4XP4L

X-ray structure of drosophila dopamine transporter in complex with cocaine
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
b'ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dopamine transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
total genus 47
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp4L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp4L01
1J0HA 4HIIB 1RUMH 3ARDA 3L3KA 3LS5H 3TH2T 3N9GL 4HXAL 2FL5A 5C1MB 1XGPA 4GXUM 4MXVF 3H2WA 3O3AA 3EBAA 4E5XA 1A9EB 2ADFL 1KJ3H 2OYPA 2B5IB 5I71C 3V9FA 3SJVA 3HE6B 4EI5C 2X40A 3GK8L 4G6KL 1U0QA 1F11A 2MHAA 2D9QB 5D8JH 2CRIA 3N1MC 4X0KA 1INQA 5SWSD 4GRLB 4OLWH 5IGXH 4N90D 3ZZ1A 4YHMH 2UZYB 4UDUB 4FFVC 3LMJH 2VO5A 2VMFA 1ZT7B 3AY4A 5H2BB 4GUPB 2VSCA 2P8LA 4U0QB 1BM3L 3PNWA 4PRNA 1QBLL 3H3KA 1U8MA 2XTJD 3FOLB 4RBPH 2EE3A 1DQLH 2X70A 1KTLB 1AXTH 2OTPA 4ERSL 3D2UA 3QJFB 1BAFL 5D6DC 2HT4D 3MRDA 5FUZL 5INDA 4QRRA 4HS8L 4X83A 2PXYC 2X9XA 4OFYD 3RUGB 3W9DB 2XY1A 4J8RA 1YQVH 2CXKA 2XWJB 1IC7H 3C09B 1VERA 3PIQB 1X5GA 2ZP0T 1QNZL 1HKLL 1YNKL 1EEQA 2AJSL 4MXQC 3QIWC 3C9NB 2VDQL 4OF5A 2UZIL 4X4YB 2EE6A 3BZFB 3NN8A 4YHNA 1M7IA 2GI7A 8FABA 1FGNH 2DQTH 5GJSL 4MD0A 2DTML 1T03L 3ZDYE 5C86A 3QEUB 2PTVA 4GS7B 4JFYA 5KSVA 2CKBB 4LEOB 2QHRL 3GSWA 5EOTB 5DGQA 1YEKL 1SEQL 3RWHA 2HP4A 4LLAA 3DRTB 5BRZE 2BVPA 3GSUB 4LCIH 4DQOH 3LN4B 4JPIA 4RGOL 1UACH 3IKCA 3G04B 5DA4A 3PWNA 2BNQE 4JLRB 1JWSB 2VLKA 4UOJA 4X4MA 1OP5H 2P8MA 3JWDC 1ND0B 1S7WA 4K9EL 2QR0A 3DV4B 3WNPA 1PVHA 1U91B 4HPOH 4OCXL 5TE4H 2DAVA 2OK0L 2NY0D 4RAVB 3EYOA 4PJ7B 3DGCR 5IB1B 3IETB 3OPZL 5KVEH 2K1MA 2APVA 4PLKC 1C8PA 2XPGA 1U8JB 1NLDL 1JPTL 1MY5A 3RPIB 2V9TA 5E00B 3EDJA 5AG8A 3GIZL 2DWEA 1T7WA 4KDWA 1A22B 4GBXD 3VXOB 4OLVL 1KELH 1KPRB 4ODTL 2VN7A 3NACL 5DQ9A 4WV1B 1MWAH 1RK0B 5E08L 3C5ZB 1CFNA 1FFRA 5DJYB 2D4FA 3EYSH 2NW3A 3KPRD 1SBSH 3MLWL 1OLZA 4TULL 3G6JF 4XP1H 3O3BA 3KPNA 4Z0XA 1YY9C 3PP4L 1E28B 1TVBB 3MROA 1A21A 3MGAA 4Y5VA 2OXHA 3S3JA 1UFUA 2A83A 2DQGL 2XKSA 4HH9B 1YUHB 2VDLH 3O8XC 3G6DH 3BWAA 5IB2A 2BJML 3CFCL 4F9PC 4GW1A 1AP2A 3V0WL 5JMOC 1KCVL 5JW5A 3CU1A 3RKDD 1CDIA 2GUOA 4Y4KA 1EIBA 1E4JA 4DUXA 3ARBC 5HHPB 4MS8D 3IAGC 4R4BA 4NQCE 5AYUH 2YRPA 5FM5M 5IVXE 1ZHKB 1EEYB 4JHWL 5DJXA 4Y4HA 4CL7A 3P77B 3LRGA 4Z7WB 3MLVH 4OZGE 2Y07H 4E42B 1DQQB 2JJTA 4Z0BL 1KIRA 4RWHA 3KPSB 5JDSB 2VISA 4P48A 5L2KE 4FXKB 4JO3H 2HVKB 2O5XH 3ARXA 1MHEA 4U05A 1BFVH 5J06A 3CVHB 4OQ1A 3QPQD 4C4KT 1J11A 3L5JA 4AL8L 4WCYH 2CDFA 1F4WL 4URTB 5D7KE 2DQUH 1U9KA 4PJIF 3WSQH 1N3NA 1OAQL 4U6YB 3T8XB 5D5MA 3O4LE 5MEPA 1EZVX 5DURB 3ZTJG 3WN5B 1BJ1J 3V5HB 4F57L 4XMPH 1G9MC 3MO1B 4OCWH 4XCYA 4G8FB 3VE0B 5DC0A 2Z4QA 3WHE0 3B9KC 1CL7H 3LSOA 3PGCA 4L3ED 4X6EB 1WZLA 1SY6H 3KXFB 2P42B 1ZLUK 4JKPL 4R7DB 1RU9H 3NIFF 4ZFZB 5CKGA 4OD2A 5IMOB 2AXGA 4UTBL 1S8DA 3DV6A 4S1RH 3NFPA 4POZD 2Y5EA 3ARQA 4OF6A 3HNSL 3SE3C 1YPZE 5ITBH 4PB0H 3QO1B 1N59A 3LKNA 1AXSA 1ERNA 2VL5B 4KJPD 2YOCA 4L5FH 3F6LA 1FDLL 4HF5L 4KFZC 3X11B 3QCVH 4CW1B 5EH1A 1B2WH 4L4TB 4M4RA 3D48R 3ZKND 4L8SB 5IB4B 1LO2H 4BFEA 1YYML 3KJ4B 4KROC 5AUMA 1DBML 1TZIB 1NDMA 1UVQB 1QVOA 3B6SA 1WSST 4Q6IA 3UC0L 5AG9A 4JFQA 3VFGL 5GRUH 5E03A 1D5BB 1XR8B 4MZ3A 1PEWA 2V7NB 1FBIL 1UJ3C 4MJIB 4YXHH 1L7TH 3FONA 1G6RL 5C0CE 2NY3B 5SX5H 1T1XB 3GI8L 1TJHL 3P2TA 2VDPL 4JM2B 2FX8L 3NABH 4LEXH 2APFA 4U2ZA 1FGVH 4MMZC 4O02H 1BJMA 5CIPB 3OZ9L 4NIKB 1RIHH 2NY2C 2A6DB 4PJHF 1T04A 4PJXF 2JE8A 4KXZI 1PQZB 4KK6C 5C09D 3S35X 3KLSA 4Z77A 2R56L 5HGBB 3ZL4H 5ACLA 5EOQL 4CMMB 4KPHH 3KYMA 2PYED 5DT1L 1QSEE 1S7TA 4X6DE 1CDBA 1NC2A 1I7RB 3GMMB 4HQQL 4XNMA 3IJSA 1FFNB 4RGNE 3PWUA 4HJ0D 3WL9A 4NZRL 4Q2ZA 5E2UL 4HPYL 3BIAX 2EYRA 2R0LH 3IDXL 3BDYH 5DVNA 4P59L 4YPGA 1NBVH 5MI0B 2BSTB 3EDEA 4TSAL 1A6VL 1QD0A 1RJZB 5IFAL 1VFUA 4EN3A 1RI8A 4S1SL 1J1XH 5EUOA 4PRAB 1LP9E 3RDTA 5E70A 1P7KB 2WIMA 1NEZA 3O4OB 2GTWA 5HGGS 4HS6A 3KDMB 5E99L 4D0BB 1DR9A 2BDNL 4PRPA 4FZEH 4Y19A 3HC4L 1FG2B 3MOQA 1VA9A 4N0YL 3F7RA 4K2UH 3ROOB 3GKWL 4GW5B 4U1KB 4K7PH 1KFAL 3MJ9A 1N2RA 4G6AC 4PJGF 1D5IH 4U1GC 4G8IB 5HI3D 3UYPA 2A73B 2EZ0D 5GGVH 4KVNL 3CFJB 4M1GL 3WUZA 4ZD3L 2V5RA 1NBYA 5FUCC 4NKOB 4XB7A 3TC9A 5BV7H 4UIKH 1ZHLB 5HHME 3QDMB 2D3VA 1UQSB 3NPSC 1OPGL 3RVUC 1IAKA 4J12A 1DJSA 4GW4B 2P8PB 5DJZB 1ADQH 3W0WA 1OQXA 4G7VL 3PWLB 1G1YA 2B20A 4KHTH 3RZCD 3DMMD 3CFDB 2EXWC 3MLUL 5HY9A 5DXWA 1JNHB 4M7ZC 4P5TD 2DM4A 4N0CD 3TZVC 2R23B 3LKPB 1KOAA 3ULUE 3MCLH 4Y4FD 5EU7E 2O5ZL 2JB6B 4FQ2L 3CVIH 3GI9L 3KS0H 4KKAC 1YJDC 3P30H 3OGCB 4LKXA 1NFIB 2BNRD 5IV2B 3QEQB 1BJ8A 4ETYA 5JW4M 3U0TA 3B2VL 3MV7E 5K9JH 1VFAB 4R7NA 4R0LA 2X4UB 2JB5L 3BXNB 2W0PA 4H25B 1NQBA 4NZJA 5D7JB 2IBZY 3SHSA 4Y16A 4GKSA 1CZ8H 3SO3C 3TJEH 3DSFL 5DS8B 5JPMA 1T21B 3LDBC 1WFOA 4I9WE 2HFTA 1HOCA 2HTKD 2Z8WC 2COQA 5JW4R 1OB1B 2ITCA 4MA8H 1HHJB 5HYEA 5LXGL 3IXAB 3FT4B 2ZUXA 4U3XA 5DK2B 4UQ2A 5FEBA 5E1HB 1AJ7L 3HI5H 3RWFB 1OGTB 3UP1A 1IGYA 1EFXD 1KXVC 4J3TA 4M03A 1F4YL 3RI5F 1DUZA 2CKBL 3L5WA 1AR2A 3GB7B 3WE6A 2HMIC 3EJYC 4XP9H 1F6AA 4HS3A 2EE2A 4M8QB 5EU3A 1AQKL 5JXEA 1IVLA 1R5WB 3O11A 1IC4H 5JMRA 1K4DB 5EZJA 3WS6A 5TH2B 4LBEA 2XXCB 4DGVH 2Q87A 1KTDB 4NNXB 3NMEA 2DWDB 5GS0C 3SKNA 2VWEC 2HLFD 3OAZK 3MRLA 2DB8A 4X6CA 3P4OB 3O6KH 2GJZA 2VLRB 1ACYH 3QCUH 2LV4A 3T3MF 4YDLB 3L3KB 2HAZA 2MOVA 2FIRT 4MA1C 5CZVL 3VW3H 4G42B 5IB3A 1WWBX 4HIXH 3PHQB 5D1ZD 2KUTA 1WCBA 4W4OA 4RGNC 2W92A 1JHLL 4PREA 2FHCA 1NSNL 5FYJU 5H37H 4ZS7L 1F11B 1RFDH 2HT2D 3H9YA 3CLEH 1X5JA 2MHAB 1R3KA 3EHBD 4AENA 35C8H 5TQ0H 1RUKL 3BPLC 4X0KB 1INQB 2JJUA 4XBGA 4KK8D 2FR4A 4JO1H 5MENA 1CFQA 3NPZB 1RURH 4LCUA 5ISZA 4NJ9L 2VAAA 4NNPH 5EU6A 1YEJL 5GZOD 4NZDA 4G5ZL 1CLOL 3PNWB 3MRPB 3PJSA 5FK9B 2BFVL 1U8MB 2KDGA 3MR9A 4P57B 4PR5A 3L3DA 3UTPD 5C08B 3T2OA 3NCBB 1CDGA 1Q9LB 5ERWA 3MLSH 2EDJA 4DW2L 3D2UB 4BZ2H 5IUSA 3MRDB 3GSQB 4OM1H 5DZOA 4QRRB 4TVPD 1MCKA 2QSCH 1RZIA 4TPRH 1IGFH 1XR9A 2FWOA 1ZE3C 2V7HA 2ZOKA 4J8RB 2X1OA 4OZIF 1XGRA 4QRTA 3RGVA 4N8VB 4YE4L 2UWEF 4NDMB 5DUBB 3OMZA 4I2XA 1JWMB 3HS0A 5F7DB 3TO4A 2VQTA 2EDDA 4DKFH 5L7XL 1K4CA 3NN8B 1FZKA 5EC1B 1A8JH 2RR3A 1N64H 1M7IB 3BQUA 5KZCB 1BZ9A 1BD2E 4HAGA 1UZ6E 8FABB 2CGRH 2MTPA 1A3LL 1JHKL 3T0ED 5HYJD 2WQRA 1AGDB 2OQJA 2J7LA 3P0VH 5GIRB 5KSVB 1L0YA 2H41A 5ECJE 1GOHA 4NZTH 3HMWH 5I16A 4JFOA 3VXRB 4W70A 1G7LB 1OT2A 5C0NC 1OD7A 3C6LD 1BOYA 3RWHB 1CBVL 3CVHL 1Z3GH 1IQWH 2BVPB 5D1QC 4OGAD 3M1BA 3BAEL 2NR6C 1Z2KA 4JPIB 4OM0L 5JQ6H 4WJ5B 4MJ5A 3IDIB 3OX8A 1BFOA 1JGUL 4HCRH 4AQOA 4GRWB 5SX4I 1NUDA 4ONHB 1UXSA 4MJ2A 2ITDA 1FFQA 5ENWA 2QR0B 4CADA 1X4ZA 4P46C 5J3HD 4HXBH 4LCWB 4LRIA 1BVLB 1NDGA 5CHNA 1LGVA 3TPKA 3C8HA 4BH7A 4QTHA 4YHOH 4QNPF 4OCRL 1FRGL 3D1MC 3I6GA 3P9WB 4XBEH 2XPGB 5TPWL 1KBGL 1NMAH 5E6ZA 3THMH 1FNEA 4HT1H 4LSUL 1GIGL 4FQXC 3X12A 3PXJA 4GG8A 4ZO8A 4R96A 3QDJE 4ODUA 1WAAA 2DWEB 4H8WL 4QRUB 3VFOA 4DEPC 5IOPA 5D2LF 1HI6A 5E1AA 1A7BA 1B3JA 2FD6L 1I1AB 4G6FD 5DQ9B 4DGYL 4XVSL 3NA9L 4HBQA 1RSFA 1RZJC 4I0KA 3PHOA 1K3IA 3HN3A 2H2PC 2AJ3A 1M7XA 4AYFA 3VFUB 3FN9A 5BS0E 4H1LB 4XVTH 3BX7C 4Z0XB 5GSRA 1FLRH 3QIUD 1P9MA 5F1KC 3MROB 2UVEA 2A83B 4K3JL 3CH8A 1PG7X 1UB5A 3BO8A 1U8NA 2IJ0C 2B4CC 4GOSA 2DQCL 4TVPH 2I5YL 5DHYA 5FKPB 1AP2B 5DDHB 2V5MA 3UPAA 2C7UA 3ME0A 2GUOB 2WWMD 3UJIL 1D5XB 2CK0H 1Q9KB 4F8TA 3C2SA 1HQ4A 4ZS6C 5DHVH 3EJZD 4MXVE 3SDYH 3HC0A 5ILTL 4JRXD 5DJ2A 1U8LA 1LHZA 2XIDA 1IFHL 2RAMA 4HAFA 4JO2L 3RVXC 4Y4HB 1VEPA 1ZKAA 5CSZB 4MB4A 1LWRA 4JRYB 3CXDH 4NKQB 2X4QB 4C56A 2FH8A 4JR9H 3SDCC 1KGCE 3DXAA 4NUGL 3FN0L 4FQHA 2E7CA 2Z35A 2VZTA 1IAIH 2J6EH 2K9UA 3IFPB 3DNKA 3BP5A 4L4VB 1PFCA 4HC1H 2W9EL 2VZOA 2CDFB 4A6YL 4JFPA 5DD3H 1JZ3A 3GBNL 5DMGC 2IFGA 4U6XB 5ANMA 1N3NB 5FAAA 2IPTH 5JPNA 3MXWH 1NAMB 4YGAB 1E4XI 2H1PL 4GXVH 1JGLL 4LLDA 1F97A 3TA3B 2Q3ZA 4WWKB 4XCYB 2NPLX 4ONGL 2HJKB 4ZPTA 3LSOB 4WTZG 1N8ZB 4FMFA 4K3EH 4AMKL 4JKKA 4IRSC 3ZE0F 5C9JB 4HIEA 4BM7A 4OD2B 1CXKA 1S8DB 4Z7VF 5EO9A 5TE6H 2NXYD 25C8L 4WW2C 1A6UH 3NFPB 2R0ZL 1XF2A 5E5UB 4ZSOB 3IXTA 5H37G 3VXUB 4K7FB 1ZXQA 3AS1A 1JGDA 4NCC2 1YYLH 4O9HL 5EPMA 2OR8A 3VG0L 5T3ZL 3LKNB 4PYHA 1S9WA 3INUL 1M05A 1MOEA 4Q9QL 4LAQL 5CZXD 4G7YH 3NCCB 1BFSA 3T09A 2KQMA 1NUNB 5HTSA 5CCKH 1EO7A 1QVOB 4AK1A 3B6SB 5IESH 1Z9SA 1V7ML 4N9GA 3BKJL 1X5AA 1MRFH 5DJAA 3W11C 3MRRA 3ESUF 1YEHH 2W9DH 1KYOK 4MAYC 5DRNB 5FDWB 2IAND 4NKIL 1NGXA 3ROLA 2B1AL 3O2DH 1AI1L 1SJVA 3SBWA 5DWUL 5J6HA 5IMLA 4MCZB 3FONB 5ID0A 1U6AL 2C3WA 2B2XL 2WUCL 4PV9B 1DEEA 3V0VB 3U4BH 1F3JA 5FCUH 1MPAH 2Z93A 5L2JA 4PJBA 1OAXL 4LPVA 1CLZL 4M43H 4O4YH 4XPHL 4YXLL 1JP5A 5KG9B 3FFCE 4HBCL 3VA6A 5C2BL 1NLBH 3ARFA 5ALBL 4OT1H 3ZHLA 4NN5B 1T04B 2GQHA 4WUUE 2BVYA 1U8OB 5IIEB 1Z9LA 2CKNA 1GJIA 4WUKL 1TTUA 4LNVA 2J1KA 4ODHL 5JLZA 4YFLF 1CICC 2XN9E 1AY1H 1KJVA 4AH2A 4Y2DB 1F2QA 1GGCH 3WHXB 6FABH 1SEBB 3DJ9A 3SCMA 1GGIL 4WFEE 3WL9B 4WO4A 4X7EC 4P9HL 1QQDA 4HSQA 1HHKB 5JA9A 4L8BA 2AI0H 4PJ9A 1A47A 4YPGB 5D4QA 3NCEB 3N1QC 4OZFH 5FGBA 1Q1JH 3NZHH 1BQSA 2VLLB 2NW2B 2G5RA 4GMTH 1ZSDB 3S37X 4LSVL 1EEUA 3AXLA 2F54D 5EUOB 4UZGA 3Q6FA 1A1OA 3QNZB 2QADB 2GTWB 3HG1E 1ZHBB 4DGIL 4Y19B 2GJ6E 3DPBA 5J1SC 1KLGA 4P4KB 1RUQH 1TETH 3L3OB 4P23A 1FO0A 1FL3A 4R97B 4PJ5D 2YN3A 1OTUD 3FQNA 2R29L 3QEHB 15C8L 4G80A 5HJ3B 4F33A 3L9RB 4MZ2A 4JFED 2IADA 5KVFH 4ISVB 1NBYB 3P4LA 2DYPA 4OCNC 3WXVH 4H20L 3HFMH 2WINA 2NQCA 1J8HA 2NX5D 3LKSA 3E3QE 4C59B 4HUUA 2X1QA 3V6OA 5L8KB 2HT4C 2VABA 3W0WB 4NC2B 4PJIE 3GSXA 4JO4H 5HY9B 4DAGH 1WISA 5E9DE 2HWZH 4WI3A 1ZEAL 4YDJA 3OJDB 1IEAA 3OKMA 4ENED 1AIFA 3OB0H 2V2TA 1L0QA 4QKXB 4QHNB 5CEZD 1FH5L 4QGYA 3QXDA 4U6VL 2APWA 1N7MH 5KSUA 2VRAA 2HJLA 1JNLH 3IT8D 3TYGH 1NUFA 2H6PA 5J1TC 2ENSA 1XGQB 1KLFA 3NIFE 4R7NB 3QI9D 4R0LB 1MCQA 1CD8A 1QKZH 3JVGA 1PG7W 4N0UA 3KJ6L 1HILA 2IQAA 3BN9D 4GG6A 2BMKA 4GQ9H 3O3UN 1BBDL 4EI5A 2N7AA 2Y06L 1NFDF 4JZJA 5GGTA 1MH5A 3H9HB 1CLYH 5F71A 1UKSA 3DX8A 3BPCB 5JO5A 2R0WH 4XPBL 2HYMA 4NQED 2ITCB 2C3VA 2V17H 1CS6A 1KPVA 5HYSA 5FA3A 1EEZA 1EFQA 4NQDD 4ZUTB 4JN2B 4UQ2B 1U2CA 3JTSA 3G5XA 2R9HD 3AREB 2F15A 1HNGA 4RFOH 1MVFA 4NYLA 2J5LB 5C0BB 3LRSB 4AQ1B 3PWJB 2E27H 3WE6B 3V5DB 2NY0C 1T4KB 2F19H 5D6DA 3QRFM 2JCCA 2EDKA 3VGHA 2FO4A 5F1SA 4EUPH 2PXYA 3VJ6A 4MJ4A 5D72L 3H6JA 3D3VD 1I85A 4N1CA 3EDDA 4ELMA 3H3PL 5EOCH 2E6QA 3MQIA 1F3RB 4HGMA 1V05A 2CLVA 3E2HC 4GBXC 3QIWA 5DUPL 4JDTH 4KI5D 4QHUB 3VFVA 5I66A 4PJXE 4PJFA 3MYJB 4Z7NF 1MVUB 5F9JB 5IB3B 3O6ML 2PYEE 4Q74A 4TN9A 5K9QG 1F45A 4PREB 1DL7H 2AK4E 2CRZA 3Q1SL 1IKNC 3NCJH 1R3KB 4OIIL 1YN7B 2BY2A 4RNRB 3MLYH 4MDIA 4FQ1L 3VG9B 4BQ8A 3K0WA 4MSWA 2FR4B 5HVGB 2HJFB 4ZXBB 3V4PL 3OSKA 1IQDA 4LCUB 4XBPA 1R24A 1KTKE 1CU4L 4YBLB 3RKDC 1T1YA 3LZFH 2IH1B 3BDBA 1GPOH 2CMRL 2O26U 2YKLH 2NY6D 4P49A 1LVEA 1PSKH 2FCBA 1OAZH 4DOHB 4MS8C 4XPGH 1NCNA 2Q6WB 1CDJA 5CEZH 5ERWB 3U9PH 1WJ3A 1F02I 1NAKH 5C3LD 3A6CH 4LLWB 4M7KL 4YEEA 2MQ3A 2FJHB 2KZWA 1YNTA 4MQ7A 5CBAA 1IGMH 4WTXA 2VIRA 1P7QA 4Y1AB 4EEEA 4UOW1 1P2CA 3ARPA 3H9SD 1JV5A 4XXDB 1G9NH 1WTLA 5GRWA 1WFTA 1JRHH 4X80L 5TDPA 5C07E 1XGRB 4QRTB 3RGVB 5IWLC 3D39A 4WEBH 1QPXA 5ADOH 4WY7H 1KUMA 1G7PA 4WEUD 5C0GB 2Z92A 5IW3A 1ORQA 3HS0B 3IRPX 1FAIL 1I1YB 5MHSD 3ILQD 3VWJC 3QPQC 5D7SH 4IMKC 5AD0A 2QQKH 1K4CB 2E7LC 1K8DA 2A1WH 1FZKB 4UUJA 1PX3A 3AM8C 1BZ9B 2OL3H 3TBWA 7FABL 5B3NA 4YDKL 2W59A 5I8OH 1GZPB 1W72A 3HR5B 3CX2A 1HK6A 1QLRA 4JFOB 3IF1B 1X4XA 1YN6A 2J8UF 1IMHC 2A9NH 3DHJA 1Z9OA 5D9SA 1KNOA 4C4KO 4F9PA 4L4JA 2EDXA 1IT9H 2H26A 1YDPA 3GJFK 4OZFG 3RQ3A 4X99B 4MJ5B 3OX8B 2BK8A 4CDHA 1WZMA 4U0RB 2ARWA 3H0TA 4POZC 2ITDB 3ARBA 5ENWB 1R3LA 3RIFF 3M45A 5DUMH 1IGIL 5E4EC 3A0OA 4KJQD 5CHNB 1VEOA 2LU3A 3X3FL 4FFYL 5BV7C 4QTHB 3G9AB 5FCSH 3O41A 4V2CB 1A1NA 3ZKNC 4K8RH 3I6GB 4WHDA 4NKMB 4PP2B 3RY4A 4R8WL 4CVXA 5FGRA 1FNEB 4L3CA 5L8LB 3X12B 2NTFA 4GG8B 2X4SA 5JDJA 2X4NA 4R96B 4ODUB 3VFOB 4F2MA 1MIMH 1EVTC 2YSSA 1KIQB 3GK8H 3QIBC 4G6KH 4PGEA 5E1AB 4RA0C 2F5AH 4GQPH 1ZT1A 5GRVL 3MLPA 1RVFL 2DLEA 1RHHA 3HAEA 1S9YA 4WTWA 4G8EB 3GM0A 3PHOB 1FN4B 3QHZH 4AEEA 3KYNA 2HRPH 1I9JL 4X9FA 32C2B 1MCLA 4Z5RA 5DYOB 3MUZ1 1UB5B 1CK0H 5IEHB 4PJDB 4JREC 2HLAA 3MLXL 5DHYB 2VXQL 3MRHA 5IBLD 1QRND 5FUZH 5AAMA 4U1NA 2C7UB 3MRQA 4DKEL 2ATPB 2WBJD 3HI6L 4BQ9A 5JXAL 2GJJA 3T3ME 3KPPB 4PS4L 3L3JA 3BIBX 1HQ4B 1QEWA 2BXYA 4PBVC 3HC0B 3SE3A 1U8LB 3CH1A 1BX2A 4HJ0C 3N1GC 1HKLH 2A0LD 1CD0A 1A7NH 3LKOA 1IEBB 2VDQH 3W81A 2A6KA 5BRZA 5T5FH 1QFOA 1VGKB 1B6DA 5HPMA 3JTTB 1MNUH 2C1PB 5GJTL 1PG7H 5E4IA 1FV1B 1MUJA 2ZPKL 2Z35B 1KN4H 3FN3A 3MJ6A 3KYOA 1ZVSA 2F5BL 2EDEA 5BCAA 1X6LA 4IRJD 4JDZB 2N1KA 1IRAY 1MFAL 3MFFA 1NANI 1KCUL 4FFWC 1EBPA 4JFPB 1TQCB 3TEUA 2Q3AA 4L1DA 1QSFD 1UJ3A 3R4DA 4KRNA 5CP3A 2E9BA 2E9IA 4EUPG 5IMMA 3SGDH 2MCG1 1UWGL 5GZNC 4JPKL 3OF6A 4LLDB 4YDVB 5JOPE 5CSBA 4QHMA 4W68A 1OAUL 2EZ0C 4I5BB 4OD3H 4ZPTB 3CX5J 4K55A 5A16A 3E1F1 4OZIE 1YMHA 1BWMA 4ODWB 5F89A 3MRGB 4U1IB 2HG5B 2UWEE 3OKOA 5TQ2H 5KW9L 1XGTB 1XIWB 4HUVB 3V79C 3LQAL 2JIXA 2VYRE 2YUVA 1E4WH 5TFSL 1XF2B 4GKZA 3X13A 1MRDH 3MJ9L 3RZCC 3DMMC 1JGDB 1P84K 3SQOH 5EPMB 3T0EE 3NZ8A 3SE8L 4HWZB 1ODAA 1I7UA 2G75A 4N0CC 1S9WB 5LQBL 1Q72L 4Z8FL 3ULVF 4OLVH 5J11B 2XI9A 4Y4FC 1UH4A 3OJ2C 3ULVD 3NACH 4TUOA 1RK1A 1E27A 4PD4J 1U3JA 5E08H 4K3HA 3LKRA 5EBLA 1L0XA 3LPWA 4OI9A 1JUFA 1NGWA 1N6QH 4N9GB 4TTDD 5BO1L 2XKUA 1KENH 5F9DC 4KZEH 3PP4H 3MRRB 4NQCA 4JM4L 3UAJD 5IVXA 1JGVH 1SJHA 1NGXB 4YO0A 5KTEL 3SDXF 2FB4H 4XP5L 2BJMH 3S34L 1CVRA 4OZGA 2RHEA 5J6HB 5ID0B 4PLJD 2HTKC 1ETZA 3FFDA 4ETQA 5L2KA 5L2JB 2Z93B 3EZ8A 4QNPE 3QHFH 4I1NB 5DMIL 3S37L 4PJBB 2D7QA 1X44A 2AEQH 3DBXA 1F42A 4MHHG 4P2RD 4JZOA 3ARFB 3MV9D 3WIFA 1UT9A 3RWEA 3K46A 1R3IH 3ALWA 4JHWH 5F72S 2G9HA 3ARRA 1RAMA 2NYYC 3MLRL 2FO1A 4PG9A 5D2LE 4KTDL 1RJYA 3BP7A 2F53E 5JLZB 4G6ML 3Q3GB 3O4LA 1KJVB 1MIEL 3DLQR 4AH2B 1S7VA 3QEGL 3NGBC 1FIGL 4RCAA 1J18A 3BKCH 4ODXB 5GGRA 4C58B 2ARJQ 3U0PA 3TZVA 3VI4F 2R0KH 1NC4A 4UV7H 2HLFC 3T4AB 2IAMD 1F4WH 4L8BB 2DICA 4NQVB 4PJ9B 4S2SB 4NHUB 1CE6B 4ZFOA 1EAPA 3FQUA 3QUXD 3S96A 5GGSY 5I18H 3M17A 4M9OA 4OQTA 3HI1A 4X5WA 2CLRB 4LMQE 3AXLB 3PWVA 3G6AB 2CJUH 5D1ZC 4LCYB 3Q6FB 4F3FB 5H35B 1JN6B 4M6MH 3M07A 2HT2C 4JRXE 4HLJA 1MCBA 2AXFB 1AD0A 2DQDH 1BP3B 3EHBC 4AG4H 4JKPH 4S0TD 1KLGB 4OCSL 1FO0B 3G08A 1FL3B 3GIVB 4WHTA 3FQNB 3PQYD 4G80B 4QXGL 2VTFA 5HHVH 5A3ID 4CN4A 5GZOC 3CK0H 2OTUB 1CF8L 2DYPB 4JFFA 1U93B 4JHZA 4NQXA 1U8HA 3ULVH 4NO0A 5HD8D 2WINB 3QSKB 3QUMA 4YHKL 3HE6D 2F58H 1WZ1H 2X4PA 1I3GH 4HF5H 2YBRB 3CC5B 4HWNA 43CAA 5C0CA 2OJZL 1SHMA 1DN0B 1Z5LA 3RA7H 4OZ4A 4FQIL 4QRQA 3GRWL 3QUKB 4GRLD 2WWKO 3BKYH 5T3ZE 5DQDH 1IEAB 3VFGH 1JF6A 2V2TB 4HK0B 3OR7A 5KSUB 2HJLB 4M6OL 1C5BH 2H6PB 5CEXA 1QSEA 5D7IE 4X6DA 1H5BC 4N0UB 1YECH 5I71B 1HQRA 5GGQL 1HILB 2BMKB 3T0EC 4MNGE 4J1UA 4P2OA 4JZJB 1MH5B 1S9XA 4ZOAA 5LGKA 3F7YB 4B7IA 4I77L 1U8QA 1WEJH 3DX8B 1II4E 3IDNA 3A6BH 3BW9A 4OGAC 2GKIA 4D9RE 2C3VB 1SYSB 1CGVA 2X6MA 2JJSA 3CUPB 4Q9RL 5IMKB 1KPVB 4WI8A 2A77H 2LVEA 5HYSB 1N6VA 5FA3B 1EEZB 3GSVA 3JTSB 4ZO9A 1QO3A 4HQQH 5ACZA 2EH7L 2P48B 1LP9A 2Q7NA 3HZKA 5IFJA 2V5SA 2IEPA 5J3HC 3F65A 1E6JL 3P9LB 5EZIL 3MCG1 1LNUA 1XF4A 4HWEL 1AHWC 3IDXH 5F1OB 2FO4B 1MCSA 4JG1H 4WFFD 3TBYA 5FDYA 3NAAL 4AIZA 5I19H 3WUWB 1N4XH 5GGSB 5EBWA 5HYQA 2B7DT 1R0AH 1ZOXA 3MZGB 2EC9T 3MOAL 3SKOB 4KRMB 3D25B 1T5XB 3ALXA 3REWB 4LCCA 1QPPA 2CLVB 3DX9B 3OG6B 1VPOL 3L3IA 3UYOD 4NGHL 2BDNH 5KVGH 4MA7H 5ADPL 3ARGD 4GAFB 2CDEB 2VDMH 5MEOA 2L0DA 4XVUD 3BPNB 5JNYA 4FP8H 2P5WE 4KVNH 3SE4C 4ZD3H 3QIUC 1LEIB 5F8QC 3DHMA 3F58H 3K8LA 4RFEA 1JI2A 1WZKA 3QULB 5CJ5A 5D1QA 4ZOEA 5I6XC 5DI8A 1MEXL 4HGWA 1R24B 3MV7A 5I30H 4NHCL 2IPKB 1T1YB 3IYLW 1P4LB 3MLUH 3C5ZD 1J7VR 5I75C 3SJVE 4XP4L 5HGAA 3EO0A 3BESR 2F54E 3EJZC 4P46A 3FRUA 3O9WA 1CL7I 5JR1L 1YNTB 4MQ7B 2FECL 1Y18A 2ZUSA 5CBEB 1P7QB 4ZUSA 1Q0XL 4LP4A 2X9WA 4FNLH 5HVHB 1MJ8H 1A7OL 2D7TL 3RNKB 3B2VH 1OGAB 1F90L 2VXSH 2Y4SA 1EHLL 3EOBA 3PGFL 3BEWA 3W2DL 4LHUD 1OM3H 2JB5H 3K2MC 4M6AA 4FQXA 3E6FB 4J4PD 1G7PB 2Z92B 1CG9A 4APQA 1ORQB 4XNQB 4M6NH 5C0AB 4Q0XL 4F7TB 1WIPA 2BOCA 3U4EA 4F7EA 3PDOB 3RWCB 1J12A 1BIIA 4UT6H 1YNLH 3TBWB 4MX7A 5AZ2L 2AV7B 1CGSH 2WSKA 4HH8A 4I8DA 1U8IB 5E5MA 1CIUA 1W72B 2W07A 3WFCL 3KPSD 5BJTB 3TYFA 5D2NC 2ZCKL 3NTCL 5IFHL 1A7QL 2ILLA 3C08L 3KYKL 1F8TH 1KNOB 2FLRT 2CKBH 3QYCA 3KPOA 3OKDA 3JBG7 3VDBA 3T2PA 2B39A 4YNYA 3LAFA 4WDIB 1KJ2A 3WCYA 2NXYC 3TN0C 1HH9A 2YD3A 3BYTA 1DLHA 1MI5E 3ARBB 1E6OH 3IFNH 3NCFB 3SN6N 3N50A 2P43B 3QPXH 5DURD 3T3PF 3EO9L 1C7TA 1H15B 4MA3B 5DVOA 1S7UB 2BRQA 4TOYL 1NFDE 4EOWL 1NJ9A 2Z8RA 5CZXC 2NZ9D 3L3GA 4KQ4H 4RFNB 4OCYL 3MV8E 2FSEA 4L3CB 3RKPA 2NTFB 5C92A 3KLHD 1FNFA 2Y36H 3IJYA 2EDTA 4F2MB 1UENA 2YSSB 4ZS7H 3WFZA 3MFGB 5DD6A 4PGEB 2JLLA 4LRNL 4WFHD 1G7JA 2APXA 3O2WH 1CGYA 1ZT1B 4KXZH 4F7MA 5GRJL 1KSRA 5E94B 1BBJB 3GSNA 1P5UA 4PRHB 1A5FL 2PTTB 2UYLA 4LLQA 1HXYB 5E2VH 3U9UB 2VSDA 1UM6H 2OR9L 1TZGH 3FO9B 4UI2A 5HPOA 3MLZL 4L4TD 4R3SA 4UINH 4Z5RB 5L9DL 3BEVA 1C1EH 5FO7A 3O6FB 4GRMB 2VZ3A 2MMXA 2HLAB 2G60L 3U4AA 4H5SA 4NN6C 1CTOA 1ZVHA 3MRHB 4IRSA 2YZ8A 3FZUD 4LSTH 1IKFH 3ZMRA 3FQTA 2AJVH 5CLWA 4HUWA 3HCVB 4U1NB 5GRXG 4CNIA 5DSCA 5DFWH 3ES6B 1JPSL 4HMCA 1GSMA 4WW2A 5DR5H 1ITCA 3DVGA 1G7QA 4MJID 3ET9F 2HFFA 1HIMH 2IF7A 4Z7NE 1WBZA 2YC1A 4Z76A 3STZB 3T2NH 2D0GA 2YPLE 3LPGA 1BX2B 2NY3D 4TNVF 3U36A 5F6IC 1I1CA 2E9JA 4JM2F 4ZQKA 5IB5B 4O2FA 1UB6A 4QRPA 4JM2D 3EFDH 4YX2H 4JKWA 4I0PA 1CLCA 4PRIE 2JK5B 3WXWH 2HTLD 1BQHB 4N8CL 3QRGH 1EO8L 3KLDA 4GFTB 3IU4H 3WV0A 2BNQB 1CQYA 4JY5L 5TF1L 3WFHA 4U49A 4D3CL 1ZVSB 5GGRY 3EOTH 4N1HB 12E8H 3QUYB 1TENA 5AZEL 1OP3H 3KR3L 2R69L 4MAYA 2NY7L 3REVB 1RJCA 1D9KD 2CDGB 3CVHH 1EHAA 1A3RH 1JTPA 5IMMB 3MA9H 1H9VA 4UU9A 4M1DL 5DTFA 1JL8A 1OTUC 4NZUH 2BHUA 3TJHD 4D9LH 5T1MA 5A2FA 2DL9A 1X5ZA 4QXTA 3QDJA 3UBXB 3B5TA 1CXIA 1J5OL 3MOBH 1YMHB 1NCAL 3OKOB 5FM4A 1KC5L 5BZDA 1CICA 1FO0L 5D5ME 5BS0A 4G3YH 4TRPH 4GKZB 2DIJA 1C12A 3X13B 5TPWH 1DBAH 1TJGL 3S98A 3BGFB 4LSUH 3LVEA 1ZHNB 3NZ8B 1X3DA 3ULSB 3GMQA 2G75B 1OWRM 4LSQL 3BGMA 1WTGT 4ENEC 4BUGA 1LE5A 1DQML 3M8OL 4TUOB 1RK1B 4KDTC 4KKBC 2HFEA 3LKRB 2FBJH 4JFZH 2J8UE 3LV3A 3QO0A 3QDMD 5H94A 3WNNA 4PG2A 2HN7A 3V6FA 1T0MA 3QI9C 2QSQA 2YA1A 4PJ8C 1UKQA 5C0DA 1H8NA 1ZTXH 4JAMB 4NQCB 4U6HB 4U4BA 2SEBB 5KJRL 2XNAA 5C3TA 3TESA 5IVXB 2R1YA 3BUYA 4BYHA 1SJHB 1UWXH 1F2XK 2I5YH 3HA0A 2DD8H 1HHIB 5ICZA 2QKIB 1NKOA 5FYLH 5SWSA 3WYRA 5B3JF 3FFDB 4ETQB 1JWUA 4L9LC 1MWAA 2DS4A 3DSNA 4IRZH 1S7QB 3RU8L 3I75A 1MF2H 1JTTA 2DQIH 5GQBA 3HUJF 2AEWA 3QEQD 2Q86A 3MGTA 3OKYA 4TSCL 5ILTH 3D85A 4Y5XC 3KPQB 4WI7A 3RI5K 2G9HB 3T2QA 4NBXB 4D0CB 4UAOC 1ZGLM 4L8CA 5CIPH 3BP7B 2E9WA 3VFMA 2Y1VA 3FO2A 1LEKB 3WLBB 5D7JD 5HYJB 1QACA 2CIKA 3O4LB 4I3RL 4ZTPL 1S7VB 3IDYC 1V8HA 5GS3A 5DMKB 3FN0H 2R2BA 4FQLL 4NM4H 3LN5A 3W39A 4HKXB 4OFYA 4ELMF 3C6LB 1A7PL 3PG2A 2YXFA 4JY6B 3U0PB 3I9GL 2HH0H 4ZFGH 2ZCLH 1LO0L 4OF8A 4KZDH 4OFIA 3V2AR 3BZEA 1EAPB 5EG6C 4KI5C 4M3JA 3S96B 1QRNE 1T83A 2JKXA 3M17B 4J6RL 2WLZA 1AKJA 4HGKC 1AD9A 5J12C 2X1PA 3P73B 4K8RC 3PWVB 1AO7B 1J0ZA 4HG4J 3MBXL 1YPZB 4YIQA 3LHPH 2O5YH 2EYTB 3IU3A 2FNBA 4X7SL 1ZGLA 2FRGP 5E6IA 1KG0A 2XZQH 1WUNT 3G08B 5BMFL 1HNFA 3F5WA 4MNQE 3QUZB 4RGMC 4L8DA 2DQHL 3W9EA 4YDIH 25C8H 5L88H 2VLRD 2XQYG 2PCPB 3EGSB 4ZTOL 3AC0A 2YUZA 3MRMA 4F58L 4JN1L 4NO2A 5E8OA 1RZ8B 3PP3K 2NZIA 4G6FB 2NY6C 1U8HB 3HLAA 4G43A 2ARJA 4PGJA 3QUMB 1I3RB 3DVNA 2X4PB 3ECBB 1RMFL 1UCBH 1A6WL 2A2QT 1KXTB 4CMHB 5C0CB 4YK4B 3UYRH 1XF5B 4UTAH 1Z5LB 5J13B 3X14B 4QRQB 3K8KA 2FLBT 5DK0A 5C8JB 4NQSB 4OLEA 3CXHJ 4GAGL 3SOBL 3WIIH 4BK5A 3JWDL 1OCWL 3BRDA 4WUUA 3FQXA 3ILQC 4GBXA 3UBXI 1CVSC 1AQDB 4OZHA 1F6LL 5C08D 1VEMA 3WIHH 1U6AH 2RQ8A 4X6DB 2C4FT 3D2UD 4LVHC 5SX4H 1HQRB 3KPRA 4QRRD 4J1UB 1JZ6A 2Z31B 4P2OB 3G6JA 5K59F 5J7CC 3SGKA 1T7XA 1IKNA 3MYZA 4XRCB 2BERA 1NL0L 4Z18A 4NBZB 4PP1D 3BW9B 4CUCA 3JWOH 1IC1A 4ZUWB 4IJ3B 2E7HA 4XI5D 1BVZA 2EEAA 1WBXA 3UTSE 2EO9A 2W0FA 1XGUA 3QFJB 4NM8L 3F12A 3Q48A 1A64A 3HZKB 5IFJB 1GGIH 5KZCD 1RZFL 4RISH 3HG1A 4KJQC 3BKMH 5F7UA 5D96B 2R2HA 3LEYL 4BSVA 3X3GL 4NO3A 4TSBH 3SDXE 5EC2A 3HRZB 5EBWB 5DC4B 4ZO7A 3VXRD 2XACC 5J56B 1VFOA 4LLYB 1T7ZA 2DQFB 3G5YB 4LCCB 5HHMB 4GRWF 4P2RE 1F3DJ 1ITBB 2X7LA 4KI1A 2FEDD 2VLKD 1DLFL 4V2BA 3VWJA 4KUZL 4DGIH 4OLXH 4IMKA 5FGCE 1VADA 1X7QA 4XHJC 1DQJA 1KEGL 3ZYJA 2UV3A 4LCWD 1FQ9C 1S5IL 5MEOB 3AM8A 5ALCL 3FRPG 1BIHA 4PJIA 1MCPL 2DDQH 3EOYG 2DIAA 2KH2B 3UCRA 5B39B 5DLMH 1BQLH 1WVZA 3IFOA 1KF9B 4HKBB 4L3EA 4OJFL 4N5UA 3U83A 5I73C 4MAUL 1AE6L 3AS2A 3VI4E 4M9PA 2AQ1A 4FQJH 4PUBH 5DI8B 4XPTL 3NH7L 1YQ2A 2NXZD 1KCLA 3MV7B 3OWEA 3WD5L 2IALB 2XRAL 1HN1A 1I1AD 1S7XA 3L3HA 5I1HH 5J1AB 1JNNL 1QFWL 4XVJH 1MCRA 5I1EH 4H26A 2IGFH 3GJFB 5EBMB 2WK2A 4OKDA 5LAXA 4HIJA 4I13B 3FRUB 3O9WB 2AABH 3L7FA 3MACL 2XICA 1Y18B 4V1DB 1U2HA 5IBUG 2A0LC 5F7FA 5HBBA 1HHHB 1D6EA 3N85L 1EK3A 4X8JA 1TQBC 4CJ0A 1ZV5A 3EOBB 4TYUA 2J4WL 5B38B 1WITA 3K2UH 5E8DL 5EU6E 4NUJA 3DUUA 2YUWA 5HHNA 2I07A 4MDJA 5CZKA 4P9MH 4GXUN 3IDJA 1DBJL 4APQB 2GSIA 5K9QI 1I7TA 1A14L 3QIBA 2FIKA 2ZUQC 1IZKA 4MJ6B 4EDXB 3R06A 4RWYH 3V8OA 2BOCB 1VFBA 3U4EB 4F7EB 4WGVB 2YPVH 2QJDA 4M48L 4UOW0 1A7RL 1BIIB 3HMXH 2A6JB 5BQ7A 2N7BA 4QF1A 4Y4HD 2IBBA 1ROWA 1ZA6A 2E7BA 3DYOA 2XQBL 5FYKD 4AM0A 3V4VH 5E5MB 3VRIA 4JRYD 1AGEA 4PFEA 1GHFL 2FYYB 1CFSA 4XMKH 5EN2A 2P5EB 1T2QL 1ZLSL 4OD1L 4CU7A 1JHTA 2CPCA 2MSPA 1RIUL 4L4VD 4ZYKA 4PJXA 4PJHA 1LDPH 4JFDE 2AJUH 3BT2L 2X42A 5IVOA 1TVHA 2HKHL 4JY4B 2PYEA 4OLZL 3SEPA 5D72H 1I4FB 3PV6A 2VC2L 3NFSH 5LJYH 2OZ4H 4GRWH 2AK4A 5KS9F 1CIDA 1J0IA 1DE4B 1RULL 2Z0BA 3QAZC 3TA3D 4WWKD 3L1OL 5I1DA 1PEZA 4J3VA 43C9A 3ULVC 5SWZE 5KVMC 3LS4H 4MB3A 5E0QA 4ONFL 1PW3A 2FATL 5ESAA 4ONOA 1MCJA 3LY6A 3O6MH 2DLFH 1WT5C 5IP4A 5DD6B 3WFDH 1OL0A 1MFDH 2ZOLB 3UAJC 3OB0K 1R3HA 1DVFA 2VXTH 3ARSA 4ZAKA 4F7MB 1WCQA 2LU4A 1A2YA 4WTZA 1ZS8B 5D93C 1NCWL 3AB0C 4Q6YA 4PLJC 2AEPL 1VACB 4JZNB 5IBTL 3IS0X 3C5JB 1CU4H 2AERT 3FMGH 4R3SB 1VB9A 1R5IB 4PJGA 3CFBA 1DANT 4H1LH 5DJDA 3CSYB 2GY7B 4LIQL 1FNGA 1FVDA 5DO2D 4NRYA 3VFWA 4BKLA 2FGWL 3FQTB 4XX1G 2APTA 3QZWB 3ZDXF 4CNIB 1GOFA 1I1FA 1NCUA 2AK1H 1BD2B 4TQEL 1K6QH 3NIGF 3DVGB 1G7QB 3S4SB 3NFNA 4XPAL 3LD8C 3H8NA 2YC1B 1WBZB 1K5NB 2XFXA 3TLRA 1IBGL 3RZCA 3DMMA 3WKML 1G9EA 3I6LD 3EYFB 2XZZA 4RMSA 5FUOL 3F7VA 4O2FB 1UB6B 3AS0A 5MP6L 4Y4FA 2IAMC 4I0PB 3U0WH 3R0MA 4Z78A 3V52L 4HFUH 3MRFB 2D9CA 4UB0H 2EKJA 3L5XH 5FYKH 2F8OA 3QUXC 3WFHB 2E8ZA 5E8PA 2WIIA 3LEVL 3OAYK 4WU5A 3H42H 1MCNA 5EIIA 1DBKL 5EZLA 5E2TL 1FNAA 1T1ZA 4QT5A 5DQJB 4U7SA 4ELKA 1Q94A 4I3SH 3S88L 2FGZA 1Q0YL 3RX8A 2YUXA 2C4FU 4NN7B 3OTTA 1FFOA 4KKCD 1R3JA 2BOBA 4KY1L 4ZFOL 1YJDL 4C56E 3CLFL 1IAOB 3MPCA 4K23L 4QXTB 3DXAE 1T22A 4OQTL 3C8KA 1NAMH 5A3IC 3QDJB 4NPYB 3TPUA 1IGTA 1IGIH 4OFDA 1MCHA 1FE8L 3V6ZA 1RZ7L 5HD8C 3H7LA 1EFXA 2B5IC 3U7YH 1DFBH 4JPVH 4LSRH 3QWOA 2ICEB 3W82A 5ANME 2QADD 3WDJA 3UJJH 5F96L 5BS0B 1F4XL 1C12B 3CD4A 4PRPD 2J8OA 1FZOB 2FZ3A 4Y19D 3OKLA 4P4KD 2YMXL 3U7WL 5ID1B 3U7AA 3GMQB 5DMJB 4GRLC 4L29B 4ODVL 1NMBL 3HPJA 3IFLL 3BGMB 3O3DA 3KPSE 3S5LB 1LE5B 1K85A 1GXEA 1MLBA 2OS7A 2ADGA 1HCVA 2HFEB 3RL1A 4KMTL 1KPUA 5T3XE 3VXSE 1A4JA 4WVRA 5H94B 1IM9A 4FZ8H 2HN7B 3V6FB 2X9YA 1T0MB 1XH3B 2PYFB 2GK0A 1MFCL 3SDDA 4HKZA 3V5KB 1OAYH 4WHCA 5EA0H 2V6HA 3W0WD 3WDIA 5D1ZA 2R1YB 1CXLA 1OSPL 4LSDA 5I9QB 4D9QD 1IE5A 5GS0L 3VFSA 4LASL 3L7EB 5ICZB 4P5KB 5GGUA 1N6UA 3C09C 4DKEH 5JXAH 3BVNA 1NBZA 2XV6B 3GFUA 5HGHA 4MD4B 1MHHA 1ZA3B 1M71B 5CJBA 3KXFE 2VKXA 3O3EA 1G7MB 1T1WA 1HZHH 2I60L 2MQCA 2Q86B 2H32A 2A38A 3D85B 1U3HB 4N8VG 3HNTL 4XAWH 3MLTA 1MFBL 2EKSB 4L8CB 1IAIM 1Y6KR 3UJTL 3FO2B 3C60A 2BVOB 4XPFH 3B2UD 1I1RA 4GS7C 1LILA 4UILL 4BH8A 1C16A 2H9GA 4X6FB 4F37F 1IGCH 2C3HA 3KPMB 3ZTNL 4DJMA 4XC3H 3TV3L 2ZNXA 3D18A 2FJGB 4L4TE 3MJ8B 4U1SA 4U1JA 4KK9D 2RIKA 4OZIA 3VCLA 3I2CL 4RMWA 3FOMA 1S7RA 1UM5L 3ZO0A 2UWEA 5DD1H 4CU8A 5JIHA 2V5YA 3BZEB 3C2AH 4I48A 5E6YA 5I74C 4BELD 4IS6B 4O2EA 4Y5YB 5C0BD 1AFVL 5CKAA 1GGBH 1AKJB 2D03H 3OL2A 5JW3H 4JPKH 5I1GH 4P2QE 1TZHB 2ZCHL 1H3WM 5CJXA 1H5BA 3K74B 1BEYL 5FYLE 3VFPB 3WS3B 5F70A 3PDDA 3G5VA 5JXED 2OX5A 3T0EA 1JRHI 3RWJB 3TBTA 4LFHG 3TCLA 2RFXA 2J6EA 5D70L 4JFHE 5E6IB 4KK5C 4HC1A 2CIIB 3GMRA 3TVMB 4I4WA 1CD1B 2QQLH 1LD9B 4YR6A 1Q8MA 4L8DB 1ONQB 4NFDA 1CXFA 3ZE1F 3E8UH 5E56A 1MLCB 2AJZA 4NO2B 4WV1C 2L7UA 4YFDB 2FX7H 3SE8H 1O7SA 2UZXB 4G43B 2ARJB 3I50H 3FQWA 3V7AG 4Z8FH 3DVNB 3MA7A 5IG7A 4KQ3H 1J05B 4CVZB 5IQ9A 1GYAA 3ULUL 2XA8L 5I1IH 1AHWA 2ORBL 3BIKB 4ZUVA 1JYXA 1S3KH 3A67H 1JK8A 4WU7A 1T7YA 1FC2D 4WGWB 1GGUA 2RCSL 5C0JA 3GM8A 1XCQA 3FB5A 5BW7C 3O6LH 4HDIB 4H1LG 4HJJH 4ZPVB 1RUAH 3FFCB 4ZFFB 4MVBD 2R4SL 4YQXH 5I2IA 3ZKSD 1UYWH 4J4PC 1MQKL 4EI6A 5TGBA 3E2HB 3K4AA 2WBJB 3ARVA 4IIQA 2CK2A 4XP5H 5D2LA 2I25N 4MD5B 1J8HE 1JFQH 1B0RA 4HIHA 5JHLH 2N4IA 2C1OA 2F53A 4YUEL 2VDOL 3MBEA 2XN9B 5EO0A 2CD0A 4Y1AD 4K3DH 4OTXH 4NC0B 3QXUA 5AWNL 4PBWD 4W81A 5CD5D 3SE4A 5ICYA 2V2XA 4NO5A 4QXWA 5BVPL 2NY1D 3RGVD 4UIMB 5FGSA 2I9TB 3GUTA 2D4DA 5DVMA 3GKZA 1WBXB 4JPWH 3CSPA 4XNUL 1XGYL 4LLVA 3O2DA 5C7XH 1RZJL 3QDME 5T1KA 4IRJB 2DQEL 3F12B 2AXJA 5GRVK 1V7NL 3RIFK 3O2VL 4EDWH 1PJ9A 1A6TB 3D87B 4LGSB 4EZMA 1QSFB 5C0IB 5TJWK 4P2YA 2VQ1A 4DUWA 3HG1B 4JRXA 3WN5C 3MRJA 2GJ6B 2R2HB 1N0XL 4ORGA 2C26A 1QBAA 4HUXB 2B4CL 2VXVL 2EEBA 4NO3B 4CAGA 3O45A 5EC2B 4OF0A 2IH3A 1UA6L 2NZ9C 4XX1E 5JW4N 1UZ8A 4X9HA 3RX5A 1KJ2L 5F7KC 5B3JE 1EUTA 1G0YR 3DRQB 3KLHC 1VESA 5CINL 5BZWA 3QEQE 3MCKB 3HUJE 3B43A 4EBQH 1N0LA 3VWJB 4KV5F 3SDAC 5I8CA 4KHXL 4OLYH 1DQJB 4NSKB 3LIZH 1AGBA 1SYVB 1X9QA 4KKLC 5HHXH 1B0GA 4XWOD 4PJIB 1FPTL 1P6AB 5E9DB 3GHEH 1BF8A 1OF2A 4OZFA 5HDQL 4KGLA 5CUSL 4L8SC 2DJUA 3KJ4C 3VD5A 4ELME 5F88A 1MAML 1QYGL 2XKNB 1KJMB 4LQFL 1I8LA 4QCIA 3TBSB 4OBRA 3SE9L 5F93C 3GMNB 3GSNL 3WFBL 1UCTA 3T65B 3HNVL 2OJZH 3L3HB 4NNYA 3TN0A 4S1DD 3LQZB 4Z7VA 1FYTE 4MNGA 1RUML 2AW2A 3LS5L 4LOUD 1Q9OB 5E4EB 1NANH 2NY3C 2IWGA 1KJ3L 4MXWH 5TDOB 3U6RA 5JW4Q 1VKXA 3BMVA 2Z8VC 1D6EB 4M6OH 4PJDF 4JM2C 1G6RB 3VH8B 1MQ8A 5FXCH 2HTLC 2P44B 4KUCF 3GHBH 1RIVH 2X89D 5D8JL 4NUJB 3DUUB 4KUCD 2I07B 1YMME 2VLRE 2X41A 5CJQH 1M7DA 2GSIB 5IGXL 2E6JA 1I7TB 3IGAB 1ZMYA 1GOGA 1KV3A 2DJSA 4YHML 1K2DB 3R06B 4I77H 4PRBA 2QQNH 3LMJL 4O51B 3JV6B 2IPUK 1VFBB 2UY6A 3RVTD 5ITFA 4I18A 4GKNA 1AGCB 4U7KA 1KB5A 2GK2A 1AXTL 5GRYA 3TJHC 3VRIB 3RTQA 3GO1H 3GSRA 5EN2B 3FO1A 5MI0C 2OR7A 3D39E 4FS0A 1U8KA 1CR9H 4JHAH 2X4OA 1JHTB 1NCDH 1EXUB 2Y6SD 4HW6A 4JQVC 2D31A 2D7NA 3WEXA 3FHAA 4ZYKB 4Z7QF 2GAZB 5E8EB 1NGYA 1IC7L 1QA9B 2M8XA 3PL6C 1NFKA 2CXGA 3O4OC 5EUKA 4TUJA 5C0EA 2P5WA 4NT6A 2NMSA 3QR2A 5IT2H 2AK4B 5I1CH 4HEPG 2C3GA 3CZFB 1F58L 5I1DB 4UDTA 4YHIA 1VPOH 1MHPH 2ICWA 5F3HA 4XC1L 1FGNL 2DQTL 1J1PH 4HK3N 3OKEB 4OIAA 3FB7A 3CNKA 4Y8DC 2CLZA 3PUCA 1PBYA 4PPTA 5ADPH 1RQ5A 3CFKA 4QY8A 2AGJH 2ED8A 1P53A 2P4AB 5K9KB 1XIWD 4DQOL 4U33A 2F54A 3QNYB 1DVFB 4ZAKB 4XNXH 5KAQF 4G9FB 4DK6A 1HHGA 2DMCA 3CSGA 5H8DA 4FMKA 3MNWA 4U1MA 4KC3B 4HPOL 5TE4L 5C07B 1M6OB 3CFBB 4JFEA 1IM3B 4UNVA 1KN2H 4MWFA 5KSAA 3TFKD 1JTOA 5LBSH 3GNMH 3FB8A 4MNHA 5IW6B 1FNGB 1FVDB 5KVEL 4N0FA 2DBLH 4P5MA 5INCA 4BKLB 1P4IH 3AU1B 4GRWE 5GS1A 1G7IA 5FA4B 5F9OH 3R0NA 1I1FB 3DIFB 5EO1A 5D7JC 4DN3H 3QWRA 4LCWE 3JWOC 1KELL 3ORJA 4PTTA 2ZUUA 3NFNB 4IDJH 2MPAH 1ZLUH 1MWAL 1UXWA 2X2YA 1J1OL 2BSED 3CFEA 3KLAB 3OR6A 4QOKE 5GRZA 3EYSL 4NRXA 5IKCB 3F7VB 1SBSL 5A2LH 4ZNCD 5ESVB 3ARFD 4KDTA 1LO5A 4HWBH 2VDLL 3G6DL 5DD0H 3QI9A 5E8PB 1DQTA 2WIIB 1MI5A 4PJ8A 3U2SB 4WFGD 5EIIB 5SV3A 3MNVA 4LU5L 2ZZUT 3TO2A 1KCSH 5ETUA 5IQ7H 2MKWA 5FKAB 2YXMA 4TNWF 4PY7B 3TT3H 1A7QH 3KYKH 1NFDA 3BSZH 4OAWB 5KN5A 5AYUL 5FYJD 1W8OA 2J88L 4WO4D 2WBKA 3G9VA 4HWUA 3ARWA 3MV8A 3U30B 2MCPH 4PJ9D 3W5NA 3MLVL 4YDLC 4DCQB 2OL3A 3V95A 5E2WL 2HKFH 3S3SA 1VFMA 1IGTB 2K7PA 4JO3L 3ARGB 3K4DA 2O5XL 5JOFA 3W5MA 1NGZA 3HC3H 4GAYB 3QWOB 1BFVL 3RVVC 5LGJB 4MLSA 1I8KA 1VGEH 4NKDB 4OKVA 3ILPA 2G2RB 2P46B 1FL5A 4OCYH 4WCYL 1SQ2N 2OP4H 4PGDB 4JJ5A 4P23D 3DI3B 5EORH 3WSQL 3K3QA 2X5PA 4JRYE 4D8PA 4F15B 3O3DB 2XG5A 4DVRH 2XWTA 4R2GB 1MLBB 1WK0A 2ADGB 4XMPL 2BVQA 4OZHF 2DYPD 3RL1B 4OCWL 2XOTA 1A4JB 4L4VE 1IM9B 4MQSB 2W9LA 3ZYIA 2YPKA 2GK0B 4U7MA 1BGXH 1SY6L 1UC6A 5EU4B 5T5NG 3SDDB 4HZLA 1RU9L 3VXME 3MLZH 2YPLA 1XF3B 2M1KA 4X6BA 2RBLA 3VGFA 1C5DA 2GFBA 1NGQH 2OSLA 5FF6A 3Q5OA 1J0KA 5KS9E 5DFVC 4PRIA 3DURA 1EZVY 2VLMD 4JGUA 4LHUB 5ITBL 5EULV 4PB0L 3BVNB 2FJFA 5HGHB 5C71A 4XI5C 4NRZA 5DJ8B 1JYWA 2HA1A 1ORSA 3CCHA 4L5FL 3ZSTA 1T1WB 4BA8A 4X4XA 2H32B 1B2WL 4PBXA 1LO2L 4LIQE 3EJJX 5JIIA 2VNCA 1XZ0A 4ZSOE 4XP6H 4EI5D 5IR1A 3C60B 2FEEI 3VXUE 2VITA 1LO4H 5BXFB 1C16B 3UX9B 4FQQB 1JNJA 3BE1H 1XCTA 3B9DA 3A6OA 3D0LA 4JANA 1KCRH 4NOBA 3D18B 4U1JB 4YXHL 1UKTA 5IHZB 1LEGA 3VCLB 4G8GE 4FFVD 3FOMB 4RZCA 5FUCE 3S8WA 2UWEB 3MJ7A 2FEDC 3BP6B 5FYJH 1PLGH 4I48B 4PGCA 1QZ1A 4O2EB 3NABL 4LEXL 4J3SA 3RRQA 5T1LA 4GO6B 3B83A 1FGVL 4JRWA 4XCNA 4O02L 1RIHL 2XQYK 3ZDXE 3WO3B 2OTWB 4PJCF 3AMKA 2DM3A 3ZL4L 3NIGE 5CP7A 4QYOA 3ZDZF 2ICES 4KPHL 1J5OH 4CDGC 1QTYT 2A74A 3P4MB 1Y0LA 1BLNA 1PZ5A 2R15A 3HR6A 5CLTA 3GMRB 1A6AA 1OTTD 3QXAA 4YR6B 2F74B 2BXZA 2J8UA 3UZEA 4XH2B 5IEKA 3QIWD 1FO0H 1BF2A 1I1AC 5I1LB 3BDYL 3QFDB 4K94H 3BOVA 1NBVL 4S0SD 4EKXA 3FQWB 4OGXH 1ZWIB 2GY5A 1A4KA 3MA7B 4UQ3B 5J9PB 2JJVA 4PRDB 3SPVA 4IOIA 1GCFA 1FZJA 1J1XL 3ZSSA 1ES0B 2ESVE 5C0JB 4O2CB 3FB5B 5HXMA 3ETBF 4FTVE 4LSPH 2AJXL 4K2UL 2X44D 5D6CB 4Y0GA 3T77A 4JFFE 4K7PL 3OQ3B 1D5IL 5TGBB 3RWIA 1S5HB 4IIQB 5D2LB 1WC7A 5GGVL 4S10A 3WLWD 3BHBA 1B0RB 4HIHB 1N5AB 2F53B 2C5DC 3MBEB 4LARH 5BV7L 4UIKL 3OAZH 1I7ZB 1W0VA 4Y4HC 1P7QD 1L6XA 4EVNA 3QDGE 3RU8H 3BZ4B 5HHOE 3ZHDA 4PGBB 5C6TH 3MREB 1OGAD 2V2XB 3UPRA 4PLKD 1AXIB 3MV11 2VWEE 4LLUA 3MNZA 4KHTL 5GGTH 3GUTB 4UV4H 3QNXA 5BVJA 3RFZC 1RZGB 1GC1L 1QRNA 3MCLL 1MCWM 5D7LE 5T1KB 3I02A 1D6VH 3CVIL 5C0AD 4YXKH 1BOGB 1DSFH 4BSWB 1F13A 1S9KC 1CTNA 3UMTA 1D9KB 3P30L 1RZKH 3EYVA 4A6YB 5K9JL 4JQXC 1YY9D 1DDHB 3TA3C 4WWKC 4LVOB 5IHUH 3O45B 4LNRA 4MNQA 3HZYB 3B3IA 1CZ8L 3V4UH 2P7TA 1H8SA 2LQRA 2PO6B 1O5DT 5BZWB 4UBDD 1PD6A 4X7SH 4MA8L 5HHQA 9CGTA 3BH8A 1ZLWH 3WNMA 3ARBD 3VFTA 5IHLB 1AGBB 5TDNB 1CT8A 3RPKA 3MRBB 2NLJA 5M7QA 5TE7H 1WGOA 2EDHA 1OF2B 4OZFB 4XP9L 4XGZB 2V2WB 1IC4L 5KAQG 1O0VA 5DO2C 2UVFA 1JZ2A 5IM7A 1NGPL 4ESKA 5C0FA 3EFFA 5IK3B 3BD3A 5CMAB 2XWBA 4U1HA 5D7IB 2V5TA 3O6KL 5GS2D 4PRHD 1ACYL 1SJXA 3QCUL 4MNGB 4P3CH 3I6KA 1J10A 3OKKB 3MTRA 3EZJB 5A1AA 3SGEI 4E41B 4GJTB 3NCYP 4HIXL 3U6RB 1VKXB 4LF3A 5JORA 3O6FD 5DJ0B 1DUYA 1RFDL 5D1XA 3UTSA 2YEZB 4XAKE 4ALAH 4NN5C 35C8L 5TQ0L 4PJEB 5L0QB 1ZLVK 1M7DB 1A0QH 3ZE1E 4CU6A 3OKNA 1WT5A 3ZLQC 2WUBH 4JO1L 4ODSL 2BSRA 3QQ4A 3MMEA 2IQ9H 3UTTE 3NVQA 4NNPL 4PRBB 1I8IB 5J4MA 2GCYA 4Y2DC 4I18B 5T1DH 3D6GA 2MJWA 1UWEH 3SDXA 2VLJE 1KB5B 3QCTH 5GISL 1Q9WB 3MLSL 3P0YH 4KKCC 1JPFB 4M7JH 3RTQB 1GGTA 4OM1L 3GSRB 5MEQA 2QSCL 5DC9B 4P2RA 3LKQA 1U8KB 4TPRL 2BNQD 3VWKA 2X4OB 4F9LC 1IGFL 1W72H 4JG0H 3WEXB 2EECA 2W65A 2JF1A 4F7PA 2VH5H 3RJQB 3QUYD 3T1FA 3NCMA 4XWGH 4YBHA 4M3KB 5EUKB 4R26H 2QADC 4TUJB 1AR1D 4OV5A 4DKFL 5GPRA 3JV4B 2P5WB 1QBMH 4P4KC 2BHYA 3ZKXB 3P11H 4E9LA 4M8VA 4R97C 3OF6D 2R1XA 2JELH 2R4RH 5KANI 4UDTB 4YHIB 3L95A 5F3HB 2CGRL 1MCEA 1U36A 2IAMA 3P0VL 3WMSA 3ARDB 4JFXA 4E0RA 4NZTL 3HMWL 2FL5B 4YHPA 2ID5A 1XGPB 3DETD 3O3AB 4E5XB 1IQWL 1WBYA 2H2SD 3S36X 4X9BA 2EDFA 4Z7OF 3SJVB 1RJLA 3TF7C 2JIXD 5JQ6L 1EV2E 4LPCA 3VXPA 3B8SA 1HHGB 3RY5A 3ZKQD 1HINH 4HXBL 4U1MB 2Q76A 4L1HA 5HDBF 3PQYA 3TIEA 2Y9RT 3GRWA 2WWKT 1JNNH 1U42A 3TNNA 1JZ4A 1NCBH 4MWFB 5KSAB 4YHOL 2P8LB 1QLEH 4HIIA 4PRNB 5D71L 4H0GA 3ZT6A 4P5MB 5INCB 4XBEL 4R0LC 2XZCL 2X70B 5GS1B 1NMAL 1A9EA 1G7IB 4NQCD 4HT1L 3WO4B 1NCTA 4KRPB 1INEH 4KV5E 5INDB 2DQJH 2AKRA 1B4JH 2QLVB 4XMLL 2J4WH 4HX1A 1UXWB 4XCFH 4K71B 3WJJA 1DBJH 3OR6B 3WFEH 4XVTL 1FLRL 5DD5H 1ZT7A 5H2BA 1CGTA 3AREC 2ZJSH 5FHAH 1A7RH 1CGUA 1LO5B 5CSGA 4JFDA 5JHDE 3VFNA 5A43C 3RVUD 5D7KD 2J5LC 1OOAA 4YHNB 1MJUH 4TVPL 4PJ8B 2AVGA 3EO1A 4MD0B 3O4LD 2KZ1B 5JXEC 1MREH 2PN5A 1YEFH 1F00I 3MXVH 4JFYB 3PWPE 3GSWB 1ZLSH 1NFDB 5SWZA 4QRPE 1NC4D 2XWJA 3AFLA 4HKJA 4LL9A 3IKCB 3WUWG 3PWNB 2VXUH 1QFUL 4DWHA 2VC2H 2VLKB 2P8MB 3CXDL 4X4YA 2WAHA 3QG7H 1FNSH 1S7WB 4JVWA 1EO5A 2ZKHH 1RULH 4JR9L 3QJHA 5JOFB 1AO7D 4P3WA 4W4OC 1IAIL 2J6EL 1MJ7H 2DKMA 1I8KB 5JUEH 2PNDA 3EYOB 4HJGA 4HC1L 4NP4H 3UTZA 3QEUA 1L9MA 2FATH 3HZVA 5F6HJ 4LEOA 1IC5H 4N5ED 5EOTA 2JTDA 3QUZD 5I8KH 1J8KA 2DLGA 3DRTA 4ZXBC 3GSUA 1SM3H 2B0SH 3MXWL 4AEFA 2XWTB 2NXZB 4YBLC 5IVNA 4JQIH 4YHZH 2YS4A 1JWSA 1ND0A 1N5YH 2YPKB 1CFNB 3DV4A 4K3EL 4IM8A 4FQCH 4Z7QE 2KKQA 4UT7H 3S7GA 1U91A 2NW3B 4JHBA 1DN2A 5J12B 3O3BB 3KPNB 2YPLB 5C0CD 4RIRA 3D0VA 4Y5VB 5IB1A 5TE6L 1A6UL 3H3BC 3CMOH 5FF6B 2YK1L 4KRLB 1FSKB 3BWAB 3K81A 1WQVT 1X5FA 5IB2B 1U8JA 4PRIB 3RGVC 4GW1B 1YYLL 5T33H 3B9AA 3RPIA 4OF3A 1G6VK 5JW5B 3CCHB 3VXOA 4Y4KB 5AYQA 4G9DA 1NCCH 2QSTA 4XCCH 1IBGH 4WV1A 4G7YL 4M7LT 3WKMH 4R4BB 4M7LH 5CCKL 2DJ4A 5IESL 4ZODA 5DJXB 2Z31D 3MV01 4JB9H 5IR1B 4P2OD 1MRFL 2NNAA 4DFIA 2GITA 1YEHL 1L4IA 1TVBA 2W9DL 4PLOB 4GMSL 1KIRB 1YUHA 1KLUA 5EZOL 5SWSE 2VISB 1QOKA 4PB9H 4JANB 1P4BH 3O2DL 4FFZH 5BW7A 3HE7A 1MHEB 4N90E 1RUPH 2VDKH 1LEGB 4OGYH 5E2TH 3QFJD 4J4PA 5A2JH 3U4BL 1SVZA 4U0RC 3TP4A 1MPAL 3ZKMD 3UO1H 2XTJE 4PGCB 4M43L 5T1LB 4O4YL 4IEFB 3QA3A 1NLBL 5D5MB 4OT1L 1ZHKA 5MEPB 4R90H 1YJDH 5E95B 5EWIH 5ABDE 2BRRH 4K23H 5FOBA 4Z7WA 4QYOB 2L4OA 1I8MA 4E42A 2Z4QB 1EERB 1DQQA 2A74B 1AY1L 3KPSA 1Y0LB 3PGCB 4OLUH 4P0DA 1GGCL 4LSSH 4FXKA 4O5LH 1MRCH 3BJ91 5B8CA 2HVKA 3B9EA 6FABL 3EYQD 3QXAB 4YPJA 5HHMD 1IL1A 3VXSA 2NY4B 2AXGB 3DV6B 3U48A 4YWGH 1RPQA 2YRZA 4QTIH 2M2DA 2AI0L 4W6WB 4S1DC 4X7FC 3MX0A 4U6YA 5GHWH 3T8XA 4LOUC 3NBNA 1D3CA 4QRSA 2VDRH 1N59B 3NZHL 3BJLA 3MUHL 1AXSB 1T66D 4IOIB 4GMTL 3WN5A 2BY3A 5MERA 1P9MC 3S35L 3I84A 1WWCA 3QUMH 3ULUD 3VE0A 3K1KC 4G8FA 2OI9B 3QHTC 3BD4A 5AUMB 5JA8B 4X6EA 5K9OA 1IGJA 1NDMB 3KXFA 3MZTA 5F7NC 4R7DA 3R8BB 3T4YA 1RUQL 1TETL 4Q6IB 3JZ7A 5DEFA 2NR6D 3MV7D 3T77B 2GT9A 3FRPA 4JFQB 5LCVH 4AEHH 4Z7UF 1WC7B 4X9GA 3SDAA 3BHBB 4LASH 5KVFL 5F1IA 1OAKH 3RVTC 1FNHA 1BQUA 3O9WD 1HSAA 4DZBA 3WXVL 3QO1A 3HFML 4V1DD 3V8CA 1CFVH 4I9WD 1OARH 2I60H 4L4TA 2PUQT 5IB4A 4LLUB 3Q6GH 3QWQB 2ZWLT 5LWYH 1UVQA 4JO4L 4FQXD 4DAGL 4APQD 2HWZL 4Z77B 1P7HL 4BZ1H 2VQUA 4OZHE 4UILH 3KYMB 4FABH 1GAFH 1BQHG 1D5BA 1H0DA 4P2QA 3OJVC 1S7TB 1TQCC 3VA2C 1KB5L 1N7ML 1NC2B 3ARTA 5HDLA 1OY3B 4XNMB 3KPRE 3IJSB 4F7CA 3IJHA 4MJIA 2D0FA 2H2PD 3EYVB 3PWUB 3TYGL 3G6JE 4O58L 5KSBF 4Q2ZB 1OSZA 2DRUA 1MCIA 2VKWA 1QKZL 1T1XA 2EYRB 4MNQB 4JM2A 3OHXA 1CE1H 2P5ED 1TQBB 1R6VA 3V7MA 1CXHA 3FO0L 5CIPA 3FAWA 1CLYL 5IROA 2B1HH 4EN3B 4H0HB 1LE9A 3C6SA 4BFGA 1XIWC 2DTSA 5F7MC 3RP1A 4CMMA 3RDTB 2YA0A 1NEZB 4JDVA 3UBXG 1X5XA 1HYRC 4HS6B 1EJ6A 1I7RA 1TJIH 3GMMA 2DLTA 1FFNA 4PRPB 4M5YL 4RFOL 1YEIH 1TIUA 2IG2H 3RVXD 3OBAA 3L6FA 5J11C 1N2RB 1SVCP 4Y8AA 2F19L 3R8QA 1NEUA 1I9IH 1YEEL 3TFKC 5IHBA 2BSTA 1INDH 2XTJC 3MODH 3ULUH 1FORH 1IAKB 2YD4A 5F7EH 4ZNEE 5EOCL 4U1HB 3PL6A 1Q38A 1E0OB 5DMGD 4JDTL 3FHQA 1FG2A 4PJCE 4U1KA 1PX4A 1MQKH 3GJFH 2IMNA 1LK2A 4RX4D 3ZDZE 2A73A 1DL7L 4L3EE 3CFJA 2Z9TA 2UUDK 3JV5A 5D1XB 3ARFC 4LKXB 3UTSB 1H3PH 1ZHLA 3MLYL 3U0TB 4IRSD 1T5WA 3QDMA 5I1KH 5HVWA 3OKNB 5AWNH 3QQ3A 2P8PA 5L6YH 5DJZA 1BD2D 4H88H 4Y16B 3PWLA 2GCYB 3D9AH 4GKSB 3LZFL 5IJKC 5BVPH 3R1GH 1GPOL 3CFDA 4XNYH 2YKLL 1J9CT 5JPMB 1PSKL 1OAZL 3SDXB 4XPGL 3T1WA 5D93B 5CEZL 1HOCB 3LKPA 3U9PL 1NAKL 3A6CL 4M62L 4I0PD 4IOFD 1IGML 1P5VA 3WIHA 1MCCA 3PABA 5MEQB 4Y88A 4R4FH 3CIQA 5IV2A 3OGCA 4NWUH 1PKQE 3DWTA 3QEQA 3VWKB 1S78D 1EDQA 3HUJA 1IGYB 1VFAA 3AAZA 1JRHL 4LVNB 5FGCB 4F7PB 3OAUH 4XB8A 1DUZB 2X4UA 3T1FB 3L5WB 4H25A 4WEBL 5ADOL 3LPFA 4MAYD 1F6AB 4WY7L 4HS3B 5EU3B 3O11B 1YEGH 3T08A 4OV5B 2LTQB 3ARYA 5EZJB 2DKSA 2EDLA 4LBEB 2QQKL 5DS8A 2A1WL 3RNQA 3SKNB 2OL3L 3L95B 3MRLB 4K94C 1HHJA 4X6CB 2GJZB 3IXAA 3QDJD 8CGTA 3FT4A 4HFWA 5I8OL 4KI5F 3VDCA 2BVTA 5C09E 4PJHE 3RAJH 4M5ZH 2W91A 2A9NL 1DEDA 4D2NA 1FYTA 1IZJA 5C0AE 3GB7A 1WCBB 1L6ZA 3GGWA 1CICD 1IT9L 4M8QA 5BS0D 2OMBA 5C0RL 1QSVA 2F9BT 4OCLC 1V3JA 5DEGA 1FYHB 5LGHH 4AENB 5TH2A 1I9RH 1DQDH 1KTDA 4NNXA 4XBGB 3I3DA 3WFBH 5MENB 1CFQB 4DTGH 2R2CA 3HNVH 5ISZB 4HV8A 4U3HA 1OWWA 2VAAB 5F9WB 3TM6A 5EU6B 3CAFA 3KGRA 3EYUH 1YMMA 2VLRA 3WNOA 3BUTA 4QXUH 3PJSB 4GLRI 3S97C 4YHYB 3TT1H 3MR9B 4K8RL 4PR5B 3L3DB 1OTSD 4G42A 3JVGC 1UADC 4PTUA 1TDQA 5CILH 2AV1A 3PHQA 3Q5TA 3S36H 1MIML 1UM4H 4M93B 2AKRB 4JZJC 1HWGB 1RZIB 2F5AL 4F37K 2R8SH 4HX1B 1CDYA 1XR9B 1PYWA 2FWOB 4OSUH 3UTQA 2V7HB 2EDRA 4HEME 1A6PA 2ZOKB 1ZGLP 2NY1B 3QHZL 1IAMA 4PJGE 2ZUWA 1KGCD 4I2XB 1TXKA 4PJAF 2GHWB 2HRPL 1RZKC 4PLNC 3TO4B 5GSVA 4XZUA 1MCWW 1JF1A 3D85D 3MRPA 4JFDB 5CGTA 5FK9A 3VFNB 1U3HD 2FX9H 1CK0L 4P57A 4KMLB 5C08A 4KTEH 1L7IH 3BQUB 1TPXB 1Q9LA 3QT2A 4B5EA 3T0XA 3EO1B 4AJ0A 5F6HI 2OQJB 2AJYH 3GSQA 4PRHE 2RB8A 3VGBA 3TWCH 1T6VN 3BN3B 2R39A 5I16B 2YN5A 3O8XA 3VGAB 5SWZB 1I85C 4QHKJ 3T0VA 1W8NA 1OTTC 3M1BB 3RBGA 4J3XA 4N8VA 5DUBA 4NDMA 3U1SH 4HKJB 1JWMA 3RY6C 2C4XA 2BNRE 5F7DA 1A7NL 1BFOB 3HMXA 5T5FL 5I1JH 1D5ZA 1UXSB 4CADB 1AKJD 1MNUL 5EC1A 2ZSWA 1PG7L 3QJHB 4YC2C 1F58H 1NDGB 3RVWD 3BPNC 1KN4L 2NY5H 4XC1H 4BH7B 3HB3D 3DX7A 1KTRL 5CGYD 1AGDA 4KJPC 3VD7A 4HJGB 5GIRA 3UTZB 1A6ZA 5E6ID 3HZVB 3BP4A 3N9GH 4HXAH 3VXRA 1G7LA 1V3KA 3TVMD 2UY7A 2ADFH 2VAJA 2DIBA 3QQNA 5IOPB 1HI6B 3RHWK 4WJ5A 3IDIA 5B39G 2OZ4A 1F3DH 4ONHA 5I74B 4OD3L 3WLWC 4LCWA 2AJ3B 1BVLA 1H3UA 1X5IA 5TQ2L 5GSRB 2BX5A 4RIRB 5LG1A 1BVKA 5HVHC 3D0VB 2W60A 1BM3H 4CN6A 1QBLH 4QOKA 1E4WL 4WI5A 1EA9C 3B9KA 1U8NB 3BO8B 4JE4B 1MRDL 2HFGL 1VCAA 3FFCD 2EXYD 3SQOL 4ERSH 1BAFH 2P24A 1T7VA 4QRUA 4WUUD 4HS8H 3QG6A 1QG3A 4PGZA 4G9DB 1WFNA 1U58A 3PXHA 1I1AA 4XNZC 2X09A 5B38G 4KWUA 1J1OH 5GXBB 2XN9D 5DJ2B 4Z7OE 1N6QL 3VFUA 4H1LA 1KENL 1QNZH 1YNKH 2AJSH 2NNAB 4WRLA 4KZEL 4WFED 2BZDA 2GITB 2YD7A 2ZUYA 2UZIH 1JGVL 3DROA 4CKVX 1KLUB 1XMWA 1NBQA 2DI9A 1I75A 4C56B 4N9OB 1N26A 2FB4L 3DXAB 3HE7B 4FQHB 3GMPA 5FKPA 5ELIA 5HDBE 5GJSH 5DDHA 3BFOA 4LU5H 1WIUA 2DTMH 3BP5B 4UBDC 3BMWA 1T03H 4BFIA 1D5XA 3QHFL 2QHRH 3UTPE 1Q9KA 2AEQL 1SMAA 3BPOB 1YEKH 2J2ZA 1SEQH 3QA3B 2J88H 5ANMB 1F4HA 3HG1D 5JPNB 2BSSA 1R3IL 4TVPE 2GJ6D 4RGOH 2H8PA 4CJ1A 5FOBB 5HI3C 5CSZA 1I8MB 5E2WH 4JRYA 4K9EH 3DI2B 2X4QA 4RFNC 5HI5D 5B8CB 3BKCL 2GTZA 4OCXH 2OK0H 3TBVA 3IFPA 4HIEB 1IL1B 3VXSB 4L4VA 2R0KL 4UV7L 3VWJD 2WZPD 5EO9B 3EUUA 4X8XA 3OPZH 5DK3A 2VZSA 3MC0A 3VXMA 1H8OA 3IXTB 1NLDH 4U6XA 1JPTH 3Q5YA 4HUNB 5HYJE 4QRSB 5I18L 4RBPK 1NAMA 3GIZH 4P5TC 5MERB 2VUOA 4JQXA 5E9DD 1M05B 3TA3A 3ZT5A 5KS9A 4ZDHA 4ODTH 4WWKA 2CJUL 4R6UA 2HJKA 3O6FC 4M6ML 2MNUA 5K9OB 1IGJB 1N8ZA 2DQDL 4AG4L 3MLWH 3T4YB 4TULH 5C9JA 2MWCA 5DEFB 3T0WA 5DJAB 2GT9B 5B21A 2BY1A 2DQGH 5DVLA 5HHVL 3SDAB 5F1IB 3ROLB 4ZSOA 3CK0L 1AO7E 3VXUA 3CFCH 4K7FA 3VMPA 1HSAB 3K80A 4DZBB 5IMLB 3V0WH 3ULVL 3QZWG 1KCVH 1DEEB 2F58L 1WZ1L 1F3JB 1K8IA 2XTLA 1I3GL 4MCYA 1QP1A 3QQ9D 1X6NA 4M61A 3S4SG 1G1CA 3T0AA 3FB6A 4G8GA 2EIBA 3RA7L 4LHQB 3BKYL 1WV7T 5DQDL 4KU1A 5AAWA 3QIBD 1VHPA 3WKNA 3QUYC 4LGRB 5DRNA 1H0DB 4P2QB 5IBUB 5FDWA 5E5RB 4Z0BH 5IVZA 5CD3A 1AR1C 3RJDA 4F7CB 3IJHB 1OP5K 1A1MA 1AC0A 1C5BL 5DF0A 3SCMB 3CU7A 4MCZA 1OSZB 4WO4B 4PV9A 1QQDB 3V0VA 1YECL 4AL8H 4TVSa 1CGWA 3OHXB 2FECI 4R4ND 2YD8A 4KJWD 5KG9A 4FOMA 3DYPA 1OAQH 3TNMA 1WEJL 1YY8A 3DETC 1CCZA 3A6BL 1U8OA 2ERJB 3C6SB 1LE9B 4F57H 5IIEA 2H2SC 4RMUA 1A1OB 4JDVB 2A77L 2WV3A 2E3VA 2KBGA 1D5MA 3BYYA 4Y2DA 3WHXA 4W6XB 3BGFC 3MGOA 2AK4D 1SEBA 3RWDA 4P23B 1P69B 2ESVA 3L6FB 1ZVYA 4QWWD 4KK8C 2ZUVA 4UTBH 4F33B 4ZOCA 2AS5M 4FTVA 1HHKA 2IADB 4U31A 4JG1L 4MGXA 3WBDA 4FXLA 5I19L 3HNSH 1N4XL 2R1WA 4F9LA 3QFJE 2VLLA 3IDUA 1R0AL 1FHGA 2NW2A 3NA4A 3S5LG 1J8HB 3LKSB 4O00A 1ZSDA 4Q97A 2X05A 4HUUB 1FDLH 1DVFD 3VXNA 4ZAKD 2VABB 1JVKA 3PL6B 4FFWD 4KJYA 3QNZA 1YYMH 4G9FD 1DBMH 1NKRA 3QDGA 3GSXB 1ZHBA 3JV0A 5HHOA 2PR4L 5DJCA 5KVGL 4MA7L 4P4KA 3L3OA 2AJXH 3UC0H 4YDJB 4ZUUA 5GZND 2VDML 3OKMB 3QEHA 1LK2B 5C07D 1AIFB 5HJ3A 3DTXA 4FP8L 4HUMB 3L9RA 5D2NE 3QXDB 4POUB 1FBIH 4ISVA 4MQTB 3IDGA 3F58L 1AC6A 1T5WB 3ZE0E 5D7LA 1G6RH 2FEEL 4IHOA 3QQ3B 4DUVA 2IQAB 4Z7VE 3GI8H 4GG6B 1TJHH 2VDPH 1JGEA 5KOMC 2FX8H 4BQCA 4EI5B 5B22A 4TNWK 5I30L 3RUGF 4XCEA 5IJVA 4UT9L 3OZ9H 2CRMA 3C6LC 5JO5B 4KAQL 2DKUA 2R56H 5EB9A 3OJDA 3U46A 1KYOJ 1GC1H 1VENA 5EOQH 2VL4A 2YWYA 5DT1H 4QHNA 3PABB 1PDKA 1MY7A 2PW2A 4U6TA 4FNLL 1DBBL 3G5XB 3RZWA 1MJ8L 2Y7QA 2VXSL 3HUJB 3QXTA 1XGQA 4NYLB 3AAZB 4NZRH 5E2UH 1OM3L 3IAPA 1CYGA 2ZG3A 2IANE 4HPYH 1PY9A 1QR1A 2JCCB 4Z7UE 4TTGA 4P59H 5HYIA 2XZAL 3CZJA 3H9HA 2PXYB 4M6NL 3VJ6B 4WENB 4TSAH 1A6VH 4V1DE 4N5EC 2IBGA 5IFAH 3BPCA 3I85A 3QUZC 3S3PA 1JZ7A 4JKMA 3RNQB 1IILE 4UT6L 4YFEA 4S1SH 4ELMB 1YNLL 3CDGA 3TH4T 1CGSL 4GSDL 4G6JL 1W2KT 3OG4B 4HFWB 3QIWB 4ZUTA 4JN2A 2DN7A 4U3CA 5E99H 3VFVB 3AREA 5I66B 3HC4H