3S8WA

D2 domain of human ifnar2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
100
structure length
77
Chain Sequence
b'SFEPPEFEIVGFTNHINVMVKFSLVIEEQSEGIVKKHKPEINFTYIIDKLIPNTNYCVSVYLEHVIKSPLKCTLLPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interferon alpha/beta receptor 2
publication title Structural linkage between ligand discrimination and receptor activation by type I interferons.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein receptor
total genus 11
structure length 77
sequence length 100
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s8wA00
1AXTL 4PJXA 1JZ4A 3QHFH 5CP3A 5CWSA 3VMPA 4MB5A 5MERB 4RGND 4Z95H 2B39A 5HXMA 3MLZH 3RA7L 1OGAB 5D2LF 4LSQH 1ZLVH 3I84A 1PEWA 1LE5B 5EOCJ 1OTSC 4GG6F 5L2KE 3EYUL 2AKRB 4OCWH 4PJBE 1WFNA 4GSDL 1P6AB 3KYOB 4K2UL 1DQLL 1BWWA 1JNNL 3BSZH 3DETC 1UQSA 1A9EA 3T8XB 1MWAB 3ZTNH 5F9DC 3WIHH 1YECL 3A6OA 3M17A 3TN0B 3TNMB 3JV4B 4LSVH 3FQUA 4I18B 3U7YH 4CADA 1P84K 1P5VA 4QOKD 1VESA 4C59B 3FTGA 4JG1H 1A1MA 1DFBL 5GRVL 4HXBL 2VAAB 4AH2B 3EJYD 3RUGA 3MREB 5ANME 5CJ5A 1EPFA 4R4ND 4HZLA 4LAJH 3VG0L 2VQ1B 4Y5XB 3NCCB 3MJ9H 2W07A 4TUKL 3LKSB 5T5FH 5T1KB 4XZUB 3GHBH 3RVXD 4DOHB 3DUUA 1D5BA 3MV8E 3W9DB 5LQBH 4JKWA 4M93B 3D6GA 1NEZA 2FZ3B 1QLRA 1ZE3C 1IE5A 2IPTH 3I9GL 3WE6B 1GC1L 1X7QB 3TBYA 5CCKH 4GG6B 1FL6A 3OSKA 4OF7A 1FYTA 1P7QD 1S78C 4JRXA 1EHAA 2XYCA 4P2QB 4Q2ZA 1UH2A 3D2UB 1V3JA 1M7XA 5E8DL 1U8NB 4Y4HD 3OB0H 4JQXA 2APVA 5DJ6B 3HE6B 1KTRL 2BFVH 4L9DA 3QUXA 4IJ3C 4AG4H 4TOYL 4WGWB 4PRNA 4NQVA 5EU4B 1J7VR 4O2FB 3RWDB 4U7MA 3N1GC 1ZOXA 4KK5C 4TUJB 3U83A 5FYJE 1MNUL 5HTSA 2ARWA 3V6ZB 1T1WA 1RY7B 5L6YL 4D9LL 5F3BA 4L3CB 4R2GB 4HUUA 3GJEB 4PRPE 4FQ2H 5EBMA 2Z92B 3LKNB 4QHLB 4WTZA 3FB7A 4PJHB 5ESAB 2D4FA 2QSTA 1PD6A 3UBXI 5A2JH 3GMQA 4X0KB 2EDJA 2H9GB 5IM7A 3DGGA 1KLFA 2EH8H 4Z7UF 3WFEL 1GCFA 3RGVC 5EU6A 2AAVA 2VLJB 1E4KC 3FHAA 5F89A 1NFDF 4ALAL 1A0QH 4JR9H 4UT7H 3I50L 1DSFL 4ZDHA 4GMSH 2A6KA 3I3DA 4NQTA 2VDOL 2FEDC 4KQ4L 3S8WA 1IGML 1C7SA 3LVEA 3R06B 3MV11 4KJYA 2OK0L 3ARFB 1G0YR 2F5AL 1CF8H 3MJGX 2IH3B 5KVGH 1JWUA 4X4XA 3I75A 4MB3A 3EBAA 2JIXB 2A9MH 3IDYB 5BZWB 1WFTA 3GSUB 1IAKA 1QSZA 1U3HA 4UTBH 3UCRA 4J12A 4OCYH 3GMPA 4OCXL 2XOTA 2EDYA 4XC3L 5DA4A 5DUPL 1C5BH 4DUVA 2VR9A 2YZ1A 3BZDA 5A40E 3HG1B 4U1JB 1CFNA 1CYGA 4HAGA 2I26N 3IDJB 4I2XA 3IXTA 2H8PB 1N2RB 4NQDD 4OZHA 3EKCA 1U3HC 4X98B 3MODL 3WIFB 1QA9B 2FBJL 2E7HA 3VMNA 1ZLSH 4PUBL 4QXTA 1T2QH 4K8RL 3T65B 3ZE0F 1AR2A 2YA1A 5JOPD 1I4FB 3IFLH 5C0BE 1NFDB 5MHSE 1N26A 1E4JA 4BELD 2XT1B 5CHNB 3KPSA 4KJQD 3HRPA 4TRPL 4OF3A 4PTUB 2N1KA 3EO1B 1RZKL 1ZT1B 4ZS7H 3AAZB 3QWOB 3JTTA 4J3TA 5IBUB 4R7NA 1LO5A 4M00A 3VI3F 4ZAKD 4FTVD 4FQXD 5IGXH 1KIRA 1TNMA 4DCQA 3GFUA 2HVKA 3Q3GB 4R8WL 1N5YL 3R8QA 1K6QL 4JQIH 4LKCA 4AT6B 2ICWA 1UC6A 1FLRH 4LNVA 4LLDA 1MJJB 2AXJA 3HS0A 3CFJB 3DV4B 4G8GB 1KCKA 4ONGL 5I1EL 3L9RA 4H26A 1XGYH 1TVHA 3TJEL 2XA8H 4HIIA 2DIAA 4KY1L 3WD5L 3MXVH 4P49A 5DQ9B 3MRJA 3PV7A 3D87B 3MV8A 4BK5A 2XQBL 3ZYOA 1A1OA 5IR1A 1IT9H 2EYTB 1CTOA 1CXFA 5KSVA 2NW3A 3SDCC 1PKQE 5KG9B 2Z4QB 4XBEH 1P4BH 2F9BT 5JOFB 1G7HA 4PLJD 2KKQA 4LQ1A 3PV6B 2CO7B 3IAGC 2X4QA 4ORGB 5ACMA 5KSAA 4HKBB 4BFGA 5JDSA 2E8YA 1J88A 3IKCA 4TNVK 1MFAH 4B7IA 4TQEH 3X13B 2AV7B 5F9JB 2W9EL 4Z7OE 4Y16D 1K2DB 2WIIA 3MRMB 2VLKE 5LCVL 3SCMC 1J86A 2PYFB 3ILQD 5MENE 2ENYA 3QDHA 3GO1L 5KSAC 4YQXH 2WBJC 4AL8H 3CSYA 1GIGH 3O4LE 4DN4L 3QBTB 3S5LA 5GS2D 4BFBD 4PB0L 1G7MA 4XPAH 5B38B 1MCPL 3DYMA 4PJCE 3ME0A 1LO3H 1B0RB 3HMXL 5AYUL 3WXVH 5EZOL 3CMGA 1T0NB 4EI5A 1YNKL 1HEZA 2G60H 3HFMH 3MGOB 4N8VG 2A73B 1JMXA 4IRZL 1RUML 3GEWB 4J3WA 4P3CL 5E00A 6FABL 2GEEA 5KBNC 5J3HC 4XNZC 3BPCB 1C5DA 1VA9A 4YIQA 2ARJA 5E2VL 3QUYA 2EDXA 4WGVB 4YXKL 4YDVA 1S7TB 1A14L 3MLTB 1RZJH 3G6JF 3OB0K 1YYML 5FUZH 5HHPA 3NCYS 1CBVL 1NGZB 1NC2B 4L9LA 2XY2A 4N0FA 3DTXB 2VL5A 2CDGA 1S7SA 2DQTL 4Y5VB 3STZA 2VSDA 3QUYC 3GIZH 5JXED 3NAAH 4BFIB 3QEQB 2C3VA 4HBCL 3T2NH 4KUCD 2PW1B 5DUBA 3VXOA 3FONB 1BQHG 2X9XA 1R3IH 2P5EB 3PQYE 3TV3H 4ODWA 3SDAD 3QIBD 2HRPL 3FRUB 2W0LA 4L9LC 5GS0H 1B0GB 3VDBA 3NFPA 5DVNA 2JE8A 4QRTA 2EIZA 4LPXA 2MFNA 3WDHA 3MV9D 3VWJD 1JV5B 5CJOH 1KC5L 4EDXB 1BZQK 4QXUL 2EYRA 2QLVB 1OSPH 3MUGA 4XTRC 3IDMB 2Y4SA 2WWMD 4MA3B 4RFNC 4IIQA 3UTZA 1DBAH 3ALPA 4UTAL 4ZYKA 3M1BB 2E6QA 4KK9D 2R2EA 2VZSA 1MFCH 3KPPA 1G84A 3T08A 3A6CH 3QIUB 1ACYH 3GNMH 1A4JB 1F4AA 1NGQH 1I3UA 2JELH 3CFKA 2AJUH 4QGYA 4ZUUB 1R3KA 2I5YH 3WUWG 4WW2A 2X44D 4O2EA 4EUPH 3UBXB 5E8NA 4MDIA 2AK1H 2IJ0C 5FO9B 4U1IB 3RWEA 5EU7C 5BS0A 1LILA 4D3CL 4G80B 5D2NB 5DR5L 1D5ZB 4X5WB 3ARVA 4WW2C 1DBJL 4MJID 3RTQA 3H7LA 2Z91B 1K8DA 3NGBB 5JXAH 2DQIH 4JY4A 3ARYA 4LSSL 4YEEA 1HHGA 3MA9H 2M8XA 4L4TD 4G8EA 5EO9A 4U2YA 4HD9A 3NIFE 5K9OB 1XIWD 3IFNL 1D5XA 2Y25A 4P2RD 4NKIL 4X6DA 3U2SB 5J9PB 1OGAD 5E6IB 5E7FA 3MLPA 3MFFA 3WO4C 1IC7L 4LLVB 1FPTL 1S9XA 3GI9H 1N5AA 4PJ7A 3JXAA 5DDHB 4G8IB 4WEBL 2KPNA 5FK9A 1U8LA 1A2YA 1I8LC 3NIGF 2ADGB 3H9SB 1FG9C 3O81A 5FFLA 2J6EH 3HC3H 2VSCA 5ICYB 5KS9E 1QR1B 3O3DA 3PP4L 1QSEA 3WSQH 3LSOB 1HH6B 4TTGA 3C60B 2ORBH 3P9MA 3QXWA 5GRJH 3TN0D 1KENL 2DIJA 4S1QL 3MCKA 4BQ6A 2UYLB 3OKMA 4NPYB 2ADJA 4PJCA 2BVOB 2I60H 3SO5A 5JHDB 4DQOL 2BOBA 4RGNE 1B4JH 1FNGA 4TNWK 3ZT7A 2GYSA 5D71H 5JORB 1KFAH 3IFOA 4D9RD 1ZANH 3UJTH 4MSWA 4BQCA 2DMKA 1FNSH 2EDHA 2CIKB 1TNNA 4I77L 3QO0A 4L5FH 4KI5D 4LLMB 2QEJA 1R0AH 4AEFA 5T1KD 4CDGC 1M6OA 4WFHE 1TETL 2Q3ZA 3TIEB 2OXGA 4NP4H 2ID5A 3HCVB 3EHBD 5D1XC 5KN5A 3FN9A 1I3GL 4LRNH 1UWXH 4TVPD 5IBTL 4LIQH 4P2QD 3TYGL 3ZDZF 1NLDL 1ZS8B 3D2UD 3W11C 3O2VL 1ZMYA 1VB9A 2ATPB 3GUTB 4QOKE 3HE6D 1NGWB 1J10A 1IFHL 3WDJA 1KLUB 4Q9BA 5JA8B 3L3GB 1G1YA 4XHJD 2D03L 4S1SH 3KWWA 5C0JA 5IB2B 1JF6A 1GZQB 4ONFH 4DK6A 5HHXH 4A2LA 5JQ6L 2ATKA 4WWKB 3VI4E 1BECA 3QCUL 4UQ2B 1RIHH 3BYYA 4R2GD 3MGTA 3SKOB 3FQNB 5DRZB 2EZ0C 5TGBB 3P77A 1QHPA 5H8DA 1C12B 5D7LB 2JK5A 5AZEL 1G7JA 3MJ7A 1C1EH 4GAJH 3TF7C 1K8IB 5CGTA 3WLBB 1UADC 1P7HL 1RJLB 2NY0B 3KXFB 5AYQA 3U4BH 3FAWA 4M7LT 5TQ0L 1CDIA 1FO0L 4Z0XB 3GRWH 1TZIB 4Q6IC 2DTMH 4NQCB 3IFPA 3VA6A 2AERT 2MOVA 3ES6A 5C0IB 2GJZA 2CLZA 5GGRA 4PREB 5HI3D 1MUJB 3RIAF 2COQA 1F45A 1ZSDB 2QKIB 1CT8B 4JANA 2FYYA 1MCLA 4QTHA 2EXYD 1T5WB 2CRIA 4JFZH 3EIFA 3O6MH 3MV7B 3ARFD 3F7VB 4O00A 5E2UH 1QFHA 1CE6A 1KLGA 4R96A 2HA1A 1NFKA 2XZQL 4LASL 3U9UB 5FHAH 1PQZB 3QDAA 2VDKH 3V52H 4YGVA 2JIXD 3CFDB 5BRZE 4LDOB 2F5BL 2KZWA 5C6WH 3QG6A 5EU3A 3U30B 4RMTA 2IC2A 4HV8B 4D0CA 5I1JH 4QT5A 5EA0L 3SDYH 4S1DD 2A2QT 4N0RA 5GGTA 1S7RB 1YC7A 3V4VH 3H9ZA 3HG1D 4NRXA 1CGYA 4RGOH 3L6FA 1DBBH 4MHHG 1G9EA 4Y4FA 4C54A 3VFVB 4D0DA 1J12A 1KPVA 4RDQG 4U1HA 4NCDA 4LPVA 1G0DA 4PG9B 1JZ6A 4DEPC 1HHHB 4FQLH 4EXPX 5GGSY 5INCA 3HHRB 5E7BA 3MRBB 2MCPL 2VDLL 3M8OH 4PTTB 4POZC 4Y4FC 5CZXC 2DWEB 4JDZA 5LWYL 1UWGL 5FECA 1WAAA 4LVNC 4XXCA 4XC1L 1HSBA 4FFZH 4KZEH 5I17B 1Y18A 3UEZA 3D18A 3C8HA 5DO2C 5BVJA 3IDNA 1BWMA 1G9ML 4HWBL 1HHKA 1RULL 3CFBB 2OYPA 4NQDE 4N1HB 4O58L 3HMWL 1MCOH 1DBML 4G8GD 4HH9B 4JFDB 3K4ZA 4XGZA 4XXCC 2YRPA 2GIYA 5CIPA 4N0YH 4WU5B 2VQUA 2A74B 2WINB 1MEXL 5E2WH 1SJVA 4U7SA 5JOPE 3GMLA 1I7UA 2R4RH 3T0AA 4RGNC 4PLOB 1U6AH 5C08B 1I9IL 3BKML 4CVZA 3B3IA 4XBPA 4HGKC 1QFWH 1OL0A 2IADB 5ITBH 5IB4A 4NRZB 2BNRB 1JN6B 1VFMA 5A3ID 1U8KB 2DLHA 3QFJA 3CZJA 2X4OA 4FTVE 5F8QC 3NPSC 1CE1H 3P4OA 2VXUL 3ZE1F 4IOIB 1E27A 4ZFZA 1F4HA 1DL7H 4PLKC 1YEKL 4GW5B 4B41A 2FD6H 5CFHA 1T3FB 3ZDYF 2Y72A 3SOBH 3QQ3B 2R2BB 4WNQB 1IILE 4K9EH 2W0FB 2CKBB 3V4UH 3EYFB 1MOEA 4P57A 4Z0BH 3FOLB 4EN3A 5L0QB 1XF5B 1ZA3B 1TJHH 4KHTL 5AD0A 2ILLA 4R4NC 1JHKH 4UV4L 4H1LB 3SY0A 1KIPA 1AD0A 1P7QA 2F74A 2V6HA 4KKCD 5KSUA 3QUMA 1U41A 5HGHA 9CGTA 3DO7A 4WUUA 1BFVH 3RVXC 4Y4HA 1ND0B 3ARBB 2C4FU 3RI5K 2BVPB 1GAFH 1Y0LA 5F1IB 4OLUL 5TF1H 4ZFOA 1ZWIA 2BCKB 1DQML 1UWXK 2FIKB 5DHVA 3NA9L 3P9LB 5J13B 4UDUA 3WFBL 3RHWF 1R5IA 3PL6D 2DRUA 2GSIB 1X5AA 4Y4HC 4CNIB 1QFUH 1RUQH 2BXZA 3LKPB 2YC1B 2OTPA 2HLAB 3O45A 4UT6H 1EDQA 1KCVL 4GW1A 3MCLH 4DUWA 1VGKB 2APFA 4Y8DC 5EZLA 3B2VH 1RUAL 3K80A 2WWKT 4AM0A 3QEQD 1Q0YL 4WWID 3QDJA 3FO0H 1JPGA 1U8JB 2P5ED 1F4XL 5K9JL 4NN7B 3VXNA 4MD0B 3KYMA 1AD9B 1BLNB 2ZSVA 3ABZA 1DZBA 3IXAB 3WYRA 4CW1A 1MSPA 3MRQB 2HTLD 1GGBH 5IT2H 3NPZB 3KS0H 2W91A 4UDTA 2J8UB 4PJAE 1MJ8H 5HYIA 4WO4D 4JHWL 1SEQH 1IKFL 1INQB 1F11A 1JE6A 3GDBA 4XP6H 2XTJB 5E2JA 4PY7A 5EUOF 5JQHC 4XCEA 1FNFA 2VERN 3NN8A 4G5ZH 3IJYA 3QIUD 4QRQB 3RU8H 1M7DA 3RPKA 2R0KH 1T03H 5SWSA 3OHXB 1HYRC 3TJHD 4IDJL 5C0EA 4XCCH 2HJFB 3PWNB 1AH1A 3LD8B 2G5BB 3MV9E 1HDMA 4YHMH 3WLWD 5JLZB 5J6GA 5JPMB 4L8CB 2VXQH 1I9JL 1VACB 5IG7B 1C16A 4LEXL 1INDL 3LKOA 3W2DH 1I3VA 4ZS6D 5IBLD 2OL3A 1U92A 2P48B 1MQ8A 3P30H 1IQWH 1MREH 4N0UE 3ZSSA 5FCUH 1YNLL 4K3EL 3PHQA 1IGCL 5E6ID 2DM2A 3TZVA 1N6QL 3ZSTA 3HUJA 4KJWC 1BEYL 1IAOA 4JFOB 5J4MA 5JW4M 3B8YA 4X6CB 4GQ9L 2R23A 1KCSL 1VSCA 4UQ3A 1RMFL 4EI6B 5F7HA 1FHGA 3H9SD 4BM7A 2G2RA 4MJIE 3TZVC 1UJ3A 3ARDA 5ESQB 1FRGL 2NY5H 5IK3B 3C60D 3EYSH 4DW2L 3IJSB 4JEGB 2UVEA 3EO0B 3E6FB 4YDLB 3GSQA 4L4TE 1U8HA 3ALWA 3T1WA 3IS1X 1BOYA 3MZGB 5JHDD 4P2RE 3JWOH 2YBRA 2FECL 3K1KC 2Y5TB 3CMOL 4R4BB 5JNYB 2H3NA 1OGAE 3O2WH 4H25B 4JJHA 3I6KB 4Z9KB 1BREA 1UJ3C 1WZKA 3UC0L 2VMFA 2V2WB 3PNWB 3H7BB 5F7EL 2GFBA 4KV5F 5EOCL 4PJAF 4WW1A 4C4KT 4PJ5B 1HI6A 2DI8A 1TVDA 3RWCA 3WCYA 4JHAL 1A7RH 2AJVH 3RZCD 4EVNA 2ZPKH 1E4XH 5F9WB 5C8JB 3RVVD 4OD2A 4Q0XH 4NJAH 2DAVA 4Y2DA 4LCYB 5GZND 2ADIA 5IEKB 1FVEB 3OWEA 1OWWA 2B7DT 5I1DA 3P0VL 4GT7A 4HWEL 3CDGB 2QQLL 1TQCC 4HS6A 1MJUL 1R5VA 2X7LA 2NCMA 3A6BL 1GHFL 3OKLA 3N06B 1XF3B 3Q0HA 4U1KB 5EN2A 1QNZH 4D9RE 3VXSA 5ERWB 1RZ8B 4P9ML 4Y2DC 2A77H 2Z0BA 4ODVL 3KS0J 1RJZA 2QV2A 4WWKD 4HW6A 4P2OA 3QHZL 2X40A 4KI5E 3CH8A 1KEML 5CD3B 5MEQA 3ISWA 1UVQA 5I1HL 1BBJB 2WUCH 2J88L 1MCQA 4DOHE 3LZFL 4TYUA 4HC1L 5D7LD 1LVEA 3DSFH 3TA3A 4CAGA 3MYZA 4RFEA 2VDQH 4JJ5B 5EC1A 4M7LL 1CGUA 3FB8A 4NN6B 4R3SB 1YUHA 2MTPA 3S97C 3ILPB 4TVPE 2NY0D 3G5VB 3KXFD 3TBVA 2H6PB 4P2OC 4P2QE 1YPZA 5C0RH 3WS3B 4EEEA 4WTXA 2V7HB 5KVFH 4NT6B 1NSNL 3DYPA 1F2XK 4NQCD 4KTEH 3QXTA 5EULV 3SDXF 4YK4B 5IIEB 3H9HB 1E28A 5GZOD 5KVMC 5GRUH 2Z31B 5JXEA 1SYVB 3BEWA 3VFWB 3P2TA 4OZGF 1YY9D 3C09B 4OFDA 4S2SA 2R29H 5H37G 3H2WA 5HYJB 3UAJC 4L4JA 1M4KA 3RJQB 3MV7D 3O8XD 1IARB 4Z77B 1XCTB 2GT9A 5EOQL 4LBEA 3SO3B 2V5TA 4L8SA 4PJHE 5JXEC 3G6AA 2LABA 2C7UB 5C2BL 4ZOBA 5EDXA 4P2CG 2BXYA 4JREB 2ICES 2Z35B 3PP3K 4S0TD 2NPLX 3K81A 5HGBA 4YHOL 5IW6B 4L8SC 4PGCA 1UYWH 2D7MA 3VWJC 5DJXB 2AP2A 4M1GL 4XPBL 4HFUL 4KKNA 5HDBF 5A16A 1S9YA 2VRAA 1I7ZA 2CDEA 1SVZA 3BKJL 5CINL 2Y23A 1MIMH 1TENA 1CR9H 1AP2B 3CVIL 4OZFA 5ESVB 4RX4A 4MD5B 3SDXB 1OGTA 4M6OH 1QBLH 2DJ4A 4NKMA 4HGWA 5DK0B 1S7QA 4P2YA 4FXGB 3NIDE 3C9NB 4MJIA 3QHFL 2JJUA 3VFRB 4OFYA 2DTSA 1RI8A 5JW4Q 3IKKA 3D1MC 2R15A 4Z95L 5BZDB 1F97A 3MLZL 1AC0A 4AENA 5DFWH 3HG1E 3LN4B 4LSQL 4MS8C 1WJ3A 3MRRA 1LE9B 5C9JB 1EXUB 5FF6A 4LP4A 5MERA 4OCWL 4KKBC 3VXQA 5GGTH 3HR5B 5FOBA 1MCCA 4ZUSB 3BISA 3BPLB 5IVZB 5DI8A 4OJFH 1CD1A 4QHKI 1LE5A 1ZHLB 4HFWA 4EXKA 4YPGB 2IALB 5EOTB 5J1AB 3BSZL 1S9VB 3CDCA 3KYOA 4YO0B 3SQBA 3WIHL 3ZTNL 3QYCA 4OTXH 5C08D 3NA4A 5E6YA 3U7YL 4LSVL 3VFPA 5F7DB 5I1LA 4M7KH 4J3SA 4BSVA 4FA8A 4JG1L 2BNRD 3NABH 3O3UN 3BIBX 3TN0A 5SWZB 2ZUVA 4J3UA 4K94C 2EKSB 1O0VA 4I18A 5HYFA 4ZPVA 4GRWB 3L3IB 4ELMF 1IZJA 5TE7H 4DTGH 2ESVD 3MJ9L 3CU1A 4AH2A 3H9YA 3UJJH 4LCUA 5T5FL 4YE4L 3GHBL 3FT2A 4HUVA 5LQBL 4QHMA 4XX1E 3TN0C 4PJEB 3QCVH 5F72S 3LKSA 4I18C 3EOBB 5T1KA 4F37K 2IPTL 1CD0A 1HQRA 5CCKL 1CGXA 4TNVF 2K3TA 2FZ3A 5D2LA 1YY8B 3OKKB 3WE6A 5IV2A 2Y1VA 2D7PA 4GG6A 2BFVL 4Y5XC 4AG4L 4OD3H 4P2QA 4KI5C 3NH7H 4G6FB 3V9FA 5JO5A 1DVFA 4M93C 1P69B 3ARBD 4M6AA 5D7SH 1JJUA 3RWDA 2FJHB 4DFHA 4V2CB 1CFTB 2F8OA 1SYSA 3ET9F 4JPWH 4FQ2L 3E1F1 1OTUD 1QTYT 1TZHB 3MOQA 1IGJA 2PW2B 3G04A 1HXMB 4IBLT 4ZQKB 4L3CA 4ORZC 5TDOB 1EBPA 3GJEA 4NRYB 3TESA 3HE6C 4JN1L 1MCJA 4HKJA 2Z92A 5EFIB 4MAYB 3LKNA 4XHJC 2EH8L 1RFDH 4NBXB 1NGPH 1YYLH 5ESAA 4L29A 3ZHKA 4ZTOH 5JMOC 3TIDB 4ZSOB 3PWUB 3RL1B 1OW0A 3S36X 3KYNB 4R2GC 1A0QL 4JR9L 5CP7B 2VIRB 5FUCE 4GMSL 2M1KA 1TLKA 1NUNB 2VLJA 1V5JA 2NX5B 2FJGB 1F6AA 1DBKH 3L3HB 3C6LD 3VG9C 4E0RB 2EH7H 1OW0C 3BWAB 1CF8L 5KVGL 1EH9A 4WI9A 2X4NB 3ARTA 1FNEB 3JBG7 1I1AA 4WIQA 3BDYH 2A9ML 3ARFA 3QG7H 2XTJD 3INUH 3IU3B 4UTBL 4RIRB 4OCYL 4JM2F 5HI3C 3KLAB 2C1OB 1TMCB 5FO7B 4RA0C 4HSQA 2JIXA 3QISA 1C5BL 2BVYA 3GSUA 3QEQE 2VNCA 3OJVC 2C9AA 1KOAA 4XRCA 2I9LB 1HN1A 3SGEI 2EXYC 2P5EE 4OGZA 3TBTB 4ZUVA 4GKZB 1CN4A 3ARFC 1FBIH 4WY7H 5CJQH 4XNUH 1EAPA 3AMLA 5D93B 1RIUH 2LU3A 3FJTA 1ZLSL 1A5FH 1RZGB 3IDYC 1T2QL 5CUSH 4IS6B 1N2RA 5EZJB 3O9WB 3U0TB 1NBVH 1QA9A 3IFLL 4Z7UA 4MXVE 4S1DC 2D7NA 4D94A 4H0IA 5GJTH 3HI6H 3TWCH 4JB9H 1NFDA 4ZS7L 5K9QI 5IMOB 5AUMB 4KQ3H 1II4E 5CHNA 5IGXL 1IAIH 5TQ2H 4PTUA 2VLLA 4BH8B 1U8MB 1ZT1A 5L7XH 3QWOA 4JQIL 4KC3B 2VR4A 1QSFD 1GC1C 4P3DB 3HAEH 1FLRL 4JY5H 3JUYA 3Q3GA 4BZ1H 4JVPA 1XGYL 3GSNB 3QIWB 2AJXH 4IOFD 3EYQD 1FGNH 2PCPA 2XA8L 4M5YH 2YXFA 1JRHI 5GGVH 3GJFA 3MXVL 3DV4A 4G8GA 4AEIH 2ED9A 4ODHH 1IT9L 2FATH 1ZT4A 2QSQA 1EZVX 4XBEL 1P4BL 5DQ9A 1EJOH 5IBUG 5LGKA 2F8VA 4Y5YA 4K55A 3KNBB 1LK2A 5KG9A 5F1OB 1MFAL 3TP4A 3PV6A 4H5SB 4TQEL 3IAPA 2P8MB 3TCLB 4ORGA 1ETZA 2FX8H 1J0KA 5C0FB 4XX1G 5AZ2H 1B6DA 4PJ5D 4U6YB 2AV7A 1G7QB 5F9JA 5DEGA 4YQXL 4AL8L 4NZRH 1GIGL 1K2DA 1TPXB 3CIQA 5T5NF 1M71B 2WUBH 4XPAL 3H9SE 2H32H 3RKPA 1ZVYA 2JF1A 1IM9B 2EE9A 1JGDB 1MHEB 1VEPA 1LO3L 2X9WA 4ACPA 1H3XA 3VGAC 3WXVL 1FDLH 3GKZA 2FRGP 2CDFB 4OFVA 1HKFA 2G60L 3HFML 3OJDB 5JHDE 1F8TH 4NQEB 3QSKB 4O02H 1JZ8A 3S3PA 1KN2H 2OBGA 4NCC2 4MNQA 2XZCH 3FN3A 1XGUB 4F7PB 4GW4B 2A73A 1A7PH 5IHZB 3OAUH 3FCTB 3HNSH 2XQYK 1RZJL 2BVQA 4R7DB 3BN9D 5B38G 1JL8A 1XH3A 1YMMD 4PGBB 2LTQB 1CDBA 1MAMH 2XA3A 4LCWB 5FUZL 4PG2A 1UA6H 4KKCC 4UIMB 2UVFA 1T21A 3U4EB 3VRJB 2CPCA 3BP6A 3BFOA 3GIZL 3NAAL 3FT3B 1NC2A 1JHLH 4GKSB 3T2NL 4K8RC 4NZJA 3DTXA 2YOCA 1R3IL 3TV3L 4AIZB 3ZMRA 4U1NB 2Z31D 1HCVA 5GS0L 3HE7B 2GJ6D 4R0LB 5EBLB 5CJXC 4HIXH 3FONA 1NCBH 1MVUA 4GXVH 5HYJD 5CJOL 2HVJA 4KKLC 1MHHB 1RZKC 5D7LE 1OSPL 1NAMH 2A6IA 4OLVH 4Y5VC 1FVDB 1JV5A 2XN9A 4NNYB 3GSRB 1FZKB 1T5XA 4BK4A 1NKRA 1G7LA 2D31B 4EDXA 1DBAL 3KXFE 5FO8B 1M05A 1MFCL 2B4CH 3KPNB 3A6CL 5FV2A 3R1GH 1V7MH 1ACYL 4LSPH 3GNML 1NGQL 2JELL 4NQCE 2WP3T 2AJUL 3MNWB 2I5YL 3M1BA 1N6VA 1TCRB 1UM4H 4GAYB 3QIUA 1A4JA 2AK1L 4RWYH 1FZOA 1QRND 4K3DH 3G6JA 4XP4H 3REWB 1MRDL 3QCTH 1DLHB 5JW5B 3MV7E 1CICB 1TTGA 4EKXA 2CXKA 4X8JA 3CPLB 3QIUC 2B0SL 3OG6B 5JXAL 2DQIL 5D2NA 2EDLA 5I0ZA 3MA9L 3HMXA 4RAHA 2GUOA 2Z91A 3HTLX 4MMXC 3TJHC 1BQUA 5J57B 5GPRA 3DWTA 3IJHB 4UUJA 3QXDA 1OAKH 1YJDH 1R3JB 4MJ4A 3UBXG 5GGUB 4ZUTB 3G08A 5K9OA 1A6TB 3F12B 5D2NC 5FCSH 4ZXBA 2B1HL 3G5XB 2YPVH 2Q20A 3S4SG 3GI9L 5DWUH 1A1NA 3NGBC 4RMUA 4LLVA 5DMKB 1HWGB 5E9DA 5E95B 5T3ZH 1BHGA 3BD3A 2J6EL 5DDHA 4U6XA 2A6JA 3HC3L 3WSQL 3S3SA 4OZFH 2ORBL 5GRJL 1OP3H 1SJHB 5E6IC 2XWTA 1UZ6E 4KUZH 2HLFC 1H3PH 5B3NA 5ICYA 5LGHH 2I60L 3ZE2E 3DJ9A 3LSOA 4HAFA 2HFEA 5F8RC 4JFYB 4O2CB 1B4JL 5SWZD 3FFDA 4HJJH 5D71L 1KFAL 1ZANL 3UJTL 1MRFH 2LE9A 3PDGA 4ZTPL 1FNSL 4LNRB 4OD1H 2CK0H 4KI1A 2BZDA 4L5FL 2AGJH 2NY3B 2JCCE 5FA4A 1R0AL 4EBQH 5CEZD 1FYHB 5EO0B 5LJYH 2CIKA 1BVLB 4NP4L 1AGBB 2CSPA 4LLMA 1XR8B 1SHMA 3MLYH 1H0DA 1YN6A 2XTLA 4KK8C 5HHMB 4LRNL 2QSCH 1RU9H 2BNUB 3PWPD 4LIQL 3RVTC 1A6AB 5HI5D 1OAZH 3U6RB 3VFSA 3ZDXF 1T0MA 1T0PB 1QZ1A 4G6AD 5B8CB 1T20A 2BNRE 4D0BB 1ZS8A 2FSEA 4NWTH 1AKJB 2VXVH 3BDBA 4G6FD 5I76A 1NDMB 4S1SL 4F7EB 3ULVD 1P4LA 2YPLA 2WV3A 1EK3A 3O41B 4ONFL 5HHXL 3V6OA 2ESVE 1J8HB 4XMLH 4F7MB 4P4KB 1RIHL 2HKFH 2ZUQB 4F7CB 4AEHL 5IB2A 5IMMB 1GZQA 1L9MA 5GZNC 4WWKA 12E8H 1C1EL 4P5TB 4WU7A 3OG4B 4GAJL 3SKOA 3FQNA 5TGBA 1DLFH 1HYSD 3V6OC 1XGRA 4MAYD 1P4IH 3U4BL 2BSRB 3UTPD 5F6HI 2MJWA 4K3JH 1XT5A 2UZIH 3VDCA 1XGTA 4MQXD 2E7CA 3GRWL 1TTUA 2DTML 4WWKC 4UNUA 4FFWC 4E41A 5IJVA 4MWFB 5IHBA 2IQAB 4J3OC 1IEHA 4HS3B 4CVUA 4LSRH 1AJ7H 1TZIA 1QPXA 2FB4H 3QDGB 4C55A 2PNDA 3O6FB 5I8KH 4KMQA 1A7OH 1U8QB 1MUJA 1WUNT 4M4RA 4JFZL 4H88H 3O6ML 2NY0C 1ZSDA 4MX7A 4JFEB 5E2UL 1VADB 1U93A 3NACH 2MQ0A 4FS0A 3VGDA 2AXHA 1LP9F 5DGQA 5FHAL 1OPGH 3OGCA 1T5WA 2GCYB 2VDKL 3V52L 2YXMA 1QG3A 1AGEA 5I66B 4JRYB 4B0MM 3L3DA 1ROWA 1PQZA 5I1JL 3H0TB 2VL4A 1D9KB 5GZOC 3SDYL 3CFDA 2ITDB 4XWOC 3V4VL 2MQCA 4HV8A 3QT2A 5ICZB 1RZIB 4RGOL 1S7RA 1DBBL 3WO3B 1BP3B 5SV4A 5J12C 1IEBA 4MQTB 5CEYA 4CJ1A 3U30C 3O9WD 1FGVH 4GH7B 2J8UE 1QFOA 3DSNA 3S96B 4FQLL 3VFVA 1J0JA 2V5MA 1UQSB 43C9B 1PZ5A 1X9QA 1A9EB 3FQWB 4MGXA 4PG9A 1U3JA 4JO2H 3QNXA 3M8OL 2XTJE 5E56A 2NXYB 3UXFA 1EBAA 2F19H 3M17B 4ZPTA 1IAMA 2LVEA 2EKJA 3MRBA 4CADB 4R4FH 4FFZL 4KZEL 5DYOA 1BZ9B 3FTGB 4KDTA 1OARH 1A1MB 3PJSB 2DWEA 2VLRA 3RUGB 5TE6H 3Q1SH 2CH8A 1OF2A 4KRPB 5DJAA 4LGSB 4HK0B 5I17A 1FVCA 1OP5H 1MCOL 4UINH 4FN0A 4XNQA 2IGFH 2X4SA 4JM4H 3MUHL 3CFBA 3QQ9D 3DUUB 4N0YL 4KDTC 2IBZY 1YZZA 5E2WL 4LU5H 4J7RA 4Z78A 2R4RL 1NEZB 4JFDA 1YN7B 1U6AL 1QLRB 2E27H 1QFWL 2WINA 5KANI 5ITBL 1FL6B 1F90H 1FYTB 1PX3A 1T7WA 1D6VH 5C08A 1FO0A 4RSVA 4OV6F 2ED8A 4NM8H 1F3RB 1CE1L 3SJVB 4CVWA 3N9GH 3QUXB 4QF1A 2Y7QA 4PRNB 4NQVB 4NRZA 1JN6A 1DL7L 1QSFE 2FD6L 1AE6H 3C8KA 1T1WB 4X6CE 3SOBL 1FORH 3D0LB 2L0DA 4IOIA 4K9EL 5E99H 1DANU 1OP3K 5F3BB 1A47A 4J8RA 4PJIE 4W4NA 3V4UL 1T3FA 1T1XB 4Z0BL 2R2BA 1IM9D 4WNQA 2W0FA 4N8PA 1TJHL 1V7NH 3RWJA 3UDWC 4NKOA 3EYFA 5KAQG 1JHKL 4GMTH 3GMQB 5EUKA 1ZA3A 3DRQA 4RRPG 5IM7B 2JTDA 1BFVL 1CLCA 5IKCA 5EU5A 1MCNA 2BERA 5K59E 1O5DT 3X14A 5F89B 2V2TB 4KK6D 4IRSA 1B9ZA 1GAFL 2BOCA 5TF1L 4ZDHB 2A6KB 2A0LD 1ITCA 3GSWA 4OF0A 5L0QC 1ND0A 4PJ5E 4X9FA 4G7VH 5F1IA 4IOSD 1QFUL 2P5WA 4WFED 2AVGA 4LCWD 3P9LA 1E4WH 1I9RH 2YR3A 4IRSC 3K4DA 4UT6L 1JWUB 2GSIA 3MCLL 3I75B 4H1LG 4EIZC 3D3VB 5AEAA 4GRLA 3IRZA 3EOTH 3B2VL 4MCZA 5DSCA 1VFUA 3GK8H 1X5FA 4XVTH 3ARBC 5IEHA 1U3HB 1EGJA 1FIGH 3GMPB 5FYJH 2H26B 3TPUA 3FO0L 4ONHB 5I2IA 1VGKA 1SM3H 1A7BA 4MQ7B 5T1DH 2ICEB 3HE7D 4OM0H 4HWBA 4KH2A 1W0VA 1U8JA 3E3QE 3IXTB 4KFZC 4OZHB 1GGBL 5IT2L 1MLCA 1FC2D 1AD9A 1BJ1H 3BX7C 1YMME 3IXAA 3OXRA 1MJ8L 3TH2T 4EOWH 1SEQL 4HULB 4IEFB 2C3HA 3L5XH 4PJFF 3QDMD 2DOCA 4XP6L 1G9MC 2W0PA 1WQVT 3NCBB 1ADQH 3GSVA 4NN7C 1INQA 4G5ZL 3RL2A 2XZAH 2D9CA 3KPSB 3RU8L 4JO3H 2BK8A 1A6UH 5D5MF 2R0KL 1T03L 3JTTB 1NL0H 4R7NB 1LO5B 4XCCL 3MLUH 1KIRB 4DCQB 2GJ6E 4Y4KD 4PJIF 3LH2H 2WLZA 5E5RB 3OHXA 3VFGH 1AC6A 2AJYH 2ICWB 4YHML 1CICD 1H15B 2XTJC 4LLDB 3VXRA 4HHAA 2W1NA 2VXQL 1RIVH 1TVHB 2DQHH 3W2DL 1I8MB 1QQDB 1QHOA 3QQ4B 4OCLC 5HI4D 2EDWA 1CGTA 1T04B 3AMKA 5FKPA 5IR1B 4L8CA 5DK2B 1FFPA 3P30L 1IQWL 3OGOE 5BCAA 2NW3B 4OUOA 1MREL 3LCYA 4OFKA 1G7HB 5FCUL 4OLZH 3LD8C 3VD4A 2X4QB 3V7AE 3RGHA 1V05A 4JZOB 2YA0A 1T7YA 4M9OA 5JDSB 2B5IB 2Q6WB 3MOAH 1QRNE 1VFBA 4X99B 5J8OA 1YDPB 2X1QA 5T1LD 5DLMH 3ULSB 4WI8A 3AM8C 2PO6B 4QXGH 5EUOA 1JCKA 4E9LA 1NBZB 3DRTB 2NY5L 3EYSL 1ODAA 5LCVH 2UV3A 4LHUA 5C09B 3WNPA 4UBDD 3F5WA 1KCLA 3JWOL 5IK3A 3IJSA 3EO0A 4EI5B 3VCLB 5GRVK 3O2WL 5HYSG 3T3ME 1TJGH 1KUMA 4YDKH 4IOFC 2Q3AA 4XPFH 2N7BA 4MHHI 3QWRD 2Y5TA 1CD9B 4QWWC 5I71B 4W6YB 4Z8FH 2HAZA 3I6KA 2RB8A 3L5JA 1CGWA 2WAHA 2NR6D 3AREA 1Z6JT 1A7RL 3PNWA 4YIQB 2AJVL 2ARJB 4YDLC 3H7BA 2D2OA 4YDVB 3AXLB 1EO5A 2ZPKL 3MBEB 2VUYA 1E4XL 1UKTA 4PFEA 4ODUA 5HHMD 1CFQA 4Q0XL 4NJAL 3ZTJG 2WZPD 2RAMA 1RK1A 2XKNA 3VD9A 2PTUA 2UZYB 4K3GA 4L9LB 2O5XH 2PF6A 4PR5B 4C56B 1CCZA 4LGRB 5IEKA 2VL5B 2CDGB 1S7SB 2EIEA 4UIKH 1AKJD 5DUMH 1RD6A 1EIBA 1QNZL 2E7MA 2C3VB 4GRWE 1KYOJ 4G42B 2A77L 1IRAY 3CZFA 2YPKB 4CMMA 2M2DA 1EUTA 1BJ1J 4ODWB 1J8HD 1XF3A 3WHXB 1CWVA 1EEUA 1S7UB 5F9WC 2WUCL 5CEZE 3RX7A 4QRTB 2EIZB 3JUZA 3DSFL 5DVMA 4PJEE 3GJFK 4WEMB 2VDQL 1BBJA 2EYRB 3HI1B 2C4FT 1DN0A 2VDNH 3PWPE 4BSWA 2BNQB 2WIMA 3F58H 4IIQB 3UTZB 4JJ5A 5DHXB 5C0RL 5KVFL 4QNPE 1B3JA 1CGVA 4ZYKB 4CN4A 3ILPA 2R2EB 4KTEL 1GRWA 3G5VA 2AQ2A 3FQRA 3LEXA 4HLZG 5GRUL 3ULVE 1R3KB 4WW2B 3L5WA 3QDGD 4P3WA 4O2EB 3OF6D 1GVIA 4NN6C 1SYVA 3VFWA 5DT1H 4JFED 5ISZA 1EEZA 5T33H 5BS0B 1LNUA 3UJIL 5HYJA 3QB7C 3Q2CA 1MFNA 1XCTA 3RTQB 1BAFH 5F7KC 2KQMA 3WO4B 4YK4C 4JRYD 1OTSD 1PX4A 4FQIH 4JY4B 3UTPE 1D9KD 3VXTB 2Z31C 1R5WB 4YHLH 4UU9B 3C09C 1DBJH 4ZOEA 3QEHA 1L7IH 4LL9A 2X5PA 4W6WB 4P0DA 4ZSOE 1H3WM 1KYOK 1UYWL 3QNZB 2YS4A 3UZQA 1UCTA 4P23B 1UWEH 5I0DA 2FLRT 3MFFB 3ZHLA 3SO3C 5IW6A 4P4RA 3WKMH 2BHYA 1MIML 4JO4H 5DA0B 1CR9L 1J9CT 3LPFA 4PJ7B 4M43H 1OSZB 4M1CC 4M6OL 4X7CC 1QBLL 1CXHA 4PS4H 5FK9B 4DKEH 4JREC 1A2YB 1AP2A 5ESVA 2ICCA 5E4IA 5E8EA 4EJ1C 1TZGH 2PYEA 3SDXA 2NXYD 4J3XA 4PJGB 3O3DB 1JTOA 5LKNA 2B2XH 5DK0A 4OZGA 3V7AG 3EAKA 3MCKB 5C0ND 3OKMB 3C9NA 5DEZA 4CDHA 2BOBB 4NN5B 1FNGB 2GTWA 1KJ2H 4FQHB 4KRPD 2QR0B 3IFOB 3PABA 5GGTL 3O11A 2SEBA 3V7MA 3OAYH 3LN4A 3OJ2C 1LE9A 1S78D 2XV6B 5KSBF 2IPUK 4HUWA 3HR5A 4HC1A 1AHWA 4CUCA 4ZUSA 2LAAA 3WFHB 1ZHLA 3FKUS 3JVGC 4OTXL 3VGGA 5CZVH 4YPGA 1J0ZA 2F8XC 2IALA 3FB5A 1BD2B 4GRMA 5EOTA 5J1AA 1JBJA 5GGRY 1AGFA 4KK5D 5E08H 4L3AA 1FYTD 3KPRB 4M7KL 5E1HB 5CSZA 3K7UA 3NABL 1NMAH 5FM5M 3BPLC 5F7DA 4IRJA 3QUXD 1HNFA 3HNVH 1MI5B 5TE7L 4DTGL 3T0DA 5SWZA 3KWWB 4MYWB 3HC0B 1AQKL 1IFHH 4AIXA 5GS1A 1GOFA 3BD5A 4J6RH 2VLMD 5B39A 3QCVL 3X3FH 1R24B 2QL1A 4MZ2A 1ZKAA 5JQ6H 2JK5B 2JJTC 2FGWH 1G7JB 1N64H 35C8H 4BH7A 4LAQH 4YLQT 2APXA 4WI7A 3JZ7A 3EOBA 4Y19A 3B83A 5GS1C 3TT1H 4N9GB 4OD3L 3IFPB 2HH0H 4HIJB 1KB9J 4WFFD 1T1YA 2GJZB 3UYRH 5GGRB 5D7SL 5E5UB 1KCUH 3BAEH 4JPWL 3K46A 2FYYB 3CDFA 1BMGA 2FR4B 4YR6B 4HIEA 3HPLB 2CRYA 3O3EA 4F15B 4R96B 3LQAH 4G6AC 8CGTA 5DGRA 1JZ5A 1FFOB 2FHBA 3P73B 4N5EC 4PRIA 1KTKE 4YGVB 4ZQKA 3PWLA 5ENWB 1RFDL 5TDOA 1NGPL 1YYLL 3QG6B 5EU3B 1ZGLP 5HGDA 5EB9A 4ZTOL 5EFIA 1U3HD 3ROOA 3BEVA 4BZ2H 2W65A 4QT5B 4P5KA 2X1XR 2GK0A 3K8KA 4YGAB 3ETBF 1ZAGA 2VDMH 3RAJH 1J1OH 1CDJA 4X5LA 4ZSOA 2KUTA 4NRXB 4NSKB 2JJSA 3BH8A 1A6VH 3FO9A 4K71B 1DBKL 1W8OA 3L6FB 4MAYC 3WEXB 4Y4FB 5D70H 5HDOA 2EH7L 2J12B 2NX5A 1X5LA 1DQTA 4X7TA 2FJGA 3IETA 4U1HB 4MQXC 2NZ9D 1K4CB 4WFEE 4ZFOL 4L3EA 4LCWE 3BDYL 1QBAA 3QG7L 4HS8H 1EEQA 5E94A 4E0RA 3WIHA 2UWEE 3INUL 3FO2A 2JJSC 4YDJB 4PGDB 2DF3A 4PJ9A 1FNEA 2V9RA 4PIRF 4MJ5A 3KPSD 3WFCH 1B90A 4XVJH 5IQ9A 4JDZB 4RIRA 5FECB 1KB9K 3KLAA 2C1OA 5FO7A 1HSBB 2BJMH 1W0YT 1V8HA 1FBIL 4WY7L 5CJQL 4XNUL 3D18B 1EGJH 4X6FA 3IDNB 3MJ9A 5MI0B 5SWQB 1A5FL 2RQ8A 2Q1EA 5FYLE 4MA7H 1NBVL 4XGZB 2ZG1A 5CIPB 4O58H 3FRPA 4IS6A 5EZJA 5GJTL 1NUFA 3EFFB 4U6HA 3QDME 1Z0NA 3U0TA 4KRMB 3TBWA 3UTOA 3GMLB 3HI6L 2VXTH 1I7UB 3TWCL 4JB9L 1UACH 2VKXA 1D6EA 4CVZB 3U7WH 4XBPB 4KQ3L 1IZKA 4QTIH 5TJWK 4LSTH 5IB4B 2RGSA 4YX2H 4FZ8H 2XACC 1IAIL 1PG7W 5D93C 5TQ2L 5L7XL 5IMOA 5AUMA 2NMSA 3O9WC 3RBGA 4ELKB 4HMDA 5HY9A 5CSGA 3UTTA 4JY5L 3LDBC 1E27B 4ZFZB 3WHE1 4BH8A 1U8MA 1L6ZA 4BZ1L 2DL2A 5CILH 2CUIA 4JG0H 2B8OT 2AJXL 1F13A 4FXKB 1KELH 4M5YL 2PO6D 5GGVL 4P59H 2VITA 4HT1H 5HHOA 5BW7A 1Z2KA 4AEIL 4ODHL 2FATL 3QIWA 4P57B 1X5JA 5DD5H 2R4SH 4EN3B 1A3RH 1EJOL 4PJDB 5DURB 3GKWH 5C09D 5J3HD 5AD0B 3WBDA 2KH2B 4O51A 1ZTXH 4FQQA 1WCBA 3KJ6H 4EI5D 3OAYK 4PYGA 3MLWH 3B9KB 5BW7C 1EFQA 3F7QA 2DD8H 5HGHB 4MA8H 3QIWC 1F3DH 2IAMB 3QQ9C 3VE0B 2FDBP 2FX8L 2EDTA 4HCRH 5AZ2L 3QH3A 4TTDD 4OZIB 2R1WA 4H5SA 1Y0LB 5I75B 4ZFOB 1BQSA 4NZRL 4K7PH 3UPRA 3BW9A 2WUBL 1KIUA 2B20A 2EDQA 3FFCB 1R5IB 5EZIH 1QUNA 1AO7A 1G7QA 3RY6A 1HINH 1FDLL 2DI9A 3KDMA 1IM9A 3O45B 3RIAK 2AQ3A 1F8TL 5HYEA 3PGCA 3VXMA 5EZLB 4GO6B 4IDLA 3PGDB 4NQUA 3BQUA 3RNKA 1CFSB 1PYWA 4O02L 5F7NC 1OOAA 3MNZB 2P46B 1KN2L 3OJDA 4Z7WB 3CLEH 4XTRD 1TPXC 2DBLH 2DQDH 4MJ6A 3VJ6B 4NQEA 3VXNB 4FFVC 1A7PL 4MNGA 3KYMB 3OAUL 3HNSL 5D8JH 3H8NA 5AG9A 3QFDA 2B1AH 2ZSVB 3QZWB 3ULUF 1XGUA 3BN3B 4CW1B 4MQSB 4F7PA 1IKNA 3GBMH 1MAML 3DIFA 4UDTB 4I5BA 3FCTA 1UA6L 4XCFH 5HHME 3S88H 3RWHA 4JPIB 2BNQD 3EDJA 4WHYG 2G9HB 4YDIH 1F11B 4LCWA 3BPNB 4M1DH 1JHLL 1W72H 3E2HC 3U4EA 1UM5H 4X7SH 1IKNC 2A0LC 3QJHB 3IJYB 4TULH 3HAEB 1LHZA 3MLVH 5CBAA 4GKSA 1Q9KA 4HIXL 4NDMA 1MRCH 1NCBL 1J8HE 4GXVL 2NNAB 4U1NA 2VUOA 5C7XH 3UPCA 4LLYA 4K7FA 1QO3A 1U3ZA 1T80A 3HE7A 5ID0A 5BS0D 4U05A 4KJPC 1BJMA 1NAML 4OLVL 1HDMB 1MCWW 5C6TH 2LV4A 1MHHA 5J6GB 3RTQD 4FOMA 4U1MA 4AQOA 1C16B 3LKOB 5JDJA 4NO0A 2B4CL 1FVDA 1CFBA 3Q5OA 4NNYA 1JPFB 1WEJH 1V7ML 3GSRA 4LSPL 4S10A 3HE7C 2OL3B 2XRAH 1EVUA 1N4XH 3OX8A 5IFJA 3C5JB 1UM4L 1PG7H 1WIPA 2BHZA 1TVBA 5JIKA 4RWYL 3QDGE 4K3DL 3TZVB 2W9DH 5H37H 4XP4L 3RZWA 1T7ZA 4B53A 3QCTL 2EEAA 3F65A 2WM0A 4GAYA 1IAOB 2P49B 3G5YB 5IVOA 4JFEE 2YUZA 3AB0B 4YBHA 5MEOA 2R23B 3AUVA 4HIHB 4UQ3B 2BY2A 5FGBA 1C08A 4IMKA 2Z9TA 1ZGLM 4QRPB 5C9KA 2E3VA 4JRYE 3ARDB 1IC5H 4NGHH 4UV7H 2BRQA 4PJXE 3GSQB 1F3DJ 1OAKL 3DUSA 1YJDL 3B9AA 3T0EB 5FGBC 1BFOB 4P46A 2YBRB 4IMKC 1KJVB 1CICC 3IJHA 2H3NB 2YPVL 4G6KH 3G6DH 2LAGB 5DWUL 5GGUA 3T04D 1DCLA 3BJLA 3SEPA 3VH8B 3F12A 1K85A 2FX7H 3G5XA 2GFBB 4O4YH 4WW1B 5T3ZL 3UC0H 1MJ7H 1EHNA 4DWHA 1S5IL 2D9QB 3B9VA 4EVNB 2P8LB 4KUZL 1CXLA 3CX5K 4Y2DB 5I1IH 1H3PL 3KPRD 5DJZB 4OGAD 5LGHL 5L9DH 2LU7A 2WMPA 4PRHA 5I1DB 4HJJL 1RZJC 1SJHA 4HS6B 5I9QB 1I75A 1R5VB 1MRFL 2AI0H 2X7LB 2ZWLT 1I1YB 4ODXA 3V79C 1MI5D 4LSUH 3RUGE 4NM4H 4OD1L 3RHWK 2CK0L 3OKLB 5D7KD 5EN2B 3VFMA 3ROLB 2CJUH 5F3HB 2AGJL 3VXSB 5IVXF 3BKYH 4EBQL 1RJZB 4X4MA 3IU4L 4Z18A 1QVOA 1DP0A 4X7DC 5MEQB 1UVQB 4WI3A 5IFAH 4UBDC 3MLYL 3HNTH 5D7JB 3CXHK 3NCEB 3TA3B 2QSCL 1RU9L 5D7IF 4RFEB 1BVLA 1EV2E 3F62A 4JY6A 5GS0C 3FB8B 1BVKA 3MCG1 1YUHB 1OAZL 3QRFM 1FYTE 5HJ3A 2NY3C 4NWTL 5ILTH 2VXVL 3UYOD 4PB9H 3TVMA 4K94H 2R2CA 4D0BA 4EUPA 1E28B 4XMLL 1EFXA 3BEWB 4TSAH 2HKFL 2QHLA 1ORSA 4F7EA 1KNOA 4KGLA 3U1SL 1MCDA 1MWAH 12E8L 2VLME 4P4KA 2ZCHH 4DVBB 2Y07H 4S1RH 1DLFL 2GT9B 3A67H 5B8CC 4LFHD 3B4NA 3S36H 1P4IL 1MCWM 4P5TA 4K3JL 4F7TA 1C7TA 2UZIL 3BMWA 1XEDA 1S3KH 5T3XH 2BSRA 2O26U 4QCIA 4P4KC 2HFTA 2AK4B 2ZUQC 1L0YA 4NQSA 4LLAA 3MSPA 4LSRL 3T2PA 1AJ7L 5HGBB 4WFFE 2FB4L 3JV6B 4XNYH 2KDGA 3DVGA 3V5KA 4MWFA 4P5TC 4PY8J 5I8KL 3MRHB 1A7OL 4L4VB 2EE6A 2VC2L 2R1XA 3OJMB 4H88L 5A16B 1BM3H 5BXFA 1I7ZB 1WTLA 2GI7A 4POZD 4Y4FD 5HVWA 3AC0A 3O6FA 4KTYA 3NACL 5DFVC 2A38A 3TPKA 4OZFB 4TVPH 3OF6A 4OF8A 1U8QA 1OPGL 2DMCA 4EQ3A 2J6EA 5FYKD 1Q9OB 1VADA 1JYVA 3D85B 1QD0A 5FB8A 4NKMB 4Z7VF 2NW2B 4N90D 3KPOA 1S7QB 2GCYA 4F58H 4M3KB 5INDB 3MRLA 1R3LB 5DQJA 3O6FC 5I66A 5TPWH 3TEUA 2J7LA 3H0TA 3GSXA 4KMLB 3O6LH 1NCCH 4HGMA 4AENB 2ITDA 3JTSA 3SGKC 3MRRB 5JR1H 5FF6B 3JV0A 4I2XE 1I8KB 3TT3H 3VXQB 5F1NB 4OZHE 1RZIA 5ICZA 3OB8A 1HHJA 4XPGH 5FOBB 4U31A 5DI8B 1FGVL 1CD1B 1LEIB 5EO1A 3SDDA 1EA9C 4HJGA 5DJ8A 1D9KC 3ARXA 4HFWB 2OQJB 1H3VA 3MLXH 3D25A 4XP5H 3P4NA 3KYKH 1J0IA 4JO2L 4D2NA 2PKDA 4LGPB 2A83A 4LVHB 3S96A 3EDKA 1CQKA 2F19L 4PLKD 3DURB 2CLRA 4I1NB 3WS6A 43C9A 3FQWA 2AJ3B 3VFPB 3KPSE 1DR9A 2KBGA 2QQQA 3NVQA 2YD1A 5HYQA 4R4FL 5I1LB 4BSVB 3OAZH 2PXYB 1OARL 3H6JA 2X42A 2OTUA 3BP4A 3QFJD 5TE6L 3Q1SL 1J05B 4ZFGH 1KIQA 4ZPVB 3VRIA 3KG5A 5IB1B 1BZ9A 1LP9A 4UINL 3BKCH 3PJSA 1NAKH 2VB5A 2IGFL 3DROB 5C07B 4JM4L 4HG4J 3WS6C 3FQTB 4LCUB 2YZ8A 4HPOH 4HK0A 2NXYC 3FT2B 3MYJB 1NANI 4HUVB 5JIPA 4LU5L 4QHMB 4LMQE 2E27L 1BZ7B 1J1PH 4YE4H 5C0NC 1CIUA 3LN5A 4U6VH 4EN3D 1PDKA 1HQRB 3LRSB 3WKNA 4OI7A 1F90L 5DURD 1SJEA 1D6VL 1YN7A 4KRPC 3DMMA 5D2LB 2HTKD 3GRWA 1MFDL 4NM8L 3LRGA 1FZJB 5IV2B 3N9GL 1UEMA 4OFIA 4WUUD 1ZLUH 1MPAH 1L0XA 5KZCB 2RR3A 1AE6L 5JO5B 2AS5M 1WSST 1DVFB 5IROA 3SJVA 1FORL 3NCMA 5E99L 2A9NH 3WNMA 1SYSB 1WCQA 4HXAH 1NEZG 3CSPA 3D0LA 3FFCD 4RCAA 1IGJB 3W0WA 1EJ6A 4HPYH 3G04B 3SGJA 5DRWB 1V7NL 4JQXC 1T1XA 5IROC 2OSLA 1YA5A 4HKJB 3QUXC 4GMTL 3VU2A 1EO8H 5C92A 1Z0MA 1LMKA 3V8OA 1JNHA 5EWIH 4L29B 4JN1H 2DQJH 3EW3B 2IMNA 3K1DA 5F96H 3QDJD 1OVZA 3VG9B 1UXSA 3TH3T 3ZL4H 4BUGA 4Z76B 3SGJC 3NZHH 1XMWA 5H94B 4LDLB 4HG4K 1A4KA 3JWNC 1UB6A 5FGRA 4PJBF 2V2TA 3KVQA 4G7VL 1F6AB 3T0BA 2VABB 4WTZG 4ZG1A 3ZKMD 4OI9A 1E4WL 1I9RL 4I13B 5C0AA 3MMEA 2DB8A 4XXDA 1I1AB 1H3UA 1GPOH 5LG1A 2CO6B 4NO5A 4FFYH 3EOTL 3GK8L 4XVTL 4HMEA 1FIGL 1NQBA 4M7JH 4A6YA 5FYJL 4UI2A 5L88H 4L1HA 4YUEH 3BH9B 2FX9H 3D3VA 2Q76B 1SM3L 25C8H 3MQIA 1EUUA 5T1DL 4XRCB 1A6WH 5GHWH 4OM0L 2H26A 5SWSD 4Z7NE 3LOWA 4ONHA 4ZUVB 3RPIB 3L3JB 4FNLH 2Y06H 4NO2B 4MQ7A 5J7CC 2ICEA 4MMZC 1S7VA 1EAPB 1MLBA 2ZCKH 2DYPA 1SY6H 4RWHA 5IOPB 4EOWL 4BZYA 5KVDH 3GHEH 4RISH 4GFTB 3VRLE 3L5XL 1BGXH 1H8NA 3KJ4B 4Z7UB 4G7YL 3ORJA 2BNQE 5ELIA 3E8UH 1ADQL 4KJWD 4U1LB 2XZAL 4R26H 4JO3L 4PJBB 1A6UL 3LV3B 5EU7E 2OP4H 4YFLF 1NL0L 3MLUL 4JDVA 2IBZX 2VLLB 3TZVD 1O7VA 3LH2L 2NZ9C 1FN4B 3VFGL 4NNPH 2AJYL 1LO4H 3VWKA 1XGPB 3BE1H 5BS0E 1NANH 1NGXA 4R90H 3BVNB 1K5NA 1RIVL 3WN5A 2DQHL 2PCPB 3GJFB 4X80H 1H15A 3N85H 5TDPA 1QLFA 1UZ8A 4QRPD 2D7TH 3ARDD 1ZT4B 3ECBA 4U1SA 1I8MA 3VWKC 3C5SA 1QQDA 1UCBH 4K9EC 1QBMH 3QQ4A 5GGQH 3GMOA 4OLZL 4ZNCD 1T04A 2BVEA 5B4MC 5DK2A 3MROA 3T09A 4Y5YB 1HZHH 4X6DE 5I18H 3VXUA 1LK2B 1ZLVK 5J89A 3MOAL 3U79A 3SGDI 5HD8C 3I2CH 1F2QA 1ETZB 2BSSB 5DLML 5CMAB 2L4OA 4JZOA 4BQ9A 2EDDA 3VGAB 5IB5B 4PJFA 1Y6MR 4PJ7E 2Q6WA 3U46A 4X99A 4QXGL 1YDPA 3HC4H 1X5KA 2CGRH 2DLIA 3ULSA 5DEGB 3ZHDA 3N0PB 5GRWA 4MNHB 2DKMA 2HFGH 2PO6A 5D5MA 2YN3A 1ORQB 4Y2DD 2F54A 1QSEE 3X17A 1NBZA 3DRTA 3MV01 2X10A 2B5IC 3BD4A 5F71A 4XCNB 1M7IB 5DS8A 5C09A 3VGFA 4PRPB 2IANA 1TJGL 4YDKL 1CLYH 4XPFL 5ECJE 2PO6C 3VCLA 4X4YB 3VXSD 4Z8FL 1YEHH 2FJFA 1UKSA 3T77A 2FCBA 4MNQB 1OAQL 1CLZH 3DGCR 2QSVA 4P2OD 1MH5A 2OJZH 1XF4B 3S5LG 2BVQB 5D7JD 1XH3B 3TA3D 3KHQA 4C83A 4EI5C 4MD4B 5FXCH 1JGVH 4NBYB 3AXLA 3MBEA 4IM8A 1T21B 2O5XL 2X4RA 1MELA 3RQ3A 3BP6B 4JFFB 2X89A 4UIKL 3UAJD 2F58H 5I71C 5DUML 1OAYH 4TTDC 3IVKA 3BZFB 5DVKA 3EDFA 4I0CC 3AS0A 4PR5A 4C56A 4H20H 1U9KA 2QQNH 2EDOA 5D7KE 1DQDH 2L7JA 2PTTA 3DX6A 4G6MH 1FE8H 2OR7A 3MBEC 1NJ9A 4HKZA 3GB7A 1NLBH 4G42A 1MVUB 2EDEA 2DM3A 2UUDH 2YPKA 3OKEB 1X6NA 3SN6N 2XXMB 5E5MA 2HVJB 3WHXA 1S7UA 4KVNH 1AXSB 4JDTH 2VKWA 2DKSA 2A6IB 2VDNL 4TSBH 3F58L 2XN9B 1T5XB 3BZEA 1G7LB 3LRHA 3PDOB 3HI1A 4WJ5B 5ITFA 3CC5A 1M05B 3MRNA 1DUYA 2EO9A 2BNQA 2FO4A 4I9WD 2AQ1A 4X9HA 3B2UD 5KANG 2DQUH 3CH1B 3KR3H 1RAMA 4Q74A 3D48R 1FZOB 2D7OA 5DT1L 5SX5H 3G6JB 3IS0X 1G9NH 2DQFA 4Z7OF 5T33L 1BF2A 2P8PB 4IIQC 4N1EA 2K7PA 4RX4D 3MRPA 5IQ7L 3GZKA 3PWJA 4XWGH 1MRDH 1Q94B 1BAFL 4MS8D 4X8JB 5CLTA 1T66C 4FQIL 4PJCF 2HT3D 4KKBD 4YHLL 5H2BB 1L7IL 2I9TB 2GUOB 3SKNB 4OFYD 1BFTA 1B0WA 2B0SH 4HH8A 3C2AH 4M03A 2XFXA 4HK3N 4RZCA 1R5WA 4UUJB 3QXDB 3T3PE 3VXTA 2V17H 3IDIA 1HSAA 4UU9A 1UWEL 3QEUA 3G08B 1SEBB 2NY5C 3WKML 4ZXBB 1Q1JH 1CVRA 3QNZA 4JO4L 5F7MC 4HWZA 4LKXA 3RTQC 4P23A 3I3EA 5IB3A 1A1NB 4M43L 3JWOC 2EDRA 4ERSH 4PS4L 5E9DB 4DKEL 5IJKA 2B1HH 1KF9B 4MA1C 5FYKE 4Q97A 1TZGL 4U6XB 2A6JB 4CGTA 1MHCB 1OSZA 4OF5A 3L3KA 4APQB 3NCJH 2HKHH 4N90E 2B2XL 4P23C 2XWTB 3D69A 4QKXB 4PJGA 2PXYD 5IJKC 2AEQH 1WAAE 2HFEB 5MENB 3O0RH 3FFDB 1KJ2L 1MCRA 4L8DB 5B3JE 2X05A 1JUFA 2H2SD 3X11A 4UOJA 3NMEA 4FQHA 4C58B 2XKSA 3O2DL 2QR0A 5FA4B 2G5RA 3BUTA 4ZTPH 1IGTB 3MXWH 5CZVL 5E08L 5DD6B 3P4MB 1H0DB 1YN6B 3JV5A 4K23H 4NN5C 5DC4B 3WFHA 1ES0B 4X7EC 4Q9RH 4L8BB 1NMAL 1BD2A 3HZKA 1DEDA 3BT2H 3VFSB 2VJXA 3V5HA 5M94B 1T0MB 4P9HH 2VN7A 1T20B 3KPRA 5C0CA 3HNVL 3QFJE 2FSEB 4ZD3H 4QY8A 5I76B 2YKLL 5D6CB 1XCQB 4EDWH 5KZCD 1P4LB 2YPLB 4CN6A 3BI9X 4JQVA 1DVFD 2YD7A 1MI5A 4J6RL 5I1KH 3X3FL 1FV1B 3HC0A 2VZVA 2MKWA 4OGAC 2FGWL 1MAJA 5FV1L 3DO3A 5JMRA 4PGEB 4WU7B 1N64L 35C8L 4LAQL 4F2MB 1R24A 1A7NH 4JQVC 3V5DA 4RDQF 3PQYB 4AEHH 3BDXA 1HOCB 1XGRB 2P47B 4PJDE 3RY5A 3DXAA 5DRNA 3TT1L 1PEZA 1CQYA 5SX4I 1XGTB 1CL7I 2X4UA 1NUDA 3NIFF 4OLWH 2HH0L 3OTTA 4E41B 5IJVB 3UYRL 1CK0H 4WUUE 1P2CB 4N9GA 1X44A 4LPCA 1U8IA 3ARUA 1ACZA 1KCUL 1I8IB 5DZNA 2NLJA 5EBGA 2E9IA 4HIJA 3BAEL 4OZIE 2VLJD 1RQ5A 2AEWA 4LLUB 1Q9WB 4PP1C 4MX7B 4PRDB 4JZNA 3LQAL 1U93B 1CZ8H 1EHLH 2FR4A 4MXQC 4YR6A 4JZJB 3OGCB 3HPLA 5CGMA 1I1AD 4BQ8A 1T2XA 5KS9F 3V0VB 1AGEB 4NC1E 5EC2B 4BYHA 4BZ2L 3L3DB 1GGTA 5J12B 1FFOA 2P44B 2HRLA 2WP3O 3P73A 3V8CA 5ENWA 2UUDK 3QDJE 4RAVA 2VDML 3RAJL 1J1OL 2R1YA 4Z7WE 4F33A 1KB5L 5F7UA 1JI2A 4F15C 1A6VL 2X41A 2XPGA 2CKBH 1ZA6A 5C2UB 5D70L 1A9BB 3U0WH 4G6JH 1IEBB 4NSKA 3OL2A 4X6EA 5CEYB 4LFHG 1NCWH 2FLBT 4NWUH 5BMFH 4WV1B 1QP1A 5I30H 3WEXA 4HS8L 2EC8A 1HKLH 4H1LH 1PY9A 1K4CA 1PZ5B 4HMCA 3QNXB 1AI1H 5C0DA 3WFCL 4XVJL 1G0XA 4YDJA 4ZPTB 4K71C 4PGDA 1HH9B 2ZG2A 3BYTA 2BJML 5DYOB 5ICXA 4PPTA 1EGJL 5SWSE 4A6YH 3KPQA 2HG5A 4JCLA 2VLRB 2HT4D 1OF2B 5KS9B 5DJYB 5HDLA 5DJAB 1AQDA 1FVCB 4MA7L 3VI4F 4OIBA 3SBWA 2ZKHH 4YHNA 4PP2A 4XNQB 1X3DA 2X4SB 3QXAA 2HWZH 5SWQA 3QHTC 3K74B 1I85A 3B43A 3HPJA 4JCMA 4Z78B 2VXTL 3I6GA 2XG5A 3HB3C 1UACL 3U7WL 1J0YA 3SBWC 3EFFA 4QTIL 4LSTL 2MKLC 1JK8A 4FZ8L 4YX2L 5MI0C 3V6FA 1FO0B 1FCGA 1I85C 3FMGH 3GSOA 4QF1B 2Y7QB 1IEAA 3HUJE 5CILL 4JG0L 4WENB 3C8KB 4ELKA 3RWGB 4ZODA 2EECA 1KELL 2H45A 4P59L 4HT1L 3TO2B 4ESKA 4J8RB 4G3YH 2MMXA 4FXKA 5DD5L 2R4SL 2YD3A 1QKZH 1A3RL 4RMSA 1WF5A 2V9TA 1OAUH 3GKWL 5CJBA 3L5HA 4JGJA 3RWJB 4NKOB 3VFUB 3MO1B 5FDYA 1Q38A 4H8WH 1ZTXL 2C5DC 3KJ6L 1CL7H 3MLWL 5EUKB 4PJDA 3DRQB 1IQDA 2DD8L 4CU6A 4M7ZB 4MA8L 1YEDA 1FH5H 1AGDA 4OCMC 5IKCB 1FL3A 1W0WB 2BVTA 5EU5B 4HCRL 3B5GA 2WBKA 3B9KA 2EIBA 3X14B 4MNQD 3DYOA 4IRSB 2IAMA 2BOCB 3VE0A 2GW5A 3GSWB 4EN3C 3IGAB 4K7PL 1QACA 3DX8A 3PHOB 4OZIA 5EZIL 4AEEA 2OI9B 1J87A 5IUSA 2HTKC 4K8RD 4RMWA 2P5WB 4YZFE 4L1DA 1HINL 2FECI 3ARGA 3OXSA 3GM0A 3B9KC 1G7IA 1INEL 3FFCA 3LEVH 4QRRA 1HE7A 2IAMC 3I02B 4DN3H 1TITA 1YEGH 4JFFD 4ODBD 4GRLB 1GGYA 4MCZB 5DSCB 5I73C 5IEHB 1NC2D 4KKLD 1ZT7A 1IGYA 3TPUB 5I2IB 1JVKA 1ZHKB 5I75C 3CLEL 3LKRB 5ADPH 2DBLL 2DQDL 1OAXH 3PGDA 3VXSE 1LWRA 1CFSA 3D39B 2Q8AH 5D8JL 5BRZB 3MNZA 1W0VB 3B6SB 2B1AL 5C71A 4Z7WA 2EICA 5I6XB 2K9UA 3VJ6A 1EMTH 2P4AB 3UROR 3GBML 4NC1C 1MLCB 3BRGC 4XCFL 2X70A 3S88L 2Z93B 3U0PB 3QZWA 2V2XA 3OXRB 4O9HH 4IMLA 1N7MH 2XN9D 4YDIL 2IFGA 2OLDA 1OLLA 4XI5C 1LEGB 4M1DL 4V1DA 3UP1A 4AK1A 1W72L 3FO1B 1DEEA 1NBYB 4JPIA 1UM5L 1VCAA 3GSVB 1YPZE 5JW4R 4X7SL 2G9HA 2IQ9H 4TULL 3RL2B 4Q7DA 1B6UA 1XZ0A 3MLVL 4XBGA 1A3LH 1MRCL 3CLFH 5CD5D 3QJHA 1KULA 3BWUC 3HAEA 3ZKMC 4KMTH 5C7XL 5TF0A 4JKPH 3SE9H 2PR4H 1FFNB 5EIIA 4URTB 4Z7QE 2C3XA 2NNAA 3EZ8A 5C6TL 3DNKA 3BPNC 3DVFA 2VH5H 2DKUA 3VXRB 4HHAB 1BBDH 1QEWA 4WHTA 3GI8H 1N8ZB 2D7QA 1WEJL 4LPUA 5FKPB 2ZCLH 1FFPB 3G5ZB 4LVOB 2XRAL 4F3FA 1N4XL 2V5RA 2VE6A 2OMBA 4I9WE 4HLZH 1PG7L 1JPFA 2X9YA 2Z8VC 1FZMB 2W9DL 1NC4B 4JGMA 3C5JA 1MCHA 5CEXA 4ZXBD 2ZP0T 3FB6A 4J1UA 4I48A 1FAIH 3BGAA 1VFBB 3DPBA 4R97B 2HLFD 4XAWH 5E9DD 4DZBB 5JW3H 3G5YA 5EUOB 2H32A 5FM5O 4HIHA 3DX7B 4FTVB 5DZOA 3RWFA 4APQD 1J5OH 4Y1AA 1SVCP 1IC5L 4NGHL 4BFEA 4X9BA 4UV7L 1ZVSA 5IF0B 1NMBH 4HDIB 3EJJX 4LHUB 2FH8A 4QRPA 4YAQB 1CTNA 3L95A 4PRBB 3F5WB 2ZUYA 3PF2A 4JPKH 5MEND 3IF1B 2EEDA 3L7FB 3AB0C 5DD3H 3DECA 3W39B 4G6KL 2J2ZA 3G6DL 4RQQA 4KK8D 3T0EA 1BFOA 1Q0XH 3RVTD 1QPPA 2P1YA 3CCHB 1KJVA 2FX7L 4U4BA 4O4YL 1WT5A 1YNTA 3Q48A 2Q8BH 1MJ7L 3ARDC 4PV8B 3O3AB 3QR2A 4YPJA 3EGSB 2X4PA 3AREB 3VH8A 3MGAA 1U8PA 1W72B 4HF5H 4ODUB 1U91A 1CFQB 3T0EC 4ZNEA 5I1IL 1RK1B 2XKNB 5L9DL 1WT5C 3RDTA 2P8LA 4RAUB 3C08H 2DWDA 1X5HA 2AI0L 5DJZA 4F57H 2R56H 4LSUL 4NM4L 4K7PX 4KUCF 1KPRB 2CJUL 2YPLD 1XFPA 3BKYL 4Q9QH 1I1YA 3CZFB 4CMMB 5B21A 5FKAA 2WK2A 4X6BA 3RDTC 2MPAH 1NBQA 3ROLA 5F3HA 4NOFA 3ZT6A 5IFAL 4ETQB 2K1MA 5IMLB 4DGVH 3HNTL 2LFGA 1NAMA 4FFWD 4UB0H 2H2PD 3EFDH 1UG9A 5I9QC 2DDQH 2W92A 1DN0B 5D7JA 1WC7A 4BSWB 2P43B 3MJ8A 5D2LE 5ILTL 3PWVA 2FWOA 4PB9L 4GG6E 4E41D 3FQRB 4K94L 3LEXB 3HZYA 4AJ0A 4PJAB 1GXEA 1A21A 4WHDA 1IGIH 4TSAL 3E6HA 3L5WB 5D7JC 3TA3C 2NTFB 1JGUH 2B4CC 1MWAL 2VXSH 5DD1L 2ZCHL 5FIEA 5ISZB 2Y07L 1EEZB 4S1RL 3A67L 5JPNA 4XWOD 1LNUB 2Q87A 3S36L 1D7FA 4DVRH 4DVBA 3SDAB 3QIBB 1KBGH 3DV6A 3RBSA 1X5GA 2HJKB 3UJIH 5T3XL 1S3KL 4RGMB 1CXIA 5IVXA 4GUPA 1OT1A 3QEHB 2J8OA 5HVHC 2ZOLB 4XNYL 15C8H 5D9SB 5CEZH 5D6DA 2AK4A 3LIZH 2NY7H 5GJSH 4WDIA 1BFSA 1XR9B 1BQLH 1GL4B 2VLJE 1BM3L 4P4RB 3JV6A 4LK4A 5D7IA 5DFTA 1K3ZA 1YEEH 3MRHA 2E7BA 4L4VA 4TVPL 1YJDC 3MNVA 1P84J 4M4PA 5D6DC 1MHPH 4BSJA 1PG7X 3B2UC 2DS4A 4OZ4A 3WHE0 4F58L 5E8EB 2PYEB 3RVUD 2NY6B 3UTSB 5EBWA 5BQ7B 1Q9OA 3D85A 3ULVH 5E8OA 1G7PA 4JFXB 5TPWL 2NW2A 4OZGB 3O6LL 1W2KT 5INDA 4FQPA 2LU4A 1NCCL 4ZMAT 1R3LA 1GH7A 1Q8MA 2IPKA 4FMKA 3CX2A 1E6JH 5JR1L 4NZUH 4HJ0C 2VLRD 2GTWB 3R0NA 3TT3L 5M7QA 3CK0H 3JWDH 1NGYA 1T4KB 3PABB 3O11B 4XPGL 2SEBB 4H0GA 4OZFG 3SE4A 5IWLA 4JKKA 3MRKA 4KI5F 3EOAA 5DD0H 2NYYC 4L4TB 2X1PA 3QRGH 1I8KA 2CMRH 2HT3C 2AXGA 3MLXL 5F1NA 1XIWB 1F4WH 4HUWB 4P2RB 4XP5L 1AHWB 3KYKL 1LEIA 4Z7UE 4JFDD 2OQJA 3FB5B 4GRMB 4LLQA 2O61A 1HCFX 1AGFB 3SE4C 5IWLC 3T4YA 3I3BA 1U42A 2CLVA 1OHQA 1NFDE 1YEIH 2DN7A 5D1ZA 5CSZB 2XWJB 5TH2A 4WFHD 1FSKC 3DURA 4ZFGL 4MDJA 4BKLB 2AJ3A 3UX9B 4TVSa 4IRJB 3VA2C 2VOTA 5DC0A 2PXYA 3BKCL 1NAKL 5T1MB 2Q7YB 3WV0A 1J05A 3BGMB 4OCSH 1MQKL 2FEEL 3KPLA 3QNYA 2GTZB 2NZIA 3O3BB 4HPOL 1E6OH 5IB1A 5GS1B 2ZUUA 5D1ZC 3CGTA 4LVHC 4Z7VA 3LB6C 1F00I 4HX1B 3DROA 5C07A 5B39B 1VERA 3FQTA 1J1PL 2FL5A 1AQKH 4U6VL 3MYJA 2YD5A 2PXYC 4G8GE 4PJHF 4BH7B 1BIIA 2AJSL 4YBLB 1BZ7A 5DMGD 2H2SC 4Y19B 3LRSA 1PW3A 2IH1A 2YUXA 1CFVH 2DQGH 3DOSA 3I6LD 3SE8H 1MPAL 1I7RA 1FZJA 2EXWD 4D9QD 3O4OB 1T1YB 1URLA 5L8KB 1A8JH 4IRSD 1GGUA 2A9NL 1FCCA 5BV7H 1IBGH 3ZE0E 2ZSWA 1PY4A 4HXAL 2Q86B 5TDNB 5ETUB 2A1WH 4HIEB 4HPYL 1DQQA 2P5WD 3O3EB 3L7EA 3P40A 4JN2B 2YN5A 1EZVY 1EO8L 3KLHD 4P5MB 4PRIB 4GBXA 3VI3E 5DRWA 3RIFF 2IFFH 3PWLB 1LK3H 3NIDF 4GRLD 5EWIL 4OLXH 1DVFC 4ELMB 5E03A 1PFCA 5FYJU 5HGDB 5AAWA 2DQJL 2GKIA 3ROOB 3BEVB 3RGVA 2WANA 5F96L 3U36A 1FC1A 3ZL4L 2W65B 4P5KB 1H5BB 3NZHL 2GK0B 4GKNB 4QYOA 1FNAA 1DTUA 5E2TH 4QRSA 1E4KA 3GSNH 2JB6B 3D39D 4Z76A 4MNQE 5HDQH 4GBXC 5BRZD 5JA9A 3BH8B 3FO9B 1WTGT 5H94A 4Y8AA 1WIUA 3KPMB 3STLA 3GBLA 2WW8A 2GY7B 3QWQB 4X7TB 3IETB 2NY1B 5F70A 3WJLA 3C87A 4OUUA 4L3EB 2VABA 1GPOL 1RZ7L 2O5YH 4FFYL 5E94B 1UT9A 3FO2B 2EC9U 4N9OB 3OKDB 4M7JL 5L88L 3DBXA 4PJ9B 4JFFE 4YUEL 4N8CH 2FX9L 2OZ4H 4MJ5B 3M07A 1JYWA 4DFIA 25C8L 1P6FA 5IQ9B 4ZO7A 1R3HA 1A6WL 5GHWL 3SPVA 1F6FB 3WJLC 2VO5A 3BH9A 1UJTA 3CUPA 4FZEH 3ARWA 3BUYB 2Q76A 4FNLL 2Y06L 1OM3H 1X5IA 4X6FB 2ZCKL 5FM4A 1SY6L 1F4YH 1I1AC 3RPIA 3L3JA 2AV1A 1I1FA 2AW2A 4NO2A 5KVDL 3GHEL 4RISL 2I25N 3VXRD 3TO4A 1BGXL 4YBQC 5I1GH 4WHYH 3E8UL 5IOPA 1FFRA 2XN9E 4POYA 4U6HB 4N0CD 5BO1H 1S7XB 2C26A 4TUOA 3TBWB 3WDIA 4R26L 4HUXA 3LDBB 5LAXB 2YK1H 1RHHB 2OP4L 1D6EB 5JUEH 1JMZA 1FIEA 2OR8A 1PJ9A 3CVHA 4U1LA 5L2KA 3TO4C 3TGXA 2O93L 4XCYA 1WITA 4PJBA 4JKMA 3CFIC 3LV3A 1NC4D 4OLYH 2OMNA 4OIIH 4NNPL 5C86A 3IYLW 3EYVB 1LO4L 4ZO6A 3ZT5A 5HY9B 3UTTB 2VDRH 3G6JE 3KJ4C 3BE1L 1GGIH 4R90L 1FN4A 1C5CH 1PSKH 1XGPA 4X80L 2BY1A 3N85L 2VITB 4JM2B 5HHOB 1WWWX 1PBYA 2D7TL 4M8VA 3BVNA 4ZUWA 3I85A 5D2NE 5HGAA 3OMZA 4W81A 3CSBA 2JB5H 1KCRH 4HUKB 1UCBL 4QWWD 1QBML 5GGQL 4LHUD 5FGCB 3SDCA 5ANMA 2G75A 4TPRH 3DI2B 2HT4C 4M6NH 2GITA 1HZHL 4O51B 5I18L 4FQQB 1WCBB 3AU1B 3B9EA 4NC2B 2J4WH 1U8OA 3I2CL 5FYLH 2R39A 3PG2A 2IBGA 1MAKA 3MUZ1 5KJRH 4NFBA 1KN4H 4E5XB 3QH3B 3LS5H 3ULUH 2R1WB 3HC4L 4LOUC 2CGRL 5E9DE 3SCMA 2BSSA 5CMAA 3ARED 1PVHA 3UPRB 3BW9B 5IB5A 3P0YH 3VXPA 1CLOH 2WBJA 2HFGL 2WBWB 3SHSA 3EJZC 1AO7B 4Y5YC 5DJDA 2R69H 1JIBA 5I8OH 4G8FA 1T6VN 3KDMB 4MNHA 1QYGH 1MFBH 1KT2A 1ORQA 4N8VA 3PGCB 3KAAA 3VXMB 1UEYA 1XGQA 1GYAA 1CLYL 1P9MA 3BQUB 3RNKB 4XCNA 4OFPA 1M7IA 4CL7A 1PYWB 1J11A 1YEHL 1QRKA 4PRPA 1H9VA 4OSUH 4MJ6B 1CLZL 3P11H 4MNGB 2OJZL 4X4YA 5DEFA 5C1MB 1XF2A 3QFDB 3E2HB 2EE3A 2C1PB 4LCIL 1P9MC 1XF4A 3DIFB 2P7TB 2MHAA 3UTQB 3WXWH 4I5BB 3OR7B 1JGVL 4MXVF 3RWHB 4FP8H 4U33A 1ADQA 4OV5B 5J06A 4IHOA 1SBSH 4X8XA 4MD4A 4YC2B 3SKMA 5IVNA 1J8KA 2XNAB 1YC8A 2F58L 1H3TA 1IGFH 4QHUA 3VMOA 1OAYL 3VD5A 1BQHA 1VFAA 2BMKB 1BJ8A 3PL6B 4H20L 4WCYH 4JFFA 2QQNL 1IL1B 4OF6A 1DQDL 3FAXA 4G6ML 2YPLE 5CBAB 1FE8L 3BZFA 1ZHNB 4JO1H 1Q9KB 2OJEB 3V6OE 1NLBL 4NDMB 5CBEB 3NIGE 3SGEH 1U3YA 1GOGA 4PG2C 4PRAA 4QHKJ 4LLYB 4K7FB 5F6IC 1QO3B 3Q6FB 4KVNL 5ID0B 5ISZD 2R9HD 5EORH 2AJZA 4LHJB 4JDTL 3OKEA 4LRIA 2EYSA 4TSBL 4GOSA 4LCCB 3SQOH 5IMKB 4YWGH 2VZ1A 4GAGH 1AXSA 2E5EA 4JVWA 1VGEH 4U1MB 3T4AA 32C2B 4NO0B 2YWZA 1AGCB 1HXYA 3AS2A 1ED3A 4QHNA 3WUWA 3PDOA 4WJ5A 4E41E 2FHCA 3OX8B 4M1CD 5IFJB 4LRIC 2N56A 3ARPA 5DTFA 2Z8RA 2DQUL 3KR3L 1RZFH 1TVBB 4WO4B 1GGCL 1G9NL 5HHQA 5C0BA 2IPUG 3CH1A 4U2ZA 5MEOB 5ABDE 3ZDZE 4XWGL 4OQTA 2P8PA 4R9HA 1C08B 5C70A 4GS7C 1NCDH 3S37H 2PYED 5MEPB 1JRHH 2NY6D 3UTSD 1Q94A 5CD5C 2NY2C 3C2AL 1J1XH 1JPSH 2DM7A 3S4SB 1YMHA 2V17L 3DUSB 1OWRM 3C6SA 5H2BA 2VR5A 3R8BB 5JOEA 1IM3A 2AEPH 2I9TA 3SKNA 4P46B 5CSBA 4DKFH 1B2WH 3CNKA 1Q1JL 3OZ9H 2YWYA 3BO8B 5GSRA 3ZO0A 3BHBA 4LF3B 4ENED 5HPMA 1SEBA 4QO1A 3QO1A 4ERSL 5BJTB 4GG8A 2HFFB 4NKDA 1PKQA 5F97E 4XT1C 1ZVHA 1I8LA 4J4PA 4ONOA 3NCJL 4XHQA 1RJCA 2HKHL 2R2HA 4HKXB 1G6RH 5I16B 1GZPA 1A02N 1WBYB 3B5TA 4I0PA 1HQ4B 1MHCA 3HZVB 1S5IH 3NZ8A 3CJJA 4APQA 3K2MC 3BP7A 1MCKA 4ZXBC 2AEQL 1RURH 1SMAA 1FLTX 1OCWH 3O0RL 4PRHB 1ERNA 1WISA 4NQXA 4IRJD 4J4PC 4ODXB 1LDSA 5FYKU 2VLKA 1P1ZA 3S98A 5ACZB 3H3KA 3S6CA 2VLRE 3VGEA 5K9KA 5MENA 3VFMB 4L8DA 4KPHH 3O4LA 4I0PC 4APQC 2OCFD 5IW1A 1QVOB 1TDQA 3MXWL 2VTFA 1KEGH 5T3XD 3IU4H 2VAJA 4JPVH 4JFDE 5D1XA 4K23L 4CVXA 4JY6B 3QPQC 1IGTA 5CP3H 4CRPA 4Q9RL 1BVKB 2XKUA 4Y19D 1WICA<