4XP4L

X-ray structure of drosophila dopamine transporter in complex with cocaine
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
molecule keywords Dopamine transporter
total genus 47
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp4L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp4L01
1ZXQA 2ATKB 1NCTA 3MGAA 3TM6A 2F53D 2FO4A 3G08B 2Y36H 2CXKA 3LKNB 5AYUH 5I8EA 3U36A 2PO6C 4PJGB 4YHMH 3QQNA 3QUYC 3ISWA 3TWCH 4Q9RH 3K4ZA 3DGGB 2WANA 4ZFZA 2EDKA 4IRSC 2GTZA 5CFHA 5I1KH 2GAZA 2IQ9H 1YC7A 1KTLB 5DFTA 4ZSOA 2OR7A 3MLRL 2X4QA 3VI3F 1EHXA 5GQBA 3DNKA 2KZ1B 4QXGH 2HMIC 1D5BA 1HKFA 5DMIL 4RIRA 2BVOB 3ARDB 4KHXH 3WKNA 4LASL 1CGTA 4JO4L 3HNTH 3VXSE 4JGJA 3BJ91 3HHRB 4NQXB 4WEUD 4N0UA 3ZKNC 3BW9A 4XPHL 3FFCA 3BE1H 4L3ED 5FO8B 1DUYB 2XTJD 4OCYL 1DCLA 5M7QA 1DQQB 4HSQA 3BUTA 1OL0A 1BBDH 3FZUC 2E7LA 4HGWB 1DQJB 3V4VH 3QXAA 4G6FB 4NNYB 3CH1A 2CO6B 4G8FA 5IK3A 4HJJL 5DUPH 3P40A 5IB3B 3VH8G 3KPLA 3WJLA 4OZIB 3VXME 1E27B 1HYRC 2IMMA 1TLKA 5TQ0H 3RNKB 5FM5O 4RFNB 3UBXI 4UTAL 2ZUXA 3JV0A 4BK4A 3E1F1 3RUGE 5HYEA 4YZFE 4F7EA 3U9UA 5FYJL 1MCPH 1KELH 2FEDD 3TBYB 1A1OB 3IKCB 3GO1H 1NFKA 5ERWA 5I76B 1KB9J 2VDPH 4JFHD 5DRWA 1F4AA 5TGBB 3NFNB 2YD7A 4J1UB 1CDCA 3C5JA 2BOCA 4K3JL 5FO7B 3BFOA 3OKDB 4K7PL 3LKRB 2FZ3B 4NQSA 4DAGL 1AP2A 2PUQT 4YJZL 2NNAB 2NPLX 2NY4B 2YK1H 5CEZD 3EKCA 4NDMB 2DQCL 4P23B 5GS2H 2CJUH 4KMTH 1QFOA 3L3GA 1F13A 3AC0A 3A6CH 3RWFB 5I8CA 3B2VH 2J4WL 1JNHB 4OLUH 1JMXA 1QBLH 3JXAA 5ID0A 1IGML 2HJKA 5DJYB 2HRPH 4XAKD 1HQRB 3L5WB 3P0VH 4Z7VE 2CUIA 3PWVA 2EECA 1BQHB 5DEFB 1OAKL 2JJUA 3PABB 4CU7A 4BQ6A 4ZNCD 3FB8B 3TBSB 4XPAL 4LLYA 2F54E 4BH8A 4G3YL 4PRAA 5DMJB 3C6SA 4XP9L 3QWOB 2OR9H 2ZCKH 3DX7A 4FQLL 5D1QC 3RZCC 4Y4FD 2FO1A 5HHME 1P9MA 1J86A 1MRDH 4O9HH 4LVHC 1IQDA 5JDJA 4KQ3H 5D93B 5EC2A 4ENEC 4M1CD 3T2NH 4X7FC 1MNUH 3C8KB 3MJ6A 1X5LA 5IKCB 3DROB 3D3VE 1XCQA 1MJJA 5F21B 2BMKA 5TF1H 1VPOL 2H6PB 4OI8A 3PXHA 2JJSA 1PW3A 1ZEAH 3TN0B 1CGSH 3ARWA 4PJ9A 2UZIH 4PRNB 3O6KH 3H7BB 1B6UA 1RFDL 5D5ME 2Q8BH 4YHKH 2WK2A 1A6ZB 4G43A 1NDGA 3JV5A 1G9MC 1PX4A 4NRYB 5ANMA 5EOQL 4WWKB 3SDCD 1SEBA 4OKVB 1PQZB 2E7MA 2F5BL 3GM8A 2ADIB 3DUUB 5CZXD 3V8CA 5J4MA 2NX5A 5C08E 4BFIB 3NCYS 1UZ6F 2HA1A 1Y18A 4L3AA 2HFEA 4I77H 4QT5A 1KENL 1LE5B 2LTQC 4PJ9D 5F7FA 2PETA 3LSOA 4GQ9H 12E8H 3Q5YA 8CGTA 1X4ZA 2YD1A 2YN3A 4M7JL 3VXPB 3ESUF 3F7YA 3I6KB 4ZG1A 1VFOA 4BJLA 3MBEA 5FUZH 5JMRA 1F42A 2YXMA 3MLSL 2X4TB 3MV7A 4MA1B 1QZ1A 3BZEB 3EDEA 4Q0XH 3MQIA 1KB5B 2Q3AA 4PP2B 4F2MA 1P1ZA 4MJ6A 4LLYB 4P2OD 4BH8B 1K8DB 4YC2B 3HB3C 2Z35B 3B9DA 4O5LH 2RFXB 2AJSL 2VDRH 4GKNB 3AS3A 1INQA 2RFXA 4Z6AT 1RU9H 35C8L 2GJ6D 2DIJA 1UJ3A 2P5WD 1HKLH 4XBEL 5E2UL 1K6QL 1H3PL 5I30H 4B7LA 5C0AA 2XPGA 4FQHA 2D4DA 3CXHJ 2IAMD 4YPGB 4YGVA 3X14B 4L4JA 4LLMB 2CGRH 4GKSB 1EMTH 4LLDA 2X9YA 5T1KA 3VXPA 5A2FA 1ZHBB 1PSKH 3MO1B 4KKCC 3LSOB 5GSRA 5DVLA 1FHGA 3CH8A 2DQTL 4K71C 4GW4A 3QEGL 2Z8SA 4YDIL 3UDWA 2Y9RT 3OR6B 4Y88A 4DUXA 5TQ2L 1LD9B 4JFDE 4LHJB 3QI9D 2Q86A 4LPTA 4MQXC 1M1SA 2BC4B 4OGZA 4LCUA 5DRXB 1MWAH 4R2GB 1REIA 1NCBL 4IMKA 2NTFA 4HMCA 1C5DA 4NUGH 4M43L 4LQFL 4PJ9B 5HHOE 1OP5H 4X7TB 1XGPB 5IMOA 3OB8A 1J1OL 2D7TL 2QSCL 3L9RA 1NCNA 2OP4H 4J6RH 3U0WH 1XEDA 2R0KH 3F7QA 5JUEH 5DHXB 2UV3A 4XP4H 4QHNB 2XRAH 4HFWA 1JZ3A 4R4FH 4CMHC 2NY5H 1K85A 2F8VA 2EDWA 4BFIA 3ORJA 4YDLB 1X5XA 5ITBL 4RCAA 3TO4A 2X7LB 2BY2A 1TPXB 3OKMA 4DOHE 4RWYH 3WFCH 4V2CB 3U7YH 2HFFA 4M8VA 4IRSA 4KKAC 4Z7UA 3BD4A 3WBDA 1CDIA 5MENA 3CDCA 3BKJL 1KCUL 2Z31D 1A7PL 4WUUB 1NLBL 4YIQA 5DJ0B 4DGIL 3FO0H 2Z92B 2QKIA 4X8JB 4KJPC 5EZIH 4XPFH 4KVNH 4PFEA 1WTGT 4OGXL 3FO9B 2WNGA 3DTXB 5C1MB 4NHUA 3CVHB 3QP3A 4LCIH 3UTPE 3JV4A 4YO0B 3CJJA 4YWGL 5KSVB 3UJIH 5EC2B 3GHEL 5EBWB 3QUZC 5BXFA 1PKQA 1GOFA 1TFHA 1W72L 5F7EH 3T3ME 3M8OL 1OPGH 2PO6B 32C2B 4PJHE 4XVTL 2VLJE 1J9CT 3DGGA 2AJYL 4G6MH 4AH2A 3I02B 1U3HD 1U8OA 1Q9KB 3I75A 5DFWH 3QUXC 5IHUL 3O4LD 2AGJH 4UOJA 5JMOC 4OJFH 2MNUA 4HQQH 5E9DB 4UILH 1J1XL 1KIUA 4S1RL 3INUL 3AS1A 2G75B 2ZPKL 4JQIH 5EZOH 1ZHKA 4JKMA 4NHCH 3RWEB 1WIOA 3QAZB 1KNOA 1XGRA 1TZIA 5J11B 3SGJA 3QUYD 5C0AD 5KN5B 2YA0A 4P9HC 3LRSB 4YBLC 1T3FB 4LHUG 1VB9A 4P23D 2EDYA 2KBGA 5JR1H 2J6EL 3CPLB 5DLML 1VENA 2OTUB 1TJIH 1MHPL 1JGUH 2DKUA 2AJZB 4KZEL 3RY5A 2GSGA 5DF0A 3QXAB 1NGXA 3DO7A 1NSNH 1JCKA 3O4LA 5JZ7C 4OCWH 5FF6A 1I3RA 1RIUH 4PJDB 1DVFA 4LEXL 3L5IA 1T6WA 5C92A 1OSZA 2B2XH 1WZMA 5DR5L 2OI9B 1A64A 3KYKH 4KKBD 1IRAY 2DTMH 1OVZA 5F44A 2J5LB 1FIGL 4YXHL 2ZUQB 3WL9B 1IFHH 2ICWA 3MV8E 4OGAD 5JPNB 4HKZB 1J1PL 4FQCL 3OG4B 1W8NA 4XMLH 5CEZH 1BZ7A 2VXTL 4QXGL 1QSEE 3WS3A 2K7QA 2J8OA 4C58B 2IBGA 3IDIB 2ZZUT 4Y1AB 5E4EC 1MWAL 3BPNC 4LPYA 1L7IH 1FSKB 2C4XA 3IFOB 4EDWH 2VXVH 4TQEH 3MRHA 1NC2A 1J0ZA 2DQEL 3VG0L 5SX4I 1S7UA 1T21B 3LKOB 4Q9BA 3GJFB 3EFFA 3PHOB 2GSIA 3K2MC 3LKNA 1P4IL 4KUCD 2ORBH 4A6YH 1SJEA 4U1SB 3PGFH 4KRPD 5DVKA 1B4JL 1HHJB 1RZ8B 4LCWE 1SY6A 3PWUB 3LKPB 2X1PA 5HYIA 2FJGB 1HHKA 4CVUA 3BPCA 4R7NB 3VMNA 4U4BA 5ITFB 5F6HI 3ARFD 5MHSE 4WUUE 4MZ2A 4PLOB 1B90A 3HR5A 1M7IB 4U1HB 1W72B 3LEYH 3Q6GH 5AG9A 4LDLB 1E4KA 5GHWH 4OGYH 3D3VA 4YXLH 2FX7H 3UBXG 3X3FL 1T1YB 3TNMB 2PTVA 5EH1A 2FB4H 3LD8B 4GSDH 1A4JB 4LBEB 1DSFH 5DR5H 2NLJA 2H8PA 2QR0B 4ZS7H 3WEXA 1GGBL 3PHOA 1A3LH 2HN7A 4LVHB 1BJMA 4AIZA 4YDJA 2VLJB 5D93C 2EYTA 4LAQH 1T21A 3LKOA 2VMFA 2DQFB 3OXRA 2C3VA 1PZ5B 4HC1L 4JN2B 4LSSH 3SKOA 5C08D 3QYCA 3EYVA 3MOAL 3W9DA 5D71L 1TZHA 4L4TE 4LU5L 2EXYD 3CK0H 4YBQD 5EU6A 2PYEA 4MNGA 5E56A 2DICA 2H9GA 3GMMA 1T20A 1OQXA 4FXGA 4XCNB 3O3EA 2AI0H 5DJZA 1DJSA 4HGMA 1INDH 5MENB 5F7LB 2O5YL 4RMSA 5DZOA 1VACB 3WJJC 4DN4H 5D2NE 1RJLB 3O9WB 4WO4D 4YZFF 4OI9A 3VXTB 3RVUD 3VXUA 3QFDB 5DQDH 5SWSE 3DARA 2BDNH 3ZKQD 1PY9A 2XKUA 1EA9C 4ZAKC 3HZKA 3GKWH 1ADQH 2ZCLH 3TFKC 3THML 4F15B 2JK5A 2YHGA 4PJDA 2XA8H 4C54A 5LBSL 3HAEG 4F9LC 4MHHI 1QLEH 2UVEA 3DV4B 2DQDH 4NN7C 4AEHL 1I3UA 5KAQF 3TV3H 5T5FL 1BFVH 1C08A 4Y1AD 2RIKA 1BVKA 2VXUH 5TE6H 3QXWA 4F7CB 2VO5A 4HFUH 3ZL4L 1MCNA 1KN4H 4HGKC 4FQXA 4MYWB 3H0TB 1UXWA 3GFUA 1KBGL 1NMAH 3RHWK 3GHEH 4OSUL 2VAAA 4RGMB 1IAMA 3T2PA 1MWAB 1B0RA 2IH3A 3LZFH 1LVEA 5ADPH 4NM8L 4NC0B 4QRRB 3W11C 3P9LB 2D0HA 3F5WA 2Z8WC 4PJFB 4AEIL 3BX7C 4IRJC 3C60B 3HE7A 2VXSH 3A6BL 1DQLH 2BNRB 3W0WD 1P2CB 3VFWA 3OAYH 2V17L 4QYOB 3VFSB 4JPVL 4LLDB 5T1KB 3VXRA 4JDTL 3K8KA 4FA8A 3HAEA 4NQDA 1T0NB 2ICES 2B5IC 4WI9A 4JJ5B 3AREC 2A2QT 4U1GC 4LCWD 4HXBH 4LARL 2P5EB 1XR8A 1WV7T 4WEMB 5TE4H 1MCPL 1EEYB 2R69H 3UPAA 4KVCL 1RULL 3ROLB 2IQAA 5T5NG 3BHBB 5AEAA 3DVNB 1LGVA 4GFTB 4OGXH 5E6ZA 4YBLB 4PRHE 4TTGA 5HGBB 4U7SA 1OAYL 5EPMB 1LO5A 3ARED 5IMLA 4F2MB 4LIQL 4WW1A 5DK2A 2NYYD 2HT3C 2HJLA 1A4KB 5F3BA 2VB5A 4KJQC 1A6WL 5K9OB 1HHIA 4MB4A 1KB5H 4PJBA 2FNBA 2VIRA 4QLRA 4L8SC 3RVUC 1OW0C 4XVJL 5HI5D 1DTUA 5JHDD 4ALAH 1BF8A 4WO4C 3I50L 2X42A 4PJ7A 5FYLH 4OZHB 1WZ1H 1R3KB 2NY1C 1MCOH 4HMEA 5DURB 1OCWL 2YS4A 5E8OB 1B6DA 4RRPG 5D7LE 2ENYA 2HFEB 4FZEL 3G5VA 5HI4D 5GS0L 1G7JA 2Y06H 2Y72A 3RZCB 4IDJL 3C9NB 2Q20A 4S2SB 3WN5A 4L4VA 2LVEA 3REWB 1X5GA 4ZPVB 4GUPB 1TIUA 3U4BH 2JCCE 4Z7OF 3GNMH 5TDNA 4E42A 1OOAA 3TIDA 1TVHA 3H7BA 1IJ9A 4OV6F 1Z9LA 1WTLA 3D1MC 3MCKB 4NT6B 1NANH 1UACH 4LAQL 5T3XL 3VGGA 1WT5A 5SWSD 4G6JH 1PEWA 4P59L 1VKXA 1QFWI 2R1YA 1VPOH 4OCNC 2AEQH 4P2RB 4AL8L 1K2DB 4OAWB 4X83A 2QADD 5B8CC 4N5EC 1D5ZB 4YHNA 2Q86B 4F7PA 5AYQA 2V6HA 3MFFB 5B22A 4WENB 4EN3B 5DHYA 2VN4A 2APWA 1J5OH 1MEXL 2XWBB 5I75B 4LEOA 4BH7B 2WP3T 1QD0A 3S96B 1EZVY 5HPOA 3BP7A 4ZUUA 4RAUA 5CLTA 5ABDE 3QUMB 4JAMB 3I6LD 3T1FB 3OF6D 3MGOB 3PL6D 1E4JA 4HJ0C 3C60A 3HE7B 4G7VH 4KPHH 3ILQC 2H45A 4NFCA 1D9KA 2H32H 1U8JB 4QTIH 4TQEL 5EUOE 3U7WL 3QNYA 1K5NA 5DYOB 1R3LA 3GB7A 1G0XA 1G1YA 4EUPH 1RZFH 1I7RA 3KPRB 1RFDH 2DI8A 3QFJA 4O58H 3QCTH 4QOKB 4ORZC 5GS1C 2EC9T 3CFEB 3QH3A 2E9IA 4IBLT 2LAAA 4J1UA 5CJQL 3QUXB 5DD3L 1S9WB 1M7DB 1U8HB 3NCCB 2GEEA 5EFIA 4MAYC 4OF3A 3WFZA 1P4BL 1YEEL 1Z9OA 4GO6B 2ESVE 3OF6A 5IR1B 5I74C 5IVXB 3NIFF 4QOKE 2ZUVA 4C4KT 1QKZL 2YPLA 4XNYL 5DUBA 1MF2L 1IGYB 5DWUL 5J11C 1B2WH 3LQAC 4LF3B 2FATH 5IG7A 4KKNA 4E42B 1I3VA 4HX1A 3MACL 5ILTL 1AJ7H 3WNMA 1J12A 4OZGA 3HS0B 4PD4J 4D8PB 3G5XB 5SX5K 1T1XB 2D7OA 3L3IB 4LGSB 1S9YA 1E4KC 1D5XB 5KZCB 1E28B 1VEOA 3V0WL 1AO7E 1A6TA 1IAOB 2WWKT 2QTEA 5IBTH 3ULVE 1MRFL 4PJ7B 3VXOA 1ND0B 1JVKA 1NCDH 3OKNB 4MX7A 4JM4H 5F1KC 4J3UA 4M62L 4U05A 4Z8FL 3D18B 3CXDH 4FFZL 2P8LA 3S98A 4U1LB 5J06A 1L7IL 4QHLA 3GK8L 4MS8C 4JKWA 4M93B 1IC5L 2KQNA 1GHFL 4OCRL 1U3HA 4Z7WB 5DVOA 5EO1B 3C08H 4RMWA 1K4CA 4JQVA 1C1EL 4MJ5B 3L5WA 4QTHA 5AG8A 1KTLA 1SEQL 3BEVB 2P7TB 3LRGA 3T4YB 5F3HA 4TUKL 4GKOA 1SBBA 4HUWA 5I6XC 5FYJH 4YPJA 3U46A 1LE9A 5CUSL 1AQKL 2HWZL 3VFTA 4TVPL 4Y16B 5F93C 4E5XA 2HJFA 4W4NA 5D7IF 2FZ3A 3HPLB 2CKBH 5GS1B 4M7KH 5ADPL 2IBBA 2X4RA 4YHLL 1YN6B 3TLRA 5C0BD 1IAKA 1XGYL 4W81A 1OHQA 5J57B 2UWEA 3IU4H 3KPPA 1FFQA 4N0RA 5LG1A 5F7NC 1NH6A 3IJHB 4CU8A 3NPSB 1QSEA 2VDLL 4QHKJ 3FMGH 2FHFA 3GI9H 4YDIH 4HG4K 4HIXH 1OM3L 3LKSB 1HSAB 2FDBP 3DVIA 3ZE1E 1ZA3A 5FF6B 3WCYA 3BPOB 4GW5A 2CH8A 3SE8H 5FECA 3U83A 1S7TA 1L0YA 1X6LA 4PGCB 1H9VA 1NCBH 2B1HH 1FN4B 3ESVF 5BRZD 4Y4HD 5HYSA 4BSJA 2UYLA 3O45A 3MFGB 4PJBF 4EI5A 5F7UA 4TNWK 3OSKA 3RWHA 1FVEB 4EI5D 5J9PB 2XQYG 1Q72H 2ZG3A 1ETZB 1IZKA 3O9WA 3Q0HA 1EVUA 4HT1H 2VABA 5L7XH 1CFNA 2EC8A 3X3FH 2LQRA 4FQQB 4PJEA 1F97A 1S7XA 5FO9A 3L6FB 1PYWB 5IP4A 4M48L 4OUUB 4M93C 1DN0B 1AR1C 4HS6A 4ODBD 4DGYH 4Q9QL 1U58A 2NY6C 4LSTH 5EOCJ 4C56E 3RGVA 3RVVD 2EYTB 5E99L 3T8XB 3CLFL 1JRHH 2H8PB 4L8SA 2XFXB 2GAZB 3S97C 5L2JB 4GBXA 3LS5L 3LOWA 1Z0NA 5HYFA 2R0WL 1R24B 4QRSB 4NJAH 4LLQA 5C9JA 5B39A 2HG5B 1C12B 5FDYA 2QQQA 2BOBA 5HGAB 5ACZB 1P5VA 5I8EB 5JIPA 1N5YL 2IPUK 4U1HA 2PR4H 4APQB 2AQ3A 3O41A 3F58H 4NWUL 4P2QD 3H3PH 4XZUA 1PBYA 1DUZA 4NO3A 4WW2B 2GT9B 3LKPA 4Q58C 1RQ5A 3MV01 1S7SA 3ULUC 1P4IH 4PTUA 1G7PB 2EDXA 4TULL 4OCSL 2VABB 1U8MB 4DCQB 3RPKA 3IDJB 2X70B 5TDPA 4GG6A 2NW3A 2MPAH 1I8LC 4NO5B 1R24A 4ZXBB 5K9KA 4XBPA 1KCSH 3W9EA 5GJTL 4R8WL 2P48B 1AFVL 5BMFL 1ZT1B 4ODSH 3BN3B 4U1NB 4QRPE 1KIPB 3L1OL 5E9DE 2QQLH 2GK0A 1UQSA 3FCTB 5IMMA 4OF6A 3MODH 4OFDA 1EMTL 4NN5B 3AVEA 3O3DB 3QJFB 4F9PC 3WL9A 1CFTA 5KZCD 3VGDA 3NGBC 4GRWE 4F57H 4FZEH 5IQ9B 1XIWC 2JELL 2R29H 2W0KA 1SYVA 2OTWA 1MELA 2APBA 4DQOL 1MHEA 4ZOCA 4ODTL 4P2CG 1KJ2L 1Z9SA 5MERB 5I1DA 3QG7L 1FPTH 4LCCA 5FYKD 4OCWL 4I0KA 3HC0B 4KJWC 1AIFB 5EU3A 2NCMA 2YA1A 4M02A 2YXFA 1I7TA 4OKDA 1SHMA 1I3RB 2LU4A 4XP5L 3HC3H 4JM4L 3W39A 4MJ2A 1EZVX 2UYLB 4ODUB 3T0VA 1KLUB 5MI0B 2OL3A 1IC4H 1D6VL 5CZXC 5HDLA 4XAKE 1U3JA 3BGAA 1UACL 1CK0H 5I71B 1KTRL 5BQ7A 2B1AL 3V0VB 3TF7C 3WDIA 1PZUB 3VFTB 2DQIL 4PP1C 5C71A 4HIJA 4DW2H 2BK8A 4X9FA 4MLSA 3FO2A 3K1KC 2I60H 3RX5A 2CQVA 5T33H 5KW9L 3BP6A 5KJRH 2VXQH 4FMKA 3QIBA 1KT2A 5F70A 4MDJA 4B0MM 3MLZL 1N0LA 5IEKA 3VA2C 4JDVA 3V6BR 1ODAA 4DKFL 3PWPE 4JG1H 4KRLB 5A3ID 4HFUL 1EHLH 3NCJH 1BFVL 4ZUVA 2WQRA 3FRUA 5IB5A 2VDQL 4TSBL 8FABB 4OM0L 3CCHA 4Z8FH 2CDFA 2F74A 2FLBT 2Q3ZA 2AXFA 3D39B 4XB8A 5DEGB 3RWCB 3S35X 3DUSA 3GBNL 3ARQA 4GRWF 1PKQB 1TQCC 1FBIL 3VG9B 5FA3B 3R1GL 5FM8A 3CUPB 1FL5A 2ARJQ 2YMXH 5B3JE 3ARFA 2ZSVB 4HUNB 5KOVC 3L95A 1J88A 5F9WC 5EWIH 3S5LA 5IHBA 4EBQL 1J8HD 3ELAT 4ONFH 3E6HA 5I17A 2BSED 3T08A 5JPMA 5IJVB 1IVLA 5EU6D 3W5MA 4H8WL 3BKMH 1NCCH 2X4UB 3KJ6L 4JGUA 3KYMB 4PGEB 4HUKB 2B7DT 4MQTB 1YEFL 3WIIL 3NA9L 4NRYA 3KYOB 1SY6L 2ZSWB 2P49B 3MOAH 1KIRA 1W0WA 2HWZH 1J7VR 1JK8B 3H3PL 4X8XA 3KNBB 1JV5B 3T1WA 1EO8L 4R2GD 3AAZB 1KJ3H 1Q94A 4JHBA 3QEGH 5FHAL 5GXBB 3MA7B 4MQXD 1S9YB 3MACH 3SGEH 4WHYH 3RU8L 2I9LA 4MSWA 1DBBL 4MAYB 4M1DL 3QIBD 1MPAH 4QRUA 3V5KA 1A7QL 4JO4H 3HRPA 5CJ5A 5ISZE 5FA4A 1UG9A 2HH0H 4OZGB 4X6DE 3N1FC 5DHVA 2DAVA 5EDXA 1AFVH 4KKCD 4WDIB 5C86A 5IG7B 5C7XL 4WFGE 4CAGA 1PLGL 5CP3A 2PO6D 3O3UN 3KHQA 3DX9A 2QQLL 3WXWL 1H8SA 3VD9A 4NC1E 4ZUWA 3OPZL 4DVBB 1D9KB 4PJ5D 4ZS7L 4Q6IC 3GIZH 4GW4B 4LGRB 1FVDA 1FFRA 4R6UA 1XR9B 3BKCH 4ELKB 1ORSA 4PGDB 5D7IB 1MFCL 2I26N 4PIRF 4ZFOA 3DVGA 5DD5H 3GI8H 25C8L 3E8UH 3ULVL 2E7HA 3HNSL 1CD1A 4D2NA 2V5MA 4M03A 3KJ4B 3RKDD 3F58L 3MRGB 3DUSB 4NWUH 1FZMB 4X5XB 4P2OC 3UO1L 4UV7L 3WIHH 3KLAA 4OFVA 5I18H 4Y4KB 4NCDA 3ZE2F 3Q1SL 5I1HL 3BPLB 5A16A 3ZSSA 5I8OH 2XOTA 1JPSL 4DZBA 4JFED 4POZD 1NGQH 4PBXA 1UWEH 3SBWC 2XQBL 3VDBA 4JFZH 5EU4B 4YHIB 2CDGB 3SOBH 5BRZE 3CVHH 4FQPA 3LV3B 4MDJB 4ZQKB 1FZOA 3N50A 5IB1B 2BHYA 3WUWA 1CFQB 1MEXH 3LS5H 3L3OA 5LGHL 3OKKB 3REVA 3FT3A 3S5LG 4UIKH 4NC1C 1S3KL 2F19L 4N9OB 3V0VA 4JFEA 4D3CH 1E27A 5FA4B 2GJ6A 3CFBA 3WNOA 4XMKH 1ZTXL 5IB3A 2QEJA 1DBJH 4DKFH 5GS0D 4OCLC 4ONHB 3G6DH 5D2LE 3MFFA 4PJAA 2NX5B 4P57B 4YBHA 3WUZA 4CL7A 5H35A 5I1IH 3UTPD 4PY8J 2KPNA 5D7JC 1Q94B 6FABH 2JJTC 4FTVB 1FBIH 2R0LL 1I1AA 3SDXA 3PQYA 4RFEB 1A1NB 5K9JH 3NPZB 5ISZA 3SE8L 5T1DL 4U2ZA 1N8ZB 3KPMB 2YZ8A 3RY4A 1KXTB 1WZLA 3MZGB 3H8NA 4NSKB 1OWWA 3E3QC 3RZCD 2NX5E 4P99A 4YHPA 1Q38A 4XP1H 1DN2A 3RP1A 3GSNL 2GTWA 1I1CA 3UX9B 4FNLL 2M2DA 2NY2C 3OB0K 5JHLL 5TE4L 1XMWA 4LVOC 3P30H 1KJMA 1R3HB 4C83B 4TPRL 5MP6H 1A6PA 4UQ3B 4G3YH 1BAFL 1OAQH 3F7RA 1NUFA 4AIOA 2BDNL 3IU4L 4N0CD 1FNEB 3NBNA 5DTFA 4JG1L 1WBYA 3A0OA 2CMRL 4HEPG 2OXGA 3KPQB 3S4SB 2D03L 3KYNA 2C3XA 5CKGA 2VLRA 3WLBB 5DK2B 1F90L 5MEQA 3M1BB 2YPKB 2GT9A 2JKXA 3FT2B 5ACLA 5E6IB 2YSSA 1MI5E 4QKXB 2QSTA 2MSPA 4R97B 4F33B 2VNCA 4DKEH 4F9PA 4N9GB 1HIMH 1OD9A 3MNZA 5K9QG 1UB5B 3RFZC 4K3EH 4L9LA 3QULB 2E7LC 2W91A 5FOJA 5E4IA 4OF8A 5EWIL 1QR4A 2DQIH 5I1LA 2X44D 5DO2C 2CUHA 1RZJH 1T04A 2JIXD 3RKPA 5E8NA 3MV8D 4M4RA 2DQJH 3GK8H 3MMEB 5KVEH 3VWJC 5GRXG 3V2AR 2BNRA 3RZWA 4WJ5A 3VGAB 3RGVB 1TTFA 4PRBA 4O2EB 4A6YA 5L8JB 4UT9L 5IESL 3BQUD 3U0TA 4KXZI 1FLRL 3OJDB 4I3GA 4XP1L 4PJFA 4KXZH 3QCTL 2PYFB 2DWEA 4HF5H 3UJJH 2BHUA 2LABA 4DVBA 2O5XH 5HYJD 4Y8AA 4G5ZH 3G5YA 3NGBB 1KG0B 4MJIB 5D8JH 4X4YB 5EZJB 1Q9LB 1YDPA 1RPQA 4Y16C 3U0PB 1BFOB 4UTBL 5KG9A 4RFNC 1OLLA 4XCNA 3F12B 4PB9L 3AXLB 1C08B 2OMNA 3ARUA 4DTGH 2DKMA 1FORH 5I15H 4JG0H 4PJ7F 3FRPG 2AK1H 3OB0H 4RRPA 4U3CA 4XCFL 2AV1B 4PRBB 5I71C 3VXQB 4JRXD 3IXAA 1AJ7L 3PIQB 3CFIC 2X4SB 2EDLA 3HKFA 4P4KC 5KVFL 1R5VB 2FCBA 1WISA 2HN7B 4MQ7B 3MOQA 5HI3D 4DKDC 5MEND 1A4JA 4IM8A 4NWTL 5F88A 1AGBB 1AXTL 3GMPA 5CMAB 5F1OB 1J0JA 1UWGL 3LS4H 3MRIA 3C5SA 4NPYA 3RKDC 4HC1H 2FYYA 3I9GH 1YMHA 2XRAL 3VWKD 3AUVA 1KLGB 3DXAA 1DEEA 1JI2A 2VE6B 3EYSL 5DI8B 5EU6B 3U30B 3QDMD 4POYA 3E6HB 3WO4B 5I17B 5E6IA 3HCVA 2JIXA 1K3ZA 3QXUA 3SKOB 2N4IA 2GTZB 1VFBA 4OM1L 2R1XB 1U93B 3GMNB 4KGLA 2J1KA 2QSVA 1T66C 4NGHL 4UUJA 5DQ9A 5ENWB 4LAJH 2VLJA 1CLCA 2BP3A 3OX8B 4Y19B 5E2WL 1RZKH 1YNTA 2MKWA 3QG7H 4P49A 3P0YL 1UXSA 1KF9B 1H5BA 1ZHNA 2VDLH 3D2UA 5DQDL 3GJFA 3QB7C 5HVGB 3GSRB 4GS7B 4HWZB 2VL5B 4WWKC 3TNMA 3AGVA 3EZJB 1NC2B 2AERT 1NBZB 1UWXH 4L4TB 1A7BA 4NRZA 1Q9OA 1R5IB 2VQTA 4MJ5A 5A43C 3M17B 4GAJL 4UIKL 1UH2A 2VXTH 1J5OL 1DN0A 4HS6B 1AY1H 5ITFA 1U3HB 5HHVL 1UM4L 2VISB 2J88L 3FQXB 3PWUA 2P5WE 4HK0B 3R06B 3GMPB 2Z4QA 3O2VH 4MMZC 1GC1H 2P8LB 5E95B 2C7UB 2MCPL 2P4AB 1IL1B 1KPVB 4G80B 3T4AA 4MX7B 4I4WB 1ZSDB 5DGRA 2OTPA 3JSSA 5KVGH 3D69A 2EDHA 3Q1SH 1DZBA 2YD5A 5SWZA 3GGWB 4KVCH 4KI1A 1WLHA 4K94H 2DBLL 3HRZA 1D5XA 4NYLA 3DYPA 3MBEC 5CEYA 3C09C 2UY7A 1C1EH 4LIQE 1WVZA 3EHBD 2XN9A 3CFDA 4JPVH 3NZHL 2APXA 5CHNB 4OLVL 3VD5A 5IIEA 5KVMC 4MJIA 3DRTB 1SYVB 4PRPE 1IGTB 2HTLC 1JPTH 4RWHA 4ZXBC 1XZ0A 2QQNH 3ZDXF 3VRLF 1JZ6A 3MRCA 3QT2A 2PW2B 3FTGA 4MJIE 2JE8A 3FQXA 1FFPA 3GBNH 2DM2A 5I8KL 1TVDA 2UWEB 2G75A 2AV7A 3C6LD 1U8HA 5HYQA 4BM7A 1UGNA 3M17A 3DWTA 2R8SL 5GRUH 4FQ2L 3MNWA 2ESVD 2JELH 4OLZH 3EOYG 2Q8BL 3IGAB 1C7SA 4KV5F 1Q8MA 2IALA 3GIZL 1PKQE 2C3WA 3UDWC 4Y5VA 4X5XA 3O6LH 1I9EA 4JFFB 5DYOA 4LLUB 4YXHH 2H2PD 4NQUA 2Y5EA 2VC2H 5D2NC 3I3BA 2IF7A 1CYGA 2PTUA 5GSVA 3WIFA 3DJ9A 4IMKC 2JB6A 1GPOH 3HE6A 4ZFOL 2RHEA 1NPUA 2CIIA 1TCRA 4N0FA 2EO9A 3S4SA 1GC1C 1F4YH 2DDQH 3SKMA 4ZUWB 4Z95L 1GZQA 1T0MB 5HPMA 5J3HD 2DLHA 1WBYB 5BZDB 5T1DH 1K3IA 4S1DD 4KJWD 3IDNB 3PWNA 1N0XH 3BJLA 5DDHA 5F88B 5DJXB 4FTVD 2R2HB 2I60L 2CMRH 2XFXA 3MBXH 1BOYA 4TNWF 2C9AA 4XPBL 1CLOL 5BCAA 1DBKL 2R4SL 1V5JA 4U6HA 4DKAA 2YUVA 1PG7L 4P5TA 5I9QC 4UBDD 3TO2B 2F19H 4MS8D 5E2WH 5BV7H 2MQ0A 3NABH 1D3CA 1SQ2N 2WINA 2E8ZA 5CEZE 1X5KA 1XF3B 1IE5A 2VXSL 3A6BH 2FR4A 3B3IB 4OCMC 2I9TB 4YFLI 3CLFH 5ISZB 2AKRA 1K4DB 2V9RA 2KH2B 4H26B 1RUAL 4X4YA 2DLGA 1JBJA 3SY0B 5J9PA 3P3YA 4F7MA 1VA9A 2ESVA 1NGQL 3O6LL 2HVKA 5D96C 4M62H 2VRAA 1NGPL 3B9KB 3ZYJA 1UM4H 1F2QA 4NKMB 3QUXA 3O2VL 4POZC 4QXTB 1C7TA 3EYQD 5E2VL 5EORL 3B9VA 3PGCB 4IOIB 4DN3H 2VIRB 2CR3A 3VH8A 1M71A 4TULH 5AD0A 1FFNB 1QNZH 5F97E 1C5DB 3OQ3B 5ALBH 3GDBA 3TIEB 3KS0H 3V4PH 2B1HL 3O4OB 4JHWH 4RX4D 2QQKH 1YZZA 2CDGA 1GYAA 1S9KC 1XH3A 2BNQE 4FXKA 4LRIA 2FD6H 4PJHB 4ZS6D 2X41A 4IOFC 4LSSL 1A9EA 4ELME 4AM0B 4MA7L 4PV9B 4R4ND 1CFSA 3SJVE 2LE9A 4TSAL 2NY6D 4RGNC 5TQ0L 3GMQB 4HPOL 5A16B 2FIKA 5MEOB 3TH3T 4PJFF 3TJEL 2MWCA 2XACC 3MCLL 4NQDE 4Y16A 2D3VA 3BI9X 4GJTB 4PJIF 4BUGA 3NABL 4MMXC 4N90E 3OTTA 5C07B 3L7FA 2EH7H 2OMBA 2YWZA 4LLMA 1CD1B 4LRNH 5DRZB 2XG4A 4HUWB 4QF1A 2J2ZA 3S4SG 1R3HA 3C2AH 1T83A 2R29L 4KC3B 5DJAA 4UNVA 3RAJH 1XIWB 4BELD 2YD2A 1BIIB 1NAMH 4U3HA 4Z7QF 2X89A 3E8UL 3BZ4B 4OCYH 3ULVH 4WTZA 2YC1B 4H25A 3VDAA 4AM0A 3NAAH 4XP6L 4JRXE 3TO4D 2ESVB 4LCWB 3TZVA 4YEFA 1QHOA 5C0RL 1XGTB 1JN6A 1FGNL 1SVZA 2MQCA 4I9WD 3UTSA 2EIZA 4HDIA 4BQBA 3WV0A 1N6QH 1U6AL 3MBEB 4KTYA 5E5UB 1PLGH 5JW3L 3UC0H 1I1AB 1CDYA 4KRNA 1FZJB 4UZGA 4EVNB 5I1KL 1Q72L 1E6JH 1I9RL 1UM5H 4N5ED 2NR6D 4P9HL 2B4CC 4H0HB 3EO1B 3AU1A 4QCIB 5E1HB 2WWMD 1WAAF 4XNXL 1FNHA 5LCVL 3LEYL 4V1DD 1EFQA 1P7QD 4WWKA 3EJYD 4K3DL 3VDCA 2IBZX 2BSTB 5FKPB 5TDPB 4QRTA 1VACA 2I9TA 2J8HA 1IGYA 3KR3H 5GRUL 4D0BA 4P4RA 1UADC 4OFYD 3TN0A 5IB1A 1AHWA 4DAGH 3QIUD 5BS0D 2VXUL 5CUSH 4XX1E 3OHXB 3L3HA 4LLAA 4HUMB 3BWUC 3TO2A 3KLDA 2DLEA 1ZLWH 3BGMB 2CLRA 3JTTB 3JTSA 5A3IC 1PZ5A 4HJJH 1MIMH 1QBAA 3RWFA 3PDDA 3VA6A 1MFNA 4NBZB 4ONFL 4WV1B 1YMMA 5C0CB 5ACZA 1GOHA 1PEZA 1RUAH 4M6ML 5B39B 5GGRA 3DMMD 2NYYC 3NZ8B 1V3MA 4M9OA 3WNNA 1CDUA 3S7GA 3RDTB 5CGYD 4CADB 7CGTA 1ZT7A 2AXGA 3FB5A 3WIIH 2VYRE 1IBGH 1FO0B 4AIXA 4CJ1A 4P46C 4HIXL 1ZVYA 1U8PA 4PY7A 3KXFA 1WBZA 5J89A 4ODHL 2V2XA 4IDJH 3TCXA 4W6YB 1I3GL 3RGHA 5TDOB 3BMVA 5JHLH 4N8VG 1CD9B 1OAQL 2ED9A 4ZAKA 3V7MA 3F7PC 1QSFD 1RULH 4X4ZA 2IG2H 4ISVB 1MCJA 4H1LB 3IRZA 4F9LA 2UY6A 3P77A 5J7CC 4LEOB 1F6AA 1CDHA 1RMFH 3RY6C 4UMGA 4K7FB 3MRHB 4PRPA 2CKNA 5FOBB 1FNAA 4LSVL 4OF0A 2OL3B 4JANB 4HBCH 2NY0B 4P9ML 3FO0L 2W1NA 3VXNA 3HRZB 5I76A 2CLZB 3BRGC 4YHNB 2QHRH 3TJEH 1A1OA 3IKCA 3BN9D 4IS6B 1BJ1J 3HZKB 3LEVH 4I4WA 4JO2H 3SKJL 3U9UB 1LHZA 3KNBA 5IQ9A 3VXUB 1JE6A 1KIRB 3IAQA 4IJ3C 2W65B 3CU7A 3HE7C 5GS2D 4JRYE 2FRGP 1G6RL 3EOAB 3IT8D 4UAOB 3V5HA 3N1QC 4K9EH 4QHMB 5H37G 2YBRA 2F54B 4IDLA 4LKXB 5LAXB 3UTTA 2L4OA 5IK3B 2J88H 4Y5YB 1NGWB 1TZHB 3GHBL 1T2XA 5JXEC 5EU6E 1UWEL 3MYJA 2FBJL 4U0RB 4HWZA 1T4KA 2X9XA 1BD2D 4HJ0D 3GO1L 3R0NA 4QRRE 4WFEE 1I1YA 3G5ZA 1T80A 1H5BB 2VDRL 3QUYA 1TITA 2DLFH 3VFPB 1E6JL 4DQOH 1A21A 4JRYB 1KCSL 5E8PB 5DVMA 2AW2A 2NY5L 5EO9B 1KJ3L 4TN9A 2H1PH 3QQ4A 4IIQB 1AC0A 4EIZC 1EGJH 1RZIA 2X5PA 2JIXB 1JIBA 3SDDD 4MD0B 1F11A 2VR9A 3PDGA 3DXAB 2HH0L 1OW0A 5KVDL 2RBLA 4EXPX 2RGSA 4K94L 3QQ3A 4NQEE 5EN2B 1NQBA 5IEKB 1IGJA 2BZDA 1RZIB 2FJGA 4NQTA 1KTKE 3LHPH 5EO9A 3OPZH 4HIIB 5DVNA 4QRQB 4Z5RA 2C3HA 5L2JA 3QHTC 3LPFA 5D1ZB 1R5WA 3AS0A 5EA0L 1CR9L 3G5ZB 2F5BH 1ACYL 1WIPA 5F7DA 3HUJB 1HNGA 3V79C 4RGOL 5DC0A 1G0YR 4AL8H 3F5WB 2ZUWA 4X80H 2F5AH 3MSPA 4Y1AA 3AXLA 3QO0A 1OM3H 4ODUA 1KEML 1H15B 3IVKB 1AC6A 4DGYL 4Q9QH 4WI3A 1EFXB 1I7TB 1CLYL 5CJOL 1CE1L 4GRWB 1MI5B 4HKZA 1MQKL 3MRQB 5C0IB 2BVTA 2E5EA 2G5RA 4JR9L 4LLVB 3GSOB 1RJYB 2YMXL 4MD5A 3MLZH 5J12B 4RGNE 3NFSL 5EZOL 1G84A 4M5ZL 4O4YH 5GGVY 2HT3D 1VDGA 5E4EB 2CKBL 4UDUA 4G5ZL 3OJDA 4JZJC 5HYJB 4KRPB 3EYSH 3FFCD 4JFEE 1EGJL 3PXJA 4YE4L 1S9WA 1UCTA 1WBXB 3IS0X 3QIUB 4H8WH 3V7AE 1P53A 5E2UH 2J3SA 4Q74A 4FQJH 3ZTJH 1IGFH 3EJZC 4X9GA 3O2DL 4QOKD 3ZHDA 3GSOA 3WMSA 4RFOL 3MRNB 4IMLB 2OL3L 4KTEH 2NTFB 1R0AH 1NLDL 4ZTOL 1KENH 3GB7B 3OJ2C 1JZ8A 1BLNA 1LDSA 3TT3H 2HKHH 5I1GL 3BH9B 3FB7B 2VKWA 5IHZB 5DFVC 1YN6A 2ZOKA 3S3JA 1IC7L 3HPJA 4Y8DC 5FUZL 5ANME 5GS1A 2YRPA 4LARH 1XGYH 3HUJA 3T3PE 3RDTC 2N1KA 3VRJA 3T1FA 5DFVD 3MMEA 3T0EC 1LP9E 4WFFD 2VZOA 3BKML 5D96B 4P46B 5D1QA 1FZKA 4DUWA 3HC3L 3MLVH 3U48A 2QQNL 1CXFA 2CPCA 4KZDH 4WTZG 3CD4A 3D9AH 2VDKH 3CX5K 2G60H 2JB5L 3PNWA 5I16A 1S7WB 1YPZE 5SWSA 3QQ3B 5EN2A 3QHFL 1MVUB 1ZLVK 1HOCB 2DJUA 4MHHG 1BD2A 1NBYA 4PB9H 4NHUB 4YDVA 1JNNL 3QUML 4LSQH 3MROA 3KYAA 1PYWA 4JREB 4Y1AE 2GJ6E 4PGZA 5I1JH 1VFAA 1VKXB 3QQ4B 4Y4FA 2XNAB 5IWLA 3GUTB 5C6TL 1IEHA 4NT6A 2HLFC 3KPMA 5H8DA 3RA7H 3QUZD 1HSBA 2VLME 2HFGH 1I1YB 1A1NA 5FYKE 2KUTA 5FYJD 2OS7A 4P4KB 3IAPA 3OKMB 3VFOA 2NW2B 2VC2L 4S2SA 4KK9D 3W11D 4KUCF 3STZA 3TPUA 4FABL 5JW5B 2WBKA 3MLTA 3V8OA 5IB4B 3WIHA 3QIWB 2F54A 1KJ2H 2DBJA 3EO1A 4QCIA 4YWGH 3GMOA 4GW5B 4I1NB 4U1KA 1O0VA 4F7TB 5EBMA 3UO1H 4X5WB 1DQDL 4MXQC 4UAOC 4LSRH 3ECBB 1IC4L 4PJBB 3LMJH 3T0WA 5HHMD 1G7IA 3C2SA 3GMLB 4CVXB 2HJLB 4B7IA 1IILE 4QHUA 4ZOBA 5HGHB 1F4XH 2BC4A 5BMFH 2BX5A 3BXNA 3QR2A 3SJVD 4P5KB 2BMKB 3RI5F 3B6SB 3DVNA 5T1LB 3BZ4A 4DZBB 4HIEB 1SYSB 3HTLX 4G9DB 4N1HB 2DQGL 3CIQA 1NAML 2OI9C 5GSRB 2HT2D 1PX3A 3VE0A 3MV9B 4WUKL 4JFEB 4QOKA 4Z78B 3TA3B 5HYJE 1LP9A 3ILPB 5I1CL 4M48H 2EICA 1CS6A 5KAQG 3K7UA 4NQDB 2A9NH 2XI9A 3VGAC 2Y07H 2WBJD 3X14A 5KN5A 1DBMH 1U91A 5T1MB 3PABA 3DVGB 1NAKH 3WFEH 5F3HB 2V2WA 4PLJD 2FIKB 1C16A 2A9ML 3W2DL 5TE6L 1WBZB 1FL6B 4XMKL 2UZYB 1Q0YH 3D85A 1MWAA 2DTSA 2JCCF 4EDWL 3DX9B 3CFKB 2VLKE 3OGCA 1NFDB 5EOTA 1FLRH 4LFHG 2EYRA 5GGUB 5B4MC 2K7PA 3HAEH 2NNAA 4ZO6A 4FQCH 3GRWL 2NXYB 1ONQB 3SGDI 2A1WL 4FP8L 1H3VA 4Z7WF 25C8H 3AB0C 3A6OA 3QEQD 4KRMB 1D5ZA 3WS6A 1F5WA 2PN5A 1OAXL 2HLAA 3GSXB 1KTDB 2EDQA 4D0CB 4JHAH 2SEBA 5JHDB 5AYUL 2DWDA 3FQUB 1T1XA 2IAMB 3MNVB 4TRPL 3RHWF 5B39G 3MCKA 4P4RB 3PJSA 5ALCL 2BNRE 4KJYA 2NY1D 3UJIL 4XCFH 3SQOH 4Z7VF 4X5WA 2BSTA 2AKRB 4KJYB 3RPIA 4L29B 1U92A 5KSBB 2P5ED 2WBWB 2WM0A 2D03H 4XTRD 5DRNB 4ZPVA 1Z2KA 1GGIH 4OZIA 3L7EB 1CL7H 7FABL 3DMMA 4W6XB 5EC1A 1YNKH 3B5TA 4GAGH 2SEBB 1EHAA 4OZFB 2PCPA 1A7OL 4DZ8A 3BH8B 4PJ5A 1CICC 3RJQB 4W70A 3AU1B 2H6PA 3TBWB 5ESQA 4K3GA 2C4FU 4PUBL 3SPVB 5AWNL 2XY2A 4OSUH 1CFVH 3IDMB 3HE7D 5FKAB 3S36X 4P46D 4JQIL 1TQCB 3VG9C 1G7MB 1KPUB 2W9DL 2AEWA 2NLJB 3WEXB 4F3FB 3H9ZA 3MJ7A 4JZOA 4MQSB 2R0ZH 5M95B 3RRQA 1U3ZA 3AM8A 3BW9B 4HHAB 4J3WA 4FXLA 5DHVH 3JWDL 3QFJD 5D6CA 1NFDA 1GAFH 12E8L 3DLQR 4HK3J 5IJVA 3IDGB 1NCUA 5LCVH 1S7WA 5IBLC 5SWSB 3PQYE 3LEVL 3SKJH 1I8LA 4MVBC 5IM7B 2Q7YA 1LEIB 3SGJC 4HPYH 4KJPD 2FL5B 4X6EB 5DRZA 3KPTA 2QSQA 1TETH 1CD0A 1KUMA 3LDBC 1OF2B 4GKZB 3OKOB 4KKAD 8FABA 2XPGB 4FQ1H 3IDXH 3EJYC 4JCLA 3TVMA 3PHSA 3SCMA 2R0KL 3MV9A 2VUYA 3BO8B 2C4FT 3ARBA 3K80A 3IGAA 4F8QA 5MEOA 1G7QB 3VW3H 3QUKA 4HIEA 1CGUA 1HHGB 1HXYA 4X98B 4HH9A 2R4RH 1BZ7B 4GMSH 4NKQB 2IPKA 4L8CB 3RUGB 3NCFB 3WXVL 5MERA 3LB6C 1ZTXH 1D6EB 5ID1A 3NPSC 1M71B 5AD0B 5LJYH 4URTB 2N7BA 4M4PA 4HIJB 3NH7L 3FQNB 3IDYC 5IVXA 4NKMA 1A3QA 3ZLQC 3REWA 3KPSA 3QDMB 3RUGF 1UQSB 1FNSL 5BW7A 3GMOB 5BJTB 3QIUC 1U0QA 4X6BB 3U2SB 4JZNB 3QXVA 3O11A 2APVA 3OXSB 4LLVA 3SO5A 4YFEA 5SWZB 2OQJB 2WUBL 4HIHB 2V7NA 2BNRD 3W0WB 1RJLA 1K4DA 4P9HH 1DEDA 3CMOH 4OCXH 5IVZB 3DOSA 4PJCB 1XF2A 2I27N 1BGXH 4XH2B 4U7MA 5IEHA 2Z4QB 3DURA 2CK0H 1R3IL 3MLRH 1SM3H 3HNVL 1I7ZB 3MRMB 3G9VA 1L0QA 4K3DH 2YRZA 5E2TL 5FM4A 1IKNC 3Q3GA 1BD2B 5E9DD 1MF2H 1FO0H 5DWUH 3MLWL 5E9DA 1TPXC 5IVXE 3DBXB 4R9HA 3ARFC 4X9BA 1LNUA 1XCTB 3O6KL 5D71H 1R5WB 3HFMH 1EXUA 1IFHL 5EULV 1LO0H 3VFVA 3HZYA 1KB9K 4NO5A 4DFIA 1QSZA 4EJ1C 1JF1A 5BVPL 2VTFA 1QLFA 2X70A 4OLEA 2RQ8A 4KKLD 5FUCE 4P5MA 1LNUB 4XWGH 4JCMA 1KV3A 1U8QA 4Y2DC 4MAUL 1D6VH 2A6JA 1BVLB 4CUCA 1T03L 5DD1H 2P8PB 2OX5A 1ZGLM 4XVUD 1I7UA 4JGMA 5DT1L 3UZEA 5GGSB 3V4VL 2IH3B 1IM9B 4HS3B 1BVLA 5F9AC 3CC5B 4DVRL 4KAQL 4WUUA 4DEPC 3WJJA 4R90H 4JB9H 4XNZB 3JBG7 1NUGA 5CIPH 2Z93A 1T66D 2AVGA 2D31A 1C8PA 5IW6A 5F8QC 3RVWD 4JM2B 2AJSH 3SGEI 1YECL 4BFBD 2OL3H 3X11A 4CN1A 5IW1B 1HE7A 3VD3A 2NY0D 3MNWB 3V9FA 1C5CH 1F00I 3BDYL 3RTQC 1IAIL 5ADOH 3QNZB 3MUZ1 4IOFD 1CDJA 5DC9B 1GVIA 4JHZA 4OZHF 2XYCA 5FGBC 5C8JA 1BREA 4J7RA 4HKBB 1HSAA 3S35H 3O0RH 5INCA 1MFAL 3KLSA 3GI8L 1DLHB 3KDMA 3P9MB 1XF2B 5GGTA 1N2RA 1N3NB 1XAUA 2M8XA 3HG1A 4OLXL 2MCG1 4FQXC 2QL1A 3BRDA 2V7NB 1M4KA 4P23C 1YY8B 2CKBB 2Y36L 3UPCA 1N7ML 3O4LE 3TEUA 2GI7A 3IF1A 5CGMA 2EEAA 3G6JE 2VDOL 3LIZH 1AGCA 5F89B 1BF2A 4HZLA 2WUCL 5LXGH 2GCYB 4X80L 2VZUA 1IC5H 1KJVB 3NA9H 2W38A 2UUDH 5BV7L 2BSRA 5GISH 1KN2H 3RNQB 5CEZL 1J8KA 4JFOA 2QV2A 1NFIB 1YEHL 2COQA 1FV1A 1P6FA 4H1LA 1IL1A 4UQ2A 1NEZA 4TSCH 3OAYK 4KKLC 3DRQB 2L0DA 4JFQB 3FFCB 5DXWA 5JDSB 4H5SB 4AT6A 1T1YA 1TTUA 4TVSa 5INDB 3KPPB 4XPBH 2EDFA 3RWEA 1NJ9B 2VDML 1EIBA 1JFQL 1X7QB 2ERJC 1NANI 2NX5D 4ALAL 2A38A 4O9HL 5DSCB 1I9JL 1MQ8A 4K8RL 1X5JA 5DJ8A 2AP2A 3UMTA 2X4QB 3L3KB 1X9QA 2G9HA 3E3QE 5E7FA 1ED3A 2YPVL 3HPLA 4LSPL 3EOBA 1OARH 1L7TL 4XXDA 4PP2A 5D1QD 1B2WL 3OKOA 4GW1A 5CIPA 3D2UB 2Q6WA 3MRKB 2CIKA 3GBML 2I25N 1JGVL 1YMMB 3F7YB 3I6KA 5C0CA 3OKNA 4CU6A 3JV6A 1YJDL 1EEQA 2EIDA 2P5EE 1BVZA 4PJEF 3FQWA 2K9UA 5DGQA 4MGXA 2G5BA 3S34H 4E0RB 5DJCB 3TT3L 5BS0E 1LEKB 4JEGB 3S37L 2NY7H 4DZ8B 1MCHA 4QTHB 2D7TH 2QSCH 3GSUA 4AEHH 4JDTH 1MRFH 1ZVHA 2D7MA 2XWTB 2IAND 2PXYD 4LSUH 1S7VA 3MREA 4KK6D 4OKVA 2X4OB 3VFRB 4PJEE 4QNPF 3FB6A 3G6AB 5HHOA 5D7JB 3CSYA 4ZO7A 3ZDXE 2W65A 2ZWLT 2JB5H 4U7KA 1V3LA 1BAFH 1N8ZA 4OLUL 5HDQL 5IGXH 1JPGB 2AABL 4WI8A 4MXWL 3SDDB 3V95A 4PJ8B 4U6XA 4D0CA 1OTUD 2DD8L 3MTRA 5ICYB 4X9IA 1IM3B 1INDL 1IEAB 1M7DA 3IFPA 1F90H 1JPTL 2FEDC 3BT2H 1D9KD 3BH8A 4PJ5B 3QWQB 3OJVC 5IVOA 3QA3A 1GGIL 4I3RH 1HDMA 3WHE1 2DIAA 1TQBC 2HRPL 4JB9L 2IFGA 1QRNB 2VH5H 1L6XA 3QDAA 5L9DH 2EE2A 4UT7H 1QFHA 1K6QH 1YNLH 4XC3L 5A1AA 3K8MA 4RX4A 1BWMA 1T3FA 1C5CL 4GQ9L 1OP9A 2EZ0D 4HUUA 5KVGL 4HUVB 1FIEA 3DX8B 4B41A 2IAMC 1AI1H 2VLKA 4LMQE 3GJEB 3O0RL 4JFDB 5GGQL 3BZDA 4A6YB 4X6CE 4G8GB 1WQVT 3MO1A 3VWJA 1WFTA 1BX2B 2A6KB 5JXAH 1P4LA 1X3DA 2AXGB 3QH3B 3CFEA 1MCWW 5FCUH 5E00A 3B9KD 2M26A 3KVQA 2BHZA 2BSSA 1N6QL 1N7MH 5EIIA 1NC4A 2OSLB 4YPGA 1S7RB 1CGSL 3WLWD 4LPXA 5BW7C 5HDBE 1G6RA 3GMQA 4YFLF 3BKYH 1SM3L 5I75C 3D85B 3ULUL 3NFNA 1OP3K 1U2CA 1L0XA 3P0YH 1CFVL 4IHOA 4G7YH 2Z35A 4Q9RL 2BCKA 1JUFA 2BVUA 5T3ZL 4QO1A 4XCYB 3KPRE 1XFPA 3VD4A 3L3HB 5TPWH 3KYNB 2KQMA 1I85A 3LQMA 1JRHL 1BBJA 3BDYH 3TCLA 3QWRD 1TVHB 1MJ7L 4WFGD 3C5ZB 4NIKB 3MLXH 5DJ2B 2CK0L 1BZQK 3LQAL 1A6AB 1H3UA 1IKNA 4OJFL 5F9JB 3LS4L 4HPOH 4XPHH 3VWKC 4J3TA 4POUB 2ZP0T 1A47A 2ZJSL 3GKZA 3W0WE 3TT1L 3QIWD 1W8OA 2LAGB 5FIEA 1HK6A 1S8DA 2CRIA 4G6KL 5F1IA 4XWOD 2EC9U 1QO3B 5EUKB 1L9NA 1HSBB 5D7LA 1A0QH 2VL4A 4HLJA 4CNIB 5B38G 1A9BA 2AJ3A 3GSVA 3MJGX 1T89C 5I0ZA 5TDNB 5ICXB 5I74B 3TESA 3ARTA 3RVXD 1Z3GH 4YHML 1IKFH 3MROB 4U1KB 1QQDA 4JQVC 4OZGE 1LD9A 2FJHB 4FQ1L 2DMCA 4ONHA 3QI9A 3LAFA 3SE9L 3FFDA 1EEYA 1U95B 3ZDZE 1G6RB 5DMKB 3PDOB 5C0GA 1UH3A 1A6AA 5CJXC 4OZHA 3S36H 2OSLA 3IDYB 4AG4H 3N9GL 4F8TA 4K2UH 3N0PB 1A3RH 1QSFA 1FYTA 2WBJB 1ZHLA 1N0XL 2VR5A 4JVPA 4RISL 5C6TH 3OKKA 3REVB 3RWCA 4XI5C 1V05A 5CBEB 3BDXA 4WHDA 4YQXH 5D7LD 1HN1A 3SDAA 5JORA 3MV9D 2G9HB 3O81A 1C16B 3VRIA 2HP4A 5DD6A 3GRWA 5DSCA 3BHBA 3EYFA 1MCOL 5I16B 3F8UB 1X7QA 4PJAE 5D6DC 1H3TA 1P1ZB 4MJ6B 5EO0A 4GLRI 5CS7A 4P23A 5DO2D 3TIEA 2OBGA 3BZEA 3KPSE 1JRHI 2IALB 1OT2A 2RJMA 4EI6B 2EE6A 5IVNA 3BVNB 5KW9H 3MXVH 1OTSC 3VXRB 1NMBH 1MUJA 4I8DA 3CDGB 1BP3B 4JZJB 4UNTA 1JTTA 4KFZC 1F6LL 2IFFL 4YK4B 5GGQH 1ZA6A 1CQKA 1UZ8B 4XNUH 1DQLL 3KJ4C 5DS8A 5SX5H 4NZRL 4P5KA 4UV4L 4ETQB 4JRXA 2C1OB 5ICYA 1RHHB 1JZ2A 3BD3A 3G6JA 3P2TA 3SDDA 1ES0A 5T3XE 4HUVA 1MRCH 4X6CA 1DFBL 1AIFA 2XA8L 4OUOA 4OFKA 3SY0A 4TSCL 3I3DA 4LKCA 2EXWD 4FQXB 2I07A 3T04D 2XXCB 4N0YL 4WNQB 2FR4B 3CVIH 3JWDH 4I3RL 2YK1L 4BKLB 4PJDE 1PSKL 1QFWH 1CFTB 4FXGB 1BVKB 3GSUB 4MSWB 1P5UA 2H26B 1GL4B 1MI5D 2ITDA 1CXHA 3PP3H 4R0LC 1T5WA 1LEKA 2X10A 2LTQB 5GGVH 4WI7A 3PWLA 3OL2A 1J0IA 1ZOXA 4Z0BH 1HKLL 4YDJB 4HWEH 2BY1A 1DQQA 5I66A 3VMPA 3ZT5A 4XPFL 4GAGL 2YEZA 4O2FA 5F7YC 3DX7B 1CLZH 3BEWA 1BQLL 4KROB 4HCRA 3FHQA 5BVJB 1JWSA 2I5YH 2ED8A 2Y7QB 2X4OA 3TBSA 2ADGA 4RIRB 5CCKH 5I1AB 5KS9F 3T0ED 3MXVL 1HOCA 5ESVA 4UNUA 3S37H 1ZT4A 3L3JB 1H8OA 4R7NA 3WO4C 3K1DA 5FYKH 5JOFA 2UVFA 4JN2A 1J8HB 1W0YT 4LNRA 4NKOB 4TTDC 3BAEH 4FFVC 4J4PD 1PJ9A 4OF7A 1G7LA 4OFPA 4LLUA 3U36B 4Q2ZB 2X4PA 5DEGA 1JF1B 5CIPB 1CLYH 1RU9L 4PJIB 3NIFE 1U93A 3VFVB 4GBXB 3UTTE 1MCQA 1MOEA 2FGZA 5CZVH 2GCYA 3HUJE 3V6ZB 3SDXE 3VFNA 5LGJB 3C5JB 4QGYA 4Y4HA 3HR5B 5F89A 1DQMH 3G04B 5I1AA 5HYQB 5MHSD 1JP5A 4LVNC 2YUZA 4JKKA 4K2UL 3H9HB 2J6EH 5C0DA 1S5HB 5IFJA 4CBPA 5KSAC 4LGPB 4R2GC 3HNSH 4M9PA 1MAJA 3KWWA 4HC1A 2YD9A 1AGDB 1N3NA 4G42B 3FO2B 1RIVL 3KDMB 4GRWH 3U1SH 3UTSE 1BJ8A 1CTNA 5HTSA 3WXWH 4J3VA 1YYLL 2EKSB 3PUCA 4O02L 3LRHA 1EFXD 5LQBH 4MD4A 1J1XH 1XF4B 3RGVD 3VXNB 5IUSA 4BFGA 3LMJL 1HEZB 1HQ4B 4HZLB 4DVRH 3FAXA 4JFFD 2DMKA 4JLRB 1YEIH 1OAYH 3HE6D 1MHCA 4XPGH 4TSAH 4K7FA 1P6AB 35C8H 4MA3A 43C9B 3JWOL 1CGYA 1YY8A 2CKBA 5SWZD 2EKJA 1BEYL 3HZVB 1ACYH 2AJXL 2AEPH 2A6IB 2C7UA 3ZKXB 3WFBL 3QIBC 3GMRB 3CC5A 1V7NL 4NQXA 3F6LA 4ERSH 1FE8L 2R2CA 4LL9A 4X4XA 1ROWA 1EAJA 1LDPL 3QQ9D 5IFAL 4G6AD 3U6RA 1A14L 1KC5H 1U8PB 4PY7B 2VQ1A 3QEQE 4Y4HB 5JOPE 5GIRA 1B4JH 4XX1G 4AENB 3OAZK 3QUKB 1FO0A 4CGTA 4L4TA 5HDBF 2VJXA 1T83C 3O3BB 4O2CA 4TUOB 1QBLL 3BVNA 1NDMB 3J8F7 3TVMB 4E5XB 1JGDB 4LSQL 1LQSR 5GRZA 3KJ6H 3MRPA 4GXVH 4MXWH 1OF2A 4GKZA 4XB7A 2YD4A 4ZFGL 3MV11 1JNLH 5HBBA 4OZ4B 4X6EA 4TNVF 5FHBL 4BQ8A 3CVHA 2P44B 3M8OH 3H7LA 1HILB 4HBCL 3RWJA 1ZGLB 4X0KB 3VI4E 3FO1A 3ARDC 2VE6A 3QAZC 1BHGA 3MUGB 1K4CB 4PJHF 5DJ0A 4B5EA 1CZ8L 5GGRY 1BQLH 4EUPA 3KYKL 2ICEB 5LGKA 1GHFH 3BEWB 1M6OB 3W0WA 1A3RL 1G0DA 4U6TA 3N06B 1LK3H 1U42A 4J3SA 2YUWA 4O2FB 4OT1L 2AXHA 2X7LA 1FQ9C 4WV1A 5JO5A 1R3JA 4OB5L 1FYTD 1AE6H 3CX5J 3MJ9A 2VZTA 5E1AA 2DMBA 1FCGA 2GTWB 4OTXL 4WUUD 4QHMA 5CJXA 4JM2F 4EDXB 1IEBA 1FG2A 1QUNA 2XXMB 3GSQB 2UWEF 2HTKD 1QFWL 4KVNL 1AHWC 1U8NB 1BQUA 3P73B 1MAMH 2EIEA 1H0DA 4X7TA 4UINL 5KG9B 4NQDD 5C0JA 1WAAE 4MNHB 5H94A 4L3EE 2R1WA 4NBYB 1QLEL 4FFYL 1OPGL 2HFFB 3PE9A 1NUNB 4LF3A 1W72H 4Z0BL 2O61A 3HC4L 3TYGL 3DSNA 2EIBA 4KV5E 4H20H 4D9RE 2AS5M 4S11A 1LO2H 3MRBA 3MNVA 4JZNA 3MLUL 3UBXB 4RFOH 4KROD 3HNTL 3BPNB 4HXAL 2AGJL 1F3DH 1QPXA 3BO8A 3DPBA 3QDMA 4HJGA 1JPST 3STLA 1RVFL 4UDTA 5C07D 4LSUL 4G8IB 3X13A 1XIWD 4WHTB 5C07A 3B9EA 3ZDZF 4P2OA 2OP4L 1UM6L 1J10A 4Z7UE 2YRLA 1MCLA 4HDIB 3MUJA 1BOGA 1IC1A 4XNMB 4M7LL 4OI7A 1Q9WA 3LN5B 1JUFB 2NY3C 4OT1H 3QNYB 2OK0L 5KS9A 1DR9A 4WCYH 2NY0C 3LKQA 4CKVX 3VFMA 1A9EB 3MJ8B 1A7NL 4PY8I 4RGNB 3RY6A 1AR1D 3ZTJG 1OTTD 5J0BA 4MB3A 5B4MD 5JA8B 3BPOC 2HJFB 1EAPA 1BEYH 4BZ2H 3SO3C 3FRPA 5T1MA 3SDAD 5FYLD 3NZ8A 1BJ1H 1NFDE 2OJZL 2OLDA 3C8DA 2LVCA 4Y0GA 2EEBA 3OAUH 5I0DA 3EDDA 1QKZH 4WHTA 4Q6YA 4TYUA 4BH7A 4UQ3A 3H3KA 1FIGH 3I6LE 4UDTB 1AKJA 3ILQD 1LEIA 1S9XB 4J3XA 1U95A 3PL6C 5DHYB 3ARXA 4CN6A 4N1EA 3AROA 3HFML 5KANI 4RZCB 2JTDA 5C0NC 3BXNB 4HWEL 3B5GA 4JVWA 4FNLH 5DRNA 1GGYA 1HH9A 1BFTA 4L8DB 3LN5A 2ZOLB 2ATPA 3M07A 1I1AC 1VADA 5I18L 4YR6B 3WD5L 5ANMB 4RMQA 4QHLB 4IRZL 5C0JB 5E2VH 2NQCA 5CSZB 4HQQL 4YGAB 3V5KB 4F3FA 2YA2A 4DN3L 2BXZA 1YEGH 4NQCB 3RVVC 1MCEA 3C60D 3CFJA 1FG2B 5GGSY 3PGDB 3PGFL 4ZPTB 3WN5B 4LMQI 3QIWA 5L7XL 3TO4C 1WK0A 3D0VA 2XIDA 3EOTL 3IYLW 4Y4KD 4HH8A 3OR7B 4FQIH 1G7JB 3DYOA 2DN7A 4NQCA 5D2LA 4Z77B 3EYUL 1EO8H 2FGWH 5CILH 1ACZA 2WMPA 1S5IL 4FRWA 1YEKL 2O61B 1FNGA 4D3CL 4HX1B 3X3GH 2IGFL 4YR6A 3ZYIA 2AQ1A 5DJ6B 5JQ6L 1CXLA 2OJZH 4PJXF 3UEZA 1H3XA 3MREB 3L3OB 4BQCA 1T0MA 5HPMB 2WINB 4Y4HC 4EKXA 1E4WH 3MJ9L 5BOZG 1A4KA 5DEFA 3NMEA 4X6DB 4Z18A 4FFVD 1OAXH 1VCAA 1LO5B 1Y0LB 1E4XL 3DVFA 5E5MB 1ADQA 1MRCL 1OTTC 3MC0A 1RZ7L 3O8XA 4JFZL 5E1AB 1A8JH 4EBQH 3RAJL 3SDYH 2FX9H 1X5HA 4C59B 3JV6B 3KLHD 4JN1H 1NAKL 3L7FB 3WFEL 3L3GB 1RZGA 4OQTA 4ZUTA 5C2BL 4KJQD 2Q6WB 4H20L 1OAUL 5CSGA 1I3GH 2GYSA 3VXSB 5BOPA 1QRNE 1MY5A 3IDNA 5EIIB 3FRUB 1UEMA 2X40A 1RIHL 3BOVA 5FAAA 4HZAA 1UC6A 2AJVH 1K5NB 3VFSA 1JPFA 1HCFX 2ARJB 3VFMB 2NY4C 4LDOB 3EDFA 2Q87A 3NCYP 3QSKB 2MHAB 2DJSA 4GXUN 1ZGLA 4HEME 3P9LA 3AMKA 3TBYA 4M8QB 4OV5A 3JWOC 1OSPL 5KJRL 1KFAL 4J23A 1GOGA 2AEPL 3HZVA 2VZSA 4Y5VB 1YEDA 3ILPA 4Y5XB 4Z78A 5C0BA 1KN4L 3IJSA 2DM4A 3ZL4H 5B38B 5DD0L 2IGFH 4QRPA 2BVQA 4UOW0 4OBRA 4LCYA 5T1LA 1GPOL 5KSUA 2HTKC 1U2HA 1OARL 4I5BA 2D7NA 1NCWH 4NM8H 3O6FC 4HGWA 4IJ3B 2J5LC 4PJDF 2J8UE 4NQED 3SJVB 4ONGH 4P4KA 5HGHA 5EUOA 15C8H 4LCIL 4BSWA 1RUQL 1XGQB 2OTWB 3EYOB 3E2HB 1LEGB 1N2RB 1MLBB 3HG1B 1YJDH 4G42A 1XF3A 2V17H 3ULUF 1L6ZA 4GG6F 4HS8H 2J6EA 1N59A 3P73A 3ET9F 1VFAB 4YAQB 4RQQA 4S1DC 3S3PA 3ZE0F 5I19L 1IEBB 3ARDA 1S7VB 3T0EA 3ALXA 5I9QB 3CFCL 3P4NB 3GMMB 1UT9A 3NCBB 3TFKD 2R23A 4ZOAA 3T77B 4JLRA 5CEYB 3MR9A 1QLRB 4FMFA 3MLYL 2XKNA 5HVWA 2ZG1A 3Q5OA 5DUML 4JM2A 1JFQH 4U0RC 3GSRA 5DDHB 1ZLSH 3TYFB 2E9WA 2OYPA 5E08H 2X4PB 1H5BC 4ZSOE 3VI4F 4QXWA 3IJYA 1CXIA 1G7LB 1IQWH 3VGBA 5C09D 4KMQA 4Z5RB 1GZQB 4K3JH 3I2CL 1L7TH 1F4HA 1H3GA 3EOTH 3LHPL 1J0YA 4L8BB 1S3KH 5IWLC 1EV2E 1ED3B 4OD2A 4JKPH 3KG5A 3PF2A 5EIQA 1JWUA 1KLGA 3QXTA 4APQA 4U6YB 5LXGL 2GUOA 3FQTB 4PR5B 4JDVB 3CZFB 1JWUB 2BFVH 2FYYB 3P4MB 3B83A 1Q9OB 4ODSL 4U6VL 4ZSOB 1U8IA 3BPCB 2BVPA 3QQ9C 5CEXA 2ED7A 4JFFA 3G6DL 3A67L 5INDA 4ZFZB 1A7RL 3PHQA 5IJKC 4MDIA 1VFMA 3IXTB 2DQTH 1HHJA 2XTJE 4IMLA 4GRLB 1HWHB 4ZXBD 4M7LH 1SJXA 1DANU 3OJMB 1P2CA 2JF1A 3IAGC 5D5MA 1P7KA 4X99A 3IXAB 1MQKH 4ACPA 1U58B 5AZEH 4JN1L 4HBQA 3L6FA 4ERSL 1BZ9B 3P9WB 4JY4A 4Z7QE 3S88L 3HNVH 3RX7A 1MVFA 3JZ7A 1AGCB 5I8KH 3WKML 5DZNA 2J8UA 4RSVA 3ZTNL 3V0AC 2WAHA 5JW4Q 3C87A 3HA0A 4XCEB 4PGBA 1TJGL 4K55A 1RAMA 2X4NA 4HWBA 1N59B 4NWTH 1YC8A 4MAUH 2OQJA 5A2IH 2CLVA 2R0WH 5JXED 1QR1B 1DLHA 1CCZA 2JJVA 4LLWB 3RIAF 5I1CH 3O3DA 3QJFA 3HMWH 4LHQB 5BVPH 3G6JB 1F58L 3L5XH 5CCKL 5JLZB 3BQUB 3SKNB 4MD4B 4ETQA 4NYLB 2AV1A 1V7MH 1IZJA 4GRMA 3DO7B 3SKNA 4UDUB 2AK4D 2OZ4L 3QRGH 4MA1C 5F7DB 1IGCL 1BGXL 2BY0A 4BKLA 1EHNA 5J6GB 2PW1A 5K9KB 1KPRB 2F8OA 2VITA 4Y5XA 4XRCA 2I07B 2D31B 2FH6A 3MRQA 3RWDA 3R06A 2A0LD 1CG9A 4OFIA 3LRSA 2HKFH 2Q1EA 4M7ZC 4X6CB 3OKEB 1N64L 2DM7A 3QPXL 2Q8AH 2NY3B 5HGDA 5EU7E 5F96L 1OB1B 1W0VA 4J4PC 4E41D 1F11B 3MLVL 3QDJB 4OF5A 2YPKA 1NBZA 3GNML 5HD8C 2P8PA 2Z91A 5IESH 5A2LH 5CWSB 1KXQE 4N8CL 4HK3N 2ARJA 4ZDHA 4GLRH 3SGDH 3LEXA 2OJEA 4GRLA 4NJ9H 1QSFB 2WBJA 2Z8RA 4ODXB 4HIIA 2E6QA 2HT4D 2OM5A 4LLQB 5C9JB 3IXTA 5DQ9B 3MYJB 3T4YA 1TMCB 2PO6A 32C2A 4LPCA 2W60B 4JKLA 3MLYH 3QULA 4NGHH 2VKXA 1FYTE 2FEEI 3MGTB 3RJDA 3HI1A 4D9QE 3G9AB 1X4YA 5DUMH 2BJML 1ZT4B 1WF5A 4DWHA 1WIUA 3I84A 1IMHC 4P5TC 3JTSB 4LP5A 3D39E 3QHZL 1I8KB 2GW5A 5E5MA 1RMFL 1I7ZA 1EGJA 3EOAA 2AK1L 2GKIA 4U49A 3DMMC 2V5TA 2X6MA 3HI6L 1HYSC 4OLYH 1LO0L 3NCEB 2B1AH 4RAHA 5HHPB 5DTFB 3D18A 4JRYD 2AJYH 1ZHLB 5GZOC 1XGQA 1G7MA 4D9LL 2J4WH 3BKJH 3CAFA 4Y16D 3RDTD 1TTGA 3JVGA 4APQD 5F1SA 3PWLB 4ORGA 1CI5A 3WFDH 4LFHD 4I5BB 3WN5C 2PXYC 5H35B 4Y7MA 4LCYB 4KDVA 3UTTB 3AM8C 4MB5A 1OD7A 1PVHA 2FJFA 1JJUA 4QRPB 5GRJL 3B5HA 1YEGL 3ES6B 4XNQB 1CU4H 2ERJB 4LSDA 3ABZA 4YHPB 4HCRH 5IHLB 1WT5C 4LKCB 3VWJD 4MJ4A 3VCLB 3BP4A 3ARGC 4QY8A 1A6UH 3EJZD 4Z76B 1D6EA 4OB5H 5ID1B 5B8CA 2IPUG 3SE3C 1BBJB 1TETL 4PLNC 2WWMC 5L88H 1YECH 3RWIA 3QDGE 5ESAA 5L8KB 2WIIA 2ZNXA 5FXCH 1AD9B 1YQ2A 3D9AL 3QRFM 4OZIF 1MAML 2YC1A 2GSGB 1KGCE 1T7ZA 5CJOH 4UTAH 3K2UL 2O5YH 2W0PA 1F8TL 2GJJA 1S9XA 3SCMC 3RIAK 5JIHA 1S9VB 2IADA 4KY1L 5C9KA 5ISZD 4P3DA 1C5BL 4KRPC 3MRGA 5KBNC 5C0ND 5FYJE 2R39A 1UCBL 4N0CC 2FX9L 5HHNA 3OKLA 3H42L 2K3TA 2EXYC 4YBQC 3NCMA 4F33A 2FECL 4XPTH 1T1ZB 1LO4H 3M1BA 4AY0A 4YFDB 4XP4L 1RUMH 2VLKB 3MODL 3OV6A 2NY2D 1EEZB 4OQTL 3DHJA 2DBLH 4DUVA 3QEQB 5DK0B 4GMTL 1ZT7B 1T03H 4XPGL 2P47B 4R97C 5GGRB 2B4CH 3S88H 1N64H 3QPXH 5FB8A 1IC7H 1FZMA 1YEKH 3VE0B 4RGND 3PGCA 3T0XA 3RWGA 4LVEA 4MAYA 5LWYL 4NOBA 1P9MC 2YZ1A 5J56B 3PWJA 4MNQD 5DD5L 1ORSB 4UB0H 4C4KO 2CLRB 3PGDA 1IM3A 5F8RC 3PQYD 4QHUB 3VGFA 5J6HA 3UBXA 2AJ3B 3GSVB 5D4QA 1ITCA 2EYSA 4CVZB 1JPGA 4LVOB 1QVOA 4YIQB 5CSZA 3W82A 4F7MB 4D0BB 3U7AA 5HY9B 4PB0L 3VFGL 4WUKH 1ITBB 4HW6A 3TJHD 1DBAL 2ATPB 4PJ9C 3B3IA 3FOLA 1FRGL 2FHBA 4MCZB 3TN0C 1FAKT 4LHUA 2A9NL 4FS0A 1QBML 4F37K 4PJBE 4X7SL 5JPMB 43CAB 3G5VB 4PJCE 5F9JA 2NY7L 2G2RA 3WXVH 5FGSA 3VFOB 1AKJB 1R3KA 2MCPH 3C8KA 3QEUA 3QXDA 1ONQA 1TZGL 3QJHA 1R3JB 2O5XL 4Y2DA 3MV7E 3L9RB 2L7UA 4Y2DD 2VAJA 5JA9A 3GJFK 5DJXA 1CFQA 1U3HC 1I4FB 5T1LD 5LGHH 3QWOA 3WNKA 1BQSA 1RZFL 3EOBB 5KTEL 3B43A 4L1DA 4C55A 2X4UA 4V1DA 1OP5K 4ENED 3IFNH 1HQRA 3STBA 4FXKB 5FK9A 1T1ZA 1MCIA 4W68A 3Q6FB 5DJAB 2BRRL 4AMKH 5I8OL 3KLAB 1NSNL 1MHHA 4WVRA 2V2TB 2BSSB 4JKPL 4S1QL 2VOTA 1ZEAL 1IT9L 4NZUH 3HLAA 3VRJB 4UINH 4G8GA 5ACMA 3MXWH 3LKRA 4JFDA 3V5DB 1N5AA 2R8SH 3LKQB 1G6RH 3P11H 1RURH 4PJ8D 5HJ3B 3DX8A 4JFXA 5CP7A 3MRBB 4GXUM 1NGPH 4XVTH 2A73A 1DDHB 4GXVL 1WWCA 4F15C 4OIIL 5C0EA 2AQ2A 3FTGB 1MHEB 5I1DB 3QIBB 2R1WB 1A6VL 5JDSA 3CSGA 3MRNA 3DX6A 1YPZF 1XZ0B 5C7XH 1WJ3A 1RY7B 3ECBA 1FV1B 3V6FB 4J4PA 1VERA 1N4XH 1A5FH 5IMMB 1WEJH 1YEFH 1MHCB 1T5XB 3CMOL 3H6JA 4OCXL 5HYJA 5E8DL 4E41E 4AEIH 1KACB 3D25B 4YQXL 2VLRE 2WLYA 3QNZA 1D5MA 2NXZD 5JXEA 4GRLC 1MLCA 3O9WC 5J13B 1MFDL 2CD0A 3MRDB 1ADQL 1PQZA 2ZCLL 2EKSA 2IANE 1SMAA 3V4UH 1U8KA 1T7WA 2DLTA 4WU5A 1M6OA 4G80A 3T4AB 5HHOB 5D70H 5F9OL 5JOEA 1ORQA 4XVJH 5HHPA 3P9MA 1EFXA 4FQ2H 1ZMYA 1IM9D 1CGVA 2XWTA 2D9CA 2ZUSA 3UYPA 1RI8A 4JE4B 2ADFL 1QTYT 2VZVA 3RGVC 1JPSH 1DQML 1UKSA 4TRPH 3WFCL 4DK6A 3T65A 1JMZA 1RD6A 2G5BB 4E0RA 2W59A 4RISH 2C3VB 5IBLD 4U6HB 2ZSVA 4JFPB 5D5MB 2HKFL 3HI1B 3PNWB 5FHBH 3SKUD 2CRYA 4FOMA 1KCKA 5EIVA 3TZVD 4PJGE 3JVGC 4PJXB 2BERA 3W2DH 2DI9A 3PWNB 5C2UB 3VI3E 1FZKB 2IJ0C 1MJUL 4Z7NE 3HZYB 1CBVL 1CFBA 3I3EA 3CSBA 4PJGA 2BVPB 2XTJB 1T7XA 1KIQA 4WIQA 1NFDF 1G7PA 4OCSH 2CR6A 3UPRB 3DO3A 1A2YB 1YYMH 4D9RD 2GITA 1W2KT 5CWSA 3U6RB 2R9HC 5FCUL 4R3SB 5C2BH 4XVSL 4RDQG 4PPTA 1NCAH 2YKLH 4AK1A 5T3XD 3ZSTA 2DQGH 3ARGA 4RAVB 1OB1A 2A6JB 1QFUL 3GMRA 2ADGB 3FN0L 3MA9L 4PJXE 5DD3H 2AJXH 2VXQL 5L2KE 3T0AA 5E8EA 1NFIA 5AAMA 4JO3L 2IPTH 4XNXH 1V3KA 4M6AA 1EK3A 1CGWA 4XRCB 3O2DH 4JHAL 1QOKA 1GCFA 2Y5TA 1NDMA 3MRDA 1PG7X 4OIAA 4XC3H 4ZTPL 5BRZB 1DVFD 2HAZA 3WE6B 4NN5C 3U2SA 5CJ8A 1AQDA 4WI4A 4LKXA 5LAXA 4ZS6C 3VXQA 1FYHB 1OAZL 1G9NC 4UT6H 4XMPL 1UZ6E 5FO9B 5C08B 4X7DC 5JPNA 2BNQB 1YPZA 2E27L 4LP4A 2B20A 3MUHL 3UTZB 2CXGA 1DVFC 5JXAL 1YMMD 4WNQA 4X4MA 1VGEH 5I1IL 3X12B 4CW1B 4HKBA 5IFJB 3CZJA 4M1GL 1R6VA 4X4ME 2IH1A 4HH9B 2GK0B 3RQ3A 1RUKL 5HHVH 2DWEB 3QNXB 3VXRE 3LQZB 4TOYL 3CH1B 1LILA 5KVDH 4PRPB 2F58H 3SCMB 1QG3A 2MQ3A 5T3ZH 2D0FA 2GFBB 2F54D 1KEGL 1T6VN 4W4OC 1DFBH 3BIKB 1EEUA 3IDJA 3DHMA 4Z9KB 5FCSH 1RUPL 2AK4A 3VGEA 2AAVA 4PTUB 4LPWA 1I1RA 3ARGB 1IM9A 1VSCA 3GMNA 1EJ6A 5ENWA 4FN0A 1J8HA 4HPYL 4ZNEA 2XZQL 4MJID 4D9QD 5IBUG 5D1XB 3KPNA 5SWQA 2BVOA 2HT2C 3SCMD 4Z7NF 3D3VD 5EZLA 3BGFB 3O41B 4M1DH 2H3NB 1F4WH 4F37F 4WEBL 4NKIL 5HHXH 1JPFB 3BISA 4M61A 3WDJA 4UIMA 1KULA 1JWSB 1QSVA 5E5RB 2Y06L 4Y4FC 4Q9CA 1NC2D 4M3KB 1T7VA 4AEEA 3VWKA 1SJEB 1LE9B 3VFPA 4NQEB 4XC1H 1UXSB 1RUQH 1MFBL 1OGTA 1RZGB 3LPGA 3EGSA 4JPKL 4S0SD 4OD3L 1RZ7H 4K3EL 5KSVA 1G9NH 4NKOA 4Q6IB 4ODWB 3HCVB 4NUJA 5C3LD 2PCPB 4X8JA 1IKFL 1RVFH 5GS3A 2EE3A 5EC1B 4XI5D 2H2PC 3T2OA 1BD2E 2Y7QA 4PJCA 4YAQA 5TH2A 2OZ4A 2FWOB 5CLWA 4HIHA 1KG0A 2IQ9L 2H32B 3MYZA 4PLKC 5T3ZE 3FHAA 4TPRH 2P45B 3BWAB 1MLCB 4BZYA 1FJ1A 1WC7A 5HSFA 3PQYB 1R5VA 4X6BA 4U1JA 1S8DB 5MEPB 5F6IB 4FTVA 3UYRH 1S7TB 3O4LB 2X89D 3TBWA 1UZ8A 5DS8B 4DGVL 4PJAB 2HMID 1MH5A 4OLYL 1NL0L 2IWGA 4DKEL 4UTBH 2V5YA 2NY6B 2IBZY 2DB8A 3BP5B 2OTUA 4NKIH 2V7HA 4O4YL 3C5ZA 2YPVH 3OAZH 4Z95H 5DLMH 1MY7A 2UUDK 5F9DC 5EOCH 3LH2H 5DK0A 1WFOA 3PJSB 4PYHA 5DUBB 4LCWA 5SV3A 3TZVB 1GXEA 3WUWB 4JDZB 2ZJSH 4RZCA 1LK3L 4P9MH 5GS0C 3B8SA 2DWDB 4EQ2A 4AEFA 1AGFA 4PD4K 1MCWM 3EIFA 3FN3A 3VXRD 4NZTL 3VGHA 4MVBD 1FDLL 2CK2A 4XHQA 3DI2B 1OGAB 1WAAA 2AJVL 3OKLB 1B9ZA 5KTEH 3HUJF 4WI5A 2FD6L 2W0FA 2FSEA 1VGKA 4NUGL 5IW3A 1X4XA 5E94A 3BP7B 4ZUUB 3X3GL 4IRJB 3L5JA 2V2TA 5HHOD 4XNYH 3QDGB 2L7JA 1AKJD 1K8IB 5CINH 1CT8A 4KI5C 4JY5L 5EOTB 3PDOA 4PB0H 3VFGH 5C0GB 4F58H 2XZAL 1V7NH 3SE9H 1ZWIA 3ARZA 1UB5A 4MNQE 4N1CA 3AREA 1MREH 2GJZA 3U82B 4FQIL 3WS6C 2A6DB 1AD9A 4S10A 3UAJC 5KS9B 4V2BA 3BYTA 5ESAB 3C6LA 4G8GD 1CICD 5ICXA 5DEZA 5E70A 1PAMA 4M7LT 1Q1JH 1DBJL 2X1XR 4J8RB 4CVXA 4HKXB 2JLLA 4R0LA 4DK3A 5DJ6A 4RAUB 3TIDB 2VH5L 2FGWL 1IGIH 2Z9TA 4G8IA 5CILL 2H41A 3TA3A 5C09E 1F4WL 4P3CH 5JIKA 4PRIB 1RZJC 5GGTL 1LE5A 1AXTH 3UTTD 4G9DA 1HXMB 4BZ1L 1ZGLP 2I9LB 4OQTH 1J8HE