3S8WA

D2 domain of human ifnar2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
100
structure length
77
Chain Sequence
SFEPPEFEIVGFTNHINVMVKFSLVIEEQSEGIVKKHKPEINFTYIIDKLIPNTNYCVSVYLEHVIKSPLKCTLLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interferon alpha/beta receptor 2
publication title Structural linkage between ligand discrimination and receptor activation by type I interferons.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein receptor
total genus 11
structure length 77
sequence length 100
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s8wA00
1RJYA 2R2EA 3W2DH 5IMLB 3N1MC 3IDGB 3MACH 4ODXA 5BV7C 4GG6F 5HYQB 5I8CA 3MV8A 1AIFB 1F11B 1TFHA 4WO4B 5F6HJ 5J7CC 2V5YA 3O6FC 1XGQA 3OHXA 1EX0A 4PJ9B 1BBDL 1W0YT 3NH7H 1R3IH 4K55A 4JFYA 2YUXA 4KMTH 4U1JA 5DK2A 3VGAC 1XF2A 4ZUTB 4U2ZA 3KHOA 1UG9A 4S1SL 4LMQI 4PJ8B 1OAXH 2FIKA 3DX6A 3KPOA 3RVUD 2F53E 4CMMB 4LSPH 3MV8E 3RAJL 3D2UD 3HCVA 4LIQE 4BH8B 3GKZA 5GXBB 4P2QE 1GL4B 5DK0A 4LCYA 5D1ZA 3ARXA 3DOSA 2B1AL 5T1MB 1QFWM 1R5IA 3DPBA 3TA3A 5HI4C 1UGNA 4UMGA 3WIFA 3ULUD 3HA0A 4PJDF 5CJXC 4RBPH 3FHQA 5ACZB 3VH8A 1GGYA 1KIRA 4N5EC 1KIQA 4HUWB 5BOPA 1INQA 1RZ7H 1CFSB 4HIJB 3V5DB 2H2PD 3WEXB 4FZEL 1FNHA 5GGRB 5LKNA 4LASH 5D7LB 3BN3B 2P8MA 4U6XA 4S10A 3WD5L 4L4TD 1MCFA 2R2BB 4JZOB 4LRIA 4YBQC 1XF4B 3UBXA 3DRTA 3HPLA 4M1CD 3LS4L 4WHYH 3U0PB 4U05A 1XF3B 1MEXH 5LAXB 1L6ZA 2CO7B 4NRZB 1V7MH 3NA9L 3SY0A 1F3DJ 5ALCL 4KRPB 4WU5B 5JO5B 2DQEH 2YA0A 4O2CA 3FN9A 2XKSA 4GXVL 1UZ8A 1MRCH 2VLKD 1Q9OA 3OAUL 2XRAL 3CFIC 1KACB 1CGYA 3QQNA 3KPMA 3RWEA 5TQ0H 1D5MB 4NNPL 4R4BA 4U0QB 1AI1L 4J12A 3VGEA 1Q9WA 3EFFB 4Z7NE 1HHKA 4FG6C 1I9IL 4ESKA 1T83A 2BNQB 1JFQL 2W9EH 5DJ8A 4FMKA 4N0CC 5CBEB 4GRMB 5I73B 1FCCA 2JK5B 1G7LA 3LKSB 1NGZB 1QLFB 1RU9H 1R3LA 1P9MA 4UOJA 4K8RC 3ZT7A 4WY7L 3D5OF 4RIRB 2BFVL 1EFQA 4PJGB 1U8OA 4DQOH 3AY4C 2EDNA 3QXTA 3MXWH 4BSWA 4A6YL 2VERN 1OAYL 1S7TB 1I9RL 4AIOA 5D93C 4CVZB 1NCTA 3HLAB 3LSOA 4DTGH 3G6JB 1EHLH 4MWFB 1RULH 4LHUB 4XHJD 3SKOA 4NC0B 3SDXF 2Y23A 4UIKL 4LCIL 1WBXA 4X6CE 4JY6A 5GZND 5J12B 4OM1H 5HGAA 1HHJA 3OZ9L 1CE6A 3HE6D 2OTUA 4PUBH 3SGDI 1OQXA 1E6JL 1D9KB 4AEHH 1JIBA 4NSKB 2W60B 3DURA 1T89A 3HS0A 1VPOL 2PYEE 4MB4A 3HMWL 1FCGA 5KS9A 3Q48A 3LRHA 5CWSB 3S96A 3CDCA 1YC7A 4U1GB 5A2FA 2EDHA 4HV8A 4V1DB 5LXGH 4P3CL 3JWOC 4MVBC 3RUGB 4QT5B 3WE6A 3RHWF 2GYSA 2A83A 3IF1A 5JOEA 1EO5A 5D7IF 5GRWA 4Z8FH 3U4EB 1G0YR 3SDDC 1VFBA 5MEPA 3VFGH 4QHUA 3ESVF 4IOSD 1L7TH 4EDXB 2E9WA 5ESQB 4NKOA 3P4NA 1CICC 5DMIL 4XP5L 2E9IA 5C0AA 1LILA 4PR5A 1ES0B 5MP6H 1WFTA 3MLSL 4FQ1L 1KULA 1TLKA 2CGRH 1F90L 5DHVA 1MFEL 4D0DB 3QH3B 1AO7A 4LLAA 3FN3A 1T22A 3EDEA 1ZGLM 5DMKA 1U8KB 5TE7H 4FABL 4YDKH 1N64L 1NFDF 3DMMD 4B7LA 3UC0L 4CRPA 5FIEA 1Q72H 2CK0H 2V2XB 3C8KB 2D7PA 2VQUA 5BW7C 4HS6B 3D2UB 4D0CA 4UT9H 5DXWA 3TIEA 2E27H 3UYRL 1JGUH 4ZTPH 3IXAA 1QFWI 3G9VA 3ILQD 3QFJA 3A67H 3L3JA 3ZTNH 2EDFA 1CFQB 35C8H 1FG9C 3AM8C 2Y7QB 4MNQD 3FT3A 4X7CC 3I9GH 4X6BA 4LNRA 1NAML 1PEZA 4NN7C 3WFBL 4EJ1C 4ZFOA 4IDJL 2OJZL 3QFJE 4LKXB 4UTBL 4MJ6A 4MQXD 2YZ8A 4JGJA 4TSBL 5KAQG 4Y16A 3O3UN 4PGBB 1MPAH 3BGFB 4L4TB 4NT6A 4QGYA 1AXIB 1BJ1J 1CXHA 4G6KH 3ISWA 1L7IH 2GK2A 4WTWA 1BQHG 1ZWIA 4FQ2L 1CICA 4WCYL 5C3TA 2C3GA 1MIEL 1YZZA 5J0BA 4P23A 2DI9A 3H3BC 4OZIA 1S7VA 3FB5A 4LEXL 4S1RH 25C8H 3WHXB 2VLKB 3TIDA 3CPLB 4M8QB 3ZHDA 1A47A 4PJXA 2R0KL 1OM3H 3TNNA 2FCBA 5LG1A 2BRRH 4KROD 4WUKH 5DD3H 3RU8H 1KJVA 5LJYH 4OKVB 1KT2A 4PS4H 5ITBL 2C3VA 4R0LA 3HG1A 1QPPA 2F15A 5F3HA 3CSPA 4OZIE 1A7NL 3TO4D 3S36L 1WFNA 4P2RD 3EOBB 3ZKQD 1K4DB 5BW7A 4MJID 1E27A 1T7ZA 5FUZH 5L9DH 4PJXE 3ULSB 1YYMH 1FZJB 3IJYB 3O6MH 4LQFH 1C5CL 4OM0L 2EDRA 1MCWM 3HG1E 4Y19D 3BWAA 4BSVB 5CKAA 2VOTA 1TJGL 4NKMB 5DJAA 4HEME 1CZ8H 1KIUA 2J8UA 3BUYA 4YR6B 1MNUL 3S97C 2EEBA 1CGUA 1MQKH 1KELH 3H0TB 3VFWB 5FO7A 4HCRL 3BGMA 2CRYA 2PW1B 3ZHLA 2VIRA 1HK6A 2CJUH 2D3VA 2P43B 3LRSA 1YEJH 4MD4B 4PBVC 3EGSA 2RGSA 5FA4A 3NFNA 3B9AA 2EO1A 2J8UE 4ZOBA 2C3WA 5IB5B 1JWSB 4DCQB 5BVJB 2FYYA 4ZUUB 4OUUB 3QBTB 5C9JB 1TNNA 4CNIB 3I75A 3C6LD 1N7MH 4GSDL 1CD1A 3QXVA 3QCUL 3BUTA 3CFKB 4NC2B 1HCFX 3HE6B 1I4FA 4ZOCA 4M9PA 3QG7H 3QPQC 2R0ZH 3RP1A 1AGEA 1CLOL 2GAZB 4X4YA 4QHMA 5EUOA 1NGYA 2YA1A 5DHXB 5EFIB 3QXAA 4EQ2A 4W68A 4CVWA 5EO1A 2DQGH 3HZYB 1FFRA 5CS7A 2AK1H 3RWHB 3BPOB 3JTSB 3ZL4L 4H88H 1PQZB 4KXZH 3MRQB 3QEUA 2CIIA 4C83B 2X05A 1A6ZB 1MAMH 1UWGL 2ZCHL 2YSSA 4DAGH 1DDHB 3EO1B 1ZXQA 4BZ2H 1OF2A 3M1BB 3PXHA 3GBMH 4S1QH 4XVSL 2C3HA 1ONQA 1BAFH 2YXFA 1OAQH 4CADB 1IGML 4KVCH 5EOTB 5L2KA 1QYGL 1BPVA 5IEHB 3L1OH 5KSUA 5EIIA 2HMID 4GAYA 3JZ7A 1NQBA 4S11A 4MJ5B 3TN0C 3CFEA 2XWTA 4P59L 1GGCL 5GGQL 5B3JE 4DUVA 2ZKHL 4CL7A 2FJGA 1OB1B 1QFOA 3DMMB 2V7HA 2EIZB 3I02B 2AEWA 4AQ1B 1FE8L 5CJBA 3QI9D 3HI5L 3QHZH 3CH8A 3O3BB 3WUWG 5DRWA 1F6FB 3MMEA 3HZMA 3EYVA 1RVFH 1ZSDA 1FL5B 1MVFA 3SBWC 3MRPA 1N3NA 2G5RA 4ODHL 4YX2H 5F1OB 3QUML 43C9A 1RURL 3BMWA 4NCC2 1ZLWK 2GUOB 1HOCA 2VDKL 2EIBA 2H3NA 1H5BB 5I66B 3U30B 4QHLA 5DJ2B 5D70L 3IFLH 4OV5B 1MIMH 4NKIH 4Z0XB 5C0GB 3FFCD 4RRPG 3QQ9D 5JOPE 4R97B 1RJLB 1LE5A 1F42A 3OSKA 4M02A 4Y2DD 3KYOA 3ARFC 3DHMA 1NCNA 2R4RL 2A1WH 2NCMA 4F7TA 4NQSA 2I5YL 4ONGL 1H3PH 2AK4A 4O2FB 1WZKA 1J0HA 4MJ4A 1FDLH 3EOAB 2VDPH 2XQBL 5DURB 2ZCLH 4Q74A 4G8EA 4TOYL 5JNYA 3K7UA 2VSCA 1T5WB 1B2WL 3GMRB 4OD1L 1T2XA 1D5XA 3AC0A 5FFLA 1NCWH 1YY9C 4YE4L 4YZFF 3LPWA 1VB9A 5D7JC 5KJRH 1IAIM 2AK4E 5LCVH 2GSGB 2I9TB 3UYPA 3GO1H 4WHDA 2EYTA 4FXGA 2ADGA 4X9IA 1YEKH 3TO4B 1IAOB 4P2RB 5C8JB 2UWEE 5DWUH 2CLRB 3NN8B 3GSUA 3G08A 3HE7C 4J6RL 4MJIB 4AT6A 2GSIA 1D5ZA 4LMQE 2LVCA 1ZHKB 4HFUH 3QO1A 1W0VB 1Q9LB 4Z7WB 3SBWA 4Y19B 5F7DA 4EUPA 1KN2L 4C4KO 3GMQB 1LO5A 4N8VB 4RAVA 4AIZA 1ZS8A 5CLTA 4FP8H 5JLZB 5EZJA 2XV6B 2YUWA 5IBLC 3QCVH 5GGVY 3R06B 3VDCA 1FJ1B 5J6HB 2PO6C 4F7PB 4F7EB 5MEOB 2XZZA 5ADPL 3S5LG 2PTTA 5C0BD 1MI5D 2AJZA 3C2AH 1NAKL 5DSCB 3PP4H 2XPGA 3EYUH 2VZ1A 3GDBA 2GJ6D 5B8CC 3OKLA 4L8DB 3ARFA 4NZRL 1LNUB 3H2WA 3JWDL 4WJ5A 1MHPL 3C6LB 4U6YA 3U7AA 3CU1A 3EJZD 3WN5B 3MYZA 4RA0C 5GHWH 2Z35B 3MQIA 4K9EL 3HC3H 2EEDA 2Y5TB 4RFEB 1DBAL 4EI6B 2X4UB 3LAFA 4RMVA 5D1ZD 1FL3B 4K71C 3CAFA 5E2UL 1YNKL 5CP3H 2F5BL 3MJ7B 1AHWC 1A6WH 1TVHB 1FNSH 5GGTL 1NEZG 4PJEB 1T5XA 5TDOA 4RFNC 1AGBA 2IFFH 5K9KA 4HWZB 1BGXL 4XTRD 4JLRB 4TSAL 3HI1A 1D6EA 3GMLA 3B8SA 3EAKA 3LDBB 2I24N 5L0QC 4LEOB 4KZEL 2NYYD 5IFHH 1A7RL 2YPVL 2VXSL 1CDCA 1NC2A 4OSUL 4HC1A 1JN6A 3WDJA 3MBEC 3F6IA 1MCLA 2PXYC 2L7JA 5HDOA 1NJ9B 3DO3A 5DJCB 5JMRA 3DXAA 5GRYA 1I3VA 5TH2B 4PFEA 5JW5B 3THMH 1M7DB 2DQCL 4RDQG 5DZLA 4LCCA 4ZO9A 2E7HA 3MRNA 3S37H 3KYKH 1ZVSB 4P9HL 3SKJH 2P8PB 2IADA 5TQ2L 3LOWA 3DXAE 2OZ4A 5GIRB 3QEGL 3QI9B 2FO1A 4D3CH 5JA8B 1DEEB 3IKCB 3TVMC 3DRQA 4NZTL 5CUSL 5I8EA 3QIUA 3MNZA 1R3JA 2J5LC 3G5ZB 5DUML 1MOEA 1RIHH 3H6JA 4FTVA 4U7MA 4AL8H 3B2VH 3QQ3A 1UT9A 3U36B 3U0WH 3IDNB 1XGYH 4JPVL 1DJSA 2Y9RT 3VFPA 2X2YA 2R2HA 1I1FA 1FYTE 4M3JA 4JRWA 5HGDB 2CKBA 3VRLF 2IMNA 3ARBC 4JFEA 2VLRE 4FTVE 1KPUB 1I3UA 1ITCA 4QRPB 1ZLWH 3FFCB 1A7PL 2PCPA 5GZOC 2C9AA 3VXTB 2V17L 4U6HA 4Q0XL 5FYJD 2HJFB 2MFNA 2HJKB 2PW2B 2QQNL 1FAIL 1QSFA 5K9JL 4JFEE 2NY0C 2FEDD 1KEML 3VA2C 3Q5TA 1G9NL 4J1UB 3MBEA 1RK1B 3GSNA 2K3TA 1R24A 2PXYA 1J0KA 2HFGL 2ENSA 5HHNA 4PGJA 4FQLL 1ZEAH 4N90E 4XCCL 1N0XH 1NDMB 1DLFL 4YHNA 5DJYA 2HT2D 2KQMA 1IAII 4LCWA 2XTJE 4N68A 3AXLA 3MLUL 4M93C 2I26N 3VDAA 3LKPA 3LKOA 4ZD3L 1I1CA 2AJVL 3GUTB 3TVMA 2CDGB 1OAXL 3RWFA 1U9KA 4D0BB 3SGEI 4M61A 2QHRH 4LCWE 2IGFL 5J13C 4C59B 3WFHB 1TCRB 4XNQA 1Q38A 5SWZA 2P5WA 3ZT6A 3VWKC 3SE9H 3PNWA 5E7FA 3F58H 3TT1H 2IG2L 4E41A 4U1IB 5LGJB 1UM5H 3RY5A 2ZJSL 3RVWC 5SWSA 2X09A 4N8CH 3B9KA 5SWZE 1IGCL 2P5WE 3MRMA 1OT2A 2P24B 2R1XB 5KSVB 3V52H 5L8JB 4XBPB 1WEJL 1DSFH 2DL9A 4ZUVB 5C0AD 5C0BB 4YEEA 1MI5B 1RJYB 1Y6NR 2R2EB 4BA8A 5HVHC 2RJMA 5SWSE 2EDBA 5D5MB 4ODXB 5T3XE 5BVPH 5HYSA 1ORQA 4PJIB 3MV8B 5I8CB 1BVKA 2BY0A 1AO7D 1JRHL 2Q7NA 1TJIH 3HC0A 1XGQB 3OHXB 4Z7QE 3RWGA 1A9BB 1G1CA 5DK2B 4JFYB 2EH7L 3A6CH 3MJ6A 5AWNH 5CEZD 4OCNC 1CR9H 2VDMH 1NCBH 3DX6B 1T03L 3KPOB 5ID0A 4G3YL 4HKBA 3OB8A 2FH6A 1PKQA 5C71A 4K7PY 1BQHA 5DC0A 2DQEL 3MX0A 5DK0B 4U1LA 5D1ZB 1MRCL 4QXUL 3CLEH 1UA6L 1R5IB 1S8DA 5TDNA 5GS2H 5TQ0L 1PVHA 5FGBC 5T5FH 1A14L 5AYQA 1E4XL 3WIFB 1PKQE 4WW2C 3CX5K 3QXDB 1EO7A 3SCMA 5JA9A 2N4IA 3ZTJG 4QYOA 3VH8B 1KIRB 4NPYA 1KIQB 3JWNC 4JRXE 3OMZA 5E1AA 3SDYL 3VWKA 5EU4B 1INQB 1ZTXH 5GGSY 2CUHA 3BKCH 4YC2C 3U6RA 1A02N 2PF6A 2Y07H 1MCWW 2P8MB 4Y16D 4MX7A 4U6XB 4KUZH 5I1KL 2DLFH 1RK0A 2H9GA 2VH5H 4JFHD 3UBXB 3DRTB 2NXYC 1YC8A 3HPLB 5C08E 4J8RA 4PJCA 4DQOL 1KPRA 1TZGH 1NSNH 1FVDA 1DBKH 1MJ7L 2BC4A 4P23D 3SY0B 3BP4B 5TDPA 4H0IA 2R4SL 4UV7H 4P2OD 1B6UA 5CFHA 3BH8A 4O2CB 1A3LH 4MCZA 1JTOA 1ZANH 4PJCE 3KPMB 2XWJA 3R0MA 4GXUN 1NDGA 5E03A 3RIFK 5EWIH 3RWEB 5DT1H 4DTGL 5ADOH 4R4BB 3Q5YA 1RQ5A 1HHKB 4Q9QL 1DFBH 1XR9B 1SBBA 2CLVA 5DJ8B 1CLYL 3AVEA 2NX5A 4GAGH 3K8LA 4P57A 1YPZF 1G7LB 3WNOA 1GYAA 1FAKT 3MGOA 3C5ZA 4MAUL 1IBGL 5FGBA 4ODWA 2BNRA 3W81A 5JIKA 5GGSA 4WW2A 2Y36L 1YEHL 1MJJA 5T5NF 2VDOL 4HIEA 2COQA 4L8BA 4YHLL 5JPMA 4G7YL 2R15A 1U2CA 1U8OB 1WV7T 1S5HB 1UFUA 2ADJB 1FZOB 5HHME 4KK8C 2AABH 1T4KA 1UB6A 3KS0H 1HKLH 3MJ9H 1CVRA 3LSOB 3ULUL 2WLYA 5FOJA 1QR4A 1MLCA 1WAAF 4GRWB 2HN7A 2JE8A 2FHFA 2F74A 3L7FA 4TNVK 1EA9C 3SKOB 5ILTH 2DLEA 3JBG7 1WBXB 3P11H 4JY6B 2C1PA 5HGAB 1HHJB 3CDFA 1CE6B 1TQCB 1H3GA 3IAGC 3L9RA 4PJFF 1RZGA 2VLME 3DURB 3HS0B 4XB8A 5KS9B 4R9HA 1Q72L 2CK0L 4XBEH 3S96B 4RAUA 3BKJH 2BSSA 5CEZH 2AXHA 4H25A 2R0WH 5DTFA 4O4YH 2R1YA 2SEBA 4Z0BL 3WE6B 2E27L 2VKXA 5GRUH 2GEEA 1JGUL 4ZTPL 5IKCA 2A83B 3IF1B 1IMHC 4K2UL 4UDUA 4WIQA 1VFBB 3RVVC 5MEPB 4QHUB 2DB8A 2XYCA 4GQ9H 3ZTNL 4NCC1 1GC1C 5L2JA 4NKOB 3NPSC 4IBLT 3WLWC 3P30L 3P4NB 4OD2B 5FYLE 2XY2A 4F58L 5C0AB 5L2KD 4PR5B 3P4LA 3TJHC 2ATPB 3VD5A 1P84K 1QLEL 3GHBH 2C4XA 5DHVB 4R7DA 3NIGE 1AO7B 2HLFC 1NGPL 4HUXB 4TNWF 3WFEH 1T22B 4RRPA 1V3LA 3X12A 4JCMA 3V95A 3AB0B 3D9AL 4LARL 1TJHH 3HC4L 1MCBA 4YFLF 1T0PB 2Y1VA 2E7LC 4JFPB 3FOLA 1UCTA 1ZLVH 3K74B 4D0CB 2J3SA 1LDPL 1OD9A 3TIEB 1KJ3H 5C92A 1S3KH 3V0VA 1CDYA 3FO2A 3IXAB 4Z7OE 1KN4L 1YJDH 1K2DA 1IGYA 2BRRL 4IMKA 5C0NC 4CVUA 3QFJB 1GHFH 4JHBA 3L3JB 1JNNH 4MQ7A 4JGUA 1HYRC 4JO2H 3ILPA 2QQLH 4OT1H 1EEYB 2JJSC 4JKMA 4JRYA 3QZWG 2EDOA 3CVHA 3E0GA 5L9DL 4X6BB 5D1QD 2YN5A 1JGEA 3C6SA 3LHPH 4LQFL 3UO1H 3GRWH 4Y5VB 4FFYH 1J11A 1X4YA 3ME0A 2ADFL 4Y16B 4KHTH 4X6EA 1NLDH 1T1WA 2DTMH 1LGVA 5K59E 2HJLA 1MCPL 3DARA 1U95A 4GW1A 5CBAA 5DO2D 3B8YA 1ZWIB 1QBAA 1K4CA 4GFTB 4P9MH 2XG5A 4P23B 1YEJL 3RKDD 3MODH 4P2OB 4OZIB 1S7VB 2EXYC 1FNAA 1IGJA 3FB5B 4HZLA 3U7WL 4M3KB 3TIDB 3PWPE 4GMSH 5I71B 4YDJB 3ROOA 1MFCH 1TITA 4RMTA 4KI5C 1KJVB 1KT2B 3LQAC 2C3VB 4R0LB 1BFTA 5E70A 3MCLH 5F3HB 4S1DD 4JFFA 3AMLA 4JO1L 4JVUA 1FORL 2LABA 5FHBH 3IXTA 3VXRA 2LQRA 1S9WA 1J12A 3BHBA 3BWAB 2BVQA 4MZ2A 4IEFB 1NUNB 1QSVA 5DJAB 5J11C 3LZFH 1QTYT 4GMTH 4HQQL 4NZUH 3TCLA 1U2HA 2J8UB 1YMMA 3BUYB 4H88L 2Q8AH 3ZDZF 4HGWA 2ZCKH 4JZJA 1QP1A 3BX7C 1MAML 3VXRE 4M5ZL 3VFOA 5FO7B 3I6GA 3BGMB 4DAGL 2VIRB 4PB9H 4G5ZL 3LRSB 4BZ2L 1HKFA 4S1QL 3I6KB 5HY9A 4AEEA 5FA4B 3NFNB 1YMME 2E7BA 5I18H 1VGEL 2DAVA 2FYYB 1OAQL 2GJZA 1O0VA 4CU6A 4ZUSA 4OGZA 1LK2A 4PIRF 1CDHA 1SJVA 4IDLA 2LU4A 4JVWA 2A77L 1S9KC 1N5AA 1UEMA 2UZIL 2FWOA 4P46C 3BP7A 3B2UD 1ZT1A 5EZOL 5IOPA 4AJ0A 1U91A 3QDGA 1GZPA 4HD9A 5ANMA 1I4FB 2L0DA 4NOBA 1GVIA 1MRDH 2VXQH 1FV1A 1AGEB 4X4YB 4QHMB 4G8GD 5EUOB 4OZHE 3VG0H 2ARJA 3MLZH 3QXAB 1FRGL 3U82B 1ZA6A 3CFDA 5DQDH 4ZTOL 3HAEH 3VW3H 3QEUB 4YHKL 2CIIB 4D9RE 5FM8A 2NY2C 1C5BH 1F8TL 1ZHLA 5GJSL 2YSSB 5EPMA 5TF1L 1FO0A 1SMAA 2YD4A 1OF2B 2FHBA 2J6EL 4KI5E 3TBYA 3L5XH 1ONQB 5KVFL 1XF5A 4U1HA 5A40E 2V7NA 4OF7A 2YD6A 5CINL 5L2KB 1M1SA 5KSUB 5EIIB 4NKIL 3DXAD 4GAYB 5I0DA 1RUPL 1OTTC 3U46B 2XWTB 1U41A 3CFJA 5A3IC 5DUBA 2FJGB 3JV4B 4YPJA 3IAQA 5D8JH 2V7HB 1RJCA 3C08H 5IHUH 1HILA 1BLNA 3MLWH 5F9JB 1CXIA 4JDZA 4FFWC 3HAEB 1H3PL 4NQDA 4U1NA 4AEIL 3KPNA 1R5WA 1CGSL 3QRGH 3QIUD 3MMEB 3HZMB 4P46A 2YD7A 3EYVB 5HGHA 2NTFA 4WFFE 4FTVD 3UJJH 3MRPB 1N3NB 1ULVA 3H3PH 5MEQA 1E28A 2WWKT 1J87A 43C9B 2R23B 5E6IC 1A7BA 1AE6H 4Y4FA 1LO4L 3BIAX 1E4KC 1HOCB 4RMWA 2YPKA 3RA7H 2H3NB 4JFED 5E2WH 1TTGA 4QHLB 3ULVD 2FH8A 5ICZA 4RA3A 5KVDH 4XGZA 4UNTA 1BVLA 4XI5C 2D7TL 4AMKL 1QSFD 4XPGL 3KYOB 3VD9A 4LAQH 4FP8L 3G5XA 4HF5L 2NXZC 2XTJD 2Y4SA 1LQSR 1DBBH 4UV4H 1SM3H 2AK4B 2IBZY 4YQXL 3B5TA 2B2XL 3UZVB 5I8OL 3T2PA 5JNYB 2NLJB 3PP4L 3DETD 1D5XB 3NCJH 3EYUL 4MLSA 2R56H 1CIDA 2QEJA 2E8ZA 3BT2H 2AEPH 2WWMD 4GKOA 1GIGH 1MCDA 2EYTB 4FXGB 2ADGB 1LDSA 4BJLA 1BD2E 3D87B 1VFOA 3NACH 3GSUB 3G08B 4AT6B 2GSIB 4FS0A 1D5ZB 2WK2A 4G43A 1DQJA 4RZCA 2P5WD 3QO1B 1G6RA 4PP1C 5I8KL 5F7DB 4WNQA 1RI8A 5ESVA 1DQLH 4E41D 4EUPB 1BZQK 4WWKA 5E6IA 2EZ0D 4RAVB 4QO1A 5SWSD 4AIZB 4KQ3L 1YN7A 5E7BA 5EZJB 5C6PB 2P8LA 1E4KA 4KAQH 1KCUL 2DQFA 4KK6C 3B9KD 1L0YA 3B5HA 4MYWB 3FJTA 2A6KA 4CU8A 4G7VL 15C8H 4FQJL 3S88H 2PTTB 4PG2A 4JHWL 2AJZB 3DUHA 2YPLA 3GBNL 1TVDA 1F3DH 2XPGB 3BRFA 4QOKA 3OKLB 4J23A 3ARFB 3REVA 3MCKB 4D9QD 3MLTB 5KVGL 1I8LA 4U6YB 1OAKH 3THML 1Q94B 3MRHA 4ORGB 2YD8A 3S37L 1E0OB 4QOKE 3WS3A 3OJ2C 4G8GB 4CMHC 2DM4A 3W82A 3U7YH 1CWVA 5I16A 3T0DA 5CGYC 1IC5H 2DBLL 1LO2H 1JK8A 3STZA 3V6ZB 3V6BR 1T5XB 3CXDH 5K9KB 3E8UL 2UZYB 4NHUA 1IGIH 3HI1B 1D6EB 3GMLB 3OBAA 3FFDA 4HPYH 3BSZH 3SCMD 3MUZ1 4Y1AA 5JW4Q 1RZFL 3U0WL 1XGYL 3BP5A 4QY8B 5E94A 4NN5C 1AKJD 2W0LA 1B9ZA 3OAZK 3MBXH 5DRNA 4UT6H 3TNMA 1NC2B 5IESH 2UUDK 1K6QL 4UNVA 5GRVL 1Z9SA 4QWWC 5DK3A 2Z8RA 4Y1AE 3EDKA 3B4NA 3DXAB 3FMGL 2H2SC 43CAB 2LU7A 5F6IC 1U58A 4LCCB 3UDWA 1UENA 2ADIA 3DSFL 4WU7A 1PG7X 4JHZA 4O00A 5I1DA 2IADB 4HSQA 3U48A 3VFSA 2CO6B 2D9QB 1OTSD 1JI1A 3O4OB 3KYMA 5TE4L 1JHTA 1KBGH 1T7VA 3DRQB 2AJXH 4MNGB 4KTYA 1F5WA 3CFCL 2D0GA 3DI2B 1MCIA 3QIUB 3MNZB 5D72H 4HHAB 1R3JB 5F1IA 4OIBA 4L1HA 1YEEH 3Q3GB 4FTVB 1FBIL 3BN9C 3QQ3B 5EC2A 5KOMC 3QA3A 3EYOA 1JZ3A 4F57H 4NJ9H 4WW1A 2NX5D 3VFPB 4LIQL 1EIBA 2HVJA 4PPTA 2R2HB 3SN6N 1I1FB 3QNZB 4R26L 3WMSA 3CD4A 4ORZC 3SQOH 5CAYB 1I8IB 4JFEB 2QLVB 4JQXA 1KC5H 1T20A 1HXYA 3C5ZD 5TE6H 2BNRD 1KJ2A 2YK1H 2NY3D 3S6CA 2GITA 1UVQA 4P4KC 2PETA 4DW2H 2PCPB 3QJFA 1CL7L 3W39A 5ICXB 4U6HB 5TPWH 4ELMF 3MV01 5L0QB 1QSFB 4PLJC 5E8PA 1FQ9C 4G6FD 3HNSH 3IETB 3TBWB 3GSXA 3NTCL 2HTLC 3MBEB 2XTJB 3GSNB 4R6UA 1R6VA 3BKYH 4IJ3B 1R24B 5FOBA 4OIIL 4K3DL 3CDGB 4FMFA 5I75C 1KF9B 5HHNB 4ZSOE 5HJ3A 4K23H 2DQDH 4PY8J 3T4AA 2P44B 2OL3H 2VLMD 4WGVB 1GXEA 2K9UA 1OP9A 4RISL 4GQPH 1A22B 5BS0A 2FX7L 3FB6A 5DJYB 5IB3A 2YBRA 5BVPL 1KCRL 4LCWB 4LF3A 3MA9H 3VXUA 3AXLB 1DEDA 5C1MB 1N2RA 2A0LC 5DQ9A 1I7UB 3LKOB 3Q6GL 5DUPL 4PJHA 3UXFA 3O9WA 3R1GL 4XPHL 4N0YH 3RWFB 4HBCH 1PSKL 5FCUH 2UVEA 4LBEA 1A3RL 2B4CC 4M61B 4OGXH 4Y5YC 4NBXB 4YFDB 4XNQB 5IVXA 2C3XA 1SJEA 2Z8VC 5SWZB 1GCFA 2P5WB 4JM2F 4MS8C 3KPLA 3PNWB 4KUCD 4AG4H 1H3UA 3FONA 4E41B 1XIWC 5F1SA 1PW3A 4X7SL 1UYWL 5BV7L 5F88A 2PR4L 2DQUH 5SWSB 5H94A 4XPFH 2YD9A 3VI3E 3LN4A 2HYMA 3FQUA 1BJ1H 3B9KB 4B53A 3GSRA 3MRMB 4R4NC 3WDIA 4L9LB 3QDJD 1P4IL 1X5AA 5L7XL 5IVZA 5AAWA 1BX2A 4KRLB 2G60H 2AVGA 7CGTA 1HZHL 3BKCL 3V0AC 4ZOEA 5HYSB 4HUUB 1ORQB 2LFGA 3VXMA 5LQBH 1BVKB 1OPGL 3QUYC 4OD3H 1WICA 3HC0B 4KUZL 1S7XA 1FZMA 1U3HC 1A5FH 2XTLA 3RWGB 2I60L 2QSQA 1DQDH 4HIHA 1XT5A 4I2XA 3ROLA 1CDBA 1RFDL 3RDTA 5ID0B 5FEBA 2CDEA 4YLQT 4HKBB 3N9GL 4GW5B 4PJ7E 1VGKA 2OXGA 1CGVA 3AU1A 3VXME 4JREC 5FYJL 5IHBA 1BQHB 3L3GA 4KH2A 4U1LB 4TUKL 4I2XE 4F80A 4RFOH 1S8DB 3KPTA 5TDNB 1BWWA 5EWIL 4PJDA 4OFYD 3W11C 5ERWB 1KTDA 2P47B 4DGIL 3RIFF 3SCMB 1RUMH 3KLHD 4JRYD 2P5EE 4Y5YA 4UQ3A 4M5YL 4NPYB 4HPOH 4LLVB 1EJOL 3DYOA 5L8LB 2AKRA 5E1AB 1AKJB 2WIMA 3ZDXE 1XIWA 1TQBB 5L6YL 1CTNA 1YA5A 3E2HC 4OLVH 5CZKA 3C60C 5H2BA 5TJWK 3OAZH 2EDQA 4MX7B 5KSAC 3EOYG 3KPSA 4KK9C 3ZYOA 3O3EA 1RK0B 2H9GB 3F6LA 2UUDH 3T0WA 1JRHI 5HXMA 1N5YL 4WFHE 4J8RB 5LGHL 4PJCB 4LSQH 1Q0YL 2RIKA 1KPRB 2NW3B 4FQHA 1MAJA 1FVDB 2IQ9L 5HYJA 4ERSL 1A3QA 5TDPB 3BH8B 3IDYC 4JO3H 1HKLL 5KSBB 1OL0A 1JJUA 3FT4A 2NTSP 4MCZB 4TULL 4LHUG 1U3HA 3RTQD 5I17B 2XWJB 1J8HE 1NDGB 3BXNB 4F7MA 5IMKA 3K2UH 2Z8SA 5HYJE 1IQWH 4JFFD 3P11L 4JY4B 1RUQL 4TNVF 4DKFH 1NPUA 3NCCB 4JAMA 1JV5B 3MV9A 4LPUA 2NX5B 1G6VK 3T3MF 3D48R 4LSVL 1H3TA 4U1MA 2NR6C 4XBEL 6FABH 1BEYL 3UTZA 5HHMB 1KB9J 3C5ZB 5CEZL 1AQDB 4ODWB 2BNRB 1KB5A 2NY3B 1YMMD 1MJJB 2LVEA 5GRUL 4HIEB 1BIIA 3MV9E 4L8BB 5JPMB 1QLRB 1JYXA 5JXEC 1S9XA 5D1XA 2H8PA 2DJ4A 2ARWA 1DVFD 4G6FB 3ALXA 3ARGC 5M7QA 1VERA 1LP9F 1T4KB 1UB6B 1J8KA 1C8PA 5EORH 3KAAA 5DLMH 2Q6WA 2ZUWA 4OKDA 1XEDA 5I30H 1MLCB 1HIMH 2HN7B 2Q76A 4JQIH 3SDXA 3L7FB 3T0EA 3JWOL 1P5VA 2C1PB 5C0JA 1G7QA 3QDGD 2ENYA 5T3ZD 3BO8A 3GNMH 3E6FA 4OF0A 4QRRE 3L9RB 4XP6L 4XNUH 3TWCH 2GHWB 1FHGA 5DD1H 4YHZH 3FTGB 2DJUA 4MAYC 4RAUB 2BSSB 2HT3C 1K8IA 2X4QB 3MV7E 4HWBA 2R1YB 5CJOH 2SEBB 3TO2B 3P4OA 4ZS6C 1I9JH 5I1LB 5FK9A 3FAXA 4NQEA 4DKDC 2WIIA 4B7IA 3GI8L 4UDUB 1M6OA 5FF6A 1A7QH 1GHFL 4KVNL 3SGKA 5CD3A 5L2JB 3O6KH 4JKKA 1IE5A 3WBDA 2DKUA 4RGNE 4D94A 1UJ3C 1ZV5A 1G7PA 1CBVL 1T2QL 1I7TA 2DICA 3QIBC 4EQ3A 2HRLA 3UO1L 4HKJA 5JXEA 4FFYL 2XZCL 1BFOA 3WKNA 1HDMB 4R7DB 2B5IB 1CXFA 4F8TA 3P4MB 3LH2L 5IG7A 1NFDA 3X12B 5FYKE 5B21A 4WFFD 1Q1JH 1CXKA 4Z18A 1IT9H 3VXSA 4NQDD 3V4UL 1JNHA 3FOLB 5FHAH 1FGVH 2VSDA 4GLRI 4HS8H 5BQ7A 2AI0L 1ZT7A 1J10A 4Z7UF 2GW5A 3G5YB 4ONFL 3FO2B 1EHXA 4F9PA 5E95B 3DVGA 4YK4B 1FNLA 3KPRA 5AZ2H 1IGYB 3VXSE 5CD5C 1MFCL 2EE6A 3SQBA 4KV5E 1ZAGA 3ZHKA 2EKSA 4Y4FD 4L3ED 4MAYA 3TCXA 1JUFA 4JRYB 5AZEL 2DWDA 3SE3C 5FHBL 1ADQH 1KYOJ 3CVHB 1S7SA 4XWOD 5EBMA 4ALAL 1LD9A 3KPRE 4PRHE 3BD5A 3LN5A 4QKXB 1JGEB 1TVBA 5J1SC 4OZFA 2IQAB 2X9XA 3VMPA 3OGCA 5CZVH 1HH6A 4WHTA 4HWEH 3KLAA 1QFUH 2X41A 4EDWL 3JWDC 5J8OA 3CK0L 2B1HH 1T1WB 3NPSB 2HJLB 3F7VB 2Q8AL 4R96A 1U95B 1UJ3A 5CBAB 3S8WA 5HGBA 3O3AB 4GRLC 4PB9L 3GMMA 4YHIA 1QFHA 4X9HA 2A73B 5IW6A 1PAMA 4HZLB 3QT2A 1A1NA 3SDAC 1CDIA 1FIEA 1AFVH 3ROOB 2VWEE 2VUOA 1IEBA 2YUVA 3QWOA 4JANA 2XZQH 5I74C 3WO4C 5KVEH 2C1OA 4JFFB 4Q2ZA 1QSEA 4HT1H 4H8WL 1I8KA 2OR9H 1AY1H 3MA7A 5HHXL 4CW1B 3MZGB 4DOHE 4E0RA 1MRDL 2VXQL 3HUJF 3T04D 3BPCA 4EI5D 3VJ6A 3VXRB 3VG0L 1S9WB 4KJWC 4NJAH 5FDYA 1ZLSL 3BEVA 3BHBB 2DIJA 3IFOB 3V4PH 2BVQB 3WHE1 1QSEE 1V7NH 1RY7B 5DMGC 4G9DA 4WRLA 3BZEB 4KC3B 4WWKD 4IRJC 1YMMB 4HGWB 5DF0A 3U1SL 4JZJB 2WZPD 4Q9RL 2DDQL 1CVSC 1CE1L 1D6VL 3NGBC 4U3XA 1QA9A 5T33H 1JF6A 4MDIA 4Y4HC 4RGOL 5AYUH 1DANT 2YPLD 5HY9B 3V0WL 3S35X 4OI9A 1TZHA 2DBJA 5DD0H 4YHYC 2LAGB 2GJZB 4QOKD 4ZUSB 1MCJA 4JN1H 1LK2B 1QUNA 2MPAH 1MCEA 5IF0B 1KCSH 3MRCA 3HRZB 1HI6A 4MCYB 2FWOB 4NQXA 3GB7A 4X6DB 2RFXA 3BP7B 5IOPB 4XCEA 1U91B 3LEVL 4FFVD 3QDGB 3TJEH 1GZPB 2V9QA 5ANMB 3IFNL 3JUYA 4FFZH 4ZFFA 5E00B 1FV1B 4F7CB 1FLTX 4WO4C 1MWAH 4LSRH 3GM0A 3SDAA 3UTQA 3JVGC 5IHUL 2ARJB 4PJ9C 3KDMA 4OTXL 3MLWL 2XFXA 3VDBA 4HWNA 3UZEA 2C7UA 3OKYA 3F12A 4H1LA 2H6PA 4PJ8C 3WJJC 3M8OL 1G7JA 3EYQC 4XZUB 4CUCA 2BX5A 3M45A 3QEHA 4JFDA 1RUAH 4LSSH 3O41A 2ESVA 3MRRB 4WUUD 2YR3A 2ITDA 1FO0B 5EPMB 5EBGA 4OB5H 3H3PL 1WZLA 3IS1X 3TBYB 4X0KA 3FQNA 1UACL 4XMKH 1AE6L 4F3FA 5IFAH 1XF5B 4U1HB 3HB3D 2V7NB 1RV6X 1XF1A 4HJGA 2ESVE 5E2WL 3MR9A 4L29A 3KYNA 5EC1B 1A2YA 3BE1H 2VL4A 3CFJB 4HBQA 5DUBB 3MLYL 4I4WB 1PZ5B 4M1DH 4OZGA 4FHBD 1P4LA 5CSBA 1HILB 4JDZB 2FD6L 3UAJC 4NQDB 1SM3L 1J9CT 2CIKA 4U1NB 3KPNB 5GS0D 4HLZH 4QEGA 1R5WB 3H9SA 5GGRY 1HHGA 4OZGE 1Z3GH 5SX5H 1WBZA 2DQJL 4LFHD 2DYPD 5HGHB 5IMLA 4KRPC 4FQCL 5DR5L 3RVXC 3Q1SL 1BIHA 4IOFD 4PB0L 3RZCD 1AIFA 1U8NB 1AJ7H 1NLBL 4WO4A 2D0HA 1E28B 5HDQH 3H9SE 1CCZA 3CU7A 2IAND 5C6TL 1MJUL 4Y4FB 3A0OA 2YPKB 3UTPD 3PE9A 4NBZB 4PJ8A 4I3SL 2D7QA 5DJXA 3WJJA 1U42A 3ZE2F 2RAMA 4K8RH 5ICZB 3O8XA 1J18A 4N8VG 4XGZB 1BVLB 1OP3H 4EN3D 5I73C 4MA7L 2Z31A 4IMLA 4XNXH 3L5WB 2KL6A 4UILL 3DSNA 1LO3H 2AEQH 4J3UA 1NUDA 4XP4L 5D6CA 1BJMA 1BHGA 3DLQR 5CEXB 1JZ5A 2HFEA 1T1ZB 5EOQH 4JM4L 2AV7A 4Z7VF 2BERA 5IM7A 4YDIL 2QSCL 3VGDA 5BS0D 4MMXC 4BSJA 4KDWA 4HIJA 3C5JA 4XVJH 3V5DA 3WEXA 4K94L 4JFOB 5F9OH 4C4KT 4I3RL 3VXUD 4CGTA 4CDGC 4HC1L 3VFUB 3QUXA 4NHCL 3VFMB 3RY4A 3H42H 9CGTA 2W92A 3D0VB 3ZKNC 1JPSH 3O9WD 2DJSA 2WV3A 1HYSD 3QAZB 4OV6F 1T6VN 5J12C 5AD0A 1XF3A 1EDQA 1NC4A 4FNLH 1DQJB 4RZCB 1G6RB 3RBSA 3JV5A 3BPNB 3L95A 1D9KC 3EDFA 3U7YL 1G0XA 5ESVB 2ZOKB 1FC2D 3LEXA 2OZ4L 1LO2L 3LV3B 3FRPA 2QBWA 3LQMA 4POZC 4NO3A 4WWKB 4U1GC 5HHOD 5IP4A 1YN7B 5J56B 2P8LB 3LN9A 3NIDF 3NBNA 1GAFH 4HPYL 2VJXA 2A6KB 3VFRA 2MWCA 1JHLL 3MOAH 3WXVH 1CF8H 4BKLB 3MRLA 4Z9KB 2YPLB 1ZOXA 1P53A 5IQ7L 3T1WA 4L3AA 3QPQD 1RIVH 1WC7A 4QOKB 2JK5A 5DVKA 2AW2A 1FGNH 3REVB 5C9KA 1EFXD 4KKNA 3W5MA 5JTWA 2BNQE 4LHQB 3VI4E 3MRHB 5D7KD 4RIRA 3ULVL 2VXVH 4PJGA 4CDHA 3RDTD 3WS3B 3CDYA 4PRIA 4K3GA 1S7TA 5JXAL 5I16B 2RCSH 2CRMA 5FM5O 3GSNL 1RUKH 4PJGE 3RVUC 3NCFB 4FA8A 5D72L 4NHUB 12E8H 3D25B 1YEEL 4LHUA 1OSZA 3FFDB 4R8WL 4WUUB 4TPRL 3PGFH 4MXWH 3BP5B 4NJ9L 5E94B 2OTPA 3JSSA 4Z78B 5CJ8A 1EUUA 4NSKA 3TNMB 3KLSA 3G6JE 3ULUC 3SQOL 5D96B 5JUEL 2VQTA 5CIPH 3KPSD 3IFPA 3OF6A 3MLXL 3TP4A 4QT5A 4DW2L 3BYYA 1A4KB 4ISVA 3CVIH 1U58B 4PV8A 1QBLH 1VDGA 1Y6KR 1CLZL 2H2PC 1NMAH 4WU7B 2CLZB 2QKIB 1BFVH 5I1DB 1MF2L 5SV4A 1A64A 5C3LD 3BGFC 1EZVY 3RUGE 3KYMB 3LMJH 5HDBE 1JHTB 4KY1L 1UJTA 2FBOJ 3UTSA 4ZFZA 4M1CC 1MFAH 2IJ0C 3ZYIA 1IC1A 3FZUD 3V5KB 4H0HB 5F8QC 1JYWA 4XVTL 1ES0A 5F1IB 5SX4H 1J0ZA 2DYPB 2HLAA 2WUBH 4XWGH 1SEBA 3RZCB 4KGJA 4D0DA 3EYOB 4HIXL 2J88H 4CMHB 3OKNA 4WW1B 2HVJB 4YHMH 3S98A 4UTAL 4J2XA 4N0YL 2IAMA 5E2JA 1A1MA 2V2XA 1T20B 1HXYB 2Q87A 1KJ2B 3BGAA 3D2UA 1BBJA 3U4AA 1UVQB 1T0NA 2O93L 3QJFB 5INCA 1DLHA 3W39B 1WK0A 4D9LH 3QUZA 4EN3B 1CS6A 1WVZA 5D1XD 1CD0A 5E8PB 3MRDA 3FO9A 4JFZH 4NRXB 4TVPD 3BD4A 4XCNA 4XPFL 3GSXB 1J05A 1JMZA 1YECH 4PRNA 5FOBB 4TQEL 4NO5B 4WI9A 1EHNA 2HH0L 1IQDB 4JDVB 5E8EA 3T0ED 1WZMA 5BS0B 1WCBB 5IB3B 4W6XB 2YBRB 5J06A 4LF3B 3VXUB 3X11A 1E4WH 3FQTB 1N2RB 3OX8A 5DQ9B 1MSPA 4L4TA 4L9DA 4PJHB 1IC7H 1XGPB 4BQ8A 3O9WB 5A2KH 4QRUB 4XAKD 4XHJC 4WTXA 4LBEB 5GZNC 4YJZL 3HE6C 3LKNA 3QUKA 5IVXB 5EU3A 4XPAL 2ILLA 3KPLB 1HWGB 4LLYA 4L4TE 4NQED 2FX9H 1QHOA 4HUKB 3FONB 5F96L 3CPLA 1CL7I 4Y89A 5F88B 2HT4D 5F3BB 1NUFA 3KVQA 5HHOB 3VH8G 5H94B 3HZVA 1W8NA 5GSRA 1BQUA 3BPOC 3KWWA 3LN4B 1URLA 1MQ8A 1BZ7A 3GSRB 1INEL 1JGVH 1IAKA 3TH3T 2XG4A 3VD7A 2VLKE 4I18A 4LPVA 1BX2B 3LVEA 3ULSA 4LRNL 4GG6B 1FZJA 3VXMB 4O9HH 1WUNT 4JY5H 4OLVL 3W0WD 3WCYA 5E8DH 1SHMA 4NKMA 4P0DA 4ODSL 3UBXG 1FZMB 4PY7B 1DBML 4HIHB 4LSUH 3ROLB 1U3JA 3SPVA 1YNLH 1NKRA 4N8PA 3P40A 3RDTB 4PD4K 1N8ZB 2CDEB 4DVRL 1VGKB 3AU1B 5FB8B 4FZ8H 5LBSL 4KFZC 3L3GB 4MD4A 3DMMC 3UBXI 3D1MC 3NPZB 1HQ4B 4YAQB 4JO4L 3FOMB 5EU6A 4ZUUA 4OUUA 5F7EL 2FB4H 1GGIH 4PJDB 2NY7H 3NFSH 4BZYA 5BO1L 5C9JA 1SY6H 1MHCA 1KTDB 5C7XL 3O2VL 4PRDA 3CFKA 4PLOB 3HE6A 4PYHA 4R2GB 4OLUL 1MVUA 1QACA 5EU6E 1B0RB 1WLHA 3ILQC 1EVTC 4M6OH 1WWAX 1XIWB 5H2BB 2AERT 2N7BA 2HAZA 3P0GB 1UH3A 3KPSB 3O3EB 3RWHA 1H5BC 1PQZA 3U30C 3N1PC 5ID1B 2AJUH 4HIIA 1A6ZA 1B4JH 2YHGA 3ETBF 4JKWA 4MQXC 3FN0L 4FQHB 4KJQC 1AC0A 4R97C 3I6LD 4PJBF 4MD5A 1EMTL 4TVPH 4Z7NF 2RHEA 4GKZB 1PFCA 4GAJH 3H7BA 2ZUQC 3FB7A 3EYSH 3ZSTA 3KNBA 2O5XL 3OKMB 3FKUS 4F7MB 5IMKB 5IEHA 2XOTA 1PGRB 3U83A 1N4XH 5MHSD 2X9YA 4QRSB 4XP1L 3AS0A 4KPHH 4MA1B 5GZOD 3WUZA 1MCCA 3KS0J 3GNML 2V2WA 4KROC 4N0UA 3T4YA 3TWCL 4U1MB 5DD1L 5GGVH 4RMRA 4YHZL 3UPRB 3PWUA 3TO4C 2ICWI 3UTZB 4K07A 3FRUA 3V5HB 1KB5B 5CJOL 1OP5K 2ZOLA 3GI9L 1KNOA 1H8NA 1GOFA 4HWBH 4KDTC 5IK3A 2MJWA 4N0UE 5L8KB 1CXEA 1FL5A 1S9XB 5D1XB 3SE8H 2H8PB 3BMVA 3RGHA 4X8JB 1NBYA 3L3DA 3NIFE 4KTDH 2XI9A 2OI9B 1V8HA 4X6CF 2OYPA 5FGSA 3DIFA 1ACYL 2Q6WB 1WAAA 2EYSA 3EOTH 4X4MA 4FQXD 4MNQA 4OLZL 5ALBL 5HHVH 2Q76B 3R8BB 4AH2A 3SDXB 3T0EB 4OZ4A 3CVHL 3MYJA 2APXA 5C0GA 2W9DL 3U4BL 5C0JB 1G7QB 1M7XA 1WAAE 4X4ME 4PJFA 3BO8B 1DL7L 5CSZB 4MNQE 1A4JA 4YHOH 3UJTL 3C6LC 2W0FA 2FATH 2F5AH 1IT9L 5D7SL 4MMZC 3KJ6H 4HJ0D 4OCRL 2OCFD 4O2FA 1BM3H 3WN5C 2R69L 5TFSL 2Q86A 4PGDB 4NQVA 3P4OB 4RGNB 3NABH 5FK9B 4PJFE 4TRPH 5D7IB 4NQEB 4X7EC 2WIIB 4JFDD 1A6UL 1M6OB 1BF8A 5FF6B 1KIPA 3BZDA 4K3JL 3DTXA 3TZVD 3V2AR 2GSGA 5CD3B 3KR3H 3N1QC 3BDYH 1JHKH 5DVNA 1IAOA 1G7PB 3BEWB 1FG2A 1VENA 5DJDA 3NN8A 2HRPH 3LDBC 4RAHA 5I1IL 4X7FC 2CR6A 4H20L 3DVNA 1MFBH 5CZVL 4TSCH 1BFOB 1QFUL 2ATKA 4Y19A 5JQ6L 2X1PA 2DLTA 1C1EH 2XNAA 3W0WB 5GISH 5IG7B 1NFDB 1WIPA 4X7TA 1RIUH 1U8MA 3EBAA 4MJIE 4UT7H 2GCYB 3DUUA 4N8VA 2HMIC 3EZJB 4R3SA 4NZJA 3K4DA 3VXSB 4U6VH 3R06A 1EVUA 1FJ1A 3CX5J 1JNHB 4Y19E 3I85A 4F7EA 4UINL 3IDJA 1T04B 2VITB 5BQ7B 2FO4B 1ZT7B 4OGAD 4MHHG 4LP5A 3GKWH 3RX7A 3REWA 1TZIB 3DVGB 1KG0A 3KPRB 3QI9C 3L5JA 4ACPA 1CK0L 4L8DA 3PHSA 5B39A 4WI8A 2EEAA 3C6LA 4WI4A 2EKSB 1VFUA 3RL1A 1IFHL 1JUFB 3CXHK 4QHKJ 3BISA 2DWDB 1JGLH 4HS3A 1S7SB 4MHHI 5EBMB 4RNRB 1LD9B 4OCWL 2QJDA 4PJAF 3LN5B 32C2A 3QO0A 4OZFB 5T3ZL 3ARDA 3O8XD 3OGCB 4RFEA 2QR0A 3KLAB 5J1TC 1OTUD 2X4UA 3GJFH 1FL3A 3TGXA 1OCWL 1SQ2N 4FXLA 1LO0L 4XCFH 2Z31D 2WSKA 4OIAA 1P4BH 5IBTH 1FNGA 2EDJA 4R96B 4OLYL 2J7LA 1UM6L 4XPBL 1YYLH 1A6VH 3QQ9C 5HTSA 5HGBB 1IM3A 2XWBA 5FYJU 3N1GC 4XNMA 2VDQH 3K4AA 4Y2DC 5A43C 5IW6B 1FO0L 4NUGH 3SDCD 3IVKA 2D0FA 1A1NB 5SWQA 4PJEE 5DD0L 5E99H 4DOHB 4WV1B 4PJXF 4JN1L 4LSTH 1IEBB 3QWOB 1KCSL 2Q3AA 3QUXD 4JANB 1OY3B 2R8SL 5DJCA 4NCDA 2C1OB 5TH2A 3TPKA 2ZUVA 4Q2ZB 2EIEA 4Y0GA 1I8KB 1S7QA 3LPGA 2ZPKL 3TJEL 2WAHA 3OL2A 4E0RB 5E6ZA 1S7UA 3BPCB 3BPLB 1NC4D 2O26U 3JXAA 3VJ6B 4WFED 3GJFB 1C08A 3GJEA 1BQLL 3ECBA 5CP3A 4AEFA 3WIHH 5GIRA 1NL0L 3BZ4A 4L5FL 5C0CA 2FGWH 1CGWA 3MRIB 5E2TL 4G9DB 4MDJA 1WIUA 5CJQH 5J4MA 1E6OH 3WS6A 1PG7L 4Y8AA 3I84A 2UY7A 1OP5H 1QA9B 3CNKA 4MDIB 4DN4H 4OB5L 3VWJA 4MA3A 5C0CE 3U36A 1A0QH 2O5ZH 4OQTH 5E08L 1S9YA 1TZHB 1FPTH 3BIKB 4ODVH 5I1JH 2ARJQ 2ICEA 2P48B 2YC1A 1BVZA 4M7KH 1VFAB 4K7PH 2LE9A 1HI6B 2I07A 1TTUA 4JKLA 4NQXB 2FEEL 3GB7B 2NY4D 1HINH 4XCEB 1C16A 3X3FH 2B0SH 3WFDL 5DS8A 3HAEG 4Y2DA 4ZFFB 1OAUH 5CMAA 3SDAB 3ZE1E 1NANH 4PRID 1F4XH 2XFXB 1I75A 1KB9K 3FFCE 3GM8A 2C7UB 3EJZC 3F12B 4H1LB 2H6PB 4FRWA 4PP2A 2VDRL 5I74B 1G7JB 2V5TA 4HJJH 1KSRA 2C4FU 1Z3GL 3VXPA 3T1FA 4XMPH 5SV3A 4JFDB 5IB1A 3SO3B 5HVWA 3O41B 5IROC 1NCAH 2ITDB 5D1ZC 3MLRH 8CGTA 4LPTA 3TZVB 3AAZA 5DVLA 4X0KB 3FQNB 4F3FB 1F4WH 1SEQH 1IC4L 2C4FT 4XTRC 4R90L 3TLRA 4HJGB 4UQ2A 4WEBL 3HI6H 4JQVA 4ZFGH 4YXHH 3MR9B 2NYYC 3OF6D 3ARRA 3RWCA 4NWTH 4L29B 5FECA 2WUCL 3KYNB 1CU4L 3EO9H 3TYGL 1G6RL 1MCOH 1LE9B 4U1IA 1P4LB 2MQCA 3O6LL 5EG6C 2EXWD 1FIGH 4X5XA 4GBXD 3SEPA 4YXKL 4LRIC 2CIKB 3QR2A 4ZNEA 1T7WA 3UTSD 5CILH 1F58L 1HHGB 1HQRA 5EBWA 1WBZB 4EBQH 3S9DB 5AUMB 3NAAL 5D5MA 4DJMA 1F6LL 3QDMA 4PJIA 3T08A 2XZAH 1C5DB 4QRQB 2GJ6A 2DD8L 1T80A 1BZ9B 3ZMRA 1A9BA 5BZWA 4NWUL 2D03H 3L3HB 5C0BE 1MI5E 2NW2A 1JPSL 2IAMD 4IIQB 5DJXB 5D5ME 4NM4L 4I0PA 1VEOA 2OP4L 3BW9A 4BQ6A 5I1AA 4PJIE 1X5IA 4EUPG 3OB0H 1T83C 2GJ6E 3S4SA 3DYPA 3O8XB 5IROA 4WENB 5DEFB 3QUZD 3GHEH 3LIZH 2BVYA 4JPKH 2Z31B 3OKEA 4IMLB 2WBJA 1OW0A 2ZG2A 4F8QA 2X1WL 4CBPA 1P9MC 2PUQT 3RVTD 2EDKA 5F6HI 5E2VL 2R0LL 3QXDA 5D6CB 1J0JA 3MOAL 3UTOA 2FR4A 2HFEB 4HDIA 3GBLA 2AV7B 4ZG1A 5IM7B 3SDCB 2UWEF 2FEDC 5EU4A 5LWYH 1R0AL 1W72H 3HMXH 3C5JB 5GRJH 4OCXH 1B6DA 1FGNL 4M7JH 2CPCA 3QP3A 4N0FB 1U3ZA 3QUXB 4OCYH 1W0WB 1NMBL 5IQ9B 2J4WH 4PLNC 1KYOK 1MFDH 2VXVL 1IM9A 2HT2C 1WZ1H 3ZLQC 5AD0B 3NZ8A 1NC4B 4HXAL 1TQCC 3BP4A 1YEIL 1R3KB 3EFDH 3L95B 1X44A 4DKEL 2P46B 3QDHA 1T89C 1YQ2A 3LEXB 4I13B 5JW4N 5B38A 4NO3B 6CGTA 2IH3A 5GS0L 3AS2A 3AFLA 4EOWH 1UEYA 2FDBP 3MOBL 2VR5A 1N6VA 3G9AB 5CZXD 4JHAH 3B9VA 1B90A 3NZHL 3MGTA 3VFRB 5DD5L 3I2CL 4MXWL 2XICA 5C6WH 1XR9A 3MRLB 2YMXL 4M6ML 2DOCA 1G1YA 2XN9A 1IGFL 4CAGA 3S37X 5L88H 1WC7B 3O45B 1G7IA 1Q0XH 2D7OA 5JOFA 3I50H 4YDLB 3K1DA 4M7LL 2FHCA 4WEMB 3OQ3B 2NY4B 2X9WA 1KJ2L 2CSPA 5HHQA 4M43H 3LQZA 4XT1C 3O2DH 1AQKH 5HI5D 4WFGD 1IEAA 1S5HA 4B50A 2ADJA 1FZOA 4YBLB 2EDWA 1FSKB 3PV6A 4PRIB 4NN6B 1U92A 3GSVA 1RHFA 2DQIL 1KOAA 3AB0C 1RZKH 4ZS7L 1UKSA 3GIZH 4LKCA 4XC3H 5EU6D 1MRFL 5FYJE 2CDFA 2VAJA 4GH7B 3LEYH 3BYTA 3VFTB 1OSZB 4OLWH 2Y06L 3J7HA 5IWLA 1OTTD 2ICWA 5E1HB 2JCCF 1OGAA 4GRWE 1F3RB 4F9LA 1JWUA 4K7FA 3DUSA 4U7KA 3TT3H 2JJUA 3AROA 5A2JH 5DJ0B 5EU7C 5DEGB 4LK4A 3INUL 3IFPB 5F89B 5IFJA 5CP7A 3PXJA 4LVEA 2X7LA 4ISVB 4PV8B 2EECA 1UZ6E 1JZ2A 4Y5VC 1HH9A 1RSFA 4JFZL 5KS9E 3SOBH 2VZOA 2BHYA 2F54D 4Y16C 4DEPC 3MJ9A 1PZUB 3NVQA 5CHNB 3PWNA 4GBXB 1CT8A 4OD2A 2VXTH 3UTSB 4ZFZB 1X5LA 3LQAH 5CEYA 3QCTL 2BDNH 4P23C 1FFOA 4XNYL 5FM4A 2HLAB 2ATPA 4P2OC 5BZDA 1SEBB 1MUJA 1E4WL 1JWMA 3L7EA 4HUXA 2DI7A 3MRBA 3OKNB 3PHOA 2YD3A 5I71C 2DQHH 1DQML 2KPNA 5C0AE 5FGCB 1INDL 3QIWD 3RWDB 4LOUD 1NMCB 2DMCA 4R0LC 4GG8A 2IAMB 1A1MB 1EEZA 4MXVE 4M48H 4IOIA 3MSPA 4JFPA 1AO7E 2A6JA 1BBJB 4HW6A 2GY5A 1T0NB 4ELMA 5INCB 1DLHB 2FX9L 5GJTH 1ED3B 2GI7A 3QUZB 4GJTB 5CEZE 1H15A 3MRDB 3FO9B 3PQYA 5AAMA 4XCNB 1OD7A 1J05B 4PRNB 4O02L 4WVRA 2NY6D 1EEQA 2MOVA 2RR3A 4ELME 4XP9L 1EEYA 4FQIH 2ZSVA 1IAIH 3BAEH 4OGYL 2Q20A 5HYSG 1YEFL 1S5IH 3WKMH 3PQYE 5IB4B 2B4CL 5E8EB 2DF3A 4NOFA 2WLZA 2X70A 2NNAB 4TNWK 3N85H 3U9UA 4Y5VA 1PYWB 1YEGL 4TN9A 3X11B 1TNMA 1HSAA 3DHJA 3OX8B 2Z92A 5EU7E 2VO5A 4O2EB 3X3GL 5DDHA 2FL5B 1I3GL 5DYOB 3SGEH 2ITCA 4ENED 2A9ML 2FX8H 4DFIA 4LVHB 2VLJD 1JYVA 1G9MH 2AGJL 1DE4A 5J9PA 4JM2A 3LKNB 3QUKB 5HDLA 4FZ8L 1H9VA 5EU3B 4P2OA 4LLYB 4GUPB 4ZOAA 4HFWA 1GZQA 4NQCA 1XFPA 4JFHE 1T21A 2BY1A 3L6FB 3EJYD 5KTEH 2A9NH 4PBWD 4YDJA 1QO3B 3NFSL 3HZVB 5GSRB 1RMFH 3KWWB 4PV9A 1GOGA 1BZ7B 4P5TD 4Z7QF 1IAKB 1P6AB 2FBJH 4I18B 3GRWA 4OLEA 4F33B 4NM8H 4KK5D 1N6QL 2AV1A 1EO8L 2FECI 2G5BA 4UIMA 4Y8DC 1PLGL 1NBVH 2GTZA 4DWHA 4C55A 2AJ3A 4BFIB 3BZFA 4H8WC 5KAQF 5CJ5A 3SPVB 1KB5L 1CG9A 3EIFA 4G6JL 2NY5L 2AQ2A 3PGDA 4YBHA 3B9DA 1NFIA 3B9EA 2A6DA 2HKFL 1L4IA 3RGVA 1GH7A 3I6KA 2GK0A 2CQVA 2V5SA 4X80H 5EU6B 4OI7A 3HNTL 3MOQA 5JR1H 4OAWA 4QWWD 4EIGB 1MHCB 3LS5H 5E9DA 2NY1D 4IRZL 4PRDB 1JPTH 4LPXA 3S35L 1TETL 2JELL 4JFQB 4NNXA 4RSVA 1MVUB 3IAPA 1ZHNA 3AREA 4JVPA 3ARDD 3ZTJH 5E9DE 3RBGA 3H7LA 3IU4L 2W91A 1I1AD 3V8CA 1MCSA 4S1SH 4CN1A 5D1QC 4G6AD 4K3EL 4HIIB 4HWBL 3GK8H 4G9FA 4KRNA 5EUOE 3RAJH 2J1KA 4KQ4H 1U8HA 4MD5B 2BXYA 3T09A 1DQQA 3H7BB 1ODAA 2B1AH 2GQHA 5ENWA 3FB7B 2KZWA 4ODUA 5DO2C 1WJ3A 3EOTL 3KNBB 1U0QA 4G9FE 5JHLL 5GGUA 3EHBD 2BVOA 5HHVL 3MXVH 3WXWL 2HA1A 2YOCA 4M62H 3RNQA 3HPJA 1OLLA 4RMQA 3RKDC 5FYKL 5DFWH 3U46A 4YXLL 5BOZG 2AXFA 2KZ1B 3JV4A 5FDWA 4LU5L 1YPZB 2V2WB 3NCBB 1EGJH 4FZEH 5L2KE 3BDXA 3D39A 3PABA 3QIWB 4N0UB 4YHOL 3T4YB 4OFVA 4E5XB 5F9JA 4NGHL 2FATL 4PJ5A 3PWUB 4S1DC 3HAEA 3WD5H 5JHDA 3KJ6L 5C0CD 3FRUB 3EO0A 1U8JB 2ZOLB 4WW2F 2ZZUT 1KNOB 2O61A 3U9PL 3LS4H 5IK3B 5DRXB 5GS1C 3DV4A 3NA9H 1NBYB 3L3DB 4PJ5E 4XPTL 5ALCH 1LP9A 3VWJD 5JIPA 1UB5A 4GXVH 3TFKD 3OAUH 2R23A 3PWLA 5DA0B 2XRAH 1JHKL 2NY6B 4Y88A 1KENL 1BOGB 3DIFB 3L3IA 3LY6A 2EYSB 3EYFA 3GMOB 1OARL 4MNQB 3MREA 1CQYA 1AI1H 5D1QA 4AH2B 3MUGA 4OZ4B 5KG9B 3MYJB 4TSCL 3DJ9A 2P7TB 4NYLA 1JFQH 1CFNB 4PJFB 4X5LA 2OK0L 5IUSA 2ZUQB 1A4JB 1IAMA 2X4RB 3BKML 4NQTA 2W0FB 2VLJB 3JTTA 5C07D 2L7UA 1UM4L 2QADD 2Q86B 4WY7H 1XGRA 4NQVB 1NH6A 2BFVH 4Q6IA 4YO0A 4PRBB 2NLJA 8FABB 4GOSA 2F58L 1IKNA 1DN0B 4A6YH 1KIPB 1OAYH 2F8XC 2IH1A 4KROB 3DTXB 3GEWB 3E3QC 4Y5XA 3EDDA 2R1WB 2FRGP 3NIGF 1I8MA 4P5TB 3T2QA 4PTUA 3KPQB 1FG2B 1JGLL 4JPWH 1KTLA 5DJDB 5F1NA 3MO1A 4XB7A 4UIKH 3DVNB 4LCIH 3BH9A 1NGQL 5IW1A 4MNHB 3OZ9H 5GS1A 4K94C 2ATKB 4YWGL 4MJ2A 2XNAB 1CFVL 1MJ8L 3BQUA 1MI5A 4M6NL 4I77L 4X7TB 5IBTL 1U8MB 2W07A 3HMWH 2GT9A 3DUUB 4R3SB 4OFIA 1YYLL 3RL2A 1A6VL 2XA8H 2VDLL 3TESA 4PREA 2MCPL 3QEQD 4LCCC 4KKBD 1P7QD 3IDJB 1QBBA 5IHLB 1VACA 4Z95L 3SE4C 3REWB 1KG0B 1UKQA 3O4OC 3QDMD 5DGQA 4DZ8A 4YUEL 5C0RL 5I1EL 3S34L 4ZO6A 5B39B 1F45A 1RD6A 2OQJB 3MCKA 3MLTA 3QIUC 2BY2A 2NY1B 1Q94A 3RL1B 5DMIH 1Z9LA 4XP5H 2X5PA 4ORGA 3K46A 2HWZL 5K59F 4HS3B 3T3PE 4I0PD 3QNXA 4PG9A 4FQ1H 4ODTL 32C2B 3CLFL 1QG3A 3QO0B 2DLGA 1F90H 4TYUA 4G8GA 1A7OH 4EZMA 1MFEH 3ARDB 2JB5H 3NMEA 2QR0B 5FXCH 1KEGL 4FABH 1N64H 3A6BL 4HG4K 2D31B 5C09A 2WBJD 3V6ZA 5CJQL 1FNGB 3IDMB 3UC0H 1L6XA 3HFML 3ULVC 1HHIA 4G8GE 5IGXL 5T1KD 4O5LL 1IM3B 2XWBB 3CH1A 4DN4L 4KGLA 2PN5A 1G0DA 4POYA 4XNMB 3UYRH 1A0QL 1V3JA 4QY8A 3E3QE 3IVKB 4OQTL 2HKHL 5SWQB 3PG2A 1I1YA 2J8OA 2XTJC 4IJ3C 1NCDL 4YHPA 43CAA 3IGAA 2W9LA 1S7QB 1HINL 1D7FA 3DETC 3HUJA 1IM9D 1NAMH 3WFBH 5JORB 1S7UB 3B3IA 3VGFA 5BCAA 2OJZH 1JGDA 4UTBH 2FSEA 2ZUYA 1C08B 2WWMC 3GJEB 3WSQL 3SE4A 4TSBH 3ECBB 3PJSA 1F4XL 1FFNA 3BZ4B 3P0VL 5C0CB 3RI5K 4HXBL 5GS2D 5JIIA 4KMQA 4JDTL 4MNGA 4MDJB 1D3CA 1Y0LA 4FQ2H 4HHAA 4P3DA 1N59A 1TDQA 4WCYH 1HHHA 3MRGA 4MB5A 4XMPL 1MIEH 3Q3GA 3ZO0A 2O5YH 1Q9KB 3H9ZA 5F9AC 3VWJB 4MA3B 2AJSL 2Y6SD 3MPCA 1GGBL 4MNGE 2XN9D 4MQTB 4OCSL 1S9YB 2EZ0C 4XVUD 2R0KH 3QNZA 3B9KC 2ICEB 1I8IA 1KCVL 1RZJH 2YC1B 4OZHF 5ITBH 3D85A 4YXHL 2Q8BL 1A7NH 4L9LC 3S36H 2I07B 2VZTA 1IL1A 5T1DL 5ICXA 3CX2A 1C16B 7FABL 1AR2A 3L3KA 3QWRA 5BMFL 5DS8B 4Y2DB 5IJKA 2MNUA 2AXJA 5CMAB 5A2LH 3LKRA 1C5CH 2NZIA 4PRPD 4RDQF 2Z91A 3IETA 4QTIL 4X6FB 3TBWA 3ULVE 4ETQB 5C07B 5IR1A 2QADB 3CDGA 4KI5F 1MNUH 4PP2B 1QSFE 2BHUA 4HCRH 3VXPB 3W2DL 3T1FB 4TTDD 5IB1B 3MACL 4X9FA 3C5SA 5KOVC 1T0MA 3AAZB 1I7UA 3GIVA 1OGAD 2B39A 3NH7L 1FVCB 4Y4KA 1R3IL 2QHLA 4KMTL 1ETZB 2IALA 3CSBA 5KZCD 3SCMC 4UQ2B 4LSPL 4XNZB 4GSDH 3ZDYE 3WYRA 3QCUH 3RWCB 1YY8A 5FECB 2EDLA 5JMOC 1GPOH 4A2MA 1CLOH 2FEEI 1TQBC 4RQQA 4X5XB 2XACC 2Z4QA 5H8DA 2OL3A 4MXQD 4L9LA 1HQRB 4E41E 5EBWB 1WWWX 2JB6A 2EIDA 1RZ7L 1S7WA 1OTSC 4QRTA 3QDMB 3FCTA 5E5UB 4HUUA 3UZQA 2GJ6B 4LASL 2H26A 4XVSH 3OKKA 5BZWB 3DX9A 2X4OB 4I0CC 2NW2B 1IGMH 4J4PA 2Q7YA 1MFDL 1QYGH 3IJHB 4I0PB 1WZ1L 3BW9B 1MEXL 1A21A 2IF7A 4AQOA 4GW5A 5I1AB 3SKMA 3S4SB 1V7ML 4P59H 1GGCH 1DN2A 2HG5A 4D9QE 2WWKO 3OKEB 3PQYD 2WBJB 4DK3A 1NGWA 4ZXBA 3C5ZC 1FE8H 5D71H 1A6TB 1G7MB 2IPKB 3HI5H 2NY3C 4BZ1H 5ERWA 1FFQA 3EW3B 2FR4B 4Z7VA 4HDIB 3H9YA 1M05B 4LLVA 3HKFA 3F7QA 2W9EL 3TBVB 1AKJA 3JV0A 4ZPTA 4ODHH 2ED7A 2H1PH 3N50A 2A74A 4AZ8A 1RURH 5HVFB 1RU9L 4Z7VE 3CSGA 1U8LA 3U2SA 3T2NH 1OT1A 4N9OB 2VAAA 1NUGA 3Q5OA 1IM9B 4P5KA 5D70H 4Q97A 1QD0A 1TTFA 3NZ8B 1MCHA 2NW3A 5ISZD 4JM2D 3UTTA 1XH3A 3MXWL 2WINB 2G2RA 5DHYA 3ZZ1A 2W1NA 5KSBA 1ORSA 4NQCD 4MLIA 2G75A 2R4RH 5B38B 3QG6A 1II4E 5I17A 5DJZA 2IH3B 3BXNA 4UBDD 4ONGH 4APQA 3UTTE 4WTZG 3LEYL 5BJTA 1EHLL 1RULL 3RIAK 2YEZA 2K7PA 1ITBB 4JY4A 1F02I 2XQBH 3MGTB 5KSBE 4OM1L 4UAOC 1J1XH 4X9BA 4PGEA 5H35A 3CSYA 4PUBL 1B2WH 4OD1H 3PL6A 1JV5A 2CKNA 2XN9B 2F8VA 4AEHL 4YE4H 1G7IB 2HTKD 1YNTA 3TT3L 5JOFB 4ELKB 1DTUA 1CXLA 2VZ3A 1AQDA 5LXGL 2EDXA 1CDUA 1T66D 5A16A 3O3DA 4Q9BA 4J6RH 2NX5E 5HHQB 1EHAA 1QLRA 4XBGB 3LQZB 3S7GA 4Z8FL 1IEAB 2B5IC 3VFGL 5TF0A 1L7TL 3RGVD 3PV6B 2BNRE 1KN2H 1U92B 1FLRH 3GSVB 2MKWA 2YRLA 4I9WD 4LKCB 1FVEA 1AGDA 1U6AH 1HNFA 2CDFB 5MP6L 4XCYB 2R39A 4W4OA 5E9DD 2YWYA 1MCKA 5ADPH 2CGRL 2DKSA 4X9GA 5J6GA 1NAKH 2ICWB 4YK4C 1OGAB 3UJIH 5TE7L 1XAUA 1C7SA 4YDKL 4NKQB 4IMKC 4RX4D 3ARED 3AS1A 4J3SA 4QNPE 1IILE 5KZCB 1JWUB 4K7FB 2P45B 3DUSB 4NZRH 1L0XA 3FTGA 3KLHC 4NIKB 1QR1B 1MHPH 1OOAA 2X4QA 3LD8B 5IFJB 3OPZH 4I0KA 4LLUA 5CP7B 3TO2A 4UT9L 2MQ3A 4NFCA 5I1LA 2X7LB 1JPFA 1U93A 4G9FD 4DVBA 4LLDA 1Z0MA 2OR7A 1HH9B 4LLQA 1LEIA 4K9EH 2OMBA 5DI8A 1DBAH 1T7YA 2EDDA 3A67L 4EIZC 1UWEH 4AYFA 2N1KA 5E2UH 3PWNB 1CT8B 35C8L 1YNKH 4YIQA 3CC5A 3SJVD 2Y5EA 3QNYA 3RPKA 3DX8A 5GGTH 4BUHA 1CDJA 5D6DC 3TYFA 2KUTA 2V5MA 3QDJA 1BGXH 4M00A 5CEYB 3HZKA 3I9GL 4TSAH 5I9QB 4BK4A 1FFOB 4Y2OA 5BZDB 3N85L 4XX1G 3TH4T 4NDMB 4KZEH 1MUJB 2Y25A 1HDMA 2DRUA 3QB7C 1JWMB 1A7RH 2F9BT 2YPVH 3L7EB 3P4MA 1MPAL 3MRBB 4JPIA 3RTQC 3PHOB 5GSVA 2BVEA 3QDJE 4G6KL 3D39D 1L7IL 4YNYA 4GG8B 4PJ5D 5JHDD 1EEZB 1UXWA 1G9ML 4IOIB 4W6WB 3T0VA 5IHZA 2X4TA 5KN5A 2BVUA 2A6JB 1K3IA 2DQCH 5D2NA 4ELMB 1CN4A 4S1RL 25C8L 3G5YA 4D2NA 5J89A 4P9HH 3PHQB 1H15B 3PQYB 1OM3L 1RZ8A 1EPFA 2WP3T 2A9NL 5FUCC 4WUKL 3RU8L 5DD3L 3QEGH 4OFYA 4PS4L 2BVTA 4QCIB 1PG7W 5D2NE 5EZLA 4NKDA 4NZTH 4JZJC 4RWYH 3K8MA 2FBJL 2WBKA 2ZSVB 2VZSA 1M7IA 5FUZL 4LCUA 3T77B 1YYML 2X70B 3O6ML 2IQAA 5I2IB 5MERA 3U9UB 1C7TA 1HSBA 4JG1H 4JPVH 1HSAB 5GPRA 1QBMH 2Z92B 1CZ8L 4OFDA 5DDHB 4DEPB 4JRYE 1JF1A 4W81A 2ITCB 3F7VA 1MQKL 1KELL 4LPCA 4ZAKD 5D6DA 1DE4B 3O3AA 3ZE0E 1I85A 3VI3F 5J9PB 1WF5A 5ISZB 1A7PH 2CJUL 4JM2B 3QXWA 2IPUG 2A73A 2V17H 4Q0XH 4KKLD 5K9JH 2QQNH 1FAIH 1GZQB 4HFWB 4O51A 4NQCB 1JPST 1T21B 1B0GA 2X1OA 4MQSB 3RTQA 3DROB 4MA8H 2M26A 1G9NH 1SVCP 2D9CA 1QKZH 2VZUA 2HFGH 4PV9B 1N7ML 3CGTA 1ADQA 4OCMC 4FQLH 4XCCH 3MGAA 4CW1A 1PKOA 4D8PA 1DLFH 3QG7L 2R0ZL 3RKPA 3MNVA 2F53A 4E9LA 2AV1B 3MLUH 2G5BB 4PJ7F 2HFFA 3IFOA 4UIMB 3BQUD 4P2QA 4JFFE 2GTZB 2DQGL 4ZD3H 3BZEA 2AK1L 3RZWA 2AJVH 1QQDA 4PGCA 2AJ3B 3BZFB 4KJYA 3GK8L 3PWJA 1X5JA 2IGFH 1EH9A 1CG9B 3PGDB 2EO9A 1F2QA 1NFIB 2A6DB 2VYRE 4KQ4L 1DVFA 1CGTA 2WQ8A 5FUCE 4WWID 3RGVB 3GBML 1ZLUK 2BOCA 2IG2H 2GK0B 1O7SA 2FLBT 3CZFB 4GW4A 1BAFL 1EV2E 3TBTA 2ZJSH 2WMPA 4KVCL 3MXVL 5IF0A 4M62L 3ZDXF 1WFOA 3L1OL 4OAWB 1IGCH 5HPOA 3HRZA 5E9DB 3CUPB 4MCYA 1CFTA 4PLKD 4X6DA 4Z5RA 1WEJH 3QISA 2BNUB 5I0ZA 1U8QA 4NNXB 1W8OA 5E0QA 5E00A 3V7AG 4F7CA 1ZHNB 1EGJL 3MROA 3AREB 2H32H 1JRHH 4S0TD 4Y4FC 3LKQA 2OXHA 3QHZL 4X6DE 3WIIH 2EH7H 5C09D 4YFEA 3MNWA 3QDGE 4XWOC 4ZPVB 5ANME 3D0LB 5T3ZE 4XZUA 1BQSA 5DFVD 1T03H 4G9FB 4G3YH 3ZKMD 1RVFL 3MRRA 4PJBA 5I6XC 4YX2L 2E6QA 1U8HB 3LB6D 4QXUH 1X7QB 4M7LT 2W65B 1DQQB 3O6FA 3SJVB 5ENWB 1UA6H 4DKAA 3BJLA 4ODUB 5EIVA 5IW3A 1MFNA 4FOMA 5GGUB 1A14H 2BVOB 1E4XH 4PJBE 2DIAA 3IFLL 3RNKA 1MIML 3RNQB 3H3KA 3HPJB 5EC1A 1KGCD 1MWAA 2AXFB 3SDYH 1KLGA 1HEZA 4I4WA 1PZ5A 5FDWB 2H32B 2X44D 2X1XR 3ET9F 1VCAA 3D39B 2A1WL 3PABB 4PJ5B 4PGZA 2OBGA 3IU3A 5I1KH 5JHDB 3EO0B 3QAZC 4NO0A 1FDLL 5CJXA 2VDPL 4EI5C 2ZCLL 2O61B 4X4XA 1DUZA 3DV4B 3BPNC 1MJ7H 3P9LA 2Z8WC 1NCWL 1BF2A 2R4SH 1U8NA 1LP9B 2X89A 4NQDE 4X6CA 5KJRL 5LCVL 1I3RB 1UB5B 3GO1L 4WWKC 1CQKA 4X5WA 3PWLB 1I9EA 1A9EA 3O4LA 1YEKL 3L3IB 4L3EA 3EYFB 5DWUL 2FIRT 4JPWL 2PYEA 1EAPA 3MREB 3D85D 5D1QB 3MUGB 4PG2C 4HFUL 4XC1H 4Q9QH 1U3YA 4LAJH 1HXMA 4NYLB 2LTQB 3O4LE 3QWRD 1CLYH 4L3EE 4QGTA 3L5WA 2XA8L 3OWEA 1I8LC 3QCVL 3JTTB 4ZAKB 4MAUH 1IBGH 3STBA 4JB9H 5CEXA 2Y36H 1YEHH 4FFVC 2VDOH 3P9MB 1XGRB 1T1ZA 3C09B 1IGTA 2D2OA 4Q6IB 4YO0B 4YHLH 4G7YH 3C2AL 5E24E 5IB2A 5CKGA 2JJWA 3N1FC 1GJIA 4JFOA 4RCAA 2IH1B 4HKZA 4Y5XB 3VFUA 3VFMA 4Y4KD 2NPLX 1I8MB 5C0DA 2YWZA 3AMKA 3ULUH 4PTUB 3D0VA 1ZHBB 3P77A 4OZFG 1KTLB 5F1NB 1D5BA 3MO1B 4EI5A 5GHWL 4PD4J 4DK6A 4KZDH 5E4EB 1A7OL 3BH9B 3HC3L 5IT2H 5IW1B 2JB5L 3AY4A 3T0AA 5GS1B 3BQUB 3ZSSA 1UWXK 2ZOKA 2VMFA 3HB3C 2A6IA 5D96C 3LV3A 1A6WL 1FNSL 3ARQA 5FO8A 2GT9B 4YPGA 2IFFL 5FKPA 4LPWA 3WO3B 3RL2B 2GIYA 4GLRH 3ALWA 3OKOA 4PREB 2FZ3A 1VADA 1EAJA 4KV5F 3UDWC 4Z0BH 2GTWA 4Z7UB 5FGRA 5IFHL 4BKLA 1FN4B 4K2UH 5I1HH 1VACB 5KBNC 3GMNB 4HUMB 4UUJA 3BD3A 1ZLUH 4DZ8B 5EO0A 5GS0C 5IIEB 5F70A 3ESUF 5BXFA 1YQVH 3P30H 1H8OA 1JZ7A 4EXKA 2UV3A 4K3HA 2YPLE 4F58H 4J4PD 5E5RB 4PJAA 4U0RB 3KYKL 4IOFC 4U33A 3RZCC 3QNXB 3SKJL 4PG9B 1QLEH 1IJ9A 4JEGB 4JN2A 4KJQD 3SDDA 1AD0B 1NGPH 4P2CG 4D3CL 3UX9B 5C09B 4KI1A 4JQXC 4PJAE 3D9AH 4LARH 4ZXBD 3RI5F 3K2MC 1QEWA 3HC4H 1HHIB 2NZ9D 1RIHL 3D25A 3L5IA 5J3HD 4WUUA 4AL8L 1LDPH 2O5YL 3B2VL 3CH1B 5DURD 4EN3C 5HSFA 1X5XA 4S2SB 4P48A 5HI3D 4WTZA 1KN4H 4Z78A 1R3HA 1UQSA 4ONHB 1I1YB 4YHPB 1JZ6A 1RZJL 5EOCJ 2X4SB 4I8DA 1PX3A 4WUUE 4EEEA 4LDLB 1JE6A 1MREH 4ZNCD 3MTRA 3IGAB 1KPVB 1A4KA 3HUJB 3B3IB 3MLPA 2CLZA 2B8OT 1TCMA 1JGDB 2QKIA 1U8PA 2FSEB 3UTTD 4H1LG 3OJDA 2ADFH 3PJSB 1FFNB 1G84A 2ZUSA 3O9WC 1HYSC 2OJEA 1TPXB 1MCPH 3AM8A 1Y0LB 1ZEAL 3V5KA 1N0XL 4P3DB 1N59B 4APQD 3QRFM 1HHHB 3MRGB 2VL5A 2DYPA 1J1PH 4UOW1 5ITFA 2BJMH 1Z2KA 1TENA 2KH2B 1CGXA 3RZCA 5MI0B 3U7WH 3PL6D 2IANA 4WDIA 5CIPA 4TTGA 2VABA 2K7QA 5D2LF 1WGOA 1YEDB 3IYLW 1BWMA 3D85B 2QHRL 4JO1H 4JJHA 1P7HL 5FYKU 4KKCD 1IL1B 1FORH 3SE9L 1VHPA 3F58L 2IANE 3TT1L 1GPOL 4EN3A 2WNGA 3L3KB 5T1LD 4G6MH 4QF1A 4NRXA 1UM5L 3UTPE 3LKRB 2ORBH 2MSPA 4RMSA 2Z91B 5C70A 4N8CL 3NCYP 1S78D 1AC6A 1CTOA 1NANI 4HQQH 5IR1B 4NO5A 3V52L 1X6NA 1DSFL 3RDTC 2BY3A 3G6AA 1IQDA 4M5ZH 4JDVA 1WCBA 4G5ZH 1EJ6A 2BHZA 3PF2A 3C5SB 2BSTB 4G80A 1WTGT 4QXTA 1TJIL 3FQTA 1C12A 1T0MB 1ACZA 3GIVB 3CJJA 4WI3A 4Y4KB 1VGEH 5DEZA 1AGCA 2IALB 3A6CL 3J8F7 3DWTA 5AWNL 1XGPA 1CR9L 2VDML 1NCBL 4V2CB 5FCSH 4QRUA 5BS0E 4ZYKA 4N9GA 2A77H 5J1AA 2ERJC 1F13A 3VXUE 2UZIH 1YY8B 4R2GC 5EZOH 1UXSA 4XX1E 4PJHE 2CXKA 1M71A 4PY8I 1H3VA 3CLEL 4OZGF 2V9RA 5F3BA 2XY1A 5HHOA 4HUVA 1X5GA 2MQ0A 1FRGH 2MTPA 5D71L 5T5FL 4RQQB 1UWXH 4BZ1L 3WV0A 5IVXE 1KLUA 4ZTOH 2Z4QB 5D9SB 1T1YA 2OL3B 1YN6A 3BDBA 1JI2A 3NCEB 4C58B 4YHKH 5HD8D 3WLBA 3P73B 3CXHJ 4NZDA 4IRSD 1LWRA 2AEIT 2JB6B 1F8TH 3PUCA 5GJSH 1ZTXL 4GG6A 5HHOE 5TF1H 1S7WB 1J0IA 4QRTB 2H1PL 3FCTB 2J6EH 5GRVK 2H26B 2Y07L 1AXSA 2DN7A 3OKKB 2DLFL 4FQQA 3ALPA 2D7MA 4PY7A 3SKNB 3FZUC 1EFXA 3DX9B 5KVFH 2VH5L 2JKXA 3F8UB 5DRZA 3T2NL 5CINH 3ARYA 2Q7YB 4H26A 4QRPD 4GG6E 1N8ZA 1TZGL 2R9HD 1NSNL 2DWEA 5FB8A 1DBKL 1RUPH 3SKMB 4MA1C 3N0PB 3FRPG 4UV7L 2V2TA 1A3LL 1V5JA 2HG5B 1JTPA 2MHAA 2MKLC 5E8NB 1HQ4A 1JPGB 2VB5A 5D7KE 4JCLA