4WNQA

The molecular bases of delta/alpha-beta t-cell mediated antigen recognition
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
200
structure length
200
Chain Sequence
QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGVTGKLTFGQGTILTVHPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR Variable Delta 1 chain and TCR constant Alpha chain
publication title The molecular bases of delta / alpha beta T cell-mediated antigen recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 200
sequence length 200
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wnqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wnqA01
4DUVA 3MTRA 1GXEA 5IB2B 4UTBH 2HJKB 1FSKC 1CVSC 4FFVD 3BKMH 1XGTA 4HKBA 2Y36H 3QQ4A 1X5FA 5ICYA 3PQYE 1NUNB 1T83C 2VTFA 3GMQB 4PJIE 1CLYH 2KL6A 3QDMD 3QXUA 3KLHC 3KPOA 2GCYA 5KZCB 4RX4A 3FAWA 3X3FH 3SQOL 4DOHE 3RRQA 4X9IA 4JDTH 1QLFA 1TQBC 3C9NA 2ZUWA 3QFJE 1H9VA 3IJSB 1LP9B 3F7QA 1INQB 5DRNA 2A9NL 3T1WA 1BX2B 3RL2A 5EFIB 1F4YH 3REVB 2GUOB 5MEND 5E5MB 3K7UA 2D2OA 1TETH 4JO3H 1VCAA 1IGCL 4G9FE 1CGYA 1DUZB 3DVIA 2R4RL 4KQ3L 5A3ID 4M4PA 3BJ91 5KS9F 2BZDA 5CD5D 4FXGA 5DA4A 4X4XB 3H3PL 3SDDC 4MJIE 3G5YA 3HR6A 4IMKA 1MH5B 5KAQG 1OGAD 5CHNB 1F3RB 1XF5B 1JHKH 1WWBX 3BWUC 2VH5H 3S36L 4AMKL 4M7LT 1K4DB 3OX8A 2OJZL 4PS4H 3S36X 2FBJH 1AP2B 2OCFD 5L2KD 1H15A 4S1DC 4GXUN 4XGZB 5EUKA 3WXVH 1KIRA 1JZ2A 3MRIA 4JFFA 1I8LA 5JQHC 5C0GA 4E41D 1T5WB 2LTQB 2R1WA 1PZUB 3LHPL 1EV2E 1U8QB 3D2UA 4GW1B 4EI6B 1KTLA 1ZA3A 5IBLD 3CAFA 3RGVD 5LCVL 1IEBA 3C8KA 3P73B 5C6WH 5LG1A 4MNQD 4IDJH 1XGRB 4K9EC 1KIUA 5IQ7H 2BCKB 5ISZE 5JR1L 2DKSA 1LWRA 1I7RA 2CMRL 4N0FB 1MCWM 2C1PA 4OLYL 3HPLB 1QVOA 1JNJA 2AAVA 3QIUD 5CGYD 4LVNC 5FF6B 5T1MB 5HYJE 4H1LA 3MCKB 1OLLA 3TVMA 5LGJB 3PWPA 3JTTB 2VDLH 3T0AA 2MFNA 4U1IB 3QJHB 4NZTH 3C09C 3P4MB 2BVQB 4JJ5A 3IGAA 2DLFH 4I3RH 2LE9A 4OB5H 2G2RA 1T1ZB 3KXFD 4NCC1 5EULV 3IDJB 1F11A 4ZS7L 3MJ9H 4HCRA 3BEWB 3C08L 4GG6B 3KG5A 1FLTX 2P4AB 1QLFB 5I9QC 4XVJH 5IB1B 1CWVA 2SEBA 3MLVH 3TF7C 3DV4B 5DRNB 4UIKL 4DVBA 1U93B 3T0EA 1UJ3B 4TYUA 5FYKH 3MRJA 4Z95H 4XI5C 1A7OH 2NZ9C 2CDEA 4HJ0D 4PJDA 4JFFE 1T3FB 4YDLC 5CILH 3FMGL 2ZUQC 4Q97A 2VDNL 1A4JA 3OF6D 4BZ1L 4PB9L 1ND0B 3KJ6L 4P23C 5DJ8B 4LPTA 4RFOL 3WUWG 2OL3B 4HEPG 3G5YB 3EFDL 4MNHB 5GS2H 3HE6B 1QR4A 3QG7H 3BMWA 2WQ8A 4HKZA 5EWIL 4MD5A 1EAJA 4KDVA 1JGVL 3WIIL 2FBOJ 2H2PC 4K3DL 3KPQB 3WFDL 4GJTB 4H88H 3T1FB 1MAJA 4M61A 4UAOC 3QO0A 5J6HA 4GRWB 1FN4A 3IFPB 1OHQA 3QQ3B 1N5YL 1PYWB 1A22B 3MRIB 4UT7L 5F96L 3PWPE 4FABH 1JMZA 1EZVY 3FQNA 1C5BL 2ENSA 2PW1A 3REWB 4JZJA 5HDBF 1DVFB 3UROR 4WW2A 2LVCA 3LKNB 4Y5VB 3D2UB 4WNQB 3WIFB 1A14H 2VXVH 1L4IA 3MLTB 4K9EL 5DA0B 4PRHD 2IADA 1K85A 1HHJB 5EU6A 2IGFL 2VDML 2BSTB 1K6QL 5CSZB 3N9GH 1H8SA 4W6XB 3KS0H 5GJTL 1RUPH 3PUCA 4H0HB 4MLSA 4JFPB 4PJ5D 1CXFA 4Q2ZB 3SE8L 3TBWA 4X6CE 1QRKA 1AR1D 4Z7OE 3GO1L 5DJDB 1EAPA 3MNWB 5ANMA 3I6GB 1V05A 2BNUA 3DVFA 4JPVL 2PTTA 3HC4H 3O6LH 1V7MH 3MRPA 3A6CL 3AB0C 4H1LB 1C7SA 4I0PA 1YMME 1AD9B 4JRXA 1FYTB 3DYMA 1A6VL 2DI9A 1MCFA 5KANI 1DBJH 3UTOA 4DCQB 2W07A 5CS7A 2VB5A 1EEQA 1YEDB 3PXHA 4P46C 1UXSB 1F11B 2C26A 3I2CL 4OZGE 3S35H 3IFNH 1KT2B 4CRPA 2R1YB 3BIKA 4LVOB 4LCUB 4UZGA 2XKNB 1JNHA 2ZPKH 3HC0A 3QWOA 1GGBH 1DEEB 1L6ZA 5E8DH 3SDAC 2EH8H 2X4RA 4BSVA 1JJUA 4H5SA 4OCSL 2A0LC 5I66B 1PKOA 2Q7YB 1Z3GH 3SN6N 1A1NA 5C09B 2F19L 1EO5A 2BY1A 3QDGA 1H0DA 4QOKB 5ADPL 4QXGL 3T77A 1WTGT 2DM7A 4K3GA 1RAMA 2Y4SA 2CRIA 4QHMB 3ILPB 4I0CC 4JY5L 3BZ4A 5EN2A 4DN4L 4X6FB 2HTKD 3EIFA 3IS0X 4U6XB 4OCXL 2Z31D 1PQZA 2XG4A 1JCKA 3VFOA 3VXRD 4L9DA 4KZEH 1MEXH 3DHJA 2IANA 3JWOC 5C07B 5IVXE 1TJIH 2XTLA 3IJHA 3B9AA 3M45A 4NZJA 1AHWB 2PW2A 3OJMB 5FYJU 3W11D 3JWNC 1KPUA 5DDHB 1IM9B 4CGTA 3DURB 1CFVH 4YE4L 5IP4A 1S7UB 4LPWA 5J12C 3UTZB 3T0WA 1KELL 2WWMC 1WEJH 1GVIA 4Y4FC 1T66C 3PGFH 2A74B 5I71B 3DUHA 4FQHB 1Q72H 5C70A 2RFXA 5D7LD 3BO8A 4RQQA 3GRWL 5DEZA 4OT1H 1OL0A 1QLRA 2OP4H 3CVIH 1NL0L 1P9MC 4LLWB 2DDQL 2X6MA 5EU6B 4QHKJ 2PTVA 3D0VA 4M7JL 4G7YH 5F7YC 5IB3A 3EBAA 3WN5B 5IW1B 4HXBL 4MJ6A 4UTBL 5FUOH 3HI6L 4NQCE 4H20H 1MCBA 3BKML 4KKLD 3GJFH 4XNQA 2YOCA 15C8L 4X5LA 1MCKA 4Q9BA 3BISA 5JW4R 5DJ0A 1FRGH 2Y36L 4LF3B 4Z7NF 3SE9H 5F1OB 3NAAH 2NXYB 5BV7B 2JCCF 1K4CB 3QDGE 1BQHA 4OZFA 4PJCA 2CKBH 5ICZA 3T65A 1P2CB 3TBVA 1CLYL 5JLZA 4AJ0A 1W0YT 3X3FL 4LHUG 1TZIB 2FHCA 4LBEB 4JDTL 3GNMH 1U42A 2R2BB 1LO0H 1M6OA 5B39A 2EE9A 1VFBB 5FKAA 3MGOA 2GSIB 3QNYA 3TV3L 1F4YL 2AK4B 2VAAB 5F97E 3VFSB 4Q6IC 3QULA 1G6RH 3IDYC 3O4LA 2X4RB 1KIPA 5T3ZH 4L3EA 3D25A 5D2LA 2F53E 1GOFA 1JBJA 1TCMA 2EE3A 3PHQA 4RRPA 4AENA 2BSSA 5JXED 1A1NB 2F8OA 5GIRB 1T7ZA 2FL5B 3QUYA 3SGEH 1H0DB 2NY5H 5DD5L 4XH2B 3ARXA 3FQTB 3VXTB 4Y1AB 3IDIA 3LD8C 5F7DA 5CJOL 1SVZA 2R9HD 3O6FA 2VH5L 1FBIH 4XNYH 3JWOL 1PQZB 2JJTC 4LAQL 1YN6A 4PS4L 4MJ5B 2FBJL 1EFQA 2VERN 3DROA 3IU3A 3D1MC 4WGWB 4ACPA 2VDPH 2IANB 2Q76A 1MFBL 3BDBA 3QUZB 3K81A 1UWXK 5SWZE 1VDGA 3V5HB 3IJHB 2PW2B 3NIFF 4JRYA 3WXVL 1KPUB 1Z9SA 2JJSA 2Q8BL 4JY4A 3LZFL 5CEZE 3CFIC 1JYWA 5DMYA 4LIQL 3Q1SH 4ODWA 5JZ7C 2D4FA 3GM8A 4FQXC 4Z0BH 4L8CB 4NNYB 5D2NA 3V4VL 3H7LA 4ZD3L 5CMAA 3QIBA 3IAGC 1A1OA 4XCNB 2VLLA 3T2OA 2MCG1 5KG9A 1N8ZB 3MCG1 1YEEH 3RIFF 1CL7I 4IDJL 32C2A 3BVNB 1JGEB 2CO7B 1EERB 3MV8D 3C60D 5C2BH 4NO3A 4ELMB 1QQDB 2E7BA 1JYXA 5IB3B 5DS8A 1EUTA 3RWJA 4TUOA 4HMCA 1WWCA 3O4LE 4HWZB 4L3EE 1GIGH 2VDLL 4JZOA 1H8OA 3MRRA 3DGGB 4NZTL 3V6BR 5DFVD 2HT4D 4I3RL 4OLXL 4U0RC 5I1KH 4NUGH 3V5DA 5ICZB 4Z7VF 3TBVB 3MJ9L 4LU5H 4CAGA 2OJEB 4E5XA 1EHLL 1DBKL 2PN5A 4TQEH 1KEGH 3E6HB 4KJPC 3STZA 1F45A 4CMMB 3RAJH 3R8QA 5K9QG 2RJMA 5C0AD 3R4DA 4JRWA 3GDBA 4XVJL 1RV6X 1OQXA 5CZXD 2QADB 2RBLA 1FZJB 2D9QB 4J1UB 5EUOB 1BVLA 5FYKL 2MPAH 4Q9RH 3EDKA 2F54A 1PG7H 4Z95L 1A7OL 4WTXA 5T1KA 3P11H 2W60A 3FOLA 2W65B 1AO7A 2VLKA 1J0KA 1D5BA 2F9BT 2YEZB 3IF1B 1Y6NR 4FQJH 5JTWA 2YPLB 4HDIA 1C5CH 3QG7L 4OF5A 4X4YA 5B38A 2PO6A 5IHLB 1ZT1A 3MA7A 2DIBA 3RUGB 4HKJA 2P46B 1YPZF 1FH5H 1YQVL 3DROB 3IU3B 2VSCA 5E8OB 5H2BA 4APQC 3VRJA 3TCXA 2Q76B 4RFNC 2AJ3B 1FZOB 4PY7A 5HGDA 3UCRA 4JRYB 1FNFA 2AP2A 2B0SH 4YHMH 2ICCA 3TN0D 3D85D 3I6LD 2AVGA 3ZTJH 3FRPG 1M7XA 3P9LA 2DB8A 1A14L 4YFLI 3BEVB 3VXSE 5IJKC 2I07B 3QIBB 2WLZA 3RQ3A 1NBYB 4IS6B 2OX5A 5ACMA 5TFSH 2B8OT 2VLLB 4PREB 5KG9B 2X4NA 4NQDD 4ZAKB 2AJSH 4WHTA 3RVXD 1RUPL 5I1IH 1C12B 3FB6A 4JG1H 3AM8C 5B8CB 4P4RA 4D9LH 2PYFA 4TUOB 1CGVA 2EDLA 3ULSA 3HC4L 4J3WA 5GSRB 1IGIL 1IFHH 3QR2A 1LD9B 4NQSA 1U3HC 3BP6A 4JZOB 1DBJL 3SCMC 1KN2H 4HGWB 4ZO9A 3HA0A 4X7EC 3BD4A 4JDVA 1D5ZA 3BPCA 3S35L 4Z5RA 1I8KB 4P59H 4XVTH 2ZPKL 3S35X 5D1ZD 4N0UB 5E8DL 4EKXA 2EH8L 2HVKA 3D48R 1AIFB 4UILH 5D1QC 1I8MB 2ADJB 3GSNH 1A7PH 5C0DB 3KPSD 4Y4HA 2F54B 1FIGH 3PE9A 3W5NA 2XZCL 1QBLL 2CLZB 2DQTH 5DYOA 4DGVH 4WWKB 3UJTH 4JO2H 3SE3A 4C56D 2NY5C 4WV1A 2EIEA 3BZEA 2ZUSA 4IOIB 1QKZH 3MGTA 4BKLA 4LCCA 3P9WB 2MOVA 4AYFA 3O3BB 1P1ZB 3ILQC 1TJIL 2BDNH 2WQRA 2J8OA 1LK3H 3O6KH 3U46B 1Z6JT 3QT2A 3V6OE 1HOCA 2HA1A 5H2BB 1CFVL 4NC1E 4PJ9D 2PYEA 4Z9KB 4C59B 1WEJL 2Q3AA 1RUQL 5E0QA 4GAFB 5HGDB 2YD2A 4HH9A 3S37H 3LEXA 3MV11 3PGFL 4R7DB 5BS0A 3BPLC 1Q72L 1PEWA 4HWBA 2VZTA 5I16A 3RIAF 2OTPA 3QUMB 5DGQA 1H3GA 3P9LB 4RGNB 2OP4L 3QWQB 3CVIL 1OTSC 4NKMA 4XPFL 2FHBA 1KJMB 3S7GA 4IHOB 4GRLA 1DANT 1A4KB 1A64A 4YZFF 3HG1D 4G7YL 4MLIA 4U1JA 5ILTH 3GMOA 3TO4D 5FUOL 5HYEA 1BQSA 1KTRL 1QEWB 3QB7C 2AJYH 4YNYA 4YBLB 4EDWL 4H20L 2CK2A 4ZUSA 1J12A 1RQ5A 3HHRB 4ZDHB 2PXYD 1FRGL 3SE9L 3NAAL 1UQSB 5J3HC 35C8H 5EDXA 2CKBL 3HCVB 3MJ7A 3L5IA 1RJLB 1C08B 2H32A 1W72H 4AEHH 1UH3A 5CD3A 4HT1H 4JZNB 5JPNA 1C16B 1S9YA 1CL7H 1XGPA 3GNML 3QIWC 4U1GB 3O4OB 1LO0L 4JDVB 3LKPB 3WMSA 3LIZH 1ZHKA 1NAMH 4Y19D 3W0WA 2ED8A 3QCTH 5IT2H 4JPIB 1RK1A 1W0WA 3QH3B 1RZIA 4YC2B 1PW3A 1G6RL 3X14A 3WFZA 5T3ZL 4OD2B 4NN5B 2BNRE 5KTEH 5EU4A 3ZKXB 1CDGA 4OZHB 3IDGB 4U3HA 3WS6A 1BLNA 4Y4HB 2PYEE 43CAB 4ZOCA 1OY3B 4ZUTA 2NY7L 4LSRH 1BBJB 4XAKD 1NSNH 3LEVL 4JY6A 4RBPH 5CCKL 2XTJC 3OKKA 4B50A 5F8QC 5HVFB 1MCHA 3BPNB 3UTPD 4FQCH 5INDB 2PCPA 4JFEB 4WV1B 3EJZC 4PYGA 2QL1A 1FBIL 4XNYL 4M5ZH 1JPGA 2YS4A 3V0AC 4HG4J 2UWEF 1RY7B 4NQED 5DI8B 3ULVH 2YPVL 3LN5A 4BSJA 4NNPL 3HN3A 2VDPL 5DMIL 2FH6A 5DJXB 3TYGH 3CFBB 1PJ9A 3BXNB 3BH9A 3WHE1 1VB9A 4YR6A 1AXIB 2JK5B 1PSKH 5EO0A 5I8EB 2P5WD 3E2HC 1H5BB 4LAJH 4MQ7A 1FZMB 2P48B 2XWTB 1MJ8L 4OF6A 3LOWA 3ARBD 3C6LB 3EOAA 3QHZH 1IC5H 4I8DA 3HR5B 4GLRI 3FFCE 3KWWA 1FQ9C 1FCCA 2X4PA 3LSOA 1EJOH 5A2IH 2XIDA 3P4NB 2WWKO 3LDBC 4JQXC 3ZSSA 3B9VA 1K5NB 3DVGA 5C8JB 2UZYB 5C2BL 2ID5A 1NFIB 4Z7WA 4ZUVA 3VMPA 4QRUA 4O58L 3QI9C 4WTZG 4LGRB 1N59A 3VGAC 2ADIA 4RMUA 3FONB 2E9BA 1GIGL 4O5LL 3U0PA 3PGDA 5I1KL 4NUGL 5DSCB 3PL6A 3BP4A 4WHCA 4Z76A 5IMOA 1OSPH 1RFDL 4Y16B 2CIKB 3BKJL 1G1CA 4E42B 3X3GH 2ZCHH 4ZFZB 4YHPB 4ODSL 3LKRB 5IJVA 4C83B 4F7MA 3RP1A 2MPAL 4Q9RL 3SJVB 5ADOH 2XZAL 4BH8A 1JPFA 5C0BB 3ZTNH 1UH4A 3I75A 1KGCE 3P11L 5GHWH 3H8NA 3DUUA 1PG7X 4WUUE 5FK9A 3ZKNC 3SKOA 5L2JA 3PXJA 1MFNA 4FQJL 5EOQH 1RHFA 5D7KE 2CR6A 3ARFD 2I25N 2BHYA 5E9DB 2KPNA 1YNLH 3GI8L 2AEIT 2VZVA 1UXWB 4LLDA 3QG6A 3CFDA 2ARWA 2X40A 4MXVF 2OTUB 1JPGB 2DQIH 1BZQK 1FAIH 3KPNB 5F1NA 1FH5L 5AWNH 5K9JH 3WUWB 2HFEA 2WIMA 5DC9B 5D5MB 4PJFF 3RY5A 4F2MA 4LSTL 2C3VA 5IK3A 1PKQE 3O2DH 4LSDA 4KRPC 5IG7B 5I75C 4YHML 2RGSA 3OR6A 4CU6A 3RNKA 3IETA 1Q9LA 1ZKAA 4UOW1 4Z7UF 5TF0A 1DQLH 1TCRA 3OKNA 1EH9A 4IIQA 2APWA 2M1KA 5T33H 2BX5A 4M8QB 4YHYC 5TFSL 4GUPB 4U31A 5A40E 4O2CA 4X6DE 1BEYH 4F9PC 5EC2B 1XCQA 2IWGA 4JG1L 4WCYH 5F7KC 4D9LL 4TNWK 4KMTH 4QRUB 3B5GA 2QQKH 4BJLA 4JN2B 1YMHB 5GXBB 1VHPA 2OR7A 4IBLT 5CJXA 5L7XL 3KPRE 1KPVA 4KTDH 1IFHL 5ACZA 2QJDA 4YX2H 2E6PA 1A02N 1HDMA 4NO0D 2K9UA 2G9HA 3OKEA 2GQHA 3ULUD 3U0PB 5I15H 1MCPH 4OZIB 2UVFA 1KPRB 1TZHA 4LVHB 3KLDA 4K8RD 5E7BA 4JM2A 4L4TD 3UTQA 4NOBA 1HNGA 5CZKA 1FSKB 4PJHB 4U1LA 4P59L 4FQLH 4XVTL 4GQPH 3VG0H 1A7RH 1HILA 1TNMA 2JJUA 1R24A 5E2WH 4UILL 3GSNL 3PHOA 1JZ8A 1A7PL 1J0YA 4GRMA 4YDVB 1FL6A 5CEZH 1DLHA 4PRDA 1IAOA 2A2QT 4BH8B 2NNAA 1FIGL 1N3NA 5C0IA 4RMQA 1T22B 4XNMA 4JPWH 1G7HA 4PJBA 1E0OB 2DQTL 3CH1B 1DEDA 4DGVL 3OMZA 4LHQB 2BXZA 3UJTL 1FJ1A 1TQBB 3SKOB 4MVBC 4OLUH 3ZO0A 4FMFA 1IAII 3DLQR 2AK1H 4PLOB 5HHOA 2AQ3A 2DYPA 4N1HB 5GZOC 5JMRA 1ZGLP 1HSAA 5HI5D 1ETZB 1QKZL 4P4KA 3C6SB 2OSLA 3MRMA 1DSFL 1EEYA 3MLYH 4HK0B 1YEGH 5E1AA 1A7NH 1GOGA 3ULVC 2ZG3A 2QTEA 1NC2B 3IXAA 1LK3L 1HHKB 3D69A 3O6KL 3TZVD 4GQ9H 3SE4C 2NX5A 1WCQA 4M9OA 5AD0B 1OW0A 1TTUA 2HFEB 5F7EH 3O9WD 1BQLH 1XF4A 3U0TA 1R5WA 3VFRB 2Y72A 1HIMH 5KS9B 3GMLB 4N8PA 2R2CA 4QY8B 1MFAH 1V5JA 4LRIA 3DTXB 5DJAA 3S37X 1T89A 4ZPVA 4Z7QE 3O81A 1Q9WA 4GO6B 5T3XD 1X6NA 5LAXA 5SV4A 2ZOKA 4R90L 5C92A 1BZ9B 1D9KB 3Q6FB 4U7KA 5HHQB 1VERA 3BAEH 1FNHA 4Q7DA 4GH7B 4KK9C 2OI9B 1AXTH 5CJ8A 3LB6D 1ZA6B 1BFTA 2AJYL 4Z0XA 3SGJA 1S78C 4U05A 3EYFA 1G6VK 1MLBA 2BRRH 4QRPA 4AG4L 4ZO6A 1X5LA 4OI7A 4JHWL 4M3JA 35C8L 1MHEB 4GLRH 4KRNA 3EYSH 3D87B 1W72L 1HH9B 4PJEA 1EHNA 1FFOB 4HT1L 3OKEB 4LL9A 4GS7C 2F58L 5HHOE 4J8RB 2J8UF 3SKNA 1LDSA 1MIMH 1M1SA 4HIHA 2HLFD 1ZLSH 1Q9KA 2HFFB 4ONOA 5L8JB 3VW3H 5GPRA 1NAML 1FC2D 1LNUB 4LVNB 4KRMB 3BUYA 1CN4A 2GJ6A 4LHUB 1UM5H 1PBYA 5KTEL 1RPQA 1LP9E 2H2SC 4ZOAA 4HIIB 5KVMC 4BZ2H 2VQTA 3QDHA 4MWFA 1EFXB 1IAOB 4LSRL 5E6IC 1FORH 1R0AH 3GHEL 3TA3C 4M43H 2G5BA 1OP3K 3ARDA 4G80A 1QNZL 3INUH 4HUXA 5GS0H 2PETA 4NJ9L 2YD4A 4M02A 1HZHH 1U95A 5IIEB 4LRNH 1IARB 3T04D 3LKOA 4B53A 4M8VA 4N5ED 4YDLB 5LGKA 2A6DB 3F6IA 1G7QB 1MWAB 2ZUQB 3SY0B 1I9EA 1BD2A 1XEDA 5ERWB 4N8VG 4P23B 4DW2L 4PV8A 3G5VB 1CLZH 1FLRL 3QHZL 1IC5L 5D1XA 3I6KA 1U8OB 2DL9A 2H8PB 4D9RE 2BY3A 1YYLH 4PJEE 1FO0B 4S1QH 1EJOL 5ENWA 4ZPVB 3NIDE 5EU3B 2H3NA 1OF2A 1B0GB 2Y06H 5EU7E 1CZ8H 1P6FA 4UAOB 4YXLL 5FHBH 4RCAA 2WANA 3MYJA 1ZGLA 1JWMA 2FX7H 2Q8AH 4QHNA 3I9GH 3MBED 3ARGA 3ETBF 5T1LD 1VFMA 1X5KA 5DD3H 5HHNA 1QR1B 4LLUA 3AAZB 5I8CA 1X4XA 3KDMA 3TO4C 1F4HA 3DMMA 4OCRH 3RWHA 1NCWH 3ZLQC 4NYLB 4WJ5B 3QEGH 4IMLB 1ES0A 4WW1B 2Z35B 1MJ7H 2L0DA 3WFHA 1EUUA 1OSPL 4MMXC 4GKOA 3X3GL 3U4BH 2VN4A 1Q9KB 4Y4KA 2DWEA 2VLRD 3HFML 4OIAA 1T4KB 1K8DB 4L9LC 5ADOL 4GG6E 4BUGA 4X8JB 1OTTC 1VACA 1QFPA 2L4OA 5EOCJ 4CADA 3ZTNL 1JWSB 2NXZB 2GJ6B 3C5ZA 2HLAA 4HXAH 2EKSA 1A9EA 3EOBA 1B0WA 4U6YA 1BD2E 1NDMA 3MXVH 1A1MB 3QJFB 4P48A 1LO2L 1CXKA 5EOQL 3N85H 3G08A 4KHXH 4OSUH 3FO1B 3RBSA 1D7FA 1PLGH 5J6GA 3ARDB 1A7BA 2CJUL 5D7IE 1YNLL 2ESVB 2X9YA 5J13C 2QQNL 3CVHA 3UO1H 3B9KA 4WFFD 1IEHA 4LOUD 3TBTA 5HYFA 4KRLB 2DQIL 5H37H 3B8YA 3S4SG 4DN3L 1IGYA 1FAIL 5H35B 5KBNC 5AWNL 3UBXG 1CG9A 2R0ZH 3VRIA 5K9JL 5IBTH 3PF2A 1S9KC 1JUFA 1JGDA 5TQ2H 2BNQA 2VQ1B 4KXZH 1ZLWH 2ZNXA 1IAIH 3U4EA 5FA4B 4LLMB 1I7UA 2DQHL 1DQLL 4N0RA 4GAGH 4GRWE 5T33L 3MV9A 5BW7C 5JPMA 4D0BA 1JK8B 2FECL 4GMTH 4ZXBA 4PJ8D 2WBJA 1DBMH 3MRFB 1OOAA 3TWCH 4PLJD 4PJAF 5EC1B 4RAUA 1BEYL 2H3NB 4EI5D 4JANA 4ZYKB 5F6HI 1CXIA 4V1DA 2WINA 3ARBC 3LKQA 4DKEH 2IAMD 2D7QA 2QQKL 5FUZH 2LQRA 3C87A 3U36A 3PABB 1KJVB 2P8PA 2EC9U 5MI0B 3T08A 2V7HB 3ISWA 4KTDL 2Z92B 2P7TA 5DQJA 4YX2L 5IW6A 2ZUVA 3SDXF 5I8CB 5I15L 1MCPL 4QXUL 3KDMB 3U83A 4YGVA 2Z93A 4X9FA 4IRZL 1I7ZA 2ICEA 1FYTE 2O5YH 3H9SA 5DJCB 1NMAH 3CH8A 2I9LA 1BF2A 4FQLL 5KSVB 1E6OH 2XRAL 4QF1A 1A7RL 5F1KC 5CP3H 2YD1A 1BVKA 4Y4KB 3L5HA 3DNKA 4X80H 1KUMA 4R26H 1ACYH 3MLSL 4WO4C 3MV7E 4C4KO 5TH2B 4UQ2A 5IHZA 2JJVA 2OTWA 4AEIH 1J0ZA 2ZSVA 4F7TB 1CYGA 4JPWL 3Q0HA 5DRZA 3ZYIA 2JCCB 1HEZB 3DVNB 1I1YB 4GFTB 4M93C 4OLUL 2IH1A 1Q94A 3DSFH 4PRNB 4I9WE 4NPYB 5C09E 1P4LA 2CLVB 5HGAA 1GH7A 5GS0C 3LV3B 1BIIA 4XMLH 1XIWC 1Y0LB 4S0SD 3GSRB 3ALWA 4JVPA 4M7KH 1MPAH 5GS1A 4MNGA 1CFTA 1A6WH 2GFBA 1X4YA 4KK5C 5SWSB 5MENA 1DDHA 1S8DA 2X9WA 4MJ2A 5FYLH 2X42A 1JGDB 1EGJH 1OQOA 1HIML 1S7VB 4TRPH 4XMKL 5HI3D 2C9AA 5CEYA 43C9A 5DVLA 1MFAL 1OB1B 2P8LA 5MEOB 4KUZH 2C1OB 1QSED 2JF1A 2DMKA 1I7UB 1P7QB 3CXDH 1L0QA 4ODHH 5ID1B 5A16B 2X4UB 3MV9B 1YY8A 2IFGA 2WUCL 2BHUA 2EDNA 4XP4H 4RA0C 3H9SE 2V7NB 3U9PH 5IB4B 1AXTL 4V1DB 4JGMA 2FATH 3AS0A 5C9JA 5I1JL 1MCNA 2E3VA 3GK8H 3L3JA 5IESH 2BRRL 1J8KA 1IM3B 2HT3C 2P8PB 3PQYD 3MRNA 2EDBA 4NKOA 2E6QA 3M8OH 3KYKH 2DS4A 4FG6D 4NP4H 2D7MA 5E2JA 4E41A 5CBAB 1KG0A 1DN0B 3EO9L 4P0DA 3MZTA 3ULUF 1MIML 3QFJD 4IOFC 3KPMA 3ZDYF 4E0RA 1CK0H 3VW3L 3B2UC 4O2FA 1V7NH 4MNQA 4YO0B 2QQLH 5L9DL 3UXFA 5JA9A 3BE1H 4PJ7E 1JE6A 2J3SA 4WU7A 1TVHB 2ATPA 4MNGE 1UM5L 4G9FD 4HUVA 1XF1A 2D9CA 3W39B 3WUZA 5DQDL 5KVFH 4BZ2L 3QIUA 4KVNL 1EX0A 2AK4E 3RI5F 4KY1L 3ZE0F 4LEXH 4G43A 5DRZB 4MJID 3INUL 4ZTOH 4RISL 4HSQA 1TMCB 4FRWA 4X7DC 4EN3C 5GS0L 2CO6B 5JNYA 4Z7VB 4HS8H 3KXFA 3WCYA 4P5TD 4AIZB 5DMKB 3QDMB 4HIEB 1JGUH 1HZHL 4JFQB 3VXQA 5AG8A 1FG9C 3MREB 1VENA 3AROA 3P0GB 1CT8B 5HGBA 1WSST 4MHHG 4JHZA 4Q0XH 4KJYA 4XX1E 4WI6A 4JFOB 4GAJH 3WIHA 5E08L 2UUDH 4KK6C 4NRXB 1WIPA 1RD6A 1DDHB 5KOMC 4ONHA 5I73B 3TFKD 1CVRA 5K9OB 2IG2H 2LU3A 3VI4F 1IL1A 4RX4D 3OF6A 4S1QL 1B6UA 5SX5H 4PGDA 1O5DT 2VISA 3QPQC 5EOTB 1N5AA 3MOBH 4HQQH 4F7PA 4NRYA 4APQB 5IFAH 1OGAB 2Y06L 4TOYH 5ISZD 1CZ8L 4FXLA 1F4AA 5FHBL 5TPWH 2AJUH 1YPZB 2FX7L 2Q8AL 1SYSB 1RZKH 4BM7A 4EBQH 3V8CA 3I9GL 2HN7B 5EPMA 3OKDB 5HYJD 5L2KB 3IDMA 5DEGB 2A73B 3DETD 5AYQA 5DD3L 3KYOB 4YBQD 2F74B 2BMKA 4PGBA 4ZFOA 4UBDD 2ADFL 3S88L 3UJIL 4OCRL 1NCWL 4OGXH 4AK1A 2CDFA 2Y07H 3QEGL 5C7XH 4U1KA 1X5GA 1D5MB 4XCFH 5ITBH 4PRHA 3VWJC 2EIZA 4MA7L 3RGVB 4KPHL 1CDCA 1D5XA 2FH8A 5FAAA 4J3OC 4MNQB 1HHHB 3RTQC 3O3DB 4PJ5A 4PLKD 4MQXD 4QYOB 1PZ5A 4M1CC 5DRXA 1EEUA 1U3HB 3O41B 4HXAL 5MERB 3ECBB 3UPRB 5EA0H 4JFFD 1P4IH 3MXVL 4EEEA 3I02B 5DJZA 3GSXA 5EUOE 2DQFA 4GBXA 1G7LA 1Y18A 2XXCB 5FB8B 3N85L 4OSUL 4XCEA 3D39A 2XN9B 2L7UA 5IR1A 5HYSA 2APBA 2JE8A 1JYVA 1MCSA 2YPLE 2R0ZL 2PKDA 4CVZB 5IBTL 3QBTB 4A6YH 4QEGA 4LQ1A 2WIIB 3NGBC 4XWGH 1NGWB 4KJYB 5EIVA 3ES6A 2ZUTA 3TVMD 3PWPD 3X12A 4YDJA 1DQTA 3RY6C 2DBJA 1AY1H 1LEGB 1WAAF 2EECA 4GAGL 3WFBH 1TVDA 5DZLA 3DUSB 1J8HB 4XPAH 4PFEA 4GMTL 1DBML 3EFFA 3RPIA 2Z31A 3QXDB 5JOPE 1FVEA 4KROD 2JJWA 3DV6A 3VXRA 3GIZH 4L3CB 1S7QA 3L3DA 3H7BA 1HWHB 1UKQA 3VXMA 4DKEL 5FUZL 4BH7A 1B3JA 4YK4C 1ZHBB 3SDCC 3BPLB 4ZFGH 4MAYD 4GW4A 5FHAL 5DXWA 1T2QH 3GZKA 4PRAB 5J06A 1YMMD 3RDTC 2X9XA 3ZDZF 2C3HA 5DK0B 4ZG1A 4K23H 1Q38A 5AZ2H 4CVWA 4ZFOB 4XRCA 2XQYG 5D7LA 3L3HA 5ESVA 1FV1B 4YXKH 2UV3A 3D39E 1QSFA 1EVTC 1NMAL 3PNWA 1OT2A 4ODTH 1E6OL 5I6XB 2ICWJ 3FT2A 5GRVL 1NFDA 3W9EB 1OLZA 1MFEH 5E8NB 4BFEA 3EYVB 3N50A 4X80L 4R26L 3FFDA 1IQWL 4X98A 2BC4B 3V0WL 1HXMB 3I50H 4YPGB 5LKNA 3ZYOA 1J87A 1PZ5B 4G5ZH 4AEIL 2NMSA 5I76B 1D6EA 3B9DA 3WKNA 3KNBA 5A2JH 4AZ8A 2CGRH 3DSFL 1TVBB 3QP3A 4Y2DA 2I9TA 4P2OA 3DBXB 2F15A 1T7WA 3V0VA 3MQIA 2R8SL 5FOBA 1F2QA 5IMLA 4IRSC 3DX7B 2P47B 3AFLA 2BSED 3TYFA 1F97A 4PIRF 3ARTA 3QUXD 3Q5TA 2XYCA 4OGAC 2HVJA 1YQ2A 2UZIH 2R29H 1QFOA 1A6WL 1YNKH 4DZBA 3VXME 3BP5A 3L3GA 2FZ3B 2LU7A 3KPTA 4G7VH 3OV6A 4X7TB 1NC4D 4XVUD 1G84A 2OR9H 3AY4A 3ES6B 5HJ3A 4TRPL 4I0PD 1EMTH 3OGCA 5D7JC 2DN7A 5FKPB 4B7IA 4KUZL 2A77L 3Q5OA 3QHFH 4FQPA 5JOFA 2AEQH 4QXTB 1Q9OB 3BQUA 1PX4A 2A6KB 4LGPB 5KSBF 4OFKA 3FB8A 3ZT7A 4XP4L 4K3HA 4ZOBA 1QBBA 2X7LB 1T0MB 4HC1A 3CFEA 2EEBA 5E95B 2V2WB 3DV6B 3VXRB 2FATL 4NQCD 3E2HB 2ED7A 3GK8L 4YHLH 5IESL 1A6PA 1LO5B 1FE8L 3PG2A 4ZQKA 5FO7B 1RZKC 1CI5A 3QDGD 4HIXH 3M8OL 2EDHA 3KYKL 4NP4L 4BA8A 2GTWB 3LDBB 2QR0A 3FB5B 3E3QE 5CJQL 5KSAA 2YBRA 3TJHC 3RKDC 5T5NF 3QI9B 5IF0A 1UACH 1F3DH 3MRDB 5E2UL 5EZJB 1U8NB 3L3HB 1K9TA 1WQVT 4S1RH 1V7NL 5J89A 2OL3H 2QQLL 2X4OB 1ZV5A 5GGTH 3BE1L 5ALBL 4DVRH 3C60A 3FT2B 3IT8D 3OJVC 3A6BL 2F53D 2YA2A 4B5EA 1KBGH 4X98B 4OJFL 3RZCC 2W91A 4XVSH 2FJFB 2DKMA 1KB5L 5CEXA 4ZTOL 5DD1H 1KYOJ 4OZHE 1IGFH 3NZ8B 1U8LB 2FHFA 3VE0A 5HD8D 2CXKA 1X44A 4HPOH 4Q9CA 3FO9A 3Q6GH 1IKNC 5C0AA 2AXFA 3GSNB 3OAUH 4X6BB 5E2TH 3B2VL 3HUJA 4EUPG 5SWZD 2EIBA 1ZANH 4EDXB 4GAJL 1T04B 3AU1A 1I9RH 2E7LC 5CEZD 1H3XA 4AQOA 4KJWC 5HTSA 2EYRA 4WI7A 3WL9B 5HJ3B 2IG2L 2HRLA 3KPPB 3VDAA 4X4ZA 4UNUA 4H1LH 3L9RA 3HMWH 2NR6D 5TE7H 1A7QH 1BM3H 3MOBL 4P99A 4PJXA 4N8VB 4F3FA 3GJFK 5IFAL 2F8XC 3JWDH 1QLEH 4TOYL 4L5FH 2IBBA 1S7XB 3FT3A 2VWEC 2EE6A 3CU7A 4Y5YA 4NBXB 2AJUL 4HCRH 1K2DB 2VZ1A 4OCYH 1NEZA 4NUJA 4OCNC 1OAUH 3AS1A 2KQMA 3O4LD 4EBQL 1I1AA 1RZGA 3CLFL 4L3ED 4XCCH 2YK1H 1ZHNA 3S34H 2FB4H 5C0ND 2FX8L 3G6JF 4F8QA 4GKZA 3QUYD 4GSDH 5F9JA 4YHYB 1D5IH 1QFWI 3GMNB 5MEQA 4OGXL 5HDQH 5ITFA 3TN0A 4Z7UB 2Y07L 2D7NA 3KJ4B 5C7XL 5HBBA 1R3IH 2FIRT 3O6FD 5J9PA 3HI1A 4J4PC 3CD4A 5ITBL 1M7IA 2KBGA 5I1DB 1CGTA 1B4JH 1UB6A 3IFOB 3IXTB 1DE4A 1WITA 1XR8A 4G6MH 1AR2A 4ZMAT 3MV8B 3C60B 1CDIA 5GZND 5INCA 4MD4A 1QBAA 1H3UA 4JG0H 1SJEA 5EA0L 1P4IL 1XF3B 2I26N 1W72B 3M1BA 3QISA 25C8H 3DX8A 4FQQA 1RZFL 1KTDA 1HSBA 2D0GA 4PD4J 1IEAA 1FG2B 1CDYA 4X6EA 4I77H 5JDSA 5JW5A 1X5AA 3UYPA 3L7FA 4X5XB 1X5ZA 2LTQC 3VD7A 1HN1A 1N7MH 5CWSB 1FIEA 4NRZA 2NTFA 3IDXL 1PY4A 5DMGC 3WLBA 1WWWX 3LRSA 5C0AB 2DI8A 2XOTA 2XG5A 2QEJA 3OWEA 3VD4A 5EBMA 4XWGL 5H8DA 3ARED 1MRFH 3EGSA 3KPSA 1SM3H 4PGEB 1BZ7B 2CLRB 1BREA 4ENED 1T83A 3RIAK 3UBXB 2GAZA 1IE5A 1AY1L 5D5ME 4CUCA 4HULB 2NW3B 5F71A 5BV7H 3VXSD 1EEZA 1R3JB 5D9SB 1K8IA 2PNDA 1M05B 2QSTA 5DHXB 4W4OA 2VR4A 3O0RL 3TFKC 3RWEA 1J1OH 5B3JE 1FNAA 3GIZL 1BFOB 4JFYB 4AH2A 5EZLA 1CTNA 4R2GD 4FXKB 1JIBA 3DIFB 3OB8A 4G6KH 4UQ3A 2W59A 5I1GL 1YEHL 1KCRH 2X44D 2EXYD 1T2QL 3MNVA 1RZGB 3B3IA 3Q48A 2VXSH 4G8IA 4X7FC 2F5AH 5KSUB 4MDIB 1FPTH 5ECJE 2A1WH 4J3TA 5AZ2L 5HDLA 3SDDA 4M00A 2ZJSL 1U8KB 3D85B 4YXKL 3GSVA 5JHDA 2R1XA 5J9PB 2MHAB 4ODTL 3HI1B 1J0HA 1HXYA 4GT7A 1G0DA 5C0EA 4ZFFA 2H6PB 5J11C 2Q86B 3FQXA 4OZIE 1MFEL 5TDOB 3HG1A 1DE4B 2QBWA 4IMKC 4NQDB 1XR8B 3HZMB 2P8MA 3I50L 1MIEH 5CP7B 4G5ZL 4KU1A 3MRLB 2PXYA 1HINH 2AQ1A 2E8YA 3GUTA 3NTCH 3EYQD 3WYRA 1A6AA 4M5YH 4LP4A 4FOMA 2Z8VC 4L8DB 3QQNA 5FOJA 4WDIA 3UTTB 1MCDA 3HC3L 1WIOA 1WBYB 3IKCB 1IEAB 5C0FA 5ACLA 2YPKA 2J8UB 4L4JA 4YXHL 1I8LC 2AW2A 4LMQE 2LV4A 4OLWL 4R4ND 2UZIL 4Y19A 2R29L 4FP8H 4M6MH 1DQDH 1YNKL 3L5WA 4NRZB 2VMFA 1EHAA 3LRSB 5D1ZB 3TA3B 2NY1D 1EZVX 3OAZH 4NBZB 2OR9L 4XXCA 1NAKH 4BSWB 1GHFH 3QXTA 4ETQA 1EMTL 5L8LB 4PGZA 1NJ9B 5D71H 3B5HA 3QHFL 4NQXB 1KXTB 2PF6A 3K80A 3QDJB 4MX7B 1U8JB 3IDNA 4TSAH 1T0NA 3WEXB 4UI2A 4WUKH 5KS9E 4C56B 5JHDE 4AM0B 3TVMC 1U8MB 2AV7B 3JWDC 3V52H 1YEFH 4G9DA 5EZLB 4YHLL 4QRRB 5F44A 4LLYA 2HJFA 5KANG 4LVOC 4YDKL 3QXAB 4KI1A 4HIXL 3KLAB 3EDEA 3EW3B 3O45B 1ORQB 4FQIH 2W0KA 4B7LA 4PJ9B 1A5FH 4PJDF 3FZUD 4R9HA 3T0EC 1F8TL 1B9ZA 3SHSA 2C3GA 3HZYA 5EH1A 2KKQA 2JLLA 1TJHH 1HHGB 5F7FA 4D94A 2ZSWB 5SWQA 5GGTL 4DVRL 1I9JH 5LXGH 1JWUB 2ICES 4ZFFB 2ADGA 5I19H 3SPVA 3SDYH 2BNRD 4JO1L 3CMOH 4MA3A 1KBGL 4IDLA 3TO4B 4POYA 4HUNB 5K93A 2E7MA 2PYED 3W9DA 2OQJB 3VFWB 4XVSL 5D70H 1KCSL 4X4ME 3GI9H 1VSCA 2R2HB 4OFVA 3CPLB 5DD1L 1W8NA 4C58B 4DGYH 2X5PA 4OCWH 2EIDA 1IGFL 2EDYA 4XTRC 2R39A 4YFLF 2B1HH 4WW2F 1T21A 3GRWA 4L9LB 3JTSB 4YLQT 3BZFB 2H9GB 3Q6GL 5D6DA 2VE6A 3OAUL 5E2TL 2VL4A 1F4XL 4P9HH 5AAMA 3JVGA 3MRHA 3GGWA 2X4SA 1ZANL 1RZ7H 2NQCA 4WW2C 2P5EB 5FECA 1I9RL 1CGSH 5F7WC 3MRQA 4DZ8B 1SHMA 3MJ6A 1HKLH 3Q3GB 1RHHB 5M94B 4GAYB 4DTGH 1LEKA 1FVDA 5J13B 3GSOA 5EIIA 1F90H 5JIKA 3FFCD 4ONGL 1VGEH 4UDTA 2V5YA 5GRJL 3D9AL 4AT6A 2LU4A 5TE7L 4P46A 1A7QL 1BM3L 2FLBT 2JELH 2NXYC 3ARFA 5BV7C 5DGRA 5KVDH 3RU8H 3GMPA 2AEWA 3FQWA 3JWDL 1QLEL 4LPUA 4L5FL 5AYUL 3VXPA 3RVWD 3JV6B 4LNRB 2IH3A 4HCRL 3BFOA 1WZLA 4YAQB 3SDAA 1FFQA 4NQEB 3K46A 2B2XH 4EJ1C 1OAUL 5GGUB 4XCCL 2YK1L 4U6VH 4WI3A 4FFWC 4G3YH 3VFTB 4KKCC 5HI4D 4D3CH 4GSDL 2R69L 3BP7A 1ZMYA 4GKSA 4QHUA 1D5IL 4UOJA 4ZTPH 2V9QA 1DTUA 5HDQL 3CFJA 2P5WB 4WFHE 2FDBP 2P43B 5IEHA 1KLUB 3ARBB 2VLJE 4I1NB 4BUHA 4QWWC 3NN8B 3GB7B 4LQFH 4PJAB 2C4FU 1B4JL 2O5ZH 1ADQA 5I1AA 1AFVH 5TJWK 2W0FA 4Y0GA 5HDBE 4G6ML 1IGMH 3MC0A 1MNUH 4QRSB 1C5DB 3DWTA 4ISVA 4RBPK 2ADGB 2VABB 1KGCD 2W1NA 1QPXA 1I8IA 4TTDD 4JG0L 4WUUD 1NFKA 1RU9H 4M6OH 5B22A 3NFPA 1F5WA 1Z5LA 1RK0B 3QUZC 4JFZH 5D7KD 4HLZG 2APXA 4HK3N 4NO0A 5GRZA 3SDXB 4XNZB 4WI2A 3MUGB 4LCWB 4N0CC 3UTSB 1GGIH 4I77L 3MODL 3P77B 5FEBA 4M48H 1FNEB 4U3XA 5FGRA 1S7RB 5H94B 5F93C 1FGNH 5DJ6A 1P9MA 4YHOH 4L4TA 1VGKA 1W0VA 3JZ7A 4PD4K 4PRIB 1FYHB 1AGDA 2ESVE 3BT2H 3RWDB 4YIQA 1WZ1L 4M93B 4KC3B 3MOAH 1SM3L 3GKWH 4RIRB 2O61A 5CIPB 4HHAB 3U48A 3QQ9C 4PJCF 5GGRB 5BV7L 2VIRA 3PL6D 1RZ8B 1DQJA 1YY9D 3BGAA 5FA3A 3WFCH 3D18A 1HYSD 3R0NA 3U0WH 2IBGA 3ARFB 2VR5A 5I2IB 1A0QH 1J1OL 3P0YH 4LMQI 3GMPB 5HVWA 3DX6A 4YPJA 4H1LG 4FTVA 3O3EA 1KCRL 4Q6IA 4K94H 5IB5B 3HS0B 3KPRD 1NMCB 3TZVA 2OZ4A 4KI5C 1B90A 2A9ML 2W9EH 3LN4B 2D03H 3MZGB 5D2LF 3O9WA 2W9DH 5HVHB 2F5AL 1JPTH 2A1WL 3BP7B 3P9MA 5LWYL 1SYVA 5IOPA 4P5KB 4LIQE 5DHYA 2FJGB 2AJVH 4MXQC 4U1HA 2ITDA 2JJTA 2W0LA 4OAWA 1SJHB 3MRBA 1IKFH 1ZS8B 1Z9MA 4GXVL 4YDIH 4MS8C 5D8JH 1MHCB 2HRPL 3QNZB 4JFDB 3TCLB 5HPMA 5DUMH 3PIQA 2XNAA 2VL5A 2BVPA 1CICD 1L7IH 1MJUL 2G60H 5I1LB 3DXAA 2CUHA 4R8WL 1I8IB 1HINL 4NT6B 3OJDA 3NTCL 4M5YL 3CSYA 3L95A 4YQXH 4FQXA 1R3HA 2GEEA 5L8KB 4Z7NE 4QT5A 1CFNA 2JJSC 2JCCE 3UZEA 3BDYH 4POZC 3FOMB 3V5KA 4CNIB 4L4TB 5TF1H 4FP8L 4FQ2H 5D2NC 4M6ML 2YSSB 3T8XA 4Y5XA 1AGDB 3QIBC 4FTVE 4P9HC 4EQ2A 5KW9H 1U9KA 4HV8A 1SBSH 1DP0A 1JI1A 5GGRY 4D0DB 1IC1A 1AGEB 1NAKL 1ZWIB 3UYRH 5FYKE 4EN3B 4JCLA 4BFIB 4HUUA 4KJQD 1X5IA 5SWSE 5D71L 3TPUA 3UAJC 4TSAL 1FGVH 2Z9TA 2C3WA 3NCEB 3SO3B 1R5VB 3T4YA 1SY6A 2CDGB 3QXVA 4G8FA 3V52L 4L8SA 1KB9J 1YEFL 4KQ4H 2XFXA 2BOCB 1QO3B 2OR8A 2MKWA 3O3EB 4KKNA 1H3VA 2B1AH 1U2HA 1PX3A 4PTTA 1ZVSA 3DXAE 1WC7B 3R06B 3TT1H 4FQIL 4JFHE 4JGUA 1A5FL 3J8F7 2QSQA 1L6XA 1A6TA 3NIFE 3C2AH 2P44B 3HNSH 4R96A 5HHOD 3FO0H 2DYPD 4G8EA 3TJEH 4F7CB 1MVUB 1KXVC 4WWKC 3N1GC 4U1HB 1I9JL 5LXGL 4OAWB 2AABH 3SDYL 3BWAB 4N1CA 4QO1A 2PR4H 3CMOL 1RVFH 2NX5D 3S97C 3B6SB 1OCWH 2PO6C 4Z77A 3MBEA 3CSGA 5D70L 1FFNA 2Y7QB 4U1MA 5EO1A 5T1LA 3DSNA 2GSGB 5C71A 4KV5F 4NHUA 3OJDB 1WVZA 2P45B 4DGYL 4OIBA 3VWJB 3LQZA 4YWGH 4ERSL 4OCWL 5FO9B 1XH3A 1AC6A 2R2EA 2B1HL 1IQDA 1U92A 3RTQB 1QOKA 4BK4A 1W8OA 5BOZG 4CMHC 4Z7VE 3H42L 2VQUA 2OJZH 4DWHA 4PP2A 1R3LA 5F88B 2VLRA 5LGHL 4TVPD 1JPST 4RGNC 3T8XB 3EO0B 3I3EA 4KK8D 1CGSL 2HT2C 1HKLL 3A6OA 1XF2B 1KENH 2XPGB 3GJFA 1U8PB 4WY7H 2W9LA 5I74C 2D7OA 2EDQA 5DT1H 1F90L 4LARL 5I17A 4EUPB 4HUUB 4D9RD 1VGEL 4ESKA 3DRTB 4NZRH 3LHPH 4FA8A 3TPUB 2DRUA 5K9QI 2NY1C 2JELL 1X7QB 5KVDL 2VKWA 3EOTL 4N8CH 2WUBH 3NGBB 1I75A 1BFVH 4MZ2A 3GMMA 2H26B 3KYNA 1WBXB 2B2XL 4MCYB 5T1DH 4BQCA 4NHCL 2Z8WC 1EO8L 1BQHG 3BN9D 2YWYA 5E2VH 4NN7B 1G6RA 4G3YL 5BRZE 1IILE 2MWCA 4D3CL 4XPGL 1MI5B 4IEFB 5EORL 1YPZE 1ZVSB 4ZTPL 4NN5C 5DC0A 5B39G 2ATKB 3HAEB 1VEOA 3D3VB 5A1AA 3FTGA 4LNVA 4Y4HC 3U9UB 4ZS7H 3TNNA 1Q0YH 3C08H 4YK4B 4FFYH 4PJ8A 3SDCB 3H9HB 4EI5A 3K4DA 4RRPG 1IGML 4L4VA 3SE3C 3WE6B 4CU7A 5IV2A 4NDMA 4WV1C 3G04B 4AL8L 2IAMA 4G6JH 1AGFB 12E8H 5C0CB 4JQIH 1BD2D 2AKRA 5BMFH 1T1WA 3EYOB 5DRWB 4LCCC 3L3OA 3MBEB 5J1AA 3ARYA 4PGCA 5D1XD 4ZSOB 4LDEB 4NKDA 3SKJH 4M7ZB 2XKSA 3FMGH 1EA9C 1GGIL 2VDNH 3LY6A 3C8DA 3LQZB 1VA9A 1F3JA 4TUJB 3KJ6H 4M48L 1JZ4A 3O3AB 4X0KB 4RFOH 3ARVA 4WFEE 3ZKMC 4YHOL 1JRHH 3GJEB 3IAQA 3MLZH 5EWIH 1I3VA 2DIJA 3HE6D 1MCIA 1JGVH 2XN9E 3WIIH 3AMKA 5IEKA 1X5JA 3EHBC 1JF5A 4K3DH 3BESR 1QRNB 2V17H 4R7NA 4DGIH 3MOAL 7CGTA 1KB5B 3GKWL 4JLRB 5FXCH 4GRLC 5T3ZE 1KNOA 5HYQB 1D6VH 4K7FB 3RL1A 1U58B 4QTHB 4UT7H 4GW5A 1C5BH 3WFCL 1JHTA 3IDUA 3ROOA 3GSUA 3KYMB 3QIWA 4U2YA 1HKFA 1DVFD 3P0YL 2XQYK 1ZT7B 2IGFH 2VDMH 1NDGA 1S5IH 5IGXH 7FABH 1LHZA 1JTOA 1J8HE 5F6HJ 1RZJL 1E28A 3KYNB 5EBWB 4L4VE 5JO5A 1CFQA 2BERA 1RUMH 4M4RA 1JN6A 3C5ZD 5D7JB 2W9EL 3GO1H 1NGPL 5F1IB 1T2XA 5JXAL 1WT5A 2VITB 1JPTL 2HKHH 2VDQL 1EXUA 4G8GE 4S1SH 3QEHB 1KCUL 1NCCH 2GT9A 5GGSA 1T2JA 1IAKA 1HQ4B 1FP5A 5KSBB 3B9KD 3WS6C 2FGWL 5E8EB 2ICWA 3I2CH 4ZUWA 4HZLA 4U6HA 2EYTB 3DI3B 5D8JL 3BSZH 1HHIB 2GW5A 1S9VA 3MV7D 1L7IL 1QSVA 5IQ9A 5TQ0H 5DUBB 4Z8FH 3RI5K 2G60L 4NDMB 3P2TA 2GK0A 4ODXB 4OZ4B 3S8WA 2BNQD 1AQKL 2DLHA 5F89A 1T1WB 3PQYA 4QRTB 4UDUA 1MWAH 2EZ0C 4P57B 3VH8A 4QXGH 4PJIA 4I9WD 1CGXA 5C3TA 5C09D 4PGCB 4NKDB 5BZWB 2NY4C 4HUWB 3H0TA 4M62H 4DN4H 4ZXBD 2WBJD 6FABL 1A2YB 5MEPA 2HG5B 1VESA 1T6VN 1G9MH 4HS3B 1X9QA 3QFJA 1FO0H 4KUCD 4HWBL 4MD0B 2YR3A 1SMAA 4FQ2L 5TF1L 3RZCB 4KKAD 4UV4L 4Z7WF 5KW9L 1SBSL 5HHMB 3RVVD 2EXWC 2IF7A 3PJSB 2J8HA 4OKDA 2XXMB 3UYRL 3AUVA 3IU4H 4PB0H 5K59F 3GMRA 4LGSB 4PG9B 2WW8A 3L6FA 3T0BA 2P24A 3VFUB 1FDLL 2XTJE 2CK0L 4XP9L 3RL1B 4CN6A 1R5IA 4RNRB 4MAUH 4XCYB 3DRQA 1CFSA 3H9SD 2JB6A 4P5TA 4RAVA 1FNGB 2HJLA 1NL0H 5EBLB 1OAKL 4RFEB 5ICXB 4KQ4L 4P3DA 4LVHC 1XGYH 4M7JH 3PL6C 2NY6D 5J8OA 2B1AL 1I1FA 4HXBH 2UWEE 3VFNA 3HI6H 3VXNA 3ZE2F 4QNPE 5DJ2A 1OTUD 5IFHL 3VXUA 1KCKA 15C8H 4Y8AA 3P40A 3RHWK 3TT1L 4DAGH 2X89D 5KJRH 3DO7A 1KB9K 3BGMA 1B0RB 4LKCB 2V2TB 2ITCB 5GRVK 3C2AL 3HNSL 2BSRA 3FO0L 1U91B 3GBNH 3HTLX 4KKBD 1RUKH 5GGSB 3TJEL 2V5MA 1AGBA 3F12A 5FYJH 1JV5B 2IPKB 1QSEB 4OGZA 3VFMA 4ORGA 5BZDA 1CD1A 4KVCL 2QQQA 5AUMB 5I1HH 5EO9A 3IB4A 5CKGA 4U6HB 5ISZA 2AABL 1AD0B 3CSBA 5FV1L 2PR4L 3TV3H 8FABB 2DLEA 1RVFL 1YN7B 4I5BB 2P1YA 1OCWL 2FJHB 1S9VB 4XB7A 1I85A 3O6MH 5HYJA 2GK0B 3MO1B 1IVLA 4GKNB 3G6JB 5DEFB 3O11B 3STLB 2C7UA 1E27B 5HY9A 4X99B 3F8UB 4YWGL 3NABH 5DD5H 1FL3B 4G6FB 1G7IA 3BHBA 3GSWB 4ZOEA 2FSEA 4EIZC 5CJOH 4NWTH 1M7DA 5MEPB 5BXFA 3JWOH 5IKCB 1N6UA 4LAQH 2VRAA 1LE9B 2NY2C 4U1NB 4IIQC 2NY0D 1D9KC 1MFBH 4JKPH 1P4BH 1KENL 2B20A 4WY7L 2HP4A 4G9FB 3U2SB 2OI9C 3VXUE 1RURH 2Q8BH 3LZFH 5DT1L 4LIQH 4XZUB 4NZRL 4F7EB 5C08E 3HE7D 5CBEB 3V4VH 5CJXC 1G7JA 4MJIB 1S7WA 4ZD3H 4HAGA 1HI6A 4OQTA 3PWLA 3GEWB 4N8CL 4X83A 5AG9A 3QAZC 1CFSB 2WUBL 1M71A 2FCBA 3D0LB 4GG8A 1A9BA 1BFVL 4JM2F 1F3DJ 1G7PA 2NLJA 4RAVB 2FR4B 1NAMA 5T1DL 3LKSA 1QHOA 3JV4B 4JPKH 3MMEA 5E2VL 3HB3C 5DR5H 4MXVE 2YD6A 4JM2C 3IVKA 3VFPA 1ZGLM 1CCZA 4RGOH 2NYYD 2BFVH 3H3BC 1N2RA 1KFAL 2JB5H 4DFHA 1XGTB 1SEQL 4HKBB 3VGDA 3QQ4B 3KVQA 2J5LC 5ICYB 1A3LL 3BGMB 4PJBF 4PJFE 2ORBL 4OLXH 3SGEI 3S4SA 4PGJA 4HWEL 5KN5A 1WV7T 1Q0YL 3KPOB 2GCYB 1EHLH 4FFYL 1AGBB 1DBKH 4MCZA 1CLCA 4ELKA 4ORGB 5ID0A 1LMKA 3C9NB 2GKIA 3CVHH 4X6CA 5ISZB 3WLWD 4G6JL 3SE4A 12E8L 1JZ5A 5E4EC 3RL2B 4JQIL 4P4KC 5BMFL 4XMPH 2J2ZA 2QADD 4MAYA 1HCVA 4BQ9A 1I3RA 1NCAH 1YMMA 2R4SH 3SKJL 1FNLA 1AE6H 2BJMH 1Q1JH 4FXGB 5J11B 4XWOC 4TVSa 2R0WH 2DICA 4OZGA 3F7RA 1JHLH 2UUDK 1JRHL 2NY3D 1CQKA 5DMJB 3MLZL 2IALA 2YPLD 1G9MC 4LRIC 4EOWH 5BXFB 5C86A 1WTLA 5JIIA 3OX8B 1T89C 1QUNA 3C8HA 1JFQH 4L8BA 1TFHA 4I2XA 1YQVH 2V17L 4DGIL 5SX5K 1ZOXA 3N06B 1H15B 1CLOL 4H26A 1CF8H 5EUKB 1D6VL 1KIRB 4JFFB 5L6YH 5TGBA 5C0GB 2R1WB 5JORA 3QEQE 3SGJC 1R3KA 4DEPB 3QO1A 4PJEF 2XZQL 3TM6A 4PTUA 5F3BA 1G7JB 1KTLB 4HAFA 4WHDA 1ZA3B 5DD6A 5FO8A 1I9IH 4J2XA 4XC1L 3G5XA 4UT9H 1IEBB 1MLCA 1S5IL 3C8KB 7FABL 1M71B 5IGXL 5J1SC 3QUXA 4ZS6C 5IVXA 3ULVE 3F7YA 4JE4B 3V95A 3OKLA 1NKRA 1RUML 1PGRB 4ZAKD 1NANH 1I7RB 2HTLC 4HF5H 2C1PB 5F3HA 1QVOB 4MA8H 3QPXH 3FO2A 4OLVL 1NC4A 5E6IA 1CE6A 2HKHL 5D96B 1B6DA 3WDHA 4GBXD 4IRJA 1IGIH 4S1SL 2A6IA 3D5OF 1NCCL 3TVMB 3PWPB 2NXZC 2FWOA 1GZPA 3D39D 3RA7H 1WWAX 4JJ5B 3IGAB 3SGDI 2G2RB 2F8VA 4XP6L 4LPVA 1CIUA 2ICWI 3BSZL 3ARDC 2VUYA 3L1OH 5ID0B 5TQ0L 2VZUA 2SEBB 4F37F 4Z8FL 2FEDC 4NQCA 5IFJA 4I2XE 4DVBB 2Y6SD 3T0EB 4RWHA 1Y6MR 3MRJB 4ZUUA 3O2DA 2Z8RA 1MWAL 1DR9A 2CDEB 1QBLH 2XZCH 4PJDB 4GOSA 2EDTA 1MREH 1YMMB 3T2NL 3VWKA 3EJYC 4LCYA 4XPBH 3N0PB 4M62L 3RWCA 3F7VA 1A4JB 5B4MD 3BUTA 1G9ML 4XXDA 4ONFH 1FO0L 1ZLUH 4HKXA 4OZGB 3QRFM 4XNXL 3UTTE 4FN0A 5DTFA 3QHTC 4HKZB 2X70A 3VXMD 2YZ8A 1DQQA 4MD5B 1WCBA 3RNQA 1JNLL 1GZQA 2F53A 1OGTA 2APVA 5F70A 1TZGH 3IU4L 3F5WA 3S9DB 4PB0L 4HJGA 4CJ1A 4CVXA 5IVOA 4M61B 1NCNA 4TVPL 1RUQH 3QO0B 1N26A 5J6HB 1FN4B 4IM8A 1RMFH 3JUYA 4M03A 5MI0C 4MAUL 3FQNB 4KTYA 4ZO7A 3ARGC 1MJJA 2IEPA 5JORB 2PW1B 5DVOA 3A0OA 4JZJB 4TTGA 4IJ3B 2DJUA 4WW2B 1QSFD 5F3BB 1JF1A 1P5UA 5DQ9A 3RWFA 1ZK9A 2YUVA 4XPFH 2IADB 3QDJE 4M3KB 4ZO8A 2RAMA 1A6UH 1XGYL 3DMMC 5JA8B 3SKMA 1IC7H 2MKLC 5SWZA 4F8TA 3OG4B 3TBWB 4EDWH 2QHRH 5DJYA 1EAPB 5KJRL 5ANMB 4DAGL 4Y4KC 2BNUB 2PTTB 5CLTA 1ONQA 1NC4B 4QRRE 3MRPB 5LBSH 4Y2DD 4YEFA 2A6IB 4I0PB 4P2OD 1UVQA 3GBNL 4JRXB 2YD7A 1RUKL 3MR9A 2XWJA 1OT1A 3PV6A 5FYJL 4J3SA 1NBQA 4CDHA 2A6JA 1YUHA 5I1HL 1PFCA 1CR9H 2GJJA 1OD9A 1OP9A 3QDAA 1DZBA 3BIKB 1JNHB 3HC0B 3QWOB 4X7SL 3CCHA 3O6ML 3QZWA 4BSVB 4H5SB 3X13A 2CIIA 5TDNA 3C5JA 3PDGA 5IM7A 2Z91A 1TNNA 3OTTA 2YUWA 3PDOA 4LKXA 1H3PH 2NY7H 3QDGB 2EO1A 1J0IA 3NABL 3LEVH 4R3SA 5CCKH 3L3KA 3T77B 4OD1L 1SEBA 5D6CA 3BQUD 1AKJA 5FDWA 4NWTL 4UIMA 1TXKA 3BZ4B 5EN2B 4B0MM 1YEKH 3ZT5A 2IPUG 2EDKA 3CDYA 2YPVH 3CDGA 3VFOB 4NNPH 2X70B 5DMIH 4PP1C 3MYZA 4JKPL 1WFTA 3RVUD 1P4BL 2ARJA 3UDWA 2F53B 5FUCC 1RURL 4QRQA 2P5EE 4J23A 4HJGB 1VFAA 1MHPH 4XBPA 4TN9A 1H3WM 1MJ8H 4M1GH 2EDXA 2DQGH 4BFGA 1ROWA 5KSAD 2CH8A 2BOBA 3CZFA 1MCLA 4UU9A 2R23A 4PY8I 3ZYJA 3CXHJ 5CJBA 3C6LD 2RFXB 2APTA 2XI9A 3TEUA 3W82A 3BO8B 2VNCA 4RQQB 2YWZA 3ARRA 1QLRB 4LLQA 3CJJA 1YDPA 5CKAA 4JPKL 4O58H 3LCYA 1JL8A 2XV6B 3D0VB 4HUKB 4WO4A 1B88A 1CDHA 4KGJA 1SJXA 3B5TA 3QEUA 4NO2A 5DR5L 1JP5A 1UYWL 3H9ZA 4MJ6B 3CUPA 4RGOL 3AREA 5FCUH 4U7SA 1AXSA 2EKJA 2BFVL 4XNQB 1TPXC 2JB5L 3PWUA 5DJ0B 1SQ2N 2UYLA 4NSKA 5DO2C 4O5LH 2NZIA 1BQHB 3OKOA 4OZFB 4PJCB 3VCLA 3T65B 1QFWM 5JLZB 3VXSA 2DWDA 4FFVC 1OTUC 3C5SA 1XIWA 5DVNA 3UBXI 3WV0A 4ODVL 1RFDH 4P2RA 3BKJH 4XT1C 1M6OB 1HE7A 5B39B 3CVHL 2Z0BA 4Y16D 5FKAB 3MGOB 5ESQA 4ODSH 3QNYB 2GTZA 4D8PA 2AV1A 4PJAE 2XZAH 4XMPL 3QULB 2W92A 3O4LB 3CCHB 1KIPB 4PR5A 1NUFA 1NCAL 4L3EB 3D25B 5D2LB 3NMEA 3U1SL 2R4SL 2MNUA 3FN0L 3PHQB 4K3EH 4AENB 2BSSB 1AE6L 2BJML 1Q1JL 2VAJA 4LFHG 5GS1C 3PDOB 2Q1EA 5E8PA 2LAAA 3LS5H 3QUYB 3SGDH 3EZJB 4CW1A 5C9KA 3RGHA 1CD9B 5I73C 2R0WL 4XHJD 3IDIB 1JHLL 5F7DB 1UKSA 3GI8H 3MSPA 4G42A 4OV6F 4F9LA 2Q20A 3O6FB 3SDXE 1GOHA 5HPOA 5A3IC 4KDTC 4LCWE 4EOWL 5CD5C 3UTSE 3CGTA 4J12A 2APFA 2V2XA 3G6AA 3O8XD 4Q74A 1F58H 1JFQL 1YN6B 4I4WA 3CDGB 4ZPTA 1I1AD 1PD6A 1F42A 5DURD 1A6ZA 3OPZL 1CF8L 4LSTH 3TESA 4PRIE 2IPTH 4P5MA 3QFDA 1L0YA 4JY4B 3LPFA 2DM2A 5L6YL 1KF9B 4G6AD 3K8LA 4ODWB 4QCIA 4R4BA 3TBYA 5D2NB 3CZFB 2B5IB 4HD9A 4R6UA 5CMAB 1G0YR 1A1OB 1I9IL 3UP1A 4UT9L 1OWRM 1I3GH 4P2RE 1MAKA 32C2B 1KLGA 2YD9A 4NO3B 4PJGA 4YHNA 3IS1X 3V6OA 1G1YA 4HF5L 4RMVA 5IBLC 4RZCA 3RGVC 5EZOH 4OI8A 5DS8B 3RWJB 4MA8L 3QPXL 5L7XH 2JIXA 4HIJA 4I48A 2VJXA 3QUKA 2XICA 3TIDA 1T5XA 3I3DA 3BRDA 4NSKB 3MRRB 3RA7L 2AJZA 3V5DB 3QIUC 5CGYC 2DWDB 2K1MA 4E5XB 4N90E 2BVEA 4YHZH 1FZKA 1QSZA 4NBYB 3STZB 5I1EH 1YEIH 1KV3A 5AZEH 3T3PF 3L1OL 3TBSA 3S98A 5E00A 1ZLVH 1MUJA 2EYSA 1WBZA 1N64H 1D3CA 2XZZA 4YFDB 4H25A 1BVLB 3WDJA 3RWIA 2DD8H 3EJJX 5F7HA 4JFDE 5ETUA 1JPSH 1MSPA 4PR5B 5T1KB 2W60B 3FOLB 5C0RH 1MREL 1JZ3A 1NGYA 2GITA 3KLHD 4I3SH 1AO7B 2VLKB 4XPBL 2ZZUT 3BW9A 3ABZA 5DZOA 1C1EL 1D5BB 3N1MC 5E8PB 2X05A 4ONFL 4HDIB 4HJ0C 5F6IC 1DSFH 3QNXA 4OUUA 4X4YB 2PO6B 2FECI 5B38B 1ZT1B 3IFLL 3DJ9A 2BXYA 3MA7B 2YC1A 2CXGA 3QWRA 4HKJB 3ZDXE 1MHHA 3ZDYE 4PJGE 2BNRA 3KR3L 3PP4H 1TZGL 1T20A 3VRJB 4HC1H 1NC2D 1QBMH 4BK5A 4PY7B 5ESAA 1FCGA 4P5MB 3QFDB 2Y5EA 1RMFL 3SDDD 4OF0A 1U3JA 2DL2A 3NCBB 2XWBA 4MB5A 4CMHB 2RCSL 2B4CH 5JHDD 5C3LD 1FNSL 1MY7A 2Z4QA 4NCC2 3TBYB 3F65A 1RIUH 3BZDA 4R90H 1RULH 3CDFA 1A6UL 2X4NB 2GY5A 4WHTB 2R0LH 1IC7L 4S1DD 2X1QA 1IAMA 1QFUH 4P9ML 5CP3A 1U2CA 5I74B 3PWJA 3FB6B 4P4RB 2QHRL 3SO5A 5I6XC 2EICA 4AG4H 2PYFB 2NY1B 5DHVA 3ELAT 4JHWH 3PWVA 3ULSB 2ZUXA 1LEIA 5LBSL 4HIJB 4I48B 3FFCA 3W5MA 1QG3A 4L29A 1T5XB 1UCBL 2QKIA 4NQSB 4HFUH 3BP6B 1AR1C 2V9TA 1OVZA 2AJZB 2F58H 2UY7A 4TUKH 1D5ZB 1CR9L 3BPCB 4GBXC 3LN9A 5IHUH 5F21B 3S3JA 1YNTA 4Z5RB 1J18A 1GGCL 3U6RA 4UB0L 1WFUA 4JGJA 3VRLF 2HVKB 3ME0A 2QSCH 3VMOA 4KMLB 1S7TA 5C0JA 4LHUD 4OV5A 1BJ1H 1H3PL 3X11A 1EGJA 1KJ2A 3WIHL 2Y5TA 3GHEH 1S9WA 2W0PA 3MOQA 1EFXD 5DYOB 1QNZH 1F6AA 3CC5A 4TNWF 1NBZA 3HLAA 1YEKL 3BZEB 5T5FL 1KCLA 4NJ9H 3OAZK 3TO2A 3MGTB 1BOGA 4BKLB 4W6WB 3RX7A 4LCCB 4PV9A 2BVTA 4XI5D 2Y1VA 2HTKC 2NZ9D 3AXLA 2Z31C 3NCYP 1FFRA 1HOCB 3RDTA 4WUUA 3K0WA 5HGHA 4DW2H 3ALPA 2PYEB 1MHPL 3EYUH 3MJ8A 4M1GL 2DQGL 5ESAB 1FLRH 4HH9B 3LEXB 4S2SA 4P23D 5E6YA 3TNMA 3ZMRA 5BS0B 1UZ6E 1DFBL 3W11C 5BO1H 4P2QE 2J6EA 4XX1G 4ZFOL 4HFWA 3GM0A 4U2ZA 3MLUH 1XCTA 5I16B 5IWLA 2X41A 1KACB 4HX1A 1FVCA 2KZWA 2D31A 4JHBA 4NKMB 2H2PD 2YRLA 4GRLB 4YXLH 4XBGA 3VJ6A 1NFDF 4NKIL 5C1MB 3CXHK 4OQ1A 5F9DC 4U1JB 3OZ9H 3GMOB 1PKQA 3T0XA 3L7EA 4YNYB 5FCUL 4ZUSB 1HH6A 3WDIA 3G5ZA 2EE2A 4M6AA 3PDDA 5FYLE 4WFHD 1EBAA 2YD8A 3S96A 3CFKA 2BK8A 2VLJD 1LEIB 3CK0L 3MJ7B 1MRDL 1MI5E 2H32B 3GIVA 3PGCA 4KKLC 5LVEA 5CD3B 4IRSA 2NPLX 1J05A 3IRZA 5DK2A 1KIQA 4JVUA 1S9YB 4X6DA 5JPNB 1DLFH 1XGPB 2Q87A 1WAAE 1V3LA 1UKTA 3D3VE 4FMKA 1ZHKB 3W0WB 3HFMH 3VI3F 3VXOA 1RK1B 4EIGB 1W0WB 5FM5O 1RZIB 3KPRA 1JGLL 3X14B 4P3WA 1W2KT 3OG6B 2NTSP 3P3YA 4K3EL 3DX9A 5EU4B 3K2UH 1KJ3L 1LK2A 1J1PL 1VADA 1BLNB 1LO2H 3LS5L 4ZUTB 1KJ2B 5C0CE 4WU5A 3ZKSD 5F7LB 4JY6B 4P46D 3OKKB 3ZDZE 3UZVB 2CJUH 4W6YB 2D3VA 1F6AB 3MNZA 3AY4C 2QQNH 1AQDA 2PCPB 5IMKA 1P53A 1GL4B 5JXEC 2ESVD 3EZ8A 2MQ0A 3SDAD 4Z78A 4DN3H 1F58L 1FFPA 2A0LD 3LN5B 3HKFA 4DKDC 1CICA 3G6DH 3OBAA 4MA1C 4PRPE 1F4WL 2R9HC 1NGZA 3V4UL 2EO9A 2IPTL 3D6GA 4O9HL 3BH9B 4QLRA 4U33A 2NY4B 1FL5A 4YR6B 1ZSDA 5E94A 5EO0B 5GRWA 5KAQF 1QRNE 5HGGS 4MQ7B 2B39A 3MJ8B 3EOAB 2XY2A 2DQHH 4S2SB 3TNMB 1HQRA 1UGNA 3KAAA 3KWWB 4JDZA 2B4CC 2X4PB 3LSOB 1ORSA 1F2XK 2K7QA 2DLIA 4HFWB 1I3GL 5CLWA 3MACL 3GSQA 3MRKA 1FVCB 3KJ4C 1PG7W 3DVGB 4Z7WB 1NGXA 4ZUVB 5EZOL 1EDQA 1N59B 3MLXL 3H2WA 4WHYH 2WWMD 2ADIB 1PKQB 4Y4FD 4N68A 4I18A 1T66D 3TLRA 2FIKA 1HH6B 4EVNA 4M6NL 3C60C 4TPRL 1JZ7A 3TC9A 3TH3T 3LVEA 3V6FA 3TIEA 4OD3H 1IZJA 4O51A 1OSZA 3PGDB 4QXUH 3OXRA 1ACZA 4MSWA 3PL6B 4JHAH 3BP4B 3GIVB 4IRZH 3AS3A 4YHZL 4Z76B 3MLPA 4LK4A 5I1EL 5IMOB 1YEIL 1NMBL 2E5EA 5AZEL 3BGFB 2XRAH 2X4QA 4YHKL 5DFVC 2HT4C 5IVZA 3ZL4L 4MQSB 1N64L 3HUJF 3PP3H 4QHLA 5IJVB 3MLSH 4A6YA 4F7MB 3OXSA 2DD8L 4XP1H 1JPFB 1JPSL 1X4ZA 3IAPA 5JW4Q 3I75B 3O2VH 5IB2A 2DJ4A 2HJKA 5C0RL 3DUUB 5CZXC 4I3SL 3RPKA 4KXZI 2DM4A 5FK9B 5LJYH 5L2JB 4UTAL 4WU5B 4I3GA 1GRWA 4P49A 3ARPA 1E4XH 3U7AA 1CTOA 3GMQA 4PJXF 4LLDB 3QG6B 3CFDB 2BVOA 4FTVD 2DLTA 4R0LA 3PP4L 5F1NB 3AMLA 5FYKD 3IJSA 1LP9A 1INQA 2BRQA 1J7VR 4HC1L 2I60H 3MLWL 1L0XA 1QBML 1BX2A 4F2MB 5EFIA 2C3VB 3REVA 3P30L 2GUOA 3G9AB 5E5MA 5IK3B 5SWSD 5HVGB 4XMKH 5HHME 1ULVA 1DUZA 3OR6B 2B4CL 3RNKB 4BQ8A 3IETB 1Q9LB 4J3UA 2NY2B 3ESUF 2P49B 5GS2D 1TCRB 3OKNB 1RIUL 4OKVA 4IIQB 5F9OL 2EDWA 1RULL 2WUCH 1OP5H 1MH5A 3VDCA 5CHNA 3ROLA 3TN0C 4O2CB 4G6AC 2R0LL 1Z9LA 1QFUL 2X1OA 4N0YL 1XCQB 1G9NH 1K4DA 5I1JH 3DXAD 2RB8A 4NQUA 4OCLC 1AP2A 1ZVYA 4JFHD 3IKKA 3RVXC 1EPFA 5JZ7D 4FQXD 4HK3J 5MP6L 1KPVB 1NCBH 4XGZA 5ACZB 3QAZB 2DOCA 1HDMB 4HFUL 2G9HB 5ALCH 4LCIH 2CR3A 4O51B 3EO9H 1T5WA 4TUKL 2ZWLT 1KTKE 1TZHB 3K4AA 4MSWB 1U8QA 4GW1A 4HJJL 5IHUL 2Q7NA 4JM2B 4EI6A 3UTQB 2VWEE 2WMPA 4U1LB 5L9DH 3TH4T 2HMID 1HILB 1R24B 1XGRA 2J5LB 2QSCL 3CDCA 3PHOB 2BCKA 4GRMB 1FL6B 4N0FA 5DQDH 1DLHB 4PRDB 4KVNH 3HPLA 2NNAB 4KY1H 1BGXH 1N3NB 3MUJA 5C0IB 5D1ZC 4XNMB 1G7HB 4PJBB 5FF6A 5T1MA 4RISH 2D0HA 3MCKA 5CIPH 1FJ1B 8CGTA 3G6JE 5LGJA 4XPTH 4KJPD 3JTTA 1CXEA 1WZMA 4U1IA 1A47A 2A83A 1UH2A 3QJHA 5HHOB 3P4MA 2DYPB 4Y89A 2BVQA 1HSAB 5E4EB 1T1ZA 4L1HA 4P4KB 2OSLB 3MRMB 3IDJA 3BEWA 1EEYB 2ZG2A 1NKOA 3ET9F 4GG6A 2BVOB 4XC3H 5E1AB 2R15A 3K8MA 1WZKA 3QCVH 3D69B 3IXAB 4W4OC 4R0LB 5E08H 5IB1A 2NX5B 3EAKA 3CFCL 3DV4A 3U7YH 1U93A 4DQOH 1UJ3A 3EYUL 1XF4B 5F9AC 3U0TB 1R5WB 1LILA 4JQVA 4JO4H 5C6TL 5DD0H 5BO1L 2XQBH 5D7IA 5DJAB 5GS3A 1T3FA 3MLUL 4PJ9C 1Q9WB 1GC1H 5LAXB 2ZOKB 4OKVB 4PG2A 1ND0A 5DJ8A 2GIYA 2VXUL 4RMTA 1IGTA 1CFBA 2OL3A 4MNHA 3HE6A 5GGTA 4APQD 3ROLB 5BRZD 5I0ZA 3OZ9L 1MVFA 1ADQH 3SGKC 4Z0XB 2MJWA 1BECA 2ZUUA 1MLBB 3EYFB 4QRPB 5EOCH 2C5DC 3KPQA 3T1FA 2ADFH 3S88H 3UJIH 2WM0A 5BVJA 3IFPA 1WK0A 3QQ3A 4PJEB 1PYWA 1TLKA 5DFTA 2PXYC 5F7NC 1MQKL 1J86A 1DLFL 1NGQL 3RJDA 3SKNB 3REWA 1DVFA 1GGYA 2IMMA 3FB7A 4MA7H 4HIHB 3LKNA 4OM1H 4Y5VA 2QHLA 3ULUH 4WNQA 3WIFA 4KPHH 1PDKA 1PVHA 3MLTA 5L88L 4N9OB 1GGTA 1HHJA 4K8RH 2BSTA 1C8PA 5CSZA 4LSUL 3SBWA 4NJAH 3BUYB 4JFPA 4KH2A 4Q2ZA 4FFZH 4UMGA 3K2UL 1U3HD 5DJDA 3MNWA 1VEPA 4MWFB 3SCMD 4Y8DC 3I6GA 1HWGB 2G5BB 2OS7A 4WFED 4G80B 4HUXB 3KPLA 4XXCC 1AD9A 1FYTA 4A2LA 2A83B 2WP3T 2FD6L 2XN9D 4DCQA 1YEDA 1UXSA 5D1QD 1RIVH 1U95B 4P3CH 4KTEH 2AEPH 3LKOB 3MV7A 1G7MA 1KT2A 2VXTL 2R1YA 3G6DL 5FGBC 1J9CT 4LCUA 5T3ZD 3ZT6A 4RA3A 2XKNA 1DEEA 2N1KA 4HLJA 1BD2B 5I66A 1TITA 2OZ4H 4PV8B 3THMH 2Q7YA 4OBRA 1U8IA 5C09A 5D1XB 2O5XH 3I6KB 4JFXA 1JZ6A 4QOKA 1NEZG 1RI8A 2WLYA 5D7IB 3VA2C 3T0DA 5ENWB 1J8HD 3FHQA 4QHMA 1OF2B 3ILQD 3ILPA 4X6FA 4L4VD 4PBWD 4U6XA 3MPCA 5T3XH 1IGTB 5CUSH 3MYJB 1ZGLB 1JWMB 1G9NC 4QHNB 5FHAH 1MRCH 5C07A 4G8GD 3ARGB 1AHWA 1NCDL 5F1SA 5HHNB 4LLUB 5DDHA 1IM9A 3DURA 3BX7C 4OD3L 1S7UA 3UTZA 1EK3A 5BVJB 1OTSD 4JHAL 3DMMB 3RWHB 2A74A 1ES0B 4FQHA 4XNZC 3WFHB 3WO4B 5GQBA 3FB7B 1E4WH 1YEJL 2DWEB 1MQ8A 1IQWH 4LLWA 3V0WH 1HCFX 5I8KL 4XP1L 5DLMH 1VACB 1NLBL 5J3HD 4CADB 5JDJA 3C5ZB 3O2VL 5D6DC 3WN5A 2HLAB 5FDYA 5IW1A 1AJ7L 2EKSB 1A9EB 2X89A 3EOBB 3JVGC 4MB3A 4U6YB 1NDMB 5EU5A 3S5LA 4NN6C 3T0EE 4LF3A 4NZDA 4NOFA 3QIWD 2XKUA 5HDOA 4EUPH 1K4CA 3G08B 1E4XL 2E9WA 2R8SH 5J6GB 4QOKE 3UJJH 3KPLB 1P2CA 4PJDE 4F58H 3AGVA 5D7SL 3HI5H 3CVHB 5SX4H 2QLVB 3B9KB 1MFDL 4PJ7A 1TZIA 4U49A 1TDQA 3TBTB 1WIUA 4LBEA 1SY6H 2R2BA 1IGYB 3KS0J 1CG9B 3ARFC 3F7PC 1VFBA 3QRGL 3VRIB 2I60L 2GSIA 1G7MB 3MV7B 4JR9H 1BBDL 1JUFB 5E99L 1NUDA 2AK4A 2VAAA 4K3JH 3VFSA 4LPCA 5C07E 1BFSA 2BNQB 2XTJD 3HMXA 1NMCC 2KQNA 2KH2B 3U4EB 2A77H 1U8IB 3EJZD 5GIRA 5HVHC 5IHBA 2FL5A 4K2UH 4OI9A 2R56H 4JFXB 4XH2A 4D0BB 3HAEH 5JPMB 3FQTA 4ZXBB 1I3UA 2WBJB 4Y1AA 1H3TA 2BVYA 3VXTA 1GC1C 1DBAL 4RAUB 1XT5A 4JANB 2I5YH 2WINB 1G9NL 1UA6H 2VO5A 1L9MA 3FQRA 4QTIL 3LKQB 1DCLA 4MJ5A 3U36B 2VDOL 1FE8H 4NWUH 5EU6E 1JMXA 3QUZA 4ODBD 1WISA 1NCBL 3NCJL 2P7TB 3V5HA 5DQJB 4OTXL 4DK3A 2DQJL 5IW6B 5ALCL 3HE7A 2OXGA 4LCIL 4WHYG 5CJQH 5ANME 5HHPA 3OAYH 4K7PH 5E4IA 4YGVB 4L8CA 5E2UH 4NNYA 2Z93B 4OFIA 3RZWA 4C54A 4D0CA 4YUEH 1I7ZB 3QI9D 1T7VA 2ZP0T 2ICEB 3H9SB 4JRXE 2I9LB 4XCNA 5ALBH 2IPUK 3ULUC 4QF1B 1EO7A 1N8ZA 1TPXB 5KVEL 2VYRE 4WEMB 3Q5YA 3A6BH 1BVKB 3BVNA 1JGEA 2NY6B 2WWKT 4K8RC 4ELMA 4OJFH 1QQDA 4UQ2B 5IHZB 2OTWB 1RIHH 3WJLC 2ZSVB 1BGXL 3CZJA 3NACH 4OFYD 1KB5H 5EU5B 4HWZA 3S5LB 3F58H 4XPTL 2IH1B 1Q94B 3DGGA 1P4LB 3NVQA 5HGAB 4H0IA 1BIIB 4EXPX 2DMBA 4J3XA 4Y1AE 3U82B 2OJEA 3SO3C 4XC3L 4PJ7B 4P2YA 3B2VH 3E6HA 4CMMA 3QCVL 2DQUH 5GS1B 4MNGB 1CFTB 5HI5C 3VXUD 2GFBB 5MENB 3U7YL 1UM4H 1S8DB 1FZJA 1SMOA 3ZKND 4J1UA 5EUOA 4DQOL 3R8BB 2IANE 5C08D 1DUYA 5EBGA 1TETL 5CEYB 4JO4L 43C9B 3TZVC 5DD0L 4JO3L 2XQBL 2W65A 2P8LB 3VU2A 2VDRH 2IBZX 2YN5A 1GC1L 3O9WC 4DK6A 2YEZA 4NQVA 3IF1A 5E7FA 4J7RA 1YY8B 2YPLA 3WJJA 1QFHA 1QA9A 1JHKL 3B83A 1ADQL 3BIBX 4WFGE 4KRPD 5C9JB 3CLFH 3RUGA 3FQRB 3I84A 3DHMA 2NY0B 3L3JB 4RAHA 5J0BA 4ELME 1BIHA 4PBVC 5EOCL 2FX8H 1U8HA 1ED3A 5E8OA 3MRNB 4NKOB 2AJ3A 1FZOA 3LB6C 1F00I 1QTYT 4E41B 3P4OA 1KG0B 3HE7B 4I13B 1ZXQA 5HHPB 5F9WC 3OB0H 4OM1L 4RMRA 4F37K 3ULUL 4PJCE 3KPMB 4E0RB 4D0CB 5FYKU 3BEVA 4O2FB 2I07A <