3S8WA

D2 domain of human ifnar2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
100
structure length
77
Chain Sequence
SFEPPEFEIVGFTNHINVMVKFSLVIEEQSEGIVKKHKPEINFTYIIDKLIPNTNYCVSVYLEHVIKSPLKCTLLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein receptor
molecule keywords Interferon alpha/beta receptor 2
publication title Structural linkage between ligand discrimination and receptor activation by type I interferons.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 77
sequence length 100
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s8wA00
1KB5H 5F96L 4JG0H 4K3GA 1YJDC 4FABL 4YR6A 1NFDB 3QIUA 3FMGH 4OZHF 1XGUB 2Z9TA 4QRRB 5KVEL 2DLEA 1IAOA 1JPSL 1EHAA 1Q9LA 1WZ1L 1U8MA 4OD2A 1R24B 3QDHA 4PGDA 3RUGF 3S4SA 5EO9B 3BPLC 4PJBF 3DMMA 4MX7A 4NQDD 3S3PA 1JI2A 5GGTL 3LEYL 3BRFA 4ETQA 1DQJB 2VLRD 1HDMB 2Y72A 1OAKL 3GHBL 3RP1A 3IDJA 1MLBA 3VWKA 3IU3A 3PQYB 5KAQF 2YUVA 1ZGLM 3P0YL 2ZPKH 3MRKA 3HE6B 4NN7C 2DQGL 4O2EA 5FO8B 5KW9L 1JHKH 2VO5A 5JIPA 1WZKA 2EIZA 1MEXH 4Z7UF 2F5AL 4JPWH 5E4EC 2BK8A 3FL7A 5IHZB 4EJ1C 1NLDH 2EE9A 3O4LE 3P9MB 1I7TA 1QPXA 1YEFH 4P2OA 3PWPB 5HYFA 1KB5L 4KH2A 3PXHA 4WUKH 4JG0L 5I74C 5I1LB 4Q0XH 2J8UB 2PR4H 1LE5B 3ILQC 2VH5H 2ITCA 3TBTB 3WIFB 3JUZA 3MNZB 3KPNB 4MSWB 2BRRH 5L6YH 1X5IA 5GGVH 1MAMH 1AGCB 5E99H 1ERNA 3TFKC 2XNAB 3NN8A 3AS2A 3FZUC 4UT6H 4WFED 1QOKA 2IGFL 3AMKA 4PJ8A 3ARPA 3VGDA 5EU5A 5E9DA 1ZLUH 2PCPA 4A2LA 5TE4L 2D4DA 1YEHH 1LO3H 2ZPKL 1C8PA 5IR1B 1UEMA 4UT7H 3BISA 4RNRB 2MMXA 1MHHA 4JPWL 1DUYB 3PABA 1NMCB 5F9AC 5K9KB 1FBIH 1TVHB 4F7MA 2R1WB 5F7DA 1NLDL 2XG4A 2VUOA 1YEFL 3AXLA 4HH9A 4W4OA 2XRAH 2BNQE 5F7KC 2EZ0C 4Q0XL 2EXWC 4GO6B 4ZTOH 1MRFL 2PR4L 1DQQA 1CL7H 2EE3A 3QG7H 2PYED 1BFVH 5DRZB 2UY6A 4E41A 5CD5D 2BRRL 5CUSH 3HPLA 5DJ0A 5GGVL 3QHZH 4PIRF 4Y19B 1MAML 5E99L 3IDXH 5B21A 5CJ5A 5C8JB 5JOEA 3FFCB 2FJFA 2EIEA 5DRWB 5HYJD 4RFOH 1XH3B 5CJQH 3TA3D 1IFHH 3AB0C 1JRHL 4UT6L 4PRDB 3ALPA 3RTQD 5JQ6H 3QEQB 2HVKA 3S5LA 5IFHH 3LV3A 2AJVH 1YEJH 4Y4HD 3A67H 4ZO7A 4XZUA 1YEHL 1LO3L 5DEFA 2J4WL 1S9VB 3RVXD 3VD5A 3QUMB 3TYFA 2X1OA 5CSGA 5SX4I 3O3EA 4U1SB 1FBIL 2F53E 1RJLA 2HYMA 4U6VH 4KMTL 3KYNB 5JW3H 4OZFG 5KSBA 4PJGA 2BSSB 1RK0A 2UWEE 2XA8H 2XRAL 1A6PA 3VFGL 1QO3A 1YUHB 1UT9A 4ZTOL 3MJ9H 3KWWA 1M7DA 4N1CA 4GAYA 2BNUB 4M62H 4HG4K 5I1CH 4EZMA 5D1XC 1MFCH 5IFJB 2O93L 4PLJD 1BFVL 1CF8H 5LQBH 3GSWB 1H15A 3QHZL 3B83A 3JV6B 3MRPB 1UEYA 1RAMA 3MXWL 1VADB 1BOYA 2VZOA 4M7LH 1FCCA 2XXCB 4YHYC 1YQ2A 1OSZA 3LDBC 4R2GC 4EUPB 5J06A 4RFOL 2I5YH 4C56D 1PQZB 1VEOA 3U9PH 4E0RB 2EH8H 4LLVA 5CJQL 5T3XE 4ZPTA 1IFHL 3WS6A 5IFHL 1I8IB 2AJVL 1L7TH 1S9XB 1G7LA 3VU2A 2IBZY 2K7QA 2HKHH 3JTTB 5FOBB 4NN6B 2FX7H 4WO4A 5E8EA 2R1XA 1I1FA 3AUVA 1FYTD 4DKFL 1HI6B 3KPOA 4FZEH 4IRJA 1QSZA 5H94B 5IVXB 1S7RA 4U6VL 1KLUB 5JW3L 3SGJC 2I9TA 4ODSH 1URLA 2Q7YB 2XA8L 4EI6B 1WFOA 5FKPA 4P4KA 4WTZA 3ZYOA 3MJ9L 3IRZA 3MYJA 3ROOA 1LWRA 4M62L 5I1CL 3MRQB 1MFCL 5F1SA 1CF8L 3FQTB 4Z78A 4JY5L 5LQBL 4Y2DD 5KZCD 4RAVA 2X4SA 2E9WA 4ZSOA 1PLGH 2YD8A 4YBQC 4M7LL 3DURB 5DQJA 1HQRB 4I3SH 2I5YL 4H5SA 1CXIA 3FO1B 4PGCB 3BVNA 2EH8L 4L4JA 4UU9A 3UTSA 3LQAH 3U0WH 3VFPB 2R2EB 4L3EE 4JRYE 1TJIH 1GGCH 4EOWH 4DGVH 5CMAA 1K6QH 2HKHL 2WV3A 3IS0X 1FN4A 5JW4M 3LEVL 1H8OA 5LXGH 3EZJB 3DX7B 2DM2A 1MLCA 1YEIH 2FX7L 2WINA 1AD9B 1MCRA 1XGRA 4LSSH 4PBXA 3UROR 1IZJA 2D03H 1SEBB 1NC2A 3JVGC 1F3DJ 4FZEL 4X4MA 3P11L 5CIPH 5I73B 2NY1D 3FN3A 3NA9H 3RWEA 5CEZD 4G8IA 4Z77A 4ODSL 3DXAD 4PRHA 2ZJSL 2NY4C 3LKOA 4WW2B 4O4YH 4ERSH 4X9HA 4IM8A 1HHGB 1OD7A 5DLMH 3T0ED 3SQOH 2BHUA 2VDKH 4LSRH 1DANT 4AG4H 4QY8A 1ED3A 3KXFE 1KNOA 4QHKJ 2CDEB 1DBAL 4CVXA 1E4XH 4HKZA 3SKNB 1S9WA 1LQSR 1A1NB 4FFZH 3FB8A 1SJVA 4I3SL 5CLTA 2OM5A 3M17A 5D2LA 3FOLB 3OAUH 2KH2B 3CFBA 4YDJB 2ZSWB 3UPCA 2YRPA 3Q2CA 1XF4A 5DS8A 1F42A 5EU6E 3U0WL 4N0CD 1QBLH 3T77A 5BV7B 3CFDA 5E2TH 4HLZG 1GGCL 4EOWL 2AJYH 3ARFC 5LXGL 4RX4A 4DZBB 2QQNH 3WE6A 1YEIL 4OIAA 1OF2B 2GJ6D 4KHTH 4LSSL 1I8MB 1MCKA 5EULV 3IDYC 1FPTH 2D03L 1AI1H 3K3QA 2JJSA 5D71H 4XX1E 3VH8A 3NA9L 4JFFB 1XGQB 4Q6IA 3I2CL 2IH1B 2VLKA 2H9GA 4P2RE 4ERSL 4O4YL 4KAQH 4UUJB 3MV8E 4LSRL 4AG4L 2R4RL 2FZ3B 4TVPD 3NIDE 4HD9A 1B2WL 4HCRA 3BN9D 3U0TB 1E4XL 4Z7WF 4PB0L 1HEZB 3CDGA 5HGDA 4TTDD 3LKPB 3EYOA 1NGPH 3PDOA 3MV7E 3DECA 4NNYB 5ESQA 4ZFFB 1QSFE 3OAUL 3SOBH 1HQ4A 2K1MA 3U2SA 5IQ7L 2VZSA 3FRPA 2UYLB 2XZQH 5F72S 4L4VD 3V52H 1PGRB 4L3CA 1QBLL 4NUGH 3BZFB 4KRPD 3MGTB 5E2TL 3K81A 4P46C 5KSAC 1BD2A 5CSZA 4LAQH 2QQNL 4UNTA 3W11C 2HT2D 4GLRI 5F1NA 4P2QE 2IALA 1QRNB 4KHTL 1J8KA 1Z9OA 3UTPD 5F6HJ 5C0GA 1D5ZB 3KYKH 1FPTL 4Q2ZA 1MOEA 2YXMA 3ARBD 3QBTB 4OZ4A 3U30B 1CDHA 2VQ1B 4NO2B 5JXED 4YHOL 5CJOH 4X6FB 4KAQL 3JWOH 1R3JB 2VAAA 3BQUD 1S9YA 1T89C 5BVPH 3ARDB 1N6VA 4XCCH 3GB7A 2OR7A 2ZUUA 4MAUH 3ULVC 3LRGA 2M26A 32C2A 2CLZB 4PG9A 4XVUD 3SDXF 4M43H 2HFEA 5F6HI 3ZE2F 4Y5VA 1FLRH 1NCWH 1T20B 5GGRY 3SOBL 1Q94B 1B6DA 4WI3A 1E27B 2UVEA 4POZD 4NUGL 4YGVA 3BN3B 4I0PC 5F7YC 3MREB 2C3XA 4ZYKA 4LAQL 4JFDB 1I7RA 1ES0B 2XZAH 1QEWB 4LCYB 3OKDB 1AIFA 4KZDH 1KF9B 5B39A 3CC5B 5SV4A 5EIIA 1S7QA 1OWRM 3TIDA 1FG2B 2OL3A 4ZS7H 3ES6B 1YY8B 5CJOL 4JFHE 3QDJB 4KI5E 3JWOL 3SGEI 3EOTH 5BS0B 2YR3A 1T7VA 4N8VG 5EUOB 4V2CB 5B38G 5BVPL 2A74B 4XCCL 4MAUL 2QR0B 1KPVB 4PBWD 5FFLA 4KK8D 2QQLH 2Z8WC 3O6LH 2O5ZL 3IF1A 4M43L 2QHRL 3LN4B 3C8DA 1IM9A 4C58B 3SN6N 1FLRL 4ZQKA 4JDTH 3UTQA 1JPFA 3VD9A 3UXFA 1IAKA 2OXHA 4TUJA 4G8EB 5EC2A 5JHDE 3SO3C 3IAPA 2IAMB 1TLKA 5ANMA 4M48L 3T3PE 1I9RH 1CDIA 2VXQH 2XZAL 2FX8H 5IFAH 4LARL 5LAXB 4U1NA 5EFIB 3SDAD 3QHFL 4KZDL 2GITA 1MNUH 4YFLI 1FYHB 3Q0HA 3K74B 5D7SH 4M4RA 1CXLA 1TETH 4UDTA 1F6AA 4ZS7L 3B43A 1X6LA 1CXFA 4ZUVA 4NPYA 5HPOA 2C5DC 4FQLH 3HFML 4P9HC 4X6CE 1DZBA 4Z7VF 5J56B 4P0DA 3O45A 2QQLL 1VFAA 3O4LB 3VXNB 3O6LL 1I3VA 1HSBB 3CK0H 5SWSB 4KKLD 1V3MA 1I85A 4ZAKC 3WIHH 5ERWB 4JDTL 3H3PH 4NFDA 3WO4C 2V9RA 3BP5B 4JO2L 1PD6A 1MI5A 5D7LA 1LGVA 5AZ2H 3L3IB 2JK5B 4F9LA 3BDXA 4BSVA 4AJ0A 5FXCH 3E1F1 4W4NA 5D7IF 4QF1B 1I9RL 2OK0H 2NY5C 2VXQL 1P4LB 1SJHB 3CZFB 2FX8L 5IFAL 2EXYC 5FGRA 4PJEE 4AQ1B 1JJUA 1J11A 1FORH 1MNUL 1QD0A 3S3JA 4YXKL 3MC0A 3EDDA 2XTJB 2X1XR 1TETL 5DHXB 3FQNB 3SJVB 5SWZD 1JYWA 1AHWB 1N0XH 4PGEA 2EDTA 4U1MB 3V95A 3SDYH 5EU4B 1RVFH 3LY6A 2OTUA 1GZPA 2VL4A 4FQLL 5CINL 5FYKE 2XWJA 3H8NA 4QOKA 4JLRA 5HY9A 5GZND 3ET9F 3CK0L 4DAGH 3VWJC 3QIBB 1MQKH 1WBXA 2BNQB 2IANB 2JJTC 4KROC 4O02H 2IQAA 4PRAA 3WIHL 5DJ6A 3H3PL 4LCCB 3HUJF 3BEVA 4R7NB 1GZQA 4CDHA 5EPMB 2A6JB 1FNFA 1IEAA 1II4E 4ZUUB 3VFWB 3HPJB 4H1LG 5DHYB 2BVOB 2V6HA 5I15L 1J12A 4LGPB 2VISA 1I7UA 4RFNC 2R0KH 1V7ML 5C08A 3TPUB 2OK0L 4M03A 2CRMA 4HHAA 3TH2T 3ALWA 2AXHA 1KEMH 2Q8BH 5BW7C 3DUSB 4Q9QH 2F54E 3KLSA 1FORL 1YN6A 4NQCA 3O41A 4HFUL 5IROA 4G43B 5I8KH 5TQ0H 5E5MA 4Y16C 5ETUA 3DETC 3PIQB 4D0BA 5FB8A 3SDYL 1RVFL 3HZYA 3CU1A 1B9ZA 3QH3B 4I77H 1GOGA 2OP4H 4WWKD 3LKSB 5JORA 2FLRT 3C09B 2F53B 1VERA 7CGTA 4IIQC 4G6AC 5DHVB 1G7QB 4DAGL 1ZTXL 4HWZA 4JGMA 2UWEB 1MQKL 2CJUH 1BGXH 1JMZA 2H1PH 1PX3A 2NY2C 4QRPE 3W9DA 3ULVE 3RVWC 4GRLD 1WIPA 3BH8B 3L7EB 4NUJB 3T1FB 2E7LA 4J3OC 4ELME 3W82A 3VFRB 15C8H 3E0GA 5FOJA 2ZUQC 5IIEB 4WENB 2R0KL 3SDDC 2WZPD 1EFXB 1FC2D 5BOZG 3QUZD 4UDUB 1KEML 2Q8BL 4LCIL 4Q9QL 3FQRA 2YRLA 1WICA 3E2HC 3GIZH 2A6DB 4NDMA 4XXCA 2H45A 5HI4C 3RVVD 1Q9OA 2E5EA 3ARED 4BZ1H 2DLFH 1MFAH 4ZFZA 5I8KL 4FXLA 1IL1A 4S1SH 4JDZB 1MHCB 1RK1B 4OFVA 3S8WA 1DEEA 1QLRA 4I77L 2OP4L 1RULH 1EO5A 3RGVC 3F7YB 1JZ4A 5AD0B 1DN0B 1NFDA 2P48B 3CGTA 5DK0B 3MBEB 5C1MB 2YPLB 1XGUA 2CJUL 4QRRA 1BGXL 1EPFA 4OGXL 2H1PL 4XCFH 4MLIA 4RBPK 4XP6L 3O81A 2XQBH 1R24A 1P84K 4NQEE 5EO9A 4MA8H 3GBLA 1MQ8A 4YHNB 5DO2D 4LNVA 1DQJA 1ZHLB 2PUQT 2IBZX 5J57B 2BJML 3PQYA 3VWKD 4XBGB 3GIZL 3HE6A 4NZRH 5I8OH 1TENA 5FO8A 2Y7QB 4L3EB 4JRYB 2DLFL 4BZ1L 1MFAL 1KTKE 2A9ML 1EHNA 3BPLB 4S1SL 3GJFK 1CLCA 4BA8A 2HJKB 4XPGH 5HD8D 3KLHC 3QXVA 3P9MA 3WXVL 1OD9A 1EEYA 1SJEB 1RULL 3PWPA 4P2OD 2DKMA 4LK4A 2J8UA 3I3BA 1AKJD 4U1KB 1W0VB 4LSTH 1LE5A 3QUXC 3TBTA 5LBSH 4KKAD 4U2YA 1BWMA 3MNZA 3KPNA 2M1KA 1BZ7B 4KGLA 4MSWA 3CSYA 1L4IA 4XCFL 2GY5A 5AG9A 3N1MC 4LASL 1JWMB 5E4EB 1AGCA 2GUOB 3TNMB 1UWXK 4JRWA 2XICA 4KJWD 5EOCJ 4MA8L 2XNAA 1YZZA 3KXFB 3OG4B 2VC2H 4LVHC 2UVFA 4PJIE 2DL2A 1HYSC 1AE6L 3KG5A 4L9LC 4JVPA 3B2VH 4PJ7E 5I74B 1CS6A 4HS3B 1ZLVK 2J7LA 2IPKB 5JLZB 4YHPB 5CGYC 2HT4C 2AXFA 2XA3A 2APVA 2YD7A 3WHXB 4DEPB 5I8OL 5IR1A 3TO4D 1YEKH 3DI2B 3ZSTA 4RNRA 1N2RB 5IW6B 3VGAB 1HH9B 1DUYA 1DDHB 1TVHA 5CKAA 1RJZB 3MRDB 2R1WA 4XPGL 4BUGA 5IVNA 4G8FB 4ALAH 5IMLB 3C6LA 5KANI 1ZV5A 4LIQH 1NGWA 2AV1B 4LSTL 2BHZA 3CFKB 3A6BH 3F62A 5LBSL 4C83A 2FD6H 2VDNH 2QSQA 4NJAH 5DRZA 4P2RB 5D1ZB 1JF1B 4Y19A 5EO0B 1HKLH 3MV8B 2IFFL 2CUHA 5C8JA 3FFCA 3WJJA 3LRHA 5DRWA 2VC2L 3LB6C 1XH3A 5C09E 1XF3B 3B2VL 2ADJA 4PRDA 4JG1H 2DAVA 1KGCD 2CIIB 5BZDB 4L1HA 1QSFB 2C26A 2DQJL 2V5TA 1HHIB 1IC1A 1C7SA 4J3UA 3UMTA 1A21A 4I48B 4RWYH 1S9VA 4UT9L 4YDIH 1YEKL 1XAUA 3QUMA 4GBXD 4EN3C 1CCZA 3NIFF 3CXHK 2CUMA 2PO6D 3QWQB 3S88H 1R0AL 3EOBB 2Q7NA 4XMKH 5GGSY 3AB0B 2VN4A 3KYNA 4P2QB 3X11B 1OP5H 3TO2B 3UC0H 3SKJH 1D5IH 1YUHA 3P73B 1G0YR 3O3UN 4LIQL 1ZLSL 4QGTA 1T7ZA 3DX8B 5IFJA 2BNUA 4G9FE 3A6BL 2FD6L 1H8SA 5GRJH 5J13C 1D6EB 1U42A 4M7KL 4NJAL 3VW3L 1BHGA 2BDNH 3GSWA 2RCSH 3JV6A 3MRPA 1AXSA 3KJ6H 1HKLL 1VADA 2W07A 1ZHKB 1VCAA 3BIKB 4KK5C 4XNMB 1GCFA 3EOAB 4EUPA 4E0RA 1PQZA 4UILH 4WDIB 3PP3K 5MEPB 2F8XC 4JG1L 4PJFA 3E6HB 4J6RL 5D1XB 3QXTA 3FAXA 1I8IA 1P7QB 5F3BB 1S9XA 3JTTA 5L0QB 4PJGF 4WVRA 3EOYG 4OFYD 4YDIL 5IV2B 4WO4D 4WRLA 5FUCE 1U3HD 1JZ3A 2CPCA 4YHYB 3HAEG 4OF8A 4WJ5B 3LDBB 4R2GB 1HI6A 1Y6KR 2NXZD 5C7XH 3S88L 3EYUH 5H94A 5IVXA 5ICYB 4XMKL 1KLUA 4JKPH 3QDMB 3UC0L 2Q7YA 3SKJL 4EI6A 2DQUH 1D5IL 2HTLD 1KENH 4IMKC 4P4KD 5FO9B 1MCNA 1SBSL 3O11B 5F9WC 4LSUH 5GRJL 4HT1L 1CVRA 3EYQC 3ARZA 2ZUSA 2QKIB 2BDNL 2Y5TB 1F4HA 1J0ZA 3PWVB 3KJ6L 3DURA 2ARJB 1HQRA 4UILL 2MHAB 4PGCA 2X89A 3U48A 3VFPA 2R2EA 1OP9A 2YKLL 4K23H 5GRVL 3WD5H 2VLJE 3DX7A 4ZFOL 1AD9A 4OKDA 4KDTA 3WKNA 4HIJB 1B88A 2J88L 3H9SE 1SEBA 2FJHB 5C7XL 3EYUL 3WFZA 3OKKA 1E4WH 5KTEH 4JKPL 2FWOB 2NR6D 2DQUL 4OLWH 4U1IA 5L88H 1FGVH 4MVBC 1KENL 4WW2A 4AIZB 1GGIH 1HHGA 1GIGH 3PXJA 2PETA 5INDB 4HUXB 3W39B 4NN5C 1GSMA 5DQ9B 1LEKB 5HGAB 3RVTD 2CDEA 4AIXA 1A4KB 4YBLC 3HLAA 3SKNA 4CKVX 2IQ9L 1SY6L 5IUSA 1A1NA 4GW1B 5LVEA 12E8H 3F6IA 4QXTB 5DQDL 3FOLA 3PWNB 4NZJA 2NY4B 4YDJA 2MPAH 3G6AB 1ZKAA 3QQ9D 5MP6H 3TWCH 3SDCC 4EVNB 4OGAD 4GUPB 1I1YB 3RJDA 3GI9L 4MB3A 3U0PB 1JHLH 1LP9E 4X7CC 3WD5L 3QIWC 4RX4D 4ZUWB 5DJDA 1FNSH 1OF2A 5BRZB 1NCBL 2V5YA 5A2FA 5E5RB 4AEHL 1I8MA 1FV1B 2XT1B 1EX0A 2BNRE 5E0QA 2H32H 3P40A 1U8PB 1YY9C 1E4WL 1FAKT 2OZ4L 1B4RA 4JFFA 1XGQA 3MRBB 3KYAA 2Q3ZA 4FTVE 4OLWL 2XN9E 5L88L 2IH1A 1CLOH 2VSCA 4NC1C 1GGIL 2R39A 3ARFB 4U31A 1GIGL 4UUJA 1NKRA 4GKSB 5HXMA 2BCKA 1JUFB 4NBYB 2JJUA 3BMWA 3ETBF 4AY0A 2FZ3A 3IDYB 3U0TA 2DIBA 1HEZA 2MNUA 2VUYA 1I75A 3LKPA 4WFFE 4ZOAA 1HSAA 4P23D 4NNYA 12E8L 4ZFFA 1WV7T 1FRGH 3HHRB 2YRZA 5FKAB 2MPAL 5MP6L 2UYLA 3TWCL 1KJMB 3OF6D 3MLRH 4YK4C 4Z7QE 3BZFA 1X5JA 3MGTA 2JIXD 2D31B 1JHLL 1AD0B 5L7XH 3MRIB 3QXWA 1G6VK 4ZNEE 2CO7B 4XBEL 5EU6D 1WFUA 4J3WA 4HH8A 1QRNA 1OB1B 3CUPB 1CTOA 3MUY1 1D5ZA 2FB4H 4TYUA 1WC7B 4ELKA 2HFGH 5CLWA 4D9RE 2B2XH 4NO2A 2F54B 4HKJA 4LSDA 4X6FA 4P46B 1CLOL 5KSAB 1FVDB 1R3JA 3MLUH 1L6ZA 3ARDA 3S7GA 1CGSH 4JM2D 4P59L 3L1OH 1VFUA 2CLZA 2AP2A 4WFHD 3BO8B 4PRBB 4X6DE 4HXBH 4R6UA 2XWBB 1DJSA 1NFKA 3I75B 3ZDXE 3T4AB 1T20A 4UTAH 3PWUB 1FRGL 3HNVH 1Q94A 4JQXA 4KI1A 2E7CA 3AM8C 1BBDH 3MLRL 4R4ND 4FQIH 4C4KT 4MAYC 4QRPB 5C0BE 3MREA 5L7XL 4NOBA 1PYWB 3VDAA 2DWDA 3X17A 3DWTA 4P5KB 4JFDA 1ES0A 3Q48A 3T3MF 4LCYA 1QEWA 2EDOA 4ELMB 3OKDA 4M7ZB 3EUUA 1RPQA 4I2XE 2FB4L 2YA2A 1VPOH 4JHBA 5C0IB 1QHPA 2HFGL 1EFQA 4PJ9D 2APBA 3CC5A 2ZG3A 4QHLB 1CVSC 1FG2A 2AV7B 2B2XL 1A47A 3ES6A 2ZCLH 2YZ1A 4I0PB 3QDJA 2P24A 3MLUL 4OLXH 5BS0A 5EUOA 4Y4KB 2A74A 1CGSL 1PFCA 4ZOBA 4Q74A 3B9KD 5I1GL 1CFVH 3QQ4A 3OB0K 2H26B 3EFFB 2FIKB 3IFNH 4MZ3A 2BOBB 4PUBH 4H25B 2HJLB 4KTDH 3LN4A 1BX2B 4HXBL 1X5XA 1S7XA 3WLWD 4GRWF 1ORQB 2X70B 2NMSA 4UTAL 2J1KA 2DQCH 2N1KA 3HZMB 3VI4F 5T1MB 1F90H 3RWGA 4APQD 1DBMH 2W9EH 1KYOJ 4G8EA 4XCNB 5CCKH 1EEQA 4KKBD 2KBGA 4AIOA 2IAMA 3C87A 4H8WC 1E28B 3WNMA 4NQEB 1I3UA 1JMXA 1KACB 3LKQB 1OP3K 2VE6B 5LAXA 5K9QG 5MENA 5EFIA 5E94B 1U8JA 2Q76A 5D9SB 1A6VH 2DMKA 4TRPH 4LAJH 2AABL 2DDQH 3SO3B 2FEEI 3RX7A 5DRNB 1L7IH 4OLXL 4R8WH 2R2BB 3LRSB 4K8RC 5SX4H 4JANB 3CLFH 1MRDL 1CFVL 5MEOB 4KI5D 3QPQD 3O4LA 3VXNA 2QSVA 3IFNL 4M1GH 1HSBA 4KTDL 2DBJA 5SWSA 4GXUN 3MXVH 4ONGL 5ERWA 2DD8H 2IG2H 3QXDB 3BGMB 3BP5A 5T5FH 2G75B 1UH3A 3MNVB 1MI5D 2BY3A 4RMUA 5D7LD 3L3IA 2JK5A 4HUMB 4TUKH 4YHLH 1F90L 3NTCH 1DBML 2W9EL 5CCKL 3RNKB 5T33H 3U4BH 1A14H 4QF1A 4HEPG 1NUNB 1P4LA 1SJHA 3CZFA 4PJIB 5JHDD 4N5ED 5L9DL 1EO7A 4ZAKB 4IOIB 4LLUB 5A2KH 3WO4B 4KJQD 4TSBH 2VERN 5J1AB 1A6VL 1LDPH 1FQ9C 4TRPL 4EIZC 2UZXB 2DDQL 5GRZA 5EZJB 3FQNA 3HKFA 3SJVA 1AHWA 4NNPL 4U1MA 1L7IL 4OQTH 1LD9B 4OM0H 5EU4A 4HULB 2ICWI 3EJYC 4NC2B 3OMZA 4PV8B 3CLFL 2R56L 1OL0A 1K8IB 3K80A 4GXVH 4PTUB 1MCDA 4G3YL 1WAAF 2IANA 5FM8A 5IK3B 1JWUA 4M6ML 4FQXD 4P5TC 2DD8L 5T5FL 3NMEA 4LCCA 4LPYA 1RHFA 2A77H 4R7NA 4TUKL 5EPMA 3NTCL 2A6JA 3AFLA 5I1DB 2ARJQ 4AT6B 4ZUUA 3QDGA 2VAJA 3VFWA 5T33L 3HPJA 5DHYA 1FZMB 5BJTB 1A14L 1P4IH 4G80B 1QVOB 3TPUA 4MJIB 1CGXA 5GPRA 1JWSB 2I27N 2B5IB 3VWJB 4KROB 3DUSA 4UV7H 2AGJH 2XY2A 4HWUA 5ID0B 1LDPL 4L8BB 1U3ZA 5IEKB 4PJCB 4QEGA 2VZVA 2D9QB 4OQTL 1DSFH 3NZHH 4JZOB 2EDHA 2D0HA 3QH3A 4RFNB 5DJCB 5FHBH 3LKSA 5HVHC 1MCSA 1X4XA 1SHMA 3FQUB 4MJ4A 5I1HL 1M6OB 5DHVA 1G7QA 5J12C 2UWEA 3U46B 2CKNA 4MA1C 4RDQF 4PRIA 4Y16B 1JGEB 3NABL 3ZMRA 5HDBE 2A77L 3BH8A 4XNZC 5IMMB 3L7EA 4G9FB 4NKQB 4O00A 4NUJA 3TV3L 3T1FA 4GKOA 3U83A 4K2UL 1HNFA 4QWWC 2NY0D 2YBRB 3VFRA 2R0LH 5IIEA 4U0RC 1DVFD 2EE2A 4IIQB 1K5NB 4HIIA 1EFXA 3WLBB 4UDUA 1KUMA 3U7WH 2YD6A 1JIBA 4R96B 2RBLA 1T80A 2NY2B 2A6DA 3AAZA 3BT2L 2Y07H 4M9PA 4W81A 5TDNB 5E2WL 4KFZC 4GW4B 4LRIC 3Q5TA 2EKSB 4JDZA 5E00A 1DSFL 1BQHG 3NZHL 2ZUQB 1MHCA 1RK1A 3PV6B 4IOFC 3QCUH 3SDDB 5FHBL 5CWSB 3ZE1E 2FNBA 3F7YA 5J3HC 4XP9H 5AD0A 5TJWK 1DN0A 2BY0A 3E2HB 5DK0A 3MBEA 1MAKA 2YPLA 1VFBB 3BZDA 2WQ8A 3JSSA 1HYRC 3ZKMC 5FGCE 5GS1A 4Y4FD 3DHMA 1JYNA 3VE0B 1CZ8H 1BECA 3MACH 1YNTA 2FHBA 2ZOLB 4U1JB 5IGXH 4RFEB 3C9NB 3RIFK 4CRPA 4YHNA 2R0LL 1RZFL 4WFGD 3RGVB 4OLUH 2D3VA 1UADC 2IC2A 3ULUH 5E7FA 5A2JH 1ZHLA 3U7WL 4XVSH 2VQUA 2O5YL 2VDRL 3GNMH 4FP8L 1F2QA 4XBGA 5D8JH 3DUHA 4JPKH 4KUCF 1WCBB 2Y07L 3KS0J 4HDIB 2Y7QA 4HS8H 3INUH 4JO3H 4GAJH 4JRYA 4L3EA 5I1JH 4TPRH 3PWJB 3FT3B 1NFDF 3GI8L 2VLJB 5HTSA 3T2QA 1FH5H 1SY6A 4GLRH 3QCUL 5GS0C 1SJEA 1PG7X 1VB9A 3H9SB 1NBQA 4NCDA 4XP9L 1CI5A 1JGLH 3D69B 5DC9B 4U1KA 3MZTA 1W0VA 3E3QC 1V3LA 3FHQA 4JQVC 5DMKB 1BZ7A 2DKSA 2BX5A 5TE7L 2J8OA 3MUGB 4JFEE 4JFYA 1JWMA 4CBPA 2GUOA 3TNMA 2NQCA 4MMXC 1CZ8L 4MHHI 3MACL 2GJJA 1OAUH 2CXGA 3EGSB 5IGXL 3BFOA 3KR3H 2FIRT 3KPSD 2ADGB 2BY1A 5C2UB 3KPRE 3VD4A 2QLVB 4HS3A 1NGQL 2OJEA 5T3ZH 4OSUH 2VXTH 3QUXB 1XIWC 4I4WB 2WUBH 4XVSL 4YHPA 1BZ9B 1J88A 3GNML 4LPVA 5D8JL 3WHXA 4JPKL 3D0VB 4L8CA 2EDDA 3INUL 4JO3L 2F15A 4GAJL 3HA0A 4TPRL 1CD8A 4HJJH 2J8UF 4DUWA 1LP9B 1HH9A 2J8HA 4LVHB 1TNNA 4QT5B 1RJZA 3VCLA 3MRDA 4P9HL 4HAFA 4X6BB 1FH5L 4PGBB 1NC4B 2K9UA 2EEBA 4G8FA 2X4NB 3ZDZF 2X7LA 43CAB 5IMLA 4CW1B 3P0VH 4FA8A 4RWHA 3C6LD 5FO7B 4KVCH 5C0RH 1JGLL 2AV1A 5HHOB 3CFKA 3B5GA 4FTVB 1WZLA 1NDGA 1PEZA 4P2RA 3OAYH 1JF1A 3VXME 4CN4A 1YNKL 3NIGE 2D0GA 1A7BA 3MV8A 5E56A 4C59B 3FFCD 3PL6C 1NGYB 4PJXA 3RY6C 5HSFA 1CE1L 3KR3L 4KWUA 3EDJA 4GG6E 5I1EL 1XF3A 4J3VA 1RZKC 3T2PA 2AKRA 5GSVB 5T3ZL 5BZDA 4OSUL 2VXTL 1J05B 2WUBL 4ODWB 2QV2A 3W2DL 3U4AA 3LKRB 1R5WB 2NZ9C 1KPUA 5E2UH 5B3JF 1BIIB 3EOBA 1VSCA 3L3OB 4DTGL 3X11A 3S6CA 3D5OF 3TO2A 3P73A 3CXDH 1Z2KA 4DKDC 4KVCL 2Y36H 5C0RL 3DX8A 4MQXC 1D9KC 1Z3GH 5GISH 1NCNA 3ILPB 5H37H 3R8BB 1D6EA 5J4MA 3K7UA 1DE4B 4DFHA 4EN3B 3RWIB 1WWBX 1EAPB 4U3CA 5EZIH 1F4XH 3VFMB 1ZHKA 3BIKA 2BVPB 5D5ME 1FO0H 3EOAA 2NY6D 2BSED 2ICES 2AEPH 2W59A 3EJZC 4WDIA 5MEPA 5K9QI 4X6DB 5CSBA 3E6HA 2I25N 5D1XA 1N3NA 1P7QA 5EA0H 2W9DL 5F3BA 1TMCB 3GSXB 3HZKB 4LKCB 5JPNB 3HC0B 5C9KA 3BIAX 5ITBH 1OSPH 1X6NA 4XPAH 3GMLA 3HG1E 5C9JB 5C0BB 4WJ5A 3DSNA 1T1XB 1HN1A 2EDNA 3GMRB 3MA9H 3OTTA 1WLHA 3BH9B 2EYSB 4JGUA 2DF3A 3QDMA 4ZDHB 4I2XB 1VFOA 1JNHB 4XTRC 4KMLB 3CXDL 5JMOC 5HHVH 5ISZE 3UBXG 2Y36L 5FO9A 3KGRA 3OHXB 5F1IB 1Z3GL 5GISL 1KIUA 2X4RB 1J0IA 2QKIA 2Y5TA 3DTXA 3TZVD 4YZFE 2V2XB 1TIUA 3PWVA 5EZIL 9CGTA 1RUPH 1F4XL 3BPCB 1HZHH 3MRGB 1FO0L 3SGJA 3R0NA 3KJ4C 4LLWA 2AEPL 1A6UL 1RZJC 5CZXD 2XACC 3HI5L 2WANA 5F9WB 5T1LD 5IVXF 4K9EC 1G6RB 3JWDC 1OHQA 1LK3H 2XQYK 1LE9B 1OSPL 4HIJA 1H3VA 4OJFH 2FJHA 2NX5E 1C1EH 3BGFB 2D9CA 1EMTH 2EDJA 2FWOA 5ESVB 5GRWA 1TQBC 5DEZA 1CGUA 2WWMD 4GG8B 4WY7H 4Y1AE 2OXGA 2DJUA 4XBPB 2LVCA 3V8CA 5INDA 5IHLB 4HUXA 3W39A 3CZJA 4FS0A 5DQ9A 1LEKA 5HGAA 1A4KA 3JVGA 1NCCH 1HXMB 4G6FB 4OCWH 4ONHB 2ED7A 1CFQB 1RUPL 4GW1A 5JZ7C 1HZHL 5IBLD 2R8SH 4PJ5D 2NPLX 4M5ZH 4QXTA 2A9NH 4WHDA 4IBLT 1UWEH 1A3LH 2XTLA 3G6AA 2B4CH 2WBJD 5LCVH 4S1DD 5DD0H 3MOAH 4EVNA 4OLYH 1DP0A 1ZWIB 4GUPA 5GGQH 2I60H 3U0PA 4LEXL 2I24N 2VMFA 3B9AA 5GJSH 1LK3L 3OKMB 2AQ1A 1RJCA 3OKNB 3W0WD 4YBLB 3RNQA 2X4PB 2V9TA 4N8VB 5BRZA 5B38B 4WW2F 2FGZA 5EB9A 5CEXB 1FV1A 1N5YH 4NZUH 3WXWH 4OJFL 1C1EL 1U8PA 3VDCA 3QG6B 3VFSB 1G7IA 4Y5YC 3MRBA 3SDCB 4NBZB 4X6EB 4RMVA 4WI2A 3L95B 1CWVA 4IMLA 4GW5B 3ARFA 4WY7L 2EECA 4RBPH 4GKSA 3QO0B 1TVDA 1JUFA 3B9DA 4JFPB 4RA0C 2MCG1 5B8CB 4MCZB 1BJ1J 3VGEA 3BW9B 2AK4E 1NCCL 4KRLB 4YDLC 1U8IB 4ONOA 4M5ZL 5HHXH 3DUUB 2A9NL 4KQ3L 4DCQB 3ZYZA 3TYGH 1A3LL 5FKAA 2B4CL 2D0FA 5LCVL 1KJMA 2WM0A 2YPVH 3HRZB 3V6BR 4OLYL 2I60L 3CDCA 4KK6C 2D31A 5GJSL 3MRIA 3WYRA 2FYYB 4WTXA 4XT1C 5B4MD 3HRPA 1QRND 3CUPA 1MWAB 4NZUL 4Y2OA 3WXWL 3ELAT 1WC7A 1ZLWH 4V1DE 2HTKD 3UTTD 2Z31B 3QUYC 3VRIB 4YK4B 4JPIB 4HK3J 2F54A 3JUYA 3QNZA 4KY1L 5FYLH 4P46A 5KSAA 2Y5EA 2BNRD 4XC1H 1FVDA 3CFJA 1F11B 1CDCA 1FNAA 3MSPA 4KKNA 2E7MA 4O5LH 2ORBH 4P9MH 2GK2A 1INEL 3OKYA 2R2HB 3SHSA 5MHSD 1RUKL 3EDEA 2XN9D 3LH2H 4MXWH 1RUQH 3OJ2C 3FT2B 4XGZB 1RUML 4PRBA 1L9NA 2AK1H 3IXTB 4MB4A 3I75A 3T4AA 3HZVB 3ARGD 3PWUA 3TYGL 5BMFH 5FIEA 4LL9A 1H3UA 4WFFD 1T89A 2RHEA 4YUEH 2RAMA 4QRPA 4RMQA 4ODXB 2D7OA 1PYWA 4P5KA 5C0AE 2YHGA 2CRIA 4NP4L 3TNNB 5JMRA 2N4IA 1XCQB 5C3LD 2B20A 3S35X 1F2XK 4QHLA 2AV7A 4PYHA 3V4PH 4Z7NF 4I0PA 4MAYB 4Z18A 5FYLL 1OPGH 1HCVA 4DK3A 3ULUE 4O5LL 4D8PA 2ORBL 4P9ML 4P3WA 4JVUA 1Y0LB 1MUJB 4Y88A 3QEHB 2W0FB 3LH2L 5EOCH 4PP1D 1RUQL 2FIKA 3V6OC 2BOBA 1ZLUK 2HJLA 2XKNB 2AK1L 3P4MA 1BX2A 3SE9H 3UZVB 2ZNWA 4GMTH 1EVUA 4GOSA 1ORQA 2X70A 3G6JE 3HZMA 5BMFL 4FG6D 1P1ZA 1NH6A 3T08A 5EOTA 4XCNA 1UM5H 4N90E 5FGCB 1TNMA 4YUEL 3MRLB 5HYIA 4Y8AA 1E28A 4Q97A 4Q6YA 4NQEA 3O8XC 4YPJA 3MZGB 4JREC 4UQ2B 5B22A 4MNGA 3LKQA 2VE6A 1I9IH 4GKNA 5MEND 3U9UB 4DKEH 5EUOF 1A7OL 3RL1B 1WISA 4JJHA 2CRYA 3V4PL 5E1AB 3O9WC 5T3ZE 2R2BA 1EJ6A 1T04B 3LRSA 3OB8A 3DYMA 1WBZB 5MEOA 5D6CB 4NHUB 5EOCL 5DMIH 4G6JH 5D7IB 5CD5C 5HJ3B 3FRUB 4S0SD 3SE9L 4GMTL 2APXA 2W60B 2FBJL 2G75A 3MNVA 2I07A 3REWB 4BSJA 3D2UD 3RNKA 3TA3C 1NCTA 3RTQC 5ALBL 1JI1A 1F4YH 4XXDB 1ITCA 2YC1A 1F58H 2ESVE 2HH0L 4Y4HC 3X12B 1FAIH 1I9IL 5F9JB 4ZAKA 3KPRB 4LLUA 4P3CH 2D7MA 5I71C 1C08A 5J1AA 8CGTA 2BHYA 1OAQH 2X09A 4QTHB 5J1SC 1J8HA 1A7RL 5EZJA 1PG7W 3BKYL 1H0DB 1LD9A 5FDWB 5FK9B 4AL8L 5GS3A 4PV8A 3VFUB 4YIQB 3U1SH 1I1RA 5DMIL 1GAFL 4PLJC 3I6KB 1K8IA 4G6JL 4PTUA 3H3KA 3L5XH 1N26A 4J1UB 2LU7A 5IK3A 2DYPA 1S7VB 4E42B 1IQWL 4Y89A 2WIMA 4K3HA 1ZT4B 2HMID 2CDGB 1JFQH 5I1DA 3QNXB 5IJVB 4AT6A 4AZ8A 3VXMB 1S9KC 3QDGD 1FZMA 3UYRH 1F4YL 5BJTA 4G80A 1QVOA 4MJIA 4NGHL 1JWSA 5DFVD 3VWJA 1AP2B 1FAIL 1G9EA 2JJTA 4P5TB 4P3CL 1CFNB 1EJOH 2I9LB 5BO1H 5ID0A 4L8BA 1P9MC 2C3HA 2JTDA 3RUGE 5IEKA 4PJCA 4PJBE 4JZOA 1MH5B 2GSIB 3WN5C 2EO9A 4IRSD 1UZ6E 4M3KB 3VA6A 1NJ9B 3U1SL 4XHJC 4DFIA 5BW7A 3FQUA 3MFFA 2YMXH 4Q58C 1M6OA 1T66D 1U93B 5GRXG 2VXSH 3L5XL 4Y2DC 3VFNB 3QA3B 3U46A 4Y16A 1IM3B 1JGEA 4PRID 5IMOB 4Z7UE 4CADA 5IMMA 4G9FA 2JKXA 4N0RA 2IMMA 4YC2B 1UGNA 2YBRA 5HVHB 2J5LC 5F6IC 1I4FB 5D2NC 3UYRL 4MMZC 2L4OA 5JIHA 3LAFA 1K5NA 3LN5B 4IIQA 5D5MB 2PTVA 5JNYB 3WLBA 2MJWA 4AEFA 1K9TA 5MI0C 4R96A 4NQDE 4MA1B 4R0LC 1FL3B 1R3KA 3IFLH 1EJOL 3DIFA 4X5LA 1Q72H 1QHOA 4XNZB 1MCJA 1ADQH 5HYQB 1PZ5B 2ZCHH 1T21A 1F6FB 4GW4A 2EKSA 2UWEF 1KFAH 2EC8A 3UDWC 3WNKA 4U0RB 3PV6A 3R1GL 3MBXH 3SDDA 5CWSA 2UZIL 3UPRB 3C60A 1JE6A 1ETZB 1X7QB 1YEEH 3MLTA 1Y18B 2YMXL 4M8VA 2CMRH 4Z0XB 1IRAY 2H6PB 2YPLD 3P2TA 1FZKB 1KJ2H 2VTFA 5ISZB 2AEWA 5F7UA 3BUYB 4DKAA 3VE0A 4RMTA 4POUB 5E4IA 2ZOLA 3V6OE 5T5NG 3C9NA 1MCCA 3RGVA 1OAZL 4N0CC 5D7JB 4DGIH 3NZ8A 4HQQL 4MXQC 3L3KB 1N7MH 4HMEA 4LSQH 4OZFA 4IRZH 2W9LA 1T2JA 4U2ZA 4CJ1A 3QJFB 3IFLL 1Q72L 3MNWB 1OM3H 1WCBA 2OSLB 4HDIA 1ADQL 2NYYC 3DVNB 2ZCHL 3PWJA 2HG5B 3FT3A 4BFIB 4NO5B 2ICWB 2OR8A 2VLJA 1KFAL 1QTYT 3TVMD 3MBXL 3R0MA 3H9SA 4GT7A 1GYAA 1JYVA 3BE1H 3QQ3B 3HC3H 4J8RB 2NX5B 4MWFB 1MCBA 4LF3B 3D69A 1IT9H 4YAQB 1LDSA 5DMKA 2BOCB 5JTWA 3BN9C 4K7PY 1QFWH 1KJ2L 3MUGA 5FEBA 3WMSA 1LO0H 4TTDC 3WKMH 4Y1AB 3STLB 2FO1A 5CGTA 1EUTA 2PYEE 3EGSA 5H8DA 5CHNB 2ADGA 1JK8B 3WS3B 3HAEB 3MMEB 1KEGL 4DGIL 1YECH 4NFBA 1N7ML 1LO4L 1YMMB 4OTXH 5I0ZA 4LSQL 2AJUH 3QUXA 5FDYA 5HYJE 4NQVA 4I4WA 1TPXC 1X5AA 4IRZL 1NGXA 2RR3A 1BZ9A 5IB3B 1A9EB 4I18C 2HT2C 3MCLH 5EUKA 5HHPB 5I0DA 5GXBB 1OM3L 3D0VA 4X0KB 1G9MC 5B3NA 1BM3H 4K8RL 1LP9A 1UJ3C 1P4BH 3ARBC 3B6SB 3OAZH 3DARA 4QT5A 4K94C 4L9LA 3OKOB 4PGBA 1NC4A 1DLFH 1OVZA 5IBUG 5JXEC 4HF5H 5HGHB 5EO1B 43CAA 1XIWB 3BE1L 3BQUC 3UJTL 1FZJB 5FO7A 4D9QE 5TGBB 4WU5B 1LK2B 2E27H 1IT9L 2W1NA 5HHOA 3WFBH 2BVUA 2OCFD 4FTVA 2Q8AH 2HLFC 1QFWL 4JFQA 4XVUC 3O2VH 1LO0L 3WKML 1K8DA 1NGYA 5CP3H 4JFED 3RWHB 2F8OA 4P5MB 4POZC 2EZ0D 1ACYL 2VNCA 3RKDD 1HILB 5KOVC 4HWNA 5GSVA 4OTXL 3JV0A 2AJUL 1J05A 3QWOB 4C56E 1EIBA 3MCLL 4ODWA 1RI8A 2EDLA 1RZ7H 4ZXBB 3PL6B 2QSCL 1R5WA 1BM3L 1P4BL 3ZT7A 5L2KE 1BIIA 3PDGA 3L3OA 3RZCD 4HF5L 1TJHH 5HYSB 4V1DB 3GKWH 2E27L 4GAGH 4RMSA 4X8JB 3WFBL 3ILPA 4W6WB 4KK8C 3LSOB 2Q8AL 3OKEB 3V6FB 1DE4A 4EN3A 3O2VL 3RWIA 3D0LB 1IAII 1AFVL 4KV5F 1KXVC 3VFMA 4L29B 4YDVB 2BVPA 3IDGB 2F19H 5LWYL 3BI9X 2EDKA 1S8DB 1MAJA 2LVEA 3SEPA 4Y7MA 5E6IC 1KG0B 1UXSB 3MLZH 4ZO6A 1D9KB 3RAJH 1SVCP 3QHTC 4M9OA 4NOFA 3UZQA 3BP7B 2X42A 3HZKA 3GSXA 4LKCA 5SWQB 1AC6A 3HC0A 1RZ7L 3SDAC 5D2NE 1MCLA 5C9JA 1VHPA 2WWKO 5C0BA 2V2WB 1T1XA 2VDOL 1KCUH 4JGJA 1M7XA 3GMRA 4R2GD 3LPFA 4D94A 3L3GB 3BH9A 1BFTA 5F9DC 2EYSA 3GSNB 3L7FB 2EKJA 4UOJA 1CT8B 4ZDHA 4I2XA 3TN0B 1JNHA 1NEZG 3O2DL 4WHCA 5F1IA 3GKWL 4N9GB 4OCSH 1S7SB 1QQDB 2FEEL 3FONB 3AS1A 2X4RA 1I1CA 3X14B 1RIHH 3C5JB 5BCAA 3EYSH 4KKLC 3T0EE 2V2XA 4BUHA 4TNVK 5IMKB 5F7MC 1F8TL 1A1MB 3BPCA 3MRGA 1U8HB 2DOCA 2R15A 4TNWK 1NGZB 2IADB 5FUOH 1ND0B 3IYLW 4Z8FH 3CH8A 2XQYG 4IMKA 1E4KC 2EH7H 2FATH 1U58A 2X4QB 3MLZL 2CRZA 3RAJL 3P77B 3G6JB 1VACB 4ISVB 2IWGA 2Y25A 4OFKA 1ZK9A 1G6RA 2OYPA 2X41A 3T0VA 1LE9A 1PG7H 1YPZE 4Z7WE 4YBQD 4OD1H 3LOWA 3F12B 3DYOA 5EN2B 1ZEAH 2GJ6E 1EZVY 4LOUC 4MA3B 4HXAH 3IVKB 5ESVA 3L3HB 5DSCB 3N9GH 3EO0A 3BYTA 4OCSL 1IAIM 4WI9A 5GZNC 3HTLX 1XF5B 1RIHL 3EYSL 4OIIH 1HXMA 3F7RA 3MGAA 4ONHA 1CFQA 4ENED 4C57C 2EC9U 2V7HB 5FUOL 4MQ7B 1INQB 4LCWB 1TFHA 4NNXB 4NO3B 5GS2H 4QTIH 3RKPA 3WNOA 1MCWW 1TQBB 2EH7L 3RI5K 2FATL 2UUDH 4PS4H 5E2VL 3T3PF 1DBJH 2EYTB 1UA6H 4RISH 2R2CA 3NVQA 3DSFH 3OKMA 3OKNA 4L4VE 1WWAX 2ZUXA 1PG7L 2X4PA 4N8VA 5B38A 5CEXA 4OD1L 1QKZH 4J3TA 3D87B 3QG6A 1RZ8B 1ZEAL 1BF2A 3EKCA 2HRPL 3SDCA 4HXAL 4OFIA 4X6EA 3DX6B 3UTPE 4N0YH 5I8EB 3N9GL 3U7YH 3L95A 4WI8A 5FM5M 4GW5A 4WWKC 4PY7B 1I7ZB 3QIWA 1FNEB 3QO0A 4JFPA 1IGTB 4WV1C 4MCZA 1B0RB 3HS0B 4H26B 3DO7B 4OCLC 3BW9A 3DOSA 3V5DB 2DQFB 1U8IA 4GRLC 4Y5YB 3C6SB 3VXUD 4DCQA 4QTIL 2ZUTA 1NDMB 2BXZA 4N0UE 3H7LA 4I13B 4Q9RL 3HRZA 1KCKA 1IGFH 1UA6L 4RISL 3D39E 3KNBB 1D5MB 4UMGA 3DSFL 1F3JB 3CVHB 3O3AB 2FYYA 3I3DA 1OQOA 4KDVA 4ODHH 4LMQE 1SM3H 3STZA 1VEMA 1MWAA 3RVVC 2AXGB 2FH6A 5F7EH 2WMPA 3AREC 5IJKC 2R1YA 1QKZL 3MV9B 3QCVH 3U30C 4OD3H 4HS6B 3ARTA 1UG9A 5KG9B 4I0CC 4GAFB 3VRIA 3SDXA 4JPIA 4N0YL 3U7YL 1E6OH 1Z9LA 2Z8RA 3W11D 3R8QA 2R2HA 4G8GE 5DDHB 1GC1C 2CIKB 1SMAA 2HFFB 1LEIB 3IXTA 3A6CH 3CFIC 4MS8D 3HZVA 3QUYB 1MREH 3R06B 3MCKB 2AK4D 5CP7B 5IB5B 1WSST 4N68A 3KS0H 5DUPL 3THMH 1VFMA 1DTUA 4ZPVB 4Z7VE 2YPKB 3VXQB 1MJ7H 4JAMA 5HVWA 4CVZB 4NHCH 4ODHL 1WITA 2O5XL 1N5AB 5HHMD 3TNNA 3E8UH 1U3JA 1XCQA 3QCVL 4OD3L 4X4YB 1ZHBA 3AM8A 1KOAA 4NQDB 5HD8C 1RURH 1Z0NA 2ZP0T 1E6OL 4MAYA 4XAKD 3LZFL 5DWUH 2VLRB 3OPZH 1OLLA 3ZKND 5AAMA 1Y0LA 1HHKB 3A0OA 2W0FA 4KKAC 2DN7A 4H1LA 4E9LA 4LHUD 2XKNA 3ULVF 3FN0L 3A6CL 4G5ZH 4KJWC 5IEHA 5GZOD 4LVOC 4ELMF 2FO4A 4DGYH 1QSED 4MDIB 4N1EA 5DVMA 2MKWA 2PF6A 1IEHA 2WLZA 3WFDH 2V17H 3UYPA 4Z7OE 1MJ7L 2AQ2A 3P4NB 1MY7A 4UQ2A 4Y8DC 4F9PC 1ZVSB 3PP4H 4YE4H 3U9UA 3TO4C 5TF0A 3E8UL 3FQXB 1BJ8A 5C0AD 3M8OH 5E8OB 5I17B 3T0WA 1G9NC 4CMMB 1RURL 3JTSB 5E1AA 3LVEA 5DD1H 4NQSA 1T04A 4OM1H 4JREB 5SWZE 4M00A 1WBZA 1CFTB 4L1DA 5D6CA 4NHUA 4WEBH 1KTLB 3X3FH 3SKOB 1J0HA 5D93C 2QQKH 5D7IA 3CH1B 3H42H 3FRUA 3LQMA 5HJ3A 4G5ZL 2MQ0A 3O9WB 2C3WA 4XPBH 3SPVB 3REWA 5JHLH 4EI5D 3LS4H 4XXDA 3MUHL 2N7AA 2AERT 1OP5K 3RX8A 2D7NA 2PYEB 1BQHB 5EZOH 1U9KA 3X12A 1FC1A 4N90D 3QI9D 5F9JA 2C1OA 5FGSA 3KPRA 1W8NA 4GBXC 3V4VL 3M8OL 4U0QB 1JNNH 2PO6C 3TCLB 5I2IB 5KSUB 1CBVH 3BAEH 4QTHA 4F37K 1J8HD 3TA3B 3BPNC 2PYFB 1NAMB 4HCRH 3RTQB 1H0DA 5FK9A 1KPRB 5FDWA 3IDIB 2ZKHH 2D7QA 5DD1L 3HUJA 4AEIH 4OM1L 1AGFB 4Y4HB 4BH8B 3L3JB 3VFUA 5JPMA 3KVQA 4OT1L 4YIQA 1HWHB 4WEBL 2PXYD 3X3FL 3I6KA 5I71B 3QIBC 2QQKL 4EDWH 5T3ZD 3H42L 4K7PX 2OS7A 4J1UA 5E8NB 1TDQA 1MIML 4QYOB 4LHQB 1UC6A 4QHNB 2DYPD 3GJFB 4E42A 2EDXA 5DA4A 4PJIF 4XPBL 4GRMB 1ZT4A 5CFHA 3LN9A 1PW3A 5IJVA 2NW2B 3CDFA 1IVLA 4LLYB 2IF7A 3LS4L 4RRPG 2YXFA 1MFDL 3RY5A 4A6YB 1ITBB 1D7FA 5EZOL 4MJID 2EDRA 2DM7A 1AQDB 4JRXE 4QLRA 1I9JH 1AP2A 3CDYA 4HZAA 3OR7B 5CBAA 1PKQE 4P5TA 1MVUB 1U3HC 1L6XA 1CFNA 2I9LA 2ESVD 3NA4A 1CDBA 4HUVB 2NXZC 3QWRA 4C56B 1CBVL 3AROA 1S7WB 2DJ4A 2GK0A 1I9EA 1JPGB 4HCRL 1G7PB 2ZKHL 1FGNH 1YC7A 1MH5A 2XOTA 1SEQH 5E70A 2HTLC 2GSIA 4BZ2H 1UWGH 1NJ9A 3D3VE 4HJ0D 4IJ3C 3VFNA 3HI1B 1FYTB 3QA3A 5CZKA 4XAWH 3I6LE 1IM3A 4ORZC 1JZ2A 5IMOA 4XP4H 2L0DA 4GRWH 1FVCA 1FFRA 2X4UB 3KLAB 5GHWH 3VXTB 3BESR 3WN5B 6FABL 5F96H 3BOVA 1OGAD 3LPWA 3S35H 1I4FA 2CO6B 3V5HB 4OV5B 1PAMA 5JNYA 3LN5A 5D5MA 3RZWA 3ZE0E 3I02B 5KVEH 2OR9H 4Y2DB 2OL3H 3O2DA 5KZCB 1A2YB 1LO5B 1SYSB 1FL3A 3DV6B 4Z0BL 3GMPA 2EDYA 4YWGH 4Y0GA 1FE8H 1KTDB 5HYQA 3MRNB 1PZ5A 5EORH 1I3GL 3GSRB 1P5VA 2NW3B 2LTQC 4Q9BA 3OZ9H 2J5LB 5F6IB 3LEYH 5D2NB 2NR6C 1SEQL 3V7AE 5J9PA 1OAKH 4BZ2L 3GHBH 4XNQB 1IEBB 1UWGL 1AXTH 1LEGB 3C60D 4HK0B 5MI0B 1ETZA 3HN3A 3P0YH 5HVGB 3GMOB 3WDJA 4R0LB 1Y18A 3CMOH 4NWUH 4Z0XA 2X4OB 2H6PA 3SGKC 4PRPD 4KMQA 1FZKA 2YWYA 1QFOA 4HZLB 5ISZA 3CSBA 4LRIA 4XP4L 3BUYA 1XGPB 2NY1B 5GQBA 5F8QC 2AJ3B 3NFPB 4PGZA 5DYOB 3DXAB 5GHWL 2VXVH 5M95B 3L6FB 3MJ6A 1K85A 1BQLH 3SKMB 2P8PB 3RGVD 3S35L 3L3KA 4OB5H 1TQCC 3GGWB 2OR9L 2OL3L 2HWZH 1IGML 3ARRA 1FJ1B 3QJFA 3MNWA 5FF6B 5ABDE 2OSLA 3ISWA 4YWGL 4O58H 2KUTA 1FE8L 4ZUTB 1QPPA 3DVNA 3F65A 5EORL 2HG5A 3FB7B 4BFIA 5DVKA 2ICWA 3OZ9L 2DLHA 1EUUA 4CJ0A 2IGFH 1S7TB 5C0CA 1YPZB 2ZWLT 1BJ1H 1ONQB 4M3JA 1AXTL 1AR2A 3QQ3A 4J8RA 2NX5A 5TE4H 4LF3A 2GJ6B 3CMOL 5DC4B 4NWUL 2BOCA 3O6FD 4F57L 4Y1AA 3STLA 3FTGB 1YEGH 4P23C 5C0JA 2L7JA 3BHBA 5GJTH 4PJAB 2XKSA 4UTBH 4OZGB 2VXVL 4E41E 3OV6A 1JK8A 1T22A 1BQLL 3HAEA 3MMEA 4OZIE 5IW1B 4C54A 1MRFH 4PREB 4N8CL 4K3DH 2EIBA 1XFPA 1FFOB 1YMMA 4OB5L 5FA3B 3I6GB 3AS0A 4JQVA 1QBAA 3S36X 2HWZL 5IB3A 4S10A 1A9EA 5HHPA 4MZ2A 4DEPC 5EIQA 4N8PA 1KGCE 3UBXB 1AO7B 4X0KA 4O58L 2DQTH 1BREA 3FO9B 3VGAC 5EU7E 4NKDB 3I9GL 4LVNC 3B6SA 1JRHH 1EZVX 4KRPB 5DJZB 5EO1A 1XIWA 2DTSA 1TPXB 1B4JL 1FZJA 5A16B 1R5IB 4TNVF 2HT4D 4I18B 2J4WH 4JM2C 5TGBA 4WU5A 1LK2A 3W9EB 5KSBE 1UXWA 1T1ZB 1HINL 1BFOB 5D1ZC 1U92A 1SMOA 1UJ3B 3ARBB 5F88B 1YEGL 4UIKH 1QFHA 5L8LB 4KMTH 3KHOA 5GJTL 4UTBL 1JPTL 1WUNT 3VFGH 3D85D 4I3GA 4HBCH 4J4PD 3RWHA 3ZL4H 4P5MA 1WWWX 3BQUB 1HK6A 1FSKC 2IH3A 4HUUB 4K3DL 1HILA 4FQJH 4W6XB 3U36B 1LP9F 1U41A 2FSEB 3CPLB 3QWOA 5FYJH 5D7KD 4N0UB 1RJYB 3MXWH 3J7HA 1MCHA 2DQTL 4U6HB 5EG6C 3MCG1 2DICA 3GSVB 3VG9C 3PL6A 1L0QA 2A0LD 3RY6A 1YMHB 4D9LH 4PJ9C 1I1AD 4LPWA 3LB6D 3DHJA 3BP4A 3K1DA 1RHHB 2A73B 4PY8I 2VABA 3OGCB 1BPVA 1VGKA 1SVZA 4NKOB 2X05A 3B9KC 4X8JA 1IGJB 3LSOA 4XH2A 3OKEA 3V6FA 4HWEH 4DKFH 1MPAH 3D0LA 2R29H 2X10A 1EK3A 3RI5F 4D9QD 4JCMA 4UIKL 2YD3A 1CL7I 3WLWC 4NJ9H 4LNRB 4YDVA 4PLKD 1OOAA 3IDGA 1S8DA 2MKLC 4HBCL 3ZL4L 4APQC 4LEOA 4Z7QF 3ZYJA 4ZSOE 4KKBC 1KG0A 4FQJL 2W0PA 1D9KA 1KCLA 5TFSH 1CIUA 1MELA 5TDPB 3GHEH 4DQOH 3BP7A 5L0QC 4JFOB 4JY5H 5FYJL 3NACH 1Q9WB 5SWQA 5FYLD 4TSCH 5D72H 5DJ2B 2ITDA 5KSVB 1UCTA 1OLZA 2V2WA 5EZLB 4D9LL 3ARXA 3L3GA 4XPTH 2WK2A 4JQIH 3GSNA 5E6IB 3L7FA 4R90L 3TT1H 2E7HA 3PJSB 4G9DB 5IOPA 2F58L 2JCCE 2LU4A 1HOCB 2DLGA 2ENSA 4JR9H 3QFJA 4X4ME 3LEVH 1JPST 5L2KD 4MNQB 4N9GA 1NEUA 3SDAB 1R3LB 3FONA 3KDMB 4KI5C 4HWEL 4LPXA 3X14A 5K59E 3C5JA 1MPAL 2P5WA 4X6DF 3P11H 2R29L 5IMKA 4JKWA 1KJ3L 4NJ9L 1A1MA 5DFWH 1U8HA 5HDQH 5CKGA 1NCDH 1NGZA 3LKNB 2IADA 3S37L 1ND0A 2ZJSH 1RFDH 3ME0A 4QXGH 2VXUH 2X4QA 1CGYA 5TFSL 3GHEL 3P77A 5D6DC 4DQOL 3C5ZD 3G6JA 1VACA 4ISVA 5D2LE 2B1AL 3NACL 8FABB 1DBAH 2P5EB 1T0MB 4TSCL 4QRQA 5D72L 3SE3C 4HBQA 4N5EC 5BXFB 2Q6WB 1WTGT 3NPSB 4KJQC 3VRJB 4N0FB 5BQ7A 1QLFB 1MJJB 1FDLH 3F12A 3GSOB 1CXEA 1EH9A 4XPTL 4JQIL 3GBNH 1KCSL 3R4DA 3TT1L 1U6AH 4MA3A 2DWEA 3IVKA 3BPOC 2P8MB 3L3HA 5JUEH 2PKDA 5DSCA 2X40A 2RIKA 4JR9L 5DK2B 3REVB 3PG2A 2EEDA 2BY2A 3RVUD 3SCMC 1XF5A 1JBJA 2X1PA 1IILE 3EO1B 3MV11 3MODH 4FQXC 4G6FD 1ZGLP 3I2CH 3FCTB 5SWZB 5HDQL 4WHTB 5IBTL 1NCDL 1GOFA 4HMDA 2V7HA 3UTZA 4MQ7A 5HBBA 3CU7A 1RFDL 1INQA 3QJHA 4LCWA 4NO3A 4NNXA 4QXGL 4F15B 2VRAA 2VXUL 2R4RH 4PRNB 2EYTA 3A6OA 1B2WH 2FJGA 2Z4QB 1NCAL 4PB0H 3SGDI 1KB9J 2COQA 1F3RB 1YA5A 1FDLL 1TITA 1MIEH 5IQ7H 1EBAA 2VZTA 4DN3L 3PHOB 3GBNL 1U6AL 2QBWA 3DX6A 1ZS8B 1V8HA 2HN7B 3ZZ1A 5JUEL 4I8DA 5I8EA 3ROLB 3DPBA 4PY7A 1I7ZA 3G04B 3QIWD 4W68A 1F4WH 1FNEA 5DRXB 4JHZA 4M7JL 1BP3B 1IGTA 1Q8MA 1YN7B 4XC3H 3HS0A 4H26A 3DO7A 1UQSB 1KN2H 3V5DA 2E3VA 2DQFA 5SV3A 3MODL 4KTEH 1YY9D 3BKMH 4Y5YA 3C6SA 4YHOH 5KS9E 4WFHE 2H3NB 1NDMA 3AC0A 2FHFA 2E6JA 4U7KA 4WWKB 3RWJB 2NY0C 1CFBA 5IB4B 1G84A 5F97E 3QUMH 4B53A 3FB6A 3KNBA 1DVFC 3U4EB 1C12B 4WV1B 1F3JA 3CVHA 3MOQA 2GCYA 4K94L 3K1KC 1CYGA 4GQPH 3TBSB 1JGVL 4TULH 1X5LA 2AXGA 4GRLB 1MVFA 3DLQR 1MIEL 3MV9A 4GRWE 3F7VB 4I9WD 4BFEA 4HS6A 5KG9A 3VI4E 4ZNCD 3MV01 2OTWB 4G6KH 1PKQB 1IJ9A 1U8NB 2OMNA 4F7CA 2W91A 2DKUA 1LHZA 3QUZB 3RL2B 1F4WL 1NAKL 3ZKXC 1DQTA 3VXSD 4EUPH 5DDHA 3LMJL 2ZOKB 4XC3L 3AREB 1KN2L 4OCNC 2HFFA 5JW4N 5I30L 4LDOB 1LEIA 4KTEL 1KT2B 5GGSB 4Y4FC 3LIZH 3BKML 1DBKH 3QUYA 3R06A 4Q7DA 4MXVF 3MCKA 3LEXB 4KVNL 2SEBB 5CP7A 4D3CH 5FCUL 5IB5A 3QUML 4DVRL 5I18H 3DVGB 3GO1H 1A1OB 4HFWB 4ZPVA 4YXHH 2O5ZH 3VXQA 2QHRH 4M7ZC 4CVZA 1IAOB 3FB5B 4TULL 3D39D 1N5AA 2DL9A 5ANME 5C07A 2C7UA 4WW1A 2O26U 1J7VR 1DL7H 4JVWA 4KJYB 4G6KL 4NQDA 4U4BA 5JDSB 4M48H 1ULVA 2VLRA 4Y4KC 5HYEA 1GGBH 1P5UA 3IDJB 5C0FA 1H3GA 4LARH 4M7LT 1G0DA 2DLTA 1HHKA 3LQAC 3QHFH 3MRKB 1JL8A 4O2EB 4X98A 4M6NH 1S7UB 4N1HB 5HDBF 3LIZL 1ZE3C 4RIRB 4G8GD 1DBKL 1CGVA 2HA1A 2DI8A 3BZEB 1BOGB 1GH7A 2EDFA 5EOQH 1EEZA 1VEPA 4D3CL 4P2OB 3WCYA 4EXPX 4MDIA 5EWIH 3V79C 4OCXL 4TN9A 1V3JA 1TCRB 2X2YA 3HFMH 4M6AA 5I18L 1AKJB 1MI5E 3GO1L 5D7LE 5LGJB 2DRUA 4YXHL 3O3BB 3P4NA 5F9OH 2HKFH 3V6OA 1I3RB 1ZVSA 5T1DH 3SE4C 4ZUSB 4X99A 4JO2H 1JZ8A 3PGFH 4MQTB 1BBJA 3RIAK 3FQXA 4LVOB 1RQ5A 1DL7L 2AEQH 3OAYK 4U49A 5E8OA 2PTTB 5ADOH 4I0KA 1JTPA 5I17A 4MD5B 4BFGA 1G7JB 1PX4A 3JTSA 1BIHA 4CMMA 4YHZL 2CKBB 5T1KA 4QHMB 5D96C 3O8XA 1EHXA 1GGBL 2PCPB 3BZ4B 1KLFA 2PTUA 1PBYA 2L7UA 1OW0C 1CFTA 3MRRB 3D25B 1KTLA 3TO4B 2G5RA 1S5HA 4M6NL 4YXKH 3ZT6A 1CU4H 3BIBX 3CH1A 1MHHB 4PLOB 4QOKE 3O9WA 3Q5OA 2XG5A 3PHQB 5EOQL 3VFTB 1GOHA 5EWIL 5IT2H 1QYGH 5CINH 1Z5LA 3N1QC 4K8RD 3BRDA 1IAIH 3U79A 3AY4C 3NGBC 2FLBT 1BQHA 5F9OL 2HKFL 5D93B 3EW3B 5T1DL 4OZIB 3QXUA 4B50A 3PGFL 3RDTA 5C08E 2FJFB 4DUVA 2AEQL 3TCLA 5KSUA 5I2IA 5ADOL 4BH7B 2DBLL 3MRCB 4L4TA 3TA3A 2C1PB 1WAAA 2PYFA 4NQCE 1NAMA 5CAYB 5I15H 3RTQA 1KPRA 3IDIA 2H41A 1V7MH 4U1LB 5GIRB 1AGFA 4Y4HA 4BH8A 3L3JA 5FYJE 2QADD 2NNAB 2N56A 2ZZUT 4K07A 1NLBH 5DEFB 3UX9B 4HFUH 1XGTB 4GBXB 4WU7B 1CU4L 1T5WB 1O7SA 2PO6B 5BV7L 3QO1A 1RJLB 4QHNA 3GJFA 3BPNB 4KK9D 4OLVL 4GRMA 5KSBB 3VXRD 5IT2L 3EJYD 5DXWA 3B5TA 1QYGL 3WNNA 1BVZA 1MHPH 4AH2B 1WT5C 1IAIL 1TTGA 5E6YA 3FHAA 1JGDB 4HIHB 4A6YA 3QNYA 4XWGH 5A3ID 2B5IC 2ILLA 1ZTXH 4HKBB 3QPXH 1P2CA 1AQDA 3JWOC 1IKFH 4PD4J 1TXKA 3O4OC 2VWEC 1MVUA 1A8JH 2EC9T 5DUML 3B2UD 1OSZB 3TBYA 4HUVA 1MCFA 4G42B 3MTRA 4RGNE 5JA9A 1JPGA 4YFEA 4UINH 1G7PA 2P8LB 3BWAA 4KZEH 1G7LB 1ZVHA 2N7BA 4LCIH 4XB8A 4UBDD 1NLBL 4OAWB 1U3HB 4RAUB 5E8EB 1WZMA 4FZ8H 1I1FB 3CIQA 2GTZA 3TZVC 3NIGF 1FYTA 1P9MA 2YD9A 2NXZB 3KPOB 4NO0D 4KHXL 3QB7C 5TH2B 3RQ3A 1NFDE 5CS7A 3STBA 2X4UA 1U91B 3KLAA 4GG6F 1UB6B 3BKJH 1X5ZA 4QRRE 3WN5A 1RUAL 1MHPL 4TTGA 1UKTA 3HR5A 5CZXC 5IB2A 3MYJB 4OV5A 2X9WA 4XWGL 4WUUD 4IJ3B 3I02A 3QPXL 4JN1L 4MCYB 5IBUB 1IKFL 4OGXH 4Y2DA 1PY4A 1LO5A 4PD4K 3TCXA 1SYSA 2CXKA 4WFGE 3G5ZB 4XP6H 3DV6A 1AGBB 2ZUWA 1EGJA 5DQJB 1J1OH 1KTDA 4JRXD 3G08B 3MO1A 2D7TL 2NW3A 5FUCC 5ADPL 4UINL 5D2NA 3KPTA 5K9OA 2VZ3A 1QUNA 4XNQA 2WWMC 4KZEL 1LEGA 1A7QH 4HK0A 2BJMH 1ZT1B 3GMOA 4R0LA 4FXKB 4OCMC 1G1YA 4FZ8L 4JY6B 4M1CD 2X4OA 5HI3D 4LKXA 2A9MH 3PWPE 2JCCB 4HZLA 3D3VD 1M05B 5D5MF 2J8UE 5IBLC 1XGPA 3VJ6A 2LTQB 2AJ3A 3WXVH 3NFPA 4QKXB 3UDWA 4Z77B 4IDJH 3DXAA 2AQ3A 3BKJL 2WBJC 3L6FA 5F7FA 3I6LD 3SKMA 2P8PA 2KQNA 3QIUD 3GSUB 5KOMC 2ZSVB 4FXGB 3GGWA 3KPSE 3F7QA 4OIBA 2IFGA 1IQDB 1FJ1A 4LASH 5IF0B 2BSTB 3O0RL 4X7SH 5FF6A 3HB3D 5DJAB 1J1OL 3EYVB 4ZUTA 4FQQB 3EYFB 5AAWA 2IEPA 3FB7A 1AE6H 3DMMD 3ZDYE 2C4FT 5DS8B 1IGCH 2ED8A 4WHYH 5C0CD 5JQHC 3CX5J 1HDMA 1ONQA 1OTSD 1TQCB 5J6GB 1A7QL 3QXAB 4K7FB 5AWNH 5C92A 4BQBA 2MQ3A 3VA2C 4YZFF 5IHZA 1GRWA 2C3GA 3VH8B 3FTGA 4QO1A 4EXKA 3PUCA 1NUDA 4X7TB 4PJAA 4IDJL 4OZGA 4HUKB 2H9GB 1ZLWK 5I1LA 5IW1A 3OR6B 3FFCE 3WIFA 5FA3A 1A02N 4NKIH 4P99A 1NEZB 3T4YB 5B4MC 1G9NL 2EE6A 1KLGB 3CDGB 5C2BH 4X7SL 3V8OA 2IFFH 3UBXA 1AO7A 3TP4A 3NFSL 4FNLH 4P23B 3U6RB 3PDOB 3BD5A 5C6TH 3DJ9A 1DUZB 4GMSL 4X9BA 2R0ZH 5DGQA 5D4QA 2HTKC 2MTPA 4K7PH 4PJ8D 1DCLA 1IGCL 5DJZA 2JIXB 5E9DD 4HWBA 2LE9A 5AWNL 3WFHB 1INDH 2DQJH 1R5IA 5F89B 5GS2D 4I18A 4HSQA 5EU6B 4UT9H 3UZEA 2NXYD 3W9EA 1X4ZA 2IALB 3P9WB 4YEEA 2E6QA 3IDUA 1T1ZA 1BFOA 5DI8B 5K9KA 1UJ3A 3ARBA 3LCYA 4LVNB 5GRUL 5ACLA 1R0AH 4CMHB 2BRQA 1MFNA 5DD6B 3MX0A 1UM6H 3ARGC 2VKWA 5JXEA 3L5WB 3ESUF 4M6OH 3BQUA 1ZLSH 1S9YB 3IGAB 3T0DA 4X7DC 1NANI 4JM2B 3U36A 1AJ7H 2FSEA 4KJPC 4M7KH 5DTFB 4LFHD 43C9B 3VW3H 3CPLA 5KS9B 5DA0B 4NKIL 4E41D 1W72B 4N0UA 1SJXA 1RJYA 5C2BL 2HFEB 3DO3A 4S1QH 4PJFE 4FNLL 2Y4SA 5C6TL 1YMHA 3TBWB 2R0ZL 1U8KB 4K7PL 1BQUA 1FSKB 2VWEE 1R6VA 3QEQA 5DHVH 1RHHA 2A73A 3MV7B 1IAMA 4J6RH 3S98A 3OGCA 1EHLH 3V0WH 1HHJB 1INDL 4NKOA 2Y9RT 2A6KB 4G7VH 3BDBA 5IVXE 2Z0BA 4MLSA 2CSPA 4F7EB 1IGJA 2DMCA 4PP1C 3QZWG 1FFPB 4U1SA 3VG9B 4XB7A 4KGJA 5B39B 1M4KA 2ZUYA 4PJ9B 1CR9H 5HGBB 1UM6L 4LNRA 2BSSA 3TIDB 4FG6C 4LGRB 3BWUC 1KIQB 4M6OL 1YDPB 3C8HA 1SBSH 2GQHA 4KXZI 3B9KB 1AJ7L 4HT1H 5TDPA 5I66B 1NUGA 4JFOA 3GBML 1Q9WA 4ZOCA 5DJ2A 5KSVA 4S1QL 2MWCA 1TVBB 2AJXH 3C2AH 3EDFA 5EZLA 3CFCH 4RAHA 4APQB 4ZODA 5E6IA 3VRLF 5ITFB 2YKLH 1EHLL 3PJSA 3V0WL 4G9DA 4FQCL 1HOCA 3QFJD 4G7VL 4OF5A 5FOBA 5F7LB 4I3RH 4MNQA 1KB5B 1G7MB 3SDAA 1R3LA 2EDBA 1FL5B 3KDMA 2J88H 4ORGB 3T65B 4LSVL 2P5WD 4IRJD 1AGEB 1CR9L 2HVJB 5I19H 1YJDH 3UAJD 4FFWD 3LKNA 1DBBL 4J3XA 1JV5B 4ZUVB 5LGHH 5T3XL 3ULSB 1FFQA 4NPYB 1N59B 3MRQA 1KTRL 4PJ5E 3FQTA 8FABA 1VFAB 2P5EA 1T0MA 3DV4B 2IQ9H 4GKZB 1SY6H 5BXFA 2Q6WA 4YXLH 2YN3A 2AJXL 3VRJA 4N0FA 3C2AL 1QLFA 5DQDH 1MJJA 2OJZH 1MI5B 2DI7A 3BGFC 3GSOA 3FO1A 5D7LB 3CFCL 3W0WE 3UTSD 1J18A 1E4KA 3BJ91 3N0PB 1XF1A 2H2PD 4G7YH 3GI9H 2P8MA 1NFIB 5HPMB 4PB9H 3ULUF 5DK2A 4I3RL 6CGTA 5FV2A 5JHDB 3CD4A 4JFFE 1NCBH 4AEHH 5TQ2H 3LS5L 1NC2D 3IS1X 5ELIA 5I19L 1YJDL 2OZ4H 4UNUA 3G6JF 5I16B 3S36H 5SWZA 4WHTA 4WGVB 3ZTJG 4TUOB 4PRHD 3BPOB 2HRLA 3RBGA 2HMIC 1HH6B 5LGHL 2RFXB 3MJ8B 2VR9A 1TZHB 4PRNA 2XWJB 3SCMB 5CZVH 4U6YB 3GMNB 5HYSG 2J6EA 2IQAB 4FQXB 4YXLL 5JZ7D 4X6CB 1JCKA 4CDGC 3CNKA 1CDYA 3CAFA 2OJZL 5EBGA 4R3SB 2ZSWA 2HAZA 2KZWA 1NL0H 3UO1L 3TJHC 1QRNE 4G7YL 2HN7A 4PB9L 2JJWA 4LHUG 3RWFB 1I7UB 3ROLA 4IRSC 3HNTH 4XBEH 4DZBA 4LLDB 2D4FA 3G04A 4HHAB 5B8CC 1X5GA 5BOPA 3UTTE 4BKLB 4X9GA 5TQ2L 3ZKSD 1PZUB 2FHCA 1YN7A 1T66C 3O41B 2BFVH 1UQSA 2AJZB 3RRQA 5ESAB 3S36L 2HLAB 4XI5D 4PJEB 5MHSE 2VLKD 1J9CT 3MRFB 1FNGB 4OLZH 1WCQA 4Z7NE 2H3NA 4WWKA 3JV5A 3RWJA 1F5WA 3DRTB 5IB4A 4FN0A 4PG2C 1XF2B 4P59H 5ICXB 5DJXB 5CZVL 3VDBA 1X5HA 1C12A 1WVZA 3OGOE 3U4EA 4R9HA 4WV1A 3MLXH 1WWCA 2J2ZA 3F8UB 3PDDA 4C4KO 4GRLA 2CLVB 2DM4A 3F7VA 3MV9D 1HCFX 5DUBB 4YGAB 2Z31C 1NL0L 3TM6A 2NY0B 3O6KH 4ZTPH 1KSRA 2OTWA 1PKQA 2G2RB 2YD2A 1BD2D 1DVFB 4DN4H 1KCVL 4KK6D 1NBYB 4DZ8B 2YZ8A 3HNTL 3TBVB 1JF5A 4K55A 4OF3A 4AK1A 1RIUH 2EDQA 3QDJE 2BC4B 2ZOKA 2BFVL 5IM7B 5IJKA 3AREA 5EUOE 2WBKA 1JZ6A 1QA9B 1IL1B 1KT2A 2VQ1A 4Y5XC 2DQDH 4OLZL 1A7PH 3LEXA 3OXSB 2VB5A 5I75C 1T03H 5I1GH 3ZKXB 3DVGA 3MLXL 1A1OA 5GSRB 2YA1A 4HFWA 1G7HB 4X7EC 4XPHH 3FB5A 4Y4FB 1CE6B 2VLMD 1EV2E 5C07D 4F8QA 4WNQB 1ORSB 1E27A 3QCTH 4U6XB 2W38A 3O6KL 4KJYA 4ZTPL 2Q86B 1CXKA 3HC4H 5MENE 5C0DB 5JDSA 3FN9A 1OAXH 4DN4L 3TVMC 4W70A 1UZ6F 3MRMB 5AG8A 1RIUL 3TH4T 1M71B 5JR1L 1S7UA 3VMPA 2AABH 1ZA6B 2P44B 4LP4A 4RIRA 1YY8A 2DQDL 3DROB 3BZEA 1BOGA 2WW8A 1A7PL 3HE7C 1EEYB 2C3VB 5SWSE 3OAZK 3OJDB 1T03L 1MRDH 5D1QC 2QR0A 1TCRA 1KPVA 3I3EA 5AUMB 1AKJA 2VJXA 2XYCA 5LGJA 3FMGL 3O3BA 4UAOB 2V2TB 3EZ8A 1I3RA 3CSYB 1IM9D 1WFNA 4WTWA 4XPHL 4B7LA 4ONGH 4ZUSA 4RZCB 4HX1B 5E08H 1ZANH 3QCTL 2VYRE 3UJJH 3KPSB 2PTTA 3HC4L 5DURD 4MD5A 4KC3B 1G7JA 5J1TC 3MPCA 5CIPB 3BXNB 1OAXL 2CKBA 2F9BT 1QG3A 3B4NA 5T1KD 1FP5A 4QHMA 3O8XD 2XTJE 4JE4B 2ICEB 2Y6SD 3BZ4A 5L9DH 4ZS6D 2AXFB 4F9PA 3SJVE 5K93A 2AVGA 1Z0MA 3MRRA 3RFZC 3W5NA 2H8PB 3D25A 2AI0H 3TO4A 1JHKL 1MEXL 4L9DA 4POYA 3VMOA 4K71C 4NNPH 3WV0A 3O9WD 3PHQA 3VFTA 3X13B 1UFUA 5D96B 3VXOB 2IANE 4WUKL 2R56H 3C6LB 3RKDC 1NGWB 5H37G 4HG4J 2VH5L 3DRQB 4C83B 4G3YH 1AQKH 2IPTH 3CJJA 3FAWA 1I8KB 1T2XA 4RGMC 4YHIB 5L6YL 4M6MH 5E08L 3QDGE 4OZIA 3QAZC 3O2WH 2GTWB 3K4DA 1ZANL 3FQWB 3RDTD 3M45A 4FHBD 3UJJL 2ICWJ 2GAZB 5C6WH 1KYOK 4F33B 1T0NB 4BH7A 3MRCA 3RWDB 2RGSA 4L4TD 2C1PA 3RZCC 4LIQE 2ADJB 4ZFGH 1FIGH 1NKOA 1BAFH 1RZIB 3NGBB 4U1LA 5GIRA 5FYKH 3KLDA 2NNAA 5DMYA 5KAQG 4PJ7B 2AI0L 1I8LC 1XGTA 4UT7L 2P7TB 4GBXA 4WU7A 3GFUA 1T5WA 2PO6A 5IG7B 1YC8A 1WIUA 1H5BC 2V5MA 3ALXA 2BXYA 5TE6H 1U8LB 4HPOH 4ODBD 2IBGA 1U0QA 4AH2A 4PRIE 4BK5A 3KHQA 4QOKD 1CL7L 1JGDA 4HIHA 5I1HH 3QG7L 3L3DB 1AQKL 2IPTL 3QIBA 4HKBA 2BNQA 4ODVH 5CUSL 3D6GA 4B7IA 3NABH 2W65B 1AXSB 3O2WL 3IDXL 5DFTA 3IB4A 2BVQB 3TV3H 4OBRA 2O61B 4K2UH 2NY6B 1VA9A 2NY3D 4G42A 1XR8B 2BVOA 2P1YA 4ZFGL 5JQ6L 4JZJC 3MR9B 4PJFB 5C08D 4PR5B 1FIGL 2P8LA 3BX7C 1BAFL 2XPGB 5FYKL 1YEJL 3A67L 3MLSH 5C09B 4OFYA 4NQCD 3O4OB 2VIRB 3BT2H 1H8NA 1U3HA 4OAWA 2V5RA 3D1MC 4RAUA 4U33A 4G43A 5E2WH 3BDYH 2JB6B 5FYJD 1T6WA 4R97C 3ULVH 1AGDB 3PIQA 2B39A 5TH2A 3ZTJH 5TE6L 1U91A 4HPOL 4YC2C 3KPLB 1UB6A 2YPLE 1OAYH 2F53A 1UVQB 4KDWA 4XHJD 4MCYA 4ODVL 3TZVB 4AENB 2JF1A 3G5ZA 1AGBA 3IDMB 2OX5A 5EIVA 4OBSA 3U9PL 3G08A 1RZFH 3SGDH 2LQRA 2ATKB 3EO9H 1T3FB 5T1LB 4WI6A 1L7TL 2X9XA 2O5YH 3MLSL 2VDRH 2Q87A 4FP8H 4HC1A 1ZT1A 4OF0A 2UUDK 4RGND 4JHWH 4FXKA 4JY6A 3WL9B 4QRTB 1B0GB 4NCC1 3BDYL 2JCCA 2AEIT 3GI8H 3ULVL 1M05A 3OKKB 5H2BB 4ENEC 1QFUH 1MFEH 4DK6A 4KUCD 1T7XA 1OTTD 4U1IB 1OAYL 5D7JC 2EEAA 2ZUVA 4MJ2A 3SBWC 3GSUA 3WNLA 2ZSVA 4FXGA 4YNYB 4QRRD 5TE7H 3SGKA 5C0NC 25C8H 1IQDA 5IF0A 5E5UB 3HLAB 2BSTA 3C8KB 1PLGL 5DJAA 1GJIA 4PJ5B 3EYVA 4FQQA 3N1GC 3EYFA 4LSPH 2WBJB 3Q6GH 3ARQA 5FA4B 2CK2A 3LQAL 2FCBA 3EO9L 2YD4A 1NGQH 1CGTA 4MXQD 1TJIL 3IFPB 4DGVL 5J6GA 1K6QL 3QXAA 4K7FA 5KVGH 3PQYD 4C55A 5DJDB 4XNUH 3W0WB 4JHWL 2XKUA 3HE6D 2EDEA 5CGMA 3EFDH 4QHKI 4H0HB 1J10A 2NYYD 4EIGB 1DR9A 1MCQA 2HJKA 4P9HH 1CICC 1QFUL 1MFEL 1GVIA 4X7TA 1BVLB 1AR1D 1RY7B 3K0WA 3PWPD 4IS6B 5DMJB 4MB5A 5DLML 3OR6A 3SQOL 2VDMH 2VDKL 2BCKB 1UENA 4PJXE 2DTMH 25C8L 2VITB 1NEZA 1YNKH 1YPZF 3P9LB 4O2CB 4WI7A 1KLGA 3T4YA 4FFZL 1AO7D 4P23A 1IMHC 1HSAB 3U6RA 2NY5H 1CE1H 3KXFA 4KV5E 4LSPL 1DUZA 4AEEA 3Q6GL 1RMFH 5I1EH 3OF6A 2IPKA 5JLZA 2JIXA 2AJYL 5KVGL 3WFHA 5F89A 4PJAF 4XNUL 1Y6MR 4OZGF 5EU6A 4J12A 3W2DH 3GRWA 3EFDL 3F58H 1N2RA 3QQNA 5IW6A 1AI1L 1DDHA 5DI8A 5D71L 4ELKB 3HMXA 5DD6A 1CDUA 4DTGH 3UTTB 2CQVA 4MS8C 4HKJB 3L5WA 3EHBD 1KJVB 2BNRB 2GY7B 4UOW0 5C0E