4WNQA

The molecular bases of delta/alpha-beta t-cell mediated antigen recognition
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
200
structure length
200
Chain Sequence
QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGVTGKLTFGQGTILTVHPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords TCR Variable Delta 1 chain and TCR constant Alpha chain
publication title The molecular bases of delta / alpha beta T cell-mediated antigen recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 200
sequence length 200
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wnqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wnqA01
4Q2ZA 4WGWB 2ITDB 3X13A 4MMXC 3DRQB 4NO5B 1K4DB 2VAAA 3OKNA 2VDOH 4NZUH 3DX8A 1CDUA 3ROOB 3HLAB 1DQJA 1X9QA 3MRLB 3IXTB 3DYMA 2EZ0D 2D7PA 4ZYKA 1E27A 3QDME 1D5MA 2VZOA 5GGSA 4LLQA 4XWOD 3A6BL 3MLSH 4R0LB 3ARED 4K23L 3GDBA 1YEFH 1EO8L 1KIQA 4G8GA 5C0JB 4QOKB 5TE7L 1BECA 4FG6C 3WKML 1OAQL 4HK3J 4HKBA 1X5ZA 3TVMA 2H8PB 3B8SA 3FT3A 3F5WA 3SY0A 2L7UA 1CFTA 4N1HB 3IU3B 5GGVL 3U4EA 5DJXA 1QR4A 2OI9C 3QO0A 4P49A 1MSPA 1NCDL 3VGGA 4KV5F 2FNBA 2WINA 2XOTA 1EFXA 3O2WL 1BAFH 1QA9B 4JPKH 2M8XA 5DK2B 3LN9A 4QLRA 3S96A 1FCGA 1G0DA 4NJ9L 1FVCA 1MCEA 1IKFH 2W91A 4EDXA 4F57L 1J7VR 1AXTH 1VDGA 5FYJH 3C5JA 4WI8A 5DDHB 1J9CT 1DQDH 2NX5A 4JFFD 4UT7H 1VA9A 2WIIB 4OF8A 5K59F 2IBZX 3MR9B 1GHFL 2CO7B 1WZLA 4NQED 1QRNB 2EE2A 1WSST 2D0GA 3O3EA 1HXYA 2ARWA 2PYFA 3B5HA 1FBIH 4HPYL 5L0QC 1CZ8H 3TIDA 4DK6A 4XMKH 1KFAH 1M1SA 4ZAKA 1FAIL 1MCBA 3GMQA 4JDVB 4LBEA 1Q9LA 1P1ZA 4XNQB 3I6GB 3ROLB 4NQSB 2P8PB 5EUOF 1MFBH 4XP1L 3S35L 2IEPA 5I8OL 2R9HD 1LD9B 1AY1H 2OK0H 1AP2B 1RURH 5BRZA 5DT1L 3RUGB 3UX9B 2Y23A 3AREB 1ZVSB 4M6AA 3NPZB 4XBGB 5IFHH 1CYGA 2P49B 1MAMH 5IW6B 3L9RB 3KNBA 3RVVC 2P46B 3HC3L 1OGAE 1RZGA 5D2LA 5SV4A 1FQ9C 4OT1H 1A3RL 3PQYE 4JCMA 4I1NB 4Y19B 4OLEA 3MREA 1NCNA 3EIFA 1EEQA 3S98A 1TZIA 3KYMB 4XCNB 5DJ6A 4HULB 4LQFL 3P0YH 5J8OA 4I77L 1OD9A 4QHKI 4MD0A 1YNTA 4P23A 2DLFL 1OPGL 4HMCA 2DM2A 1ETZB 4PJ8A 2FJGB 5HHNA 4LNRA 3VA6A 4HG4K 1S3KL 4BUGA 4IRJA 3DUSB 4M6OL 6FABL 5CJQL 3BPCA 4DOHB 3HPJB 4K23H 3TIEA 1NAKL 4Z5RA 1D5IL 1SHMA 5HYQB 3NOIA 4DW2L 4EN3C 5TE7H 4HS6B 3AGVA 3M1BB 4P2QE 3WKMH 1SYVB 4DN3H 2CDEA 3MFFB 2Z31C 15C8L 2V5RA 3Q6FA 4P48A 1T6VN 2XA3A 4KH2A 3UROR 3SKMB 3MRNA 3SKNA 4JFFB 1EHLH 3U2SA 1GZQA 5GGVH 4RX4A 4BQ6A 2NYYC 4OD1L 4R3SB 4NQEB 4OZFG 1NCDH 2QSQA 4YZFF 4UUJB 2OTWB 2DKUA 4HWUA 1M7IA 3B5TA 3O2WH 4U6VL 4OSUL 3SCMC 2O5YL 2XZQH 12E8L 4L4JA 4UI2A 3HR5A 1FZKB 1E6OL 5IHBA 5HGAB 5LVEA 1OM3L 2IQ9L 5DHYB 1ZGLP 5TH2A 5HI4D 5LAXA 1X7QB 4J12A 3K4ZA 4JHZA 4NJ9H 2VRAA 3PWNB 4BK4A 4LVHC 4XPBH 3GMOA 2F54E 4JDTH 4ELMF 4F57H 4QHMB 3RKDD 1M05B 1OP5H 1E0OB 2R1WA 1QLRA 3PL6A 4AIXA 1J0JA 1VFBB 3GSWB 1GHFH 2DKSA 2HFFA 1WT5C 3V0VB 3QWQB 4YHIB 2BCKA 4YHLH 3RZCA 4M6ML 5E8EB 4NKIL 3B3IA 1HSAB 4PJGE 2PXYD 3SE3C 3EO0B 4Y2OA 2QHRL 5GS1A 4PLKC 1FAIH 3NMEA 1SYSB 5IB2B 5M95B 4ZXBD 3G04B 3S35H 2FZ3A 5I8OH 2HJKA 1NEZB 4XCEB 5DT1H 2J8UA 3RDTC 1ZT4A 4QOKE 1AD9A 4HCRL 5DVNA 5F7KC 4UU9A 5LXGL 4Y1AA 3ULVF 3LOWA 5HDBE 1S9YB 1FG2B 1A3RH 1FL5B 3ARBA 3DYOA 5IMMA 5FYJD 3BRDA 4YQXL 1O5DT 4PJDB 2E7BA 2FSEB 4BQ9A 3HC0A 3QUZA 4IIQB 5F93C 3G08A 1EEYA 3MA9L 3V52H 4LQFH 1G9NL 1MJ8L 2GY5A 4I77H 3FB7A 3SGKC 5IWLC 4PJ5D 1WBYA 3WJLA 2DLFH 2GUOB 1UZ8A 1KC5H 2WNGA 3PHOB 1NDMB 1JF1A 5EC1A 3K2UL 4RFEB 3MRJA 1S3KH 4M6OH 6FABH 1VEOA 2D3VA 5CJQH 3RTQD 3BPOB 3WFEL 2EXWC 2LTQB 1I8IB 1NAKH 2HG5B 3BXNB 1L0XA 3QH3B 4P5TB 1VB9A 3MNWA 3QCVL 2LU4A 3LKNA 3LD8B 1HDMA 1XF1A 3SE9L 15C8H 1AR2A 1JPFB 5C7XH 3CVHA 4AIZA 3OV6A 1BIHA 1AIFA 3HE7D 1TIUA 4ZNEA 5TQ0L 2G2RA 3BI9X 1QRNE 2Y1VA 3D6GA 4A6YB 4OD1H 3T65A 4NWTL 1KELH 2Z92A 1IAKB 3VFWA 4XNXL 5FIEA 2AV1A 4AT6B 1WWCA 5FYKL 4P2RD 4U6VH 4OSUH 2PXYB 4LRNL 3GJEA 3ULSA 12E8H 4O2FB 4MXWL 5FUOL 1E6OH 3QEHB 3S37X 4DN4L 3ZE1E 2B4CC 4K3DH 1OM3H 1J88A 2IQ9H 1INEH 3MTRA 4ZXBB 3RUGE 1BF8A 1SY6H 4MJ4A 2YWYA 4XPFH 4MDIB 4FS0A 4MXQC 5ACMA 1IGCH 5CJXA 4L8BB 2A1WH 3PNWA 4HEME 5DA4A 4WV1A 1FNAA 1WIPA 5E2WL 4DKFH 1ZTXL 3MCKA 4H0IA 2FL5B 3CMOL 4Y19E 2AV7A 4M6MH 4NKIH 3MLXL 1T7ZA 2PUQT 5ERWB 4X4MA 5AUMA 4LCUB 2QHRH 4KJQC 2DICA 4WFFD 3M45A 1CFQB 1T89A 1A1MA 2X4UB 3SDAC 2LU3A 4PTTB 4PJ5B 3IU4L 3U0TB 4RZCB 1G7HB 4U1JB 4G7VL 5DFVC 2IG2H 4M5ZL 5B39G 4DOHE 5FK9A 3BWAB 3VI4F 1KIUA 3TA3C 4ZFOL 1A6VH 1RZKL 4X98A 2EO1A 1H8SA 3GRWA 5LXGH 4KMLB 2MQ3A 3FL7A 3NACL 1OAXL 2Z93A 4PBXA 5LCVH 5IESL 4UQ3B 4JFFE 2CLVB 2UUDH 3RWGA 1BQLH 1G9NH 3HE7B 4NQEE 3NFNA 4ODBD 4HG4J 3TN0A 3M07A 5F1SA 2BMKB 3K2UH 3DMMC 1OT1A 5EBLA 1XH3A 3F7QA 3HE6C 1BX2A 3WEXA 1I8KA 4RSVA 4S2SA 4P2RB 2NY0D 1U8QA 5B4MD 4IS6B 5HGHA 5KN5A 4G6AC 4Q6YA 2ZOLB 3NCYP 3VXSA 3QCVH 1NAMA 2ZOKB 1HXMA 5DSCB 5C0AA 1HINH 1A7QL 3ZT6A 1R24A 5LGJB 2V7HB 3W5NA 4S0SD 1S8DA 5E7FA 3MRCA 4G80B 4RISL 2LFGA 3SKJL 3B5GA 5TQ0H 1QQDA 2CDGB 4YC2B 3SDCC 1MJJA 4NWTH 3BGFC 4KHTL 3B9VA 4JGMA 4QXGH 3ILPA 3PXJA 2CKBA 4XNXH 3BQUA 4NBXB 2J8OA 1N6VA 3LN5A 4IOFD 3QDMA 3UTTD 3VFVA 2BXZA 4DZ8A 1KTRL 4MDJA 1KV3A 1A6TB 4LRNH 4M93C 4RQQA 3IDNB 1LDSA 5DJ0B 3GSUB 3V5DB 1XF4B 1ZA6A 4CADB 1EUTA 3PWUB 1ED3B 3KR3L 4JAMA 1B0GB 1UVQB 1AJ7H 4QHUA 2V2TA 4XBEL 4UBDC 5H2BB 3EFFA 4KRPD 5C09D 3WHE0 1WCBB 3V8OA 3BKCL 1RPQA 5GIRB 1A7RL 1IAIM 5GS2H 2JIXD 4NT6A 5GRWA 1FVEB 4WTWA 3BPLC 4WI7A 1ZTXH 3J7HA 2J7LA 4LU5L 4PJDE 5D2LF 4JFXB 4NYLB 3MLXH 1HHKA 1SMOA 2YA2A 4WDIB 4MNQA 4Y2DD 5DK0B 5I16B 3NCJH 2NNAA 2VXSH 2DTML 3MBED 1HHJA 3QDGE 3QO1B 3RWIA 4G7VH 4M5ZH 3GK8L 4TULL 2NY0B 5IBLC 1RZKH 5ETUA 2V7NB 5IK3A 1G7MB 3CFBA 4XVJH 1GGTA 5E08H 3H7BB 5DLMH 4O4YL 2AEPL 2AQ2A 1W72B 1OAXH 1E4KA 4R0LC 1JNLL 4WO4A 3WE6A 1DTUA 2FIRT 4U1MB 5DEGA 3TBVA 5IESH 2HVJA 4V2BA 2DQHH 3QXAA 1I1AD 2H2PD 3QULB 1PZ5A 1DN0A 1WITA 3MODL 2B7DT 5H37H 4ERSL 4KKCC 4LOUD 4PGZA 3BZFB 2F8VA 3F12A 3EDJA 3UTTB 1L9MA 3SE8L 2ZG2A 5DHVA 5T5NG 1Z0MA 2D7OA 3QPQC 5DEFA 3VDCA 1A6ZA 3H0TB 1S9XB 2ZSWA 2XWJB 3MMEA 3UPRA 1LE9B 1J0KA 5E4EC 2SEBA 5DFTA 4ZUUB 1C16B 4YDJB 3CDYA 4PY8J 3P3YA 1KCVL 4M8QB 4KRPB 3SPVA 5C09B 4QRPD 1QOKA 4GKSA 2APVA 3SKJH 5JDSA 4H26B 3MRIB 4HWEL 3GUTA 4QXWA 4WJ5B 3FOLB 1OWWA 5FYJE 4UT9L 2ITCA 4KHTH 1L0QA 5E8NA 5DJ8B 1NGQL 5HD8C 3T2QA 4BFIA 3MRFA 3GNML 5EN2A 4PJ5E 4HUWA 4Y2DB 2CIKA 3WHE1 1SJHB 4N0UA 1RZFL 1LE5A 3OF6D 3SOBL 1ZE3C 5EU4A 3MBEB 3FKUS 3FFCD 2EIZB 3KPLA 5EZLB 3UYOD 5DD5H 4BSWA 2WK2A 1DR9A 5D93B 3MJ9L 4XCYA 3CSPA 3NBNA 1CF8L 3C6SB 5BJTA 4L8CA 3BKCH 4EBQL 2AXGA 5IW1B 2VDMH 4GH7B 1QVOA 4WI4A 3SJVD 2EZ0C 4LU5H 3RWEA 1NCWL 1VKXB 1S7VB 4XWOC 5E8OA 2EKSA 4QY8B 1DDHB 3AREC 2Q7NA 3EDKA 3I9GH 2AXFA 2B2XL 1I1AB 4G43B 5EU6A 2DTMH 2R0WH 3FT4B 5CUSL 4EVNA 1YYMH 4G6KH 1EVTC 4PB0L 3L3OB 5KOMC 2DS4A 2HT2D 4P2RE 1HI6B 4Z7QE 4H5SB 2EYTB 5IMKA 2Q20A 1KCRL 1CLZH 4XCFH 1M4KA 2BXYA 4XGZB 2CPCA 2FJHA 4ZUVA 3S3JA 4M6NL 3VXMD 2NCMA 2AEPH 4G42B 5GS2D 4JPIA 2B39A 3DRQA 2YPLD 5FDWB 3WDHA 1GC1C 3DGGB 4QRPB 1KTDB 3SBWA 3DRTA 8CGTA 1N2RB 1FGNL 3MODH 1HK6A 1RZIB 4WI2A 4ERSH 4KI1A 1MVUB 2ARJQ 3C09B 4EUPA 1U58A 5CFHA 4WFFE 2AJZB 3RQ3A 1MFDL 4TSBL 1K3ZA 1F2QA 2K3TA 3HR6A 5C0JA 5AZEL 4QEGA 3QR2A 3O6LL 1YDPA 2X4TB 3B2VL 2LVEA 3MLWL 2GJJA 3FFCB 4XAWL 5D6CB 1H8OA 2RB8A 2MMXA 1XFPA 1KCVH 4JG1L 4JJHA 5FO8B 3WKNA 4R4FL 2ARJB 1RY7B 4Z7OE 3X3FH 1SVZA 4UT9H 4WHYG 3SJVB 4FXKB 5DRWA 1A21A 2ICWA 5EPMA 2R9HC 1ZLUK 5DK2A 5E03A 1GOHA 4ENEC 4MA7L 2GAZB 1H3TA 4YBHA 1RZFH 3KHQA 3SOBH 5JHDB 1N8ZB 4NPYB 4PGCA 1ZLVK 3WXVH 1HWGB 5ISZD 5DRZA 3AFLA 4OCWL 2G75B 2OX5A 3O6FD 3TO2A 4JO3H 2WLZA 4LCCB 4EXKA 1BM3L 4QWWD 1CF8H 4GAJL 4EEEA 4LVNB 4GUPB 2FCBA 3MR9A 3JSSA 3MJ7B 4ELKB 4P9HC 3TCXA 3VXMB 3VWJD 4L29B 1ZEAL 1NCWH 3OR6B 4LLMB 5FHBL 1FYTD 1GYAA 4DEPB 1NEZG 2YPLB 1NFKA 3MFGB 4ODXA 2B2XH 3RX8A 1UACL 2BFVL 2P5WA 4L3AA 4NKOB 2OZ4A 3ROLA 2VQ1A 2VAJA 5AWNL 1U8OB 2V17H 3BIKB 5CUSH 5ICXA 1LNUB 5E8DL 7FABL 1OGTA 4G9DA 3BDBA 3FRPA 3TGXA 4NNYA 4WWID 1ZVSA 1GXEA 1NDGA 1JGUL 5IT2L 4IIQC 5D71L 4CDHA 5IW6A 1R3JB 4L5FL 5E2UL 4G6ML 5TFSH 3HC4L 5J6GA 5T1LD 1IZJA 5EBMB 3IDIA 3FQWB 4GRWF 1H5BB 3EJYD 5C09E 1BFVL 3VWKB 2GSGB 4FXGA 4OLYH 2HFEA 3BPOC 1T7VA 5CGMA 4TUJB 2Y36L 3PDOB 3RFZC 2IAND 1FGNH 3TH3T 4P5TC 4U1GB 2HLAA 4LLWA 3FQTA 1MCKA 1NC4A 4N9GA 5DMKA 5HI4C 1JF5A 3PWLA 1N3NA 3LD8C 4NFBA 4MJ6A 5JPMA 2IH1A 1ZLSH 4GXUM 4JFQB 4LRIA 4UB0H 4LVOB 1FNSL 2O5ZH 5HYQA 1JCKA 2V5SA 4XB7A 5JDJA 5D1ZD 5AZEH 4CJ1A 1MHHB 4WW1B 3LQAL 4J23A 1K5NB 3B2VH 2Z91A 5EZOL 4ZOEA 1BP3B 1D5XA 3STLB 2UYLA 4CMMA 4Q9QL 1PLGH 3JV6A 4FMFA 4JG1H 3TJEL 5HGDB 1UM5L 3O3DB 1UYWH 4OM1L 5D1XB 1WIUA 4L3ED 4DUWA 1J10A 4MVBD 4PJBE 1RUAL 3S37H 2PO6D 3ULUL 4R3SA 4ZXBC 1SJEB 4UUJA 1FRGL 2BVUA 1UKQA 3W0WA 2XICA 1FYTB 3UPAA 3DROA 3BN3B 1WV7T 2H3NA 4HIIB 1A7BA 4B41A 2XWBB 3NZ8A 5I76A 4X7TB 4XAKD 2ZCLH 4GW5A 3GSXB 1PSKL 3WNMA 4NQDA 4GAYA 4KZEL 2ZUTA 2XTJD 3QWOB 3W9EB 3CC5A 4ONHB 3W9DB 1BM3H 3SO3B 2VLLB 4GAJH 1VFBA 1T6WA 2P7TB 5DJYA 3LAFA 2JF1A 5HHQA 5FA4B 2FO4B 4GBXD 5T1LB 4Y4KD 3X11A 5KSBB 5GGQL 4BQCA 3LDBB 5FHBH 1OQXA 1W0VA 3G9VA 3EO0A 1BJMA 4QRPE 1S7RA 4PJ9A 1DQQB 1I3UA 1A4JB 1UACH 2BFVH 2NTFA 3U0PB 1CIUA 5AWNH 2IANB 2LQRA 3BW9A 1SEQL 1S7SB 3G04A 3JTSA 4MA3A 1MUJB 3T0BA 2PW2A 4X7SL 4XXCC 3KS0H 1JGUH 4WHCA 5D71H 5D96B 1ZHNB 4IOSD 1YA5A 1PY4A 4L5FH 5E2UH 2RR3A 4G6MH 1NSNL 1R0AL 3HE7C 1HZHH 2Y6SD 5D1ZB 5F7UA 1TPXB 3FFCE 4JPWH 2HA1A 2R0ZL 3T3MF 1H15A 3ARYA 4K55A 1K4CB 1KPVB 1DBBL 4XBPB 3KDMA 3KYKL 4OLWL 4L3EB 4PRDB 3V2AR 2Y36H 2H2SD 3V4UH 1TNMA 1Z9OA 4OF7A 3TVMC 3W2DL 2PO6B 2H26A 2X4NB 5F3BA 1U36A 1FL6B 5F88B 5J9PA 4R7NB 2OJEB 1I8IA 2ATKA 2Q8BL 3P77A 2Z4QB 5GSVB 1FNSH 4HGWA 1QBML 4L8DA 5J1TC 4GKNA 1BLNA 5JHDE 4YC2C 1FVDA 3SKOB 2UZIL 4JY5L 1XF5A 4WUUB 3WDIA 3OXSB 5EZOH 4X4XB 1FN4A 1CFBA 2XTJB 4JFED 4Q9QH 4M5YL 3TH2T 4OBRA 3HZMA 3BP6B 4NO2B 2E7LC 4OM1H 3KLAB 3VXME 4AH2B 3Q5TA 2FATH 5EIQA 1U8JA 2P1YA 2P48B 1IAKA 1FRGH 4Y4KB 4EI5D 5IUSA 2WWKO 3EGSA 1TVBA 2ADGA 2PXYA 4F7PA 3QEQD 3U36B 3O2DL 1WQVT 4O2FA 1EH9A 1DVFD 1LO5A 4GRMB 3REVA 2AEQL 3VRJB 3I02A 4LHUD 1JN6A 5K9KB 3K8MA 1PSKH 4YXHL 5GGUB 5C0BD 3LIZL 4K8RL 4RWYL 1IM9A 4PRHD 1T66D 2YA0A 2FX7H 4LASL 4J4PA 4X4ZA 4X9FA 1EGJL 4I5BB 4LSTL 4K7FA 3PGCB 4XI5D 3MRGB 1NGXB 2H9GB 4Z7WB 3VGAB 1PEZA 3TFKD 3N0PB 3CXDL 4PJHB 1KOAA 1ACZA 1LEIB 1FNGA 5CMAB 5CHNB 5B4MC 3L7EB 1GOGA 4RNRA 2QR0B 3T3PF 4DFIA 2FYYA 2BERA 1SEQH 2NXYC 3EJJX 4MA8L 3Q0HA 1YEGH 1IGTB 1JGLL 2BVQA 4X7SH 4XHJD 3RTQA 1MFAL 1IKNC 4FFVC 1NGZA 1QFOA 1VERA 2VIRA 1NSNH 1R0AH 2YPVL 1OAUL 3PP3H 5CAYB 4Y5YB 4RAUA 1D5ZA 2PW1B 1JWSA 5HDBF 4JFEB 3P9MA 3ZYZA 1DBBH 4MJIA 3KYKH 4OLWH 4N8PA 4R7DA 1BJ8A 4V1DD 3RAJL 3UC0H 5HY9B 5I17A 2J88H 3EYOB 1FYTE 1CGXA 4EI5B 5C3TA 3QFDB 4LLVB 3OJDB 2X5PA 1BJ1H 1YMHB 3QEQB 4KRPC 4L4TD 1FLRL 1VADA 1T5XA 2V2WB 1PFCA 1A22B 3F58H 2UZIH 4JY5H 3QXUA 2ZOKA 5SX5H 5C0BB 3THML 1XR9A 43CAA 4PRHB 4NN7C 4M5YH 4FQXA 5DQJB 4CDGC 3N1GC 2MWCA 1MFEL 4Y2DC 5JW4N 2W65A 4PTUA 1HKFA 2WWMD 5KSBE 3VFSB 2EDTA 3FO2B 4K7PX 2DQGL 3WLBA 1TQCB 3HZVA 5D93C 1Q94A 1TVHA 5DURD 4WU7A 1BVLA 3IDNA 3O2DH 2A74A 3AU1A 4PREB 4BELD 2IANE 2AEQH 4PJEA 3LEVH 4YXHH 1FFNB 1UVQA 3LIZH 4RWYH 1WJ3A 1CCZA 1H0DA 5F9DC 2OSLB 1YPZB 3O8XD 4NQCB 4X9HA 1QFUH 2F53A 4WHTB 4LASH 3OX8B 4X99A 1I1AC 5ESQB 2H2PC 4UAOB 5IROA 4EDWL 5C07D 4YO0A 4F58L 4YPJA 3OQ3B 1T5WA 1N5AA 5D1QC 2J5LB 4I48A 4Z76A 2CLZB 3CXDH 3ET9F 5HI3D 5EIIB 4WDIA 2HTLD 4PV8A 1KTLB 4WWKA 1KN4L 5JIPA 1OB1A 1IL1B 3ARBC 4CN6A 4CN1A 3B9KD 2NLJB 1MLBB 5FYJU 1TFHA 2W9DL 5F96H 1S7XB 4MA8H 1EX0A 1NFDB 2VSDA 5C0ND 4Q6IB 4HUKB 3G5ZA 1MFAH 1NCTA 4FQQA 2GTZA 4L4TB 5F44A 2I27N 2UY7A 1IAOA 2V7NA 4WUUE 2YPVH 1OAUH 3IDMB 3O9WA 1NBYA 1YMMD 5EUKB 1Q9KA 1A64A 5EU7E 2CLRA 4Z78B 4U2YA 4S11A 3QG7L 1T1XA 3C09C 1RIVL 3MV7D 5ICZB 4NSKA 5HVWA 3QEGL 2Y07L 1LQSR 3H6JA 3QULA 4K71B 3W11D 3LN4A 4KVNL 4J3WA 4ODHL 2R23A 1UENA 1WF5A 2AKRA 3RAJH 1MRDH 4X6FB 1QBAA 3WBDA 5C0EB 2WLYA 3LHPH 5HJ3A 1MY5A 4GS7B 3U30C 1REIA 3QI9D 3TZVA 4U1KA 3MUHL 3UTTA 1SM3L 5GGRB 5IFJB 1MIEL 1ZHLA 2VE6A 3HUJB 5GXBB 3UXFA 3AY4A 4ETQB 4HGMA 4D3CL 1QSZA 4U1LB 4XX1E 1JWUA 4BH7B 1RK1A 4YHOL 4WIQA 4BKLB 3THMH 4GMTL 2VXQL 1TJHL 4J3SA 4OKVA 5D70L 1JZ4A 3O8XB 4PB9L 4LSDA 2MPAH 3V5HB 1JZ2A 1MFEH 2JIXA 3GJFK 1LEGA 2Y5TB 5C07B 4PJHE 1X3DA 2DQGH 5DVLA 4OFVA 5CD3A 4UTBL 5DMYA 3GJFB 5ID0A 2AI0L 4KJWD 3U9UA 3T0XA 5CEXB 4ODUB 1IFHH 1A1NA 4PRNA 1UB6B 5LG1A 5F7WC 4YHZL 4F2MA 5BCAA 2YKLL 4LVNC 1H3PL 5A2IH 3B9KB 3L6FB 3DX6B 1ZGLA 5FGSA 3MBEA 4Z0BL 1U2HA 4AEIL 3X17A 4CVZA 5I15L 1A9EB 4IDJL 2UY6A 3VE0A 4DZBB 1G1CA 3VFPA 1DCLA 3AM8C 3MV8A 2Z35B 2BSTA 4UINL 3S4SB 4F58H 1YMMB 4U6TA 4F80A 4PRAA 4JFEE 1ULVA 4L4VD 5LGHL 4H8WC 5DJAB 1DDHA 1X5LA 5IJKC 2X9YA 2CRYA 1ACYH 5DQDL 4MZ3A 4LLUB 1D5BB 3U1SL 3I6KA 4GMSL 4JHBA 4TSAL 3MLZH 1M6OB 3ARGB 2AGJL 3QI9B 2A6KB 3QEQE 1H5BC 3PV6A 1CIDA 5AYUL 4H5SA 3VWKC 4X6CA 4AEEA 4KXZI 2YMXL 5C0BE 1C7TA 3ECBB 3F7PC 4U1GC 3UTQB 2P8MB 4PRHE 5IEHB 1CGSL 2G60L 1IM3A 2FX8L 4HCRA 4KY1L 3MCG1 1DQTA 4YE4L 5INDB 4XMLH 2J2ZA 2VZVA 1PBYA 3F7YA 1RIVH 1AGBB 3TJHD 2ZG3A 4ETYA 5JXAH 4WEBL 3ZKQD 5CLTA 4LVOC 1DEDA 4ODHH 5T1KD 4N0YH 4UDTB 1HCVA 5IM7A 1T3FB 2X4PB 4JM2D 3MCLH 2HTKD 4TSCH 3M8OH 1MVUA 4R26L 1MIEH 3QNXB 4FZ8L 1PD6A 3ZO0A 5TDPB 3MNVA 1MCWW 5D1XC 1KLGA 2E9BA 3O81A 2MHAB 2VXVL 3ZDYE 4QRQA 4MCYA 4ZOAA 3OF6A 1Z9MA 3B6SB 4CU6A 4U31A 4YHOH 5D6CA 4NQCE 1YPZE 2YSSB 4HHAA 5SX5K 3WL9A 4LCWD 2VXQH 1TJHH 4GG6A 2A6JB 5D70H 1IAIL 4LMQI 4HUVB 5FO8A 5EOCH 1ZT7B 2EDJA 2BP3A 2IC2A 4TNVK 2EDXA 1IGMH 4OAWA 3SJVA 1R3HB 1AGFB 2IADA 2FR4A 1HEZB 5IBTL 5HYIA 1P9MA 3F65A 1I9RH 4DCQB 2BSED 4L4VB 1KUMA 1VCAA 2X09A 3SO3C 1IEAA 3VXPA 4YH6A 1H3PH 4FFWD 2GJZB 2R2HB 1BVKB 1HHIA 1TJGL 2M26A 4Z0BH 1NFDE 1JGVL 3CZJA 2CIIB 4AEIH 3ZTNH 5I15H 4IDJH 4KXZH 3CLEL 3LDBC 1BFOA 4LCCA 4L4TE 3H3BC 1S5IH 3EJYC 4X9IA 3MZGB 1F6AA 4GUPA 4X8JB 2IH3B 5J89A 3MJ7A 3MACH 1HH9A 4U6YA 5C0GB 3TYGL 3RVXD 1XZ0A 3R8QA 2EIEA 1B9ZA 5FYLH 3EDEA 5LGHH 2WBWB 4UT6L 2YPLA 1AO7D 2OMNA 5D96C 2XWTA 1G84A 4ZSOB 2P44B 3D48R 3RWHA 2W9EL 5T1KB 1U8OA 4TSAH 5D1ZC 1TPXC 2W0KA 1FNLA 4JM2B 4QT5A 4X6BA 5KAQG 4MD4B 4L9DA 2AGJH 5JPNB 4QNPF 5ADPL 1OTUC 1WAAA 3HUJE 4I8DA 4FABL 5AYUH 4ONOA 1IE5A 3RI5F 5CBEA 3TPUA 4HT1H 1WFOA 3RU8L 4M7JH 3P4MA 2D31B 1VEPA 2YMXH 3VRLE 4MVBC 4UV7L 2OTUB 2ZUXA 2R2CA 3QNYB 5GQBA 2PO6C 1HSBA 5EBMA 1CGSH 2VITA 2G60H 4ZFOA 1T83A 1MRCL 4RAVA 4JQIL 4AENB 1U91A 3NA9H 4LCWB 3RI5K 2GSGA 1F4HA 3E0GA 4NDMA 4N0CD 4WEBH 2IPTL 1J8KA 3QG6B 4NO3B 3IRPX 5ACLA 4PUBL 5C07E 3WN5B 2DBLL 1H3XA 2HMID 4YEFA 4C57C 1UM6L 4R26H 1C5DB 3DVGA 3VXOA 5EU7C 1CD0A 3FMGL 1HILB 5C0CA 2OQJB 4Y7MA 4TPRL 3L5HA 4JFHD 3GSRB 4PGEB 4P5KA 4PJEF 3PWJA 3VH8A 1ZOXA 5ISZA 5CCKL 1HH6A 3Q3GB 3O6FA 3I85A 1EERB 1OTSC 3D25B 3QHTC 1YMME 1CXHA 3GM0A 3UDWA 1XGPB 4JGJA 2XQBL 1KIPA 2HFGL 4M1GL 2CDFB 3VWJA 3TH4T 3QUMH 1J0YA 4OCRH 4Z77B 4XX1G 2CR6A 1AO7B 4PGJA 4KI5F 1YEJL 5C0DA 4K3EL 5DMGD 2I07B 3FTGB 3VXTB 1XCQA 3GSXA 1TJGH 2EE9A 1JGVH 5IMLA 3QUXA 1Z3GL 1L6XA 3C08H 2VDPH 3W9EA 4ONHA 4POYA 3V95A 1JHKL 2XG5A 3O3UN 1MFNA 3D2UA 5E0QA 2R4RL 2H2SC 3GSOB 4DGYH 2VL5A 3QWRD 1NMBL 1NH6A 3B9DA 5KSBA 3FOMB 4TTGA 2P24B 3QIWD 4K3JL 4UT6H 5C9KA 1RZJL 4F7TB 5DUPL 4HMEA 2BDNL 4G9FD 4QRSB 3WUWB 4JY4B 4LLDB 3E2HB 1UXSA 3HG1A 1INDL 5TGBA 5IR1B 4Y5YC 1F90L 2D4FA 4OUUB 5ADPH 2R2BB 2F5BH 3SBWC 4ALAL 5FKAB 5JW5B 4I18B 2OR8A 4D9LL 3RU8H 1FE8L 1RIUL 4ONGL 4D0BB 4F9PA 3RWJA 5KVDL 2DLGA 4QTIL 4UV7H 5J1SC 1AC6A 2DOCA 3MRQB 1A8JH 5BZWB 1MRCH 3FO1B 4JQIH 4EI5C 1BQHB 3MLYH 3QQ3B 1VACB 3FO9A 1NKOA 4IRSD 3RBGA 3ZHDA 2IPTH 2X7LA 4GW1B 3IDGB 4L3EA 1F3JB 3VFTB 1BREA 3BP7A 3L3IB 5T3XE 4IOIB 2DBLH 3OHXB 5FYLD 4DKEL 5INCA 4P4RB 5DO2D 1G7JB 4RRPG 4L4VE 2VYRE 1U93B 2I60H 2MKLC 5E8PB 1RSFA 3P9LA 1CS6A 3FMGH 1T66C 4HWBL 1X6LA 5EO0B 3RJQB 3ZT7A 4JR9L 4I3RL 3DUUA 1JPTL 1RUQH 1U41A 3OXSA 4X4XA 3MOBL 2JE8A 1GOFA 5DD6A 3TFKC 3PP4L 3CXHK 4IMLB 3CSGA 3TNMA 4WFEE 5B3JF 2ORBL 3GMRA 4M1GH 4GBXA 1I9IL 2OL3L 4Y4KA 4OLUL 2VISB 4PJCA 1YY8A 1LHZA 1RFDL 3NIFF 4MS8C 3VFGL 4ZSOE 1AXSB 3OG4B 4PR5B 1MHEB 2ICEA 4YNYB 1OAYL 5F7LB 1YEJH 3LKSA 4K3EH 4FQ2H 1I9JH 4X7EC 4QHLB 4UAOC 2NY4D 4Y16A 3MLTB 4NQXA 1K3IA 3WNPA 1TJIL 1IEHA 4HJJH 1Z3GH 3FQUB 2J5LC 2JELH 3L3DA 1EDQA 3JVGC 4JZNA 3E6FA 5B38B 3IXAB 4X6CF 3EAKA 4OV5A 3TT3L 2R4RH 1S5HB 3MJ9A 5IVZB 1B88A 3DECA 4Z7WA 4LSUL 3DV6B 4LCWE 2ED8A 1K2DA 4M7KL 5CJBA 4MNHA 4OM0L 4EKXA 3LPFA 4K3JH 1I3RB 5F7EL 1CXEA 1KNOB 1YNLH 4BZ1L 4WCYH 3NIDF 4IRSB 5DUML 1YEEL 5DUPH 1D9KD 2BDNH 1MWAL 3TNNB 1UG9A 2AEIT 4IRZH 1INDH 1U8MA 2G9HA 4MMZC 1F90H 2OS7A 4NCDA 5MHSD 1ORQA 5FGBA 4LSSH 2IQAB 3GSNL 3N85L 4Z18A 3LRGA 4P4KD 4C55A 4X4YB 4D9LH 4O9HL 3MXVH 1FE8H 2FECL 3HCVA 1RIUH 5D7SL 4TNWK 5KVDH 4ONFH 4QTIH 1AD0B 2WWMC 3DBXB 4YUEL 1CQYA 4YHKH 2DM7A 1G7LA 2KH2B 4GS7C 5KJRH 3L1OH 5AEAA 4TTDC 3QDAA 1UWXK 2AABL 3BIAX 4GG6F 3ARWA 4POUB 3D3VA 1Y18A 4DKEH 1X44A 1UJ3B 4ODTL 1S7UA 1PQZA 3QRGL 1ZS8A 4WNQA 2QQNL 3E8UL 3BGAA 4M1DL 3MLVL 4LLVA 1OW0A 1OOAA 5IQ9B 4K94L 3I75B 3O8XC 1RUPL 2JCCB 2KQNA 2WBJD 1DVFA 2VABB 3LH2H 1HYRC 4JR9H 2Y06L 4I3RH 4U3CA 4LHUA 1QSVA 5GSRA 3EO1A 2NY4B 5I1GL 3MXWL 2FDBP 5D6DA 3GHEL 5I1JH 5MI0B 3MOBH 4OKDA 2FECI 3PP4H 2JB6A 2C26A 3U79A 1LMKA 3OR7B 5HI3C 1VFMA 4PJIA 2HTLC 2J8HA 4YIQA 5E6IB 4KUZL 4YBQC 1XT5A 3B9KC 1C5BL 3VFSA 4BFGA 5MEOB 1QYGH 1I9IH 3HS0B 3P4NA 5I8CA 1ZAGA 1I1RA 2GJ6A 3B43A 4OLUH 3VCLB 1LO4L 5K9OB 2BVPA 3HMXH 1RFDH 2Z8WC 3RY6C 3BH8A 4X6DB 3K46A 1XGQB 1D9KB 3FN9A 1X4ZA 3MRPB 3QUMB 2BNRD 2J6EL 4XXDA 1TJIH 3S4SG 1UQSA 4C4KT 5HDQL 3T1WA 1WAAF 1J11A 4P4KB 1ROWA 2Z0BA 4JFHE 1FNEB 3RGVD 3KXFB 3W11C 5DRXB 3TT3H 5BVJB 4MLSA 4X6EB 5DQ9A 2XPGB 2PTTA 3KPOA 4LKCB 2R0LH 5DFWH 3ARDA 2DLEA 3QBTB 3UMTA 4N5EC 5I1DB 4M7KH 3ARGC 4HIXL 5C8JA 2CLZA 4OFDA 3QI9C 3FQRA 2YD8A 1HNGA 4JREB 3BYTA 1IL1A 3UBXA 5DUMH 4BZ1H 1MWAH 5EU3B 2VXUH 1KXTB 4E41A 4V1DA 4PLOB 1G6RL 1TETL 5IVXA 1C08A 3VXRD 3GSNH 1DQLL 2DJUA 5FO9A 1S9VA 5I1CL 2FHCA 4UDUB 4UQ2B 1UCTA 2WBJB 4DGIL 4O9HH 3HAEH 5E99H 3OKLB 4G8FB 3GSQB 5ITFB 4JKLA 1B2WL 5D7SH 4XPHL 4C56D 3BDXA 3UP1A 3CD4A 4Y8DC 3OL2A 4YUEH 5EZIL 1QSFB 3UTPE 3EYVA 1JTTA 5F3HA 5D7IA 5GJTL 2AABH 3W5MA 4Q9RH 1YQVL 2COQA 4KJWC 4A2MA 1JGDB 2MNUA 5IOPB 3V6ZB 4MA1B 5FDYA 2EDYA 3V6FB 3IKCA 2YWZA 3GI8L 4BFBD 4ODTH 1E28B 4M1DH 4N1CA 3MLVH 3S6CA 5JLZA 2HH0H 5IFJA 4K94H 4HXBL 1RUPH 4KRMB 2GITB 3WMSA 3EYFB 4NQVB 1EBPA 5GRJH 1IQDA 2BNRB 4I4WA 1MCQA 2YBRB 3CXHJ 1KJMA 3U6RB 4LGSB 2D9QB 5F89A 5CZKA 1CFVH 4QRRD 4KUZH 4X7DC 1X5KA 1C5BH 3V0AC 1F4YH 4W6YB 4P99A 5C08D 2DLIA 3GHBH 5EFIA 1QLFA 4J4PC 2CXKA 1JHLL 1QD0A 5KSBF 1DFBL 2QJDA 2M1KA 3VFUA 5FCUL 4ODUA 4XHQA 3GFUA 2W0FB 2H41A 5FYLE 4KVCL 5J6HB 5KG9A 2FGWL 1T0PB 3O11A 2AK4D 4M1CD 2J6EH 5D7LD 1I1FB 3QAZB 4IMKA 1INQA 4Y0GA 3OGCB 3OKOA 3VXRB 1R3IL 5HDQH 3KJ4C 2W07A 5ITBL 3TJHC 2DDQL 1WEJH 4HS3B 4O51B 5DMJB 1QFWL 3LY6A 1FV1B 2CR3A 4C56B 1WWWX 1TMCB 2E8YA 4OLXL 4TVPD 4XP5L 1FC1A 4JM2C 25C8L 1WZMA 4HIXH 1ZHKB 2HTKC 5I0ZA 5C0IB 5ALCL 5DJAA 4QRTB 4ZPVA 4WEUD 4LMQE 3MV7A 1J0ZA 2V9TA 5EU5A 4GFTB 1AE6L 4LLUA 3GMNB 4PJXB 3DIFA 1DE4A 1JGEB 5F6IB 2BOCB 3L3KB 5ESAA 5BZDA 4FA8A 1M6OA 5DJ2B 4OI7A 4OIBA 2I9TB 1TETH 5I0DA 4TUOA 2BOBA 2JCCE 1DQLH 3NTCH 2DIAA 2BSRB 4BH8A 2FD6L 3BUYA 4V2CB 3RNKB 3HZYB 4JFZL 3HRPA 3L7FB 1WC7B 4DGIH 2E7MA 1MI5D 3WN5C 1B2WH 1JK8A 3ECBA 4N5UA 4XPHH 1KEGL 2P8MA 2W92A 1FZMB 4RMRA 4JHWL 3KPSA 3NN8B 1V7NH 3V5KB 3T0DA 2VOTA 1QFWI 4PJFB 5INDA 5GJTH 4D9RD 1AGDA 3KLHD 3T2NL 2R29H 1YQVH 5FUCE 4W70A 4QRRB 5JTWA 3TBTA 2M2DA 3DVNB 3FRUA 2OM5A 3QDHA 3CMGA 5DWUL 1HOCA 3JWNC 1G9EA 4U3HA 2Y9RT 5C08B 1PX3A 3WSQL 2HLFC 2K9UA 1ZANH 4X6DE 2H6PA 4G7YL 1Q9WB 4FQIL 3QNXA 5BO1L 3GMPA 4J1UA 2JJSA 2MHAA 4P2OA 5KS9B 3BEWA 1A6AB 5MHSE 2GTWA 2AK4B 2VSCA 1NCUA 2C3VB 5D7LB 1JHTA 4X83A 4NKMB 2HN7A 3RIFF 3O4LD 1D6EB 4NQUA 1K9TA 2A6JA 3IFOB 4WHDA 4NQTA 3KXFE 2BVTA 1S7WA 3I3BA 1N5YL 4HPOL 4OIIL 2VTFA 4JRXB 4KTDL 2XT1B 2A73A 1ZA3A 4LHQB 2F15A 4DK3A 1BGXH 3PABB 5GJSL 4HKZA 1JHLH 4Z7WF 3VFRB 1KULA 5E9DB 4RFNB 2IAMA 1DFBH 1ITCA 2D4DA 3VD7A 2HVKB 2QKIB 2O61B 5FCUH 3MV9D 4O2CB 5JW3L 1C12A 4WU5A 1S9WB 4XB8A 4KVCH 2GJZA 4DVBB 5B3NA 3QA3B 4PG9B 4X5XA 1HHGB 3O2DA 1TITA 3WNLA 4S1DD 4Y5VC 2DTSA 3WFDL 4EIGB 4L3CB 1P69B 2EDFA 5JHLL 2YXMA 4ZFFA 4JKPL 2DMKA 2FBJL 3I2CH 2UVFA 3EZ8A 2WP3O 3FB5A 5HYSB 4JE4B 1QFWH 3WHXB 3E2HC 4PV9B 1MI5B 3E3QE 4XPGL 5IJVB 1QSFE 3WUWG 4OLXH 4XP5H 2B4CL 25C8H 2YD1A 4YAQB 5JZ7D 5ALCH 2A6DB 2D7MA 1JFQH 1EGJA 5FO7A 3CH1A 2A6IB 3O9WC 4NP4H 2YD6A 3O41B 3P30L 3Q1SL 3K8KA 1AE6H 4LF3A 4E0RB 3R4DA 1I8MB 4I18C 3EFDL 4NKDA 4JN2B 1BD2A 1JNNL 3VXNB 5JPNA 2RBLA 4XCCL 5EC2A 1H3UA 2AJSL 4POZD 1OAZH 1FO0B 4OUOA 1MWAB 4P9ML 2R2EB 4OD2A 5L7XL 3I50H 3QJHA 1RZ8B 1BQHG 4JFZH 1E6JL 1QLEH 4PJAB 4YJZL 5F9JA 2BNRE 4GT7A 5GS0D 3S36X 1KEGH 2OTUA 2Q7YA 3GSNB 1U95A 4OF0A 1NLBL 4OZGA 4JHWH 3CFEA 3EOBA 1OWRM 3BRFA 3N1FC 1SQ2N 3O4LB 1M7DB 1PG7X 1I7RB 1AFVL 3HAEB 3FO0L 3T2NH 4ZDHA 1I7ZB 4LSVL 3VFMA 4PJIF 2BSSB 5SWZA 3H9SD 1ORSB 1TTUA 5ENWB 1XIWC 4PRBB 3WSQH 5J7CC 2X1QA 4MQ7B 2B1AL 1IVLA 3MNZB 4FQIH 2HJLA 2F8XC 1AHWA 3DXAD 2FO1A 3MV9B 4FQPA 1DBKL 5L2JA 2OQJA 4RGND 4D8PB 3IJSB 3GIVB 4JQXC 1W0WB 5IHUL 5BVPL 4HXAL 3BVNA 5H8DA 1ZSDB 1G0XA 3VXRE 3SDXB 5IFAL 1DSFL 1Q9OA 5J1AB 2YD9A 5FB8B 4BQBA 1KJ3H 3D25A 2Q86B 4C56E 2VUOA 3MRKB 1N5YH 4HPOH 4JY6A 3GSVB 5JIKA 1GH7A 5J56B 3CSYA 3MRDB 2D03L 4WI3A 5CINL 3VJ6B 4JFDB 4PJXE 3WIIL 1AO7A 1N26A 5JW3H 2Y7QA 4HS8L 4EJ1C 3RL1B 4Q0XH 4CVXB 4NHUA 4PD4J 5B38G 3B4NA 1KB5L 3QXDB 3WNKA 2X4RB 2UWEA 4QKXB 1TCRA 3WFDH 5IB1A 5IIEB 2H1PL 2P5EA 5IVXF 5JHLH 4JKPH 4IRSC 3NIGF 1UZ6E 2FBJH 3MGOA 3EZJB 4F9LC 2DIBA 4P57A 2DKMA 3ES6B 4XPGH 1UCBH 2IBZY 4IHOB 4PJFE 2B4CH 5DO2C 4M62L 3PHQB 4U3XA 1VESA 1CK0L 3CLFL 3P4LA 2YC1A 1CN4A 4QRRE 4K9EC 1DLHB 5D7IF 2R0KH 3P30H 5C3LD 2DLHA 5D9SA 5EG6C 2EDOA 4I9WD 5C08E 4Y5XB 2B1HH 3H9SB 4M61B 1JNNH 1IGJA 4XCCH 1U8NA 3QZWA 2AJSH 4OUUA 2R2BA 3TO4A 5CIPH 2DQTL 3WIFB 4P9MH 3ARVA 1CE6A 5CJOL 3QNZA 4GRLD 3DXAB 2WMPA 2GFBB 4Y4HD 3WS6C 4RGNB 3G6JB 3IJYB 5D7LE 4Z0XB 2NYYD 3C6LD 3KPTA 5EO1B 2BNUA 2CUHA 3UEZA 3FQNB 3JV4A 1AFVH 1ONQB 3C5ZD 1I1YA 3QIBA 4JRXE 4Y4FD 4P59L 3DYPA 1F3JA 3VFTA 1EEZB 1UXWB 2IBBA 4HFWA 3OHXA 4TVPE 5ABDE 1VFAA 2QSVA 1R3LB 2F58L 2J4WH 1G7JA 3GB7B 2GCYA 2NY4C 5E9DE 2NR6D 3LEXA 4YXKL 5MI0C 1S7TB 5I8EA 4M7ZB 1N4XH 1XGUA 3JV5A 1KIRA 4NNXB 1VENA 2B1AH 3CU7A 32C2B 5D7JA 5EO0A 3HI6L 5E6IC 1DBKH 4PGBB 3OAUL 3ULUF 5FUCC 3WS3B 5ANMB 1TZHA 1JV5B 4HXAH 3PIQA 1P4LB 3TWCL 4R8WL 4F3FB 2IFFL 4AG4L 1CU4L 3AS3A 1KLUB 2PF6A 1EO7A 4G8EA 4YDIL 5E00B 1MI5E 4KK9D 3C8KB 2VC2L 4ZQKA 5E2VH 2VLKD 3IGAB 5IG7B 3QUYD 2DWDB 1HCFX 2X44D 3O2VL 3QWRA 4WTXA 3OKDB 4HWNA 3GO1L 2QEJA 4D9RE 4OI9A 1P2CB 3QIWA 5CINH 3O6KL 3WIIH 4JLRB 4Z95H 4BK5A 4H1LH 1KJ2H 4HS8H 3DTXA 2JJWA 4G9FA 4XC3L 3VDAA 2I9LB 1NGWB 1T0MA 3H9ZA 5I18L 1KB5H 3ARSA 2XNAB 5IBUB 4XH2B 1LK2B 3UTSD 1KPUB 5IB4B 4PJAE 1XR8B 3KLDA 5HI5D 5KTEH 3JZ7A 4JREC 5HYEA 4GRLB 1XEDA 4ZO9A 2DI9A 3D5OF 3BE1L 2AAVA 4Y4HB 2DB8A 4F7CA 2O26U 4S1RL 1CLCA 5D2NB 2DYPD 2FWOA 4KDTA 3BESR 3C6LB 3KYAA 3O4LE 3CFDA 4M62H 1CK0H 4XZUA 3TEUA 3CLFH 4ZFGL 5SV3A 3K1DA 3C5ZB 4Y4FB 2WBJC 3CDGB 3D1MC 4APQC 3MBXL 2AK1L 4HKJA 4HIJA 1NJ9B 1JNHA 1YN6A 2IQAA 3E3QC 3HB3D 2XQYG 2FX9L 2AJUH 5DS8B 2DQTH 4ZD3L 3MV9E 4ZOCA 2HKHH 1WVZA 5CJOH 1HQ4B 1OP3K 4PP2A 4MA1C 4QF1B 3FHQA 4I3SL 3SDXE 1AD0A 3NABH 1OQOA 5DMIL 5A40E 4DWHA 4Z8FL 3VD3A 5CBAB 4U1IA 1CBVL 2YN3A 5MEPB 4PRPD 5MEQB 1RJYA 1XF2B 3SQOL 1FFOB 5B8CA 2VLKB 1A4KA 5I1HH 1UJ3A 3QUYB 2P8LB 4F7MA 2F58H 2A9NH 8FABB 4URTB 3PWVB 4P3DB 1DBAH 1JL8A 4YXKH 4JFDE 5F7DA 4X5WB 3BO8B 3T1FA 4TUKH 2W60A 4HV8B 3HI6H 3BPNB 3D18A 4L9LA 4M9PA 2IPUK 4OF6A 1GC1L 2YUVA 1B0RB 5BW7A 1FJ1B 4NWUL 5FKPA 4O5LL 2NXZD 5IB3B 4YGVA 1AKJA 4R8WH 3TWCH 2IFFH 5DK3A 3K81A 1A6WL 5C2UB 1WBXA 3UTSB 1VEMA 4LPCA 4KJQD 2C1OA 1BPVA 2VC2H 1NCAL 3CUPA 4Z7UB 1J5OL 1K8DA 2D7TH 3DI2B 3O2VH 2FIKA 1Y6NR 4E5XB 3VCLA 5DJCA 3QAZC 3GO1H 2ZCHL 1CGWA 2BVOB 3TA3D 3OKEB 3O6KH 5ACZB 3QXWA 1UH3A 5ESVB 3OB8A 3H9SE 4X7CC 3AAZA 3T77B 4K3HA 1NCCL 4ZPTB 3DXAE 1A47A 5SWSB 2F5AL 3MGAA 1T4KA 3IF1B 4RGNE 1A7OL 3G6JE 1KLFA 3G6AA 1T1WB 3GMLB 1U92B 2C3XA 5HGBB 4GXVL 2HJFB 5F6IC 1H9VA 2MJWA 3HKFA 4X6EA 3SDYH 2XPGA 2WQ8A 4MNGB 5FOJA 5KSVB 1OGAD 3DMMD 2W0PA 1FZJA 5C0RH 4OZGF 5C0FA 4O02L 5IV2A 5GHWL 2APXA 4NGHH 2QSCH 1V7ML 5KVGL 4PRPB 2RAMA 4G6AD 1QP1A 2AK1H 3ZKMC 2V6HA 1JE6A 5GGTA 3MO1A 2NW3B 4OZ4B 3CFCH 3KYOB 4P9HL 4ZD3H 3D69A 2ADIB 4N8VB 3RX5A 3DURB 1YEKL 2BC4A 3H9HA 2X1OA 2X4SA 4IM8A 5ANME 5CSZA 4G8FA 5DC4B 4OZIA 4NRZB 4KUCF 2QQLH 4OZHB 5DMIH 4KHXH 1I8LA 3AB0B 2NXZB 3R1GH 3G5VA 1C5CL 1JTOA 4Z8FH 3K8LA 3VFNB 1K85A 2XFXB 1YEIL 3T4AA 4JFYB 2GYSA 5ALBH 1CBVH 1P7HL 3UYRL 1RJZB 1A5FL 1KG0A 3TF7C 5IB5A 1T03L 4JPVH 3M17B 4U7MA 1BIIA 3OWEA 1Z5LB 5DGQA 1LP9A 1OSZB 2AQ3A 4HX1A 4UBDD 4WW2B 3TA3B 1Q72L 5GGRY 2GITA 3H3KA 4NQVA 4L8SB 4I9WE 1GC1H 1ZXQA 1AGEA 4NWUH 3FB8A 4R90H 2EDEA 3QEUA 4MWFB 2X89D 4JZOB 4O5LH 5FOBB 4KPHH 2A2QT 3QFJD 2ZKHH 1A6WH 1YYLL 2X4QB 2UWEF 4JFPA 4RFNC 3TCLB 1MAKA 1WCQA 4HSQA 3UAJD 5D2NE 2OXGA 3RGVA 2VLJE 1J5OH 1MCIA 3C9NB 4PIRF 1ZK9A 2DQCH 4KK5D 1I7UA 5H94B 3RIAK 4C83A 5CD5D 1HHHA 2ZCHH 4A6YL 2DN7A 1UB5A 3BMWA 3CCHB 1JMXA 3LKRB 1IC5L 1U0QA 1O7VA 5I2IB 5BQ7B 3PDDA 4FNLH 1JTPA 3QQNA 2EDHA 4J2XA 1A2YB 3KYNB 4YEEA 3BIBX 2VXTL 3VXUA 5HYSG 1BZ9A 2IALA 3FB6B 2XTLA 1NCCH 1H3GA 5DTFB 3V6OA 3BD3A 1KJ2B 4NZTH 3C8DA 2AJ3B 1BAFL 2VNCA 3P73A 2F5AH 4HZLA 3KLHC 1A7OH 5F1NA 3GZKA 4GXVH 1MHPL 4HK0A 2KPNA 1MOEA 4FQHA 4QCIB 5JXED 3H42H 2Q3AA 1QNZL 2NW2B 2EC8A 2P4AB 3DX9A 5E6ZA 3ZYOA 4O02H 1VGKA 4U1HA 1OCWL 1AXTL 2CUMA 3QPQD 3W39B 5FYJL 1DEEA 2VLKE 5MERB 1V7MH 4HD9A 3UJJL 2CK0H 1DQDL 1KJVA 4U1SA 5KVGH 1ZHBB 3EOAB 3ZE2F 4PY8I 2QTEA 3SDDD 4MAYD 3VRIB 5MENA 1KBGH 1RV6X 3S36H 3QUKB 1WZ1L 1FBIL 4TQEH 3KWWA 3IS1X 4QXTA 3WIHL 4HC1A 2BSRA 5FV2A 1KFAL 1YEKH 3HAEG 3LEYH 3UZVB 4ZOBA 3BEVB 3IAQA 3BPLB 1GGBL 4GW4A 4RIRB 3UTSE 3KPPB 1C5CH 3QFJB 3MJ8A 4PJFA 1RURL 1L7TL 1Z9SA 3LRSB 1YEIH 1R5WA 3L3HB 4Z7UE 4HKXB 2DMCA 3QDJD 3T4YA 2DRUA 2WV3A 3LQZB 2HT3D 1T03H 1NBZB 3ILQD 3FCTB 3RBSA 4MX7A 5E94B 4JO1H 4S1DC 1ZV5A 5E5UB 1N0XL 4JFOA 1NFIB 1Q72H 4PJGB 3PGDB 3ZDXE 3P0YL 1EZVX 5KS9A 3MRHB 2AK4A 4CAGA 2A83B 5SWSE 1MELA 4HWBA 4JJ5A 5JR1L 1D6EA 1YYLH 3IFOA 5JZ7C 2NY5C 4M9OA 4ZUWB 4OFIA 4OCLC 4MNGE 4HIHB 1R5VB 1IEBB 1ZT1B 4WENB 1FFPA 3PABA 4DN3L 4LKXB 1Y0LA 3S9DB 5C92A 4Y19D 3L3GB 4A6YH 4POZC 3OKMB 2HVKA 4PRPE 2P47B 1IC5H 2XN9D 1M71A 5FECB 3NPSC 3JTTB 1S9WA 2FB4L 3D0LA 1FFRA 2OL3A 3OG6B 1EHLL 1ND0A 4U6HB 2G5BA 4LEOB 2VXTH 3D39D 5GS0C 3SDDB 5DUBB 3K2MC 5E4EB 4MAYB 4NUGL 2V9QA 1I4FA 1QEWB 4W4OC 4MHHI 2XZQL 4NFDA 4QTHB 3OAYK 3MRRB 4OZHE 1MHPH 2BNQE 3T0AA 3SN6N 2DLTA 4Y5XC 2R15A 1QNZH 4AM0A 3ZDZF 5KSAA 3T04D 4XPBL 4JDTL 1OCWH 1BF2A 2X4OA 4F7EA 4OLZH 5SWQB 2DI8A 3UJJH 3BHBB 1Q0YL 3QDJB 2PYEA 3HFML 4RGNC 3WFCL 1F3DJ 3L5WA 5KSUA 3T0WA 4J3XA 3LKPA 2PCPA 4YHLL 1EJOH 1WZ1H 4EIZC 4CNIB 3ZZ1A 1GVIA 4YR6A 1CFNB 3WIHH 4LLYB 2GK0A 2ATPB 5TF0A 1RZ8A 3ARFD 3DI3B 4BJLA 1KXVC 2JK5B 4P46D 5T3ZD 2H32H 4BUHA 3FQXB 1NBVL 3CFJB 1JMZA 1GGBH 2ESVD 3GSNA 2XKNB 5IHZA 3RVTC 2BRRH 1F58L 3ORJA 5HHPA 3LKQB 3HRZB 1L7TH 3MOQA 4M7ZC 1I7RA 5JW4Q 3DX7A 3MRMB 4ENED 1I7ZA 1W72L 4Z7VA 5T1DL 1T22B 1WICA 5FF6B 2VLRE 4L1DA 4MCZB 1MCJA 3MJ6A 1MJ7H 3PUCA 2LV4A 5AD0B 1MHCA 4N0FB 4XPTH 1DJSA 4PRBA 4P5MA 1SEBA 1QACA 5EUOB 1JF6A 1N0XH 1FC2D 1RJCA 2XN9B 3V52L 4X6DF 3MJGX 5DJZB 3GIVA 3S5LA 1JWMA 2F74B 3IVKB 3KPQA 5HYJE 3CAFA 4HZAA 1KC5L 5EIVA 3T0EC 3D39B 1CT8B 5EH1A 3C60D 5JR1H 1CD1B 5J1AA 1P6AB 3BH9B 1T20A 3MGTB 3RL2A 2XZAL 3TYFB 4B50A 1J8HA 1T1ZA 3AMLA 1X5FA 3VI3F 1WIOA 1XF3B 1A9BA 5F9WB 3MUY1 1CDIA 3FONA 4XP4L 5HVHC 5IBUG 3VXQA 5C7XL 1V3LA 1CE1L 2FB4H 5GRVK 4GRLC 3MQIA 4ISVA 1UM4L 4Y4HC 2C9AA 5D2NC 4PPTA 5HPMB 1KELL 3CZFA 3C6LC 3RWDA 5F9OH 4NUGH 3QDGD 2VKXA 1QR1B 1T0NB 1U3HB 4LPYA 3VFOB 3WNNA 1OF2B 4ZUSB 4MSWA 3C5ZC 3ARFB 2DJ4A 2J6EA 1RUKL 2APBA 5FA3B 3PXHA 4Y4FC 3KPMB 4P46B 1MY7A 4P5TD 4K3DL 1R3KB 3KHOA 2ESVB 3QFJE 4OZIF 1INEL 4M03A 1SY6L 2NR6C 5DD3L 4XPFL 1IGCL 4ORGB 3D0VA 2A1WL 3IFPB 2EECA 3DO7B 3MA7B 1HQRA 3V4PL 4JQVC 1BZ7B 1Q0YH 3IB4A 3HFMH 2E9IA 3WFCH 1J0HA 4BSVA 3CPLA 4DKFL 3F7VB 2I25N 4NRXB 4ZS6D 3C5SB 4YPGB 3OKKB 1RHHB 1PKQA 3DV4B 1MCDA 3BZDA 1PKOA 3WNOA 4LIQL 1LP9F 1OTTC 4G5ZL 3BKYL 4ZUTA 1P7QA 2KUTA 2R1YB 1G6RA 2RFXB 1RK0A 3RPIB 2NY6B 4N8CH 3ZT5A 3IJYA 1YECH 4KK9C 4MJ5B 4ELMB 1NBVH 2FHBA 3QUYC 1F58H 2Y72A 2IG2L 3P4OA 4I0PC 4R4BB 3C60B 1ZWIA 3BZEA 4U1NB 1KT2A 4FTVD 4R4NC 4JRYB 1QSEB 3FT2B 1W72H 4PY7B 4PRIA 1A6VL 5T1DH 3BPNC 4ESKA 5D5MA 3MRBB 1BVZA 4U0QB 5BS0A 4XNMA 4IBLT 1U9KA 3SE4C 3L95B 5DRNA 3BP4B 5CEYA 5EO9B 1XMWA 3TBSA 4HH9A 5LCVL 1FZOA 4I2XB 4PGBA 3E6HB 2LVCA 5F1IB 5HI5C 1BQLL 4G8IA 3N9GH 4JZJB 3U4BL 3PWPA 1G7PA 3GI9H 4ZFZA 1QHPA 3A67L 4MB5A 5CP3H 3VGDA 3OXRB 1PG7W 1BWWA 3QDGB 2DIJA 2NQCA 4RDQG 2XZAH 5I1AB 2F19L 3L5XL 5F72S 3RKPA 3RX7A 1QBLH 2I26N 1ODAA 4UIMB 1FYHB 3MYZA 3TBYB 1NC2A 3UCRA 4EI6B 1HINL 4LGRB 1U8IA 3HB3C 4XP4H 2DWEA 4KV5E 4MD5A 3T2OA 2BK8A 3QDJE 1CE1H 1I9EA 3KPRA 4Q9CA 3REWB 4E42B 3ZMRA 2Q76A 3G5YB 4DAGL 5EZJA 4EN3A 1UM4H 2JJTC 3B9AA 1CVRA 5I66B 3S97C 2HAZA 1EAJA 5E6YA 5AYQA 1JUFB 3TT1L 1YUHB 4QXGL 2Z31A 5F7HA 4U7SA 2D9CA 4G8GD 3HZKA 1DUYB 1MLCA 1CDHA 3NCBB 1XGRB 2OXHA 1RUKH 4JANB 1AGCA 2D2OA 3TVMD 2QV2A 4OZFA 3HI1B 5K59E 5CWSA 1AJ7L 2CO6B 2N56A 5I75C 1WISA 5DD3H 1FORL 4YX2H 3SCMA 5BXFA 4FTVB 4PJFF 4DQOL 3BP5B 2V2XB 3V4PH 4N8VG 3QIUA 3CDGA 1QO3A 1FIGL 4WTZG 1EFXD 2AJVL 1T04A 3L3JB 3LV3B 3AB0C 2ZCKL 2NXZC 5EUOE 3G9AB 4LIQH 4G5ZH 4XVUC 2XN9E 4KMTL 3AC0A 3BKYH 5DJDB 4PG2C 3ZLQC 4H8WL 3W82A 3D85A 1AC0A 3NCJL 3D39E 4DGVL 1WT5A 4HUUB 2VXSL 1IGYA 5JORA 5KS9F 3DVFA 4Y89A 2NX5D 3O3AB 4FQ1L 1K8IB 3SGJC 4WW2C 3SE3A 4RCAA 2H32B 3LSOB 3O45A 1BZQK 1E4XI 2X42A 1O7SA 1CWVA 1FFOA 4L8SC 3H2WA 3GM8A 5F6HJ 4Q2ZB 5HHXL 1U8HB 2B5IB 3X13B 4XVJL 5F70A 3TPKA 5E08L 4HUXA 1BOGA 2VAAB 3EYQD 3OKNB 5DLML 5K33A 4OIAA 5CGYD 3DX8B 2PNDA 3RDTA 1DQJB 1CFSA 5HVGB 2AVGA 5CKAA 1FSKB 2DQHL 4ZYKB 1E27B 1D5MB 3U4BH 5GGSB 4LLQB 1B0RA 4D0DA 3AS1A 5AAMA 3INUL 4GKOA 3A67H 4EOWL 4PJ7A 4XNYH 1L4IA 1KIQB 4G8GB 3CVHH 5HHOA 3QCTH 3BUTA 5T3ZE 3MROA 4S1QH 3WD5H 2F19H 3L5XH 3WJJC 3STBA 2R8SH 2ESVE 3SGKA 5IWLA 3CVIL 3TVMB 2NXYD 3F5WB 2DYPA 3FT3B 4YHYB 4TN9A 4E5XA 3SY0B 5CP7A 5IMOA 5JNYA 4K2UL 4NUJA 4YZFE 1CFTB 4P23D 2E27L 4H1LG 3U4EB 5DJXB 3U7WH 4FFVD 3QO0B 1FL3B 3BOVA 2ZSVB 4DAGH 4IRJD 2Q8AL 2ZUWA 2JB5L 3T77A 3L5IA 3KPNA 1A14L 5I1LA 1EFXB 3JXAA 2FJFA 2X05A 2X70B 3TT1H 2KZ1B 1U8KB 4GAFB 4ZPTA 3C87A 1ZLUH 3S96B 4R96A 1YNKL 4YDVA 4ELME 3GBMH 4XRCB 5GRZA 5JO5A 1T1WA 1RU9H 1FVCB 2WW8A 4EDXB 1ZLVH 5CEZH 3NCYS 3VMNA 5EBWA 4KKAC 3FFDA 4JRYE 5DD5L 3C5JB 1QSEE 2NX5B 6CGTA 1FORH 5EORL 4QYOA 4N1EA 4RX4D 3MSPA 4DQOH 3Q2CA 1YY9D 3L5JA 3JBG7 1HXYB 2PYFB 1FIGH 4Z7VF 2VDML 5JOEA 4GLRI 5EDXA 5MP6H 1PX4A 2AJVH 3F8UB 3TIDB 2IPKA 5IEKA 2ZCKH 1B0WA 1NL0L 1NPUA 4ZAKB 3QIBC 4OZ4A 3X12A 2C4FU 3KYOA 4HJGA 3GMQB 4LBEB 1Q9LB 1P1ZB 4I2XE 4LEXH 5E1AB 4KMTH 5ID1A 2W1NA 4JHAH 1A1OA 4KU1A 3I9GL 4H8WH 3UAJC 4NRYA 3T8XA 1N59A 4DGVH 2E8ZA 5C2BL 5CIPA 2R0WL 5JIIA 1FPTL 2XXCB 1YYML 4G6KL 3ULVE 4DUVA 2D7NA 3HNSL 4FQJL 4KK5C 5DA0B 3VFNA 4FQ1H 3KNBB 5CD5C 2VR5A 3G5XA 5CZVH 1RZGB 4QHNB 5D2LB 1YN7A 3RZCD 1CLZL 4XCFL 3SDAA 2EEDA 5HHXH 4LSRH 4HWZA 4Y8AA 3MREB 5I74B 3M17A 5B39A 1Z5LA 2NXYB 3V0WL 1WLHA 2YN5A 3CFKA 3C2AL 1OSZA 1TZIB 5DJ6B 1EV2E 5IKCA 3DWTA 3TA3A 4MD0B 4P23B 4YHPA 1FFQA 1KCUL 4PJ8B 3IETA 5HHNB 4LNRB 3RVUD 4GO6B 4MXVF 4IRJB 4CJ0A 5FUZL 1YEHL 3BPCB 3INUH 4EOWH 3IDJA 5H35A 1NGYA 5D1QD 5JXEC 3TIEB 4Z5RB 2UV3A 4KROD 1LO3L 4M43H 3IAGC 1LK3H 43C9A 5FGRA 3ARBD 2WAHA 1EXUA 2CDEB 5E5MA 3WYRA 3CVIH 2WQRA 4OV6F 4G3YL 3Q6FB 3QUZD 1CD9B 2CKBH 4GKZA 1OGAA 3SDDC 3DMMA 4MAYC 5H94A 4FTVE 4K7PY 3IJHA 3HE6A 2CD0A 4K2UH 3SKNB 4GLRH 3U2SB 1GZQB 3HHRB 3MZTA 3PQYA 1U8PA 2E27H 1CG9A 3LB6C 1P53A 2DQUL 2KZWA 2I24N 3JV0A 4RBPH 2Q8AH 1A2YA 2JB5H 5HSFA 4CKVX 1A14H 3I3EA 1M7IB 4ODSH 2XG4A 3X3FL 2EYRA 3RNQA 1F2XK 5DTFA 3HR5B 4H1LA 2GT9A 4LSQL 2AJ3A 4NN7B 1YNKH 3I84A 1P7KA 5TH2B 4HDIA 5D8JL 5IGXL 2C1PA 5LAXB 1KB5A 1S7QB 1F11B 3I3DA 1GCFA 1G7IA 3DLQR 3SDCA 5F97E 1I7TA 4MLIA 2HT3C 3ILQC 3U83A 4ZTPL 3E1F1 3WXVL 4P2QA 2IMNA 1QLRB 3PL6B 5EORH 4JO3L 2HFFB 3X14A 4GG8B 2XIDA 2BCKB 2VR4A 3RZCB 2ZP0T 2IFGA 2R1XA 3B3IB 5D5MF 3VRIA 3V7AE 4PJBB 4LP4A 3U46A 5GS1B 1NL0H 3GMMA 4JDZA 1XCTA 3UYPA 4HLJA 3STZA 5DD1H 5FV1L 4MYWB 3VI4E 5I73B 2FZ3B 5IF0A 2ICES 1Q38A 2HJKB 3ALXA 4YDKL 5C2BH 2J8UB 2V17L 5JHDD 1FPTH 1OSPH 1ZT4B 2X89A 4G8GE 1AD9B 3HNSH 4FQJH 5D1QB 4S0TD 2YPKA 4UU9B 4KROB 4Y1AB 1JRHI 3CX5K 2F54A 4O00A 5CEZD 3MUGA 3ARBB 5IMMB 5TFSL 5DI8A 5TDNB 3NFSL 4J8RA 1CLYL 3RWFA 3HC0B 3QQ4B 3QUZB 3V0WH 1LEKA 1KB9K 1JZ6A 3G08B 1EEYB 3C2AH 4EXPX 2QADC 2ITDA 5AZ2L 5LGKA 5DHVH 3FB7B 4NO5A 1K4DA 1WBYB 4B7IA 4OLYL 1UZ8B 4PJGA 1KCUH 5DYOB 3S8WA 5EC1B 2HT4C 3N1MC 3ROOA 4LPWA 3HLAA 3HN3A 3IXTA 3MRLA 5FGCB 2CRIA 5BMFL 4S1SL 5FUZH 1YEHH 5F9WC 4R0LA 1LO3H 2V9RA 3SKUD 2L4OA 2EDRA 3MNWB 1ZLSL 3H3PH 4UB0L 2O5ZL 3LKNB 2EDNA 3BJ91 4QOKA 1HDMB 1IEBA 4G3YH 3CVHB 2NX5E 3U30B 3HNTH 4AIZB 4KKBD 4GOSA 1AIFB 1IQWH 1U3HC 2G2RB 2H8PA 2VZSA 3VWKD 4JO4L 1ADQL 1PLGL 3O4OB 3TN0D 3T65B 2Z92B 5HHMD 2CQVA 3ARFC 2DM4A 1UYWL 2DQUH 2X40A 3VFWB 3IU3A 3ZSTA 4IEFB 4P46C 2AV1B 3EO9H 3S37L 2R69L 1F42A 3BISA 1CICC 3GJEB 3ULSB 3LPWA 1Q1JH 4LSQH 1RVFH 3U0WH 1QA9A 3VXSD 4K3GA 4D9QD 1BHGA 1J12A 5D8JH 5IGXH 5BRZE 3AXLB 1PVHA 3WCYA 2ZCLL 1JRHH 2PTUA 5J3HD 2N7BA 3PNWB 4JM4L 2X1XR 4ZTPH 1QPPA 3O3BB 5D2LE 2AEWA 3SGDI 2CJUH 4WV1B 3LCYA 1JI1A 1AQKH 2ICWI 5SWQA 5E24E 1L7IL 3MCKB 5D1XD 5DDHA 5C6TL 2AV7B 3BQUD 2NY6C 2WIIA 2N7AA 4U49A 4HK3N 1WFTA 1QRNA 5AUMB 3BN9C 3K74B 1OVZA 4J3UA 2YD7A 4CNIA 2J1KA 3C60C 1A1MB 3P2TA 3WXWH 4P2CG 2JK5A 4JDVA 4XNQA 3I6GA 4YDKH 5FK9B 4NQSA 3Q5YA 5SX4I 2P8PA 3TBWB 1MJUL 3U7AA 2MQ0A 1LD9A 1AP2A 4PJ7F 4X98B 3RUGA 3AREA 4J3VA 3S35X 4XBGA 4OB5H 1CD8A 4AEHH 1T2QH 3L9RA 4JZJC 1HZHL 2EE6A 3NFSH 1CLYH 2Z93B 1MCNA 4JPWL 1Z2KA 4MNQD 4A2LA 3RWGB 5AZ2H 4Y19A 3ULVC 3PE9A 4HAGA 3NFNB 4X9GA 1NGPH 2AP2A 3TN0B 4XCNA 3KYMA 4YK4B 4CVUA 5HHMB 3WO3B 1UWGL 1LDPL 1QBBA 1XH3B 5EBLB 3V4UL 5BMFH 1BX2B 4S1SH 3WEXB 1I8KB 1ETZA 3CFIC 4S2SB 2FJGA 1CT8A 3QT2A 1U8QB 4OGYH 4W81A 2P45B 1CD1A 3DUSA 3LKOB 2LAAA 5HGHB 3HPJA 5KN5B 4FFYH 3VXSB 1NAMB 3IAPA 3S88L 1HXMB 3BD5A 4BA8A 3V6OC 1R24B 2C3GA 4HS6A 4WO4D 3SGDH 3M1BA 4OI8A 4ZS6C 3TLRA 1SYVA 1S8DB 3MFFA 3MRCB 1OTUD 1BFSA 1QQDB 5KW9H 1F6FB 4JO4H 4ODVH 1ADQH 1MJJB 3SKMA 1CI5A 3ILPB 5ILTH 2CKBB 3BMVA 4JFFA 3BQUB 4UOW1 3LN5B 3QJFB 3VFVB 5IW3A 4DZ8B 2FATL 1FAKT 4WI9A 2R69H 4NQEA 4RBPK 3BWUC 4RQQB 4MDJB 3IDYB 2OTWA 2QSTA 1ZA6B 4TRPL 4XMPL 5SX4H 2CUIA 2YS4A 2K1MA 1FZKA 2P43B 4LIQE 4YFLF 2J8UE 5HGAA 1JNJA 4QHUB 2V2TB 5DHYA 1JP5A 1JZ5A 3ZE0E 5TDOB 4WUUD 1X7QA 3EFFB 1L6ZA 3MYJB 4JM4H 4Y1AE 1N64L 3PWNA 4NT6B 1EA9C 4QHMA 1M05A 2YD3A 1I85C 2FX7L 1L7IH 2BVYA 2B8OT 3ABZA 2OZ4H 2FLRT 5C6TH 3GSWA 1HHKB 2DQJH 3V0VA 4YHIA 4UILH 1DBMH 1Q8MA 4MNQB 1BFTA 4MB3A 5E8EA 1HSAA 4HMDA 1X5JA 2NNAB 3IRZA 3CDCA 1OTSD 5FGCE 3RWIB 3KG5A 1O0VA 1SYSA 4BFEA 5IB2A 2JLLA 2B5IC 2R56H 1F5WA 1MJUH 2YD5A 2YUWA 1IILE 5LBSH 1HIML 1YEGL 1NEZA 1MFCH 3CX5J 4XCEA 1NMAH 5ETUB 5BOPA 4PP1C 3V7AG 4WI5A 5I1EH 1FSKC 1EHNA 1KB9J 4WO4B 3WE6B 3OAZH 1UH4A 2N4IA 1S9YA 1FG2A 3L95A 4F37F 1FL5A 4ZNEE 5DEGB 3TBVB 1T7YA 2HVJB 3QXAB 1MNUL 4PJDA 2FSEA 1PZ5B 1DN0B 5M7QA 1GZPB 4IIQA 1VFUA 5CJ5A 1BQSA 2WANA 4XVSH 1UWGH 1LDPH 4M48L 3F12B 4MHHG 2C4FT 4F37K 2GUOA 3UC0L 3PHOA 5DHVB 1NDMA 4YHYC 2G5RA 2J88L 2NY3D 5DEFB 4RFEA 3QDGA 5GRUL 1A6ZB 2ZSWB 4KWUA 4RGMB 4LAJH 2HG5A 3S88H 3UPRB 3BXNA 1UH2A 3QH3A 2SEBB 3F58L 4LPXA 4P5TA 2IF7A 3F62A 2GI7A 3SPVB 1VFOA 4GKSB 5JDSB 1D6VL 5T3XL 1JPFA 3GUTB 2D7QA 4P3CH 5CEZE 4AEFA 4RMSA 4E42A 2ITCB 1W0YT 3OTTA 3GJFH 4YHML 4X4ME 2DQEL 5E5RB 5I66A 4A6YA 3EOYG 4BFIB 1YUHA 3MRFB 3LRHA 2ED9A 4AT6A 1A7NL 2YXFA 2CIKB 1JPSL 3BAEH 4TRPH 4XMPH 4N0UB 1UADC 1LE5B 3RPKA 5EU4B 3KPLB 4JANA 3QEHA 1H3VA 1WFUA 3LEVL 4ZXBA 4XCYB 1OLZA 2NY2B 4ZAKC 2VR9A 4L8CB 1N64H 3EYQC 5CGYC 3GKZA 2AXGB 1FH5L 4MDIA 1N6UA 4L8BA 1F8TL 1QVOB 1IRAY 1QFUL 1NUFA 4XPAL 3RWEB 3HPLB 5E8OB 3L3JA 2X9XA 2EKSB 1CGVA 2FL5A 5DXWA 2FEDD 1RIHL 2ED7A 3JUYA 5ERWA 2PR4H 3ALPA 1GIGH 4LCUA 5HHME 2B0SL 5EU6B 4EVNB 1TLKA 5HVFB 4PJGF 1CFQA 2X4UA 4PTTA 4PJ5A 3U0TA 4RZCA 1G7HA 4U1JA 5I74C 3WIHA 5F96L 5IMKB 1HIMH 2NY3B 3BWAA 3VXSE 2EYSB 4D9QE 4MS8D 4NQCD 1EO5A 2FJHB 5J0BA 2PETA 2VDLL 4P23C 4J6RH 5C0AE 4BZ2H 3MUZ1 1BEYL 4PJ8C 3NGBC 3EKCA 1U8HA 3PJSB 4IRJC 4JPIB 4NIKB 1QFWM 4OLVH 1MNUH 2P5WD 4XXCA 3DRTB 5T5NF 4UQ3A 3A6CL 2CLVA 1X5AA 3HE7A 1FDLH 1FHGA 1ZVHA 4M48H 5TPWL 1MRDL 4Y88A 4EUPB 1U58B 2BMKA 3LHPL 4XTRC 1UEYA 5GRUH 3R0NA 2QQQA 4P2RA 4KQ4L 4KMQA 1T80A 2YD2A 4IS6A 1YDPB 1YY9C 3VG0L 4NN5B 1MIMH 4R97B 2C3WA 2ZOLA 5M94B 5DSCA 3ZHKA 4RFOL 3ME0A 4HQQH 1DQML 2QQKH 5LGJA 1D6VH 5T3XH 2V7HA 4G80A 3JWDC 1NC4D 1FL3A 1LILA 3EUUA 3H7LA 2MPAL 2ZSVA 2XRAH 4YHMH 5DRWB 2CDGA 2ICWB 3OPZL 5EPMB 2A9ML 2DQEH 4MNQE 4DTGH 3MLUH 2X70A 1JZ7A 1U8KA 4TTDD 3PL6C 1A7NH 4AK1A 1JPSH 1A6TA 4XRCA 2HWZH 5DJ0A 4HW6A 2E7LA 1IFHL 2CXGA 1F13A 3GSUA 4PGCB 2OYPA 3RRQA 1XF4A 3RZCC 3V5DA 4CADA 5DRZB 4PYGA 3TO2B 3PWUA 1ED3A 1MF2L 1B0GA 5GS1C 3ZE1F 1SMAA 1FH5H 5H2BA 3RUGF 1F8TH 5F1OB 1WCBA 4XPAH 5GIRA 4U6XB 1WZKA 4OCYL 4OGAD 5I73C 1FVEA 3UJIL 3RVUC 3W0WD 4R9HA 3ARXA 3HNVL 4JFXA 4ODXB 4NYLA 1RIHH 4BZYA 2P5WB 5E1AA 2VQ1B 4KROC 2B0SH 4YHNB 1EIBA 2DQIL 2DAVA 1ACYL 5ICXB 4YBQD 5DK0A 4NQDD 1OGTB 3BKMH 4G9DB 3GKWH 1YJDC 5I16A 4NNYB 4ZODA 5T1MB 1NDGB 3MLZL 3QO1A 2EH7H 3QUZC 5E70A 2DMBA 4NBZB 3K3QA 4MQXD 2RHEA 3T3ME 4QHNA 2VDLH 3WJLC 5J6GB 2EDDA 2VDKH 1BEYH 5F8RC 3IDIB 1G7MA 2H45A 4PJ9D 3H7BA 4FXGB 2HFEB 3VGBA 3OAZK 1W72A 4OGZA 3AS0A 1RZ7L 4XMLL 4LARL 3FHAA 3F6IA 4U1MA 1IKNA 2HLAB 4HEPG 5JXAL 3A6CH 4LLWB 3WLWD 5FM5O 3FQTB 4EQ3A 1NC4B 5DMKB 4N9GB 3PWLB 1N3NB 3A6BH 2I5YL 4MJ6B 4N0YL 4ZG1A 5TPWH 4KRNA 2N1KA 5JPMB 3MCLL 4N5ED 4FMKA 3ARGD 2IH1B 4TSCL 3SHSA 3M8OL 3BZFA 4N0UE 1EO8H 2BHYA 1LO0L 4KQ4H 3O4OC 1IT9L 2VJXA 1OAQH 2Z91B 3H0TA 5CP3A 1P84J 1S9XA 3VG0H 2XWJA 1D5XB 1NMCC 2UYLB 4CMMB 3VG9C 1LE9A 3JV6B 4RFOH 5KVEL 4ZUUA 1C16A 4YDJA 1DQMH 4M8QA 4ZTOL 5EOCL 5C09A 2Q6WB 4H26A 3MRIA 2IGFL 4LHJB 2X41A 1V5JA 3OPZH 4WJ5A 3P40A 4AJ0A 2A9MH 3LZFL 3FOLA 4BQ8A 3W0WB 4P0DA 5CJXC 1IGML 3DROB 2H3NB 3NAAL 5DJ8A 3AS2A 3NZ8B 3QIUC 5EU6E 5I76B 1I9RL 2VDQL 1AH1A 4WV1C 3VDBA 4GW5B 1S7QA 1F11A 5LQBL 4Y2DA 4NQDB 4GAYB 4XWGL 1SJHA 4KKLC 1MF2H 3CC5B 2EIZA 3N1PC 5EZLA 1Y6KR 2FH6A 2DJSA 1JPGB 4RMWA 3ZTNL 5DJYB 1NUGA 5HHQB 1T89C 4GG8A 3U82B 1IC7L 1S5IL 1WUNT 3C6SA 3IS0X 4OCYH 3V79C 5IW1A 3X11B 1SY6A 4DKAA 4HPYH 3UJIH 3MACL 3K4DA 1W0VB 4U33A 5T3XD 4KDWA 4PJBA 1J0IA 3HNVH 1S7RB 4PJ9B 3T3PE 5JIHA 5FYLL 1VKXA 1S7VA 2NTFB 4QY8A 4PJDF 4CN4A 2Y5EA 4Z7NE 2DQIH 3BW9B 3JTSB 4MA3B 4XP1H 1I1AA 1IM9D 4K9EL 1G9MC 4G43A 1RJLB 2PW2B 7CGTA 3FT4A 3L3OA 5F7FA 4J4PD 5D1QA 4AIOA 4ODWB 4TYUA 1HI6A 4KKBC 3HC3H 3VD5A 2EYTA 1ZKAA 3TN0C 3V6BR 4FQLL 4HT1L 1U3YA 1VPOL 4YK4C 5TDNA 4XGZA 4M7JL 2EXYC 1H15B 3QQ4A 4WFED 1ERNA 3DOSA 3KDMB 3WFBL 4G42A 3B2UD 3NA9L 1RZ7H 5FDWA 2EIDA 4LARH 1OPGH 2ZUQB 5DYOA 5JOPE 2H26B 3DGGA 1C1EL 4QRPA 1KTDA 3PHSA 5F3BB 2I5YH 1N2RA 2YA1A 3ESVF 5J9PB 1RZIA 1B3JA 3BJLA 2ATKB 1D5IH 5J3HC 3P77B 4NM8L 4HGWB 4L8DB 1LO0H 4GKNB 1BLNB 4DW2H 1FVDB 2QL1A 1JBJA 3EJZD 2AJZA 3KVQA 1XF5B 1IT9H 2D0FA 1WK0A 3DSNA 1FN4B 3RP1A 1WWBX 3BQUC 2ICWJ 2X4TA 4KK8D 4GAGL 3HZMB 3FFCA 1L0YA 5KVEH 4MJID 3IDYC 2XZCL 1CLOL 3DETD 4ZTOH 1DN2A 2E9WA 1U8JB 1MCSA 2ARJA 1CDGA 2IGFH 3UZEA 3MUJA 3LZFH 2JKXA 3EGSB 1TVBB 2ADGB 2O5YH 4F7PB 2P5WE 4FXKA 2W38A 2O93L 2EDWA 1LO5B 3NAAH 3REVB 1GGUA 3QUML 1X5XA 4OCRL 3I02B 2VDQH 3CNKA 1JN6B 1R6VA 4XC1L 3LS4L 3AXLA 5LQBH 1IM9B 2GAZA 4XWGH 3VGEA 1EK3A 2VH5L 4YXLL 5JHDA 4FQXD 1N8ZA 4NPYA 2HLFD 3O3BA 5C6WH 3C08L 2G75A 2VDPL 4K7FB 2EDQA 1IC7H 3MPCA 3BKJL 5BV7C 4ELKA 4DGYL 3VXMA 1FNGB 2NZIA 4L29A 5GS3A 3OR6A 4LLMA 2Z8RA 4RNRB 1F6LL 3KJ4B 1NLDL 2FYYB 3EDFA 3WUZA 3TESA 3AM8A 4NKOA 4K9EH 5E56A 1IZKA 1E4KC 2BVQB 3BIKA 5CGTA 3TBWA 2AXHA 4WO4C 4OFPA 3RTQB 1LNUA 2F53D 2LU7A 2BHUA 4HCRH 1UA6L 3QP3A 1NGZB 2F5BL 2VIRB 4JVPA 4GSDL 1EMTL 5IJKA 2NZ9D 1RQ5A 2J3SA 4RAUB 1D5ZB 3U7YL 1R3JA 4FQLH 1VPOH 2MCG1 2KKQA 4YQXH 1JWSB 4Z7QF 1II4E 5DVOA 4WWKD 3DARA 3EYUL 4KI5D 2VN7A 3ZYIA 3P9MB 3MA9H 1UWXH 2KDGA 3FQWA 4MJIB 1MJ8H 2HRLA 3WFBH 1H5BA 3MLYL 4R7DB 3VWKA 2Z8VC 4GXUN 4RGMC 2EEBA 1C1EH 5I17B 4TUJA 2HKFL 3W0WE 3PDOA 1HYSC 4MZ2A 2ADJB 3WFEH 3BYYA 5CJ8A 4NM8H 1VADB 3LKOA 1T5XB 4OCMC 2I60L 3O9WD 5J11B 1X5HA 1DP0A 4CUCA 4JFQA 4NQDE 2D0HA 2HYMA 1MHHA 1XR9B 4WW1A 3SE9H 43CAB 1QKZL 1RUQL 1K5NA 4GAGH 4FQXB 1HKLL 1X4YA 3STLA 4K7PL 2XZCH 2W65B 4PTUB 1CLOH 4N68A 5B22A 5HGDA 4JKWA 3O3DA 1BWMA 5D1XA 3CGTA 3KAAA 3WLBB 3TZVD 1D7FA 3QJFA 3HZVB 5FYKH 1Q94B 1TVHB 4WU7B 1BVLB 1T7XA 1SJEA 2A74B 1DBJL 4MXWH 5FUOH 2NY2C 3AU1B 2XZZA 4DN4H 4Z7OF 4LPUA 5L9DL 1FYTA 4PJEB 5JW4M