3RAJH

Crystal structure of human cd38 in complex with the fab fragment of antibody hb7
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
219
structure length
215
Chain Sequence
LVQLKQSGPSLVQPSQRLSITCTVSGFSLISYGVHWVRQSPGKGLEWLGVIWRGGSTDYNAAFMSRLSITKDNSKSQVFFKMNSLQADDTAIYFCAKTLITTGYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSASMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIENR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords ADP-ribosyl cyclase 1
publication title Engineering a novel cytosolic form of CD38 for cyclic ADP-ribose dependent signaling
rcsb
source organism Homo sapiens
total genus 34
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2011-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rajH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rajH01
1W0VA 2NNAA 4J7RA 1VERA 1S5IL 5F7EH 5I66A 5IM7B 1U95B 2J2ZA 4JJ5B 4LSTH 4JPKH 3MLTB 4QOKE 1QSVA 2E3VA 2APWA 4R9HA 1P1ZA 3F7VA 5TE4H 4AG4L 1IQDB 1CVRA 4NQEB 3BDXA 4XTRD 1LK3L 4X6EA 1A1OB 4X9HA 1U3HA 1RZFH 3WFDL 3MRNB 5C09E 3QA3A 4ODTL 2VLRD 1IAMA 4NKOA 2EXYC 4JREC 4OBSA 3SY0B 3VFVB 1FNSL 2D7PA 3ARUA 4OF5A 2DQDL 1IAIM 1Q9LA 4KKBC 1WAAE 4LU5L 4NQXA 3OKKB 3MXVH 1PZ5B 1YEJH 3MODL 2NNAB 4ZNEE 1CFBA 1TVDA 4X6CB 1F6LL 5SV3A 1D6EA 3MJGX 5EBWA 4MNQD 4AT6A 5BVPL 4WY7H 1P1ZB 2X6MA 4G80B 3CDYA 3PE9A 4PJ5B 3MOQA 1J1XL 4X6EB 4XCFL 5IW3A 4HIIB 5DRXA 1EH9A 1FN4B 5I6XC 4NKOB 3VWJC 3OJVC 2A6KA 2NTFB 3RAJH 3S9DB 1ZT1A 3LAFA 2IAND 1UKQA 1WAAF 2YXFA 2D3VA 3I6KB 5FHAL 1P84K 1KCVH 3O3EA 4LLYB 2EC9T 1M4KA 4S1SL 1NDMA 1D6EB 5I9QC 5EBWB 4ALAH 4KU1A 2L0DA 3VD4A 2AERT 2JK5A 5C7XH 5CLWA 1NKRA 5DT1H 1G0YR 2XA3A 2AJ3A 3KVQA 1A21A 3NFNA 4U1JA 5DRXB 2I24N 5KVGH 1OQXA 1CIDA 1YZZA 2OI9B 4JFYA 1DCLA 1A9BA 4P46B 1BD2E 3ABZA 2CGRL 1G0DA 1EDQA 1HYSC 1BFVH 2CMRL 4Z7NE 1KTDA 5E8PA 1CICA 3O3EB 4YXKL 1JGEA 4DEPC 1JPTL 3LZFH 1YDPA 4JQIH 4N8VA 2H2PD 1UT9A 3FFDA 1Y6MR 3JWOC 3QDMA 1G1CA 4TRPL 1CFTB 3QO0B 2PTTB 5GGVL 3DMMA 4GRWH 2Y07L 4QY8B 3S37H 2FRGP 1FH5L 2QQKH 3V0VA 4FABH 3NFNB 1CGUA 3GSVA 4JFYB 5B4MC 2F54D 1A9BB 3QRGH 4R97B 2BOBB 1XCTA 2X7LB 3WFBH 1PLGH 3L7EA 1EVUA 5E8PB 3TVMA 3HZMB 3SKUD 4Y4HD 1JRHH 1CICB 1NCDL 4X98B 2O5XH 1QP1A 1YDPB 4M5ZH 1I1FA 3H8NA 1I7ZA 4N8VB 4XPGL 5DRZB 2OZ4L 5KAQF 3FFDB 4KVCH 4PREA 4Y19D 2ADFH 5D4QA 4DGIL 1IGJB 4OIIL 4XX1E 5C0EB 3IDXL 2GT9A 3V0VB 1BFTA 3TM6A 4HZLA 2ICWI 2MFNA 2OP4L 2HFEA 3GKWH 4PJCB 1AC0A 2F54E 3PGCB 5D7JC 1WCBB 5I75C 1AQKH 4FQQA 3OKOA 4POUB 5E08L 1YEDA 4OZHA 1NMAL 3TVMB 1TPXB 1J5OH 3E2HB 1I7ZB 2IPKB 1B9ZA 2J88H 5C6TL 2F53A 3OKDB 2QSCH 4X7DC 1MPAH 4PLKC 4Y19E 5F6IB 1HOCA 1TJGH 4UAOB 2GT9B 3GHBH 4PRID 4WO4A 4HCRA 1MIMH 5BVJB 1YPZA 2HFEB 1DEEA 3LKOB 3I75A 2FCBA 4QCIA 5GISH 4BQ8A 1QO3A 1J0IA 1T3FA 2HVJA 1HHIB 3MBEB 2F9BT 3TCLB 5TQ0L 5J06A 4YLQT 4WUUD 1HZHL 1IGMH 3OB0K 4QXGL 3CLEH 2F53B 4HWNA 5TF1H 1X6NA 1NUDA 3TT3L 1I1AC 3TO2A 2AXFA 2V9RA 1FO0A 3HNVH 4QEGA 4WO4B 3VFPB 4POZD 3SE3A 5CZXC 4Y5VA 1CGTA 2YPLE 5EOCJ 4XVUD 4PJ7A 1HSBB 1ZV5A 1MFDH 1T3FB 2HVJB 4DZ8B 3K8MA 3IDGA 2AEIT 1D3CA 1RZKL 1IGFH 2NZIA 4QF1B 3KYAA 5DDHA 4EVNB 3IS1X 2AK4E 4JVPA 4NRXB 4WUUE 1MOEA 2FSEA 1GZQA 1TIUA 3IU3A 5T1MB 5DHVA 3GHEH 3T4AB 4I4WA 1MAMH 3N50A 4JM2A 1G1YA 3JWDC 3TO2B 1WGOA 1FO0B 4L4VA 4TOYL 1XGRA 4Y5VB 5JMOC 5E7BA 5D1QB 3KYMA 5FUZH 3VXUA 4XHJD 4E41D 4TYUA 1B4JH 3QAZC 5EULV 1INDH 4MJ4A 3GO1H 3Q5TA 5DLML 3C87A 3KLAA 1GZQB 5DJZB 3IU3B 2HFFB 5DJ0A 3HMXH 1L0XA 1WC7A 2EDNA 1RFDH 4XB7A 1XGUA 3DGGA 4JM2B 2W0FA 3ARRA 5FV2A 3DURA 4OCXL 2EDRA 4MB4A 2AJUL 3JVGA 5GSVB 1XGRB 1MRDH 4JFEA 2ZG1A 4Y2DD 5ALCL 4GUPA 4ZD3H 2UYLA 3QR2A 5M94B 3RWDA 3AXLA 5LCVL 1EMTL 1AFVL 4DTGH 4E41E 3ROLA 4G8FA 1UYWH 3SEPA 1D9KB 3BIKA 43CAB 4XI5C 2NY4B 3KLAB 3WS3B 2VXTH 4EKXA 4HWBH 4Y88A 2R69H 1WC7B 1XGUB 3O6FC 5I8EB 3WKNA 3ARPA 2W0FB 4JO4L 3TNNB 1N3NA 3O4OB 1IAKA 1OAKH 5FUCC 3HB3C 4ODSL 5HJ3A 3V4PL 1XIWA 1YECL 1KIRB 5CJBA 3VFNB 1BIHA 2B0SH 4TQEH 4XMKH 1QFWL 4GUPB 5GPRA 1R3HA 3MZTA 4ODVL 3ARQA 1UH4A 2PYFA 3CD4A 3I2CL 5BOZG 4MJ6B 4TTDC 4A6YA 3C5SA 1C7SA 4G8FB 4S1QH 3RVXD 3IFLL 3BIKB 4PG9A 2FEDC 2R29L 4Z7WE 1K3IA 2CLVA 5C2UB 2GITB 1QPPA 1W0YT 2P5WD 5GZND 1QSFE 2XNAA 1SM3L 4FRWA 3KLHC 4UB0H 4FQLL 2Z8WC 3BZDA 1L6XA 1N3NB 3CDFA 4MXQD 4JRXB 4KY1H 5IW6A 1E4JA 3G04A 3MGTB 1AHWC 3DYOA 1XIWB 5MERB 3SCMC 5B38G 4YUEL 3O0RH 1MJ8L 2C4XA 4M1CD 2PYFB 4RFOH 4JY5L 4APQD 5ICYA 3FAXA 1QSZA 2D7TH 3OJMB 2WQRA 1WFNA 4LK4A 4PG9B 3THML 4HS6B 4EI6A 2QHRL 4Z7WF 3DV6A 4OT1H 4E42B 2P5WE 4P2RB 4ERSL 3BH8A 4ZO6A 3HZVB 1QHOA 3RRQA 4LPYA 2X2YA 5IW6B 5JW4M 3G04B 3BKJL 1YN6A 3QIUD 2W92A 2G9HA 5GGUA 2A6IA 2P48B 3O6ML 5E5UB 4N1HB 1OD7A 1ZGLP 4K94C 1D5IH 4NRYA 1EGJL 1IJ9A 1E4WH 2ZSWB 4FQIL 1CWVA 1HEZA 4JB9H 4EI6B 1F3DJ 1FFNA 1FJ1A 2HVKA 4TPRL 4U6YB 5F97E 2ADGB 5KJRL 3SGDI 4Z8FH 5I8OL 3DYPA 4BELD 1PZUB 4AEHH 3F58L 4HD9A 1YN6B 4Z7UA 3UTTA 3TF7C 3ULVC 3HR5A 2OTWB 5IBUB 2HFGH 3TJHD 4JZNA 2H32H 3LH2L 3VH8G 3T3PE 3QQ9D 1JHKL 5IGXH 4KKCD 4LVHC 4HIJA 4U1KB 5DMYA 4N0YL 4MD4A 1HEZB 4JQVC 3GGWA 3N9GL 1FFNB 4RZCA 3D1MC 3GBMH 3QUZC 4HIEA 1N4XL 1AO7E 2XKUA 5JUEH 2DQJH 2V17L 1FNGB 3V6OE 1GC1C 2VISA 3O3DB 2DWEA 3WXVH 3VE0A 4HKJA 4Z7UB 2P5EA 2ICWJ 2AV1B 1K2DA 1WIOA 2R2BA 5FCSH 2VABA 4D0BA 2HT3D 2YN3A 3T3PF 4LLDB 3S34H 1K85A 3NIFE 3Q6GL 2IADB 4PJAE 1U8HB 3H42H 3G9VA 3Q5YA 1Z0NA 2AEQL 4WNQA 2DMKA 3KJ4C 2KL6A 3IT8D 3QEHB 3GI8L 1U93B 4MQ7A 2JJSA 3UBXA 3FB8B 4V1DD 4JFDA 3Q2CA 4TUJB 4K7PX 1MFEL 2P5EB 3EYQD 5C9JB 5DK2A 3DBXA 4LEOA 4M7ZC 4NOFA 4YGAB 3CVHA 2YRZA 3ZO0A 3MREB 3NIFF 3VXOB 2IFFL 4PJAF 4IJ3B 3C5ZC 5EU6A 1NGQL 3OB8A 3HRZA 1KLFA 1U6AL 1N7MH 3O2WL 3GMQA 1YN7A 4QRRA 1F2XK 3EOBB 4R90H 2X09A 2BXZA 4KHTL 5GRYA 4JFDB 4RIRA 4V1DE 1BZ9B 3DRQA 4F37K 1NCAL 3VG9C 4DUWA 4Z77B 1OM3L 3DBXB 1JIBA 4PJXA 4X7SL 3I85A 4S0SD 2WUBH 5FECA 1AJ7H 1BFOA 2HT4C 3FO2B 1PVHA 5FKPA 5EU6B 3RDTA 3VWKD 1OLLA 1P9MA 5HHVH 1VKXB 2JCCF 2QQNL 4EI5C 1NC2A 3GMQB 1EBPA 1YN7B 4YGVA 4NSKB 1ADQH 4RIRB 3AS2A 3HI5H 2I27N 2BNQE 3OGCB 5EZOH 2APFA 5D2LA 1PEWA 1JFQH 5BRZA 3PG2A 4NQVA 4W6WB 5GS1A 3D18A 4AM0B 5E24E 4Y5YA 5FECB 1G7PB 1MCJA 1CIUA 1BFOB 1MVUB 2WIIA 5FKPB 1FC2D 3RPIB 2VJXA 1CLOL 1UB6B 3NN8A 3OJDA 3ARFA 1MCIA 4NQCB 1FBIL 1NC2B 4M7KH 5D70L 3RX5A 2AJVH 4YGVB 5CS7A 5ACZA 3GSNA 4GOSA 4JQXA 1QFWM 5L88H 1FSKB 3CH1B 3L5JA 5D5MB 3BDBA 4DOHB 1F3JA 5F3HA 1X5LA 2C4FU 5D2LB 5HI4D 3QUXA 4H8WH 5BRZB 3EFDH 1Z2KA 2Y6SC 1CFNA 4NQVB 4J4PD 1KELH 1S9YA 3MV7E 3TZVB 1WVZA 4HH9A 2BY2A 4U6XA 4LARL 4UT9H 3OJDB 4UNUA 5DQDL 3BW9A 4GRLB 3O6KH 4ZUTA 3HR6A 3DUSA 5B3NA 3BP7B 1DTUA 3VI3E 5A2JH 4YDVA 4NC1E 4WWKB 1RIVL 3P30L 4ZMAT 3EYSL 4I1NB 3ARTA 5F3HB 1MCEA 3K2MC 4B7LA 2EEBA 3QUXB 4G9FD 1KCUH 3BP6B 2DI8A 4DAGL 4ODXB 2VDNH 3DI3B 3PWLA 1HH9A 3OBAA 4UV4L 1F45A 1YNTA 1MCSA 4RISL 5IB5A 3BDYH 4LCYB 2XKNB 4CU7A 1FE8L 2AJSH 4MA7L 4OD2B 4LFHG 3HC0A 3QWOB 4KRPB 4PGCB 5DD6A 2Q8BL 1SY6H 4DVRL 1XGPA 2MQCA 1ETZA 2FLRT 1CLZL 3AB0C 3GDBA 2ARJA 4XCCL 4XPFL 5TDOB 2JTDA 5CJ5A 4FP8L 1RULH 4G9FE 4YC2B 3LS4H 3DUHA 3T09A 2ZUYA 1JHTA 3PWLB 1HH9B 3VA6A 4JZJA 1SJHA 3OMZA 4RNRA 1K4DA 1YNTB 4MWFA 3E1F1 1EXUA 3PWPA 3L5XH 4R7NA 2DIAA 2DYPA 4EUPA 3UZQA 2FLBT 1QEWB 3HC4H 3HE7C 2ATKA 5I1CL 4LLQA 3GSOA 1FZJB 4RWYH 5F1OB 2B7DT 1ODAA 4X6FA 3UXFA 3P0GB 3R1GL 1UENA 4X0KA 2O5YH 2R4SL 1KGCD 2ARJB 3BZFB 1KCLA 5JXAH 1L0QA 2AKRA 3LKRA 2GJZA 2LVCA 1IL1A 1M71A 1OLZA 5JPNA 1LNUA 1JGDA 1F3RB 2YS4A 4QT5A 4RNRB 1K4DB 5E56A 5KVEH 4H26A 1NGZA 1EXUB 3QHTC 4MLSA 5D6CA 4R7NB 3K4DA 2DYPB 4EUPB 3RIAF 1NFDA 4I3RL 3CSBA 3OR6B 1UA6L 3GSOB 2Y25A 3PDDA 4PJBB 4X6FB 5J57B 4GRMA 3MXWL 1HQ4A 4KQ3L 4ODWA 1NGPH 4LSSH 4NDMA 4LCWA 2AKRB 5J9PB 5SWZB 3NGBB 3QEQA 1DQDL 5IW1B 3B9KD 2AEPL 2XN9E 4H26B 5C0AD 2P8PB 1FG2B 5D6CB 3JUYA 1NFDB 5FFLA 1NAMH 3WFHB 3HN3A 1RK0B 1CU4H 4OZIE 4GRMB 3U0PA 5CILH 3QDJA 3QUML 4M1GL 1KJMA 1K6QH 1A4KB 5FA4A 4NDMB 3MLRH 4QTIH 5CGYC 4LVOC 5FYLE 4LCWB 4F9LA 3C8KB 1KTLB 3HNSL 3MRHB 1XGTA 2EDTA 5IB4A 1HHGA 5C0CD 4WENB 3IF1A 3CNKA 5C0AE 4ZTPL 2J5LC 1WITA 4PJGB 4YQXL 5AAWA 2NYYD 5I1IL 3DROB 1JUFA 3EOAA 5CUSL 4OZIF 4LCIL 1RUAH 5LGKA 1DEDA 3M1BA 1FFOA 3QDJB 5T1DL 4QHKJ 1TVHA 1KJMB 4ZFZB 4WHTA 4X4YA 4BFBD 1KPVA 4R8WL 1E6OL 4FXGB 5HHOA 1NAMB 2BSTA 3GJFH 5HTSA 1ZHBA 1HHGB 3T2NH 5C0CE 3VGDA 3IF1B 2GW5A 2WW8A 1QBAA 2VLKE 2VXVL 4L3CA 4MJID 5FYLL 3VU2A 1JUFB 1KB5L 3EOAB 3KPRA 1A47A 3OJ2C 3OKMA 7CGTA 1CE1L 4PYHA 1CDJA 1FFOB 2DWDA 2IGFL 3CMOH 3SKOA 1TVHB 4WHTB 4X4YB 4L9DA 5I18H 2DOCA 1OF2B 3FCTB 4Z7VE 1R0AL 3G6JA 3VD7A 4DKFH 4P9ML 1S7WA 1KC5L 2E8YA 3QNYA 3EJZC 3MYJB 3FFCB 1UM5H 2BMKA 1B6DA 4YIQA 3RVUD 2H9GA 1YEEL 2NQCA 3RUGE 5HHMD 2OX5A 5GRUH 3DXAB 4JO2H 1W72A 2PF6A 4JN2B 5EUKA 4G3YH 2PNDA 2BY1A 4DKEL 2ZJSH 2DTML 3RY6A 3QUYA 2Z31A 4OQTH 5J6HA 5CEYA 2X89A 3H9YA 4OFDA 5FYJU 3BPCA 3BPNC 4Z7VF 4K9EC 2J6EH 4OCWH 2EZ0C 2OXGA 4DN3H 5L2KE 1RZ8B 2HMID 2EE9A 4U1IA 5C71A 2B4CH 1NANH 5T3XD 2BMKB 5DSCB 1AY1L 4GS7B 3ALXA 3PIQB 3A6BH 4S11A 2H9GB 4UDUA 2R23A 3EDEA 3MCKB 1T2QH 2FGZA 5HDOA 2VR5A 3KAAA 4CRPA 1DBBL 3UC0L 4S1RL 2FO4B 5HHME 5IG7B 5FKAA 2EKSA 1W72B 5ACMA 1IT9L 2G75A 3T65B 3C60A 4UNVA 5BXFA 1XZ0A 2YMXH 3QUYB 4JM4L 4OZ4B 1ZA6A 5CEYB 4F2MB 2V6HA 5DMKA 4HGKC 4JO1L 3O2DH 3IETB 4U1IB 4X7FC 5ENWB 4HT1H 1LGVA 4B50A 1OPGL 4FS0A 2YKLH 2OI9C 4P46C 4M5YL 3WSQL 5T3XE 3D0LB 4X7CC 4GBXB 1ZLWH 1AGFA 2R23B 3PWJB 3QDGA 5EBLA 1VENA 4WU7A 4HFUH 3I3EA 1ZXQA 1JPGA 3QXDB 1BMGA 2G75B 2E7MA 5E1AB 2DQFA 1CK0L 5FCUH 3STZB 2XWBA 1VEMA 1FVDA 5E8NA 3A0OA 4OLWH 3IRPX 1ZA6B 3TYGH 1U8OA 2VLLA 4UUJB 3TPUA 3K1DA 4PV8A 2A6DA 1NEUA 2OMBA 3K81A 2FHCA 3BAEH 1LO4L 4OD1L 1T5XA 2H41A 3SGKC 3RKPA 3B3IA 4K2UL 4WFED 3MACL 3C2AH 2EH7L 3OKEA 1LP9B 3GRWA 3BH9B 1CICC 5IEKA 2R8SH 1I8LA 1JPGB 2X40A 4YDLB 1MFAH 2Z4QA 2DQFB 2V5SA 4GMTL 4P59L 3DO3A 3S88H 1OHQA 1MNUL 4A2MA 4YHLH 3IB4A 2IAMD 4ZUVA 4LEXL 4NNYA 3MOBL 2FYYA 1U8OB 5GGQL 4WEUD 3MRFB 2Q87A 5GGTH 3TPUB 3SDCB 2A6DB 2HLFC 2AJYH 1J0ZA 1QUNA 2ZCLH 1RJLA 3B3IB 4XT1C 1XF5A 3IGAA 2VZUA 1IM3B 2UZXB 5I0ZA 3TVMC 3N1PC 1DDHB 1RU9L 1TPXC 3QQ3A 4NGHH 2G60H 3LB6D 4N9OB 3X3GH 3QFJD 3E2HC 5IBTH 3ARBB 1MFBL 2Z4QB 2P46B 3WO4B 5ANMB 1HWGB 4KZEL 4NM4L 3ARED 3H9SE 4ZUVB 1T03H 1ZSDA 4NNYB 2FYYB 4EDWH 1U9KA 4J8RA 4PRPB 5F6HI 2Q8AH 3W39A 1N59B 4J1UA 4LCUB 4BQBA 2IPUK 5TPWH 5D96C 5J4MA 3QYCA 3IGAB 4U1HA 3QQ3B 3X17A 4F7EA 2VRAA 1T04A 3QFJE 1NGWA 5DMJB 5MI0C 4RGMB 4Q9RL 4MVBC 1UACL 5ETUB 1BQHA 4S1DD 2O5ZL 2Y7QB 1Q1JH 2NX5A 5T5NF 3HAEB 3BP4A 3VXSA 4MCZA 1AIFB 4Z7QF 4EBQL 4N0FB 4OLVH 4WO4C 5AYUL 4ESKA 4BQCA 2X9XA 3QXVA 3OKNA 3T2PA 1VGKA 1J10A 4YHIB 5F89A 4ZS6C 4FFWC 4GAGL 1UJ3A 2VC2L 5F7KC 5J8OA 3E6FA 1T04B 3JV4A 5EN2A 5D7IF 1IC1A 3WHE1 4LSRL 1BQHB 2CK0L 3I9GH 4ONFH 5I1AA 5MENA 1ORQA 3WIIH 4HGWA 4MCZB 5D7KD 1LO5B 1OAYL 3BX7C 4XWOD 4BSWA 1JN6B 3SE3C 5ISZA 4Y5VC 2H2SC 3MNWA 3GIVB 1OWWA 2CKBB 1CG9B 2Q1EA 2BC4A 4U6HB 3HPLA 3V5DB 4HAFA 3JV4B 5EN2B 3CFCL 5DUPL 2VZ1A 9CGTA 5I1AB 1GGIH 2ATPA 2FBJL 2DMBA 4NNXA 1WISA 4HGWB 4JM2C 5D1ZA 4BSWB 1FVEA 2YZ8A 4LPVA 4KKLC 5DJDA 4WHYH 3I3BA 3SDDA 5BQ7A 1NMBL 2D9QB 3MTRA 2P7TB 5HBBA 1KIQA 4PS4H 3UTPD 3PQYE 2CR3A 4RMSA 3HPLB 5DZOA 3L3GB 2E7HA 3G5XB 1D9KC 2NY4C 3JTSA 4NNXB 1IGTB 3ECBA 3K3QA 2Q76B 4OLZL 1X5YA 1GGBL 4PJEE 5D1ZB 5GRXG 1WBZB 4UINH 3O4OC 5AEAA 1A0QL 2VERN 1FVEB 4PY8J 1FP5A 4XPBL 1Q72H 3AROA 1DLFL 4P3CH 5FGBC 2FR4A 4MA3B 5DFWH 4AZ8A 1CD0A 1S7VA 3SDDB 2R56L 1A6WH 1FQ9C 4WI7A 1V7ML 2NXZB 3RP1A 1KIQB 3EO1B 4ZDHB 3UTPE 3FO0L 1KPUA 2F5AH 5I1GH 4FMFA 4I77H 4F80A 1K8IB 2W9DL 2BXYA 3JTSB 5HYSA 1A02N 3ECBB 1H8OA 3TYFB 3B43A 1GGCL 5IJKC 4KPHL 4ZFGL 2DAVA 1Q0YH 1MCOH 1Z9OA 1IAIH 4GAJL 4KK5C 5F71A 1XIWC 2FR4B 1G6RA 1X5AA 5CD5C 1YEHH 3HZYA 4H20H 5GGRY 4RDQG 3PGDA 4JHAH 1FL3A 4JFOA 3HC3H 4K71B 3QIWD 2AS5M 1T1ZA 1KPUB 4O00A 1FNEA 1H8SA 3DRTB 2WANA 5IVXE 1WT5A 4XBGA 1XF2A 5FF6A 1FZMB 1I8KB 4KHXL 3WIHA 2YD7A 1G6VK 5FEBA 4M48H 3MJ9H 5JZ7C 4IOIA 4E5XB 4E9LA 1OY3B 1MLBB 1UWEH 2GAZA 3ZE2F 4O2CB 3MRBA 5IB1A 1GOGA 4MNHA 4M3JA 3U0WH 3LQAH 5I19L 3PGDB 1QYGL 1FL3B 4JFOB 1P2CB 4P9HH 4PJHA 3KPLA 1N8ZA 4O02H 4G8GB 5IVXF 5FM5M 1XF2B 5FF6B 3QPXH 1MREL 1CR9L 1NCCL 1ZA3A 2HTKC 1RZJH 3SGEI 2VUYA 4FMKA 4OLYL 5EIIB 3RNQB 3ZDZE 5DRNB 5A40E 1O7VA 1LO0L 1ACYH 1S7TB 5EC2B 4IOIB 4UTBL 3UTQA 1SJVA 5F21B 4YHML 3D3VE 3CC5A 3GNML 4PJ9B 1PG7X 4M62L 5C07D 1SVCP 1HI6A 1XCQA 4WW1A 5T3XH 3BKYH 3KPLB 3OX8A 4X6DA 1XF1A 3MFFB 1ZA3B 2I9TA 2R0WL 4X4ZA 4HUVA 3U30B 1B6UA 1PJ9A 4NNPH 3BZEA 1MHCA 4WI5A 2KUTA 2QQLL 2WUCH 5K9OB 1FL5A 3UTQB 3OXSA 2VDPH 2RCSL 4DQOL 5BV7L 1K4CA 4G6JH 1EV2E 2DJSA 3MRGB 1AI1H 3TBYA 1KV3A 5C8JA 3F12A 1XF3A 1PGRB 5E8EB 3MLUL 2QV2A 5C07E 3IDJA 1I3GH 3TA3B 1MQKL 1ZVSB 2E7CA 4I3SL 2OJEA 4YR6B 4X6DB 1REIA 5ILTL 3RVVD 2OYPA 5HYQA 2I9TB 4HUVB 3DVIA 4XPAL 3K0WA 1J8HD 4LBEB 5MEPB 1LQSR 5F8RC 3PJSA 4BZ1H 4D3CL 4JRWA 5F1NB 4X8XA 4YX2H 4FQ1L 3OXSB 5J13B 1N0LA 3TBYB 4CW1B 1YNKL 5F6HJ 3KDMA 1SJXA 3PWVB 5C8JB 3F12B 4OSUH 4YDIH 2DLGA 2G5BA 2FECI 3QG7H 5IROA 4ZOCA 4HLJA 4MCYA 1BECA 5EORH 1F4HA 1A7PL 1KN4L 2E7BA 3LEYL 3QQ4A 2IC2A 3QG6B 3QNZA 1FL6A 4L4TA 5EBGA 4F7PA 5L6YH 1R6VA 4K3DL 4NQDB 2QTEA 2Q7NA 1YJDH 1BZ7B 4IJ3C 5HYQB 2H6PB 4JGMA 3LKPB 5GRVK 1RIUH 4ZYKA 3FQTA 4KK6D 4PGZA 2CIIB 3DETD 3N1MC 3FOLB 4R7DA 3KYNB 2JJSC 3B8YA 3W0WD 4PB0L 3BI9X 1DBMH 3EJYD 3QI9A 5ADOH 4HXBL 1V3LA 1NBZA 1NCWH 4YHZH 2G5BB 5I30L 5L8KB 4U1SB 1A6UL 5E8DH 5CCKL 1J9CT 4MQSB 4MCYB 3NAAH 3U9PH 4N0UE 3ESUF 1FL6B 1A1NA 1C5CH 2Y5TB 3DX9A 3HCVB 4QRUA 5EB9A 2WINB 2MOVA 3NCFB 3H7BA 3NFPB 4W81A 4ZYKB 2WBJA 2VDOH 1GGUA 2VAAB 1HXMA 2ZPKH 1CLCA 2XZAL 1LVEA 2HKHL 1J88A 4LFHD 1FNAA 3VFOB 1NBZB 5J56B 2PYED 2Y1VA 1F4YL 2Z93A 1L9NA 3ZKNC 5GS0C 1YYML 5SWQA 4QHUA 2YR3A 2D03L 3HI6H 3PV7A 3KG5A 4KTDH 4KJQC 4JHWL 3C08L 3FQXA 4JAMA 3NIGE 5ID0B 4QRUB 2WM0A 2Z91B 3ZSSA 1P7QD 4F58H 2R0LH 1HCFX 1P9MC 4LPXA 3H7BB 1NSNH 1WWAX 3CFBB 4QRPE 3QDAA 1A8JH 2WBJB 1JF1A 3CK0H 5K9JH 1HXMB 1WZMA 4MXVE 4EEEA 2JIXB 2VXSH 4BK5A 3BJ91 1FSKC 1OSZB 1IILE 2PYEE 2K9UA 2Z93B 5HGBA 4U1GC 1HN1A 3T0EB 3TZVC 3HRPA 3UYRL 3WIFA 4MX7B 5I76B 2IQ9H 2VSCA 4AG4H 3D39A 1LK3H 3NIGF 4BK4A 4QXWA 5JW4R 4NBXB 4YHOL 3WFDH 3ARFC 3QUKB 4GRLC 3PGFL 1BLNB 1EHNA 4NO3A 2XY2A 1JF1B 3RVTC 1FNSH 3IDNB 5EG6C 4OGZA 1V8HA 5DQJA 3IVKA 5SX4I 4JQXC 4OGXL 3MODH 3ALWA 5T1LD 3DWTA 1J11A 4OUOA 2ESVD 3QUXC 3GKZA 3DX6A 1N6QH 5BVPH 4FFVC 4UBDD 5DA0B 3WIFB 3PABB 5GGRB 3RGVD 4JE4B 4HC1H 5LQBH 4XCFH 3FB7B 2V5MA 2MMXA 3V6ZA 3VGHA 1IE5A 3BMVA 3B5HA 4NO3B 4KRPC 4KI5C 5I8CA 5DQJB 4TSBL 3IVKB 2QQQA 5ESAB 2FB4L 4HV8B 3HG1D 4D94A 3OL2A 3NBNA 1A6ZA 4S1SH 3JV6B 3LPWA 2IBBA 4J6RL 3DX6B 3BZ4A 3U1SL 1WUNT 3CSYA 4K8RC 5CIPB 1GIGL 1IBGL 3VGGA 1EAJA 1G7JA 4QOKA 4O9HH 5A2IH 3HZKA 3RY5A 4G6KH 1N0XH 1N5AB 4XGZA 3G5ZB 4L8DA 4MXWL 3D69B 2EE3A 5HY9B 4F3FA 1UWGH 3SKJL 4EN3A 2CGRH 4IIQA 3AMKA 5L9DH 2CLZA 4M61B 4M6OL 5E2WL 1NGYA 2OL3A 3ARDB 3CXHK 3QWRA 4ODHH 1HIML 1BVLB 1UB5B 3QIBA 4FZEH 3ZLQC 1WAAA 2ZUQB 1JPTH 3GMLA 3TWCL 4R4NC 1RMFH 2DI9A 4ZNEA 3BZ4B 4TRPH 4JFPA 4WRLA 3C5JA 3CSYB 3S5LG 2O61B 2R0KL 2X4NA 1G7JB 4OAWA 1U8NB 3ME0A 4NP4L 4XGZB 1AXTH 4F3FB 1ZK9A 4LPCA 1FNLA 3IDIA 1F3DH 5C09B 4TVPL 2GY5A 3ES6B 4NZRH 4FQJH 1FORL 2V2XA 5IVZB 4GQPH 2ADIB 1JRHI 3FAWA 1OTTD 3GMLB 1X7QA 4XPGH 1E27A 1T6VN 2VLJD 3NGBC 2BERA 1KB9K 5EUOE 2X4NB 4MNQA 4OAWB 2J8UE 5HYFA 1ZHNA 4S0TD 3MLWL 1UQSA 3S37X 1T4KA 3UTSD 3LV3A 1P4LB 3LDBB 2EDLA 3U82B 2DQCL 3IDIB 2OZ4A 2PO6A 1UXWB 3L5IA 2W38A 4LAJH 3TBSA 1BD2A 1KJ2L 5E08H 4U1MA 2HLAB 3LHPH 4UOJA 1QR1A 1QG3A 1LEIB 2PXYD 3LS5H 5IV2B 3GB7A 2X4QB 4KV5F 3NA9L 1H3WM 1E27B 5C6TH 4AIXA 1YPZF 5K93A 5IVOA 3U6RA 2DD8L 5B21A 1GYAA 1P5UA 2R9HC 1I8IA 3NCYS 3WD5H 1TTUA 1NH6A 1T4KB 2FJHA 1RHFA 1FAIL 3UTSE 3O3BA 2FATH 1T66C 4EXPX 1FPTL 4K23L 1MWAH 4ZXBA 4FFYH 3VFMA 3UJJL 1WEJH 2PO6B 4HCRL 1CLYL 4XNMA 3VXRE 3NZHL 1BD2B 4NO5A 4CVXA 3ZZ1A 4U1MB 4QRTB 3KYOB 3RTQB 1QR1B 3E3QC 5TE6H 2XPGA 4W70A 3GB7B 4XNYL 5BZWA 2EXYD 1I4FA 3GIZL 3SQBA 5IHLB 4F9LC 2VDKH 4GXVH 4RWHA 4PJ7F 4KKBD 1Q94B 1DBAH 3VXUE 3HE6A 3FQWA 3TT3H 1WICA 3BIBX 3CFEB 2R1YA 1IKNA 2CDEB 4Y16B 1OWRM 4ZXBB 4LRNL 2Y06H 1NLBH 4R26L 3RI5K 2FGWL 1RZKH 2F54A 4AIZA 4NO5B 4CVXB 1T6WA 3BN3B 3MRKB 2BHZA 5BZWB 3VWJD 5HVHB 4B7IA 3G6DL 5GXBB 2M2DA 7FABH 5C0BE 4JFEE 4AEEA 2BSSA 5C1MB 5GJSL 1BOGA 3HE6B 1VPOL 2DM7A 2W9EH 3FQWB 4H88L 2V2WB 1QQDA 2B39A 2DBLL 1RHHB 4Y19A 2R1YB 3FT3B 4KQ4L 1X44A 4TOYH 1F2QA 4HXAL 4UDTB 3DECA 5CJQL 3S4SA 1CGWA 1I9EA 4AIZB 5CINH 1CQYA 4MAUH 1MJUL 5ERWA 4KDWA 5KSVA 4TN9A 4KUZL 2R1WA 1RSFA 1AGCA 2P8MB 3CH8A 3TBVA 5C92A 5CKAA 2PR4L 3EGSA 5H37H 5BZDA 1HYSD 1BOGB 4IMLB 4TNVK 1WZ1L 1QNZH 1L7TL 1QQDB 2WK2A 4GS7C 2XZQL 3EYFA 3O8XA 2VLME 3WNPA 3J8F7 5CKGA 1S5HB 4MJ5B 5ALCH 2ZZUT 1A2YB 4O2EA 4KKNA 2Z8SA 2A73A 2YPLA 5D93C 1AFVH 1R5WA 4WFFE 3RY6C 5EO9A 3QUYC 5H2BA 3QZWG 5ERWB 1BBDH 5KSVB 3CDGA 5F7DA 5B4MD 1NUGA 2NXYB 2AK4A 3U79A 2A83A 2GY7B 1KJVB 1PYWA 4WUUA 2MPAL 3DIFB 1J8HB 5J11B 1X4YA 1KLGA 5JXED 4JDTL 2EYRA 3EYFB 3G5VB 4GBXC 3O8XB 5HSFA 3BGMA 1NAKL 1YECH 1F4AA 3PP3H 2BRQA 2F8VA 3H9ZA 2AJXH 3RWFA 2YPLB 4J12A 1PX3A 4D9LH 4C56B 2WNGA 5EO9B 3QCTL 4DW2L 3Q1SL 2BJML 5CEZD 1AD0A 3CDGB 5F7DB 4OF3A 2R29H 4A6YL 4XAWH 4AL8H 2AK4B 5D7JD 2X44D 4ORGB 2A83B 1PYWB 3W9EB 3REWB 2OQJA 5EU4A 1DN2A 4KH2A 4X9BA 1ROWA 1MCDA 4PUBH 5EFIA 2NW2B 2IQAA 4YDLC 4M8QB 4PLKD 3RWFB 5I16A 4FXLA 2DS4A 4JY5H 4JFHD 5I8KH 4C4KT 2VXUL 1ZGLA 3LKSA 1RIHH 2K7PA 4CDHA 4E41A 1AD0B 5D7LB 4NHCL 2VITA 3P73B 3ZDYF 4NKIL 2QHRH 4JKPH 5LG1A 4XNZC 3N1GC 5D72L 5F7YC 1HSAA 3UTTE 4KGJA 4NO2A 2BVUA 3SDCC 1F02I 2F5BL 3ILPA 1JNJA 2OQJB 3BT2H 5E8OA 5E6IB 1OGAB 3L7FB 4V2BA 5HHXL 3BKJH 4PR5A 4EIGB 5EFIB 2HJKB 2LFGA 2UUDH 3B9EA 3WHXB 2Z0BA 1I8LC 3IDMA 1UM6L 2HJFB 5I16B 3WYRA 3ARBC 4QWWD 5INCA 4XP6H 4I0PA 3WO4C 2D7NA 3FN0L 1ZGLB 1LDSA 3LKSB 3UO1L 3MO1A 2FH6A 2EYTA 3NFSH 1J1OH 2VITB 5DA4A 4DZBA 2J4WL 3G5YA 3VFWA 1Q8MA 4Z7WA 2OM5A 1VB9A 1QLEL 2OJZL 4HMCA 4NO2B 5DZNA 2W59A 2YD8A 3ILPB 5F1IA 1TTFA 5KJRH 5E8OB 3VGFA 3FRUA 4WCYL 1QSFA 3IFPA 5A16A 5KS9E 4F8QA 1ES0A 3O4LD 4NC0B 2JJUA 3BPLB 1UH3A 5DF0A 3IDMB 1E4KA 1P6AB 5DJYB 4I0PB 1EHLH 2HH0L 3BKML 1CXEA 4Y4KB 3BXNA 3C6LB 3UPCA 4HIXH 3SGDH 1BM3H 3ISWA 4WUKL 2I60L 4HJGA 1B0RB 3WUWA 3G5YB 4P3DB 3V8OA 3VFWB 4BZYA 3MJ6A 4LSVH 1YEIL 1JNHA 3GSRA 5F1IB 2XICA 2P5WA 1QSFB 2V17H 5A16B 3BEWA 4NZUL 4Z76A 2X4OA 4P2QE 1PSKH 4P2OA 5CZKA 5AUMB 5ESQA 4C59B 3KHQA 4R4BA 4APQA 4NFCA 4TSAL 4CMMB 5EZLA 4HJGB 3QHZH 5GJTL 6FABL 3FO9B 5E95B 1K5NA 3WUWB 4G43B 1JNHB 3DX8A 5FO8B 3V52L 4HF5L 2XOTA 1X5XA 5HVWA 2AV7A 1GL4B 4PRBA 2C4FT 4XI5D 1UJ3C 2EO9A 2X4OB 1MFEH 3AVEA 4P2OB 3QIUA 3X3FL 3DHMA 3BE1L 2Y23A 3O6FD 5FO9A 5E9DD 3OKLA 2P24B 2EE6A 3IJHA 5C0NC 1NBYB 1C5BL 1BZQK 4F8TA 1G7QA 1T0PB 4UNTA 4NWUL 1F8TL 5ESQB 3HB3D 2GKIA 4R4BB 2IFFH 3CVHL 2NY5C 4PJIE 3F7PC 1CDYA 1U6AH 4YXLL 1KIUA 4PBWD 5CLTA 4U3XA 4KK8C 3A6CH 2X9YA 3DX8B 2YK1H 4X4XA 4PJXF 4TTDD 5JPMB 2UZIL 1SBSL 1AO7A 2FEDD 3FONA 3V6OA 1OM3H 4HWUA 1AGDA 5FO9B 2AEWA 3GJFA 4WI2A 3OKLB 4U33A 3KLHD 1CTNA 4HBQA 4OZGE 4PJ8B 2AABH 2DQEL 4PJAA 4PJIF 3SCMD 5D1ZC 4EOWL 1UCBH 2I26N 5E2JA 4PRHD 1JBJA 1FYTD 4ZFOA 3SDDC 3WDIA 2NY0B 5DUMH 5IMKB 2M26A 1K8DA 1AO7B 2NXZC 4EDXB 2I5YH 2CDGB 3P4MA 5D1XB 5H35A 1NEZG 3U46B 1AGDB 1Q38A 3OF6A 3U9UA 1S78D 3MLVL 3VFRB 2AXGB 3VDCA 4C58B 2NY3C 4PJAB 4YO0B 1IC4H 3Q48A 1A7QL 2CJUL 4R2GB 1BX2A 2D2OA 1FYTE 5DYOA 4W4NA 3QULA 1K8DB 3EYVB 4G6FB 1ORSB 4K71C 3GSNL 4V1DA 3P4MB 3MCLH 3MPCA 4LHUB 5H35B 5ADPH 4OTXL 3T77B 1F4XL 4P5KA 5I73B 2ARJQ 1S7UA 2ITDA 1HINL 1OCWL 1JTTA 2IALA 4NQTA 4YXHL 3V6BR 4AEFA 3ULVD 1KF9B 2JCCB 5DEFA 4FTVD 3OAZH 3BVNA 4F57L 4WIQA 3FJTA 1QSEB 1BEYL 1EO5A 3CFJB 3WFCH 1X5JA 5L8JB 2YWZA 2HYMA 1JCKA 1JWSB 3QUZD 2BNQA 4GAYA 4PB9H 4Q7DA 1WT5C 1TETH 4P5KB 2ZCKL 2DRUA 3G9AB 3ZE1E 3TN0B 4KJPC 3VJ6A 4Q9QL 1YMMB 3PHQB 1S7UB 5C0RH 2DQUH 2UV3A 2NW3B 3QPQC 5HD8C 2FJGA 3BN9D 2ZSVA 3X13A 3JV5A 5C3LD 3ULVE 2GTZA 3ARGA 1OOAA 4HKXB 4PJ9C 4UV7H 2HT2C 3I84A 4FTVE 1PY4A 1CBVL 1VHPA 2NLJB 3ZTJG 1F4WH 4M6NL 1ZS8A 4W68A 2IEPA 3BO8A 3V6FB 15C8L 2EIBA 2BNQB 4GAYB 3JWOH 4OLUL 5C3TA 3ZE1F 3MV7A 3RWHB 3OXRA 3WDJA 1KEGH 2BNRB 2ZNWA 1W8OA 1NCNA 4M7JL 4KUCF 4QKXB 4NO0D 4PTUB 2HP4A 3QEQE 4ZODA 4LF3A 4NJAH 2WLZA 1G9ML 4Z95L 1NCBH 3C5ZD 4IOSD 3WNLA 4YAQB 3ULUC 1RUML 1T22A 3OWEA 1OB1A 4MD0B 4MAYA 3BKCL 5DJ6A 2VMFA 3MRPA 1LK2B 4LIQE 4LL9A 1JP5A 1JWUA 1T1YB 3DJ9A 3AFLA 3MV7B 1EIBA 1RZGA 4J4PA 5GRZA 4MB5A 1T89A 3F6IA 1KPRB 4M7LH 4IEFB 3GSWA 2C1OA 5F7MC 4QHNA 1UM4L 5J13C 2AXJA 1RVFL 2XRAL 4DEPB 5CEZH 5JDSB 3ALPA 1LHZA 3KPSE 4KDTC 3VFTA 1YA5A 4LF3B 2JJVA 2HT4D 1PKQB 5GHWL 3MV9D 1NC4D 5F9OH 5B39B 4XCEB 5EO1B 1T22B 2PCPA 1OB1B 3QEGH 4MAYB 4EI5D 1JNNH 5AD0B 5DJ6B 4U31A 3MRPB 2NY7H 5DMIH 2X42A 1A7RL 3D85D 1S7XA 1INEL 4G9FA 12E8L 4FA8A 1RZGB 4BUGA 3DV4A 3MR9A 3DTXB 3CU7A 4Y1AD 1RJZB 2C1OB 3B2VL 3P77B 1VFBA 5IOPA 4TULH 5IROC 3QUMH 4BA8A 2YPKA 3MV9E 2PCPB 1H8NA 2HFTA 2BRRH 4QRQB 5DVMA 3JBG7 4XP4L 2VQ1A 4I18A 3REVB 1K9TA 1OGTB 5DWUL 5LGJA 1CGSL 3VI4E 3ZHDA 4XNUL 5AG8A 3NCJH 4PRAA 3JTTA 4CGTA 2H1PH 3DV4B 3MR9B 3BRDA 2G2RB 5T3ZL 4ZO8A 2DKSA 2Y6SD 4ENEC 4L3ED 1VFBB 1QBML 2HWZL 3MA9L 4NUGL 1YJDC 2MNUA 1H3PL 4JFQA 4FFZH 4LCIH 1U92A 4PLNC 5CJXC 2YPKB 4JFFD 2HA1A 5HGHA 5LXGL 3UJIL 3ZHKA 4PD4J 4QRSA 2VQ1B 4I18B 1NL0L 2B1AL 3UAJD 5IJVB 2WBJC 4UQ3B 3QUMB 1WQVT 3FHQA 4X99A 2IPUG 4ZSOE 2VXVH 4I0KA 1MLCB 2XN9A 5KOMC 3JWDH 4C57C 2V2TA 3G6JF 4KTEL 1U3ZA 5TDNA 4QO1A 4XWGH 2VB5A 2P1YA 2RIKA 2AI0L 5FGSA 1U92B 2IGFH 5IHZA 2VXQL 4OZIA 4PTTA 4JRYB 2GJ6B 4OB5L 4PRDA 1AXIB 1I1AB 5AG9A 1R0AH 1JYVA 3LKQA 3NPZB 5K9QG 1KC5H 4QRSB 3TNMB 3IS0X 1HHKB 1TZIA 1A7NH 3MJ8A 1KB5A 3PP4L 2APVA 4ELME 1DQLH 4JKLA 2A0LC 4YBHA 1S3KL 4XRCA 3MRJA 1A14L 4X99B 8FABA 4WWID 2OR7A 2XN9B 3B9KA 3PP3K 5C0AA 4P99A 1A3LH 4QHLA 1JV5B 3DSFH 5EWIH 1BPVA 1MF2H 4UILH 4Y5XA 4MS8C 5TH2A 2DTMH 4OZIB 3MV8B 4OBRA 5CAYB 5BS0B 1JZ4A 2FX7L 3HE7D 4HUUA 3LKQB 5SWSD 5IR1A 1QLFA 2NR6D 3QXWA 1Z3GL 1TZIB 3QH3B 1KB5B 4WW2F 1AP2B 1NANI 1MAKA 3SOBL 3CFKB 1XGQA 5C0CA 1YQVL 4RBPH 1DBBH 5HHNB 3UC0H 2DKMA 1EEYA 4LOUC 2VLKA 4QHLB 2J3SA 3MRIA 5DRWB 3PHOB 1IT9H 1XR9A 4XVTL 2APTA 1BF2A 4XPHH 2LQRA 2H3NB 5HYIA 4HUUB 5I15L 3WLWD 5SWSE 3TJEL 5KBNC 4Z7VA 2MTPA 5TFSL 2L4OA 4ZPVB 5F88B 3MJ7A 4U6TA 3P0VL 4AH2A 2WZPD 2QADD 2XTJB 3ARDC 1MFCH 4JFXB 5T5FL 1H3TA 2VLKB 5JHDD 1MELA 3MRIB 2ZUQC 1Y0LA 3RUGA 1J0HA 3A67H 3CUPB 4M4PA 2BCKA 1XR9B 2AQ3A 5SX5H 3DO7B 4R3SA 3HNTL 3GSUB 5I74B 2VN7A 4RMTA 5L2KA 2K7QA 3MJ7B 5IQ7L 3VG0H 4AH2B 4EN3C 3KXFD 2XZZA 4WVRA 4OD1H 4LLWA 3PWNA 5HYJD 1JHLL 1QA9A 4K2UH 1AQDA 2EH7H 5IWLA 5FDYA 4UU9A 5JHDE 5INDA 4N5EC 2CSPA 3GJEA 1R3JA 3QJHB 2BCKB 4E0RB 4K94H 1MNUH 1WJ3A 3LQMA 4D8PB 3H9HB 4YE4H 1KFAL 5FYKL 1MI5B 3LDBC 5L2KB 3AMLA 2XIDA 5DC0A 1EFXB 2PKDA 4P0DA 1E4XL 2CUHA 3KXFE 3SDXB 1QRND 5HYJE 3MA7A 1WCQA 1ZANL 3ZTNL 4FHBD 4LSPL 4UU9B 2E8ZA 5INDB 1CFVH 1UGNA 2DM3A 1BQSA 2DMCA 3GSXB 5IMMB 4QNPE 1XF4B 1OAQH 4M9PA 1IGIH 4GXUM 4HHAA 3OKYA 4NCDA 1NDGB 3GMOA 3WL9B 3P11L 4AEIL 1X5FA 1KSRA 1CZ8H 5T1KB 4P2YA 5HHPB 2PO6C 2VNCA 4KVNH 2D4FA 5IK3B 1EK3A 3MA7B 2FH8A 4G6MH 4H1LB 4NQED 5H94B 1FVCA 3RTQC 1GC1H 3FT2B 1EEQA 3EJZD 4OJFH 4OD3H 4X5WA 1YEKL 2AQ2A 3W11D 2EDQA 2O5ZH 5CGMA 1WWCA 4RAUA 4QNPF 3NVQA 2VIRB 4TSCH 1KTKE 4OF8A 3EYUL 5K9KB 2VWEC 3GMOB 1RZ7H 4Y16C 1A6VH 4C4KO 3SPVB 4ZXBC 2ZP0T 4HPYL 3RBSA 4HQQH 4GAGH 4PJ5D 4MMZC 4LVNB 4Q97A 2EZ0D 4WTZG 4UTAL 3H0TA 2VDMH 1UKTA 4JZOA 2F15A 3IAGC 1EVTC 5HVHC 5J7CC 4OF6A 4ZOEA 4BUHA 2BVYA 5F96L 2R4RH 2H2PC 3HE6C 3HI1A 5CP3H 1MRCL 2IAMA 1T5WB 1IKNC 1D5MB 3U7WH 1BVKA 2QSVA 4Q9CA 3GBLA 4PJ5E 1G7MA 4D9RD 3IKCA 3UTZA 5AWNL 3ESVF 3V0WL 1Z5LA 3MBXL 4JZOB 5HVFB 4P46D 2OTUB 3K4ZA 1PKOA 1BGXL 3QFJA 4G6AC 3HPJA 3TIEA 4OI8A 3HI1B 5DR5L 1RZKC 3H9SB 4ODUB 3VMOA 3LRHA 4WJ5A 3L3JB 4RGNE 1G9EA 2ORBL 4WU5B 3HMWL 1S9XB 1JF5A 2EDEA 1LD9A 4NZTL 1DQML 3IKCB 2HTLC 1DQQA 3O2VL 4P5MB 3K2UH 1Z5LB 4F37F 2FEEI 3V4VH 3NMEA 3MRDA 3Q3GA 3O45A 4P2CG 2NXYC 4X9FA 5JR1H 4OZFB 5D7IB 3K80A 3AUVA 3O11B 1GGBH 5J11C 5C08E 1CICD 4CADA 3B9VA 4HUWA 1XAUA 1KLUA 3OHXB 4HIHA 3L1OL 3O8XC 4V2CB 3WXWH 5I0DA 1DLFH 1YC8A 4I2XE 3EYOB 3WNMA 2FIKA 3X14A 3ZL4H 1KG0B 4LRIC 4LSTL 4JPKL 3VXMB 1LD9B 2EE2A 3TBTB 5E7FA 5BO1L 3ARWA 2Q7YB 3SDAB 1DQQB 5TE4L 4EQ2A 2I07B 3Q3GB 3GSQA 2HLFD 2W9DH 4MA8H 1WWBX 1JPFB 2J12B 2NY6B 4NWTH 3VMNA 3TVMD 1D5ZA 1LILA 3X12A 3BYTA 3NTCH 4HIHB 5DD5H 4GAJH 5GQBA 3QNXA 3MXVL 1IAII 3F7YA 4FQXB 1YEJL 4K07A 4K3GA 1ND0B 1G6RL 1UCTA 3VFGH 4M1DH 5EO0B 3OPZL 3BFOA 1CF8H 5ITFB 4HC1A 2BSRA 2X5PA 4IMKA 4QHMA 3PQYA 3HS0A 3GSQB 1MJ7L 4PJCE 5B38A 5FUOH 3MBED 2OR9H 4KAQH 4GRWE 1D5ZB 5E6IC 5JORA 3X12B 1ZHLA 4PJHF 4PJEA 3QNXB 2RHEA 4MVBD 1KCVL 4B5EA 2F53D 1BFSA 4LDEB 3H6JA 1I3RA 2YXMA 3WJLA 5J6GB 2R39A 3WN5A 4ALAL 2V7HB 1CGVA 3FOMA 2NZ9D 1ZHKA 4WO4D 5DT1L 5D2NB 3PQYB 1MREH 1KULA 2CH8A 1HXYA 1ZT7B 3O41A 5KVGL 4FFWD 2X70B 5FGCE 1B88A 1LO0H 1PG7H 2MHAB 4GRWF 4HAGA 5TGBB 4TTGA 1ZHLB 4GW4B 4YHMH 3T1WA 2FHFA 3KS0J 3EHBC 5ICZA 1I7UB 3BPLC 3LZFL 4XP5H 4JQIL 3RNKB 1T7YA 4I0PC 3WN5B 3UPRA 1LE9A 3FOMB 2E27H 3F8UB 4JN1L 3C6LC 2EC8A 4Y4KC 3RIAK 2KBGA 2AJZA 2QQKL 2H2SD 3RZCA 2O26U 5D1QD 5IVXA 4FABL 5I71B 4JPIB 1HXYB 3O41B 1NJ9B 4RA0C 3KPOA 4X83A 3K8LA 3VH8A 1J86A 1U3JA 3QRGL 3JUZA 3WFBL 3U0TB 1OAXH 3BEVB 3AB0B 1PDKA 2YBRA 5ICZB 4GMSH 2O5XL 3QFDB 1P53A 4M5ZL 4BFIB 1E4KC 3L3HA 1LDPH 4JM2D 4KVCL 2P49B 1R24A 3UPRB 4KMTL 5IESL 4KKLD 5ESVA 3QIWA 2AJZB 5EC1B 5IVXB 1OVZA 5KW9H 5D9SB 2AW2A 4XH2A 3KPOB 3GKWL 1ZOXA 1WLHA 4ISVA 1RY7B 3WEXA 5L2JA 1AQKL 3HAEG 1IGYA 2FL5A 4MB3A 4X5XB 2LVEA 4DKAA 1D9KD 3EO0A 1YNKH 2NY4D 1VFAA 2A9ML 4MXQC 4FZ8H 4P2OC 3D3VA 1LO3L 3AAZA 3MC0A 4YEEA 2J88L 4HWZA 2QSCL 5CSZA 1MPAL 4PJFB 5BV7B 4M1CC 4K3DH 5EU7C 4HFWA 1TJGL 5ESVB 1MWAA 3DVFA 3GHBL 4DGVH 4YBQC 5HGAA 1CYGA 1MIML 1BQHG 2E7LA 1KBGH 5CHNA 5GISL 3WEXB 2AK1H 5ICXA 1IGYB 2ITCB 3C2SA 3KPQA 3EO0B 1FIGL 3LOWA 5IQ9A 1VFAB 2ERJB 2X4UA 4R0LA 1PW3A 4ZTOL 5DI8A 1FLRH 3D3VB 3IJYA 5CCKH 4LNVA 3GMNB 5IFHH 3CLEL 5C07A 5JHLH 2E9IA 4JRXD 4PJ8C 1DR9A 4KK5D 1XIWD 2H26A 5DEZA 3MRRB 5C0JB 5CD5D 1T20A 4OV5A 3EOTL 3ZT6A 4NCC2 1MFDL 2XZAH 1DQTA 4F7MB 2NY0C 5LAXA 2HKHH 1IGFL 2X9WA 4L8SB 4ZS7L 4LGSB 2YOCA 5GS3A 1OT1A 5D1XC 3RWEA 3V6OC 5DI8B 3TO4B 2D03H 5JZ7D 4P2RD 4TUOA 4JHWH 5T33H 5JLZB 3UJTH 3C08H 4JRXE 3TJHC 1CL7I 1MAML 2IH1A 3W5NA 3QQ9C 2H26B 2BY3A 2J5LB 3SJVB 5MHSD 1CFQA 8CGTA 1YQ2A 4OV5B 1VSCA 4LLMA 1YEFH 3MNZA 4R2GC 2P43B 5E03A 4OM0H 1DFBL 5FUZL 5LAXB 1H3UA 3FB5B 3QRFM 1B4JL 1I9RH 2HTKD 1R5IA 3GO1L 5DO2C 2D9CA 4Y4FB 1IARB 3TP4A 4P2RE 5AZ2H 2XWTA 1RFDL 3TEUA 5LGHL 35C8H 4N0UA 5I73C 3H7LA 4N8PA 3MGOB 4HKZB 4YHOH 4KJYA 4K9EH 1A7OH 1UZ8A 2WBKA 3IFNH 5MHSE 3VRIA 3CFDA 3S98A 1MRDL 4HKBB 4WHYG 3BQUA 4D2NA 4LLAA 4JFZL 5FB8A 2D0FA 1R5IB 3MMEA 4O5LL 1UYWL 4HBCH 5SX5K 2VXTL 1CDUA 1DN0A 4JG1L 4XCYA 2XQYG 2PW1B 2R69L 2XWTB 4Z78B 3TN0C 2EIZB 1IAOA 4YDJA 1RUQH 1OAKL 2DLFH 5SX4H 3VXQA 1MH5B 5E70A 4PP1C 1W0VB 1OT2A 3BQUB 2B0SL 4QRPA 4TQEL 4XMKL 5I66B 4HS3A 3CLFH 5CSBA 1WF5A 4CDGC 4ACPA 1O7SA 5C0GA 3UCRA 5KSBA 2FB4H 2PTUA 1F5WA 2E5EA 5FHBH 3F7VB 3MMEB 3BPNB 4KROB 5JTWA 5HXMA 4S1QL 5DS8A 1T83C 4J6RH 1U3HB 2I25N 2PYEA 1GOHA 4IS6A 3QA3B 4XCYB 3L3OA 2VLRE 1IBGH 1RUPH 1QFUL 5B8CA 4UB0L 3GI9H 1JPSH 5DJ8A 1Q9LB 3MRCA 2P5ED 4NQXB 4UT6L 5JW4Q 3VXQB 3SKJH 3D48R 5I1KH 3ARGC 5GGSA 4QRPB 4M6OH 4NQSA 3O0RL 3VRLE 4HS3B 3P40A 1IM9A 4RFOL 4RQQA 5J1AA 4AT6B 5C0GB 4MNQE 3PNWA 2OL3L 4OCYH 4OGYH 2D7TL 4IHOA 3TWCH 1QBLH 4NKQB 1LO2H 4KZDH 1X5GA 2X05A 4IS6B 2OXHA 4NQUA 4OT1L 4W4OA 3L3OB 5IHBA 2D31A 4JFDD 2QL1A 3T4YA 5GRWA 2A6KB 4YZFE 2YN5A 5B8CB 4NP4H 1HNGA 3MLSH 1ZT1B 4RX4A 1RJCA 2IANE 1F90H 4F33A 1WTLA 4I5BA 4HS8H 4P23A 4TVPH 5GGSB 3VRLF 1NDMB 5E00A 5EU6D 4TUKL 3PNWB 1X5ZA 4NC1C 2JK5B 4IHOB 1HDMA 3TT1L 1E4WL 4MAYC 4AK1A 2AJ3B 4JB9L 5JIIA 4U1JB 5IFJA 2DQIH 2D31B 2DLTA 2WP3T 3T4YB 5DJXA 4OKVA 3LQZA 4YZFF 4Z8FL 4N1CA 1T89C 3RGVA 3ZKND 4AEHL 5GS0D 1KTDB 4Z7NF 4F33B 2XFXA 1JGEB 4P23B 4KJQD 4KK9C 5DHYA 2O93L 1HHHA 2HFGL 4Y7MA 1N64H 5E00B 1CFSA 3QDMB 1BJ1J 2VH5H 5IGXL 3DMMB 1U42A 4OIAA 4YPJA 4NQCD 4NKMA 5JW5A 1NC2D 2NMSA 5ALBL 2JJWA 2DD8H 3GSVB 4HK3J 5IFJB 4OM1H 3GBML 3DVGA 1KJ2A 5DJXB 3LQZB 3O9WA 1XCTB 2CKNA 3L7EB 4RFEA 2DQJL 1FPTH 1N6UA 1WBXA 4K23H 3Q5OA 5BRZD 2XFXB 1FZKA 1Q9OA 5FIEA 4JPVH 2CD0A 5ID1A 4G8IA 4M7LT 3TZVD 1I1FB 3NZHH 3VCLA 4UOW0 3S34L 3INUL 4PREB 3ARFD 4GRLD 4OCSH 4XC1H 3RPKA 2RBLA 3H42L 4NKMB 4NQCE 3VGAB 3RVTD 5ITBH 3VDBA 2YD1A 4I18C 4HZLB 3WKML 3SE4A 4WWKD 1KJ2B 5EUOA 3O9WB 4FQQB 3M17A 5D96B 4RFEB 3OKOB 5D5ME 2X4PA 2YRPA 1YEDB 1WBXB 2J8UA 2YUXA 4OZHB 1DQJA 3QUXD 4M00A 3ZKSD 1FO0H 3TIDA 4FFVD 5MI0B 3S36H 1HWHB 1H5BA 1N2RA 3VCLB 1E6JH 3MLZH 4U4BA 1HOCB 4PBXA 4D0CA 4KRPD 4KI5D 4J3WA 4OFVA 4PRIE 1N7ML 2A9NH 1YPZB 1DEEB 4U49A 3I75B 4QCIB 1QO3B 5CP7A 2DBLH 3M17B 4KXZH 4R90L 5DK0A 4QXUL 2X4PB 3RVWC 3T2OA 1GHFH 4HXAH 4GW1A 3UTSA 4XXCA 4K8RD 4ZAKA 1H5BB 1N2RB 3VXRA 5LVEA 1MJUH 3PL6A 4FN0A 1AKJA 2WUBL 1AJ7L 3D9AH 1IC5H 1U0QA 2AXFB 2PXYA 5E2UH 3FL7A 3R4DA 1QHPA 4PJ7B 3CSPA 3RL1A 3IDGB 1NQBA 4R4ND 1ADQL 2B1HL 3B2UC 5DDHB 3HI5L 5EZOL 2DQGH 1JFQL 2FSEB 4RMRA 1UZ6E 4NN7B 1IVLA 4ZAKB 4O58H 3VXRB 4L3AA 4DFIA 5DHVB 3VD5A 3PL6B 1AKJB 4I4WB 2DYPD 1F13A 1BHGA 4HK0A 1I3VA 1MCQA 4L4VB 3NH7H 4MDJA 2MPAH 1NFIA 3U36A 4OFIA 4M7KL 4PIRF 5C0BA 2Y72A 3KYMB 2YPVH 2AJVL 3VXUB 3VXNA 1A4JA 2XTJC 3FTGA 5L88L 5SWZD 1QFWI 1U8QA 4H8WL 3EFDL 4LAQL 4DVBA 5DJ0B 1KELL 1UZ6F 4XZUA 4DW2H 3DGGB 3DURB 1DLHA 3UYOD 5IB2A 4UT9L 3QHFH 5JDJA 5HVGB 4IRZL 3O6KL 1S7RA 1X3DA 5I74C 3LY6A 1NFIB 5C0BB 4JFEB 2UYLB 3RWDB 2DBJA 3AXLB 1A4JB 3CSGA 4LCWD 3ZTJH 3FTGB 3VDAA 2C3XA 5SWZE 3ROLB 3S35H 1JGLH 1U8QB 4LHQB 1KCUL 2R9HD 4XZUB 3WLBA 2VXUH 4ETQA 5IEHA 2VDNL 4JKMA 3I6GA 3UYPA 4DCQA 2C26A 1DLHB 4N0RA 1IAKB 4OF7A 3BDYL 1OP5H 5HJ3B 2AJSL 1ZLVH 3QDJD 4YBLB 1R3HB 4KI1A 3KR3H 4A6YB 3OAUL 3C5SB 1NBQA 5IWLC 1UM6H 1U8PA 4O2FA 2CLVB 5T3ZD 5HYEA 3FN0H 3WLBB 5DUBA 4Z9KB 4JR9H 3QCVL 3UO1H 2XNAB 4CNIA 3O3AA 1M6OA 2IFGA 4DCQB 4XNQA 2J4WH 4LDOB 2FZ3A 1D6VH 1AR1C 3FQNA 4KTYA 3HC4L 2VTFA 4RWYL 1FNFA 3E3QE 4WCYH 5DJAA 3MCG1 5EU3A 5ICYB 2O5YL 1JI1A 5JXEA 2RGSA 1J0KA 4PLJC 1U8PB 5C86A 4O2FB 3FFCD 3DV6B 1KN2H 3ZYIA 1F58H 3BKMH 1IQWL 2ZOKA 3BH8B 5KVEL 4LPWA 4GXUN 4XNQB 5EH1A 5GZOD 5DD3H 5AZEH 3DXAD 3FQNB 4I9WD 5JQ6H 2G9HB 5GGUB 5FA3A 2A6IB 4W6YB 1ZTXH 2R2EA 5DJAB 4QXTA 4LLUA 5EU3B 4NRYB 4LVNC 3LEVL 2DJ4A 4Q74A 1Q0XH 3FFCE 1FJ1B 3SE9L 4M6ML 2HVKB 1VADA 4G7YH 3SO3B 4XP1L 4TSAH 4LMQE 2ZOKB 3V7MA 3D25A 5E2VL 3LRGA 1C1EH 4D9QD 3BMWA 4I9WE 1ONQA 5D8JH 2VN4A 4HJ0C 3UTTB 2R2EB 3RA7H 2X4SA 5KAQG 3HR5B 2EEDA 2VDRL 3QUYD 4QXTB 4JZNB 4XP9L 5CILL 2X89D 4G5ZH 3FRPG 1K6QL 5KS9A 4Z6AT 2J7LA 4HIJB 5KG9A 2VDLL 3MLRL 2VZVA 3GMMA 4QTIL 4MD4B 2DQTL 3BE1H 3X3FH 3GGWB 1IFHH 2BHUA 3EJJX 5DVOA 4RZCB 3LRSA 4GBXD 1VADB 1ZWIA 2R2CA 4HIEB 1A6AA 2C3GA 1EUUA 2CXGA 4QHKI 4YXLH 1GAFL 2IAMC 4R6UA 1AE6H 1DBJH 2VISB 2DWEB 3VE0B 4HKJB 1K2DB 1EBAA 2I9LA 2R2BB 4NUJA 1RUAL 3S6CA 2VABB 1GXEA 4D0BB 3RIFF 3VD3A 3GMMB 3P0YH 2MCG1 4WNQB 4X7TA 5GS0H 4P2QA 3MLPA 2A1WL 3LRSB 3LB6C 5GRVL 5C0IA 1ZWIB 1VA9A 4MQ7B 3T2NL 2YUWA 4MZ3A 3H3BC 3UBXB 1JYNA 3IDUA 5DEGA 4EOWH 5BJTA 3V2AR 3GUTA 1AGBA 2AAVA 5DK2B 4LEOB 5FYKU 4NUJB 4GW5A 4YPGA 4ZFOL 4F7TA 1Z9MA 3CVHB 3CMOL 2YA2A 4ZFFA 5KN5A 1FCCA 5I18L 3SDAC 3SDCD 1AD9A 2B2XH 4X7TB 3HRZB 4P2QB 4PGDA 5C0IB 2BVOA 3MNVA 1MY7A 3FMGH 2NY6C 1UM5L 2N7BA 4QRRB 2ENSA 4M93B 5E99H 4S1DC 4DUVA 1FAKT 2CJUH 1U8MA 4NZJA 4PJIA 3ARBD 3DRQB 4QGYA 2QKIA 2ZUWA 4FQXC 5GRUL 2IMMA 4JO2L 1F11A 4GW5B 5C70A 4PJXB 1KNOA 3D2UA 3RHWK 3WV0A 2ZJSL 4F7TB 2W91A 3RZWA 1T80A 1J18A 3HUJE 4PRPD 4OTXH 3TC9A 3N85H 1F4XH 1AD9B 3RDTB 4OCWL 2J6EL 4DN3L 1E0OB 4GAFB 4G7VL 1FFRA 2Y36H 1MCHA 4ONGL 5H37G 2B4CL 3MNVB 4LGPB 3LEXA 3P9LA 3BWAA 4OZGA 3B9DA 2L7JA 3KYKH 5IMOA 1NFKA 1T2QL 1GPOH 4P57A 4PJIB 1JZ3A 1JZ8A 5ANME 4Z7OE 4X8JA 4PP2A 4U1GB 1KNOB 3D2UB 5GS1B 3D18B 4QTHA 4CJ0A 5DVLA 1SEQL 4Y5YB 3QBTB 2WIIB 3HUJF 4PRPE 3FN9A 5D2NC 3NN8B 3ARFB 3O2DL 1ZGLM 3TBWA 4F7CA 4HT1L 5KSAA 3V4UH 4LLVA 2ED9A 3G6AA 3P9LB 2YKLL 4K8RH 5D6DA 4RAVA 5ACZB 1I8MA 1UVQA 5IMOB 3GSNB 4P57B 3EW3B 3HHRB 3KNBA 3F7QA 3SCMA 1KIPA 1F3JB 5CBEA 1YEGH 4Z0BH 4Z7OF 1CFNB 3KPMA 1S9YB 1FYTA 3NZ8A 4QTHB 4M6NH 5B3JE 3PUCA 4HH9B 3WN5C 4U6XB 1CT8A 2GK0A 1JK8A 4U6VH 2G5RA 1UKSA 4ZUTB 3BW9B 3DUSB 4OLUH 3TBWB 5I71C 5KSAB 3P3YA 5MP6L 3VI3F 2FDBP 4YDVB 4OLEA 3BAEL 3X11A 4M7JH 2R0ZL 2N56A 5C0ND 3KNBB 1N5YH 3C2AL 4EUPH 1KIPB 3TPKA 1EJOH 3O6LL 5CBEB 5IB3A 2CLRA 4FG6C 1V7NH 4WDIA 3ARZA 4Z5RA 1P7HL 3NZ8B 4JGUA 4L4JA 2EEAA 5A43C 1CT8B 1JK8B 4KK8D 5IB5B 4N9GA 3DVNA 4K7FA 3RZCC 5F3BA 4YFLF 1XR8A 4L1DA 3SKNA 3HC0B 3RU8H 5DD6B 3STBA 1XGPB 2NCMA 1ETZB 2AJYL 2VL4A 2ZCLL 3X11B 2YWYA 1UM4H 1OTSC 3MRMA 4TVSa 4IOFC 1B2WH 4NGHL 2G60L 3X3GL 1KOAA 5IB3B 1P4IH 1KENL 5IBTL 5GHWH 1AGEA 2XQBH 4FTVA 1JHTB 3IAQA 5D1ZD 2UWEA 4G42A 3UZVB 3NOIA 5FM4A 4JZJB 4Q6IA 1T03L 1CXKA 1SJHB 3GBNH 4MMXC 4JQVA 5BV7C 4EDWL 4MWFB 3PWPB 4N9GB 3LN5A 3SDDD 1XR8B 1MJJA 3QUZA 2Q8AL 3SKNB 1S7QA 2ATKB 1R5VA 5GRJL 1IZJA 4LLQB 2NXZD 4RRPG 1JTPA 3WBDA 4GKNA 5TPWL 4X0KB 3RL2A 1N26A 5IFAH 3MRMB 1WFUA 4P49A 1KGCE 3WUWG 2P44B 3LKRB 2GJZB 2ERJC 4R4FH 1IL1B 3I50H 1M71B 5HI5C 4YNYA 5JPNB 2E6QA 5A1AA 1LNUB 1JGDB 1Q1JL 1MCKA 4P4KA 4QT5B 3MRLA 5HGDA 1YNLH 3QJFA 1NGZB 1W8NA 4IRJA 4YHPA 2OR8A 1VEPA 4OLVL 1PEZA 3L95A 2E7LC 1YUHA 4ZO7A 3BIAX 1HQ4B 4GKNB 5T3ZH 4AY0A 2Z92A 1T0MA 4QYOA 4ODWB 3DYMA 3IDYB 4L8SC 5J1SC 1QBMH 3MA9H 1JTOA 5DTFA 1H3PH 1XGYH 4R0LC 4UIKH 3U4EA 3KPSA 3TO4C 3QEQB 4KKAC 1DSFH 3I9GL 4ONFL 4PGBA 4P4KB 1HKLH 3C5ZA 3EFFA 3WIIL 3UJIH 5FDWA 3QJFB 1TJHH 3VW3H 1NL0H 4IRJB 3CZJA 3L3KA 1JNLH 4CU6A 3GMRA 3AS3A 4YHKH 2EDBA 4JY4A 3U0PB 2EH8L 3SE8L 2Z92B 1T0MB 4G8GD 4JGJA 3EAKA 5FA4B 3T2QA 4JCMA 4KJPD 2A77H 2WP3O 4OUUA 3U4EB 3KPSB 1RK1A 2VXQH 4Y4FC 4XBEH 5EOQL 1FRGH 3P9MA 3QPQD 5HD8D 1XGTB 3RI5F 3A6OA 3UDWA 5IB4B 2GUOA 2DM2A 3EFFB 3MV9A 5FDWB 1NC4A 1DBKH 3RWJA 4PJ9D 5I1HH 2HT2D 3LN9A 3PP4H 5EU5A 3GMRB 3RVVC 1S3KH 1XFPA 1PFCA 3D85A 4FXKA 5C6WH 4EZMA 3M1BB 1OP3H 3BD4A 4G8GE 5FM8A 1KPVB 3H3KA 2WV3A 4S10A 4OUUB 4PY8I 4LNRA 5HHOB 1GH7A 4JANA 1W72H 2BSTB 2LABA 3P9MB 1ZHBB 2FX7H 5KTEH 2PW2A 4BSVA 3CIQA 3V7AG 2OK0H 3RWJB 1KJ3H 4LHUG 3WCYA 1C8PA 4L3CB 2BDNL 2QR0A 1Q72L 3EOYG 4MJIE 5IHUH 4P3CL 3KPRB 3ULUD 2EDKA 1CGYA 3BQUC 3OKMB 4FXKB 3TA3D 1A6WL 3G08A 4TNVF 2DWDB 2A74A 1Z9SA 1NCTA 3BD5A 1P5VA 4KK6C 1TNMA 3SKOB 1I1YA 4ZSOA 2F5AL 4IRSA 1W0WA 1WIUA 4XAKD 3G6JB 4KROC 5DVKA 3NPSC 1S7WB 4JANB 2BOCA 3QNYB 1U3HC 1F6FB 1DUZA 1I9JL 5ELIA 2PW2B 1QBBA 1JZ7A 4YIQB 3MOAH 2JKXA 3OR7A 3TJEH 1OP5K 1OARH 1TVBA 1S9VA 1Q0YL 1ZLVK 1DL7L 1MCOL 2UY6A 3RUGF 5F7UA 4BFEA 3P0VH 1YEHL 4H20L 5EA0H 4ELMA 4WW2A 5D93B 5EUKB 3ULUE 4LKCA 4Q0XH 1EX0A 3GK8L 1R3IH 4U0RB 4BQ9A 3EDJA 4NQDD 4HEPG 5T5FH 4ZSOB 3HC3L 2Z31B 2LTQB 4GQ9L 4DGYH 5J6HB 4IRSB 5FYJD 4FQCH 3QWQB 1WV7T 3BPCB 5JW3L 3FO1A 4HUMB 4HG4J 2BOCB 3OGOE 3HNTH 4M48L 1RURL 3BGFB 4FQ2L 4FNLH 4UDUB 5B8CC 3OR7B 1T0NA 1OD9A 1S9VB 1TVBB 4X9GA 2JB5H 2Z8RA 3E6HA 5FKAB 2EKSB 5HDQL 4WW2B 3LQAL 2ZOLA 3C60B 4PGJA 3S5LA 5BXFB 3ZYZA 1XZ0B 4NQDE 5DQ9A 2HRPH 5IMLA 4O02L 5FYJE 3GRWH 1KT2A 5DMKB 3KS0H 2NY2B 3ILQC 1RZJL 2ZCHH 4W4OC 1A5FH 3TLRA 4LASH 5DZLA 3OAYH 1UC6A 4ENED 1KFAH 1J8KA 1AGFB 3QDGB 5EBLB 1GZPA 2Z35A 5EZJA 3PWUA 4WU7B 5SWSA 2DF3A 1JPST 3E6HB 4WEBH 4P23C 1HHJA 2HRLA 3CPLA 4RGOH 2XWBB 3ZTNH 1FVDB 2N1KA 5E8NB 4LPUA 5T3XL 1SJEA 2EDDA 3DMMC 5FK9A 4O4YH 5IMLB 1M7IA 3BKYL 2BFVH 3W5MA 4N0CC 1KT2B 2WBJD 4N8CH 1TLKA 4XNZB 2VLLB 2VQUA 4PV8B 1WIPA 2JIXD 1KCKA 5B39G 3HAEH 2V5YA 2WUCL 1T5XB 2VDQL 2VDPL 2Z35B 1T7ZA 4WFEE 1VDGA 4AEIH 1AI1L 3PWUB 2DM4A 3OKEB 4HK3N 3P4OA 1C7TA 3W2DL 5IEKB 3F62A 2CPCA 3CPLB 1R3LA 3T0ED 3ARSA 2Q86A 4LQFL 3MLYL 3S97C 1I3GL 3M8OH 1H15A 1SJEB 4Y8AA 4PV9A 4KRNA 1R3KA 5FK9B 2A0LD 1T7XA 4Z0XA 1IGCL 2YD4A 5JHDA 3VGAC 3TCXA 1TJIH 4M43H 2DDQH 2WQ8A 4I3GA 2X1QA 5I17A 1BQLH 2BZDA 3O9WC 4YX2L 3VRJA 1OL0A 1AR2A 1RJLB 4MS8D 1BF8A 4U0QB 1XF5B 4PD4K 4UQ2A 4HPYH 2EDOA 4OSUL 4YDIL 5BW7A 5ACLA 3H3PH 4URTB 5E5MA 5DD0H 3T0EE 2ICEA 5JMRA 2GSIA 3KXFA 4K3EH 2CKBH 4GSDH 1J1PL 2JELL 5HYJA 1ZSDB 4Z0XB 4J8RB 4JCLA 3W39B 1MHHA 1WWWX 2DQHL 5F96H 4J1UB 2WIMA 4OI7A 3SE4C 5I17B 1HQRA 1CDCA 4S2SA 4CVZA 2NY5H 2JJTA 1DBML 4U1HB 3WFEL 5ADOL 4F7EB 1OAZH 3ZT5A 2FX9H 4PY7A 2D7OA 1NGWB 5E5MB 3KPNA 5E8DL 1JGUH 2N7AA 3NAAL 3U9PL 1H5BC 2VSDA 2GIYA 2NX5B 3EDKA 3BP4B 1OAUH 4WTXA 5AWNH 3VXSB 3V0WH 1C5CL 2BVPA 1BGXH 1MRFH 2KPNA 4NIKB 3ARDD 3CCHA 4ONOA 1RV6X 2VDOL 3OKNB 2CRZA 1VGKB 4KRLB 4X9IA 5E0QA 2VE6A 4S2SB 4CVZB 2OSLA 4IM8A 5F89B 3T0WA 3BPOB 1UJ3B 3TFKC 3E6FB 3UROR 1GGYA 4XVSL 4PY7B 3HI6L 5FM5O 1DQMH 4NN7C 4ZAKC 5MENB 3KWWA 4KTDL 4M8VA 1ORQB 3PL6C 3O2VH 1CN4A 3V79C 1IQDA 5D7KE 4OQ1A 4JO3H 1FGNH 1A1OA 4F58L 1IRAY 5TQ2L 5C09D 2R0LL 3MRNA 1DVFA 1NSNL 1S9WA 1K3ZA 1OSPH 3QWRD 3SY0A 5ISZB 3CK0L 4X80L 3VFVA 4ZG1A 2VE6B 2VOTA 3MNWB 4YDKL 2CDFA 2VXSL 3QZWA 3OKKA 4GG6E 4U3CA 2BC4B 4N5UA 1PZ5A 3OG4B 4X6CA 2LAGB 4KGLA 1GSMA 5BO1H 3KWWB 2ATPB 5F7HA 1QOKA 4G80A 4PJ5A 2IQ9L 2COQA 4RSVA 3RJDA 1JJUA 4HIIA 5L7XL 1FN4A 1DVFB 4P5TA 3S8WA 5DJDB 1S9WB 3JVGC 2NTFA 5BQ7B 4EQ3A 2CDFB 3I6KA 3QZWB 3LSOA 4GG6F 3JXAA 4LLYA 4C55A 1CGXA 1G6RH 3GMPA 2CIKA 3OPZH 3VXTA 1SVZA 2FX8L 1N6QL 1X5IA 1MCPH 2NY3B 2GQHA 4HC1L 5LQBL 5TF0A 1MJ7H 4PJEF 2PO6D 1QD0A 3RY4A 4P5TB 5C2BH 4P46A 3BSZH 1BD2D 3WIHH 2NY1C 1S7VB 2DB8A 4YBLC 3LIZH 3V9FA 3RTQD 1V3KA 3P9WB 4HH8A 4HEME 5C08A 3LSOB 3S96A 1KCRH 4P48A 2VO5A 3IRZA 4KMLB 5DJ2A 3GMPB 2CIKB 4RGNB 4I2XA 3RWCA 3VXTB 1CFTA 3QO0A 3BGAA 2PTTA 5HYSB 1EO7A 2M1KA 2P47B 4Y16D 4U7MA 3WNNA 4O9HL 4QY8A 2ED7A 4ZXBD 2BNUA 5DURB 4G6KL 1N0XL 1NLDL 3KJ6L 1G6RB 1UWGL 3HZYB 2BOBA 2X7LA 3SGKA 2J8HA 5D71H 5L9DL 2OMNA 3F5WA 4ODHL 2ZWLT 3HZMA 5C08B 3S96B 1T1ZB 1HH6A 4FZEL 4HPOH 1FNEB 4X98A 4XBGB 5DJ2B 5DRZA 1CTOA 1RMFL 1Y18A 4I2XB 3HE6D 3RWCB 1U91A 4RA3A 2VWEE 5E6ZA 5I1EL 3ULUH 4JN1H 1FDLH 1IGJA 5C0EA 2BNUB 2GAZB 2ZKHH 3I6LD 5JW4N 2DL9A 1MCFA 1AXTL 3KGRA 3N1QC 3MRBB 5IB1B 2VZSA 3PGCA 2VQTA 4PJCA 4MNHB 1WCBA 2F58H 4NZRL 3EZ8A 3F5WB 5IBLC 4FQJL 3B83A 3DNKA 3TESA 1C5DA 1TZGH 1HH6B 5JXEC 4PJHB 4DN4H 4G6AD 1N8ZB 1P6FA 1Y18B 2IPKA 1U91B 1NUFA 3OKDA 1JMXA 4KMTH 2MCPH 3ZDZF 3SO3C 5IESH 4H1LG 1BJ1H 3NACH 4CL7A 4BQ6A 3I6LE 4HUNB 2GSGA 4RCAA 1H3XA 2A38A 5BVJA 4HUKB 5HDBE 3CC5B 3LKOA 5FYJH 2QSTA 1ZE3C 1ZEAH 1HYRC 1HHIA 1NMCB 2HTLD 3MBEA 3ZT7A 1HI6B 1XCQB 3TCLA 4GRWB 4WW1B 5HI3C 3LHPL 1KEML 1C5DB 2NXYD 4JHBA 1U2HA 2A9MH 2B20A 3LS5L 3OX8B 3EO9L 1QFPA 1LO3H 4HJJH 5GGVY 1FGVH 1WSST 3BZEB 1MHCB 3O8XD 5LBSH 2VZ3A 3MUY1 3WD5L 1FL5B 1K4CB 3VFPA 2FATL 2GSGB 3HFMH 2YPLD 1MWAL 3DX7A 4FFYL 1JWMA 5HDBF 1XF3B 1HSBA 1WEJL 1VGEL 4DZ8A 4C56D 5FGCB 3IDJB 3CX2A 4QF1A 4KMQA 5IUSA 1FIGH 4EVNA 1OP9A 2AK4D 1YYLH 2OJEB 5TE6L 4ZTOH 2CQVA 5F7LB 4NRXA 1PQZA 2GCYA 2VZOA 1CDBA 2VDKL 5T1MA 4GXVL 1J8HE 2FO1A 1I3UA 3PJSB 3T4AA 1DBAL 4QWWC 1IC7H 1U2CA 3EOTH 5KVDH 4NM8H 3KDMB 3DX7B 1JWMB 5D1QA 5CJOH 4HMDA 2Y06L 1NLBL 4X6BA 1OP3K 4C56E 5T5NG 5EOCH 1ZLUH 1X9QA 5D7LD 4ZS7H 3K4AA 3QQ4B 3MLXH 3QNZB 4F7PB 1EPFA 4L4TB 5CZVL 2VAJA 1PQZB 2GCYB 1WFOA 5DJZA 2HFFA 7FABL 1MIEL 1OGAD 5E6ID 3T0BA 2EXWD 3FQTB 2W9EL 4HMEA 4M93C 4R7DB 3CDCA 5E1HB 5F72S 5IT2H 3SN6N 3W0WE 5CEXA 1G9NC 1NEZA 5GSVA 3QI9B 1MHPH 4OZFG 1NBVH 1B90A 4X6BB 1DFBH 2WLYA 5KZCB 5CINL 5D7LE 4MAUL 4AMKH 1CL7H 4OCRH 1A1NB 3DX9B 1D9KA 43CAA 1IKFH 3WS3A 5KVFH 2BVEA 5J12B 3ARYA 3RDTC 4XVJH 4K3JH 1OGAE 5LGHH 1ZLSH 1M05A 5I8EA 4NJ9L 4Y8DC 1QNZL 3TNNA 5KSBE 2FJFA 3EHBD 5CEXB 5FGBA 1NEZB 2CUMA 1KIRA 1M7DA 3VFNA 4I0PD 2Q3AA 1S5IH 2KQNA 5SWQB 3HMXA 2AXHA 4QHUB 3C6LD 4Y4KD 4JFZH 4MJ6A 5GS1C 1SMAA 3FQXB 4Y5YC 4O5LH 1BBDL 4JAMB 1SEBA 2GITA 4JG1H 4ODTH 1QSFD 2CRIA 1M05B 1GOFA 4OFKA 2DQDH 1JMZA 5CIPH 4H0HB 2IJ0C 5IJKA 4JRXA 4MXVF 2FJFB 2XG5A 4PFEA 4LU5H 5KSBF 3NCEB 3K8KA 3MGTA 2YUZA 5JQHC 4DFHA 1M7DB 3V5KA 5MERA 1JZ6A 4HWBA 2R2HA 2AJXL 5HGBB 3EDDA 3VFUA 2DJUA 4D9LL 2MQ0A 5DFTA 2QEJA 3LVEA 1J1XH 3D39B 4HS6A 5SV4A 4XAWL 4AL8L 1A6TA 3U4BL 1SEBB 5A3IC 4E42A 3OAYK 4P2RA 5KSAC 1QFUH 3HZVA 3MV11 2DI7A 1BIIA 5D6DC 4ZOBA 4P2OD 4UT6H 5FHAH 3BJLA 4PUBL 4X4ME 1E28A 3V5KB 2ZG3A 1G84A 4J3XA 4XHQA 2R2HB 4OGAC 2ESVE 3VFUB 3CX5J 5I8KL 1KYOJ 1GGTA 2OL3H 4YBQD 1RIHL 2ZSWA 4P4RA 3AC0A 4JKPL 1A6TB 3AGVA 3V6ZB 4U6YA 1TQCB 2MKWA 2BSED 2ADGA 5I8CB 3BT2L 3DUUA 1ULVA 1BIIB 1S78C 2CMRH 5FO7A 4C54A 4JDVA 1VFUA 4YXKH 1E28B 1IMHC 3HG1E 2OTWA 4PJ8D 5AAMA 1A6ZB 1MCBA 1U3YA 3NCMA 3N0PB 4XP6L 5EU7E 5F70A 4TUKH 5GGVH 1P69B 4Y89A 4U1KA 3TT1H 2Y07H 4A2LA 4JZJC 2MSPA 4QOKB 3HZKB 1CXIA 1FH5H 3NFSL 1J1OL 4P4RB 2KKQA 4L8DB 2NY0D 4D0DA 4EN3B 1Z9LA 4K3HA 1AO7D 1G9MC 4IIQB 3T0AA 2VLRA 2CLZB 1NGYB 3DUUB 4MA1B 4WTWA 2OL3B 5D1XD 1FNGA 5FO7B 2XTLA 4JDVB 3U2SA 3O3DA 3QIBB 1NCDH 1G7IA 2AV1A 2OZ4H 2BP3A 2XI9A 4JFPB 2JLLA 4OLXL 1EHLL 3WUZA 4LLDA 3C5JB 2IADA 4DGIH 1U8HA 4HIXL 4Q6IC 4OIIH 1BM3L 3IDXH 4R2GD 5ALBH 3WDHA 5FOBA 1SQ2N 1UEMA 3FZUC 2OP4H 4J3VA 3QCUL 4LSVL 4DJMA 4D0DB 3QEHA 2H32A 4JKWA 1U93A 2VLRB 1U36A 4G6FD 1W2KT 3FB8A 5DO2D 3QXAA 4LHUD 1RPQA 2V2XB 1NMAH 4TUJA 3U2SB 5JIKA 5H8DA 5D7SL 4MD5A 1G7IB 3IDYC 2IANA 3LKNA 5C9JA 3BN9C 1PSKL 1X7QB 3OF6D 2QHLA 4MQXC 5BMFL 1D5BA