3RAJH

Crystal structure of human cd38 in complex with the fab fragment of antibody hb7
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
219
structure length
215
Chain Sequence
LVQLKQSGPSLVQPSQRLSITCTVSGFSLISYGVHWVRQSPGKGLEWLGVIWRGGSTDYNAAFMSRLSITKDNSKSQVFFKMNSLQADDTAIYFCAKTLITTGYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSASMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIENR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase 1
publication title Engineering a novel cytosolic form of CD38 for cyclic ADP-ribose dependent signaling
rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 34
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2011-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rajH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rajH01
5FO7A 1F90L 2J6EH 4I4WA 4WNQA 4N0CC 2EDYA 3UTTB 1U95B 4MS8D 2H1PL 3V0AC 4XNMA 4Z7OE 4MJID 4JHAH 3RJQB 2JIXB 3MFGB 3UPRB 1T4KA 2WP3O 2CUMA 4M7JL 3WIHH 2QQQA 1WZLA 4J8RB 5DK3A 3OKNB 1B0RB 2NXYC 5FOJA 5F6HJ 5IJKA 5E2WH 2YKLL 1P1ZB 3DV4A 1XF2A 4MDIB 3PQYB 4MCYB 3PXHA 2H41A 3CPLA 3GMNB 3LHPL 5C6TH 2EXYC 3GSWB 2NY4B 2EDXA 5EFIA 2H6PB 1YEIL 1P4BL 1XF4A 2W65B 4AK1A 5JLZA 3O2DA 5D7LD 5JXED 4KUCF 4ZO7A 1JNNL 2E7LA 1N5YH 1FV1A 1MRDH 5HSFA 2P7TA 3TC9A 2X4PB 3EOAB 4FQJL 4IOIB 3B9KC 3G04A 3WXWH 4BFEA 3WLBA 1KEGL 2AJZA 5JDJA 3L9RB 4J1UA 5CZKA 4NQCB 3BUYB 4ESKA 3FFDB 3EDFA 1HIMH 1QSEA 2MCPH 1IGTA 3W39A 4X5WA 4NM8L 4NWUL 1I8LC 4MZ2A 1FC1A 4Z77A 1XGYH 4ENEC 5J13B 1QSEE 1NCDL 4DFHA 4LVOC 2B4CL 3O45A 3L5XL 4ZAKD 5JHLL 4P5TB 2A38A 2DTML 3TYFA 1SM3H 5E2JA 3L5WA 2GSIA 2WIIB 3B9DA 4HWZB 3MRBA 2CLVA 4PRDB 1FAIL 3C6LB 2LU4A 2ZWLT 3EKCA 4D8PB 5E24E 4JZOB 4AM0A 4O58H 4C57C 1CFTA 1TENA 3LKRA 3KJ4B 5MERA 4WUUB 3OKKA 1OT2A 4FZEH 5ADPL 4HT1H 1EFQA 4LKCA 5I1HH 1E4XI 2N1KA 5C86A 1OF2B 4BM7A 4DWHA 5EORL 3P4OB 1ULVA 3S3PA 5DC0A 3VXSD 5B21A 3VFPB 4X6CE 4Z78B 5IBLD 1T89C 1KJMA 1YQVH 2ESVD 4JFPA 2P44B 1HE7A 2COQA 3S5LA 4FFWC 3AAZA 3BSZH 4RAVA 3OKMA 3QRGL 4O4YH 2YUZA 5MEQB 2EDBA 1BIIA 4OLUH 4DKDC 2VTFA 3BDBA 3HE7D 1A7RL 2E27L 2MPAL 3PWPD 5EU7E 2K7QA 5DRNA 2VLKB 3ZTJG 3MZGB 1R24B 1I3RB 3TIDB 4U0QB 3TJEH 3PGCA 3RI5F 2LQRA 4O5LH 1NC2B 3T0EC 3O9WA 4KKAC 5CSZA 5SWZB 2ADGB 3RZCB 2A9ML 2X9WA 3O8XD 1CDIA 43CAA 2ZG1A 5IQ7H 1P7QD 3ZKXC 4PBVC 3KPMA 4LHUG 2IBGA 5I1AB 3IXAA 1TMCB 3C5SB 4KDWA 3VG0H 1IILE 3GSUA 1JF6A 4M9OA 1FE8L 1U91B 3BDYL 3RPIA 4LSUL 1TCMA 5FEBA 2GJ6E 4JRYE 4OIIH 4IEFB 3RL2B 1SVCP 4HWBH 1W0VB 2X4NB 2RFXA 1ZLUH 1UWGL 1M7IB 5IB2B 4XP6H 3L7EB 3VXPA 1VGKA 1H5BB 3MRHA 4PJHB 4X6BA 3IJHB 3WL9A 5D71H 1V3MA 3CVHB 3TFKD 5HY9B 5DMKA 4RBPK 4BFBD 3WFZA 5DC4B 3LN5B 4YHML 4XVSL 2Y07H 2OR8A 4IS6A 4L8DA 1BFTA 4Y5XC 5FDWB 4CL7A 1FFPA 3O6MH 3OBAA 5CILL 3MLSL 4M1GL 5TFSL 1AXTL 3SQOL 4NQVA 1CLOH 1A7OH 3KLHC 1XGRB 1NFDF 4YK4C 1CLYH 4PRHB 1D5MB 3KYOB 3P4NA 3VXUA 4MS8C 4NQDA 1NQBA 3QQ4B 4PJCE 3TWCH 3QCTL 3U9PL 4FQXB 2WM0A 3GSNL 1D6VL 1FDLH 2AK1L 5FAAA 2GEEA 3V5DB 4NQDE 3V5KA 4PGDA 3MRIB 2Z9TA 1CD9B 1H0DB 3NCCB 1EJOH 3GMLA 3ARXA 4YX2H 2IH3B 1LK2B 1SYVB 3O0RL 4PJGA 2O93L 2IADA 3K3QA 4RGNE 1IQDA 5KW9L 4HX1B 3D5OF 1A1NA 3ULUH 1EX0A 1VACB 3VRJA 2CSPA 2YOCA 4PTUA 4JDVB 1K3IA 1WITA 4EUPH 4IDJL 5D1ZB 4TNWK 5JXEC 3B9KA 5J1AA 5GIRB 3N85L 3P40A 4KQ3L 2VSCA 1VA9A 3TNNB 4TTGA 5BRZA 5DWUL 3TBYB 1YUHA 3MYJB 4WRLA 3SGEH 2VZTA 3HI6H 1I8LA 4PS4L 3QBTB 4U1IB 1XCQA 3RKDD 4Q2ZA 1B4RA 1MFDH 1CE1H 3E6FA 4JJ5A 1BP3B 1NGWA 3TBVA 5A2IH 5IJVB 4KVNL 4H1LH 4HUKB 5CHNB 4ZAKC 4HPYH 4XVJH 3C6SB 4K7FB 2IAMD 1G6RL 1P6FA 3VG9B 5LJYH 3JSSA 1SJEA 1T0MB 4DKAA 4DZBA 5GRWA 3DTXB 4JREB 1JNLH 2NY5H 5FKAB 4Q9QL 4HH9A 2K1MA 3P11L 5F1NB 4XXCC 4Y5VB 5E8NB 5E08H 3MV9E 2YC1A 2YD3A 5C07D 3MACL 5JHDA 1FRGH 5IB4B 4F33B 4KJYA 3MRLA 4B7IA 1OP5H 4FG6D 2CK0H 4WWKB 3V6ZB 3D39A 4LFHG 1GGCH 1QLRA 5HHPA 3MV7A 3BVNB 3MJ6A 2H3NA 4FMFA 1EGJH 2A6KA 1T89A 5FDYA 3D39E 4U3CA 3BPCA 4GW1A 3KPSA 1JE6A 4GAGH 5IBLC 4ELKA 1BVKA 1D5ZA 2VR4A 5B8CC 3QXUA 1T1YB 4WY7H 3VCLB 4R97C 1HXMA 1OAKL 4RRPA 4CGTA 3MROA 3MGTB 3DX9B 4GBXB 1GAFL 4ONHB 4F9PC 4LKXB 3HE7C 3IJYA 4NRYB 1NMBL 3HC0B 4MJ2A 1BIHA 3T0EA 1NAMA 3IGAB 2CRZA 4LSQH 5DYOA 5DHYB 2E6QA 1MVUB 3BO8A 1I9IL 4QCIA 1ZLSL 4YC2C 3V52H 4P2QA 3WO4C 2H2SD 3MLRL 2M26A 4BA8A 3FRPG 2Z8WC 3KPPA 3O8XC 5IM7B 5JOEA 5BJTB 3HI5H 1YEJL 1KYOJ 1XR9B 3TNMB 4K71C 1T1XA 1KN4H 1UYWH 4HHAB 3TH4T 3QDAA 1WCQA 1RZKL 1CGSH 4EEEA 1NCWL 3FT3A 1BD2D 4WI6A 1KPVA 4MXVE 1GL4B 3QZWA 4Q6YA 3LKNA 2X1WL 1P4IH 1NGPH 2OQJA 3ZE0F 5JW3L 4Z0XB 5F21B 1DL7L 3R1GL 4PRAB 1EVTC 1DEDA 4G9FB 1FL6A 1IC4H 2HRPH 1V05A 5ADOL 5IEHB 1J1OH 3HTLX 1MCLA 4QXTA 2PYEA 4Q9BA 2GCYA 2NMSA 4I0PB 3MOBL 4TNVK 3JWNC 1TQBB 3LDBB 5D70H 4IMLB 3QNYB 4LQFH 2OYPA 1DN2A 1UJTA 3G6AB 4LPYA 4NJAH 4Y5XA 3RI5K 3TFKC 3V6BR 1U6AL 4Y7MA 4LP4A 1T2JA 4ZFOA 4FABH 2X89D 2NY6D 4QTHA 1J88A 1OW0C 3REVA 3F7VA 2Q3ZA 4YDVB 4MA3A 4CJ0A 2X1XR 1VFBA 4MD5A 1KB5L 2ERJB 3MLVL 2DLGA 4MJIA 3OR7B 3F7RA 4KI5E 2FX7H 3EDEA 1YEDA 4PYGA 1RHHA 5D2LE 5E9DE 3LIZL 3SGDI 5C0AB 1F45A 5I71C 3X3FH 3GFUA 3PXJA 4HUVA 1NEUA 2VR9A 4NHUA 3WKMH 2IF7A 3VFGH 2P8LA 3T2PA 3P77B 3TEUA 4MA7H 2D0FA 1IEAA 2H32H 4JPIA 4S0SD 4ZFZA 3FAXA 5FCUH 5I15L 4O02H 1F58L 5EBLA 4AENA 5C09B 3LQZB 3MLYH 5IW1A 3PP4L 4ODVH 5J89A 1IAIH 2VDKH 5D7LA 1MJ8H 3G9AB 3SKMB 3CFEB 5JXEA 1DQMH 1W8NA 3QYCA 4B5EA 3CZFA 5T5FL 1CVRA 1HHGA 4RGOL 4URTB 3HLAB 1Q9LB 5D7LE 4WV1B 3VXRB 3MSPA 3BP5B 4X9GA 2F5BH 5IW3A 1MQKL 5SWQA 3VGGA 4ZUVA 1LO2H 3LN9A 4QRSB 4GLRH 4LLMB 4P46D 1IGFL 2BXYA 4JEGB 4PJEE 4AT6A 3UO1L 3OZ9L 3O4LD 3VFUA 3RKDC 4Y4KB 3VXOA 5GRVK 2E7MA 2P46B 4KC3B 1RZIA 2VO5A 5ERWA 5I75B 1M6OA 4N0FB 4EKXA 4S0TD 4YO0A 1BQUA 3HZKA 4ZAKA 4MCZB 1LMKA 1EEQA 3DYOA 1A6TA 3F62A 3L3DB 3MOAL 3WNOA 2E7CA 5B3NA 4XPBL 4PRPB 4KDTC 2HLFC 3CVHL 2IAMC 1G9ML 1F90H 1ZVHA 4XXCA 2OCFD 1MHCB 2H1PH 3OXSB 3D3VD 4WW2B 5DVOA 3DRTA 5HD8D 2ATKA 5CP3H 4DKEL 4X7SL 3IB4A 2WV3A 2XNAA 4DUVA 1VADA 3RJDA 1CIUA 5DD0L 1G7MB 4M7JH 4H0IA 5C0JA 1U3HD 1G1CA 2G9HB 4FG6C 2AK4D 2YKLH 4PJ7A 3VXSA 4KDVA 5KG9B 5IF0A 4HH8A 5KS9B 2ESVA 2D7OA 1IAKB 3LEYL 3LHPH 1JHTA 1FNHA 1EBPA 4IOFD 4OQ1A 5B8CA 2M2DA 2YRPA 4M6AA 4U1HB 1EV2E 4HUWB 5F7UA 3N1GC 2F54E 1IC7L 2APTA 2DQHL 1YEIH 1P4BH 1WWBX 3ZE2E 2HT2D 3HCVB 5FM8A 3HE7A 3PWPA 1JNNH 5BS0E 1T6WA 2GAZA 1B0GA 2V6HA 2W0FB 4XZUB 2PW2A 2YD8A 2Q8BL 4KROB 4FQJH 3QHFL 1R3LA 4YIQA 1UJ3C 4XBEL 3QWQB 4U7SA 5FA4B 1KEGH 3RVVD 2BVQB 2VISA 4FHBD 1CFBA 3SKUD 1BLNB 5DC9B 3O8XA 5JDSB 1MHHA 2H2SC 1P7QA 3HZMA 3SY0B 1TETL 2ZPKL 2BJML 4NM8H 3L1OL 4NWUH 3FO9A 1OY3B 3UTOA 3CNKA 3JWOC 1NCDH 4C56D 2B4CH 4JKWA 3U4AA 3U48A 3L5XH 1AGCB 5JHLH 1CE6A 1XGQB 5FYJU 2DTMH 3IS1X 2CXGA 1XIWB 4WW1A 2HA1A 4H5SB 5GRZA 1YY8A 2WZPD 1FAIH 5HYJE 5EU3B 2QL1A 1FFOB 4A6YB 3IDGA 3WHE0 2XWJB 3PWUB 1G6VK 3HNSL 5J1SC 3HMXA 4QWWD 2R23A 2YD9A 5CKAA 2DYPD 5ADPH 3QFJD 4P57A 3VWKB 1UXWB 3GRWL 4AL8L 1ZVYA 4Z7WF 4Q58C 1XGPA 1U3JA 1OGAE 4K94C 3M45A 3OJDA 5E2TL 3UROR 4WTZG 5EORH 1OW0A 3KPOB 4HG4K 1KG0B 2YEZB 2BSTA 2R0LL 1LNUA 2NY6C 1G1YA 1QBAA 3BZDA 5MEOB 3LVEA 5F9JA 3T09A 1VSCA 1Q94B 5F7YC 1I8KB 3QRGH 4M3JA 3MRDB 3U46A 4YDIL 1CFSA 1HHJA 4GG6E 1EIBA 4HIJB 1RFDL 4KRPD 1A7RH 2E27H 2MPAH 1OP9A 2QEJA 3D18B 4NKQB 3ZDXE 1T21A 4LLDB 5F72S 2BY0A 4Y89A 3ARQA 3VWJB 4DGYL 5I1LB 5F97E 5C0GB 3N1PC 5EBWB 1JZ2A 2A9MH 4JFYA 4XVTL 4K3HA 1DBAL 2OSLB 4LCWB 5DD1L 1RUQL 3K8MA 5ESAB 4OCRL 3NH7L 4KKBD 3TH2T 4NGHL 4Z7VA 3EJJX 5EIQA 4RAUA 1FE8H 5HTSA 5C71A 5EPMB 3EOTL 3BDYH 3LKPA 1Z2KA 1N0LA 2FR4A 1BWWA 2A6JA 4LSUH 2HJLB 1TJGL 2EDQA 1XF3B 1ZXQA 5EO9A 3F7YB 3TT1L 4XRCA 5F9WC 4EN3B 4MD4B 1WBYA 3MNVA 4L8SB 4P46C 1UWGH 4U6HB 1CG9A 3VGHA 5JORB 3GJFH 2R1XB 5D2NB 4JZNA 1KBGL 1KCRL 3HZYA 4KK6D 4TQEL 4XXDA 4I5BA 5KSBF 4R7NB 5EN2A 4YHMH 4BQ6A 4XVSH 3QWOA 1JI2A 3PJSB 4KDTA 2IAMA 5CILH 2XICA 3BZFB 3MLSH 1ETZA 4M1GH 4PJ8B 4N0UA 1AXTH 5TFSH 3SQOH 3MJ7B 1P6AB 1U92B 3GSOB 1TDQA 4KKNA 2E9JA 2A77L 5C07A 4DJMA 3LPFA 5GGRA 1CD8A 2H8PA 1ZT1A 4NFDA 1EO8L 5HD8C 4R96B 4XX1E 2XQBL 3KWWA 3NCEB 3QCTH 3U9PH 4MDJB 3GSNH 1D6VH 1FN4B 2AK1H 4QRQB 1SVZA 1CL7L 5AEAA 3NVQA 1U3HC 3IDYB 3T1FA 1U42A 2A73B 3GHBL 1JIBA 4GKZB 3ZDYF 4UV7L 3T04D 4UAOB 5D1QB 4R6UA 2X4OB 3L3JB 1SYSA 2VAAA 3GMRA 1UH2A 2IPTL 3O0RH 1F5WA 3WNLA 4Z95L 3ES6A 5KW9H 1EHLL 1UFUA 2B39A 4RZCB 1R3JA 2EE6A 2VZ1A 3MRNA 2HT2C 4NPYA 4EDXA 1RUPL 4IDJH 4I18C 3G5VA 1UJ3A 3N85H 4KQ3H 5F3BB 2X10A 2AV1A 1S7WB 2YPLB 5DWUH 4MSWB 4RNRB 1X5KA 2ZSVB 5HYSB 1JUFA 1OM3L 1Q9OA 3RVVC 2C1OA 5EU5A 3M1BA 4PS4H 3V6OE 1UACL 4M3KB 4GFTB 5GS0L 3FT4B 4N90E 3CSGA 1AO7B 3ARBB 2P49B 4HULB 1E27A 3BEVA 4PJFA 3DX6A 1ZSDB 5C9KA 5T33L 1NCTA 3NFNB 5JW4R 1LP9F 1EFXB 4KVNH 4JFQA 4S2SB 4PJFE 4DFIA 1BD2A 3JV6B 1U36A 3O4OC 1TZIB 2ITDB 5HPMA 3CFKA 4HCRL 2P8PB 1EUUA 1X5GA 1G6RH 1X3DA 2UWEF 4KXZH 4X9BA 4JKPL 4I2XE 3BRDA 1S9KC 2GITB 4IRZL 4Q9QH 4FXGA 4GH7B 3P11H 4YGVB 5MI0C 3DBXB 4X6DF 3MACH 1G0YR 4KRLB 4OB5L 4U1SA 3WS6C 4MAUL 4ELMF 1BQHB 2IBBA 2MMXA 4QWWC 4Y2DD 2P4AB 3KPNA 3H7BA 1P53A 4JPKL 3MRFB 5T3ZD 4GQ9L 4RMSA 5A3ID 5HHQB 5D96B 4P4KD 1FNEB 1T5WA 1J8HE 1H15A 3GUTA 3TPUA 2FCBA 2KQMA 3AY4C 2E9BA 2X89A 3VXTA 3PABA 3O6FB 3X14A 1ITCA 1MCQA 4MA1B 4X4YB 1RHFA 2VLLB 4LSDA 4HWNA 3NIGE 1QFPA 1OAKH 1GAFH 1ZGLM 4MB3A 4X99A 3VXMB 3BWUC 2ZP0T 2C3WA 4KRPC 1NMBH 1YA5A 4ISVB 4K7PL 1ZE3C 4J7RA 4R9HA 4PFEA 4NN7B 3S35L 4PV9A 1I9IH 1MUJA 1ZLSH 3QUZD 3NA9L 3OJMB 4LEXL 3MLRH 5E6ID 1A4KA 3K1KC 3MFFB 4JAMB 4ZTOL 2YD4A 2NY5C 2NTFA 2V17L 3GZKA 4PJDF 1LWRA 5DJ8B 3QUYB 4D9RE 5D5MB 3E6HA 1YEJH 4LLQB 2WQ8A 1IC5L 3ALPA 3PP3K 4ZFFB 4KKBC 1MCBA 3G6JF 1RZKH 2YHGA 1YPZA 2C9AA 4WEUD 1NCWH 1T7XA 2GJZA 2PTVA 3KPRE 3K81A 4NZJA 5C6PB 1T1ZB 1KT2B 5CEYA 4P46A 4MNQB 5JW3H 32C2A 3FOMA 1DL7H 1JRHL 3R1GH 2A6DA 5A1AA 5ADOH 3O4LA 1QRNB 3FKUS 4BQ8A 2W60B 4BH7A 2EH8L 3O11B 5B38A 3MOBH 3WDHA 2HFFA 1RUAL 2C4FU 4KK6C 4PGBB 5D7JD 5DURB 3CFJB 4UV4L 4HZLA 2E9WA 4X5XA 4GJTB 3G08A 1U6AH 5HHOD 4BFIB 4ZSOA 5CKGA 3QO0B 3RRQA 2IEPA 3ZT7A 2FWOB 1AIFA 2FJGA 4JFDD 2W9DL 2UZYB 2PYFA 3DMMB 1KB9J 1MFEL 3ZYZA 3D3VA 5INDB 1KB5H 3MLVH 3VD7A 5TDNB 4JLRB 4OZFH 2XN9A 1G7QA 4L5FL 3DGGB 2FHCA 1QSFB 3D3VE 4KVCL 3UTPD 1U3HA 1AHWB 3LIZH 4ZFGL 2NR6D 3LOWA 4KK8D 4L8CB 2EDEA 4UT6L 1K4CA 2AK4A 2VXQL 1MY7A 4UU9A 1AY1L 2ED7A 3C5ZD 5D9SB 5DT1L 5GGUA 3SCMB 5D72L 4GXUM 3L95B 2F58L 3IU4L 5EO1A 1ZT4B 5I15H 4LLYB 1F58H 2Q3AA 2DN7A 3UDWC 2CKBB 2F74B 1T0NB 3PP4H 4LHJB 1D6EA 5KANI 1QA9A 1S9WA 3PWVA 4NZTL 3RWCB 4OLYL 4JQXC 4I18A 5CAYB 4MNHA 1DSFL 5T5FH 1NGQL 1CFNB 3WD5L 4R2GB 4RGOH 5C0EB 1MFAL 4NQSB 5H37G 4R7DA 1KTKE 5IHZB 3CD4A 1MQKH 3QRFM 1ZANL 4K7PY 4JFOA 4UZGA 1IGFH 1BEYL 5D8JL 4KH2A 1TFHA 4GRLD 3UO1H 5TDPA 1B6DA 3OZ9H 5ICZA 3D25A 3ROOA 3VGFA 3BJLA 1Z0MA 4KK5D 2EECA 5J6GB 43C9B 3NIFE 4C56A 4P2OB 5MENB 1JTOA 1U8MA 5EU6D 2VKXA 5GGTA 3NAAL 4IIQC 2R2EA 4PP1D 1RY7B 1ROWA 3MOAH 4YWGL 3LRSB 1KPUB 3V4PL 4XPBH 1NPUA 3CVHH 1HKLL 4F2MB 1G9MH 3UCRA 1HI6B 3IDNB 1KYOK 4XPGL 5DJZB 3WS6A 4E5XA 3CSYA 5JMOC 4TUKL 4XAKD 3VGAB 4DKEH 4X7SH 1F13A 5FK9B 2G2RB 2FGZA 5DD0H 2UYLB 2DYPA 2O61A 4JN2B 1JVKA 4O9HL 3Q5OA 3QFJA 4F15B 3QNXB 4Y2DC 4L8BB 4U2ZA 2MQCA 1LD9B 1VHPA 1AP2A 5A3IC 1P5VA 1GGUA 1ZV5A 3AY4A 2OL3B 4P4KC 4LLVA 1HDMA 5EB9A 4LMQI 4ORGB 3CXDL 2LE9A 3LEYH 1ZA3A 2NY1B 1R3HB 5LGHL 2WLYA 3VI4F 3MUHL 2J7LA 1IC7H 1WBXB 4V1DB 4JRXD 3VH8G 1MIML 3KR3L 5CIPH 3U82B 1HWGB 1RIUL 5CSGA 4OZHF 4CW1A 1UB6B 4PREB 1JF5A 1H3WM 2OMNA 2XOTA 1AC6A 2EE3A 3VU2A 8FABA 2Q8BH 1IVLA 3BH9A 1CGWA 2KDGA 3QHFH 4UIMB 4Q0XL 1BZ9A 3PGFL 4XBEH 2ZOLA 3CDCA 4X7EC 1F4XL 5I74C 3EO0B 3Q6FA 1SJVA 1EEYA 2VKWA 1NBQA 4YFLI 2H26A 2VJXA 5I8EB 1S7VA 3QUZC 2IMNA 2D9CA 1TETH 2ZPKH 2BJMH 5E6IC 3L1OH 1HNGA 4ZD3L 4D0CB 3SE9L 3FQNA 1GGIL 2Z91A 1FZOB 3S35X 1VFAB 5C0CE 1JK8B 1NAKL 3RUGA 4F37K 3QIUD 1HILB 4P2RB 1MVFA 3JV4B 1YNKL 1JTTA 2ZUYA 3ZMRA 1EGJA 4PJXB 5A2KH 1R3IL 4Q6IB 4PJ9B 1VESA 4NN6B 4LAQL 5DJDA 5DJ2A 3BPOB 1FAKT 3BIBX 3LQAC 4CJ1A 4J3VA 3QDMB 3UYOD 2CR3A 2I07B 4KPHL 5FGCE 3QO1A 5ELIA 1VFUA 4YNYB 3O3BB 3HNSH 4AEHL 3BRGC 1IEBB 4RCAA 5ID1A 4LP5A 1KTDB 4R3SA 5IVOA 4XCCL 1CQYA 4N8VG 2VERN 3GRWH 3QDGD 4AL8H 1U8JB 5D7JC 1JYXA 4OF5A 3TA3B 3UZEA 5E2TH 2C3VB 3U83A 3DROA 4J23A 5IQ9A 2ZJSL 3OG4B 3P4MA 4CVXA 3F12B 5EZJB 2R0LH 2EYRA 4ODSL 4JN1L 4PGZA 3JXAA 3DYPA 1PD6A 3FRPA 4QRRE 2R2CA 3OKEA 3QUXB 4HC1L 4FXKB 4P23D 1OGTA 1TVBB 3QPQD 3UAJD 4CUCA 4YDIH 3ZTJH 2BSED 4EXPX 2AVGA 3WXVL 1RFDH 5IBTL 2NR6C 4KK8C 5K9OB 1JNJA 4XPTL 3BH8B 3ESVF 3SDAB 5IIEB 4IM8A 4JANA 4DGYH 5I73B 1I1FA 5C0FB 1PSKL 1CBVL 3HA0A 3C5ZC 3T4AB 2OZ4L 1CZ8L 4U6TA 4XVTH 3RY5A 3T0AA 1Q38A 3UDWA 3QIBB 3SDDB 1DBAH 1H3TA 5DD1H 2ITCA 1RUQH 2FJHA 4JQXA 1BJ8A 3ULVF 3DX7A 4OCRH 3WBDA 1II4E 1W72B 4L9DA 3MLPA 1TZHA 3NH7H 2X4QA 1F97A 4JJHA 4WHYG 4NGHH 3CJJA 4N9OB 3QHTC 3UTTD 2BERA 4GRWB 5FYLL 1WWAX 3EOTH 2JIXD 5E8PA 3V4VL 1TJGH 4GW5A 4Y4HB 3AS3A 5T1MA 3VXQB 1WFTA 3TT1H 1N64L 5IEKB 3H0TB 5I1DA 3NN8B 3P73A 1JF1B 3HR5A 4GT7A 1X6LA 4U6XB 3NPSB 3IDIB 4GRLC 4HIEB 4L9LC 1EXUB 1KBGH 3TO2B 1KCRH 2XY1A 4KK5C 4TQEH 4YFEA 4IIQA 1Q1JL 2NY4D 1T1WB 4GKNA 1SY6A 1KIQA 1UEMA 1UKTA 4OZIA 4HKZB 4PP1C 1BVLA 1SQ2N 3TV3L 5BV7B 5IOPB 3S4SG 2YD2A 1M1SA 4H26B 4FQQA 4N8CL 5SX4H 5HGDB 3D0LA 3ARWA 4HK0B 1E4JA 3FO1B 1FL5A 2V9TA 1FO0B 4F7MB 2A77H 1CI5A 2NLJB 1QUNA 1XMWA 1EO8H 5TE4L 1IZKA 3ZKSD 2XQBH 5IMKB 2BRQA 4Y2DA 5TPWL 4NWTL 1L9NA 5TGBA 1CL7H 4QLRA 2ZSWB 3VH8B 2AXJA 4WIQA 2XT1B 4NKOA 3I85A 4P4KA 3GMMB 3GHBH 4X6FB 4NZDA 2BK8A 1QR1A 3R4DA 4U0RC 3EGSA 4UV7H 3PWLA 1XFPA 2GT9A 1TNMA 2IPTH 1HHHA 1G9NL 4P5TD 1QKZL 1DDHA 4Z95H 1EHLH 1V3JA 2E8ZA 5DVMA 4BH8A 1LEIB 4BK4A 1G7JA 2BNUB 3KLAB 2W59A 4ZNCD 4HJGA 3O3DA 5KBNC 2Z4QA 2HMID 1RUPH 1BF2A 5KSAB 2V2WA 3RX7A 4YLQT 2V5RA 3BGAA 4FQIL 2CKBL 4RMWA 2CD0A 1DQJB 4YHIA 4WUUD 4WHTA 2HLAB 2B5IC 4PRNB 4OM1L 1OM3H 4G7VL 1X7QA 3QUZA 5E6IA 4GLRI 1UACH 5DJYA 3KGRA 5GS0H 4Y4FD 1RJLA 1MELA 3AS1A 5DFWH 2IANE 4JFFB 5AYUL 2YD1A 1UB5A 4M93C 5DA4A 5JNYB 3MV8B 5FB8B 5T33H 3FB8A 1S9XB 4M61B 3QEQB 2HVKA 1KELL 4I9WE 3VFRB 3HPJA 4YAQA 2HFEB 3ZL4L 2ICWA 3QIUC 2Q1EA 1L0XA 4HCRH 1WAAA 3DVGA 1M71A 3K8KA 1DE4A 1YC8A 4JKPH 4XPAL 1WWCA 1REIA 2EDDA 2FIKA 3NIDF 4IRZH 3VFMA 2P24A 3L3HB 4L3EE 4KFZC 1K9TA 2ARWA 4OGXL 4W6YB 3IKCA 3NCYP 3WE6A 4OB5H 1HSBB 1VGEL 4J6RL 1NC2D 4MAUH 2I9TB 3DUUB 2VZUA 1NMAL 3NFSL 5KOVC 5SWZD 4YHZL 3RZCD 1DEEA 3DO7A 5D7JA 4JPKH 4GQ9H 3BIKA 3OKLB 3CDGB 5JW5A 5HHOA 3BESR 5JPNA 2ICWI 5KOMC 1PW3A 3OR6B 1DLHB 2YSSB 4G6ML 5EUOA 3PWJA 3IFOB 3RL1B 4JFDA 3THML 2ARJQ 5HHOE 4L1DA 1JGDB 5I66A 1MHPL 5HYQA 3ZSTA 3IRZA 4M1DL 2JB6A 2OJEA 2X4UA 2OL3L 3WV0A 4HIIB 3TIEA 4P23C 4ZUWA 4S11A 2UUDK 8CGTA 3QPQC 4HKXB 3WUWA 3VFWA 4X7TA 3PGDB 3DV6B 1NFIB 4HAGA 3WNNA 2RCSL 2X44D 3ZE1F 1I3VA 3BGMA 3ARUA 3BMVA 4K7PH 5J12C 3M8OL 3Q6GL 2GIYA 3ZHLA 1NFDE 1HSAB 4RQQA 3C5ZA 4OCWL 3RAJL 3S35H 5EZLB 1DQLL 4NT6A 5B22A 3NA9H 5ENWA 1LE5B 2ORBL 4LEXH 5E5MB 4ZTOH 4EI6A 1JGUL 3BD5A 2V17H 4P3DB 3GSRB 2FJFB 4NNXA 3E3QC 3FO2B 3A6OA 4QYOB 2ZCKL 4GUPA 1QOKA 5IK3A 1IC5H 4PRHD 3EYFA 4UQ2B 3BWAA 5CP7A 5FO9B 4X98A 5KSUB 5F7HA 2JJVA 4L4VE 4AEIL 3FT2A 2XPGA 4FQXD 5IBUG 3KDMA 4UUJA 1WZ1L 1UEYA 4LLWB 1JHKL 1JRHH 2AJXL 4UT7L 1KPRA 2VB5A 4GRLA 5K59F 4EOWL 1IARB 4L9LA 4HLZH 4HUUB 1Q9KB 1Q0YL 2I60L 4ZS6D 2EH8H 4Z7UB 2OMBA 3I50L 3W0WB 1RUAH 5EU6A 3QDJE 4UV4H 1ACZA 2NY4C 4K2UL 4F7CA 4NNYA 4F7PB 5J8OA 1JWUB 3HI1A 4KTDL 3CMOL 3ILQD 5CGTA 1CGYA 2J8UA 2VZ3A 1Q0XL 2W9DH 1OAQL 5EWIL 3REWB 1MFEH 1MPAL 4RIRB 1R5IB 2D7QA 4E41D 1HHIB 2V2TB 1ZA6B 3CXHK 4L5FH 4KVCH 5F7KC 4ZFGH 1RV6X 2JJUA 1RAMA 3OPZL 3H9HB 4UT6H 2X6MA 4ZQKB 4KRNA 1RZJL 2VXQH 5M7QA 1L0QA 4EXKA 3OX8A 5F9DC 1AY1H 5C0BE 1XR8B 4HGKC 2R56L 5DT1H 5ACLA 5D72H 1ND0A 4XWOD 4GKSB 5J13C 3GB7B 3N1FC 2CH8A 4OSUL 2F58H 3IU4H 4LAJH 4NC1C 1LO5A 2NYYD 4P5TC 3MA7B 1KLGB 1P7HL 4JVUA 5IVXB 2CLRB 4JRXA 4NZTH 5JTWA 4EBQL 4XC3L 5DJ0B 4OLYH 4CN1A 2V7HA 4OFPA 1LGVA 5ESQA 2HMIC 5I1CL 1DSFH 4H25A 1NGQH 3FB7A 3WD5H 1NL0L 4HAFA 5F7LB 4ZMAT 4IDLA 1MFAH 3D85D 1EHNA 1U58B 2I25N 4XPHL 1VKXA 4ZPVA 3HKFA 1ZANH 4XPFL 2N7AA 1FG2B 1C12B 3QNZB 2PW1A 4WU7A 5LG1A 4JQIL 2D03L 3VFSB 1BEYH 5D8JH 5DXWA 3AFLA 3STZA 4Y4FC 1UCTA 2AJ3A 4J3SA 3GSNA 4QRTB 4HKJB 2DJ4A 4YFDB 1U8PB 3DURA 3QIUA 3NAAH 2MOVA 5C0IA 1DQDL 3AB0B 4YWGH 4GAJL 3V4PH 2XYCA 4QRPB 4MMXC 4GBXD 4JFZL 1ZLWK 1HKLH 4CU6A 2ZUVA 2VUYA 3FL7A 2BVTA 2VQ1B 2YA0A 3O3UN 5IKCB 4XPGH 3MUZ1 1Y0LA 3QEHA 1NBZA 4IMKC 4TUKH 4RSVA 2VQUA 2K7PA 3KAAA 2EKSA 3L5IA 5BV7L 5IP4A 4P2CG 3SE8L 3VGEA 1D9KB 2EDKA 3SKOA 2AKRA 5ACMA 1EAPA 4O9HH 1HHKB 4OUOA 3RZCC 1FO0L 3QDGA 4F3FA 3GSXA 2X4TB 3ZE0E 3DXAB 3L6FA 3CXDH 2CPCA 2XWTB 4LNRB 5LGHH 1YYML 1T3FB 3LEXA 4YGAB 2JK5B 4P23A 3MXWL 3PG2A 2QJDA 1K4DA 4OTXL 5AD0B 3LH2L 1MIMH 3KR3H 4HXBL 1RIUH 4X9FA 1U9KA 4I77L 4G9FD 5INCB 2X70A 1J1XL 4B53A 1AR1D 4I0PD 4Q0XH 3PGFH 4NDMB 3UMTA 1F4XH 1OAZL 1WJ3A 2DIAA 4LU5L 2C4XA 3G6DL 5FYKL 4XGZA 4UMGA 4I48B 2AEQL 2VDOL 5BW7C 5DS8B 4NO0D 4ZD3H 3UBXG 5ABDE 3SE9H 1SJHA 4P99A 1GGIH 4YBLB 1P7KA 2RGSA 5M94B 5I16B 3RP1A 3VRIA 2WAHA 1NAKH 3UTTA 1U95A 2CDGB 3QCUL 2QR0A 5DI8B 5I1KL 2JIXA 1YNKH 3U4EB 2F15A 1R3IH 2VXVL 1KN2L 5B39G 2BNRB 4G80B 1AGEB 1ED3B 4R90L 3OWEA 4FQXC 4LAQH 4ZPTB 5C0AD 3SN6N 1PLGL 3OKNA 3QB7C 5JXAL 1B0RA 4H8WL 2FRGP 1V7NL 4KPHH 3V0WL 2UZXB 3KXFB 4MCYA 2ZNXA 4ODXB 3GMNA 2OS7A 4AEHH 2C1PB 3L3KB 2DLTA 3FN0L 3WS3B 5AZEL 5IMLA 1NLBL 3GSWA 1YMME 4XCCH 2OI9B 1B4JL 4P3CL 3GIVA 2H6PA 4M8VA 5C09D 3UZVB 1AKJD 4PJGF 5D7KD 5GGSB 1YEFL 5D7SL 1QFWM 2NPLX 3V4UL 2ZJSH 5FYJL 4JCLA 2DI7A 2EDJA 1BX2B 1TJHL 3ILQC 3HG1B 5EU4B 2OXHA 4LARL 4ODSH 2AGJL 4JN1H 4LPUA 2UZIL 2X4PA 3EOAA 4IOIA 2XZCL 3S97C 3VXRD 4HC1H 3FFCE 1FH5L 4K9EC 1O0VA 2J8OA 3WXVH 3BUYA 4G42B 2BMKB 3FFDA 3RWFB 4DVRL 3SJVB 5IBTH 1F4HA 1TLKA 2XTJB 2ILLA 3U30C 2W38A 4P5KB 4XPTH 3FONB 3MRQB 5GPRA 1CGTA 2GFBB 5I2IB 3VFOB 1CBVH 1PSKH 1H3VA 4TOYL 2OZ4H 3H9SB 1PG7L 1CZ8H 1HNFA 4P5TA 4XWOC 5I6XC 2F8VA 1ZHLB 1FSKB 1PAMA 5GSRB 3B5HA 4LCUB 1PFCA 1KIPA 2NYYC 4PRPD 1A0QL 2YXMA 2WIIA 4HWZA 1FZMA 3RTQD 2XKNB 4TVPL 4PRDA 4M4RA 4OBSA 3VG9C 4ETQB 3CFIC 4D8PA 4F8QA 4JZOA 1HXYB 5E1HB 4NN5B 2ZUQB 1RK0B 2HAZA 5FYLH 2XZQL 4Y5VC 1AGDA 4Q97A 3V4VH 4WUUA 4AG4L 4MJ6B 4J3XA 3Q2CA 2EO1A 1N64H 4P9HL 5C08E 4Y4FA 1OF2A 1BJMA 1FVEB 5SV3A 3P4OA 5K93A 3VFPA 3D2UB 2W07A 2VZSA 4WFFE 4YHKL 5BQ7B 1QYGL 1Q1JH 4YHNB 3L7FB 4DZ8B 3L3IB 1X4YA 1I1YB 2CJUL 4OKDA 4GXUN 1WICA 4JKLA 5JQHC 3TV3H 4NYLB 2XQYG 4X0KB 3FOLB 4N8CH 2XFXB 4GBXC 1JI1A 4NO2B 4IMKA 4P48A 3RWHB 5EA0L 1R24A 1I3RA 1YJDC 4KROD 5TQ2L 3KNBB 3TIDA 1NC2A 4PV8B 2GQHA 5TE4H 3AGVA 5D6DC 5SWSB 2PXYB 5SWZA 2ADGA 3RZCA 1O5DT 5TPWH 4NWTH 4M03A 3HS0A 1JTPA 1UGNA 5I1AA 3KVQA 1U8LB 2LTQB 3C5SA 5F89B 1G9NH 5IGXL 1QKZH 2CRYA 5C0ND 3QPXL 1WCBB 3FQWB 4Y16B 4TSAL 2XRAL 1L4IA 1GVIA 2MNUA 5JA9A 1XIWD 2AEPL 2DL2A 2P45B 1VFMA 5HVWA 5E8OB 4OD2A 4Z7WE 3RL2A 4EZMA 1W0VA 2X4NA 1F6AB 4KK9D 2PO6B 5IB2A 2FEEL 4FQIH 3LN4B 2CKBH 2E9IA 3OXRB 4PJHA 4NJ9L 2DWEB 3D6GA 3IJHA 4DK6A 1NJ9A 1AR1C 3CVHA 4I0PC 4OM1H 3QI9B 4JCMA 1MF2L 4PG9A 4G7VH 5HY9A 3C60B 3VWKD 4Y19E 1ZWIB 1N2RB 3LDBC 5BW7A 2ENSA 5H35B 3B3IA 4F58L 4M7ZB 4XH2B 1INQB 3S96B 1VEMA 5AYUH 4HS8L 1XGRA 1A7QL 3V2AR 4ODTL 2AV7B 4X9HA 4PRHA 1D5MA 2DWDA 1QTYT 3KYOA 2QLVB 1KELH 3QXTA 4NUGL 3GJEA 1WLHA 15C8L 3ULSB 2NY2B 1A2YB 3ZL4H 3QQ4A 3OJVC 4FQXA 5D7IB 4ETYA 1H8OA 4XPAH 3MA9L 1U41A 3SDYL 3QULB 3MRIA 5CD3B 5FHBL 4O2FB 3N06B 5DVNA 4OGXH 3VWJD 1VGEH 5IMOB 4J6RH 1LK2A 3WDIA 2A0LD 2ARJB 4X8XA 3NFSH 1NMAH 4YHZH 3MJ9L 4Y1AE 2PKDA 2MCG1 3QUMB 4OZGB 4HX1A 4JM2B 2EIEA 5GS2D 1VACA 5TF1L 4JDVA 2KBGA 5ESVB 4G6MH 1RJYB 2WMPA 3THMH 4RA0C 5GIRA 1FZJB 1NKRA 4LVHB 1MHPH 3EHBD 4K8RL 5DHXB 4LDEB 2RQ8A 4M1DH 3TBYA 2BVUA 2H45A 1NKOA 2OL3H 4E41A 4PIRF 2GUOB 1JN6B 3L3OB 5C0DB 5HHVL 1QD0A 3MYJA 4RAHA 4EN3D 5KSBE 4CN4A 5CBEB 2RCSH 4E41E 4U1IA 1C5DB 5F44A 3SDXB 2X2YA 3M8OH 4ZNEA 3Q6GH 3RNQB 1JPFA 3V9FA 5HVHB 4OCWH 3RAJH 1P2CB 1DQLH 2V5YA 1QP1A 4L4TB 5I75C 2ORBH 5DGRA 1K8DB 5ECJE 1JGUH 1W0WA 4PGJA 2ZNWA 3C6SA 4K7FA 2VMFA 4ERSL 4PJ8D 2OTPA 3S5LG 2EDNA 2C4FT 5FKAA 1PG7X 3RTQC 5F1NA 5F88B 4Y5VA 5E8NA 1AC0A 3PHOB 3GRWA 3ZDYE 4CBPA 5ANMB 5GHWL 3D85A 4WW2C 4F33A 2EEDA 4AEIH 1GPOL 2F8OA 4Y88A 1WZ1H 2VLJD 1VEPA 1UWXH 2HVJB 3V6ZA 1NEZB 3Q3GB 1PZ5B 2P47B 1JHKH 2D0GA 2AJXH 4UT7H 2BNQB 2KUTA 3BVNA 4EOWH 2Y1VA 3TN0D 1CDYA 1TVHB 1AFVL 1Q0YH 2I60H 3ZYJA 5L2JB 4LPCA 4PJ7F 3I50H 1X44A 1A6ZB 1BJ1J 5FYJE 4F7EB 3C08L 5IFJA 4K2UH 1T1YA 2P8MB 3VCLA 1JP5A 3CDYA 4NP4L 3MUGB 2XKUA 4KTDH 3MGTA 4GBXA 3CMOH 1QQDA 4ONHA 4YBQD 4LKXA 1FYTB 4G7YL 1IGIL 1Q0XH 4NRYA 5KZCB 3HC0A 1OAQH 5EWIH 4XT1C 3F6IA 4GS7B 1A14L 3IGAA 4BZ1L 1MPAH 3O3EB 5D6DA 5DHYA 1MVUA 1Y6KR 1LP9E 3RVXD 5HYEA 4I4WB 1VERA 1YYLH 3OPZH 5IM7A 1A9BA 2EEAA 4RX4D 1AO7D 2UWEE 5BJTA 3ARBD 1RZJH 2D3VA 3W11D 2VZOA 5H2BB 3K7UA 1T4KB 1XR9A 3TNMA 2R56H 5E1AA 1A7PL 4OSUH 4X6DE 1EFXD 4KGJA 4JHWL 4G6AD 6CGTA 4TVPE 4W4NA 1GC1L 4ELME 3ZDZF 1ZS8A 1FFRA 5C0NC 1XIWC 4EBQH 4XC3H 5H37H 2BHUA 4LQ1A 2BFVL 4PRAA 3INUL 2J2ZA 5I1CH 2PETA 4G9FA 5DUBB 1CDHA 1NL0H 5KSVA 3CU1A 4Z0BL 5IEHA 4UQ3B 1ZHKA 4KK9C 1XF4B 3TBTA 4I0PA 5JLZB 4XPHH 4AIXA 1BQSA 4OQTL 2WLZA 4ZTPL 4XPFH 4IMLA 3QNYA 1FV1B 2CRMA 4PG2C 3SO5A 1QFUL 3G6AA 4JQIH 1OLLA 4GRWH 2D03H 2DQFA 3VWKC 3C09B 4NO0A 2DI8A 3UTZB 1RU9L 2AJZB 3TM6A 3O6FD 4I3SL 1QSEB 4W81A 1ZHBB 2R4SL 1IM9D 4LF3B 2EIBA 3OR7A 4Z77B 1DBKL 4G8GE 1HCFX 1DQDH 4GAJH 1FBIL 3R8QA 1J8KA 4JFZH 5C0AA 4IJ3C 4NKIL 5SX4I 4PJDE 2AJUL 3O6KL 4UILL 2HP4A 4U49A 3QA3B 3TYFB 5J06A 1KJ2L 1C7SA 3P77A 5CINL 4HJJL 5IFHL 5BV7H 1JYWA 3VWJC 3SE8H 3MRBB 3G6JE 2HTLD 2Y4SA 3ULVL 1MI5E 5CGYC 4OV5A 1FO0H 1JZ5A 5C09A 1CL7I 1DVFB 4OLVL 1AKJA 2B1AL 5J3HD 3IFNL 2OR7A 3QUYD 4JFEE 1R3KB 1OTUD 3SKMA 5FV1L 3CFEA 2ICEB 2DD8L 4POYA 4MHHI 5D7KE 3O41A 4X6CB 1YYMH 4K07A 1Q9LA 2VDLL 4G8IB 5HVGB 1BFVL 4CKVX 3VXRA 4O2CB 1FFQA 3BP5A 4Z7VF 4YEFA 3EHBC 3JWDL 4IRSB 1H9VA 5C9JB 3MXWH 4OTXH 3LH2H 4QRSA 1RIHL 1AXSA 4HXBH 2I27N 4JDZA 4EN3C 4I77H 1KTLB 4L8SC 3ALXA 1J1XH 4DAGL 1QRND 4JGJA 2HRLA 1BIIB 4HCRA 1U8IA 5D2NC 1OAZH 4LU5H 4MCZA 3G6DH 5FYKH 5DURD 4HS6B 1EZVY 2YWYA 1OQXA 2AEQH 2VDOH 5HYFA 3L3DA 3DX8B 4PRPA 2V9QA 2AERT 4NBXB 3RTQA 5EIIB 3S88L 4EVNB 2EC9T 3MLWL 3N9GL 1MHCA 3DMMD 4HS3B 3QCUH 3OXSA 4WW2A 4RRPG 1NCNA 5I1KH 2JJWA 5JIKA 5I76B 5DO2D 4UDUB 1N4XL 2VXVH 1KN2H 1IQWL 4WFGD 1G7MA 4YHOL 1XT5A 1CXKA 1CDJA 4R90H 2G9HA 3GSUB 4N5ED 2PTTB 1PLGH 1MCPL 5JXAH 4H8WH 1YNTA 1V7NH 2GJ6B 4JRYB 1A02N 3JUZA 3V0WH 3IDYC 4M5YL 4UB0L 3GJFK 5KG9A 2PF6A 3SCMD 3TN0C 4UAOC 5J11B 4MAYD 3FN0H 2VWEC 2EEBA 5AZEH 1NLBH 1FNGB 1X4ZA 1U8KB 1K85A 3NCFB 4U1HA 4HUWA 1B4JH 4P3CH 1KIRB 2EE9A 1DZBA 1VGKB 4PRIE 1BBDL 4YBHA 1YEFH 4X6BB 5D7SH 3WL9B 3MOQA 3V4UH 4JZJB 5FYJH 1TJHH 3QUML 1UH3A 4MJ5B 2W0FA 4ODHL 4LARH 4XZUA 2AGJH 3S37L 4R2GD 2UZIH 1JPTL 2XZCH 4X7DC 2YD7A 2BVQA 1FH5H 1OSZA 2G5BB 4HMCA 1BLNA 5JDSA 4PJCB 3I3EA 1N0XL 3RVXC 3OHXB 4DVRH 5F1KC 2OLDA 2Y25A 3SY0A 4NZRL 4NQDB 5ACZB 4Y2OA 3Q1SL 4DK3A 3D87B 4P2OD 5MEND 4TOYH 4XNUL 3BW9B 1AGCA 1NANH 4XVUD 5BCAA 1PG7H 5HHNA 4WHYH 1XGQA 2QTEA 4G6AC 3U0PB 4RGNB 1RMFL 1XIWA 4YDLB 1EZVX 1A0QH 1NH6A 4BSJA 1T66D 4OUUB 4TVPH 2NX5E 2P5WD 5EU3A 3GMQB 1IQDB 1F2XK 1X5IA 3NZ8A 4A6YA 2XZQH 4Z7QF 3RIFK 5JW4M 4WFHD 3VRJB 1EEZA 3RIAK 4AG4H 5J9PB 2DDQL 1TVDA 5T1KD 4PG2A 4WFED 3VI4E 2UVFA 3VWKA 3DLQR 3VE0B 1MSPA 1PDKA 3BT2L 4P9HH 4U1KA 3H8NA 2GTWB 5D96C 5CZXD 4Y0GA 5HHME 5L2KD 1MCWW 4R8WL 4OZHE 3OTTA 4WI5A 5EIVA 4OLEA 2Z92B 4YHKH 2WUBL 5MEOA 1HH6B 1QYGH 3O6FC 4Q2ZB 1Q94A 1I8KA 3MRDA 2CJUH 1ADQA 1PY4A 4V1DD 5CEZL 4LVOB 2R69L 4HIJA 1NGWB 1H3UA 3D18A 3TGXA 4LLDA 4MA8L 5EA0H 1U0QA 2YN3A 1QHOA 2D7MA 3VWJA 3ETBF 3EYVB 3MV9B 5C0GA 4QRUB 5J56B 5EBWA 2ADFL 1OPGL 1DQTA 4PJ5D 3LKQB 5IMMB 5E99L 2HTLC 3DETD 4XCEB 2NY7L 3C87A 4M02A 2CDEA 2P5ED 5JQ6L 1K6QL 2D4DA 2AJVL 5ESAA 4KJYB 4WO4B 5J3HC 3QUYC 4L29B 4OIAA 4LVNB 1HQRA 1OTUC 3D39B 4KUZL 5D93B 5IGXH 5EPMA 4P2RD 3QPXH 4Z5RA 4TSAH 2XRAH 2H3NB 2FO4B 3LMJL 1NDMB 3OGCA 2HJLA 4LCCC 1F42A 4PJ9D 1TTGA 1XGUB 2AEPH 4TSBL 3UJJL 1YPZF 3F7YA 4EN3A 4MB4A 5A40E 4MD4A 1YEKL 2GSGB 3QDMD 4L8SA 4U6HA 1C5BL 1RIVL 5E94A 2IWGA 2F53E 4WTWA 5JORA 5J6HA 2R1XA 4Z18A 3L3GA 1TJIL 5D2NA 3MRRB 4NJ9H 4NKMA 3PL6D 5JA8B 5L0QB 1MF2H 3NMEA 5DLML 3RX5A 1QVOB 4R7NA 2V2XB 3TA3D 4F58H 1NAMB 3HE6B 2R9HD 3O2DL 3BZFA 1QNZL 4PJ8A 5AWNL 5DDHB 3MJ7A 5HDBE 4QCIB 4HS8H 1U92A 1A7QH 3GSOA 4ODTH 1AQDB 3KPLB 3ZKXB 3KPPB 4NUGH 3DMMC 3QUXD 4G9DB 15C8H 2ICWJ 4Z6AT 4R96A 3ME0A 4PD4J 5DO2C 4MDJA 1T1XB 1ZKAA 1FN4A 4QRQA 2VLJA 4JFHD 3MA9H 5GRJL 1XZ0A 1VENA 3SDYH 4N5EC 1S9VB 4JPWL 1PG7W 2Q86B 2A73A 5FHBH 3ET9F 1X5LA 1J05B 5C8JB 3ULVE 2OTUB 3T8XB 2ZUSA 4GKZA 3B2UD 2PUQT 2VLJE 3SDAD 3UEZA 3TN0A 3ARDB 3QZWB 2X4OA 3L3JA 4GXVL 4QOKE 4KTYA 1E4XL 3EDJA 3SCMC 3MJ9H 4MAYC 3QIBD 5DRWA 1T0PB 5IHBA 2GCYB 5TF1H 1PYWB 5HDQH 3RWJB 2W9EL 5GQBA 3P9LB 1MJJB 1T22A 4DN4L 1U2CA 5IJKC 3QWRD 5F3BA 3R0MA 1C08B 4K8RH 4R2GC 1S7WA 3TZVB 4MSWA 4RNRA 4RFNC 2ZSVA 4Y4HD 5HHVH 1TXKA 3UBXA 4ZFOB 2RIKA 4QTHB 3VDBA 1C16B 3NA4A 4MA3B 2DIBA 3S37X 1VFBB 4M6ML 5D2LB 5E9DB 4RX4A 1AO7A 3ZYIA 3ARBA 3LPWA 1I1RA 4MQ7B 1UADC 4IHOB 1YEDB 3QQNA 5DD6B 3NIFF 3NFNA 4N9GB 3SKNB 5AG9A 3LB6D 4NQEE 1EFXA 4P2OC 4S2SA 1FL3B 4XVUC 4CAGA 5FGBC 3JV6A 1TZIA 1I1AB 3TO4B 2P8PA 4ERSH 5F8QC 2GITA 1Z9LA 1T66C 3OAZH 2BOBB 4YGVA 2JTDA 3DBXA 3SPVB 4P2YA 2AXGA 5GHWH 2ATPB 4UIKL 3D9AL 4HDIA 4X4ME 1BQHA 2PCPB 5HPOA 5C7XL 3OQ3B 5D7LB 1GPOH 3QHZL 1A7NL 1HHGB 5HHQA 3GJFB 4ZUUB 1FNEA 4F15C 3CDFA 4PJEB 5SWQB 1GH7A 4HD9A 1AFVH 5CZXC 5LGJB 1F3JB 3DIFA 2HT3D 3O6FA 5F7WC 1CT8A 1MCHA 4X4YA 4JO3L 4L1HA 2VLLA 3QP3A 3C08H 4OI8A 4YFLF 4N1CA 2FYYA 4NP4H 4A2LA 3HZVB 2R1YA 5ERWB 4EIGB 4OI9A 3O3AA 5KSAD 1J87A 4YO0B 1BAFL 1A3RL 3HZKB 3PE9A 4G7YH 1IGIH 5FYKD 3RZWA 1P84J 4ISVA 2YWZA 4FMKA 4OZ4A 3LZFL 4HKBB 3U0WL 1A14H 4BZ1H 1G84A 1S8DB 5IG7B 4ZUSA 2Y5TA 4JG1L 2G75B 1DN0A 3MFFA 4JAMA 3N50A 4K3EL 5L7XL 3DETC 3DRTB 3UTSD 1EHXA 1RUML 2ATKB 4AIZA 5DJ8A 3QUYA 5D5MA 3TVMB 1CLCA 1MAKA 1Q9WB 1VADB 1BBJA 1MH5B 4LLQA 4BKLB 1A7PH 5C0JB 4ZFFA 1MLBB 3QEQD 3NCJL 4JHWH 1GC1H 4LCCA 3NCBB 3U4BL 1T1ZA 2B0SL 3RUGF 2F54B 4Q6IC 4PJ9C 1BZQK 4NN6C 1JHTB 5IB3B 2BFVH 5B8CB 3FJTA 5K9QI 1TQCC 3BPOC 3INUH 4R97B 5BS0B 1T83C 4Z0BH 1QFWL 1QRNA 4CU7A 2JCCA 2GY5A 3HE7B 1N26A 3O11A 4OQTH 2Z35B 3A67L 1R5WB 4ZTPH 3ZLQC 3PL6C 4PGBA 3CFJA 3FB6B 1QFUH 5L9DL 1MCSA 3IETB 2JCCE 3LKSB 1R3LB 1CD1B 2JJSC 2QSQA 3RVWD 3TA3C 5KVEL 4OJFL 3PV7A 3WO4B 3S36L 1RU9H 2R9HC 2FWOA 3MYZA 3EBAA 2X4RB 3O8XB 1IL1B 4I3SH 3DMMA 1P7QB 2R4SH 5DHVB 5TDNA 1G6RB 4JLRA 4K71B 1DBKH 1T7YA 3H3BC 3QUXC 3MCKB 1FBIH 1H8NA 3V8OA 4NKIH 1CICB 4MNGE 4L8CA 4G43A 1S7RB 3O6KH 2AJUH 4UILH 5I17B 1CE6B 3B9VA 1KF9B 5HYJB 1F6LL 3FN3A 4QHUB 1KFAL 1KJ2H 3A6BL 1WIPA 5D9SA 5CINH 3B2UC 2HN7B 4HJJH 3SCMA 3SDAC 5IFHH 2RAMA 2DICA 5I73C 4MAYA 2DB8A 3L95A 3ULVH 1ZT4A 4KZEL 3MBEB 4LLYA 1TNNA 2Y5EA 4OLVH 5DSCB 2DBJA 2CKBA 2YUVA 2F74A 2B1AH 3MNZA 3QIBC 1T0NA 3IFNH 3V95A 1ORQB 3RWCA 2R23B 1OGAB 5IB1B 3TBSB 5J1TC 4KV5F 2DD8H 1B0WA 1LO4L 4P57B 1CFNA 3B4NA 4OD3L 5K59E 5L8LB 4PJAA 2VDLH 4NQSA 1BFVH 5GZND 3D1MC 3JWDH 5IHZA 1IFHL 5DZOA 3VD3A 3AU1A 3D0VA 3WIFA 1A1MB 1RIHH 4Y4HC 2BSTB 1NGXB 3DPBA 4GG6B 1WFNA 2IG2L 1MCCA 2PNDA 1OP3K 3NZHL 1WK0A 3P30L 3V7AG 4DAGH 4BELD 5I71B 1WISA 1MCDA 3CK0L 1QACA 4FRWA 4P2OA 5MENA 1AXIB 5FGBA 1GHFL 3LB6C 1T21B 2J12B 1URLA 2Y9RT 1RUKL 2W0LA 1I4FB 4FQ1L 4M8QA 2YMXL 3LRSA 4LLUB 4LRIC 2WBJB 4H20L 3FB5B 4F2MA 3ILPB 4V2BA 3S88H 2V5MA 3IDNA 2P5WA 3MLWH 3N9GH 5DJZA 1WSST 4OZIF 3BKCL 5F8RC 4OIBA 2J5LC 1NAML 1YEGL 5FK9A 3MRJB 2G2RA 2P5WE 5ID0B 3CSPA 1N4XH 1H3XA 1IQWH 2UYLA 4YHOH 5T1KA 1LDSA 3ARZA 4ZG1A 3K4AA 3RY4A 3BEWA 3IDMB 1MCPH 4L8BA 1D3CA 1LD9A 2DJSA 1ZLWH 4ODUB 2OL3A 1I9JL 1OQOA 4M5YH 4UB0H 5L2KA 4PJBA 5EO9B 4ZYKB 4ORGA 5BZDA 5DMGD 1WBYB 5IV2B 2HT3C 5L2KE 1GSMA 2LU7A 4PJBE 2J4WL 1XF1A 3QG7L 4EI5B 1WBXA 3KHOA 4V1DA 4CVWA 1BBDH 5I8CB 2QSTA 5E00B 1SEQH 2QQLL 3T0VA 1KB5B 1UB6A 4I5BB 4PREA 3QUMH 1DUYB 4ODHH 5KSAC 1NGYB 5EN2B 3S37H 5CJBA 1JPTH 4OZFB 2EE2A 1A1OB 4UIMA 1NDGB 1CGXA 1JFQL 1ETZB 2IALB 3EO0A 4FQCL 3MGOA 4PJ5A 1R5VB 1JBJA 1N0XH 5I8EA 2FIRT 3SDCB 3LV3A 3ZZ1A 5GGRB 1ZT1B 4KJWD 2P5EA 4NZRH 2APVA 5CJQL 4D0CA 5B38G 4PJ5E 1I8MA 1VFAA 5GSVB 4ZFOL 3PDOB 4YXLL 4QEGA 4XBGA 3Q1SH 1JK8A 3ALWA 2P5EE 4XNUH 2EIZB 4P2RA 1IM3B 1HILA 3CVIL 5DQJB 1A3QA 4PJXA 5KN5A 1RMFH 4PJ9A 4Q6IA 4B0MM 3PUCA 3QISA 5F1OB 5KANG 1CD0A 3QDMA 1F4YL 1T83A 1FC2D 3E8UL 3ES6B 1WAAF 1MLCB 5EC1B 4PTTB 5MEPB 4YNYA 1R3JB 3IAQA 1IEBA 1D9KD 3PL6A 1WT5C 2DDQH 1KTDA 5DMIL 4QHNB 4OM0L 5GJTL 1KUMA 3G5VB 3BT2H 1U8JA 4G8EB 1SMOA 2JJSA 4K8RD 1DLFL 3TA3A 4BUGA 2C3VA 2I5YL 5CBAA 5F1SA 2X4SA 2C7UB 3DXAD 4R8WH 3RVWC 3F12A 5EZJA 5DK2B 3M1BB 1JPGB 3CLFL 2WUBH 4N0YL 1D7FA 4BSVB 1ZGLP 3QUXA 4FXKA 1YZZA 5EUOF 5CEZH 3EYOB 3QXVA 5TDOB 4PJFB 3DX6B 2R69H 3S36X 1FIGL 4DKFH 3MMEB 4WENB 4XTRC 2QHRL 3BN9D 2I9LA 2NW2B 4JFQB 3MLZL 4I2XB 5BOZG 3ECBB 4MA8H 5K9OA 5FF6A 3BH8A 3W9EB 3KYKL 4JFHE 3SDAA 3CFKB 4WI3A 3QQ3B 5C0FA 5FUCC 3T4AA 2ADFH 1OPGH 4K3DL 5E99H 4GW4A 3QIBA 4CN6A 2NY7H 4D9LL 1FJ1B 3OMZA 1WFOA 4H0HB 4AEEA 3B6SA 5JQ6H 1D5BB 1K6QH 3VXUE 2AJVH 3LS4L 1MCRA 3FQRA 1W72A 2VYRE 1J8HB 3RWEB 2DQTL 3H7BB 4TUJA 4TUOB 3VD5A 4KUZH 3QWRA 1CK0L 2OTWA 4P9HC 3ZTNL 3LMJH 3EFDL 5FXCH 3N1MC 5CIPB 2VLRD 3H9ZA 4Y4HA 4TSBH 5GZNC 3UJJH 4CU8A 5IEKA 1BF8A 3NN8A 1YEKH 1JF1A 4PJGE 4PJIF 1C5BH 1RIVH 4EUPG 3OG6B 2VXSL 4HIEA 1TJIH 1EXUA 2NXZB 1X6NA 3TO2A 2W0PA 3M17B 3VFNB 4W6XB 5KVFL 4PRBB 5DLMH 1IEHA 3RBGA 4LRIA 4WI2A 5EUKB 5FUOL 1I7RB 2ED8A 3O2DH 4HKZA 1QNZH 4JB9L 5AWNH 5BRZE 5IOPA 4H26A 2IQAB 4MYWB 4MLIA 5HGDA 3HG1D 3FAWA 4NFCA 1U93B 1FO0A 3TCLA 3BE1L 3K2UL 2NLJA 5C2UB 3CUPB 2J8UF 4H1LG 5IMKA 5C70A 3KPRB 2AXFB 5GRJH 5T3XE 3SJVD 1LEGB 2ZSWA 2IPUG 3GMMA 4JPWH 4X6FA 3MRMA 1ZVSB 1MCEA 3FCTA 4GXVH 5HDOA 1E4XH 3S3JA 1RZFL 1DFBL 5IVZA 32C2B 4YPJA 1UA6L 5DMGC 4YDJB 4OF0A 5CMAB 5GGVL 2BNUA 4JRWA 5JHDE 4QY8B 4ZDHB 5KSAA 2W9EH 4WUKL 5AUMB 1AGFB 2BVOB 4DN4H 1NGZA 3CFCL 1L7TL 1DQJA 1S9YB 4KWUA 1U8QB 3HMXL 1S7QA 4MZ3A 1GJIA 3MV7E 2HLAA 1YDPB 1OAXL 4NO5B 2NZ9D 3C2AL 1IAOB 2EXWD 2AQ3A 2HG5B 2PYFB 3KPSE 4KJPD 3D3VB 4PGCB 4M6MH 3UTSA 2KQNA 4UBDD 4PYHA 5HGBB 4KJWC 1G7QB 1BHGA 2NQCA 3D2UD 4LHUB 4NQTA 3DVFA 3UTSE 5FB8A 4R0LB 1S9XA 1U3HB 2F9BT 3QEQA 3QSKB 3VFRA 4XCYB 2DIJA 1W0YT 2HFEA 2GI7A 5FM5M 3GNML 5IFAL 4APQD 3T0EE 3G9VA 5HI4D 3AB0C 3CX5K 4P49A 4DEPB 3L3HA 2Z8VC 4G8FB 4P2QE 5JPMB 1UKQA 4N68A 4UIKH 2I9TA 3D9AH 1WT5A 3DUUA 4GG8B 5C7XH 2PXYD 3QHZH 1D9KC 1A7NH 4F8TA 2CMRL 1AQKL 3MX0A 4QHMB 4CMMB 3OKLA 3CDGA 4R7DB 2J88L 3NFPB 4ONFL 4K8RC 1L9MA 1EERB 2NW3A 3OR6A 1DLHA 2YSSA 2AP2A 3RL1A 3MNWB 3GGWB 4JO3H 4Y16D 2Q87A 3BP7B 3V6FB 3CC5B 4YZFF 4HIIA 3KLSA 1Q8MA 4HKXA 3PGDA 5E8EA 2PYEE 1NBYA 1MCFA 3DV6A 1NFIA 1BAFH 1A3RH 3WFEL 3H9YA 2YUXA 2E7HA 3BN9C 3O4OB 3VRLE 1Y18B 2PO6D 3HFML 2YRLA 3LZFH 3U0WH 5I9QC 2QKIB 2Y7QB 4Z76A 5E70A 5EZLA 1R0AL 3QI9D 4JG1H 1LE5A 3C60D 3I3DA 4PD4K 1M7DB 3AC0A 5E5MA 5BZWB 4K3EH 4E5XB 4OCXL 2JJTA 3CSYB 4P3DA 5L7XH 2GYSA 3GSRA 3MUY1 1RUMH 2FO1A 2FJFA 1HZHL 2APXA 3FO2A 4MJIE 4PP2B 2VIRB 4QYOA 5GGQL 1XF5B 1OLZA 2E6PA 4YBLC 5GGVY 3UJTL 4UQ2A 4KMQA 1JYNA 3NCJH 1NANI 3RDTB 5FO9A 3EDDA 5D6CB 5KSUA 2NY2D 1AP2B 3AUVA 2DBLL 2VITA 3U4BH 4NRXB 4DTGL 4J3OC 1HDMB 2B0SH 4FQHA 5FHAL 3MRCB 2WUCL 1Z6JT 2F5AL 1FYHB 3P9MA 3MJ8A 1A7BA 2Q7YB 1QFWH 4HUUA 4YPGB 4X4XB 4Z7UA 1FQ9C 3A67H 3MJGX 4WU5B 4CW1B 5CS7A 4XCNB 5L88L 2MHAB 5L9DH 4JM2D 1X9QA 3HNTL 3BJ91 2OI9C 4F7PA 1JWUA 4J3TA 2A83B 5KVEH 4OJFH 3S36H 3V8CA 1EEYB 1YECL 1CLZL 1I9RL 2H26B 5K9KB 4KRMB 4AH2A 1I85C 3OKOB 4OAWA 3REWA 4RMTA 5C0CB 3QEUA 3WKNA 1ZHNA 5DJAB 1R5IA 5JO5B 1HHIA 2V2TA 1ZA6A 4NBZB 3I6GB 3G5ZB 5L8KB 3MCG1 1PKQA 3DECA 3QIWD 4NIKB 3H9HA 1MFCL 4FQPA 4ZQKA 1HINL 1RZGA 1V7ML 3JWOL 1GC1C 4YHYB 1KFAH 1PKQE 1XR8A 3A6BH 5FGCB 4K23L 2FSEB 1I75A 4RMRA 3GB7A 4L4TD 4HJ0D 3U9UB 4BK5A 1BZ7B 1M4KA 2Q76A 4KZEH 1T04B 5IR1B 3QO1B 2XN9D 1FSKC 3WNMA 3MA7A 1KLGA 3DARA 5IVXA 2CLRA 4WI8A 3VFTA 4JKMA 3CFBB 5DJ0A 4YEEA 1A9EA 3IAPA 3PWNB 1LO4H 4YXKL 1UQSB 2HWZL 4OD3H 2UY7A 4NN5C 5TF0A 2BCKB 3ESUF 1U58A 3DROB 1IFHH 4PJ7E 4QRRB 3VXSE 2UY6A 1FG2A 1N6QL 3QNZA 4K94L 2IG2H 3VFSA 2ESVE 2NZ9C 2EXWC 2BNQD 3VXNB 5KVGL 1MQ8A 2WWKT 3NZHH 4OGYL 5JOFB 4KJPC 3OKEB 1MNUL 3IXTB 3P30H 1OGTB 5ICYB 1P84K 5CEZD 4OCNC 4HEPG 2DM2A 4UBDC 3AREB 2BHYA 4HKJA 3CK0H 2EDHA 2BSSA 1U8PA 4OFDA 1GHFH 3PWPE 2VDPL 1ACYL 3ARGD 3RPKA 3BKJL 1RUKH 5I1EL 4FQ1H 4JGMA 2YMXH 3V0VB 5I0ZA 4P4RB 4JANB 5GGRY 1TTUA 4H20H 4APQC 1FYTD 1HOCB 5HI4C 3MJ9A 4XNQB 2VQ1A 5KZCD 5ISZD 3U79A 5IKCA 3UYPA 3BKCH 3MPCA 3WUWG 2ITCB 4OFVA 1F3DJ 1NAMH 1A4JA 1SBBA 4FS0A 1YEGH 3WJLC 1P9MC 1D9KA 6FABL 5CEXB 1HHKA 3ZDZE 2PXYC 3RQ3A 1NCCL 3MRKB 4S1RL 4JGUA 2OXGA 3HAEA 1G7PB 3UZQA 4JQVC 2HKFL 3V79C 1EDQA 2BVEA 1ZTXL 1I9JH 4Q9CA 4GW5B 7FABL 3DXAA 5CJXC 3BYYA 2LTQC 2XWTA 4LNRA 4YHPB 3ULUD 2X1QA 2JK5A 2APWA 2J4WH 4K3JL 4Y16C 3QG7H 5AD0A 3X13B 1K5NB 4AZ8A 3GMPA 1IZJA 2QQLH 4U1MA 5FM4A 4LNVA 2EZ0D 3GBML 1U8OB 5IESL 1NSNL 2IBZY 1KIQB 1MY5A 1HQ4A 3SGDH 1MFBL 1GZPB 3E2HC 3OKYA 1JFQH 4NDMA 1BOGB 5FO8B 3EYUL 4FQCH 3F58L 3D0LB 3W2DL 3QI9C 1B9ZA 4FFZL 1OB1B 2VABB 1FL5B 4PJHF 4I48A 3C60C 5AG8A 4WJ5B 3MRPB 4ODBD 4C58B 1KJVB 5DS8A 5CJQH 3EYQD 2GK0B 1LO0L 3KYNA 4M7ZC 5I16A 1XH3B 4YXLH 2XG5A 1N3NB 2XWBB 2CDGA 3DNKA 5DI8A 4P4KB 3CVIH 2VLRA 3PWLB 4G80A 2GT9B 3N0PB 1AGEA 1ED3A 4ZPTA 1OHQA 2L7UA 2FH8A 5CLTA 12E8L 1F4YH 3E8UH 2VLRE 1DDHB 3NPZB 1YN6B 3KYMB 3W9DB 4ODXA 2VL5B 3QT2A 5EULV 3L3KA 2Z4QB 3WS3A 5DMIH 2V2WB 2AQ2A 4OM0H 5GJTH 1HWHB 4S10A 4HQQL 4Z7VE 1DVFD 4NQXA 1QZ1A 1DLFH 4JM2C 5GGSA 4K55A 2AEWA 4YHIB 4ZO9A 4WHTB 5KVDL 2I5YH 2SEBB 5EBMB 1BX2A 1I85A 3HG1A 1HH9B 5EU4A 2IANB 2LVEA 3NTCL 2EIDA 5T5NF 3CLFH 4HBQA 2OJZL 4I1NB 4N0YH 3DVNB 4LVHC 4IRSD 3EJYD 3QJHA 1A5FL 5HI5D 1FIGH 2QHRH 2BMKA 3RWFA 3SJVA 4AJ0A 5AYQA 3QIWC 2XG4A 3MLZH 1CDUA 4KMLB 1NCBL 4P5KA 3PF2A 3KYKH 4L3EB 1MAJA 2AABL 3MRQA 3MREB 3QAZB 3N1QC 5I2IA 2BY2A 3VFOA 4GO6B 1V5JA 2IBZX 5HVHC 4RFEB 2FIKB 1AE6L 1NCUA 4N0UE 4K3DH 5DRXB 1ZHLA 4A2MA 5FOBB 4HJ0C 3TYGL 5GGTL 4UTAL 4D9LH 4OFIA 5GSRA 4LCUA 4QT5A 5C07E 3LS4H 1N59B 2BSRB 2XKNA 4ETQA 2R1WB 4WHDA 1KOAA 2DQTH 1J7VR 1HXYA 5D7JB 1QPPA 4OCMC 5GISL 3BIKB 1CK0H 2WNGA 2K3TA 1RK0A 3ZTNH 2AXHA 3BPNB 3EFDH 3DUSA 4PLOB 5HHOB 1F8TL 2DQJL 1B6UA 4D0DA 1S3KL 1HEZB 3PWJB 4ZO6A 4IOFC 3HUJA 5F93C 3MXVL 3P4LA 4FTVD 2GJ6D 4JRYD 1ES0B 1FVEA 5EBGA 5HYQB 1KLUA 2VXSH 3HUJE 5EO0B 4F7TB 3D2UA 5FFLA 1G7IB 2H9GA 1F2QA 5BQ7A 5BVPL 1NFDB 5KVFH 2VRAA 1HCVA 1PGRB 3L7FA 5D4QA 2DLEA 4DZ8A 3L3IA 3U6RB 4P5MA 4TN9A 1TCRB 3P3YA 5FUOH 4QXWA 2J6EA 3ARGC 1DUZA 4APQA 1C5CL 3C5ZB 1U8HB 5ITFA 4JB9H 2ADJA 4NYLA 3KS0J 4X0KA 3LD8C 4IBLT 1R6VA 2XFXA 4NO2A 1KENL 5ENWB 5DF0A 5A2FA 3B2VL 3RWHA 5HGGS 4LIQL 3G5XB 3WJLA 3BE1H 3K2UH 1P9MA 3WFHB 3LSOB 3WIHA 2M1KA 4TVSa 3P2TA 4PV8A 4GS7C 4NNXB 4CMHB 3NBNA 2PXYA 3GBNL 1T5XA 4L4VB 2RHEA 4MJ4A 3PIQB 1UWXK 4JQVA 4M5ZL 3WLWD 3DUHA 5DHVH 4X98B 5J57B 4XCFL 5CJXA 4CVZA 1CDBA 1FG9C 1U8LA 1XGTB 3RA7L 4DUWA 1BD2E 2HJKB 5F89A 3O81A 3AMKA 1J10A 1QLFB 1N7ML 1DFBH 1RZFH 4Z7QE 4GSDL 4Y16A 1WCBA 3FQWA 4Z8FL 1KPRB 4GRLB 1UA6H 1CFQB 3ULUC 1GOHA 3PNWB 4L9LB 4RGND 3LRGA 2NY3B 3QDJB 4YH6A 3WNKA 4AMKL 5GGVH 2I24N 1CFVL 4K3GA 1KJ3L 2R29L 5E8OA 4I3RL 1UT9A 1E4WL 2E7BA 4WUKH 1F6AA 4JFXA 3V7AE 2PO6A 2OP4L 2RB8A 2EYTB 3CFCH 5E95B 2EZ0C 3DWTA 2FX9L 4OFKA 3WUZA 1L7TH 4U1LB 4NNYB 3HI1B 4NSKB 2DWEA 3HMXH 3LRHA 1F3RB 3QI9A 1OAXH 3C60A 3U7AA 3C2AH 1ZWIA 1N2RA 4MMZC 4NUJB 3I02A 5F1IB 5H35A 4LSVL 1BWMA 1ZT7A 4UINL 1Z5LB 2Y6SD 4XH2A 4WEBL 5DEGA 1ZMYA 4XB7A 3EYQC 1LDPL 2AV7A 2VSDA 3GM8A 4PY7B 3X12B 5C0BB 4WEMB 4CADB 2VLMD 5E5UB 3EDKA 2CDFB 3ULSA 1VPOL 3AROA 1A2YA 4M6NL 3GNMH 3OX8B 4L4JA 5IFAH 3IAGC 5D7IA 2IH1A 3SEPA 4QF1B 1JGVL 5CD3A 4EJ1C 4O2FA 2EH7L 1YC7A 3NGBC 5IMOA 4W70A 3JBG7 3MV9D 2ARJA 2V7HB 1PZUB 2CK2A 2CMRH 3EZ8A 3QUMA 4H25B 4NRZB 4OZGA 4EQ3A 5IWLC 1AQKH 3EFFB 4JM2A 1TTFA 5DFVD 1DVFC 1YPZE 2B5IB 2J88H 4ONFH 4GAYA 4WO4D 5ESVA 5DUPL 1DJSA 2OR9L 4XB8A 1AD9B 3U0TA 4J12A 1FZJA 1FIEA 2YR3A 2QADB 3STZB 3HMWL 1DTUA 4M93B 5C0DA 1JN6A 3L3OA 1UZ8B 4OLWL 1S7SB 3DOSA 3IFPA 4IRSC 3O4LE 4N5UA 3EJYC 4X8JB 5HI5C 3QIWA 2R2BA 5CBEA 3X17A 1S7UB 3WFEH 4IRJB 1C5DA 1ZK9A 3HFMH 3SDXA 4WI7A 3RNQA 5EU7C 1DANU 4PB0L 4CDHA 1JPST 3AXLA 3VD4A 4LSSL 1P2CA 4L4TA 1R0AH 4ZSOE 5DJCB 3BRFA 4GMSL 1IGJB 4QHLB 4OCXH 1K8DA 3VDAA 1NBZB 1SY6L 1X5JA 4H88L 3HE6D 2EKSB 1HZHH 2P1YA 3D48R 1UC6A 5DVLA 3QFDA 3SKOB 2DKSA 1S7TA 5GGQH 2AKRB 4DOHE 4XP9L 1EAPB 2XN9E 3ZT6A 5F88A 1K8IB 3CZJA 3UJTH 3PHOA 5ANMA 2BP3A 4XMPL 3BXNB 3RGVB 4F3FB 3GSXB 2DBLH 3T77B 2AK4E 3RKPA 3BI9X 4DTGH 3SO3B 4HWBA 5F3HB 4WW2F 2HVJA 5FHAH 3TLRA 1NEZA 2WUCH 3Q3GA 5T3ZL 1PZ5A 2DQIL 2F5AH 3HRZA 2WW8A 2F19L 2BNQA 3I9GL 1DQQB 2DOCA 4X9IA 1TVHA 3ARDD 2R2HA 3BHBA 5L2JA 1GZQB 1KSRA 5J11C 1A6ZA 2GKIA 5L88H 1SBSL 4F7EA 3CH8A 2ZOKA 3ARGA 4HG4J 5LXGL 2P8MA 3HNTH 5KS9F 1A8JH 2FH6A 3C5JA 3MUGA 3IDXL 2LAAA 1FYTA 1WZKA 2P42B 4NO3B 1JV5A 1YECH 4JZJC 5ISZA 1CLZH 1I9RH 2GK2A 4XGZB 4LSTL 4HUXB 4TNWF 2BHZA 4LGSB 1JPSL 1MAML 3TBWB 3TZVD 3O3EA 2V7NB 2YS4A 5ISZE 3CCHB 1Z3GL 3K46A 3QXAB 1QEWB 4KI5D 3VRIB 2HFGL 2BVYA 1JHLL 3IJSB 1MOEA 4C56E 1MFCH 5E9DD 2QR0B 1HINH 3WLWC 1V7MH 4KU1A 3JWOH 5H2BA 4TPRL 4M1CD 2XIDA 4K23H 4LMQE 1CQKA 3AM8C 5K9JL 3J7HA 4JY5L 1I1AD 3TO4D 4EUPA 1YMMB 4OI7A 3ULUE 3LQAL 4RGNC 4YDLC 1EO5A 3RVUD 5IMLB 1T6VN 4UNVA 4YXKH 2HWZH 5DUBA 3GIVB 3QFJE 4N1HB 3I75A 1FVDA 4UQ3A 1BFOB 4GMTL 4U3HA 4JPVL 1QO3A 3ZYOA 4U1NB 3FFCB 1N6QH 1P4LB 4K94H 5E6ZA 4GAFB 5KVGH 4OGYH 2C5DC 5LAXB 3BIAX 1MNUH 3PV6A 3PHSA 3UTZA 1T03L 2Y6SC 2R15A 1IGYB 3WEXB 3LKOB 4H1LA 5T5NG 5IHUL 1ZHBA 4LF3A 2VDPH 1ACYH 3BKJH 5I1EH 1SMAA 4LIQE 4J2XA 4LRNL 3JTTA 3SGEI 3QXDA 2NCMA 2X1OA 3HR6A 2NNAA 2YN5A 4JG0L 5F70A 3ROLB 4JE4B 3QA3A 4OKVB 4HV8B 1KIPB 4QXGL 1FZMB 5GS1B 5IWLA 6FABH 4DGIL 3EO9L 4PR5B 1JNHB 1NCCH 4S1RH 2DI9A 1DVFA 4MXWL 2DLIA 1AGDB 2HKFH 5E7BA 2CGRL 3BGFB 3RUGE 1CIDA 4KY1L 3TVMD 1ZTXH 5C08B 3ZSSA 4OD1L 5DFVC 1R3KA 5EOQL 2ICEA 7FABH 4WO4C 2ZUUA 1A6WL 3CLEL 4LVNC 1K2DB 4X6CA 3T4YB 4Y4FB 4G8IA 1A6VH 5D93C 2FECL 4O2CA 1FFNA 4K3JH 5C9JA 1Z9MA 4IRSA 3G5YB 4LEOB 2F54D 2WBKA 4I0KA 3GBMH 1KTLA 5FA3A 1EH9A 4C59B 5BS0D 5IESH 3KPQB 4C4KT 4AEFA 1NSNH 1NMCB 3DRQB 5M95B 1MFBH 5TE6L 3T3PE 3EYUH 3F58H 5L0QC 4MD0A 4TNVF 1L0YA 1BJ1H 3W2DH 4HS6A 4FFZH 5IB5B 4LPWA 5HHXL 3EUUA 4I8DA 3DX8A 3WFCL 3HE6C 1CDGA 5EIIA 1LO0H 5HDBF 3SBWC 1OP3H 4EVNA 3B83A 2B4CC 4WDIB 2YA2A 3HS0B 4HS3A 1NC4B 3I6LD 1WF5A 3ARFB 3PHQB 5I76A 4UDUA 3ORJA 4WHCA 2DM3A 2XV6B 2PTTA 3VFVB 1CICD 4KKLD 2I26N 3I6KB 5DA0B 12E8H 4FTVA 2GJ6A 4JRYA 3GI9L 4Z7WB 5HYJD 3CIQA 4D0BB 3GMOB 4KV5E 3VGBA 2FHFA 2YUWA 4FTVE 3ARDC 3RBSA 4OD2B 2FEDD 1FNGA 1PKOA 5F7EL 1U8KA 1G7HB 3MBED 5HGAA 1J1PL 4HQQH 1KIRA 4Y19B 1MCKA 3CFDB 3RWIB 5KVDH 4U1GB 3T0WA 1OGAD 4JZJA 1NJ9B 2HJFB 1MCOL 4PG9B 1MHEB 4MJ5A 1O7VA 3NTCH 4FFYL 2OJZH 3PQYD 3UC0L 3B3IB 3CX2A 5J0BA 1B90A 3DHMA 4HUNB 3TZVC 3JTSA 2G5BA 1A5FH 2DQUL 4PJCA 2CUHA 2DWDB 3OHXA 2Q6WB 4KI5C 2R0KL 3GJEB 4UNTA 5ACZA 1NCBH 2H32A 3X11B 1XCTB 2AABH 5C2BL 3AM8A 2DQGL 4OZIE 4M1CC 1L6ZA 3BW9A 1AE6H 1PBYA 5EOTB 1FCCA 2EDTA 3TYGH 5GGTH 4UTAH 5BVJB 1E28B 1CVSC 4ZOCA 4U05A 4Y1AB 3U0PA 1JGLL 2FL5B 4OCYL 2WBJD 4NQCD 1I1AC 3TO4C 1X5HA 2X7LB 4HW6A 4OUUA 3OL2A 3RVUC 4Q74A 3GMQA 2EKJA 4JY6A 5GISH 4MHHG 5SX5K 1LE9B 5T3ZE 4S1QL 5J9PA 1Z0NA 1RK1B 1F8TH 2DQJH 1N5AB 5IW6A 1S3KH 3VE0A 5ICXB 1DCLA 3MXVH 4XC1L 5F7NC 5KSBB 5T1DL 1UG9A 2BVPB 2GTWA 4HIXL 2R8SL 4E41B 1OVZA 1IAII 5E2VL 3C6LD 3QUKB 3ZT5A 5JZ7D 1QFWI 2WINB 3IDUA 4HGWA 2VUOA 1WC7B 3RWDB 2Z92A 1N6UA 1J5OL 5BVPH 1HH6A 3TESA 3U30B 4BFGA 2BY1A 4EI5D 1JPFB 3E0GA 3QG6B 5I8KL 1C5CH 1S5IL 2EDWA 2VLME 5I6XB 4DVBA 1KENH 5CP3A 3B2VH 1N6VA 1T2QL 3OAZK 4LIQH 1BMGA 1UM4L 3T0XA 1W0WB 1I7ZB 3STLB 2HLFD 5L8JB 1S7XA 3EYVA 3MV9A 5CZVL 4I3GA 1RSFA 2D31B 4QRUA 1NUFA 3GBNH 3LKQA 5IMMA 4XCEA 3SDCD 1RI8A 4M5ZH 1AJ7L 1PX3A 4N8VB 5EC2A 1UM6L 4P9ML 3D85B 3BFOA 4XCFH 4WO4A 3RA7H 5J7CC 4L29A 4XBPB 2VLKD 3TVMC 1YNLL 3BPLB 3RNKB 1WAAE 2PTUA 3EYSL 1N7MH 5D5MF 4GSDH 4Z8FH 1T2XA 2FO4A 1OAYL 1NDMA 5DD3L 2CLZA 4Z7NF 1I7TB 1XGUA 3UTQB 4AMKH 1CFVH 4HLJA 1KJ3H 2R29H 3BZEB 1V3KA 4I3RH 5F6IB 2GSGA 1E4WH 2GTZA 1I8IB 4NOFA 4ONGL 2MWCA 5F7DA 5IFJB 2OP4H 5E2UL 4MB5A 4E0RA 2FX9H 3MBXL 1DR9A 5FUZL 3KLDA 3MRRA 4UT9L 2DLHA 1QQDB 1OD9A 1QVOA 1LP9B 2IPKB 2V2XA 4LSVH 1FZKB 5EUOE 2JCCF 4JFDE 5A2LH 4UINH 3HE6A 3DJ9A 3UAJC 3SBWA 4WEBH 5DDHA 4WTXA 4N90D 2UWEB 4ODWB 1LDPH 2XY2A 1AQDA 2AJYL 3KPLA 4BJLA 4GRMB 5LGKA 3UTPE 1G7LB 1A9BB 4X80L 5EZOL 1UVQB 4G9DA 1VPOH 4M6NH 4X6DB 4RWYL 1MRCL 2XACC 4ELMB 4F9LC 4C54A 5TQ0L 5E1AB 1IGML 1JGVH 1S9VA 2Q86A 1CICC 5C8JA 4KKLC 1J05A 1ZS8B 2EH7H 2D7TL 2OTUA 3T8XA 2CIIB 2DMCA 3ARDA 2IMMA 4C83A 3FQUA 4QTIL 3T0DA 2JB5L 3GEWB 4E42B 4HSQA 2FEDC 3MRGB 4PB9L 5KSVB 3VJ6B 3MBEC 4R4BB 1ZHKB 4PJIA 5AAWA 1M05B 1ZGLB 3TBTB 2ICES 1PYWA 3RWJA 4O2EB 1PEZA 1J8HD 5DUPH 2AAVA 1MJJA 2OR9H 3P9LA 1A6PA 4PJIE 3S4SB 4HLZG 5I8OL 2DQFB 1C08A 1RZ8B 2A74B 3TZVA 4NO0B 3HMWH 1UXSA 3BX7C 4OLWH 3SOBL 1ZLVK 5TE7L 3LS5L 4PJAF 5DTFB 4MX7A 2YPVL 1C16A 4G8GB 2QQKL 5E4EB 1I9EA 1KXTB 5D2LA 5E9DA 2HH0L 5EU6E