3S8WA

D2 domain of human ifnar2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
100
structure length
77
Chain Sequence
SFEPPEFEIVGFTNHINVMVKFSLVIEEQSEGIVKKHKPEINFTYIIDKLIPNTNYCVSVYLEHVIKSPLKCTLLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interferon alpha/beta receptor 2
publication title Structural linkage between ligand discrimination and receptor activation by type I interferons.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein receptor
total genus 11
structure length 77
sequence length 100
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s8wA00
3ETBF 3M1BA 4FZEL 1MVUA 3CLFL 4RAHA 3FQNB 3SN6N 7FABH 1XEDA 3HE7D 4S1RH 2GYSA 4JN1H 3DIFA 4ZFFA 4FNLL 2NY6C 4MMXC 2VXTL 2JIXD 1EO8L 3FT2B 4GW5B 4P46A 4NJ9H 5LQBH 4WW2C 3GHEL 4M93B 3C09C 4LVOC 1DUYB 3LEXB 2BRRL 3PHOB 2CRIA 5I18H 4Y2DA 2AEQL 4CGTA 4K3GA 4Q9QH 3H3PL 1JCKA 3VFUB 3P77B 3SHSA 2X70A 1WK0A 3HI1A 1FFNB 5F9OL 3QDGE 1EERB 1A7PH 3LS4H 3ILQD 4LQFH 3WLBB 5CSBA 3UTSA 5JZ7D 5C9KA 1URLA 2DBLH 1F4HA 1TETL 3V6BR 3ISWA 3P0YL 1I7TA 3IKCA 4M6OH 1UM6L 1FYTD 3OZ9H 5GZND 2VLLA 4O4YL 1M05A 1SJEB 3SJVA 3VD9A 4FQHA 2MHAB 4YDVB 1JNHA 3DUHA 4Y8DC 3S88H 4ERSL 3G04B 5E99L 4G5ZH 5HYJE 3WIFB 1JWMA 1UG9A 3VRJA 5A2LH 2PCPB 2VC2H 3WE6B 1QP1A 1RZ7L 3IDIB 3IVKA 3MJ8A 5KSAD 1Y18B 5L88L 3VFRB 4ZUWB 4P23B 2C4XA 5C0DB 3GSRB 5KSBB 4LCCA 4PJ9B 1QNZL 4RX4D 4XNXL 3MX0A 1AC0A 1DBML 2APXA 2BVOA 2VDOH 1G7QA 2VZUA 2DQUH 1I85C 2A9ML 1MJJA 1EXUA 2F54A 3GHBL 5EUOB 2Q76A 3SDCD 4ZUUA 2DM2A 3V7AE 1JVKA 4KRLB 2H41A 2HTLD 3O0RL 2OL3H 4MJIA 3V0WH 3FB7A 3MRKA 3QWOA 3BO8A 3GGWB 1I3RB 1XCQA 2ZJSH 5DWUL 3JWOL 3RTQA 1IL1A 3VFVA 3P9MB 3IDNA 2RAMA 4NN7B 5KTEH 4P59H 4LNVA 4P2QD 4WY7H 4MVBC 3UYRH 4JY5L 1GIGH 3OAYK 1JNLH 5E2UL 1MREL 3CFCL 4KZEL 1TVHB 1C7SA 1R24A 4GLRI 3LMJL 1S7XB 5FKAA 4G3YH 4U0QB 1S9KC 5EBWA 1A7QL 2NR6D 3P4OB 1RU9L 4HIHB 2B4CC 4OIIH 3LN4B 2XNAA 4RGNE 4ELMA 5B38G 1L0YA 3DMMA 1J86A 1F3RB 1YEGH 1JV5B 2AQ1A 4DJMA 5FGBC 5B8CA 5FECB 3AU1A 5BQ7B 4YZFF 1ZLVH 3DRQA 1S3KL 3VFGL 4XH2A 1NDMA 2HVKB 3W0WA 5SWSB 1J1PL 3MV9A 5EZLA 4XNUL 4PGBA 1A2YA 1GAFH 2GY5A 2AK4A 2R0WL 3C60B 4XNMA 3QNZB 5L7XL 5CD3A 1VGKB 3BP7B 5F6IB 1ZLWK 3U0PA 1G7JB 1TZIB 3O4OC 3ARDD 3Q3GA 3MJ7B 3T3ME 3VG9B 1D5MB 4CW1A 3MR9A 1XGYH 3PWNA 4V1DD 1UQSA 4NO3B 3MZGB 3KYKH 5CZVH 3QNXB 5FCUH 1ORQA 4NQED 1AI1H 1CT8A 2D4FA 4MYWB 1G1YA 5HY9B 3V5HA 4JM2A 3GI9L 5KSBE 1NCBL 3AS1A 5DJXA 2B2XH 4HH9A 4UIKH 4IM8A 2X5PA 1F4XL 2WUBL 3ZTJH 3QXVA 4NFCA 1YEFH 2NXYC 2ADGA 5EUOE 3EJZC 4PRBA 5DJYB 5HVGB 1CDYA 1G7IB 5FYKU 4I0PA 3DO7B 1CXFA 4PJ7B 1F11A 3V2AR 1C12A 1U8OA 3H0TB 3GSWA 2BJMH 4JZOB 4BSJA 4JDZA 4JR9H 2DDQL 1HIML 2APFA 3QFJD 3R0NA 3LKOA 2HRLA 1SJVA 4PJHE 3WKML 1LO4L 5I2IB 5TQ2H 2MKLC 3RFZC 1KGCE 1OF2A 4XVTH 5FKPB 5A16A 3UJIH 3B43A 4D0DB 5T3XD 3GMLB 1AQKL 4Z7UF 4LMQE 3AY4A 5FDWB 5KOMC 4U6TA 4LCIH 1N8ZA 4ZO6A 3QCTH 4FXKA 3GKWL 1RD6A 3QJHA 2HJLA 5IFAL 4WTZG 3NFNA 1WC7A 4GW1A 5ICZA 3VFOA 5AD0A 1HXMA 5SWSE 5GS1C 1ZA3B 3GEWB 3WDIA 3NA9H 1DR9A 4NHUA 1FAIH 1JF6A 1W0WA 2Z31B 1CL7I 2E7BA 1HHJA 1AE6H 3FFDB 1MPAH 4O5LH 2HG5A 5TDNA 3CDYA 1KCSL 4D9LH 4DOHB 1H5BC 1RIVL 5E1AB 5I6XC 3TFKD 3T4AB 5DTFB 2D4DA 4OM0L 1ZVYA 5C08D 2CRZA 3QIUC 4HLZG 3RIAF 2OL3A 3D85D 3BP4B 1OAQL 1JYXA 4Z95H 3HAEH 4JY4A 1FLRL 1N5YH 1W72L 1CN4A 12E8L 1FRGL 4PG2A 4NKMB 3VGGA 5EOTA 2CO7B 3ARPA 2JJVA 2DLIA 1T2XA 1IAIM 5HGAB 3ALXA 2IFFH 5DFVC 5FF6B 1U92A 1UM4L 4PD4K 4PY7B 5DK0A 1VGEL 1KULA 1S5IH 1PG7W 1YDPA 1ZGLM 4GO6B 2Z91B 3L3HA 1AY1L 1B4RA 2BNQA 3NCYP 1Q94A 3CFDA 1KN2L 4XNZB 4M48L 3JV0A 3OWEA 3QAZB 4PJ8B 5HI3C 5I1JH 2WZPD 1HNGA 4PJ7E 3OX8A 1U3YA 1ZEAH 5GS2D 4G42B 2CR6A 4R2GD 5JUEH 4L4VB 2DM4A 5FGBA 2RBLA 4KUCF 4OLZL 5T1MB 3MPCA 2CKNA 2CK0L 3DX6A 4L3EB 4ZO7A 4U31A 4CMMA 5FUOH 1EEZB 4PP2B 2I9LA 1JP5A 3U6RB 3OB0H 1NFDA 1VKXB 1I1AC 2FJFB 4LVHC 4U6VL 2YC1B 1YYLH 1I8IA 1Q9WB 2VXVL 1UT9A 1W72A 2VN4A 1J0JA 3EOYG 4NIKB 4NO0B 2FSEA 2Z93B 2QSQA 5HHOB 2PYEA 3EJJX 3QR2A 2PXYD 3V79C 4QHMA 4ZAKC 4OZHF 3TZVC 2R0LL 4XPGH 2C1OB 4I3SH 3CIQA 4LHUD 3LKNA 5F1OB 1E28B 1MRDH 4IRSB 1G7PB 1L9MA 1T04A 3MUGA 1E6JH 1RIHH 2J5LC 4DVBB 4TUJB 3OKEB 1KIQB 4MNQA 4X5XA 2A9NH 2P5EB 4DOHE 4LKCA 4XVSL 3R1GH 2VABA 2Q86A 2F58L 3DWTA 2ICWA 2VAAB 4FMFA 4HC1H 2BVEA 1OLZA 3BMVA 4JKWA 5EBGA 4RNRB 2D7TL 4PJEA 1CZ8L 4WHDA 2OXHA 2HJFA 4WWKB 4MNGB 4RWYH 4Z77A 2HMID 3U30B 4PJAA 4ZODA 1G9ML 4PB9H 3PXJA 4G43B 2ILLA 2FECI 4K23H 3MCG1 2JJTA 3PWPD 2DQFB 4E42A 2A83A 4EKXA 2FDBP 5I74C 4YBQC 3F58L 5FM4A 5HD8C 8FABB 4CVZA 2ERJB 3DX9A 4HX1B 4OCYH 4OCRL 2LQRA 4JFDD 2A6IA 2P8MA 1N4XH 3DUSA 1YMMA 1MFDH 2FHFA 1IVLA 4P3CH 2QKIB 3EO1A 4LLYA 5ILTH 2R9HC 1F45A 15C8L 1HH6A 4L4VE 5T1DH 2DMCA 4HUXB 3EGSB 2K3TA 2V6HA 4L3EE 1OL0A 3WXWL 1MQKH 3BX7C 3EOTH 4XVJH 1AGFB 4JRXB 5GS1A 1KB5H 4RZCB 4V2BA 2P24A 2HFEB 4NO2B 3UDWC 2KH2B 3A6BL 1TZGL 3DARA 1RMFH 2VITB 3DSFH 5IMOA 2C7UB 4AQOA 1D5IL 4PRPD 4Y5YB 1FBIH 1H5BA 5IMLB 2AJVH 3KLSA 4JZJB 3STLA 1T83C 3IAGC 5HHOE 2D9QB 2R2BB 2W9EL 3I85A 2IH1B 4OZ4B 2NW3A 5IW1B 1OB1A 1CIUA 1UXSB 3HAEA 3QIUA 4KAQL 5C0EA 1W8NA 4HT1L 4FABH 2J8OA 1INQB 4BA8A 3KS0J 5EO1B 1XZ0A 2ZSVB 5IBLD 3BEVB 4JFEB 1N6QL 4HFUH 5FYKE 4K55A 4JO4H 1KIPB 1DN0A 2QQKL 4JAMA 2H8PA 5L2KB 5T1KA 2P5EE 3CFJA 5DMGD 3T1FA 4Y4HB 3TCLB 5FYLE 3AC0A 3N1PC 3FT3B 3V6FB 5AZ2H 4P4RA 4FQQB 1KPVB 4DGVH 4X4MA 3ARWA 1MRCH 3QDMA 5IVXF 3TT1H 3TO4A 4IOIA 3C5JA 2W0FA 2G75B 2COQA 4MS8D 4MNGE 1A6UH 2MQ3A 4XMKL 3QCUH 4GW4A 2Y07H 1PAMA 4OCSL 1R3IL 4ALAH 3PNWB 4PRDB 2JKXA 3UTPE 2L4OA 5DURB 2HH0L 4QHUB 4UI2A 3HNTL 5CBAA 4K9EC 5C2BH 3TV3L 1CBVL 4DTGL 3S3PA 2FNBA 2X9XA 3OKOB 1LNUA 4K8RL 4LARL 5JXED 5KW9H 3L3JB 5F88A 1TVDA 4R26L 1RJYA 2ORBL 2JTDA 4NNXB 3HCVA 4M1GL 1RZKC 3VXRA 3WUWA 4GFTB 5H94B 4U1HA 4G8IB 1RZKH 2E7HA 2ZCLL 3MXVH 4NNPL 2YK1H 3NABL 2X4QA 3RWIA 4JRXE 1S7WB 1BD2D 2F74B 3JV5A 4PREA 3U4BL 2AJXH 4BFBD 1MCBA 2I26N 1HSBB 4QRPB 2GJZB 3ULVC 4YIQB 5GRUH 4UOW0 2QJDA 5B3JF 1VFAA 2MKWA 1JPGB 3FB8B 3QXDA 3ULVH 3BAEL 3NCFB 4HC1A 3E8UH 5EORL 3WO3B 3C5ZD 2DN7A 3ARFA 3BJ91 5D71H 4AM0B 3FRUA 1FNFA 2BVYA 4AMKH 1T2QH 3S36L 5D7JC 3O2DH 3S96A 5DQ9B 1BWWA 1X7QA 2KUTA 4XPTH 2KQMA 1OP5H 4QRTA 5AZEL 1MI5D 3ALPA 4JFEE 3WIIL 1X5JA 4XBGA 2ZUTA 1NGPH 3BEWB 3I75A 5FOBB 1MIEH 2R4SL 3QEHA 5L2KE 2ZKHH 2YS4A 4WHTB 4Z7VA 1F6FB 4ZPTA 2FGWL 3IT8D 2DICA 2QHLA 3IETB 1BZ9B 4NGHL 4NDMA 2Y5TB 4N8CH 3E0GA 4M9PA 32C2A 1ZGLB 3BPLB 2AXFB 3PHQB 1KENH 3B2UD 5E08H 1ZV5A 1NUFA 2AV7A 3MROA 4HXBL 2LV4A 3T77A 5IFJB 4LHUG 4U1KB 5C0FB 4HCRL 1IT9H 2C1PA 3UBXA 5KS9F 1I1FA 5DUML 5IKCA 3EYOA 2X9YA 4RMUA 3P11L 4NN5C 5I16A 4NQSA 1DANT 5KVGH 4GMTH 5C0ND 4QEGA 3VE0A 1KB5A 3PV7A 1PLGL 2X4TB 3REWA 1WTGT 1K5NB 3PGFL 5SX5K 1JGVL 5D6DA 1OARH 3UDWA 3JTSA 3ULUC 4XX1E 2P42B 2VLRB 1I8LC 4J8RA 3ULUH 4S1SL 3O9WA 1QFUH 3ARUA 1T83A 4G6KL 5IJVA 1GHFH 4POZD 2H6PB 2XTJB 4E5XA 4JVUA 3NH7H 2B0SL 4KHTH 3MRLB 1FIGL 1FG9C 4HK0B 3V0VB 4F37K 5ICYA 5C6TL 4LLUA 1IJ9A 4GT7A 4AG4L 4QRPE 4TNVF 3FFCA 5E6ID 3MOBH 5HHVH 4KVCL 1Q9KA 3OKKA 3RL2B 3MA9L 3Q5YA 2R0ZH 4HUVA 2C4FU 3T0VA 3GM0A 1KTLB 3GMRA 1GGUA 4CBPA 1OOAA 3GBNH 5DHYB 1EFXA 4IRJA 4KK6C 5ENWB 4LK4A 1MEXH 5EUKB 1MFAL 3WNNA 3VI3E 3ULSA 3V4VH 1WZ1H 1IMHC 1R3HA 3ARTA 3C9NA 3U2SB 3ET9F 4X7SH 3E3QE 3S3JA 2GEEA 3EZJB 4N9GA 3RWEA 5TGBA 2A6DA 2BMKA 4ZTOH 5D6CB 3G5VA 3MLRH 3CVHH 3LN5B 1NCDH 4ZS6D 4HS8L 1ZA6B 2YEZA 5INDB 1GGCL 1QACA 1YEEL 3UJTH 2FJHB 2Q3ZA 3BZ4B 1ZLSL 5HSFA 1XFPA 5EZOL 2W9DL 4ZPVA 5TH2A 4OIBA 5D2NA 1QEWA 5J3HD 5EWIH 1VFUA 3FQUA 5CGTA 5I66A 4LLDB 4YC2B 5BVJB 5D7SH 4XWGL 4E9LA 1Q0YL 3QA3A 3WJLA 4PJFB 1KTRL 3RVVD 3D39B 4NNYB 1MRFL 1G7MA 2XZCL 4AENB 5F71A 2BSRB 4GRWB 2ADFH 3CDGA 3BDYH 5D96C 4BSWB 4C56D 2BNRA 3GSOB 5EU6A 3QJFA 2YUWA 4JLRB 3EYFB 4K94H 5L8LB 3VJ6A 5I1GL 4EUPB 2VLRE 1LEKA 3IJSB 4PJCA 4I9WE 5I1EH 1FG2A 2R1XA 4F3FB 4RMSA 2XTJE 3EOAA 1ZLUK 5JXAL 3OAZK 3O3DA 4K3EH 3O2DA 5DF0A 5GGUB 1T5WB 1U8KB 3S9DB 3SDDA 1JJUA 3ZYOA 2F9BT 4X99A 4RISH 4R0LB 5DVLA 4C83A 3FTGB 2Y7QB 3DUUB 1QHOA 3U7YH 3U9PL 4PRIA 4U3XA 3EHBD 5E94A 3SQOH 4MJ5A 1YJDC 2UWEA 1MWAL 3TIEA 4KKAD 1YJDH 3K4AA 3QO1A 3CFKA 3NZ8B 4OLUH 5SWZB 4GUPA 4HJ0C 2CDFA 1MIMH 4QT5B 4QRRB 4LCWA 4QRUA 3A67L 3W11C 3OKDB 3WN5B 2GTWA 4ODBD 4QY8B 4HJJH 3MSPA 1S5HB 3THMH 2XWBA 3L3GB 4GAGL 5DJ0B 3TN0D 1U58A 4M1DH 5FYJD 4QOKB 1W0VA 4XP1H 3T0AA 3J8F7 3OG4B 4RIRA 1G9NL 4KTEL 4NZUL 2PO6C 4IRZH 2VISA 4S2SB 1EEQA 2DQGH 5DJZA 1DBKH 2DQTL 1IAOA 4ZFOA 3L5IA 5J6GB 2YBRA 1LEIB 5ID1A 1XGTB 4WUUB 1XIWC 3NCEB 1JMZA 1AKJB 4GQ9H 4N0FB 1ADQL 1JGDA 3T3MF 2V2TA 1AHWB 5GSVB 4UNVA 2IQAB 1QR1B 4P46D 1RUKL 3EUUA 4JRYA 2AKRA 4IIQC 1ND0A 4WFHE 5GS0L 4KV5E 2CR3A 3H9SA 5T3ZE 1OGTA 4PJFE 3D39E 2Z8VC 4BFIA 5BS0D 4YUEL 4QHNB 2GTZB 5HYIA 3UJJH 3N1QC 4GRWE 3PP4L 4F7TA 2Y6SC 2ZUUA 5KSBF 4ODVH 3CFEB 2P49B 1CF8L 2VLJA 4LLWB 3AXLA 1T20A 1V7MH 4P3DB 5EUOF 3NCJH 1UJ3B 4MJ4A 2NY1D 2XPGA 5CILL 2PN5A 4KQ3H 1IFHH 4X0KA 5J6HB 3HE6A 4HWZA 3B9KA 2J12B 3HA0A 3VXMD 4I4WB 1OM3L 1A3QA 3RX8A 4BQBA 2BDNH 4OZGA 3P3YA 4J7RA 4NUJB 4KI1A 1JN6B 5H35B 2XN9B 1ED3B 2A77H 1FNSH 2R29L 1TQBC 1VPOH 4A2MA 1ZANL 4LKXA 3DO3A 4GAYB 1KCUL 3MRMB 3H3BC 1P84K 5DJAA 3VU2A 2EDKA 3L3DA 4Q2ZB 1H15A 3NN8B 1AGDA 1I9JH 1K6QH 1FNEB 2JB5H 2R1YA 1H3PL 3NFPA 3OKMB 4N8VG 1ZS8B 1RI8A 3OXSB 1U8QB 3MQIA 1X5HA 3GMPB 3NIGE 4GBXC 5SWZE 3KHQA 3Q0HA 3ORJA 1QKZL 2ZUWA 1WZMA 4QRRE 1JWUB 2KPNA 5KZCD 5INCB 1BAFL 1ZXQA 3GI8H 3LHPL 4UOW1 4U1SB 3O6FC 1WV7T 1K8IB 1X5GA 4G8FA 4L8BA 1KFAL 2F54D 4MZ2A 1EEYB 5IBTH 4QOKE 3O3BB 3QG6B 1PKQB 3MV7A 5J1TC 2ESVB 4NQCA 4EDXA 2E6PA 1Q0XH 4PG9A 4D2NA 4MJID 4BYHA 2V9QA 3S5LG 4BM7A 1BOGA 2J8UB 2H26A 3TNMB 4FQIL 5BRZB 3RTQD 5IVZB 4L4TE 3KYAA 5CIPH 2VUOA 2NY2D 3F5WB 4MCZB 4WUUE 3T8XB 4YHLL 2FH6A 4QXTB 3K1DA 5KVDL 1AJ7H 1EPFA 4ZOCA 1ZTXL 5FUCE 5B39B 3RUGA 2DTMH 4P9HC 1U3JA 2CSPA 4OLYH 3KLAA 4P9HH 4YDLC 1LDPL 3RVUC 3MRBA 3S3SA 3FO9A 3WLWD 2D2OA 1TJIL 2G60H 5E8DH 4Y8AA 3SCMA 5HGHB 5IB1A 3S37L 5I75B 2OP4H 5IB2A 4Z78A 4LASH 5DUPH 4N0RA 2YD8A 1RFDH 4RGMC 5IQ9A 1JPFA 3QUXD 4WV1B 4OKDA 4JGJA 5FUZL 1SYVA 1BVKA 4YPJA 4CJ1A 1IQDA 3MV9D 3KDMA 3WFBL 4AIZB 4WO4C 4RFEB 1LEGA 5ID0A 2XN9E 2FRGP 3HZVA 3SGJA 2DQEH 3P2TA 1QFPA 3MLSL 3OKLA 3RZCB 3BZFB 1ZT7B 4LAQH 5F8RC 4UDTA 5IG7A 2E7LA 1FJ1A 4Y5XB 3STBA 1S9VB 1ORSB 3PP3H 2XKSA 4OFDA 1UKQA 2NW2B 1JL8A 3TT3H 3MO1B 3IXAB 1FNAA 2YSSA 4Z8FL 4EI5C 3MRRB 3OR6A 3WNKA 4HPOL 4JM2D 3RRQA 1XIWA 2ATKB 4U3HA 4W6YB 3KVQA 3HNSH 3MLZL 4YFLF 2XXCB 1IRAY 2LABA 4P57B 5F3BB 5F1NA 4IIQA 5CJQH 2AJUH 5SV3A 2KZ1B 4RA0C 4ORGA 4IJ3B 2BOCB 4KU1A 4KC3B 3U79A 1PKQE 1ZT1A 2ESVE 4WI4A 5F9OH 4I0PD 2VWEC 5EBLA 1IKNC 4CN6A 4MXWL 2J8UE 3FMGL 4PS4L 5BRZE 1B90A 1XF4B 3IFLL 4UT7L 3VFTB 3D2UB 3KNBB 1NC2A 2PTVA 3HLAB 1RZIB 2DD8L 1UFUA 2CLRB 3G5ZA 4NZTL 5JPMB 3VWKA 1V7NH 3BMWA 3QUKB 4CVUA 3BD5A 1NEUA 1J88A 1T0MA 4TUOB 1NAKL 1FL3A 3W9DB 1IARB 5DEZA 4OD2B 1A7BA 1R3JA 3BSZH 1FSKC 2Q7YB 1RPQA 2XICA 4XPAL 4MD0A 3WLWC 5EB9A 1YEJL 3K8MA 1BFVH 1TITA 4U05A 2QSTA 1MUJB 2FATH 3EYSL 4KROD 4XTRC 4Y4KB 4HS6B 5C0CB 5D93B 4Y16C 4M62L 3L5WB 4B5EA 2E27L 3MLTA 5IROC 4XAKD 4AT6B 1H3UA 3FZUC 3BD3A 1QA9A 3PDOB 3SDAA 2A9MH 3PGDB 3ZKNC 2FHCA 2YA2A 2FIRT 2PR4H 2DS4A 4DCQB 5ERWA 4OBSA 3ILPB 5M7QA 1S7QA 1UB6B 2QQNL 1N3NB 5CSZB 5HYFA 5GPRA 1DEEB 4XCNA 4M7ZB 4NQDB 4EN3C 4KK8D 2NTSP 1G7LB 3AAZB 2IJ0C 4M7LH 5IQ7L 5IF0A 3VXPB 4YHOL 1CXLA 1BF2A 4HIJB 3HC4H 3BUYA 4MJ2A 5HHPA 2NY0B 3QI9A 2VQTA 3MGTA 2Q87A 4YHIA 3ZHDA 3QRFM 3T2NH 5KN5B 3SPVB 5I73B 3OHXA 4WU7A 1T1ZB 4X9BA 2BNQD 5DJ2A 3P0GB 1BQHB 4BUHA 1DQMH 1K4DB 4P4KB 3KPRB 5BZDA 1J8HA 5CJBA 3UZQA 5C07A 4R96A 3X17A 4U6XA 1VEOA 2R0WH 2V7HB 4MA7L 3IJHB 5IGXH 1GZQB 2XZQL 1RAMA 1QPXA 1MOEA 2MCG1 4KK5C 5T1LA 4WO4A 2APWA 5BVPL 1RZFH 3K46A 5D1ZC 1KJMA 4WEMB 1JWSB 3MRIB 1KPUA 4N1EA 5D7IA 1QR4A 3S6CA 3UTTA 3JXAA 1II4E 1HWHB 4X7TA 4QHLB 3WSQH 3MOAH 2FBJH 2VDMH 1A14L 2W65B 3MJ9L 2PYED 2FR4A 5IW6A 3MA7B 5DMKA 1SYSB 1KIUA 4Z76A 1OAZL 5C0CE 3DSNA 5K9OB 3CX5J 1WBXB 3F12B 5LCVH 4M6ML 1LO3H 2R23B 1YUHB 2WUBH 1NFKA 5EU5A 3HB3C 2J1KA 3ROOB 3QUYB 4MNQD 2Z35A 3BGFB 1FAKT 4H0GA 1I8KB 3BP6B 3IFOA 4QGTA 4F9LA 1WF5A 1D6EA 2HAZA 1OT1A 4G80B 5BV7L 1IQWH 2IF7A 1WFUA 4J2XA 5BJTA 4NQDE 1U91B 4LCUA 3RKPA 3GSVB 5EDXA 4FFWD 5KJRH 5L6YH 1HOCB 5F7KC 1AGEA 3VFWA 1DUZA 4LOUC 4RQQA 2IMMA 2VDKH 1RUAH 2IAMB 1PZ5B 4PLOB 4I1NB 3FRPA 3VG0H 4RMQA 1FH5H 1MFCL 4JG1L 1QOKA 3PG2A 2P7TA 1J1OL 5EU4A 4BZYA 3D69A 4NN6C 3O4LB 5KOVC 3KPOA 4JANA 1YMMD 1S9WA 4PJGB 2GSGA 1UB5B 2F8OA 1AXTH 5ICXB 3LSOA 3KPRE 3ARGC 2IH3A 4OBRA 3GSQB 4X80L 2BVPB 1FPTL 3JZ7A 3TCXA 2DJ4A 2RJMA 2KKQA 4XMLL 3QUZA 4JFOB 5K59E 4PRAA 3MRGA 1R5WA 1IGFL 4R6UA 2DQHL 2K1MA 4RSVA 4GAJH 5C0BA 1MFEH 4XGZB 5ITFB 5IFHL 1AO7B 1CU4H 4JJ5A 5GGTH 2V2XB 2ZPKL 4Y88A 2XACC 3DPBA 4KPHH 5LAXA 1BP3B 2ZSWA 2ZG1A 2FO4B 4WW1A 3RL1A 4KGJA 1UENA 3VH8B 3HRZB 2PW2A 4N68A 5FV2A 4ODSL 5GRWA 4EN3A 3ARBB 1DQJA 4KRMB 3ROLA 1IGIL 4OZHA 4G6MH 3PWVA 2HA1A 1A4KB 1C1EL 4PTTB 4L9LB 2X4PA 3WFCH 1T66C 4P2OD 2CKBL 1KIRB 5T1KD 3PL6D 3V6OC 1FZOA 4F9PC 4M48H 5BW7A 1IGCL 3OPZL 5F9WB 4FQPA 1NLDH 4PJ5A 2E7CA 3TO4D 3QDJB 3TA3C 5JW4Q 3GSUB 3RDTB 3C87A 4Y5VA 1AR2A 4JB9H 1WBZB 5HDBE 1PD6A 5MP6H 5LGHH 4NM4L 1JZ7A 4N90E 4MA1B 4P9MH 5CEXB 4QTIH 3KPNB 5GGRA 2WM0A 5E1HB 1JHTB 2NTFA 2X2YA 4AJ0A 2NY6B 1OAYH 2VH5H 2VIRB 2VJXA 3HMWL 3KPPA 2CUMA 2X1WL 6CGTA 3ZMRA 4XC3H 3O4LE 4UOJA 4X4XB 5CSGA 4WW2B 4PJGE 5CEZH 3H6JA 2NCMA 4I18C 4Y4FD 3VXRD 1C5DB 4LLMB 2WNGA 2CKBA 4LLQA 3STZB 3WL9A 4RMTA 1NCNA 4N9OB 3JUYA 3HG1A 1DQDH 1WITA 2I60H 4KJQC 4LDLB 1OCWL 5K33A 1FZJA 4BH8B 2V9RA 3IXTB 1BIIA 4WWID 5JW3L 5DRZB 3JV6B 2WMPA 2V2WA 3BW9A 3QIBD 1H8NA 3MBEA 1Q72H 5IMKB 3R8BB 3G5YB 5DD1L 4DK3A 2F58H 3KR3H 4ZFGL 1AO7E 4FQLH 3QUMB 4G6FB 3BQUB 3HI6L 3TJHC 2XKNA 3MRHB 1CD9B 3H9ZA 1CFVL 1C16A 3QIWD 1MJ8H 3ARFD 2EEDA 2GAZB 5K9JH 1DVFC 5HI4D 3HPJB 3QP3A 4OGYL 4XWOD 2VXUH 1QZ1A 1QFWH 3ARED 3X11B 4K8RD 4KUZL 5DS8A 4F7CB 3PV6B 2NYYC 1DBAL 5GZOC 1QLEH 5C09B 1XGPA 4LSTL 4WU5B 4MDIB 5EFIA 2X10A 4KGLA 2F5AL 5DMIH 4WIQA 1KYOJ 4EVNB 4BZ2L 4L8CB 1R5IB 4X6DB 5MENB 2ICES 1EZVY 3LZFH 3JWDH 3VXNB 3D48R 5FO7A 2HT3D 3CXDL 3QDJE 2QSCH 4JFZL 2D7MA 3GJEA 2PNDA 4YE4L 5IVXA 2EH7L 1OD9A 1TTFA 4AK1A 1NGYB 2R2HB 3PQYA 4TVSa 4NZRH 3GIZH 2IBGA 1Z0NA 1WAAF 2C4FT 3ZTJG 3RNQB 3HE7B 1UC6A 3BH8B 4GKNA 3BDXA 1KNOB 5DEFB 1OSZB 1AXSB 4HXAL 4GKSB 2UVEA 3MCKA 2JIXB 1JRHH 1CDHA 1UCTA 5HI5C 3V8CA 1B2WL 3MRNA 3S4SA 1MCWW 5BXFB 2NZIA 1A6VL 1HHGB 1HSAA 3OJDB 3O9WD 1K8DB 5C0RH 4P5MB 1NGZB 4KJPD 5ESQA 2W38A 5J56B 1VACA 3W39A 4XP5H 4UNTA 2YN5A 5IR1A 5E8EA 5JORA 4O2CA 1FZMA 4WI7A 3GM8A 2NY3D 1N0XH 3FFCD 3PABA 4ODHH 3ESUF 3SE4C 2X1PA 1BF8A 5DJ8B 1U3HC 3PE9A 1NEZB 1QRNB 1WBYB 2OQJB 4KV5F 3V6OA 3DECA 1UWGL 5HHXH 4PJFF 5AYQA 2AI0L 1PVHA 4KTDH 1FYTB 3O4OB 4GRWF 1EFXD 4DVRL 5KG9A 1U8MA 4IRJD 4G8GD 3HNTH 5I15L 4DKEL 2O5XH 1JYNA 2NY4D 5DK2B 1F42A 2J2ZA 3G5XB 5C09E 3MACH 3ARXA 5F1SA 3O2WH 4L29A 2ICEB 3O41B 1FO0B 3VDBA 2H1PL 5A2FA 4HBCL 3TEUA 4OI8A 3DTXA 5D1XA 3O6KL 4X6DE 2IPUG 4LSPH 3TYGL 5MENE 4H1LB 4M93C 3HZMA 1HXYB 3DV4A 1DBBH 4L5FH 1DLHB 4HUWB 1J11A 3GBML 4PJDB 4AZ8A 1JF5A 3HAEG 3X13A 4I18A 4OAWA 1IGYB 2VDLL 3RP1A 1MJUH 2EDJA 5H2BB 4JZNB 4ZYKA 3SDCB 4LSSL 2FX7L 1NL0L 5T5NG 2O5ZL 3DURA 3IDJA 1RJZA 3NIGF 5J4MA 5C9JA 1NCWL 4DN3H 2J4WL 2HFGL 1L7IL 1BX2A 1RJLA 3CZFA 5C70A 3L6FA 4EBQH 4X98B 3QXAB 5EU6D 4U1JB 4XRCB 4B53A 5AG9A 2NX5E 4Q74A 3HPLB 1QLRA 1S7RB 1XGRA 1YN6A 3QEUA 3SGKC 2F53A 1QLFA 4PLNC 2UUDK 1FORL 4M6NL 1YNLH 4WNQA 1FGNL 3RX5A 3WNMA 1I1YA 1SVCP 4KZDH 1D9KD 4P23C 1HKFA 4XXCA 2CDGB 2GITB 2AABH 4HKXA 4PJ9C 2CO6B 5SWQB 1CFNA 1IBGH 1VDGA 4XHJC 1QRNE 1V8HA 4N0UB 4KHXL 1MELA 1P2CB 3WUWG 1P6AB 3FHAA 3BYTA 5H8DA 5I6XB 1FYTE 1P4IL 5GIRA 1T3FB 3GNMH 4LCWD 4XCFH 2LTQC 5GRXG 3P11H 4FXLA 4JHWL 3ARDB 2EE3A 4O58L 2D31A 4GJTB 1BVLA 3BKMH 5TDPA 4NKIL 1UH2A 4X6CB 4NN7C 1CDBA 1TJGH 3BJLA 3QDGA 3BH9A 4MB4A 4FQJH 4HPYH 1FNGA 4X7FC 3SKNB 2Z8RA 4NQEB 3SOBL 2BY0A 1E27B 4N0CD 2A74B 5D9SB 3D0LA 5FA3B 1QSVA 1HN1A 4KDTA 3RA7H 5I9QB 4K3JH 3HI5L 1I3VA 4JFFB 4PJDE 1NDGA 4R3SB 3QXTA 4LNRA 1JPSL 3CUPA 2VZ1A 3AS2A 4TTGA 1FIGH 1CVSC 3PHSA 4JRYD 1YEHH 4PJBB 1ITBB 2VKWA 5FO8A 3H9SD 4HUUB 3VGEA 4F15C 43C9B 5HYJA 1HQRA 4OF8A 1AD0A 5D72L 4S1DD 2CH8A 2R1WA 3QFJB 4Q0XH 3HC0B 4OGAD 5CUSL 5F6IC 5FIEA 1QRKA 1F4WH 4R8WL 4JPVH 2NY7L 3E6HA 2Y06L 2FD6H 2V17L 5C2UB 3LPWA 5B4MC 4HDIB 3ARZA 1B0RB 4D8PB 3Q6FA 4U2ZA 1MH5A 3HE6D 1LDSA 4K2UH 3B9KD 2AJZA 4BZ1H 1Z3GL 4FA8A 1OTUC 3UBXG 2EXWC 3X12A 1R6VA 4WI2A 2DKMA 2N4IA 2J8UF 1U8HA 2NY5L 1FVCB 1L7TL 1IC5L 1RUPH 1E4WH 2B39A 3FQNA 4HWEL 1EH9A 4OD3L 4RWHA 4U0RC 1I7RB 1CFSB 4JKMA 2FEDD 1MHCB 3FT2A 3TH2T 1TVBA 1U8JB 2PUQT 3QQ4B 1T7ZA 4XNQB 4N0UE 5EOQL 3ARYA 3V4UH 5GS0D 5HJ3B 1VFBB 1ZT4B 4LFHG 3DX7B 5ALCL 2VZSA 2O61A 5CHNA 4FQ2H 1DUYA 1GOHA 3DV6A 3PHOA 2O5YL 5E2VH 2I25N 1AQDB 1BBJB 3VFUA 1YNTB 5DRNB 5DLMH 3SE8L 2JELL 4C55A 2VMFA 5C08B 1KELH 1LO5B 2AQ3A 2GY7B 2I5YL 4A6YL 4WCYL 3GRWH 4X6CE 1FFNA 4PRNB 3RKDC 3WLBA 4Z0BH 3MV7D 4NQCD 4NQEE 3GSXA 3BIKB 3NTCH 4UBDD 5FHBL 5I74B 4HWBL 3VWJD 4F8QA 4LU5L 3VW3H 5DHVB 4JFFE 1S7VB 2XWJB 1C5BH 3FJTA 3UO1L 1SJEA 2OTUB 3HC3H 4S1QL 4YDVA 4PJBE 1P7QB 4POUB 3G04A 5CWSB 4CNIB 1RVFL 2YPVL 4JPIB 3NIDE 3WE6A 1E6OL 1IEAB 2PCPA 4OGXL 3IDIA 4NKDB 3O81A 4R2GB 1Y18A 1A6TA 5LXGL 3V4PL 3VFRA 3SCMD 4ZUWA 2Z31C 3QFJE 4P23A 5C0DA 4UT6L 5KSBA 1MFBH 4PJ9A 3VXUD 3SGEH 2VZTA 3B4NA 3O8XA 2MQ0A 2ZUSA 4UIMA 1S8DB 4PV8B 4HGKC 5EUOA 1HYSC 3ZLQC 2ICCA 2HLAA 5HXMA 2A6KB 3H9YA 4HWBA 5KVEL 3WXVH 1I3RA 3L7EB 4DZBB 5BCAA 1FE8L 5DEGA 3DXAE 3LB6D 2H2PC 3RJQB 3VGFA 1FYHB 4U3CA 3P9MA 1XF3B 4PJHA 5EU7C 4ETYA 4M5YL 1V3LA 4XCCL 4LHUB 1NGXB 3L3OB 5EIIB 3FCTB 1TVHA 2UYLA 2VDPH 3OXRB 5MEOB 1S7XA 4LQ1A 3AS0A 4XNZC 5JOPD 4UTAH 3QAZC 3P4OA 4HIHA 4DK6A 4LHQB 3LN4A 3FKUS 4M61B 4YXLH 2OMNA 2QQLL 3IGAB 2GK0B 1JV5A 4ONHA 1FZKA 1PSKL 1DBJL 2GT9B 3LQAL 5C08E 5FECA 4O02H 4JO2H 3EJYD 1A6ZB 1WUNT 2HVKA 4XMPH 4YDJB 5SWSA 4P5KB 4NKQB 1T4KB 4L9DA 5C3LD 5DUBB 4M6AA 3C60A 2EIZB 4NWTH 3PWPB 3I2CL 1QHPA 3NACH 3QNZA 1VGKA 3Q1SL 1JGLH 5CCKL 2BOBB 2Q8AH 1G7JA 1NC2D 2GKIA 4JFDB 4K7PX 1D5MA 3VWKD 2FB4H 2RIKA 4L1DA 1K9TA 3WDHA 3C08L 4Q9RH 1KLUB 1KOAA 4MQXC 3HKFA 4D3CL 3QNXA 4QWWD 3UTZB 4Y0GA 4YNYB 5E9DB 5FYKH 1KN4L 1VENA 1XCTB 5FO9B 1QKZH 3V52L 1BFOB 5TFSL 4KRPD 5FYLH 2CMRL 5I1AB 5CGYC 5K9QI 4I3RH 4WWKC 3SDAD 3GMQB 1G7IA 3DO7A 1HHHB 3IF1A 4PJ7A 3CMOH 3U30C 4ZTPL 2HN7B 1NBQA 4WFGD 4YPGB 1QSFD 3H0TA 3GRWA 5DJCB 1JUFB 4PFEA 4JZOA 5D7JB 3K2UH 4FRWA 1C5CL 1KPRB 5LBSH 2RR3A 3IKKA 5K59F 4FQIH 5I2IA 2Y5EA 4KWUA 4ODTH 2H32B 2ERJC 4TPRL 1A1MB 4JKKA 1B0GB 5FKPA 5DSCA 3F7YB 4D0DA 1CDUA 3GMLA 2WWKT 5FDWA 3LQZB 1YNKL 2WANA 5EG6C 4Q9CA 3QI9D 4PRHD 5CGMA 3IDUA 3K8KA 1OGAA 2VR9A 2F5BL 5K9KB 2N7AA 4Z18A 3TPUB 2HKFL 1RULL 1S78D 1T89A 4EXKA 3IRPX 1DSFL 4NN5B 3O6MH 1PDKA 5ESAA 1LE9A 1J8HD 4HF5H 2Z31A 3FFDA 4HIXH 3VXOB 2DLEA 2Q8BL 3KXFD 2APBA 6FABH 3MZTA 1F3JB 1FQ9C 4JZJC 5E1AA 2E8ZA 3T4AA 4HS3B 2H9GB 5DTFA 4JFDE 4DGIH 1QD0A 2BK8A 4KRNA 2EIDA 4N0YH 5T1LD 3BP4A 3KYMB 1YECL 2W0LA 4UU9B 1UWXH 3CU7A 3VGHA 1SEBB 4G8EB 4OLXH 3T4YB 3SBWC 3KG5A 1EMTH 3FONA 1HHIB 3BKCH 1KJ2L 3UXFA 5E9DE 5HGAA 2CIIA 2WK2A 5FF6A 4Y4HC 3GIVB 3GSNB 4PY7A 3ULVE 4FFYH 3TESA 4LSQL 1KUMA 4OF0A 2Z91A 4JY6B 2ADJB 4NP4L 2B8OT 1GGBH 4PJGF 5ABDE 1CDGA 3BPCA 2P44B 3KPMA 1E4XL 4PJ8A 2ICWI 4FFVC 1J18A 4DUXA 2D7NA 1RUQL 2YPKB 4GG6B 3C5ZB 4G42A 3RNKA 1I9RL 4WDIB 1P9MC 4L4VA 1MLBB 3W2DH 1MJ7H 3ARQA 5T1MA 3DVGA 5I1LB 4L3EA 3F7VA 4NHCH 4XI5C 4H25B 1GC1L 1KF9B 4PP2A 2N56A 3U6RA 3T65B 2V5TA 1VKXA 5JDSB 2FJFA 2YC1A 1Q9WA 1A5FL 4TOYL 1N64L 1KEGH 4XPHL 5HDQH 4F8TA 2ZCHH 2LU7A 1KXTB 2IPUK 4LGRB 5KANG 5I76A 1ZSDB 5HHOA 1ACZA 2BSSA 2XA8H 2QADD 1Y6NR 1TQCB 3QQ9C 1AD9B 5ADPH 1Q1JH 2C1OA 1K3ZA 4G7VH 4MNHA 1E28A 1B9ZA 1YC7A 2A0LC 5JA9A 3P0VH 4IRSA 4WI6A 3CJJA 1G7PA 4NPYB 3SGDH 1OHQA 4BFGA 1A6WH 1CFTA 1FL6B 4JM4L 5JQ6H 4DVBA 2OR7A 2E27H 4OKVB 4TUJA 3OKEA 2D03H 1VEMA 3QUZD 1HE7A 1UKSA 3CH8A 4P5TC 4DZ8A 3ULUE 1VHPA 2VAAA 3TBYB 4TTDC 2H2SC 1HKLH 2P48B 4FG6D 4ONGL 3RGVC 3U1SH 3VFSA 3X3GL 3BT2H 1EAJA 4MNGA 5C0BD 5FYJU 3QPXL 1IEBA 4Z7NE 5JR1L 5FDYA 3O3AB 1KV3A 5DD3L 3VD4A 4G43A 4OTXL 3GUTB 2XFXB 2JF1A 4YXHH 3D18B 2DQFA 4F37F 3T2QA 4JFPB 5IVNA 2OXGA 2X4SA 4PR5B 5D7LD 2ZOKB 5TF1H 5BMFH 5TQ0H 5I0ZA 3NCYS 3MRQB 1ES0B 3K81A 3LD8B 4HX1A 2GUOB 1TZHB 1XT5A 1IAIH 5E6IB 2UY7A 5C7XH 4KKBD 4HV8B 3O2VH 1L9NA 2X9WA 4F57H 2R15A 5TE6H 4PLJC 5FM5M 1YEKH 4GG6E 2QKIA 1CK0H 5IWLC 3QRGL 4UB0L 5ACZB 2C3GA 4HUXA 3EGSA 4JHAL 2EZ0C 3N50A 2AAVA 2AP2A 2IQ9L 4JHZA 3MCLL 1CICD 3BYYA 4PJ5D 3I50H 2ID5A 4JRXA 2UVFA 3L9RA 3IU4L 1J0HA 1H3WM 1OTSD 5D1QC 3V0AC 5L2JB 4RZCA 5E03A 1OTTD 1YEDB 4NQUA 2HFEA 4NO2A 1NSNL 2VITA 2YN3A 2R2EB 4YXKL 1IGMH 4U1NB 5CMAB 4Y5YA 5IMLA 3INUH 1I7UB 3QXUA 1IZJA 4DN4L 1A3LL 1KLGB 2R2BA 3V6ZB 2R4RH 2IH1A 4OZ4A 5LGJB 3BKJH 1UXSA 3MJ9H 4U2YA 3MGAA 4FQXD 1INQA 2ZSVA 1FGVL 4JFEA 25C8L 1KIPA 1U9KA 3VFPA 1FFQA 5ITBH 5FB8B 5L2KA 5B3NA 1OSPH 4XP9H 3I9GL 3TCLA 2SEBA 1QQDB 3WO4B 5HHQB 1JPTL 2OJZL 3SDXB 3DVIA 3FT3A 4FQQA 1KPVA 3MBED 3MFGB 1OAXH 3WEXB 1KCVH 1UCBH 5HPMB 1BLNA 1P4BH 1CWVA 1NGWA 2IWGA 3TM6A 2DQCH 1A0QH 3C6SA 1H3VA 3TGXA 1G6RL 3CVIH 5T3XL 1P9MA 3PNWA 4LDOB 4P2CG 4XPBH 4PRDA 5JA8B 4WFFD 3G6JA 4QHUA 3CH1B 1NAML 4QHKI 1DZBA 4OI9A 4NUGH 5C0JB 1PQZB 3OKOA 3PGCB 1HWGB 3L3JA 1MHPH 4YHML 1BZQK 4XAWH 3SE3C 3BIAX 4OJFL 1LMKA 1MCJA 4GBXB 4YR6B 3L7FB 4GH7B 2BC4B 5H94A 3NCMA 4HKZB 4KJWD 4U1MA 4YC2C 1HZHL 1SVZA 2EKSB 3O6FB 2AJSL 3DYOA 5T3ZH 1FPTH 1BQLH 2FX9L 1S7WA 2F74A 1WFNA 4RMRA 4BSVA 2V9TA 4ZDHA 2CXGA 1KEMH 1HSBA 5AWNH 4QRPA 2GJZA 4GRWH 3TN0B 5E00B 2Y36H 3LH2L 4DGYH 4BQ6A 1JPGA 3FB8A 3NZHL 3BHBB 5CIPB 3T2PA 4AEIL 3PQYD 5KVFH 1F90L 4KVNL 1MCOL 2EDWA 3M1BB 4Q6IC 4EUPH 4NC0B 4ACPA 3GK8L 2VDNH 2BCKB 4AM0A 4H5SB 3DYPA 1EZVX 4HIIA 2R56H 2V5SA 4GLRH 4R0LC 1FVEB 5LKNA 5C0IB 2HTKC 3BEWA 5EIQA 1J0YA 4NBXB 4C59B 5F70A 5FOBA 5BS0B 4I77L 2X4UA 3SDXE 4PJDF 5ETUB 2WBJC 3IETA 1BZ9A 1Z0MA 3FRPG 2Y5TA 1OWWA 1ZGLA 3HI1B 1VEPA 5H37H 4NC2B 3T1WA 3PHQA 3WN5C 2GK2A 1DJSA 5C1MB 2NY1B 4O9HL 5JHLH 5IFJA 4U1KA 5C0FA 3KS0H 1P1ZB 3OAYH 3VXMB 1KB9K 4ZS7L 4PB0L 1PYWB 3WD5H 3IKCB 1T0PB 3ZKMD 3ALWA 3BZEB 1ZHKA 3EOBB 2VLLB 2X4TA 3QISA 4YZFE 1N2RB 3S34H 4FQHB 3CC5A 1JNHB 3EDFA 3KPLB 5ALBH 4ZXBD 3HMWH 3W5NA 2R0KL 1AHWC 2VLRA 3TVMD 4EI5B 1BECA 1DFBL 5FUCC 5D1XD 2C3VB 3IDGA 2IG2H 2HLFC 1TTUA 1KC5L 2YUXA 5I8EB 3MRLA 1P7HL 1I3GH 1ZLWH 1CDJA 1MCWM 4HK0A 2IALB 4X4ZA 1IC7L 4ZO8A 4QRSA 4B50A 2Q76B 4UQ2B 5FYJE 3UPAA 1A7OH 3GKZA 3LY6A 3RL2A 1UJ3C 2NMSA 1UZ8B 4M3KB 3MREB 1GJIA 5LVEA 2NY2B 4RFOL 5DHYA 5GGQH 1XGQA 3IDNB 3EZ8A 2L0DA 1HNFA 3RWGB 5ENWA 1RUML 2VXQH 3CFIC 2IPKB 5EUKA 4X6CF 5DC9B 4CVWA 2XY1A 4KMLB 4YK4B 3U2SA 1FSKB 3MOQA 5BS0E 1WISA 1A9EB 3MXWH 1FC2D 4ELMB 2WBWB 5D6CA 5IHZB 4YWGH 3EYUL 3LN5A 2DI8A 4N5UA 2UZIL 3AU1B 5B8CB 5A40E 1CXEA 5IV2B 3B5TA 5I8OL 5DVMA 2UZXB 4KMQA 3U7WL 3SE3A 1HCFX 4K7PH 2NQCA 1I1RA 1DN2A 5TF0A 1XF5A 3C6LC 3QUXB 4PJBF 1CL7H 3MV9B 5FK9A 3VXME 1QG3A 1YMHA 4R4ND 4PGBB 1A2YB 4LLDA 4BKLA 5BVJA 3HFML 4U7SA 2GHWB 5GGVY 3H9HA 4L3AA 1V3JA 4NM8H 3RU8H 2HKHH 4PJFA 3D39A 4NNYA 4UTBH 1BGXL 2IPTL 4AENA 3CFBB 3VI4E 2BSRA 4OCXH 3Q3GB 4CJ0A 3F6LA 4BSWA 5IHLB 3GSOA 4LSRL 1NFIB 4JLRA 1I9IH 3EYFA 4MXQC 4JGUA 3R0MA 1J5OL 1UQSB 4HXAH 3LIZL 3KPQA 4EUPA 2OTPA 3IJSA 3FHQA 3QWQB 3CSYB 1B2WH 3EO9L 1DQLL 4F3FA 5I17B 1LP9B 3M8OH 4YFLI 2OTWB 5GGUA 1T5WA 4QRQA 2EDTA 4XC1H 4R0LA 2EEBA 3FTGA 2Y7QA 3QBTB 3DUUA 4MAUH 4G6JL 5I75C 4OLWH 4JPWH 4FMKA 3ZTNL 5E2WL 1EJOL 3WJJA 1KT2B 4AQ1B 3D6GA 4JFQB 1CGVA 3NZ8A 3GSWB 2WUCL 1NLBH 1WCQA 4UV7L 4QT5A 1INEH 4UT9L 4QRRA 2AI0H 3VCLB 4XNYL 2BXYA 3QNYB 5D1ZB 4UUJB 5L8JB 1DLFH 4WEBL 3L3GA 5DJ0A 4M7JH 1MF2H 4QOKA 4ZOBA 1UYWH 3IDMA 2Z0BA 4ELME 5MERB 1KLFA 1N6VA 3BXNB 1SJXA 1OPGH 5FGSA 1MCCA 2ED8A 3NFNB 1T1YB 4L4TA 2BNUB 4KROB 1XGTA 4MJ6B 5ICZB 1AKJA 1CLYL 2J6EH 4N0FA 1HXMB 4NJAL 1AHWA 1JHKH 4FFZH 2IQAA 3ELAT 4LAJH 2DM3A 4OCNC 5F9DC 5GSVA 3S4SG 1QR1A 3MV9E 2APTA 2QHRH 3TWCL 5D70H 1HHJB 4ZSOB 3IFNL 4LDEB 5TDOB 3PDGA 4TUKH 4ORZC 1OP3H 2HRPL 2EC8A 4QHNA 3BP5B 2GTZA 4RGND 1X5AA 2HWZH 3CFEA 2VKXA 3BKYH 2R69H 3NA4A 2AJ3B 5I1CH 5DO2C 4P3DA 3Q6GL 3D9AL 1F4AA 2L7JA 4X7EC 2OYPA 5J6HA 4RAVB 4TRPL 4I4WA 1LP9E 3P9LB 2VO5A 5EOTB 3BN9D 4KMTH 4NUJA 5JO5B 5H35A 2XN9A 1ED3A 1A6AB 1DE4B 3M45A 4GRMB 1LO0H 4GAYA 5KAQG 3MRMA 1A4JA 1RHHB 3L3HB 3ZDXF 4Q2ZA 3CFDB 3NN8A 3ARGB 4U49A 5IESL 1FNEA 1E4KC 1WICA 5D93C 2DOCA 3OKMA 1ZS8A 2YD4A 3FQWA 1SBBA 3GMPA 3S35X 1HINH 2X4OB 1G1CA 1F97A 3SKJL 3ZSSA 1CGYA 1TMCB 5I8KH 1MHHB 2OR9H 4LCYB 4CMMB 4QLRA 1HEZB 3O8XD 1F8TH 1NFDB 5CZXD 5KANI 1NJ9B 2IADA 1EEYA 4AY0A 4TVPL 1CD8A 4M7ZC 5F3HB 3CK0H 1W72B 3O11B 3O3BA 1PKQA 3QG6A 5F7FA 2ESVA 1WT5A 2IMNA 5DR5L 1KBGL 3QZWB 4JFHD 5BRZA 4MAYC 3TYFB 2A6JB 4MCZA 3SDYH 3T8XA 2NY0C 4QXTA 5ACMA 4L8DB 5J9PB 2FBOJ 1KGCD 1MAML 5TE7H 4XAKE 5I73C 1RV6X 4PP1C 3B3IA 4ZSOE 4XVUD 4X5XB 1XGUB 5E4IA 4AL8H 4PGCB 4NC1E 3F8UB 2AW2A 5IMMA 5HGHA 2ICWB 3A6CL 1NBZB 2XRAL 3RX7A 5JTWA 3REVB 1QVOA 3LEVH 4Z77B 4WV1A 5SWSD 4M03A 4FTVB 2AEPH 3ABZA 4RFEA 1CG9B 3OF6D 3C60D 1I8MA 3DVNB 2Y25A 4Y2OA 1SBSH 4D0BB 3RZCA 4OD1H 1KSRA 1ZT7A 5LWYH 4YHPB 3EFDH 3BFOA 4KK9C 4JKPL 1FDLH 2NXZC 4Y5XA 4OT1H 1S9VA 1A1NA 1ORSA 3MBXL 5HDLA 1PZUB 3KPSB 2NW2A 5F96L 3MO1A 3IXAA 4OSUL 1UWEL 5CJOL 1J9CT 5E5RB 2J6EA 4HWNA 2W60A 4LPVA 4KY1L 4EOWH 3D0VB 1D6VH 3BGFC 2CUIA 2YRLA 3QHFH 4M7KL 3RVWD 5F3BA 1NFDE 2J88L 3G9VA 2BOCA 5IJKA 3V5DB 3RIFK 4TSAL 5DFWH 4R4FH 3TBSA 2KQNA 2WP3O 1RJCA 1DVFB 3STLB 2X42A 2WWMD 1CGTA 4MQSB 1J0ZA 4LIQL 4PBXA 5CD5D 1XF4A 3UROR 1YN7B 4RDQG 1F5WA 3DX8A 4QXGL 1YA5A 3VFTA 3D2UA 1OB1B 5EBMA 3DETC 2OM5A 1RZIA 4P99A 3KLHD 5JIPA 2CLRA 3MLXH 1FCCA 5JPMA 1KG0B 1VB9A 3QUKA 1CR9L 1EHLH 2MCPH 3MLUH 4Z7NF 4P2OB 4U7MA 4DFIA 1AR1D 1SQ2N 3W9DA 4HMCA 1EDQA 3PL6B 3TBTA 2HFTA 4OD2A 3V7AG 1BEYL 2Q7YA 1INDH 5E8NB 1A7RL 4N8PA 4NQXB 3IDXL 4HGMA 4PUBH 1E6OH 3QCVH 1N7ML 3RVTC 5JOFA 4M43H 1MUJA 4IOIB 1NGQH 1OGAD 5GHWL 3C5JB 5J06A 5JW5B 4F58H 4Y4KA 1QSEB 3KYNB 1U42A 4LHJB 4YQXL 4HS6A 4R90H 5E56A 3WKNA 5C0CA 2WQRA 5IIEA 5BO1L 2DBJA 1RIUL 3L5WA 4FTVE 1BBDL 4IOSD 3MYJB 3HS0B 4AT6A 3PGDA 4GG6F 5T5FH 3OAUL 2YMXL 5CBAB 3OJMB 1IC4H 4M00A 1CFQB 5ISZB 1N3NA 5F88B 1FE8H 4V2CB 2Z8WC 2B5IC 5F7MC 4NQDA 3KPSE 3ARBC 3HCVB 1AXIB 4IEFB 4UDUB 4Y4FB 1DQQB 1G7LA 1KCRH 1AGCA 3VXRB 3AAZA 3T0EC 4N5ED 5KS9E 3VXPA 4L9LC 4HIJA 4ZOEA 1RK1A 1JZ5A 2XWTB 3T0BA 4NRYB 5EO9A 4I8DA 3QIBB 4PREB 4PTUB 3L5XH 4P2RB 5F9WC 3V7MA 3LQAC 5KN5A 5J1AA 1U3HB 2QQLH 4M02A 4X6FB 1T1ZA 1U93B 5SX5H 3T08A 5IEHB 4HGWA 2OK0L 1K4DA 1Z5LA 4MA8L 3MLWL 4P4KA 2DQIH 4PJ8D 5GGVL 3KPRA 5IHBA 3Q5TA 5JDJA 3QIWB 2YKLL 1RZJH 4L4VD 4MA1C 1G7HB 1VESA 2YD7A 3FQTB 1CGSH 4H20H 3FN0L 4GXVH 3AREB 3HZKA 2OZ4L 3IJHA 4TQEH 1GZQA 3P4NB 1F58L 4QRTB 2NZ9C 1OY3B 4XBGB 1UJTA 2DMKA 3I75B 5M95B 2HT4C 3BD4A 3QPQD 3UAJD 1JWSA 3MRIA 4AEFA 4WTXA 1CXHA 1JF1B 4XBEL 4ZPTB 4LRNL 4HIEB 3TNNB 1Q9LB 1YYML 4QHLA 4I5BA 5E2TL 5HHOD 4APQC 4NDMB 3MA7A 1A8JH 1SYSA 2PW1A 4OQTH 1QSEE 4YHKL 4ZUVB 3AMKA 5K9OA 4LSVL 1T2JA 4M8VA 7CGTA 5T33L 1WBXA 3F12A 2LU4A 4XP4H 2R23A 1YUHA 4IRSD 5HGBB 3TH4T 1MCSA 5GJTL 1TJHH 3ROOA 3BQUC 5BZWA 1ZHNA 3RWCB 3LKRA 3QUYA 3B2VH 3VE0B 3QUMH 2MFNA 1NBYB 5D8JL 1CE1H 1I8KA 3BP6A 2AK1L 4JO1L 3MYZA 2OZ4A 5ISZE 4G80A 3RAJH 3WS3A 4YHZL 3C5SA 2LAAA 1U91A 5HYSA 2AJYH 2EH8L 1X4XA 4RAUA 5AAWA 2ZUVA 1N59B 3EW3B 4IS6B 4JEGB 5IBUB 5I1IL 2A1WL 1QBLL 2IAMA 3OQ3B 1PX4A 3ES6B 2CGRH 4B7IA 4F7MA 4P2RE 3BVNB 3I02B 2MPAH 2FO1A 4FP8H 1T1WA 4TSCL 3O4LA 3QFDB 3LKPB 1UB5A 5ICXA 4JQXC 4ZNEE 4JQIH 4O00A 3KJ6H 4PLKD 1M7DB 4NBZB 1RULH 2ZWLT 4YDIH 2LTQB 2BVPA 2CQVA 1EFXB 1Z9OA 1X9QA 1NMBH 3OAZH 4G8GB 3SDXF 1WIOA 4H0HB 5C86A 5GJSL 3HE7C 5I1KH 4B7LA 4HH8A 3GJFB 4KJYB 4JG0L 4GG8A 2DLTA 4J4PA 2FX8L 5ITFA 4XGZA 4XP6L 1AO7A 5A43C 4LPYA 2V2XA 5CJXA 4XPFH 3FO0H 4QYOB 3HN3A 7FABL 4OLVH 4S1RL 4JN1L 4NCC1 2FO4A 3G5VB 2DKUA 1N6UA 3VH8A 3HRZA 2EYRA 4LSUH 2A73B 4Y1AB 2B4CH 3MGOB 3LRSB 2DLFH 4NJ9L 1XH3B 5LQBL 3ARBA 3QG7H 5D2NB 4F15B 3FQUB 2EEAA 4PTTA 4JFED 5I18L 4Q9QL 3ILQC 5JZ7C 2Q6WA 4FZ8H 2P5WA 1HDMB 1KIRA 5L2KD 4OFKA 4NT6B 5JOEA 4OZFA 1JNNH 2ARJQ 3CDGB 2EDFA 3LS4L 4LQFL 1UA6H 1I9RH 5EU6B 3QJFB 2DBLL 1OAKH 3QXWA 4DFHA 5GZNC 3QDJA 3G6DH 3UC0H 3SE9H 1GC1C 5C0AB 1LEKB 1PG7H 3GSUA 3RDTA 4PJCB 2JJUA 1TCRB 1GC1H 1WBZA 3O45B 4W81A 4M6OL 1U2HA 3OZ9L 1QUNA 3O3DB 2AGJH 2DKSA 3KPNA 5F6HJ 5AYUH 1JHTA 5KSAC 1FO0H 4U0RB 4UV4H 3TBWB 3FOLB 2DMBA 4F2MB 2VIRA 1AP2B 1D9KB 1KJ3H 4G5ZL 4KI5D 3ZO0A 4H1LH 5E94B 4MJ5B 2UWEB 2VC2L 4WW2A 5KBNC 2XQBH 1ZHLA 4HKJB 3CDCA 4HWUA 3P9WB 1X6LA 3CFKB 3B9AA 3STZA 4OQTA 3SDCC 3LV3B 4L1HA 2HTLC 5CBEA 3IXTA 2VDOL 4G8GE 2DQUL 4DUWA 1WLHA 5C8JB 5DRZA 4J3WA 1G6VK 5F93C 3VMOA 3JV6A 3QULA 1NBVH 4Z7OE 4I13B 1CE6B 1R3LA 3G5YA 2D7QA 1HILB 4QRPD 5SV4A 2OL3L 3V0WL 3QUMA 3X3FH 3BQUA 4MCYB 2ZJSL 4RIRB 1QBBA 3MRHA 4WGWB 4UQ3B 3LS5H 2VE6A 2AS5M 1LE5B 3OJ2C 3V95A 1IAOB 3MNZB 5KTEL 4P59L 3VRIB 3BISA 2NR6C 4Y1AE 4WY7L 2YBRB 2D0HA 2GAZA 3UYRL 3VI4F 2MMXA 3PWLB 1Z9LA 1GIGL 1JNLL 1H3XA 3X11A 1TFHA 2OLDA 1UXWA 5D2NE 8CGTA 4F7CA 3PV6A 4G3YL 1MWAB 1ND0B 3NFSH 1GPOH 5C09A 3H9SB 2M26A 4OIIL 4WU5A 1YEGL 5DGRA 3P30H 1EBAA 4L8CA 4F7TB 2QL1A 4X6DA 3I6LD 3VXNA 4Y19D 1S7UB 5EN2B 1Z9MA 5EU6E 1MCIA 1I85A 4X8JA 3UPCA 35C8H 2HJKB 3VMPA 5C0AE 3ARDC 3LKSB 3VFNA 1GAFL 4PJCE 3KWWA 4JQXA 4FQ1H 2PTTB 1U41A 1JI2A 5DVNA 1J0IA 3DGCR 3UPRA 4NSKA 4HG4K 3S35H 4HW6A 4O2EB 1CXKA 4MD5B 3RNQA 1B0WA 3HE7A 2LE9A 2M2DA 3BH8A 1XGYL 5DEFA 1OSZA 3L3DB 1TPXB 4GKSA 1NUDA 5I9QC 1I3UA 4ODWA 2UWEE 4PY8I 4MB5A 5CZVL 4KI5C 1IM3B 4E41D 5FCUL 5BXFA 2NX5A 3CXHJ 2VLRD 1HHGA 3OJDA 3B5GA 1ACYH 2B1AL 2XZAH 4P5MA 5E0QA 1NGZA 3L1OH 2XTJD 4ELMF 3RWHB 1FCGA 1A9BA 2B2XL 4UIKL 4LPCA 1ONQB 3K74B 1YEFL 4NQVA 5C0GB 4G8FB 2EDBA 3S97C 3ARRA 1N0LA 3QEQD 2W91A 4XB7A 5DJ8A 5MHSD 1NEZA 1QRNA 1WBYA 4NQCB 4EDXB 3WFZA 2VLKB 3I6KB 1U95B 4WUKH 4PG9B 4JR9L 4F7PB 2MJWA 2VDQH 1BOGB 4IHOB 3VWJB 2H26B 5FAAA 2ZP0T 5TQ2L 1FYTA 2ZUXA 4H8WC 4XVTL 3ZYIA 3MODH 3EYVA 3UJIL 4H8WH 1EUTA 5DK2A 1GXEA 5EZJB 3H9SE 1GGYA 3KLAB 4LCIL 3I3BA 1DDHB 1KCKA 4IOFD 4URTB 5FCSH 3D25B 3FO9B 3IDYB 3QCTL 4XCEB 1QBMH 1K85A 4QCIB 1LP9F 1EX0A 3D3VD 2OMBA 3RWJB 4H1LA 1HXYA 4ZD3H 3VXUB 1DLHA 3AM8C 4HUWA 4PJDA 1WWCA 4QF1B 1EGJH 4B0MM 3NA9L 3TFKC 5IQ9B 1FAIL 3MUZ1 2BSED 3K7UA 1JPFB 3DLQR 4LLVB 1IGYA 1OW0C 3PJSB 1AE6L 1MPAL 1TXKA 1AGBB 4JZNA 4WFHD 3SDCA 4D9LL 5T3ZD 5ID0B 4PGEA 5TE4H 5EH1A 3OKLB 5EU7E 4RMVA 3HNVH 4UDTB 5EIVA 3AS3A 1FJ1B 5EOCH 4YEEA 4X98A 4Z95L 1N5YL 4U1JA 3O6LH 5DHVH 4XRCA 1C08B 5CAYB 3C8KA 1YEIH 5TPWH 5DJ6A 1S7RA 1DL7H 2ED9A 5EA0H 2IFFL 5L8KB 1NCCH 5D2LB 1S5IL 2VDRH 4R2GC 2NNAB 5GS2H 4TULH 2CIKA 3HZYB 5I1JL 1CLZH 2CDGA 5GRZA 3U4EA 5SWQA 4ORGB 5DD5H 4WRLA 1ZEAL 3RWFB 4NQCE 2CLVB 4XX1G 4YAQB 1YZZA 2VLKE 5JUEL 4N0UA 4OV5A 1MNUH 5EBLB 4LVNB 1P2CA 4TNWK 1XR9A 5FUOL 3WFEH 3OKNB 1X5IA 1T3FA 5GRJH 4QRRD 5K93A 1E0OB 1YYLL 2PXYC 3U83A 3VWKB 1MCPH 4X6CA 4HUKB 2FH8A 4S0TD 2FEEL 4QOKD 3LRHA 5IT2H 3RY6C 4EDWH 3CPLA 3JVGC 3U48A 5I1HH 4ENED 5FA3A 3DRTB 4XPGL 2YHGA 3RY4A 3VXUE 1PEZA 4I3SL 4JFFA 4L4TD 4D9QD 4R3SA 1MRDL 1OLLA 5DD0H 5HHNB 1E6JL 2W0PA 1RIHL 3MLTB 3F7PC 4HUUA 1IGTB 4XCYB 3R1GL 2HMIC 3CLEL 4HC1L 5ERWB 4X6EB 1QSFB 3F7RA 3WHXB 3HC0A 3UX9B 4RWYL 4K9EH 1I1AA 4NKOB 1NFDF 4JN2B 4PB9L 4WI3A 5L9DH 1NC4D 4HDIA 4D8PA 1B0RA 1LO2H 3QHTC 5JOPE 1K4CA 2P45B 5D2LE 3LEYH 2XT1B 4OCYL 3BE1H 4KKCD 3ZKXC 4YX2H 4IDLA 1FVCA 3MGTB 4PRHB 3CCHB 4ZAKA 1FV1A 1N4XL 3DXAA 3TZVA 3RWDB 1MFDL 2K7QA 1I7RA 4MQTB 1MFNA 4P3CL 1CFSA 4YDKH 5ILTL 3WFDH 5E5MB 1MHCA 1U8JA 4XNQA 1BM3H 5E8PB 1VFBA 3HMXH 1ZT4A 4FQCH 3DX7A 1JFQH 1EGJA 1MQKL 3EOTL 3KXFB 4P5TB 4XVJL 4R96B 3AM8A 1AQDA 2MNUA 4PYHA 1KB5L 1BBJA 5DMYA 4WFED 3RGVB 1YNTA 5JMOC 5DRNA 3BI9X 3NCCB 1HI6B 2ARJA 4RRPA 3B8SA 1OW0A 1RMFL 3DSFL 5C08A 3GDBA 4OM1H 1GL4B 2E5EA 4PRNA 1FBIL 4PJAF 2AJVL 2I9TB 3QSKB 5IBLC 2ESVD 5D7IB 2H32H 4JPKH 1Q9OB 4JCMA 1YY8B 3QEGH 2X4NB 4FABL 1S9YB 5DMGC 1WEJH 4D0CB 1S7VA 4Z76B 2XWJA 1ETZB 1J12A 4HFUL 2N1KA 4JO4L 4FS0A 2OTUA 5CZKA 1X5YA 1T21B 2OI9B 1P7QA 2GSIB 5DT1H 4MS8C 2CJUH 5CWSA 5F7EH 4CNIA 3MLVL 4YGVA 3SY0B 4JPIA 2EE6A 5AZ2L 1QSFE 4NKDA 1MRCL 3IFOB 3TT1L 3IAPA 3TO2A 1T0NB 1A6UL 3RVXD 1QBAA 1LD9B 5D1QB 3NAAH 3QCUL 2F19H 2Y07L 3H8NA 3FT4A 1L6XA 4ALAL 5JXEC 1S8DA 3MRCB 4TVPD 4PV8A 5JLZB 1AGEB 2DIJA 5GISH 5C2BL 3VXQB 4IDJH 2IANB 1SM3H 2WQ8A 2XQYG 4PRHE 3MV8D 4BJLA 5KW9L 4PGJA 1GH7A 3L7EA 2BVQB 4DZBA 3RZCD 2OCFD 4JDVA 1S7TA 2QADB 4PD4J 4PJXA 1XF3A 3D69B 3MLYH 5CEYA 3ARSA 3KPOB 4JANB 3WUZA 1S9WB 1NGXA 3L3OA 3W5MA 5EIIA 1FL5B 3GSNH 1CLYH 1UACH 3MXVL 2YK1L 2IH3B 3FCTA 3JVGA 4EUPG 3DHJA 4K3DH 1UM5H 4LEXH 3KXFE 3TBVB 3QUZB 3TWCH 3VFMA 2AJXL 3WIHH 5BV7B 3C5ZC 1TNNA 4M61A 1I7ZB 2GK0A 5GRUL 2GT9A 3H42H 4DAGH 3ULVL 4E0RB 1CQKA 5J11B 1RZ8B 4Z7WB 5FHAL 5C0BB 1A6ZA 3E8UL 4JJ5B 2PKDA 4YDJA 3S98A 4W4OC 4P5KA 3KJ4C 2WIIB 3W9EB 3JUZA 3LKQA 4JDTH 5D71L 5JIHA 5AG8A 5DUBA 1IM9A 2GJ6A 5IK3A 2EIZA 3TC9A 1T2QL 2JJSC 4MZ3A 3O2DL 1CI5A 2OJEA 5DA0B 5D7LB 4XPTL 3D2UD 2BOBA 4CUCA 2I27N 3B9DA 3ROLB 3U46B 1KTDB 4OCWH 1NGPL 5ADOH 3FQRB 4JFDA 4JHBA 4ZQKA 2HT2D 1MIEL 5HHMD 1TQCC 2ZKHL 4LP4A 3B2UC 1KLUA 2B1HL 1VADA 1NKRA 2X09A 4YNYA 1QTYT 5D4QA 1KENL 5HGDB 5E08L 1CICB 4PJ5B 5E9DA 5C0NC 5FV1L 5F7DB 2AVGA 1XCTA 1WWBX 2YXMA 1F4YH 5IM7B 1BFOA 3I84A 4Y4KD 1IT9L 1RSFA 5EZIL 1QYGH 4Y5VB 3OSKA 1B4JH 1RURH 3U0WH 2FIKB 1MLCB 5KVGL 2D7PA 1EHNA 4GMTL 3H2WA 4Q6IB 3GMQA 2IANE 2E3VA 1HHHA 1F6AB 2XYCA 3QHZH 3RPIB 3VGAB 2P8PA 1XR8B 3FB6B 4GRLD 4M8QB 4D94A 5IEKB 1OWRM 4YPGA 4POZC 2RCSH 1OARL 4ZFOL 1JUFA 3MTRA 5D7JA 1GCFA 3KPPB 1KPRA 3BPOC 3FQXA 1EJ6A 2QSVA 3HR5A 4EQ3A 4FQXB 1QFUL 2H32A 1GHFL 3LD8C 4ISVB 1B0GA 2PYFB 3NPZB 3F7YA 5E4EB 4BH7A 5E6IC 2CKBB 3NH7L 4KHTL 3MUY1 2QBWA 1IGJA 4W68A 4U6HB 1FZJB 1WAAE 4YEFA 4ZOAA 3Q2CA 3LQZA 2WBJB 3C8HA 2EIBA 2FJGB 3BW9B 5GGSA 1HHKB 2A2QT 3MOBL 3MBEB 4HEME 1FHGA 5HHVL 4PBWD 4Z7WE 2R0ZL 4OUUB 3R06B 5SX4I 5K9KA 1CTOA 4HAFA 3EIFA 4TSBH 3TJEH 3GBNL 2FL5B 3KPRD 4M1CD 2CDEB 3WCYA 5I0DA 4ZFZA 5CINH 5D7LE 1MEXL 4GMSH 3EDDA 4NWUH 3CGTA 1W0YT 3V4VL 1F3JA 3G08B 1D5BB 1WZ1L 5MEQB 2H9GA 1JGEB 4ZS6C 3GO1H 3OG6B 4X7SL 3HUJB 1I8LA 1JGUH 3MFFB 5F1IB 4ZTOL 4G7YH 3MLRL 1SEBA 2JJWA 5J3HC 3WS6C 3CVHL 4G8EA 1NCDL 3UTQB 1OQXA 1HHIA 4Y2DD 3UJTL 3ZL4H 4X8XA 3C2AH 3RVVC 4PJ5E 5AUMB 5CJOH 1E4XI 3GIVA 3GSNA 5EWIL 3K1KC 3WO4C 4NO5B 1IKFL 3LOWA 5D7SL 1A3RH 3GMMB 1YY9D 4J3OC 2WINB 2QV2A 3UTSD 3PQYB 3LVEA 2ADFL 1OAUH 1NCAH 2YPKA 3BDYL 3C5ZA 3QUYD 5I30L 4GG6A 1OD7A 4OLEA 4KDVA 1J1XH 1MLBA 4K94L 4EI6B 1BZ7B 4AEHH 4Z7OF 3SJVD 4H25A 5I1EL 1U8LB 1VCAA 4UAOB 2R8SH 3T65A 2ATPB 5JDSA 3EHBC 4K3EL 3CVHA 4G6AD 3HR6A 4XBPB 4KKAC 5E6ZA 3DBXB 3U9UB 1YQ2A 1FFOB 4RISL 1I4FB 1T6VN 1MCDA 2IAMD 1SEQH 3U7YL 5JORB 1A7NH 1ROWA 3MRFB 3SQOL 3U36B 2OSLA 4UILL 2VYRE 2X4RB 3C6LB 3DYMA 5GSRA 1EK3A 3PABB 1YJDL 1R5VB 1AD9A 4U6YB 2X6MA 3GMNB 2V5MA 4G9FA 4OLUL 2MOVA 2Z92B 3P4LA 1T03H 2C9AA 4NPYA 3TN0C 3M07A 4J6RH 1MIML 4WFFE 1FL6A 3ECBB 1T7WA 2BFVH 4OKVA 5FYJH 3EYQD 2UUDH 3JV4B 4HJJL 5EU3A 3NMEA 3OBAA 5DZNA 3THML 4ONFL 3TBYA 4KKLD 1JZ6A 3HUJE 3JBG7 4XP1L 4ZXBB 4PJCF 1SY6H 4J4PD 4IRZL 4QXUH 2DQGL 2IGFH 2XV6B 4YJZL 4P46C 3TVMB 1DBKL 3MMEB 4ELKB 3O3AA 2X7LB 3DTXB 4FHBD 1C8PA 3OGCB 5EC2B 3GUTA 3D18A 4GQ9L 3DMMD 2DWEA 4JFPA 3KYOB 4PR5A 4J1UA 2ZOKA 2Q20A 4JQVC 1G84A 5DQDH 1ES0A 5IHUL 2GUOA 1TZHA 4UINH 2UWEF 4S11A 5I19H 5E6IA 2FWOB 1CLOH 1T7YA 3W0WD 4XZUB 4MWFA 5A3ID 1FIEA 2RFXB 4HK3N 3L95B 3UJJL 3IDJB 4DQOH 2NY1C 1J10A 1W8OA 2AK4D 2P5WD 4ODVL 3V5KB 5C9JB 3AB0C 4DKFH 1FLTX 4MA3B 4LLAA 5ACZA 3CZFB 1V7ML 3NCJL 2IFGA 1ZVHA 4FZEH 4KQ3L 1BFSA 1IFHL 3CLFH 3QDJD 5GS3A 4Q7DA 2ITCA 2G2RB 5L2JA 2EDHA 3RDTD 4FNLH 1YEDA 2BDNL 2G5BA 2EXYD 1XGRB 1YN6B 1F58H 2PO6A 2VXTH 1KXVC 2A77L 1FNSL 1EO8H 4PPTA 1QLFB 5GRYA 4OFIA 4NQTA 3D1MC 2MSPA 1VPOL 4U1NA 5CMAA 3MV11 1ZVSA 2EYSA 3MRDB 1I7UA 3GHEH 2NY6D 2GW5A 2BRRH 3L3IB 1I9JL 1K6QL 1KLGA 2JB5L 3V6ZA 4R97B 2AEQH 5CLTA 1I9EA 2KZWA 3H3PH 4MQ7B 1CFNB 4R9HA 2X44D 3S36X 3AUVA 3VA6A 1WVZA 3RGHA 5DRXB 3GI8L 2CXKA 5FB8A 3ZYJA 1TETH 1P7KA 1QQDA 2QR0A 5DA4A 5HHQA 5EO0A 5F89B 3KPTA 3SDXA 3P0YH 3RTQC 5IBTL 4LF3B 2NY2C 5D8JH 1UM6H 3WEXA 4MDJB 4WGVB 1U8PB 3BH9B 1Q0XL 5HPMA 4O4YH 2DQJL 1U8NB 1XMWA 2P47B 5D7KE 4ERSH 5E99H 4K7FB 4YK4C 2AQ2A 4RA3A 1BREA 1EO7A 3PWUB 3GB7B 4JO3L 1MY5A 1AJ7L 3CH1A 1RZ7H 3RI5K 5L88H 2DTML 5C0JA 2AEIT 4P2YA 3L5HA 4OLYL 3PGCA 1DQTA 5B8CC 3N06B 3QQ3A 3DI3B 1UGNA 1QNZH 1BJ8A 3NPSC 4XNXH 5C09D 1DBMH 2VL5B 2G60L 3GMOB 5E8DL 4GBXA 1HQRB 3QUXC 1UZ6E 3L7FA 4TSCH 2EE2A 2BC4A 3GFUA 4I48B 3GHBH 4HKZA 1KXQE 2WLZA 2OP4L 3TF7C 4LASL 2EKSA 5DUPL 5DC4B 3O6FA 3O0RH 3JWOC 2D9CA 5DWUH 5HDOA 3JWOH 3W82A 1IC1A 3CSGA 5GJSH 1MH5B 5E00A 3E1F1 1AFVL 5CP3H 3ZZ1A 2DQEL 5CIPA 1D5ZB 5GRVK 4JY5H 5E2UH 1MREH 3CFCH 4YBHA 4KZEH 4MAYB 1U8HB 2EYTB 4K07A 1CYGA 3LMJH 5DD6B 4R4BB 4EZMA 2BCKA 1SY6A 1A7QH 1RU9H 4JM2C 4MVBD 5F9JB 4H5SA 3TT3L 2XA3A 3RUGF 2NLJB 1TVBB 1FVEA 3TIDA 4C4KO 3FL7A 1CTNA 2NX5D 5C0IA 5HYSG 1S3KH 2YD9A 3VFGH 4RBPK 2O61B 5CHNB 3DV6B 4Z0XA 5BS0A 3FAWA 1J1PH 4I0PC 4OF7A 3HNSL 5E6YA 4JQVA 4RGNB 4XNUH 2Y4SA 3SKOB 2QEJA 5CJQL 4MSWB 2AJUL 5ETUA 5L7XH 4O2FB 2FGZA 3K80A 5ESVB 1JTTA 2VQ1A 3AMLA 4Z7QE 1DTUA 2XXMB 5JPNA 1QRND 2HFFA 5J0BA 1P1ZA 1T6WA 1FNLA 3GSXB 3VXMA 1PYWA 1EV2E 5A2JH 4Z7UA 3RZWA 2XQYK 3BZEA 3AY4C 2NXZB 3EOBA 1V7NL 2LFGA 1N2RA 5F8QC 3GI9H 2XOTA 4YO0B 5FA4B 4KROC 1G0XA 1NCBH 3KPLA 1M71A 3BSZL 1F4XH 2YUZA 2JK5A 2GJJA 4RFNB 4YFDB 4EI5A 4I0CC 3P4MA 4B41A 1BFVL 5DQJA 5AEAA 1A6TB 5D2LF 2C3VA 1R3KB 2FATL 1MSPA 1WFOA 3VH8G 2Z9TA 4MD4B 5I8EA 4I2XB 4IMLA 4NC1C 4A6YB 2NXYD 3K0WA 3O8XB 2IALA 2DDQH 3EJZD 4UIMB 1HIMH 3DHMA 5DDHB 4UQ2A 3WKMH 1FFPB 1LO4H 2PR4L 2HLAB 4KK8C 5DRWB 1IKNA 1H9VA 2BRQA 1UZ8A 3MREA 5DEGB 4PG2C 3JTTB 1T5XB 1UADC 4C57C 1AQKH 4OZFG 2HVJB 4PJHB 3RWGA 3I6GB 4DWHA 1P84J 4M7LL 3GKWH 2IPKA 5IFAH 3HC4L 3VDAA 2UYLB 5CP7B 4LPTA 1Q8MA 4R7NB 4X6BA 2GIYA 5J89A 1A9EA 4ODUB 1KJVB 3T2NL 5IHZA 1KACB 4ONHB 1FZKB 4YBLB 3ME0A 5E8OB 1DQML 5IV2A 1KCSH 3CU1A 4Y16A 4X5WA 4GAFB 4ZUTB 1RK0B 1RIVH 1T22B 5IROA 5ACLA 3QUXA 5DJDB 4OM0H 2YPLA 2DYPA 3B9VA 3VXSB 2ZOLB 1V3MA 4CU6A 4GXUN 1OAQH 3VDCA 4Z5RB 4JKLA 5IGXL 1FLRH 3B8YA 1W72H 3F62A 12E8H 2XTLA 1FRGH 3CFBA 4GKZA 2B5IB 1FVDB 1PX3A 3EKCA 5JW4N 3QIUD 1IAKB 5CP3A 1RZFL 4CDHA 2IBBA 1UM4H 1NFIA 3T0EB 4KFZC 2I07B 1VGEH 4F7EB 3WSQL 3CSYA 2FBJL 2VDML 3MOAL 1AY1H 4AH2B 2AV1B 5I17A 1KN2H 3UEZA 5DFVD 1YC8A 1LP9A 5JNYA 3WDJA 2OTWA 1LQSR 1YPZB 4GKOA 2B1AH 2J7LA 4I2XE 4JFFD 5LCVL 4R7DB 1LO3L 2DWDA 3QDMD 3K4ZA 5CS7A 1X5KA 3CNKA 4OLZH 1EHAA 3CAFA 4M7LT 3RIFF 2CK0H 5HI3D 4HZAA 4FFWC 2BY1A 3IF1B 2ZCKL 1KT2A 5B38B 3VD3A 2H3NB 4U6VH 3MRJB 4JFQA 1IQWL 2C3WA 2VXVH 4JFHE 5CJ5A 2X1XR 2JJTC 2VZVA 3EFFB 3VCLA 1I1AD 5KJRL 2LAGB 3LDBB 3OR7A 5L6YL 3BRFA 3QNYA 1UH3A 5D1ZA 5DSCB 4O51B 4UUJA 2VDKL 1LILA 1RUAL 2R0LH 5J12B 5D7IF 5HVWA 3VG0L 5MERA 4APQB 1FH5L 2Z8SA 3B6SB 3BXNA 4Q9BA 4ZAKD 3DXAD 3TZVD 1T1YA 1OGAB 2BNUA 1N5AA 2QTEA 4FOMA 4MJ6A 4XVSH 1AXTL 3BGAA 3FO2B 1BVZA 2R39A 4JFXB 3BWAB 4XXDA 2D7TH 1CZ8H 4Y7MA 1DEDA 3VXSE 5ESAB 1LE9B 1J05B 1LWRA 1G9MC 1MVFA 3U0TB 4ZSOA 3M17B 5TDOA 1G9MH 3BP5A 1A1OB 1LK2B 3FO1A 2X1QA 4GAJL 1MFEL 2G9HA 1CU4L 5GGTL 3RHWF 3T0EE 3S37X 4KPHL 2AJ3A 3F58H 3OV6A 4X4YA 4QXWA 5DHXB 4OCRH 3P73B 3T0DA 2XG4A 1NEZG 4RAVA 1ITCA 3FONB 1LK3L 4QNPE 3P9LA 5F72S 4YBQD 4DEPB 4P2OC 4BFEA 1YPZE 5JO5A 2DL9A 5HD8D 2CIIB 3PL6C 5EOCJ 1A6AA 5JHDB 4JVWA 1DE4A 5LGKA 4G6ML 4GRMA 4HZLA 15C8H 4UNUA 1OVZA 3WFCL 3NIFF 1RHHA 2MQCA 3TO4C 3X14B 3WXWH 1P7QD 3O3UN 2YD3A 3ARGA 3BPCB 3KPMB 3SKUD 2Z4QA 2R9HD 3IFPB 2YD1A 3RNKB 1NLDL 3A6BH 1TZGH 2X4OA 1BQUA 1D5IH 3DVGB 4H1LG 3ZSTA 1MHHA 4WJ5A 2E6QA 2W0KA 3F7VB 5GGTA 4LCYA 5LG1A 4JB9L 5F9AC 5MP6L 1HEZA 4Z7WF 5LGHL 2W9EH 2Q7NA 4P9ML 4QTIL 1NJ9A 4KAQH 4LFHD 4HT1H 5F3HA 4F33A 5LJYH 3O11A 4N1HB 1LVEA 1OP3K 1OAYL 4Y4FC 3BGMB 2VH5L 1KJ2B 3OB8A 4I3GA 4HHAA 1JZ4A 4L3CA 1N6QH 4OGZA 5I76B 3QZWA 2QQKH 4XC3L 2BSSB 4RGOL 1OGAE 3R4DA 3TYFA 5CEZL 3IJYB 2A6JA 3VRLE 2PETA 3ZT6A 3QIBC 1D5XB 4L8DA 5J9PA 4GQPH 1MCEA 4MNHB 1K2DB 1DQDL 2F15A 2I60L 1MAJA 1CFTB 4F9PA 4XMKH 4YHNB 2AXGA 2FZ3A 5JMRA 1XGUA 4PGCA 1Q72L 5EPMB 4OCSH 1R3IH 3CLEH 4DZ8B 3QIWC 3KR3L 3ARFC 3TA3A 4FQLL 1NBZA 2HH0H 2EDNA 5HI4C 3K4DA 3VFSB 4XWOC 3AREC 3REVA 3TV3H 4K8RC 4DTGH 4NYLB 1CBVH 3OGOE 1QFHA 5F7HA 2VR4A 1T1XB 1IEBB 3KHOA 3DOSA 4K8RH 1MJ8L 4LARH 2ZNXA 3DGGB 4FTVA 4R26H 5K9JL 2ORBH 1F02I 5I1DB 2CK2A 1AIFA 1CG9A 1CLCA 5KSAB 1IM9D 2GJ6D 2VXUL 1QFWL 4M1GH 3DVNA 1HCVA 3MNVB 1GOGA 3CSPA 5JHDE 2X4SB 3EDJA 4D0BA 3DNKA 1NMCB 1QLEL 2ZCLH 4NNPH 4YHPA 1ZOXA 3FAXA 2FLBT 3NABH 2HT3C 1WIPA 5DMIL 2BVUA 3SKMB 1FFRA 4NRXB 3KPSA 1MQ8A 3U4BH 1MCHA 5D5MB 2ITDB 3LZFL 3JWDL 4BK5A 5KS9A 1U8IB 5FFLA 2QSCL 3L3KA 3BAEH 1HQ4B 3D0VA 1ERNA 5E9DD 5EORH 2X05A 4X83A 4J3VA 5IB4B 3L9RB 2G5RA 3ULVD 2BNRD 2GI7A 4P2QB 4NZRL 3GIZL 2IBZY 4QTHB 5D6DC 3S36H 4KQ4L 3V5DA 3EO0B 5AZEH