BN9C 2VLJE 5C70A 4NKQB 4NOBA 5B8CC 3NIDE 3EYOA 5HHMD 1GGCL 4L3EA 4ZO6A 3VG0L 4PG2A 4XNYH 2A1WL 1J9CT 3QNXA 2AK4D 1XGUA 3KYNA 2E27H 5I1KH 5EC2B 1WFOA 4KVCH 1FNGB 5I6XC 4ELKA 4PTUA 2AJVL 4X4ZA 2MTPA 2GT9B 4OZFB 3QHZL 4XMPL 3PDOB 1XCQB 2EDLA 5F96L 4EKXA 4YGVA 4XRCB 4NHCH 3ARGA 3KLHD 4E0RB 2NW2A 2P5EA 4Y16A 5I16B 2FJGA 5DZLA 5EUOF 5I9QC 5DYOA 5CMAB 4WO4B 4JHAH 2FB4H 1YQVL 2HP4A 4C56D 2HKFL 1D5XA 2IGFH 2VDOL 4ALAL 2WWMC 1VERA 3RUGF 5CD5D 3BQUB 3G6JE 5D1XA 4JO3H 5HI3C 2H8PB 1RHHA 1XF5B 5C0GB 3V79C 1DVFB 4EJ1C 4U3CA 3ARFD 4P2CG 3P73B 4U1IA 4YR6A 3OZ9L 1DBBH 5EOCJ 3WIHL 1B0WA 3VGEA 4RIRB 2DQDH 2ZUYA 4PTTA 1JHTB 3C5SA 3LD8C 1RVFH 4FXLA 4M8VA 6FABL 1KB9J 1RHHB 5HHVH 1ZLWH 1J86A 5T3XL 4M4PA 3ZHKA 1NGWA 2DBJA 3OR6B 1N5AA 1CLZH 5EU4A 3LQAH 4FFZH 2D4FA 1YQ2A 3WKMH 3HS0A 3LAFA 5JHDE 3RX7A 5FB8A 2P4AB 1TQCB 1HDMB 3U0WL 1ZEAH 4HG4J 1A6WH 4X4YA 4LSSH 3AAZB 4LDLB 3DVNA 4OF5A 4N0RA 1GOHA 4XWOC 2VLLA 4IRJA 4NUJA 3IETB 3DI3B 1LO4L 4PYGA 2VIRB 5EBWB 3CSPA 1NUGA 5HHNA 4Y1AE 4BQ6A 2AK4E 5FDWB 1ULVA 2D03H 3ZT7A 1ERNA 4NZTL 4D9RD 3ARDB 5IESH 1SMOA 3THML 1GZQB 4J7RA 1T1XA 5FEBA 1KTDA 3TJHD 2WAHA 2DQIH 4Y4FB 2L0DA 3T77A 4PP1C 4O2CA 3FHQA 1TJHH 1YYMH 2GKIA 5ACZB 3EYQC 2XWBB 3UC0H 3LV3A 2DD8H 1KOAA 1D5IH 2V6HA 2EE9A 1I8MB 4RISH 3VXSD 3HMXH 3GZKA 5JO5B 5JDJA 2DLEA 5IB3A 3OG6B 3SDDC 3IAGC 1VEOA 1MNUH 3AU1B 3B2UD 1BF8A 1NCWL 3CFDB 3RGVA 4UNTA 2XFXB 5F7KC 3FOLB 3H9SA 5CSBA 3AB0B 3MOBL 1RUAL 5IVNA 5L88H 4PY8I 2VDNH 4S10A 2UZIL 5EIVA 4QRSA 1U3HD 4YEEA 3MCKA 1X6NA 5EH1A 2UY6A 4L4TD 3KXFD 3MNZB 1YA5A 1N8ZA 3ZSTA 2HH0H 1NBQA 4KUCD 2VSCA 1Z9OA 1XIWD 3HAEB 5F7DB 1MOEA 3MFGB 2NXYC 5I1GL 3REWB 3FQXA 3RVXC 3RVUD 1JHTA 1FZJA 4GSDL 3NFNA 4WI5A 1MHEA 5ITFA 4AL8L 3STZA 1KG0B 2YD4A 1IQDA 1I8IA 1GC1H 1M7XA 4NHUA 5AZEH 1NFIB 5HHPA 2V9TA 3O3AA 2MNUA 1IMHC 2DL9A 4PRDA 5DJCA 4HQQH 2DL2A 1ZA6A 4PJCB 3ZL4L 4YBQC 4JB9H 2W60B 4KPHH 1XR8A 4LHUB 3C6LB 3HC3L 3KYOA 1RK0B 3C2SA 3GIZH 1RZGB 1VFUA 2YN5A 3K3QA 3NTCH 1ZA3A 3QNZB 1REIA 2ED7A 3SKMB 1IKNA 4Y4HC 3D39D 5B38G 4ETQB 1R3LA 1L0YA 2JB6B 2YA1A 3OGOE 3VD9A 3GMPB 3H3PH 5C6TL 4YE4L 4HWEL 4R4ND 3EDEA 1NH6A 4L8SA 4X6FB 3O0RL 2IH3A 5J4MA 3VRJA 4LSPL 1QO3B 5I1AB 3G5ZA 2Z31B 3ES6A 3P0YH 1JRHH 4OFPA 1F13A 2VLRD 1U8IA 4HWBH 1WZMA 5JORA 3BT2L 1MFDH 1NCDL 1I9IH 4DCQB 1V7ML 4WCYL 3DECA 3SQOL 1WEJL 5TDNA 3ARDC 1SY6L 1T2QL 3T1FB 4ZUVA 5CLWA 5HYSB 1I4FB 1P7KA 1TJIL 4CUCA 4XH2B 1BGXH 4L4VA 1FJ1A 5ISZD 3LZFL 1JMZA 4G7YL 5CJOH 3WNOA 4JKWA 2K3TA 2ERJC 3QIWC 1I8LC 1T5WB 1U91A 4XCCH 5F3HA 4YXLL 3VI3F 1SJHA 4WU5B 1Y0LA 4GW4A 2P8LA 3WDIA 2R0WH 1NLBH 4P23C 1XH3A 2YMXL 2XV6B 1CLZL 3RDTC 3SE9H 5J6GA 2VLME 4JGUA 4P5KA 1N8ZB 1LO0L 4Y5XA 5D5MF 5DEFB 2HKFH 1H3TA 4PJAF 5EU6A 3B5TA 1L7TH 2HT4C 1KGCE 4ESKA 1U41A 3F7VB 2DJUA 2CO6B 4NO0B 4ZS6D 3W2DL 1CFTB 3DX7A 5HPMA 1G1YA 1M05B 5IB2B 3ULSB 5F1SA 1UZ6F 3DXAD 1A7NH 5JW3L 1FFOB 1YEGL 3WFCL 5BVJB 2E6PA 4X9HA 3GMQB 2W0LA 1LQSR 2OL3L 5BO1H 4L8CB 4X5WA 5J1SC 2Z31C 4Z7VF 3N9GL 5CIPB 3QDMD 1YMHA 4EUPH 3S3PA 3K74B 5A1AA 5FFLA 5DUMH 4TVPD 1ZVHA 2W65A 4XPAH 4R4FL 1FC2D 1BX2A 1MJ7H 4LMQI 2IANB 5IHZB 3FO2B 4XVTH 4O9HL 4WU5A 3U7WL 3D18A 1MPAL 4MAYD 3PWUB 2OQJB 5C0RL 1EFXA 5T3XD 9CGTA 1HYSC 3MLWH 3RQ3A 3DX9B 2EXWC 3TYGH 1F8TL 3EO9L 4WVRA 3GMLA 4A2MA 3NACL 1NKOA 3JSSA 1JZ2A 4H26A 3ROLB 3KGRA 5IV2B 3UCRA 4N0UB 1A7QL 1PGRB 5HI4C 5JMOC 1U8QA 1NAKH 1CU4L 2JB5L 3KPRB 1KLUA 1BWWA 5C08D 2P5WB 3GSOA 2YR3A 1FL5B 1T3FB 4RGMC 1KPUA 4JFOB 1D5MB 4HXBL 4DEPB 4GMSH 5JOFA 4X6CB 4JFQA 4FMKA 3QXVA 1ADQA 2VDOH 3MJGX 1CIDA 2CLZA 1JZ4A 4LSVL 2KQNA 1DQQA 1ITBB 1F2XK 4PY8J 5TQ0H 1WBXB 2C3HA 3BP6B 3NTCL 1FYTB 5E1AB 1BJ1J 4LCUA 4YR6B 5GISL 4R7NB 1MFEL 2O5ZL 4TQEL 4DVRH 3CC5A 5C0EB 3OXSB 3NABH 2DLGA 5I1DB 4UI2A 1JGUL 3TV3H 3SDAC 5TE7L 3HAEH 4P46A 5J57B 5EZOH 3MGOA 4IMKC 3TWCL 3AXLA 3RWGA 2L7UA 5DEFA 1S5IL 4PJXA 2G75A 1AO7B 3TP4A 2V2XB 4PJ7F 3B5GA 2RIKA 4QHLA 3GUTB 1UZ6E 1QOKA 3R0MA 5BS0B 2JJWA 1I9IL 1HDMA 4CU8A 4OLVH 4XVTL 4KK8D 4AJ0A 2FEDC 5DD6B 3QEGL 2WUCL 3UJJL 3QG7H 3EYOB 3LEVH 2ESVB 4WTZA 4B41A 1I85A 4MQ7A 5T1DH 2FH6A 4U1LB 5FIEA 1KBGH 3HE7D 5BZWA 5DJ8B 3WHE0 4OZGF 3MUY1 4I18B 2V7HA 1X5IA 4K8RL 1PVHA 4JPKH 3PJSB 4LPCA 4LK4A 4X7SH 4OZGE 1I7TB 3BIKB 3V5KB 4LIQE 1NCDH 3QDJD 4R7DB 3DMMB 1N2RA 3OKLA 2JIXD 5E6IC 4NO2B 4P2RE 4R0LA 1VFOA 5GS0H 2B1HH 3H9SB 5ADOL 4YNYB 2QQNH 3BIKA 3D3VB 2CMRH 4WI4A 1OCWH 1N4XH 4RBPK 2XYCA 3TZVB 1TVBB 4CW1B 4P9HL 4Y5VC 2QSQA 2E6QA 2ICEA 2PW1A 2X1WL 5T3ZD 1LE9A 4WFFE 2R0WL 2F54E 4HS3B 5ESQB 1A0QL 4JFYA 4HWNA 2ATPA 3WXVL 3ET9F 3AFLA 4Y4HD 3S34H 3BPLB 4BZ2H 1FL5A 3N1PC 5H94A 3IU4L 1DL7H 2WBKA 4Z7VE 1WWWX 1YZZA 3ARZA 3QA3B 4PR5B 2CRIA 3WD5L 3ZL4H 5K9OA 3CPLB 1D5ZB 1QFHA 1RUKL 4ZMAT 3KLAB 3WV0A 1LGVA 1OWWA 2UWEB 4D9QE 3QULA 3JWDL 4ZFZA 5LWYH 4XTRD 4XCYB 4PTTB 4LEOA 3RJDA 3ZSSA 1C5BH 2ZUTA 1BFOA 3QA3A 4HPOL 1KIRB 4JKKA 4HUNB 4KK5C 3RL2A 5I1JH 3GKWL 5I76B 1OB1A 1K8DB 4XP4L 2XZCL 5ALBL 2R0KL 1NLDH 3UTSE 4IOSD 4LBEA 4FN0A 1KCVL 5IROA 3L3IB 3AS0A 3IDNB 5T33L 4NKDA 3D0LB 1G7MB 3CXHK 3EYSH 3V4VL 2X4RA 4WTWA 1AGBA 3TFKD 3QDJB 3QEQD 1IGJA 1R3HB 4G9DB 1E4KC 4JKPH 4XTRC 1S7XB 4XH2A 3L3KB 5DD0L 4H1LA 3GJFH 3LKSB 1NSNH 1BZQK 4R26L 4UT7H 4YHZH 1NDMB 5GPRA 1A7RH 1N0LA 5GHWL 4PJ5B 2P7TB 1RUPL 3FQTB 2WINB 5L6YH 5FA4B 1RHFA 3BGMB 5ID1B 1IKNC 3R8BB 4Z78B 5ILTL 4EBQL 2QQKH 1B6DA 4NN6C 2O5YH 5CKAA 5L7XL 1DBJL 4CADB 1HI6B 1EJOH 1I9RH 1HIML 1W8OA 1G6RH 1I3GH 3BPLC 3QHTC 4FQXB 2WINA 5EG6C 1UA6L 2VRAA 2DF3A 3L5IA 1KCLA 5FOJA 4PJHF 3GSNH 5IGXL 3G5ZB 1KN4H 3PG2A 1JRHL 1T22A 2BY0A 1T1YA 3CX5J 4YGVB 4YHKH 1NEZG 1RURL 3ARFA 4OCLC 2DQJH 3NCCB 3U48A 1T5WA 4H0IA 1JNLH 5GZND 1U58A 3O81A 1IM3B 1EEUA 1A6TB 1EEZA 2ADFH 1S9WB 1K9TA 2OR9L 1GZPB 4ZAKC 1NAMA 4OZ4B 3FQUA 1YNLL 1UYWH 1QEWA 4CN4A 1QSED 2LU4A 4NN7B 2R4SH 2CXKA 1CBVL 1AGEB 3O9WA 3FQRA 1IGCL 2GFBA 3QEQA 4YJZL 2M2DA 4C83B 3FKUS 4M03A 1ZSDA 5C0CE 4DGYL 1DBAL 3PGDB 3LB6C 4ODUA 4WW1A 3MV7E 3KDMA 4HV8B 5I8OL 1L7IH 4OT1H 1FO0H 3WJLC 1PKOA 3WS3B 5INDA 5F6IC 3WNNA 1CFTA 1EEYB 4HHAA 2OR8A 3ECBA 4MWFB 5DJZA 2FX9H 2BERA 2ORBL 1YPZA 2D7TH 1WVZA 1JF1B 2JJTC 5T1MB 1QYGH 4HIIA 3OR6A 4K7PL 5HGDB 4ODVL 2ZUSA 2QHRL 5CHNA 4UUJA 1MEXL 4QNPF 1INEL 3SDXB 4P9MH 3SOBH 4HBQA 5CWSA 3BEWA 1BD2E 1VCAA 2CDFB 3RGVC 3S5LB 4TULL 4LHUD 1FVCB 5T1KA 3VG0H 2EDTA 3WXWL 1IM9D 5FUCC 4JY6B 3OHXB 2AJXH 2BRQA 2I24N 4Z7OE 3R06A 4XPGL 1FNHA 5F89A 1UEYA 5C0GA 3MUJA 1UXSA 4ZTOH 1QVOB 5CJQH 4Z7QF 3OKEA 4QRTB 5DSCB 1M71A 4P46D 5D2LA 1I3RA 2DM7A 15C8H 3LEYH 1HHJA 4IRSD 1FBIL 2W1NA 1VADA 4MDJA 4PJGB 1IGFL 5GS0L 1ACYL 3RGVD 4G3YL 3MBEA 3EYUH 1WICA 2X9XA 5BRZA 4R26H 4UT7L 5DJ2A 1EMTL 4MHHI 5JW4N 5F1IA 5HGHB 4KROB 3OKOA 2J1KA 2CIIB 4LQFL 3DSNA 3N1QC 4XMKH 2DB8A 3O2DA 4BSJA 1G7LA 3MGOB 1GIGL 4R4BA 2PXYC 2Z4QB 4LPXA 5EIIB 5F6IB 4BH8A 3LS4H 3MNZA 4U6VH 5TGBB 5FXCH 3FZUC 2LU7A 3BWAB 5LKNA 1U3ZA 3VWKC 1INQB 2DAVA 4UIMB 3BRDA 3Q1SH 3FOMA 4Y19B 1PG7X 3FN0H 1FZKB 3HZMB 5IFJB 1KCKA 4J2XA 2WIMA 4OLEA 1KYOK 1QBLH 4IS6A 3FQUB 4ZYKA 3ZTNL 2P43B 3I9GH 1FP5A 4U1GC 3TT3H 3JVGA 4RAHA 1UGNA 2Y4SA 3QG7L 1IZJA 4NNYA 2EKJA 4LVNC 4JO1H 4NN5C 4ZUWB 1G7PA 4O2EB 3WXVH 3WUWB 4NQEE 3BDBA 5IFHH 3IFNH 2AXJA 3IKKA 3RKDC 1EZVY 3T2PA 3MJ6A 4MA7L 4TOYL 4WUUB 4LIQL 3H9HA 2FZ3A 3A6OA 4YDKH 5L2KD 3LEYL 3CFBA 2JCCA 4NP4L 2ZSVB 3KS0H 3X14B 4JPWL 1BVKB 1F4XH 2Q3ZA 1FZMB 4R4BB 1YECH 4HK0B 4IDLA 4GW5A 3MRJB 5INCA 3FONB 1VEMA 2VXVH 4JZOA 4X6EA 3DROA 2VIRA 4Q9RH 3QZWB 3WSQH 12E8H 3CSYA 4F7CA 2A83B 3QQNA 3MRPA 4O4YL 1TETL 1EGJL 5DVOA 2FGWH 5SWZA 3BEVA 3BN3B 3B9KD 3ARGB 3G04B 3SE3C 5D5ME 2F53E 4OV6F 1C12B 4I3GA 4URTB 4H25A 1SJXA 3O41B 4OSUL 3KHQA 8CGTA 4X0KA 4P5TB 5D96B 1DQML 1M4KA 4JZNB 2OS7A 3DGGA 4GRWH 5DTFB 3KLHC 3OJMB 5GS1A 1DUYA 2E3VA 1FO0L 3UTTD 4NWUL 1BBDH 5AAWA 3BDYH 1NCBL 3OSKA 2P5WD 4V1DD 4MD0B 1VPOH 3FO0H 4XNUH 3CXHJ 3FO1B 1OAKL 1MSPA 3OAZH 3NCYP 1IGFH 2WWMD 4N9GB 2Q8AH 1KNOA 5I8EB 3TO4A 3PQYE 1QQDA 3IJHB 4PJ9C 2VWEC 3FB5A 3I9GL 3TJHC 3DV4B 4GAJL 5IMKB 1J0IA 2SEBB 4PGCB 2DWDB 2VDQL 1ED3A 3LN4A 3S35L 1NANH 1WZ1H 1IL1A 4LCWB 4UOJA 5I1CL 2FJFA 3MLUH 4V1DB 5D71L 4XPGH 3KJ6L 1U92B 4X80H 5CEZH 1LD9A 4BFIB 4J4PD 43CAA 1UJTA 1QZ1A 1PG7L 4QHKJ 1D7FA 5IBUG 3TVMC 4QXGL 3P3YA 4G6FD 4Y4KD 4MZ2A 4PGJA 4NBYB 3S36X 4G5ZL 1EGJA 2D03L 3B9KA 4LLYB 4QTIL 4QWWC 3BZFA 3D85B 2UZXB 1GGYA 1P9MC 5ILTH 1OOAA 2EE3A 1FZKA 4JFFE 5JW5B 2E8YA 5SV3A 5DK3A 3VXSE 5ISZB 3H42H 5DHVB 1ZLUK 5IQ7H 3CZJA 5H2BA 5HDOA 1EVUA 5A2KH 1CWVA 4POZC 5EOTB 2OJEB 5GGSY 4R3SA 3MRBA 5DEZA 1UCTA 3QXWA 2NTFB 2UVEA 4DZ8B 3HA0A 3ZDYE 2ZP0T 4LIQH 2ADGB 4D9RE 5L2JB 3V4UL 5I18L 5D7JD 4M48L 3EYQD 5GGVY 3SDAB 2V2WA 3M1BA 3VFNB 2A38A 2NCMA 5JPNB 3JV5A 3VDBA 4GG6E 4YPGB 1OM3H 4LOUC 4XPHH 4Z7UF 5I1HL 1NC2B 4PB9L 2E9JA 4WUKL 1C7SA 1FNFA 5L8KB 4NCC2 1RJZB 4HJ0D 3OL2A 1WTLA 3K8MA 2APWA 3Q6FA 1NC4B 3JBG7 1QUNA 1ZVSB 1MFCH 3SDCA 3FB6A 1HIMH 4JLRB 4ZTOL 1DLHB 3HMXL 5C0ND 3ZMRA 4QXTA 5GZOD 1EEZB 1S7TA 1V5JA 1EHXA 2FLRT 1MCJA 3FO2A 1RUAH 2E7LA 5LXGH 3F58H 3PHOA 1FZJB 4YC2C 4HUKB 1MEXH 3SOBL 1IARB 1MJUH 3GMOB 3TH3T 2W65B 2AS5M 1NUDA 3OKKB 2EYRA 3QYCA 4K94L 5LAXA 1R3KA 2XRAH 2QV2A 3TCLA 5E6IA 3IFLL 2VISA 4QTHB 3WL9B 4HIXL 3ZHDA 3L1OH 4LLDA 4AK1A 4N8CL 3RWIB 4PJHE 5JXEA 1DBBL 1AD0B 3MOBH 2PO6B 3MRLA 5CD3B 1EH9A 4A6YL 1N0XH 2VAJA 2DTMH 2CH8A 1QBBA 5IMOA 1YN7A 1Z3GL 4E41A 1OGAB 3QJHB 4MNQA 2BRRH 3UTPE 1NGXB 1B0GB 4IOIA 1YNTA 5HDQL 5HGBB 3U79A 3TIDB 2I25N 4LAQH 3HUJB 3BP5B 4GMSL 3RVVD 1LP9A 3NCJH 4HAGA 4MXWL 1LEIB 1HE7A 1JGDB 5I1HH 4N0YL 5KJRH 1Y6KR 5HHOA 4NJ9L 5DRNA 4KI5E 2NY6B 1RJLB 3K8KA 1HNFA 4OLWL 2BNQE 2CLZB 1U8HB 5A16B 1TMCB 5JUEL 3QJFA 4DW2L 5C9JB 4W4OA 5D7LB 5HYQB 3QDGA 4HZLA 5DMKA 5GGVH 1OGTA 2NX5E 3V0WH 4LSUL 1HHKA 5DJXB 3MC0A 4PD4K 2C3GA 3UMTA 1L6ZA 1J05A 4Y1AA 1QBAA 4HKJA 4J3SA 5H35A 1BREA 1J1OH 3ARDD 1UM5H 4XVSL 1B0RA 5JHLH 4KZDL 4FQXD 4OZIF 4JVPA 2Z4QA 4OGAD 2XA8H 3U9PL 2VZ3A 2VZUA 5D1XD 2FWOB 4KGLA 2O5XH 1RULL 4WUUA 2RQ8A 3E6HB 3MLVH 3S37H 3PIQB 1QSEB 1UG9A 1RZ7H 1GSMA 3AAZA 2NZ9D 2F58L 2UUDK 4JREB 3V52H 4AG4L 4N1EA 3PP3K 1YEHH 4HK3J 3E8UH 1BP3B 2WUBL 4U1SA 1BZ9A 4GAFB 4PJ7E 2VXTL 5E9DA 5IB1A 2J2ZA 3PL6D 3BPCB 5A3ID 5DURB 4NQDB 3DI2B 1Q0XH 1NC4D 2EZ0C 2FNBA 3PWPE 4WHYG 4ZOEA 3QIBD 4OKVA 5KSVB 4HC1L 3BISA 4XP5L 4BUGA 1M6OB 5GRXG 5DQJB 4ZFZB 1ND0A 3U7YL 5DA4A 1F6AB 5IBLC 3UROR 5IMLA 5D1XB 2BHUA 3L3HA 4OLZL 2VUYA 3P2TA 1CFSB 4PD4J 3L3GA 1OT1A 3VXQB 1G0YR 2MCPH 4M5ZH 5CEXA 5AD0B 5I6XB 5IFHL 3QRGL 3GRWA 4X80L 3AU1A 4J3OC 4XCCL 4HIXH 4UUJB 4Y16B 5K9KA 5TQ0L 4NWTL 1P69B 4QKXB 4BFBD 3I6LD 3KJ4C 3OBAA 5JLZB 1A4JB 1KB5A 2EIDA 3GMPA 3OAUL 1B2WH 1AGCB 3DHJA 2OL3H 1EJ6A 4JY5H 1FYTD 4F3FA 3RTQD 3L5HA 4H25B 3S9DB 1PDKA 4TSBH 3SQOH 1HINL 4WFFD 2PR4H 5CGMA 3ABZA 3LKOB 1AC0A 1UXWA 4LPUA 1VB9A 3U4EA 1KEML 1CL7I 5FM5M 4FP8H 4UOW0 4WI9A 1DVFC 1JGEB 3QIWB 3CX2A 2A9NH 5EZLB 3GHBH 4EUPA 2F8XC 1KIQB 3NACH 3A6BL 1AGBB 3C8HA 1RZ7L 5LGJA 2AJYL 4KTEH 4NM8H 1MFCL 4GRMA 4WWKD 1XGUB 4J3UA 2AVGA 3VDCA 1JWSA 4Z5RA 4C56B 3RWCA 1YUHB 25C8L 5AYUL 4CBPA 1WCBB 4OZFG 2R2HB 4QHKI 2X4TB 3DHMA 1ZAGA 1P53A 4LCWA 1FNEA 1ORSA 3MRFA 4QT5A 3RUGE 2ICEB 3RWCB 5I18H 1MRCH 3D2UB 3ULUH 2IAMD 3PGDA 1GRWA 1AHWB 1T04A 3C5ZB 3MV9B 3FB5B 3JV4A 4ODSH 1UACL 2A6IA 3D3VD 4KDVA 2FR4B 4XMLL 1KCRL 1NL0L 5K9QG 5M94B 4QY8A 1T7ZA 1FNEB 3UTTE 4PRHB 1CK0H 2O26U 2VKXA 1ZSDB 1TPXB 4I48B 5AAMA 1RK1B 1MHPL 4QRRE 1AKJB 4N0CD 1NMCC 4BQ9A 1YEHL 4PLKC 5D9SB 5J3HD 3O3DA 1GAFL 3FQWB 4OLUH 2J8HA 3WLWD 2FYYA 3AREB 4NQEA 5JMRA 3BJLA 4KKNA 4JRXE 4D9LH 3B9KB 1Q72H 1JUFB 4HUUB 2K1MA 3P30L 4CNIB 4WIQA 1B4RA 4G9FB 3L3IA 1MCHA 2GCYB 1NDGA 1XF3A 2OP4L 3EFFA 3KR3L 2DYPB 1EXUA 3B2VL 1KPRA 4RAUB 2YC1A 3CK0H 3HAEA 3P0VL 3JWOC 4OZIB 2ARWA 4R9HA 5C92A 3IXAB 5FHAH 3ARBB 3MRJA 5F6HJ 5INCB 5F9OH 3NA4A 3S8WA 1VADB 2DS4A 1AO7D 4R2GB 4KK5D 1QD0A 2ICWB 4FZEH 5D2LF 4AM0B 5MENA 1NJ9B 2OCFD 4XHJC 5D2LB 4KKAC 2AW2A 3OKOB 5ICXA 3DX6A 1K3IA 1S3KH 2ITDB 2XA8L 3RFZC 1MRFH 4P2YA 2A6KA 2EDNA 5JLZA 5CZKA 2J8OA 3ALXA 4YDLB 4HC1A 5E8NA 4P9ML 5ICXB 5EU5B 5GGUB 2Y5TB 3HE6D 5HYEA 4MJ6B 1RAMA 1UYWL 5E70A 1OT2A 4HIJB 3VE0A 4F33A 5ETUB 3MLVL 1EUUA 4HT1L 1ZA6B 2C4FU 4E41E 4XHJD 2V9RA 4JFHE 3HZMA 2O5YL 4LEOB 3BXNA 3ZDZF 2HN7A 4NBXB 4JHWL 3PP4H 3IU4H 3S88H 3OX8A 3P73A 4YWGH 5D96C 1XF2B 4YHYB 1R3JA 3G5XA 3H9YA 4NKIH 4Z7QE 4YHZL 3CH8A 2EC9U 1T66C 3LDBC 3WFZA 5EUKB 1H0DA 1DUYB 3O6LL 4DFHA 1XAUA 1G7LB 2MWCA 2CK2A 4QOKE 3E2HC 1WWAX 1CGSH 1CDGA 3QPXL 3RNKB 4B5EA 1TNNA 5C0AE 3QPQD 3R4DA 2DD8L 2Z92B 3MRMA 4MZ3A 4M1GL 4CMHB 3F7YA 1U3HA 4HS6A 5H35B 2CR6A 5KVEL 5TDPB 3PUCA 4MCYB 5AG9A 1IC5L 2MPAL 4X5LA 2FCBA 1W2KT 4H26B 4RFOL 4MQXD 3V5DA 4OUUA 4NUGH 2JJSA 3OV6A 3L5WA 5F9DC 4OZGA 3CMOL 4HIEA 3PJSA 4G6MH 1JNLL 3FOMB 5F89B 1YMMB 3FN0L 5LCVH 3MX0A 5FO7A 4FP8L 5F88B 2Y06H 2GK0A 1UKTA 5D8JH 2DQIL 2Q86B 3QEGH 1YPZE 2AI0L 3BJ91 1XGQB 5C0IA 4I2XB 3BQUA 5CINL 1UCBL 2VWEE 1FVDA 3GK8H 1MUJB 3MGAA 3DIFB 5KVDL 3V0WL 4L8CA 4MD5A 1INDH 2AQ1A 4W68A 3MV7D 1T1ZA 4J4PA 3D69B 1U93A 3UAJD 5IK3A 2EXWD 4XNZC 4P9HC 4NFDA 5F9WB 3BW9A 1G9ML 5K9QI 1AQKL 3X3GL 5DI8A 5I8OH 1XZ0A 1CFNA 4NQXA 2EDBA 2R39A 5L88L 5AZ2H 3FN3A 1A6UL 1ZGLP 4KJQC 2V2XA 2EDOA 4PJIE 4PJDF 4UTAH 3NCJL 2VQ1A 1G6RA 3ALPA 3L3DA 1AP2B 5EUOA 4PGDB 2R4SL 4FQ2L 1D9KB 2HRPH 5T1LA 3A6CH 5E5MB 2H45A 3RVXD 3ARED 3GSNA 4LHJB 4UAOC 5HYSG 3FB8A 5I1EH 3VXMA 3AC0A 4ODHH 5I19L 4Y19D 2MSPA 2Z0BA 5CGYC 4DKFH 1PW3A 2VLRB 4LPYA 4O58H 1UWGH 1NKRA 3FB7A 1NBYA 5C0FA 1KXQE 2VXTH 3S5LA 4BM7A 1PEWA 5I1GH 2ZJSH 3WNPA 1LD9B 2Q1EA 2NY0D 3GSNL 4YHPB 4XMPH 4KJWD 2DJ4A 5IESL 2Q87A 1NUNB 3UDWA 3GKZA 3RBGA 4YE4H 4JZJC 4ZOAA 5E5RB 4JFQB 2QTEA 5K9JL 4F9PA 1M6OA 2FX9L 3DYOA 4YGAB 1I3RB 1FV1B 5D2NE 3G5XB 3TBYB 1U8PA 4MJ5A 4PJEF 4OFYD 1WWBX 4NPYA 4ELMA 2E5EA 3TCXA 4L3EE 2VXQH 3UPAA 3IFPA 5EU6B 2OTWB 1OL0A 1WZKA 4KJWC 4XP6L 4S0TD 5FM4A 2Y5EA 4F9LA 2XFXA 3EOAB 3GHEL 1K2DB 3GGWA 1TVHA 3UPCA 5GS1C 5DD3H 1A4KA 1I1FA 1EHLL 5BO1L 4JPIB 4JN1H 3HE7C 4NUGL 3ELAT 4AL8H 2ZG1A 2DQJL 1GAFH 1JPSL 3Q1SL 4NN7C 2DLFH 5FO8A 1AQDB 3IKCB 1KEMH 1OP5H 2CLRB 1C1EH 5DZOA 3I6GA 1YUHA 4MA3B 1R5IA 2P47B 4IDJL 3V5KA 2VDMH 4NC0B 3BWUC 2HVKA 1YMMA 2GSIB 5E8DL 4ZQKA 4QRQB 1H8OA 3T1FA 2KPNA 5KBNC 2X5PA 5GJSH 1AO7A 2DQHH 1WT5A 2VABA 3TYGL 4OI8A 3WO4C 4P23D 1HOCA 4KMTL 4XNXH 5DC0A 2F54D 5A16A 2P8PB 1QRNE 3RBSA 3NABL 3ZT6A 2VDLH 5L2KE 4GAYB 1MQ8A 1G7PB 2A6DB 2X70B 3LQMA 3X3GH 4I0PB 1KFAL 3D25A 5DVNA 2PW1B 5EZJB 4XZUB 2LE9A 3NCMA 2IADB 1T0MA 3NN8B 4LCCA 4H1LH 5IW6B 4KQ3H 5DUML 3QPXH 3SCMD 4NCDA 4JPWH 3QP3A 1CQYA 3INUH 4GXVH 3W9DA 3OKNA 3C09C 1NJ9A 5IVXF 2DKSA 2Q6WA 5DURD 3JTTB 1DSFH 1OQXA 2GJZA 4XBPA 4JE4B 2NY4D 3OKLB 3Q5OA 3U30C 3H42L 2XXMB 1YYLL 2YD2A 4F7CB 2PYFA 3O4LD 4LSTH 4XAKE 2IPKA 1S7UA 5E8OB 3C6LD 3MUGA 1K8IB 3MLUL 5D71H 5AYUH 3U0PA 4DKDC 1S7SB 1CDHA 1T7XA 2QKIB 2BNQD 2CGRH 1N64L 4K2UL 5E6IB 2BVYA 5GSRB 1AD9B 5DA0B 1ONQA 3GSQB 5DS8B 4O2FB 4XVUC 2R0ZL 3DURB 2PXYB 1OM3L 3DJ9A 4Y89A 1S5HA 5KSAC 2AJZA 1CDUA 1HNGA 1TZGH 4NKOA 1IEBA 3C08L 2BCKA 4UTBL 4PGBA 1Q0YH 1R3LB 2JB6A 4C83A 1VGEH 2C3XA 3S4SA 4NBZB 1XGTA 3VWKB 4MJ5B 1NGZA 4ODTH 4K23H 3N9GH 1RZJH 2M26A 3P4OA 3T4AB 3RU8H 4R97C 2F5AH 1GC1L 4K3GA 2C4XA 5BXFB 4MAUH 1RZFH 2J5LB 1UZ8A 1BVLB 4L4TB 3PWLA 4OBSA 2B4CC 4RA3A 4YDVB 1FAIH 1U3HB 3JXAA 2B0SL 3VCLA 1U8NA 1SY6A 4KJYB 1LK2B 2CUHA 1GGCH 1W72B 1BBJB 3F7VA 5GGTL 1IM9B 1UB5A 5DD5L 5CAYB 1RQ5A 4IRSA 1MCBA 4QRPE 3HC4H 3AM8C 4OSUH 3LV3B 3K2UH 2WSKA 2A0LC 2Q20A 3WFBH 3ESUF 2W0KA 1W72A 4LGRB 4MX7A 2FX8H 1LEGA 4Y4KC 1MIMH 5HVGB 1GZQA 5EBGA 4LSTL 5T5FH 4FG6C 4XVJL 3FQTA 4MAYA 4N5ED 4M62L 5C0NC 3W0WB 2HT3D 1J7VR 3O11A 3WFDL 4PTUB 3FRPA 2VISB 3TNNB 32C2B 2J8UB 4JFEE 4RGNC 4P0DA 3DWTA 3L5JA 2P45B 2GJ6E 3W0WA 4LRNH 1RU9H 3BPNB 3K0WA 1SEBA 3CXDL 1D6EA 4LL9A 4OQ1A 4XNYL 1WLHA 4IMLA 2HFGL 2R29L 1ETZB 3DV6B 5E00A 3NPSC 5CWSB 5C08A 2GK0B 2Z91B 5HJ3A 4X6DE 5GGRY 5T1MA 3AS2A 2IQ9H 3PP3H 3V0VA 5A2IH 3FB6B 5C0IB 2EKSB 1F6AA 5HY9B 1CT8B 4LCYB 1T3FA 1KLFA 3TBVA 1SBBA 1K8IA 5KSBA 3MROB 4JM2C 3ZKND 5J7CC 5IB5A 3MCLL 2Q7YB 4KZDH 4M3KB 5IEKA 1P4LB 1T2XA 2EIEA 2P24B 3LHPL 3OXSA 1CGXA 5KSUB 2V17L 4GBXB 3O9WB 2GITA 2CXGA 4AH2B 1AR1D 5ICZB 1CBVH 1UWEH 5T5NF 1ZHLA 3FRUA 4GUPB 3EOTH 4GKSB 3IT8D 1AGCA 2CMRL 3T2QA 1A5FL 1R0AL 4MA1C 1LNUB 1YEEL 3RA7H 2AKRB 3Q3GB 5HHOE 4KV5F 3ILQD 4I0CC 1SYSB 4P2QE 1EBPA 4AH2A 1L7IL 4L4VE 2D7OA 1RMFH 1DEDA 2R4RH 2DQDL 4HLZH 3T3PF 3GSVA 4RGNB 1F90H 2RGSA 4L3AA 5DEGA 3FT4B 3RVTC 3VXNA 4FTVA 3O6FA 3MYJA 5JDSA 2VLRA 3W9EA 1BQHB 1AP2A 5DDHB 4B7LA 3QNYA 1PX4A 3OX8B 5C2BH 5HDQH 4P5MA 4K7PX 4XP5H 1AHWA 5LQBH 1DN2A 3KPLA 1G9EA 2R1YA 2OR9H 5MERA 3DTXB 4U7KA 4PJAB 4XC3H 4JHAL 4DUVA 3NPSB 3E1F1 1ZHKB 4IDJH 5T33H 5JDSB 4J1UB 4JDZB 3RKPA 1AC6A 4JFDA 1FGNH 2F8OA 4LSSL 4TRPH 2QADC 2VR4A 3BE1L 3H0TA 3MRHB 2G5RA 2NY0B 1ZS8B 1U8MB 4LGSB 2C26A 3PGCB 5C7XL 2R0LL 4OAWB 1CN4A 2AERT 2YPKB 4KRPB 1UA6H 3FOLA 1HH9B 4PRAA 1X5JA 5HXMA 5F1KC 1FPTH 4PUBL 3TPUA 1X9QA 4JFPA 4ONHA 4EQ2A 1S7VB 3D69A 4J6RL 3SO5A 4K94H 3B43A 3QQ9C 3UYPA 2XN9B 4PRIE 2QQNL 4OAWA 1OHQA 4X4ME 4AYFA 2CIKA 3VJ6B 5C0BB 3IAQA 3AM8A 4GW1A 1FDLL 1U91B 4W6YB 1YEFH 1NLDL 5IB4A 1R5WA 5MP6L 3O3BB 1P84K 2OL3A 3NFPA 4MXWH 4HKBA 1KPVB 5SV4A 1FNGA 1A1OB 3VXPA 1TLKA 2XN9A 5D6CB 2AXHA 4KMTH 4LDEB 2VLMD 1LO3L 4XNXL 4AZ8A 5HVWA 2ARJB 1MHCA 3SE8H 3O8XA 3WFBL 2X4OA 1WISA 4MSWB 4YUEH 4K8RD 4K71C 1Y6MR 5F7NC 1P4IL 3V6OC 3HI6H 1E4JA 1LDPL 2VUOA 4Q0XL 5D72H 2I07B 3C9NB 3RWEA 3FRPG 4MNQD 4Y8AA 3RZCB 4WY7H 2HT4D 3ES6B 4X99B 1OB1B 3DUSA 5BV7C 4KAQH 2ZCHH 3J8F7 4U1SB 4MXVE 5HGDA 2AAVA 5FUOL 3U0WH 2FGZA 1S8DA 3OGCA 5CP7B 1JI2A 2BVQA 3WHXA 3P40A 2ZUUA 4NNXB 4ODTL 5EWIL 4PJCF 1BOYA 5HGAA 1JIBA 1C16A 1X5YA 1ZA3B 3QNZA 4WENB 1WJ3A 1LILA 5EUKA 1FIEA 4KRPC 4LASL 2VITB 1HILA 1OTSD 4TNVF 3CJJA 3VFMA 4QF1A 5HDBE 1BMGA 1H5BB 1J5OH 4KDTC 4FQ1L 1DQLL 2AJZB 3RWJB 3FJTA 4FTVB 4RFEA 4K07A 1CLYH 5DJ0A 3QR2A 3D2UD 1ODAA 1B6UA 4K94C 1FCGA 1TFHA 3WO3B 5ERWA 4ZXBC 4CVXB 3CFKA 1MAMH 1L6XA 3O4OB 4HIIB 1IBGL 2PTUA 4FZ8L 5DR5H 4PGCA 1EK3A 4RRPA 3EO1B 4X6CA 4ZUUA 5MEQB 2VDPH 1XT5A 4WFHD 4GT7A 3F6IA 1KLUB 3MZGB 1FFOA 2CO7B 4HDIA 4YDVA 1FL3B 4C58B 2IPKB 4IEFB 4WI8A 1A0QH 4GKZA 3N85H 2ZCKL 2IFGA 3MJ8A 2EE6A 4IRZH 2QR0A 3RTQC 1OWRM 2NY3C 3HNTH 4PJFF 3NZHL 5F7MC 4XB7A 2CUIA 4P3CL 4U0RB 5I0ZA 4WDIB 4Y7MA 1RZ8B 4HH9B 4OCSH 2EYSA 1EVTC 3FO1A 3MRIB 3LH2H 4N5EC 3KPSE 3KPOA 3P77B 1OAKH 4QOKD 4M93C 4R7NA 2UYLA 3EFDH 3HFML 5BOPA 3MCLH 4PJ8D 3UO1H 3WKNA 4RGND 4EI5B 3V6FB 1FGVH 3MOQA 3DX6B 3MRIA 3M8OH 3MLYL 1YEDA 4M43H 1H15A 3LD8B 3NGBB 2NY3D 4HJ0C 1DBKL 2R9HC 3VFWB 3MOAH 3A6BH 1T20A 3LKQA 4NNPH 2E9WA 1VA9A 1EAJA 3IS0X 5HHVL 1MJ8L 4WHTA 1MF2L 4XBEH 5EZIL 1T4KB 4YWGL 4F7EA 4NWUH 3VA6A 4KU1A 4LSPH 2IBBA 1FZMA 4LRNL 1K4DA 4CMMA 4XC3L 5DO2D 3TNMB 1QVOA 1UB5B 3D9AL 1PKQA 3TJEH 4JLRA 1I7RB 4YBQD 5BV7B 3ZYZA 3BOVA 2VLKE 4FQQB 4D0DB 1KXVC 3BYYA 4HXAL 1UVQB 2F53A 4DOHE 3KDMB 4AEIL 1RUMH 3O2WL 3NA9H 2R4RL 1TVBA 5A2JH 4QNPE 1AKJD 2DBLH 1HSBB 1T7YA 4U0RC 4UU9A 5CEYB 3TH4T 5EO1A 1HCVA 5DFVD 3SKOB 2Q8BL 4J3WA 4POYA 2AJUL 1HQ4B 1F5WA 2AK1H 2IMNA 4XBGA 4OGYL 4KQ4L 4XCNA 5KOVC 5JW4M 2JCCB 1FL6B 4PFEA 4EI5C 3MA9L 1AIFA 4YHNA 3JVGC 2CIIA 3HFMH 4APQC 1VFMA 4M5ZL 1IT9L 5IB2A 1HXMB 3QEQE 1XF5A 4NO5B 4JHWH 1OPGL 3PGFL 2GI7A 2YD1A 1RI8A 1LDPH 5D72L 1CD8A 5E2UH 15C8L 2UV3A 1JYVA 2IQ9L 1WZLA 1VGKA 1J88A 3OAUH 2XZAL 3G5VB 4YAQB 1YEJH 3MUGB 1MH5A 1A3LH 4TOYH 1T5XA 1RZIB 1F6LL 1KTLA 1V7MH 1ZKAA 1ZHNB 3GSUA 4TVPL 4Z7UB 4MCZA 1MCFA 2B4CH 4RMTA 4JFDE 4WDIA 2WQRA 1NBZA 5AWNH 5L8LB 4RRPG 3U0TA 3F5WA 4RBPH 3TBYA 2X1QA 1T89C 2ITCA 2FR4A 2OLDA 1RZJC 5EU6D 5IOPA 4M93B 4W6XB 2NY7H 4BUHA 3ZDXE 4J8RA 3N06B 4UOW1 4ZO7A 4FFVD 2G2RA 3WFCH 1MCWM 1IM9A 2XIDA 5DUPL 3OF6D 4JM4H 1UH4A 5KW9H 2YSSA 5DT1H 2D7MA 1DDHA 2C1PA 3UXFA 1MFAH 3QO1A 3P0YL 3VGAC 3MNWA 3HI1B 4J1UA 5JR1H 3IDYB 2HMIC 2WBJA 1I75A 5JOFB 2RAMA 1Z0NA 4P2RA 3KPLB 4LU5H 3HR5A 4P2RD 1A22B 4I9WE 2EDFA 1CVSC 1XR9A 3B8SA 4XMKL 5I8CA 1TJGH 3EBAA 5IP4A 1H3GA 1JGEA 4WEMB 4L5FL 1UENA 4MA3A 4OF6A 4S1QH 4BK4A 1P9MA 1GZPA 4K3DL 4QXWA 2ZUVA 4P57A 3QIUB 1NFDB 3ZYJA 3NIFF 2VLJD 1G7JA 3BKYL 2HT3C 5A2LH 1QA9B 4N8CH 1M7IB 3GSXA 1U8KB 2F54A 1UH3A 3VGHA 5EOCL 1JGVH 3RL1B 1BECA 4D0DA 4NP4H 3PNWB 3MMEA 1OTTC 5I75C 3PIQA 2P5EE 4WEUD 1CG9B 1MUJA 4N90E 5CBAB 4ZAKD 5FGCB 5KS9B 5IT2H 1WEJH 1J8HE 1YEKH 2FWOA 2A9MH 3UTQB 2ZSWA 4HUXB 4LVHC 5MP6H 3UYRL 2NLJA 1XR8B 1GJIA 2YSSB 5GQBA 1QR1B 1YNTB 4OI7A 4JR9L 1NGYA 1RZGA 1UM4L 5KVFL 3FCTB 1X5XA 5I17A 5MEOB 2UWEF 5B3NA 3HMWL 7FABH 4Q6IA 4MSWA 2GK2A 5K59F 1LEKA 3EJYC 3MLRL 1YJDL 3KWWA 2R1WB 4C54A 1I8LA 2CKNA 3QIWA 1KBGL 5KVMC 1HQRB 4ZSOB 2XPGB 4FOMA 3BPCA 2X4SB 2X4PB 3IDIA 4R96A 5JW5A 5J13C 3SDYH 4OV5B 1JFQH 3E6FA 5F7DA 4KAQL 2VQUA 2YK1H 4XPHL 5CLTA 1E28A 1AFVL 5I2IB 3OKYA 4NZJA 3BZFB 3LN5A 5JHDA 3Q3GA 2ICWJ 1NSNL 5GS2H 2YUVA 4F7MB 3QISA 5KANG 4HKXB 3RL2B 4WW2A 5EN2A 1A9BA 2HJFA 1YJDC 3X12B 2AEQH 3UP1A 5DWUH 3V7MA 3DETD 5D5MA 1NEZA 4OGZA 2OR7A 4WU7A 2I9TB 3SE8L 32C2A 5D7IB 1UM6L 1QFOA 3MRNA 4GJTB 2HRLA 1MCEA 1GHFH 4XAWL 5F1NB 4DN3H 2FSEA 2XN9D 1H8SA 4CJ0A 5T3ZL 2K9UA 1KPVA 5GISH 3SDDD 4PJDB 4U6YA 1DCLA 4FQHA 5EIIA 1CTOA 1A64A 5IUSA 4LAQL 4RSVA 1NC4A 4K8RH 1OSZA 2CRZA 1IGTA 1ZHBA 3UDWC 1CGWA 3KLAA 2XRAL 3K4ZA 4Z8FH 3T0EE 2V5YA 1QKZH 4U6XB 3T0XA 1MJUL 2FJGB 4OLWH 2FYYB 3AREA 3B9VA 1LK3L 2HLAA 1JHKL 3DVFA 1SJEA 5KZCD 1JNNH 3WBDA 5GRJL 3HHRB 4TVPE 1Z5LB 2N56A 4JY6A 2OJZL 1QG3A 4P59L 1LEIA 1JGDA 2AQ2A 3X11A 5DO2C 1DTUA 1UWGL 2F5BH 5JOEA 1GCFA 3O8XC 3C60D 2MJWA 4X5XA 3RWHB 1G7IA 1WSST 5C07E 2XWJA 5I1IL 1T83C 2OTUB 3VXRB 1XCTB 1CD9B 1TQBB 3KG5A 1G6RL 5D7SH 2WMPA 2GY5A 3G6AB 5GRZA 1RZJL 5IHLB 1I4FA 3IJSB 4GRWB 1LHZA 4UB0H 4GBXA 1I7UA 3VFUA 5FYLE 5AG8A 5DRZA 2FX7L 5T3XH 1P6FA 2ZG2A 4EVNB 1G7HB 1ZANH 1Q9WA 5JNYA 5F1OB 3RWIA 2A1WH 2Z8VC 4O9HH 1EPFA 2KBGA 3FT3B 4Z0XA 1BX2B 4CDGC 2IAND 4NJAL 5IVZB 3MCG1 1SEQH 3BYTA 3GSWA 3VFUB 4K3JH 4BSWA 3WE6B 4WHDA 5B4MD 2VO5A 3RZCA 4P9HH 2WLYA 2WIIB 3QDMB 1HSAA 4F7PA 2I9LB 4MJIE 5F7EH 4LKXB 5DWUL 1QSZA 1S7RA 1KCUL 5KVDH 1PSKL 4GKOA 5EBLA 5HHMB 3WLBB 3VDAA 7FABL 3UJIH 5CP7A 3TV3L 3F7QA 4PRPA 1LE5B 1QSFB 5I0DA 1MHCB 1BIHA 1C5DB 2LAGB 3WIHH 4CN1A 1T22B 4TVPH 1EUTA 1UQSA 4YDJB 2FO1A 4JRXD 3TO2A 3VFOB 4ONFH 2I07A 2XPGA 3MA9H 4G8FB 1TJGL 3S96B 4AM0A 5D2NA 5MENB 3L95A 2HRPL 1MCWW 4N9GA 1DN0B 2MKWA 4X7TB 1G9NH 5JIPA 3OKDA 4FXKA 5CSZA 4TSCH 1OAXL 4L3CA 4K3EL 4WNQB 3ARBD 3LEVL 3W81A 2KL6A 3BFOA 3STZB 3MV8B 2FECL 5GS1B 5FHAL 1BOGB 2WV3A 2R15A 4ZAKB 5DQDH 4Z7UA 2Y6SD 3RJQB 1GHFL 3EIFA 4O02H 3LKRA 2BNUA 2CIKB 2FJFB 2NXZC 4M61B 4Q9QH 4WGWB 3QUXC 4F7PB 4FFVC 2NYYD 4XGZB 3W0WD 5FGBC 3ZE0E 4R90H 1S7VA 4QHNB 4NO5A 3RZCD 5E1HB 3RVWC 3VA2C 2WP3T 2YEZA 2R1XA 4CN6A 4D9LL 4QHUB 2ED9A 4DJMA 2PNDA 2Z8RA 5C6WH 2EIZA 5TDNB 5AWNL 1TXKA 4XPTL 4YHNB 1MRDL 1ES0B 2ZUWA 1BVLA 1OLZA 4C4KT 4H88H 1O7SA 1HXMA 3TGXA 5GZNC 5FDWA 2ZNXA 4TULH 3CXDH 1KTLB 1P7QA 2AGJL 1A6VH 3GJEA 4B0MM 2XQBL 2FH8A 3V5DB 4HT1H 2F5AL 1QHOA 1KJ2A 5IM7B 4OBRA 4LLYA 1A21A 3GMRB 1B2WL 1NQBA 1AY1H 2P8MB 2Y1VA 2ZNWA 2D7NA 4Q9CA 1KACB 5FA3A 4XI5D 1PD6A 2ADJA 3OGCB 1DLFH 3LDBB 5L0QB 1IEAA 4QRPA 1TCRB 3DVIA 2VAAB 5A43C 3VGFA 1XIWB 3VXME 3IDGA 3E2HB 4D0CA 3DUSB 4IJ3B 4UU9B 3F7PC 1IAIM 5BS0A 5IHUH 4BKLA 4W4NA 3RY6A 3L3HB 4XX1E 3ZZ1A 3U6RB 1CGSL 4JRYB 2HVJA 3H7BA 1WV7T 4JG0L 3T3MF 4XCNB 4NM8L 5HHPB 5GJSL 1GGIL 3CVHA 4RMVA 3IU3B 4LQFH 2GHWB 4HV8A 1JTOA 1C16B 1OARL 5CUSH 1A2YA 3UJTL 4HFUH 4IIQA 4YDIH 5EOCH 3IETA 5I30H 3SGKC 2Y5TA 5J6GB 3IFNL 5E9DE 2BNRE 1A3RH 1CLOH 4KRMB 4KUZH 1MHPH 3K8LA 1UQSB 4XP9L 3PP4L 4U3HA 1WTGT 4M7LL 3AUVA 4IBLT 4OZHF 3DBXA 4P2OA 2XA3A 3DXAE 3QT2A 5BW7C 5E8EB 5B38A 2GEEA 3FN9A 4KDTA 3U7YH 4LU5L 1MVUB 3CUPA 3TYFA 1KJ2B 5KANI 1YQVH 4KHXL 4R8WH 5GGTH 4ZYKB 4WGVB 4UQ2A 3VGGA 1DEEA 5D93B 2ZUQB 1JWSB 5D1ZB 2NXYD 3NFNB 1CXKA 3G04A 2QQKL 5E94A 3QXAB 5SWZE 5B8CA 2DIBA 3PWVA 3P4LA 2FD6L 2PXYA 4MDJB 4PJGA 1EMTH 1JZ8A 2YD8A 4O4YH 1Q9LA 5EB9A 4H88L 3MRGA 3CVHL 5T3ZH 4YXKH 4MJIA 4JO1L 5LJYH 5I1CH 1KB5L 1JPGA 2ED8A 4N0UA 3KPOB 4LLDB 1W0WA 3I75A 3MJ8B 3EJJX 5DHXB 4F3FB 4OM1H 3RNQA 4RWHA 2BSTA 2HT2D 3ULUL 2HLFD 5IVXB 2YMXH 2ILLA 4GS7C 5DD6A 4M8QA 3SDCC 3QUXB 2ZCHL 3LKPA 1FL3A 5GGSB 3QUZD 1LP9B 3QXDB 3QQ3A 1OW0A 4WEBH 1LP9F 3QEUA 5E7FA 3GMNB 5GS3A 2VR9A 5DJYB 3HB3D 1QSVA 1MIEH 2LAAA 1ORQB 2I5YL 1J8HD 2VZVA 3G5YB 1AKJA 3DTXA 3N85L 4HZAA 4QYOA 2FATL 2VNCA 4IHOA 4PJ5D 2P5ED 5ANMA 4PJXE 5KOMC 1L9MA 5B21A 1JNHA 3KYAA 3D39E 1K3ZA 1ORSB 4ZNEE 4Q9RL 1UWXH 2XY1A 3GJFA 4GRLC 3CU1A 3VMNA 1U95A 3LH2L 1FSKC 4NGHH 5LBSH 2EDXA 1OAXH 2CSPA 3HPLB 4ZQKB 3V9FA 1NL0H 2VAAA 4KKCC 5ADPH 1CTNA 3X12A 3IFOB 5IHBA 2OK0L 2XACC 2XTJB 3UBXA 3ARPA 5I66A 3DVGB 2EH7H 1MPAH 4XPFH 5E7BA 4PGBB 4Z7WE 4K3JL 4JQXC 4F58L 1XH3B 3MLSL 4RMQA 2BK8A 5E4EB 4JJHA 1XEDA 1LO5A 2BVUA 4LASH 3MREA 3S37X 5FO9B 3TVMA 2FX7H 35C8L 3NAAH 4JPKL 1L0XA 1XF1A 4G8GA 2DIJA 3T8XA 3QCVH 2H32B 5DJYA 4E5XA 4ZS6C 1T2QH 2AEIT 4NN5B 2QKIA 4U05A 5FO9A 2HFFB 5BVJA 1JI1A 2HTKC 2WBJB 1X7QA 1W0YT 2J6EA 2APFA 4PLJC 3VFTA 3FFCE 1E6JH 1KJ3L 4XCFL 3RIFF 3F65A 1BD2A 3HG1E 1RIHL 3REWA 2VDPL 4OLXH 3CZFA 1TQCC 1F58L 4XAWH 4XXCC 4Y16D 4YPJA 3OJDB 4HJGA 5LGHL 3QWOB 3ZKXB 2J8UF 4J3TA 3W9DB 1K6QL 4K55A 4DZ8A 1RZKC 2HKHH 2ENSA 5GRYA 1TZIA 4YHPA 1EEYA 4HHAB 3V6FA 4RFOH 3HG1A 3GBNH 5TE7H 3RL1A 4XZUA 5GS0C 1CFSA 4LSRL 4UV7H 5FUOH 3K80A 2DQEL 5FV1L 4GMTL 3TFKC 1JJUA 4X83A 5FK9B 4JEGB 3RVWD 2CKBH 4Z77B 1KIRA 2AK4A 5I19H 3R1GH 2PUQT 5EUOB 1MREH 1FH5H 2AEPL 2NY4B 4OZHE 4M7KL 3EOTL 4LVHB 3SDCB 4JPVL 4KK6C 1G84A 1TZHA 1IFHL 4JKMA 3WLBA 5I1IH 3SKNA 2EDWA 3BUYA 5K9OB 4QXGH 2FJHA 1S5HB 4OCRL 1F90L 2Z31A 4I3RH 3BKCH 3NFSL 5TF1H 4FQQA 1FORL 5J1TC 2R2CA 4EDXB 4JQVA 5FO7B 3ARGC 1Q94B 1U8JA 1YNKL 4AEFA 3A6CL 4KTDH 4OGYH 2P46B 2ZUXA 4HWUA 2NY2C 3GMRA 3CIQA 5A40E 3EGSB 4Z78A 1J1PL 5EOQH 1C08A 1Q9WB 1NBZB 1RUQL 4ODUB 3I2CL 1RFDL 1TZGL 3DX9A 5JOPE 1R5WB 3H7LA 1S78C 1TTFA 4FABH 4H0HB 4ELMB 2XZCH 2NY1B 1X4ZA 3RTQA 3D5OF 1MY5A 3RPIB 4GLRI 1HH6A 2XNAA 2GJZB 2ZKHH 5IJVA 2ADGA 4F8QA 5L2JA 4RQQB 3PHQB 4R0LC 1S9YA 4G8GB 4GRLA 3PNWA 5K9JH 1NMCB 2IFFH 1HN1A 2Q3AA 3V6OE 5M7QA 4BFGA 4HG4K 3O6LH 1JK8B 4Y4KA 3GM8A 3FQWA 3GJEB 4S1RL 2FEDD 1RURH 2GTZB 5LXGL 4U2YA 3SO3B 3H9SD 3ZKMC 4YBHA 5DUBA 5EO0B 3VRLF 5K33A 1CE1L 2OMNA 4JG1H 4OIIH 4LLQB 1BFOB 4EI5D 3VXUE 2W38A 3DMMD 4L5FH 2FECI 5KG9A 4NNPL 3GMQA 4A6YA 1N4XL 5KSAB 4X7TA 1DBJH 1AR1C 4MVBD 1D9KD 3JV6B 4S2SA 3AS3A 3BESR 4TUJB 3DPBA 2O93L 3TNNA 2OTUA 3VXRA 4UT6H 1GOFA 4D0CB 1DJSA 1F3JA 3ZE1E 1NEZB 4WU7B 1MHHB 4OCXL 4I4WB 4LRIC 5JXAL 5HD8D 4U2ZA 1R24A 2F74B 5IT2L 3LQZA 4UZGA 4WW2F 4V2BA 3KYMA 4ZPVA 4F57H 1YEIL 1OCWL 3CLEH 1S7WA 2F19H 4GAJH 3L3OA 3FRUB 1JV5A 3EJZD 5TE4H 3DLQR 4KJYA 2FEEL 1C12A 2IALA 4UTBH 4PJEB 1QACA 5GGTA 3I50H 4UIMA 1BZ9B 4NO0D 2YRPA 1O7VA 1MCNA 1H3VA 3MJ7B 4Z76B 3HC0B 1MCIA 4YHOL 1KJVA 1ZXQA 2EDQA 3QFJD 2JKXA 4A6YB 3RUGA 3RDTB 5J8OA 3O9WC 3HRPA 4RDQG 1E6OL 1H0DB 3IDGB 2N7BA 5C09E 1I9JL 4OI9A 2DDQL 4PP2B 5TPWL 1OW0C 2CD0A 5KTEL 3LVEA 2DKMA 1A6ZB 1CR9L 3BPNC 1J87A 1IEHA 1HILB 3GRWL 1KN2L 5EOTA 4YC2B 5HHNB 3FAXA 4F7TA 1BZ7B 2PYEE 2VOTA 5GRUH 3AXLB 3TWCH 5E2UL 2C5DC 2XKNB 2BSRA 2BHYA 2Y7QA 2VL5A 2XZQH 5D7IF 3REVB 5KN5A 5H37H 2AXFB 3QQ4B 4N8VA 4YO0A 1C1EL 1D6VH 3RX5A 4G3YH 1ZWIB 3VRIA 1FAKT 1T89A 4JO2L 2PR4L 3B9EA 4PRPB 3DX8A 1DVFA 1PQZB 4AG4H 1PKQB 3QIWD 4JO4L 1LO2H 1MIEL 1I3GL 4U1LA 1S7RB 4XI5C 1QLRA 3WS6A 4POUB 3WEXA 1FH5L 3I3EA 3SEPA 2YKLH 1MCOH 2LVEA 1UJ3A 1P2CA 2YPLE 4JHBA 1PLGH 4IOFC 2RBLA 5F96H 1FAIL 4F9PC 4WW1B 2A6DA 2X70A 4Y4HA 1UM5L 5CS7A 1WIPA 5CSGA 3S3JA 5SWQB 1DANT 3N1FC 1A8JH 2E8ZA 4UILL 2VITA 5HI4D 3RIAK 3UZEA 2BNRA 4WWKB 3GBNL 3LPWA 1AI1H 4YK4B 5SWSE 3VJ6A 5DMYA 3ARQA 3FAWA 2VDKL 3OKEB 3TJEL 3Q5TA 1YNKH 4G42A 4S1SL 4H20H 2E27L 3LB6D 5JUEH 2HJLB 5IR1A 4OIIL 5FYKE 5KVGH 5CGTA 5DQ9B 3WUWG 1XCQA 3J7HA 4OQTA 2XQYK 3MXWH 3OJVC 3LSOB 4G8EA 2DYPD 5DJ2B 5MEQA 5EU3A 1U2HA 2D7PA 4KK6D 2APBA 4OD3H 2BHZA 3G9AB 2XOTA 3QZWA 4DAGH 4HKZB 3SGEH 3QUMB 1JUFA 5HYJA 5HVHB 5ACZA 5FYLL 1JRHI 3SE9L 2C1OB 1FE8H 3C2AH 3R06B 4ONFL 2CKBL 1CFBA 2VDRH 4JG1L 3CMGA 2R69H 1BQHA 4L1DA 1KC5H 1RJCA 2IQAA 3VU2A 4FA8A 2YPVH 1MAJA 3SY0B 1JYWA 4MJID 1OAQL 3W2DH 1ZTXH 4S11A 3U4BH 1LK3H 3QFJE 2EXYC 3TN0D 4HUVB 3HZYA 5C0BA 5E94B 1NGZB 4JRWA