2MQCA

Nmr structure of the protein bvu_0925 from bacteroides vulgatus atcc 8482
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
105
structure length
105
Chain Sequence
GHMGSPVSYYFSYADGGTSHTEYPDDSSAGSFILDITSYKKTGNSTKALSWNASGDSWIHVNGSSVSYDENPAKERRTGLVTLKQDESGKTLSLKIVQPGKTSID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title NMR structure of the protein BVU_0925 from Bacteroides vulgatus ATCC 8482
rcsb
source organism Bacteroides vulgatus atcc 8482
total genus 13
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13004 BACON Putative binding domain, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mqcA00
3VXMD 3KJ4B 3P0YL 1NFKA 3IF1B 4Y4KB 4U1GB 3QNXB 3ZT6A 3FB6A 3C08H 3GKWL 1UJTA 1TTFA 5EBLA 5DI8B 5AWNL 3QXAB 2F53B 4L9LB 2W0KA 4RBPH 4FQJH 1QRKA 1KG0A 3TPUB 5C6WH 5EOCL 1HH6B 1JWUA 2APWA 1T1YB 3VFWB 3TO2A 5MEOA 4MNQA 3RGVB 3CUPA 4WI9A 2Z8VC 4JFXA 5EOCJ 2H2SD 5IEHB 4PJXF 2FIRT 1FIGL 1ZGLM 1T03L 2CD0A 5HHNA 1HXMA 4V1DE 4LFHG 3OKEA 3T0WA 3WSQH 1CE6B 3KNBA 5IK3B 5ELIA 4L8CB 4DJMA 1UA6L 4Y4FD 1V3KA 4ORZC 5DVKA 3TBVA 1KCSL 1MLCA 4ZXBD 1G6RA 1RJZB 3DBXB 3ULVE 4G42B 3RY6C 2PTUA 2UYLB 2K7PA 3E0GA 1MHPL 2C3VA 2ZP0T 1DE4B 1GGBH 3ULUL 2UWEF 3QEGL 4ODWA 2VXVH 3MRNB 4KMTH 2P48B 1UT9A 1U9KA 2Z92A 4KKCD 3QIWA 3VGBA 3CFBB 1W72H 3H0TA 4KROD 1NCCH 2XACC 3NTCH 5I8EB 5DFWH 3IDYB 4XAKD 3QRGH 3QNYA 1KC5H 2FO4B 4YDKL 1OSZB 1TZIB 1WC7B 4FFYH 1F6FB 3FRPG 3DMMA 1FNGA 1IGYA 1J0JA 3PWLB 3L7FA 2GIYA 4QRTA 4Y2DA 5C0GB 1J5OL 1OAQL 4NHCH 3WE6B 5JDJA 3CSPA 3SQOL 1YEDA 3P40A 4I9WD 5ITFB 3V5HB 2DJSA 5GS3A 5T5FH 3VXME 1NGYB 4JKPL 5LXGH 3IAGC 1WEJL 5FUCC 1F5WA 2ADIB 2QQLL 2NY1D 1MCNA 5LWYL 4XNZC 4DN3H 4YHNB 1I8KA 1S9WB 4M3JA 3DI3B 1T7VA 3FN9A 1U8PB 4PB9L 4CVZB 4GRLB 4XP9L 4ZAKC 2X4UA 3BT2L 5BQ7A 1J0IA 3IGAB 5DUMH 1J1OL 3LRHA 4XWOD 2NNAB 4QHNA 3RVUC 2VLKA 5JHLH 2MQ3A 1MHHA 3G6AB 2FATH 2VL5B 2NLJA 3HE7B 4JANA 5L9DH 4M48H 4XHQA 2Q3AA 2FWOB 3VFTB 4OZHE 4U6VH 5JXAL 2X09A 1DQDL 4X6FB 4WUUB 1BM3H 2EO9A 3KXFB 1OAKH 4XPHL 3VWJC 3T0AA 1Z9OA 1TETL 2VAAB 1X44A 3CDFA 3QULB 3L7EB 4JM2C 3LKOB 1R3KB 3OZ9H 2IMMA 5E9DA 4YBQC 5EBWB 3MRKA 2HYMA 3UTOA 1TNMA 4JFYA 1GL4B 4JO2H 4M61A 2HFEB 2O93L 4EI5B 2X4RA 2FD6L 1OCWH 1V7NL 3Q0HA 4NRZA 4UT9H 5C2BH 1YQVL 4WTZA 5DLMH 4LLAA 4UNTA 3GM0A 4PJFB 1EBAA 5FOJA 1KSRA 2VZ1A 4OFPA 5EA0H 5D70H 5C0FB 3AB0B 1JPTH 1YJDL 1B0RA 4M8VA 2EXWC 4F3FA 4LSRL 2NY6C 1BLNA 3S4SB 2DQCL 1AQDB 2PYFB 5AYQA 3PWJB 1CN4A 2IQ9H 4MXQD 3T1FB 3QFDA 5D96B 3LRGA 1GOHA 5IFJB 2AJ3A 1EO8H 3LH2L 4XCYB 1K8DB 3TBWB 1HWHB 3WNOA 5KSBB 3I3BA 5BW7A 2AKRB 5DFTA 4LLQA 3MV7E 3L3KB 2VN7A 3QCUH 4FN0A 1SJEA 1BQUA 5A2JH 3T0DA 3CMOL 4AIOA 1QLEH 4RDQF 3FB6B 4NO0A 3REVA 1YECH 5EBLB 2RCSL 1WCBA 3FB8A 3VXUB 4X8JA 3KR3H 2YKLL 2W07A 5D7LE 1KG0B 2W0FA 5EC1A 1JWUB 4MNGE 1JGVH 1NMCC 3TO2B 4I77L 2DYPA 4MNQB 5MEOB 3CUPB 4JFXB 1ZWIA 3MLYL 4H0GA 1RIVH 1VA9A 4NBXB 2VLRA 3H6JA 5HHNB 1HXMB 3OKEB 2RGSA 1CL7H 3KNBB 4M1DL 3RVWD 1IAIL 4WV1A 3QUZC 5HHXL 5A3ID 3FO1A 1G7HA 3UBXG 5C2UB 3VGEA 3MA7A 4QGTA 5FUCE 3EOTL 1G6RB 5C7XL 1CFQA 1FLTX 1X5AA 3KG5A 5C07E 3RVVC 4YEEA 5JMRA 4P2QE 2OQJA 1VSCA 2C3VB 4ZTOL 3K4DA 3EOYG 4WI3A 1RHFA 4YHYB 4JR9H 4ODWB 3SCMA 1G6RL 4K94C 4WI4A 4HPOL 2VLME 1BBDH 4M1GL 1A3RH 5IW1A 3QIWB 3H0TB 4XZUA 3EO9L 1CXIA 5I30H 1D6VL 3ARYA 1AR1D 2NXYD 3QNYB 1OT2A 3STLA 3IJYA 1ACYL 5FYJD 3VFPA 4ACPA 3TPKA 2E9IA 1W72A 3DMMB 1FNGB 1IGYB 5KSUA 5BOZG 1ZA6A 3L7FB 4Y2DB 4QRTB 1OARL 4HMCA 1ITCA 2XQBH 3WIFA 1RVFL 3MRBA 3OMZA 1I3RA 4KQ4H 3FRUA 1YEDB 3BE1L 3HE6D 3NCMA 4TQEL 2BY0A 2AEQL 1BAFL 3TA3A 1J0YA 1JGEA 4QTIH 2YPVH 1OAXL 2YOCA 1MIML 3H3KA 4IRZL 3BVNA 4LSQL 4YEFA 1QD0A 5ID0A 1BQHA 1S78C 4NZJA 3DV6A 2XPGA 3K4ZA 3BX7C 1I8KB 3RA7H 3WNKA 2IAND 2N1KA 4UT7L 4ZG1A 1E27A 2Q20A 3D5OF 4OI9A 4K3JH 3CJJA 4TYUA 2JJTA 4HCRA 2X4UB 5BQ7B 3IFNL 4NZTH 2CUHA 4QHNB 5DR5H 2VLKB 1MHHB 2NLJB 1FH5L 4JANB 4NNPH 1VEPA 1U3ZA 1EVUA 3PQYE 3QCVL 3U36A 3V6OC 4LRNL 4NHUA 3RDTA 2X4NA 4I0KA 5F7FA 3BN9C 3IFPB 1FC1A 1LP9F 3HCVA 1R3IH 5J7CC 3V0VA 2ENYA 4AM0A 1LO3H 3QWQB 5E9DB 5IP4A 3MRKB 4JFYB 4M61B 5I17A 2X4RB 1SMAA 4ZUVA 5DVNA 4NRZB 3L6FA 4EOWL 2BCKA 3V4PL 1F58L 5B3JE 5HDQH 1UYWL 5CGTA 1TZGL 3A6BL 3OJ2C 4X7CC 3KLHD 1JGUL 4LIQL 1FZJA 3T2NL 5CUSH 3R1GH 2AJYH 1NEZG 5I1LA 5GRWA 1B0RB 4F3FB 1UJ3C 1BLNB 4G6ML 1AD0A 12E8H 3TJHD 5SWSE 4PRIE 1HIML 3GMMA 2FJHA 3BP7A 1EVTC 2CLRA 3OJDA 3UTSA 3JTTA 2B2XL 3QFDB 2A38A 5HYJE 5D5ME 2CKNA 2AJ3B 3R8BB 4U6TA 3ABZA 4ZTPH 2D0HA 3IRZA 3GI8L 3WDJA 1A6ZA 2N7AA 2IANE 1SJEB 2OLDA 5A2FA 4PP1D 3LQAL 1G9NH 1QFWH 1S3KH 1MCOH 4TRPL 2VQ1A 3DWTA 5AG8A 4NO0B 1K5NB 3REVB 1CICC 1UM5H 4KXZI 3GNML 1WCBB 2F54A 3FB8B 2Q6WA 2OS7A 3SOBH 4FQLH 4X8JB 3CFIC 4JFZL 3DYMA 5ESAA 2W0FB 3NPSB 3U1SL 5EC1B 5HHME 2Y6SD 5BV7C 3PP3K 4Z7UF 5C71A 2DYPB 4XGZA 1FQ9C 3HPJA 1ZWIB 2FJFA 1PY9A 1O7SA 3P2TA 4FFWC 2VLRB 1JE6A 1G1CA 3QIBD 5I1DA 3CXDH 1MOEA 3C08L 4WV1B 2W9DL 3FO1B 4MS8C 3L5WA 4NCDA 1PDKA 3ZZ1A 4DW2H 1G7HB 4JFFD 1J8KA 3MNZA 5FYLE 4FQJL 3BZEA 2HJFA 1CFQB 4D0DA 2QKIA 3AVEA 5DQDH 4R4BA 1KCUL 2BSSA 4R4NC 1PSKL 1PEZA 2OBGA 5MI0B 2OQJB 4JFQA 1FP5A 3QDAA 2BVPA 2YUXA 1RFDH 5DVLA 4LU5H 3U82B 3SCMB 3V5KA 4J1UA 5TDOA 3WSQL 3K7UA 4NQED 3I3DA 2VB5A 4FQIL 5IW1B 2IBGA 4XZUB 1EZVX 2NY4C 2HT2D 3G9VA 3U30B 5DEGA 1IQWL 3LKPA 4PJXA 2NTFA 3STLB 4OCSH 4O2FA 3IJYB 3VFPB 4P3DA 4MJ6A 1INQA 4JHAH 1W72B 4JY5L 4PJCE 5F7MC 5IHBA 5KSUB 5D2LE 1GGBL 1REIA 1ZA6B 2DLIA 1PG7H 3UO1H 3V6OE 2VDKL 4W4NA 2PN5A 4MD0A 1VPOL 3WIFB 3MRBB 4P5KA 2VQTA 4KMTL 1I3RB 4DCQA 1KULA 3FRUB 5D8JH 1W72L 1NCCL 4J3OC 2FX7L 3TA3B 3FO9A 1JGEB 2CUMA 1N5AA 4M7ZB 3QRGL 5I16A 3BVNB 1MH5A 4LPVA 2UWEA 3NN8B 5ID0B 4QHLA 1BQHB 2VH5H 3DV6B 1CD9B 2XPGB 1PKQB 4K94H 4FFYL 4K7FA 3RRQA 3RY6A 1BVLA 2A6JA 1CTNA 1EHXA 3LRSA 1E27B 2DICA 2PO6D 4NHCL 5KJRL 2OI9C 4NWUL 3SDAD 2ZUQB 2L7UA 4PJIE 4ZO8A 1VB9A 1Q72H 4IDLA 4DKFL 3BKCL 3HI5H 4XBEL 4DKAA 3GIZH 3EO1A 1E0OB 5C0RH 2GT9A 4HCRL 4OLZL 3BZFA 1KJ3H 1BQLH 4JFFE 4JREB 4MCZA 4OT1H 4IMLA 2DM3A 2QSCL 4XPBL 3ARSA 4DN3L 2DLFH 4HPYH 4XC3L 2GHWB 3U36B 1PG7W 5I71C 4XP5H 2ORBL 4NHUB 3RDTB 1MQKL 3MLWL 2X4NB 3EJZC 4CL7A 1QR4A 3HCVB 4XP4L 2J6EL 1H3TA 3V0VB 5ISZE 4FFVC 4AM0B 3PL6D 4Y16D 1KN2L 1R24A 1SQ2N 5I17B 3H8NA 3F7PC 1NCUA 4ZUVB 4HBCH 3JWOC 5AAWA 4M48L 4OSUL 2BCKB 4JDTH 4QNPF 2BRQA 3C6LC 1J18A 4B50A 4HSQA 3BWAB 3OR6A 4U1HA 4I4WA 4J4PC 1OAKL 1AH1A 1FZJB 5I8OH 3D6GA 5AZ2H 4LCWA 3ULVL 5I1LB 3QPQD 4JG0L 1AD0B 2BY1A 4OM1H 2FJHB 3BP7B 3LVEA 2CLRB 2H32H 3OJDB 3UTSB 1OCWL 3JTTB 1IT9H 4UT9L 1JIBA 2DLHA 5DLML 4WJ5A 1L7IH 2VSDA 2EXYD 5IFAL 2XKUA 3VWJA 1A6ZB 5F70A 2QQNH 1MF2L 3ZYZA 4JM2A 4NUJA 3WO4C 2VQ1B 3JBG7 3R06A 3T0BA 4NQDD 4NIKB 2F54B 4GAGL 3GBMH 2Q6WB 1X4ZA 5HD8C 4Y8DC 3F5WA 3DPBA 5ESAB 4ZSOE 1W2KT 4WWID 4WFGE 4HWBH 5HVGB 1CWVA 5EH1A 4RFOL 4XGZB 3SDYH 3HPJB 1CXEA 3SE9L 4FMKA 1I8MA 2FJFB 1IGTA 3TT1H 2OXGA 5I1DB 1EX0A 4X6CE 4P9MH 1Q38A 5BRZA 4C59B 3QFJE 5A2LH 5FGRA 3H7BA 1YECL 3L5WB 4YC2B 3B2UC 3MNZB 1KUMA 5JUEL 3KR3L 3JXAA 3BZEB 4HK3J 2HJFB 2AJZA 2BNUA 3K8LA 4D0DB 5GGVH 4XT1C 1UC6A 2QKIB 4R4BB 2BSSB 1SM3L 4CN1A 4JFQB 2DLTA 2BVPB 1RIVL 1N8ZA 2VYRE 1LO0H 4NN7B 3V5KB 3IETA 4J1UB 4BZ2H 3P30H 2LABA 4N8VA 5KAQF 5E2WH 5LGHH 1G9ML 5IBLC 5BV7H 4GRWF 5J3HD 3HAEG 3TZVD 4OLYL 3LKPB 4LCYA 4X7DC 2LU3A 5DEGB 2NTFB 3UC0L 1ZA3A 4JE4B 4O2FB 1MFBL 3QZWG 2E9JA 4P3DB 4MJ6B 1INQB 2DKUA 1IC4H 1FDLH 1XGUB 5DJ8A 5DRWA 2FIKA 1BGXL 5F9OL 4MD0B 3TNMA 5E6ZA 3QUYC 3MX0A 4P5KB 3MPCA 4U3HA 4DCQB 1MUJB 4O4YH 1A3RL 4R7DA 1RU9L 3QUZA 3FO9B 1QHPA 1R3JA 1N5AB 5I16B 3BSZH 1MH5B 2A73A 4KHXH 1J1PH 2UWEB 1KLUA 3D85D 3D9AH 1QRNA 3D39E 2APXA 3DOSA 1N64H 4JCMA 3VA2C 4K7FB 3UCRA 1JF6A 1BVLB 5DD5L 2A6JB 3LRSB 3IVKA 3OWEA 4WRLA 3I2CH 4Z6AT 4OZGF 1WV7T 4XPGL 4CBPA 4NGHH 1UEYA 4B5EA 1RIHH 5I2IA 5EZJA 4XHJC 2FLRT 5IIEA 1XGPA 4OLWH 3EO1B 3ZTJG 2GT9B 5LKNA 4H88L 4HXAL 3O8XD 4YO0A 4BQCA 5ACZA 4B0MM 3BZFB 1RULL 4MCZB 4IMLB 3UPCA 1I3GH 3RA7L 3GSVA 1CBVH 1CGXA 2XKSA 3S3SA 4J3WA 1EK3A 1ZKAA 2GSIA 4FHBD 4YBHA 1CS6A 1R24B 3EFFA 3FRPA 3U46A 3O4LE 1UACH 3BH9A 4WFHD 4WW2C 1X5ZA 4UTBH 4P5MA 1CTOA 5DMYA 2V2XA 2X9XA 3HNVH 4XNZB 1WSST 4K55A 2V5RA 5IR1A 4JKWA 5HSFA 4MD5A 3CVHH 4TVPH 3OR6B 4U1HB 1F4XL 2FEEI 2Z8WC 4I4WB 4M9PA 1QBML 4LCWB 1DZBA 1WUNT 5KVGH 1MVUA 4P5TD 1RUQH 1LO3L 3QQ3A 1FYTA 5K9QG 5CEZL 3HC0A 2AJXH 4ODHH 5CLWA 1NFDE 2LQRA 5T3XH 2KDGA 1PAMA 3ECBA 5F8QC 2IALA 4WJ5B 4OBRA 1ZV5A 1YEHH 1BJ1H 4AMKH 4HHAA 5IESH 5EFIA 4NPYA 3VWJB 3JWOH 3NIFE 5GZND 4LSPL 4CU6A 5FKAA 4I3SH 4JM2B 3C2AL 4OF6A 5IROC 1ZT7A 1FPTL 3MODL 4NUJB 3R06B 2GJ6A 3ZDXF 4HX1B 3BMWA 5E7BA 3RX7A 3LCYA 4KI1A 5BXFB 1JYVA 1VERA 3F5WB 4PRPE 3GDBA 4DK6A 1FHGA 3DARA 4UT6H 1EPFA 2QQKH 3OXRA 5CWSA 2YD7A 1I8MB 1IGTB 3CH1A 4ODXB 2Q3ZA 3BPNC 3K1DA 2NY6B 3CFJA 3VD5A 1S3KL 4HWBA 4X4XA 1WZMA 4WU5A 4CN6A 1EFXD 3CK0L 3FZUD 2VDNH 4M5ZL 2XZCL 1VCAA 3SOBL 3AS2A 3PP4L 3BGFC 2IBZX 4I0PC 4WENB 2AJZB 2BNUB 2DQHH 2DQDH 4OLVH 1UM6H 3MZGB 1KXVC 1C7SA 1F45A 1N8ZB 5DGQA 3ZKNC 3UYPA 4XPAH 3PE9A 5F6IC 3CXDL 3IETB 1YEJH 4JKLA 1WBXA 1N5YL 4N8VB 3QIUD 3P0VH 3EYOA 4MMZC 5DD0L 2D03H 5IGXH 4DW2L 1CICA 2VXTL 4IM8A 5BJTA 3QEQA 3BISA 4PJGE 4LCYB 3JWDC 3QHZL 1ZA3B 4P46D 4GKZA 1Z0MA 3CDCA 2B5IC 5CSBA 2DI8A 5DQDL 1OAZL 3B3IA 1NMCB 4HF5H 5DJ8B 1RFDL 3OKOA 5DRWB 2FIKB 2R0WL 3TCLA 3TNMB 2GI7A 3V95A 4NO5A 3O2WH 3QJFA 3OX8A 2XN9D 5CINH 2VL4A 2QHRH 1U8MA 1F90H 4KK9C 3FMGH 4GG8A 4R7DB 4MX7A 4K9EC 1EMTL 3QUZB 1P7QA 4HFUL 1MFDH 4GRWH 5HYJB 2E27L 5JORA 2A73B 5GS0C 1C8PA 1KLUB 1QRNB 3IJSA 3ROOA 2ZG2A 4YDLB 3VD4A 1JUFA 4XXCC 2VDLH 5CD5C 1A7OH 2DBLL 3P4OA 4JGUA 3UBXA 3IVKB 5SV4A 1Q0YH 2P5EA 4KHTH 5E2UL 5CGYC 1EXUA 5I2IB 4NC0B 5EZJB 3RPIA 3ULVF 3BUTA 1BD2A 1V7ML 5IIEB 1XGPB 1R6VA 4K2UH 2Z31C 2W9EH 4N8CL 3QR2A 4YO0B 1FE8H 2B7DT 1DQML 5ACZB 4K94L 2APBA 2X1OA 3VGDA 3WD5H 2X70A 3TN0C 3GSVB 5SWZA 4Y19A 4KKLD 4DQOL 4RBPK 3O2DH 4ZUUA 5TE6H 3TFKD 2GSIB 3KLAA 3ILQD 4KGLA 3GMLA 3EFFB 3U46B 1UKTA 5DMKA 2CH8A 3OPZL 3BH9B 4PD4J 5C0RL 5CJQH 2X41A 5CLTA 2WZPD 2YS4A 4P5MB 5HVFB 3LKNA 3PWPD 2E8ZA 1WIOA 2V2XB 2DLFL 4F33B 3VWKA 5IR1B 4KZEH 4MD5B 3FFCD 5FYLL 3QG7L 1YPZA 3B9KA 3DXAE 1MVUB 2AI0H 2MOVA 2XWJA 4X6DE 3D1MC 3MQIA 5T5NG 3QQ3B 4MA7H 5E8OA 2J2ZA 3EDFA 4BQ8A 1FYTB 1KTKE 2XN9E 1UVQA 3HC0B 5I15L 4KK5D 5BZWA 3VGGA 1DEEA 4JDTL 2HKFL 4ZODA 4BQ6A 2NX5D 1NCDH 3SKMA 3OQ3B 4QWWD 3ECBB 4Y4FC 2IALB 5E1HB 4BH7A 2Q8BH 4XCEA 5CBEA 3WFBH 4HHAB 2OP4H 5EFIB 4NPYB 3S6CA 3P4NA 1TFHA 5FKAB 2EE9A 1ZT7B 3K8MA 4KRNA 3UYOD 4WEBH 1KCKA 1U8HA 1LO5A 1U2CA 2GJ6B 1ZGLA 3H9SD 4OZHF 1NMAL 4JO4L 5JQ6H 5I0DA 2ATPA 4N1CA 4KROC 3NBNA 1YN7A 2FX9H 3ARUA 3BKJL 1N59A 2Q86A 3OXRB 5CWSB 4TULH 4F7MA 2P7TA 1CLYL 2QQNL 3MLTA 2R15A 2YXFA 3CFJB 4X4XB 1KXQE 5CJBA 5JA9A 4WU5B 2X1QA 3RVXC 3D3VA 4M9OA 2AXJA 3RBSA 5I1IH 4MA8H 2R0LH 4CVXA 4IJ3B 2FYYA 2CO6B 4HWBL 4FQQA 5L2KD 5J57B 3CDYA 3PWPE 2CMRL 1TXKA 4JQIH 2J7LA 2NY1C 3FFCE 2NY0D 5GIRA 1KELL 4LSVL 5ISZB 5ADOH 2D7OA 4P9ML 1WBXB 4CU8A 3WYRA 2IJ0C 3EYOB 1U8LA 4NQSA 1CICB 4QLRA 3U0WH 4MQTB 5BJTB 2XI9A 3QEQB 1LO2H 1IKFH 4JVUA 4BQ9A 4XWOC 2V5TA 1RQ5A 4GKZB 5GGVL 3U9UA 5FM8A 3HG1A 1SVCP 5C0NC 3GJFA 3B3IB 5BV7B 5C09A 4R0LC 2HFFA 3L3HB 1CD1A 2AK1H 5KSAD 3RTQD 2VO5A 3TV3H 3EYSL 3B5TA 2DKSA 3OKOB 4NO5B 3V5DB 3QJFB 5T1DL 1YA5A 3OX8B 3H3PL 2M2DA 3MLSL 5E2WL 3MJ8B 1U8MB 5LGHL 1KJ2H 5BV7L 4GG8B 4MX7B 3T1WA 3ARFD 1P7QB 1RK0A 5C08E 5JORB 5JW4N 2DB8A 2A2QT 2ZSWB 1I9RH 3N1FC 3VI3E 3HUJF 1JYWA 3IJSB 1HHIA 3ROOB 4EUPG 2ZUUA 1CIUA 1JUFB 1IC4L 1UB5A 5DWUL 1MAJA 3MCG1 3P4OB 1I1AC 1JYNA 1RIUH 4KJQD 3UBXB 5TGBA 3MLZH 1AXTH 2DL2A 5DUPL 3BD3A 2H9GB 2W9LA 1Z9SA 3HTLX 1I9EA 1EXUB 2DMKA 3RPIB 4D3CH 4X9HA 1BD2B 1S5HA 2NY4B 1C16A 3U7WL 4Z0XA 2Z8RA 3E1F1 4LSSH 3D9AL 1XR8A 5FYKH 3RZCD 2XA3A 3HAEH 1KLFA 1EBPA 3HC4L 2X4SA 2NMSA 2DIAA 3FQNA 1CXHA 1JZ2A 2X70B 1QSFD 1NLDH 4K3DH 4MXQC 1F4AA 4K9EH 3KJ6H 5SWZB 4Y19B 1JZ7A 4LGRB 1TTUA 2GUOA 3NFPA 4YR6A 3MLRH 5I1GL 3K3QA 4JPIA 3QUYA 5GS0H 1E6JL 1XIWD 5FM5M 4OCMC 3KLAB 3GMLB 1HNGA 5F7EL 4AQ1B 4BQBA 5DMKB 3MRLA 5FKPA 5FV2A 4HAFA 5E03A 5F1OB 4OFDA 2EH8L 2CK0H 4KI5D 5DK0A 4HLJA 1BWWA 3VWKB 3WCYA 3QHFL 4GT7A 3O3EA 5KVEH 5D7KD 2EICA 1YPZB 1OP5H 2OI9B 3B9KB 1I4FA 3SDXE 1JHKH 2XWJB 4YXKH 5TJWK 5DD1H 5E8OB 5FGCE 5KZCD 4Y2OA 1OTSC 2W1NA 4NFBA 2AAVA 1UVQB 3O2VH 4ZPVA 4KY1H 4EEEA 5BZWB 3SPVA 1LO4H 3ZTJH 1NDGA 3CXHJ 3SKMB 1A6AA 1NCTA 5A3IC 5DRNB 4BH7B 3UJTL 4XCEB 4M02A 5CBEB 2E7MA 5I71B 1NBVH 5EN2A 3T8XA 2DTMH 4UU9A 3P4NB 4HQQL 3MV9A 3HZYA 3EJJX 2DRUA 4IS6A 1U8HB 1LO5B 2AJXL 4YK4C 1ZGLB 4WW2A 4LSUL 4ZYKA 4RMTA 4U1MA 4OGYL 3JV4A 4S0SD 2ATPB 4NN6C 2DQEL 3P73A 1YN7B 5HVWA 4AMKL 1N59B 5IESL 2Q86B 5KBNC 3ES6A 2WBJC 4GJTB 3TVMD 1S8DA 4RWHA 4HJ0D 1BJ1J 4F7MB 2P7TB 2NY3D 1GOFA 4LSDA 4R8WH 3MLTB 4OCRH 3F62A 3MBED 3LPWA 1MCWM 1JF5A 3S5LG 3VFVA 5B3JF 1NMBH 3BP5A 5M95B 3GSOB 1NBQA 5I0ZA 1T20A 1V05A 3AM8C 5KSVA 3S3JA 4CVXB 2HRPL 4AT6A 4F9LC 4N9OB 2FYYB 3RY5A 4FQQB 1QPXA 1X5KA 4B53A 1CD0A 4KI5E 1P1ZA 2QQKL 4GH7B 3LHPH 1JVKA 2R23A 35C8L 5GIRB 2VDRH 4R2GC 3CFEA 3KYMA 1BFSA 2DOCA 5TE7H 5IVNA 3N9GH 3C8HA 4NZUH 5D5MF 5D7IE 4TUKH 5IROA 1U8LB 3UJIH 3WO4B 4NQSB 4BK4A 2VR5A 1A5FH 1OAYL 4UQ3A 2DQJH 5E99H 4Y4HC 3U9UB 5C1MB 2DQDL 1UM6L 3HG1B 2IG2H 4WNQA 3GJFB 5I1KH 5C09B 2HFFB 1CD1B 3QAZB 3MXWL 4R90L 3FQUA 4Z77A 2ESVE 1JPGA 1YEJL 3KPTA 3OBAA 5ID1A 4OD2A 5TF1H 3ZT5A 2D03L 5BZDA 3TIEA 1RK0B 1VGEL 4EN3D 4PJ8D 3INUL 3CPLA 1HHIB 3TC9A 4I0PA 2Y7QA 4HC1H 4AK1A 5B4MD 1KJ2A 1UB5B 4MZ2A 4HF5L 4GRWB 1HYRC 1I7RA 2HTLD 2BFVL 3ZL4H 5TGBB 1HK6A 2G5RA 3WFEL 4QRRD 5F6HI 5CINL 4N0YL 1BF8A 3RUGA 2PCPB 3KLHC 4H20L 2JJUA 4M6AA 1S5HB 5I66A 1C16B 4Z0XB 2P24A 2BNQD 4ZFZA 1XR8B 2X4SB 3KYKH 4U1NA 3FQNB 5D2NE 1QR1A 1KEML 5DJCB 3NFPB 4YR6B 3W81A 2VLLA 4JPIB 5CFHA 2XRAL 3QUYB 1CGVA 4KHTL 1R0AH 3VE0A 1FORL 1I7TA 4TVSa 3QZWA 4K7PX 5EO9A 3ZO0A 3VRJA 2SEBA 4S1DD 3MRLB 5C0BD 4KUZH 4Q9BA 5FKPB 2HP4A 2K1MA 2W9EL 3FJTA 4V2CB 4PJCF 5JR1H 3S36H 5GS2H 4OCNC 5D2LF 4K3HA 1YYLH 5JPNA 3QDGD 5JIPA 1XEDA 4WDIA 5BS0D 3UZEA 4WWKD 5LCVH 2BNRD 4YFLF 4WHTA 1D3CA 2J8HA 2BHUA 4XXCA 3O3EB 4KJWC 2MQCA 3VFNA 1OGAE 4PG9A 5D6DA 3CVIH 2C7UA 3DETC 5F9DC 1I4FB 5LQBH 2UY7A 4QXWA 3V4VL 2QR0A 4KRMB 1PVHA 3WEXA 1HYSD 5HHOA 2A77L 4DFIA 3VFRA 4IOFC 3IB4A 3TF7C 4ZPVB 1DFBL 1QFHA 1V5JA 4HIHA 2Z31A 3SPVB 1UH3A 1NDGB 1A6AB 1YZZA 4W81A 3EFDL 3TN0A 3KPQA 3CLFH 4WO4D 3OR7A 1C1EL 1YEIH 4OFKA 4N0CC 1D5BA 5EN2B 3QI9D 2H1PL 1MJ7H 3T8XB 2AI0L 3HR5A 3NA9H 4UU9B 2KKQA 3GBLA 4U3CA 4P9HC 4XCNA 3D87B 3MV9B 4MA7L 5MENA 3HZYB 2AJUH 1FCGA 3ARQA 4FQ1L 1NC2D 4KGJA 3THML 4FZEH 4IS6B 1MHCA 4WW2B 3ESVF 4ZYKB 1SYSA 5TPWH 4Y7MA 4U1MB 2CPCA 2NY2C 2KQNA 4G9DA 3JV4B 4YDVA 4NT6A 3MBXH 2BNQE 3P73B 5EU7C 3T65A 3WFBL 3MV11 2OP4L 1WZKA 5EUOA 3ES6B 1P2CA 4GLRH 2FGZA 3UTZA 1EUUA 4WW1A 5L8LB 3MCLL 2EDYA 3VFMA 1JTOA 2NY5C 3T2OA 3UJJH 1FFPA 3VFVB 1IAOA 3BP5B 4HEME 1T20B 5KSVB 5C0BE 3M45A 4HJJH 5IVXA 4YXHH 4PD4K 2GY7B 5JHDD 1BFOA 4Y4FA 4OD3L 4M7KH 3S37X 1URLA 1P1ZB 5BS0E 4XRCA 4ZXBA 4ZNCD 2R23B 3ARTA 5D7JD 5DJ2A 4ZFOL 5T1LA 5E6IC 3CFEB 5D93B 3ELAT 1E28A 3KYMB 2FGWL 2VDPH 3P3YA 3HNTH 1SHMA 4N5UA 1C5CH 1MELA 3B8YA 4PJEA 4DKDC 4OJFH 4U31A 2R0LL 1AJ7H 1Y0LA 4UQ3B 4DUXA 1CGSH 3U48A 1JP5A 5FYJH 4JPKH 3QA3A 4WNQB 4NFCA 4N90D 4OZIF 2QJDA 3VXSD 4KMQA 4NCC2 3S35X 3FQUB 4Z77B 3ZYJA 1JPGB 2DM7A 3RIFF 2VDMH 2V6HA 5ADOL 2XA8L 4PLNC 5T33L 3BPNB 3FT2A 5ID1B 3C5ZC 3QXTA 4OD2B 1BIIA 5DVMA 1JCKA 3L1OH 4JO1L 1P4BL 5BZDB 3TIEB 5FGSA 1RD6A 3BGFB 3CPLB 4B7LA 1QYGL 3WS6C 4I0PB 2Y7QB 2CXKA 5TE4H 1KJ2B 2VE6A 1HN1A 4X6CF 3VXRD 2WNGA 2BHYA 4GUPA 3TV3L 3SE8H 2FCBA 1I7RB 3UTTD 1CDUA 5GGVY 5IKCA 3HMWH 4HC1A 3E6HA 1AGFA 4HKBA 3VXNA 3RUGB 3T4YA 8CGTA 1VFAA 1LK3H 4IBLT 1L7TH 3NH7H 5GRXG 2P24B 4FRWA 1YEEH 4ZFZB 1K9TA 3P11L 4KTYA 5AD0A 4FMFA 4U1NB 5DXWA 5KVFH 1T6VN 3FONA 1QR1B 4R0LA 5DJZA 4MAYC 1QFPA 4RFEA 1W0YT 3UAJD 3V7AE 4Z7WA 2VLLB 1V3MA 3JWDL 1RSFA 3HUJA 2VXSL 3QUKA 3VE0B 1I7TB 4M1CD 5D1QD 1T83C 1A9BA 3QZWB 2HTKC 5EO9B 5I76A 1BJMA 3VRJB 1A7PL 2SEBB 2P1YA 4LSSL 5IMMA 5FYKL 1TQCC 4NUGH 5JPNB 2ADFL 1Q9LB 4DFHA 4GG6A 4EUPH 2D2OA 1A9EA 4I2XA 4WDIB 3LZFH 4N0UE 5IQ9A 4G7VH 1JNLH 1OHQA 4WHTB 1NLDL 4K3DL 1S9XB 1FJ1A 4XCFH 5MEQA 3VG0L 1MAKA 2OR9H 2AK4A 1I1AA 3VFNB 4PG9B 4P2OD 4XBPA 5GS0L 2C7UB 4JN1H 3GRWH 2MCPL 1TJGL 4FQCH 2QR0B 1M71A 3WEXB 4B7IA 5HHOB 1J11A 2APFA 5HDBE 3VFRB 3RHWF 1IKNA 1ZMYA 2R0ZH 3Q6FB 5GRZA 3BAEH 2Z31B 4HIHB 1UWXH 4R4FH 2CK0L 5EZIH 5DD3L 4O9HH 1OL0A 1NBYB 3TN0B 4NN5C 3KPQB 4X4ME 5KVEL 1PQZA 3OR7B 1TENA 3NFSH 1INDH 3VXRE 1D5BB 5DUBA 4KVCH 3EYQC 3RFZC 1A47A 3HR5B 4KTDL 4XCNB 2X89A 3G6JE 5MENB 4LPYA 3MROA 5FXCH 1HINL 3HMXH 1MHCB 2FRGP 3CFCL 5JW3L 4OUOA 4M93C 4ENED 2DJUA 5I1HL 2EIBA 4JRYA 1SYSB 1LO4L 4GMSH 1Q1JH 4G9DB 4YDVB 3DVFA 3MV8A 4NT6B 2F58L 2VAJA 3VFSA 3BFOA 5C3TA 4PRBA 5J3HC 3T65B 5HPMA 5EUOB 4XNMA 4JKMA 1P2CB 2Z35A 5IVZA 1JPSH 3TO4D 3IAPA 3UTZB 1AXSA 2CJUH 4WW1B 4APQD 2UZYB 3VFMB 3LN5A 2V5YA 1FFPB 2GK2A 2HN7A 4K23H 1IAOB 4EIZC 1K85A 1ZVSA 2C3GA 3QDMD 3O6KL 2WWKT 5IVXB 5HDOA 1BFOB 5IG7A 4Y4FB 2P47B 4F58L 5FIEA 4JJHA 3RKDD 2PKDA 4XRCB 1FNSH 4A2LA 4ZXBB 5DJ2B 3DX9A 5T1LB 1E28B 1NFDF 1P84J 3QEUA 2Y5TA 4PJEB 1IGCH 1Y0LB 3ARGC 1TVBA 3WFCH 1LEIA 3QA3B 1U8KA 1JWSB 1IRAY 4KROB 3NIFF 4HGMA 4UDUA 4ALAL 1FZMA 1DP0A 3CXHK 2WBJA 2FR4A 1MFCH 4WGVB 3O8XC 4NP4L 3RWGA 3FN0H 2VDRL 4W6YB 3FT2B 5TE7L 1G7IA 4DZ8A 4CDHA 4KQ3L 1BIIB 1ITBB 1G6VK 1OAUL 3MRHA 4AEFA 3HC3L 2DQJL 3WKNA 3HE6A 3AM8A 2D0FA 3NFNA 4KJYA 5HGAA 3F7RA 4F9LA 3PNWA 5L8JB 5D72L 2VE6B 4X5XA 3BRFA 1F97A 4GUPB 2NQCA 5C92A 5J0BA 2NY1B 5I8KH 4MQ7A 4C56E 5IKCB 3E6HB 1A3QA 1AGFB 5TF1L 4HKBB 4K07A 3RL2A 3S7GA 3VXNB 4NZDA 2RQ8A 3T4YB 1VFAB 2MNUA 4RGND 4P5TC 1E4JA 5EZLA 1IMHC 4Y4HA 4ZUTA 1DQLL 4ODSH 4HC1L 5AD0B 2IMNA 2LV4A 2XKNA 1FGNH 1IC1A 3FONB 4PJ5E 2P43B 4G8EA 4R0LB 1CDCA 5DJZB 1GC1C 2ATKA 4RFEB 3ZL4L 5A16A 4Z7WB 3AMKA 4LCIH 2QQQA 3MYJA 4LQ1A 1MCLA 3QUKB 4OKDA 2M8XA 4PJGF 1T2XA 1Z0NA 1A6WH 2H6PA 1A9BB 4H8WH 1T1ZA 5SX4I 5I76B 3ARDD 3ZYOA 1D9KD 1PZUB 1DUZA 5IMMB 4F2MA 4WGWB 3WKML 2KZWA 2NYYC 2Y1VA 1U92A 3KYKL 4GG6B 1HHJA 1A9EB 1NGPL 4I2XB 5IQ9B 4BH8A 3CU7A 1OM3H 4QXGH 5IMKB 4RFNC 5GS1C 1FJ1B 3SDCC 5MEQB 3BD5A 1Q0XH 3SKJL 2AK4B 1I1AB 1MREL 4UTAL 2W65A 2Z9TA 4XBPB 2H26A 5IQ7H 1ZS8A 1NQBA 4EUPA 3MZTA 4PJDA 1M71B 4ELMA 5JZ7C 4EBQH 2BP3A 4NJ9L 1MJUL 1KPVA 1RZGA 5T1KA 3U7YH 3S36L 1IJ9A 3D25A 3GRWA 1YYLL 3KYAA 4K71B 3P4LA 3HB3D 1JNNH 3FZUC 3GIVA 3DVNA 2ESVB 1H5BC 4XCCL 3SN6N 5I1CL 1PQZB 1PZ5B 4OM0L 5C0CA 3O9WD 4L8SC 4P3CH 5DUBB 5LQBL 4E9LA 2B1HL 3GFUA 3NCJH 4JQXC 4M6OH 1B0WA 3MROB 3RX5A 2CLZA 4K3GA 3LPGA 1OWWA 4P2RE 2BSED 1Q8MA 4JRYB 2HLFD 3QIUC 5BCAA 2OJZH 3MV8B 4HIXH 3VFSB 4TOYH 1QUNA 1OD7A 3HMXA 4PRBB 5L88L 5HPMB 4KH2A 3Q1SH 3CLFL 4OCLC 4XNMB 1AI1H 3SKNA 2Z35B 2EZ0C 5IVZB 3U0PA 1PBYA 1AXSB 2K9UA 3NA9L 4OV5A 1Z6JT 5GRJH 1X5HA 5CILL 2HN7B 3X14A 4YXLL 2XY1A 1ZVSB 4TSAH 4WFED 5TPWL 3QQ9C 4QOKA 1WIUA 2Z91A 4BFEA 5IG7B 5HI3D 1KEGL 1FIEA 1K6QH 4YWGL 1K4DB 5BMFL 4K3EH 3F7QA 4X6DF 2BK8A 1SY6H 1JRHL 3T0ED 1LGVA 4K8RD 3DX9B 1S7SA 1J0KA 5HVHC 1KFAL 3QEUB 5FO9A 3BDYH 5CAYB 3MRRA 2Y5TB 3A6CH 4YK4B 1YEGH 3EDDA 1A7QH 1TVBB 4HJJL 4NQEA 1LEIB 2BY3A 5J12B 1U8KB 1I9IH 3BGMA 4UDUB 1FZMB 1M4KA 4UIKL 2DL9A 5F3BA 1CGYA 3RNKB 3DLQR 2WBJB 2FR4B 2EDDA 1CLZH 3LOWA 4NCC1 3RWGB 3OF6A 4IOSD 5SV3A 4CMMA 5GRVK 4NQXB 1INEL 2VDPL 3GHBH 4S1RH 1G7IB 4DZ8B 3NCYP 4MQXD 5D1XD 1T4KA 5D1ZC 2GKIA 1C5CL 4DN4H 1PY4A 2DQIL 4PJAF 4OJFL 1ACZA 3MRHB 3DTXA 1E4XH 1CF8H 1AJ7L 2XTJD 4LHJB 3NFNB 1ZHBA 3N85L 5FYJL 4JPKL 1WVZA 5HGAB 5IHUL 3PNWB 3ZSSA 2R9HD 3IT8D 4Y0GA 3CLEH 4X5XB 3AREC 3S5LA 5T3ZD 1KTRL 5C0JA 3G5YA 4OTXL 2VDML 1BJ8A 3BESR 4U1GC 3P9MA 4MQ7B 3VMPA 2Z93A 4P23D 4XWGH 4R2GB 2F74A 3RL2B 3L1OL 4L9LC 3O6FC 1E6OH 1TCRA 2PO6A 4OZIA 2ID5A 1BZQK 1I9JH 5EZLB 3SDAA 5KN5A 4NQCD 4WI2A 4Y4HB 4ZUTB 5FA4A 4WFEE 1XCQA 5FCSH 4YX2H 4G8GA 2XKNB 2R4RH 1EAJA 4G8EB 1F3DH 3HI1A 4N0RA 2ATKB 5A16B 4M4RA 3S34H 2OTUA 1KCRH 1FNFA 3GK8L 3MYJB 4GMTH 3T0EE 5GHWL 3C5ZA 4UOJA 2H6PB 1T1ZB 3SE4C 5IF0A 2XG4A 3NH7L 5ALBH 1OLZA 4XNUH 2AEPL 2X42A 2Q87A 5CGMA 4G7YL 1UM4H 1HHKA 4F2MB 5F72S 1U92B 3LEYH 3REWA 3PL6A 5DQJA 3WS6A 1YY9C 1HHJB 4YE4L 1ZT1A 4ETQA 3L5IA 2XIDA 1IAMA 3ROLB 1AQKH 4Y4KD 2W65B 2H26B 4Q0XL 3B9DA 1ZS8B 4EUPB 1BEYH 4PJDB 4ELMB 4YUEL 5ECJE 1KJVA 3VI3F 5EUKA 3K74B 2F53D 2YC1A 4PTTA 3BUYA 1KPVB 1RZGB 2ZCKH 4HUUA 5T1KB 1QPPA 1O0VA 4F8TA 3QUML 1J88A 3D25B 2OJEA 3NIDE 5ENWA 4OD1L 8FABA 3LZFL 3KPSE 1HE7A 4G7VL 3RGVD 1JNLL 3GIVB 3MRQA 3DVNB 2R1YA 2HVKA 2HKHH 4PJBE 4CU7A 5C0CB 4JHWH 4PJHE 1YNLL 2EECA 3RWEA 4FQCL 3BPCA 4WUKH 4M6MH 4ERSL 5HYSG 3ULUD 5IB2B 1T83A 2CLZB 3BWUC 1VADA 4ZOAA 5EOQL 2R56H 4XNXL 4NQCE 4AZ8A 4NQDA 1OTUC 1QSZA 2OSLA 1S9KC 1DBBH 2YSSA 4ODUA 3SKNB 5IEKA 3PWVA 1UENA 3U0PB 4OAWA 3ETBF 3N0PB 4KK8D 1I1CA 4OV5B 3WS3A 4LAQH 3GMRA 2P4AB 3EUUA 1GIGL 3L5XH 4DVBB 5AZEH 3MTRA 3WFHA 3X14B 5GGSY 4PPTA 4QOKB 2Z91B 3BGAA 3W0WD 1BVZA 5KG9A 1PYWA 2R29L 4GBXD 3ARFC 5I19H 1A7BA 2JF1A 2AJVL 3LS4L 3MLXH 4ODTH 3SDXF 2I60H 2X40A 3FTGA 5J11C 1S7SB 4X80L 4GKOA 2JCCA 1MCWW 4ZNEE 1B90A 4E0RA 4M6NH 4NKIL 3G9AB 3GSXA 3LS5H 5FO9B 4K23L 3MRRB 4HFWA 5ACMA 3WUZA 4U33A 2JJWA 2H8PA 1QBAA 2F53E 3RJQB 1DL7L 5ANMA 3QJHA 3E8UH 2NY2B 4NQEB 4OF3A 4UBDD 4P9HL 1MAMH 1OTTD 1FN4A 5I1JH 3BGMB 4GRLD 1FNSL 5F3BB 5F1NA 1JN6A 1MRDH 3MXVL 4CMMB 3JV6A 2YD3A 4XVSL 2EO1A 5DFVD 2O5ZH 1T4KB 3O0RH 1OW0C 3HE7D 2RHEA 5M94B 1IGCL 5D96C 2HT3D 1CK0H 1GAFL 3DTXB 5C9KA 1MIEL 5J9PA 4ONOA 4KFZC 4KK6C 1I85C 4WUUD 2NY5L 5E70A 1FLRL 1T7WA 5E6YA 3S5LB 5C0JB 1A7NH 3FN0L 3G5YB 5T1MA 5IMOB 1S7TA 3P9MB 3RNQA 2FDBP 2Z93B 1UCBH 4YPJA 5GGUA 2DD8L 2Y36H 2F74B 1FZOA 3EJYD 4EI5D 3R0MA 3VFOB 1TCRB 4GO6B 4OZIB 1P9MA 3SDAB 4KI5F 5KN5B 3TEUA 4G43A 2Y07L 3M1BA 4JZNA 5FA4B 1XCQB 1ZXQA 2YRLA 2BXZA 1U41A 2XZQH 1EDQA 2AJSH 4G8GB 1W8NA 3MUZ1 3HI1B 1ZTXL 2R0KH 3B5GA 5D7IF 3MRPA 3O8XA 5EU6D 5I8KL 3W2DH 4D9QD 4PJ9D 4DGIH 2OTUB 4X9IA 5IV2A 2BDNH 3C5ZB 2B4CC 4P49A 4PG2C 5C0AD 1FC2D 5IF0B 2J8UA 2ED8A 5EIQA 1P84K 1HHKB 4E41A 1SEQL 4ODSL 4U4BA 4M7LH 3REWB 2HWZH 3PL6B 5DQJB 1NAMA 5KS9A 4XH2A 1FGNL 3AXLA 4BJLA 1ZT1B 4ETQB 3IRPX 1ED3A 3VMNA 1JF1A 1XGYH 2OMBA 4UV7H 4LCIL 4YQXL 2DIJA 1OPGL 4F7EA 3MLVL 1KJVB 4O58H 5EUKB 1OSPL 3FQWA 2YC1B 1RI8A 2P5WD 4PTTB 2H45A 4YIQA 3VXUD 4HUUB 5KW9H 1G7MA 4P5TA 5ENWB 4F15C 2D7QA 2OJEB 4DAGH 3MBEC 4AG4H 3GSRA 8FABB 5ALCH 3DMMC 5GSRA 4NC2B 4QXGL 3MRQB 2YEZA 3I75A 1Q0XL 2OK0L 2R1YB 2HVKB 4WUUE 3KXFE 4A6YH 1WZLA 5IQ7L 5IT2L 3DYPA 3RWEB 3BPCB 3ARBC 2GTWA 3RBGA 3TT3H 5CP3H 1Z3GH 3S97C 2NR6D 2D9QB 3U7YL 1VADB 3N1GC 1IC5L 1D5MA 3B9EA 4U2YA 1TQCB 2H2PD 1HSAA 4Q9QL 1MSPA 1JNNL 4R97B 4PJFE 4NQDB 2O61A 2NTSP 4X7FC 2OSLB 3SDCA 4S1QL 2YSSB 4PV9A 4ODUB 5IEKB 1MI5A 3PWVB 4OAWB 4J3VA 1TJHH 4JVWA 5E8DH 3AUVA 1FAIH 4G3YH 3WS3B 4D9QE 3GMRB 1CFTA 2ZCHH 2ILLA 3WFHB 3IXAA 3L3GA 1GOGA 4JB9L 4Z95H 3P9LA 4MAUH 2OJZL 5KANI 1OOAA 2W0LA 4HIXL 5KG9B 4Z7VA 3ALPA 1PYWB 3ORJA 4Y2DD 1EFXA 5KSBE 4I3RL 3Q1SL 5I9QC 1GZPA 1H5BA 1NANH 5C86A 4NN5B 1JPFA 4OLXH 3FTGB 4N9GA 2IH1A 4L8SA 1MRFL 2GQHA 2JCCB 4JQXA 4AQOA 3QXUA 4E0RB 2VWEC 5E08H 3GSXB 1IC7L 4HFWB 5CCKH 1X5GA 4M93B 1IGIH 2H8PB 1MFEH 5ANMB 3QJHB 4PRNA 3QIUA 2XG5A 1J0HA 1FN4B 2VJXA 5I1AA 1NH6A 4Q58C 5KTEL 4KVNH 2HT4C 4MNQE 4PUBL 3W11C 2FH6A 5F1NB 2VSCA 1JN6B 1HZHL 3RVTC 4P46A 2HLAA 1J7VR 4CJ0A 4TUJA 3S88H 2JK5A 4X6BA 4FABL 3BDYL 1MWAH 3A6CL 4P4KC 4G6JL 2R4SH 5FHBH 4FTVD 2DWDA 5J9PB 2OZ4H 1I1YA 1FBIH 1B2WL 4UIMA 3MO1A 1ULVA 2ICWJ 3MOAH 4PLJC 2BERA 3E3QC 4QHUA 3KLSA 1T2QL 4AEHH 1CLZL 5T1MB 5EPMA 3V0WH 1S7TB 4GAJH 4LGSB 1H0DA 3RNQB 3J7HA 3ZKMD 4R6UA 3GHBL 1UFUA 1YMMA 5GGUB 1DBKH 1FZOB 1YEFL 3MCKA 4GXVL 4JDVA 5L2JA 1E4XL 4OLEA 2ZPKL 3I02A 3OKLA 3NPSC 1KNOA 3ARGB 1H9VA 4G43B 4JZNB 1Q9KA 3M1BB 4R26L 1XF2A 3LB6D 4WEUD 4NKMA 3CLEL 4HLZG 4BSJA 4JO3L 2AQ1A 2J4WH 1A6UL 4DOHB 2EIZA 1VEOA 1EJOH 4XAWH 3MRPB 3SQBA 3O8XB 4JQVC 5IW6A 1KV3A 1WZ1H 1NC4D 3V8OA 3WXWH 4EKXA 2WUBH 3IKCA 5IV2B 3TIDA 1YUHB 4FG6D 5D1ZA 5GZOD 5FM4A 4RMQA 2J8UB 3QI9C 1QACA 2B0SL 5AG9A 2PXYC 4LVEA 4P59H 4E41B 4YHLL 4OF8A 32C2A 3PUCA 1QSEA 1JYXA 4KV5E 4PLKC 1NAMB 5KS9B 1U8QA 4XH2B 5BOPA 4OCYL 4M7JH 3AXLB 2V9QA 5JMOC 3AREA 1ED3B 2G60L 4NC1C 1JF1B 3SGJA 1N4XL 2XTLA 5JIIA 2F5BH 3BKYL 1KCRL 1F3DJ 2YD6A 4BK5A 4OGAD 1NAML 2VLKE 3FQWB 3O6FA 3QDJA 3JSSA 4JPWH 4YIQB 4HGKC 1DBAH 2EC9T 4P5TB 2DTSA 2NZIA 3RI5F 2A83A 1G7JA 3Q2CA 3LEYL 3GSRB 2DYPD 5GSRB 1B4RA 2YEZB 1L0XA 3I75B 2VLRD 5I8CA 3MRGA 5IMLA 1IQDB 2GCYA 3MJGX 2NX5A 3TJEL 5TDNA 2IFFL 4ZPTA 1BEYL 2GTWB 5GXBB 2NZ9D 3TA3C 2UUDH 1UXWA 5E9DE 3CIQA 5CHNA 2C3HA 1NDMA 2ZCKL 5F96L 3SE4A 3VCLA 4LP4A 4LIQE 4ISVA 1GC1L 3UYRH 1QBBA 2VWEE 5EO0A 3SJVA 1D5MB 1AGCA 5FCUH 3NIGE 1HSAB 3PHSA 2BSTA 3QP3A 1J9CT 4X9BA 4LKCB 1AC6A 2O61B 3H9SA 3O6LH 4MXVF 4RFNB 4ZMAT 3SDCB 4PV9B 5DT1H 1MI5B 2VLJA 3WUWG 2F9BT 2ZUQC 3V52H 3Q5YA 3K2UL 1KGCD 4JFPA 4UILH 3BMVA 5TQ0H 1CFTB 1DVFC 2JIXD 2XZAH 3MFGB 4XPFL 5F7YC 2YK1H 3IXAB 3MJ9H 2V9RA 4JREC 1L6ZA 7FABL 4Y1AD 1QQDA 4Z7VB 2IH3A 1EFXB 3CH8A 1SBSL 1GZPB 1H5BB 1JPFB 4ZO9A 1ROWA 3E3QE 5K93A 4N9GB 2IH1B 2LU7A 4L8SB 4MVBC 4Z7QF 1IEHA 3ESUF 5DZOA 4CKVX 5L2KA 4OCWH 3WNPA 3AY4C 4Z76A 3FT4A 1NSNL 3FOMA 4IRSC 5I75C 4JPVH 1JFQH 4TPRH 3IJHA 4PRNB 3QIUB 1JZ4A 1ZEAL 4HZLA 4Y5YC 4JFDD 2BZDA 3MLXL 1RZ7L 2EDKA 4WTXA 3G6JF 3FQTA 4OB5H 2VLRE 4P46B 2HLAB 1T7XA 2A0LC 3WNLA 3BP4A 2C3XA 2JK5B 4X6BB 4XX1E 3LS5L 3O6ML 1VEMA 2ZOKA 2LAAA 4N0FA 2V5MA 3PHQA 1N3NA 4XNYH 2DWDB 5D6CA 1I1YB 4ODVH 4AEIH 4U7MA 2WUCH 4UIMB 1DLFH 4XC1L 1A6VH 3MO1B 3ARFA 1MWAA 2J8OA 2D0GA 2X4TA 4QHUB 4Y89A 1A3LH 4IRJD 1RAMA 5FV1L 5EPMB 4C4KT 1UWXK 4HIEA 2OZ4A 1H0DB 5INDA 1YMMB 3ZSTA 3E2HC 4U6YA 1KGCE 3MCKB 4JDVB 2IGFH 5HVHB 1DUYA 4YLQT 3ULVD 1CK0L 4UDTA 5L2JB 3U4BH 5FUOL 1H3UA 3I02B 3OKLB 1KNOB 4D9RD 4HV8A 2KH2B 1Q9KB 3WXVH 4KKBD 1FVEA 1EJ6A 4NKMB 5LGKA 2EIZB 3RZCA 1LNUA 1KB9J 2OR8A 3HZMA 4MZ3A 3ME0A 43C9A 5IW6B 4XVJH 2Y06L 2BVEA 1QSVA 1UCBL 1N6QL 4J6RH 3IKCB 4H26A 3TIDB 3ARPA 1QSFA 4YC2C 1YYML 1RUPL 5D1ZB 1WITA 2NCMA 5HI4D 2AGJH 4DGVH 4KAQL 1XIWA 5CZKA 32C2B 4FQXC 4AH2A 4OF7A 1QSEB 1DBJL 3RL1A 1U8QB 3CSBA 5CKGA 1XAUA 4HH8A 1CFVH 4ZUWA 5HJ3A 3AREB 3UZQA 3BQUD 3QYCA 1WAAA 3L5JA 2ICES 1IGFH 3S37H 3TP4A 2J12B 1TDQA 4LLUA 3H42L 3CU1A 3DNKA 3O6FB 3QDJB 3TO4C 1CDHA 4PGCA 3DSFH 4LHQB 5M7QA 3IS1X 2A83B 1G7JB 2XY2A 4L4TA 5E2VH 1T66C 2HWZL 2VN4A 4LDEB 3SGEI 1IFHH 5E00A 2HVJA 1T1WA 3VG9B 1XGYL 1U3HD 5CZXD 1T89A 3IDGA 5I8CB 3MRGB 3MRDA 4JFEA 4KUCF 4LF3A 2GCYB 3M8OL 2NX5B 3S35H 5TDNB 5K9QI 4ZPTB 3G5ZA 3ZE1E 1EIBA 1UXWB 4O58L 1FFRA 1U42A 4PG2A 5CHNB 5AUMA 1NDMB 3TYGL 3VCLB 4ISVB 5KW9L 5EO0B 5TF0A 3SJVB 1AGCB 4DAGL 2CRYA 2WWMD 4AG4L 1IAIM 5ALCL 4QRUA 5EBGA 1FV1A 2BSTB 1UKSA 3RAJH 4D9RE 2BVTA 1RUKL 3H9SB 3BKMH 4AL8H 2VLJB 4KXZH 1VFOA 1B3JA 2QADC 2MCG1 4JFPB 4EVNA 1FGVH 4Z9KB 1U58A 4I18C 4OBSA 2QSTA 3TT3L 3GMPA 4D9LL 5FOBA 1Z3GL 4YHKL 1A0QH 4XMKH 3TWCL 3UTSE 2PETA 3WNNA 3HN3A 4X7SH 2BXYA 5FUZL 3HFMH 3MBEA 5FA3A 3PXHA 3IDXL 1QQDB 4RRPG 3LPFA 2IH3B 3D2UD 3MJ9A 5TFSL 3ZKXC 4GAYA 3KWWA 5CJ5A 5FEBA 3LIZH 1TJHL 5E8DL 3C09C 4G3YL 1MJ8L 5L2KB 3ARBA 2ZCHL 4Z76B 2YD5A 3FT4B 4MMXC 3Q6GH 4EIGB 4Z95L 3O3AA 3FOMB 2F54E 4HWEH 1NUGA 3MV7D 3NZ8A 4HZLB 4FQ2H 5HYSA 3QB7C 5EO1A 4GW5A 3FQTB 2BJML 1UWGL 1ZLVH 2D7MA 4IMKC 3G5VA 3DX8A 4NM4H 3ISWA 3BP4B 2V2WA 3X3FL 5E08L 4JVPA 5D7LD 3GSWA 2ZOKB 1RZFH 4N0FB 4PB0L 1MFEL 3PHQB 1YNKH 1N3NB 3HI6L 3W5NA 5D6CB 1F8TH 2BRRH 4TNWK 1S7RA 3GJEA 5CZVL 3ARFB 4KVNL 4RX4D 1MWAB 1RURH 2X4TB 4PV8A 4PJ8A 3LN4A 5FHAH 5J11B 4OV6F 2DKMA 2NW2A 2CLVA 2FJGA 5INDB 2Q1EA 4LPWA 4U6YB 4MD4A 4RWYL 1MWAL 3DJ9A 1DUYB 4DGYH 4UDTB 5C07D 5E4EC 3QPXH 5GJTL 1G9NC 4FXGA 5FHBL 4PJXE 4P2QD 4QRRA 1X6LA 2OZ4L 4HV8B 2IPTH 1U3JA 1FVEB 3MOAL 3WFDL 5CEZD 2ZOLB 1IGML 3KPLA 1RMFH 1HNFA 5E0QA 4ZAKD 2VLMD 1LNUB 3RZCB 5D71L 2XV6B 3V0WL 3HZMB 43C9B 3HB3C 4UNUA 5DZNA 1DBKL 4H26B 1F4YH 3OXSA 1QSFB 4YFEA 1WWBX 2WBKA 5KOMC 4EJ1C 4P4KA 3HHRB 3PG2A 3OL2A 1GZQA 5F88A 2UWEE 5GRUH 4AH2B 2H41A 3CC5A 2FEDC 3V4UH 3RL1B 4GFTB 3I9GH 4FQPA 4JRXA 4ZUWB 5HJ3B 4NQTA 3VWJD 4TSCL 2MKWA 4DTGL 4WHYG 4XAWL 4LPCA 3V9FA 3OAZH 4F7PA 3QDGA 1WZ1L 3L9RA 4G5ZL 4LPUA 4M7LT 1AD9A 2BNRA 4LLUB 2PTTA 4OLUH 4JFHD 4M43H 3KPNA 3CAFA 1NUNB 4PGCB 3IDUA 4MWFA 5CJOH 5JOEA 1OY3B 5FYKU 1HDMA 4HWZA 4L4TB 5F1KC 4LARH 2OL3H 2WK2A 4IEFB 1UZ8A 5KZCB 1JRHI 2HVJB 4HLZH 3MLPA 4ZQKA 3IDGB 1MRCL 4PJ7A 1WCQA 2EXWD 5HPOA 3ZTNH 2NY6D 2F5BL 3I3EA 3MRDB 4JFEB 4LF3B 4JQVA 3JV0A 1OGTA 4HGWA 2A1WH 5ICZA 3G5ZB 1UWEH 4KPHH 4WO4A 1CQYA 2BOBA 2N56A 5AUMB 1B0GA 3TBVB 3GBNH 1AFVH 3PQYD 1MLCB 3HNSL 3QI9A 2F8XC 2PXYA 1VACA 4HT1H 4YDLC 2B1AL 4QRUB 1FV1B 4UI2A 2YPKA 1NC2A 2I26N 4FNLH 2B4CL 4P2YA 4MHHG 5CEZE 4LCWE 4TSBH 4MJIA 1J0ZA 4EVNB 4G9FA 4HAGA 1U58B 2Z92B 3CX5J 2A6KA 3T3ME 3GMPB 3V79C 3D18A 3QWRA 5FOBB 3I6KA 5IW3A 3WLBA 1CR9H 3UYRL 2VR9A 1T0NA 2NY3B 3C5JA 4F15B 3WJLA 4D94A 1S5IL 3MMEA 3MBEB 3TYFA 5FA3B 2V2TA 3NCEB 2AVGA 4X8XA 4GAYB 3KWWB 1A14H 5SWSD 2D3VA 4PRID 4WHCA 1WISA 4WI7A 5JHDA 3ARBB 3NZHL 2PYEA 3NIDF 1PFCA 4HKXA 5HYJD 5GGQL 4UAOC 3MJ9L 4YHML 4JFHE 4BZ1H 1KN4H 3RVVD 3EW3B 2R69L 4PJBF 5EDXA 3NZ8B 3WDIA 4PJHF 1U6AL 4KMLB 5CJXA 5HYSB 3N1PC 2NXZC 3PWNA 5EO1B 1DSFH 4GW5B 4FZ8L 5BVPH 4XVTH 1CU4H 5K9JH 3ZDYE 4N1EA 2YR3A 2WWKO 5BO1H 4OCWL 3DX8B 1WF5A 4LEOA 4DZBA 4NJAL 2V2WB 1DVFA 5BRZE 3MGAA 3GO1L 3VXSA 4KU1A 2EDXA 2VZTA 5F21B 2HRLA 5HHMD 3GSWB 3NCYS 5DQ9A 4TPRL 4RMWA 5HHQA 1WT5C 4LLMA 1S7RB 3GJEB 1CT8A 4EDXA 4L5FH 2OM5A 3AAZA 3OTTA 5I9QB 1TMCB 4IDJL 4PV8B 4PJ8B 3LN4B 2VC2H 3VU2A 4ZFGH 2NW2B 3I6GA 2PUQT 2FJGB 3NGBC 5FYLD 3WHXA 4NZRL 3AY4A 4MD4B 3QSKB 1EEZA 3UTTA 1S78D 3T3PF 4FXGB 1IBGH 4IRSA 4LP5A 3WIIL 4QRRB 4AEIL 2WUCL 1DLFL 1A6VL 4Y5YA 2YD1A 2FL5A 4H25A 1BWMA 2DQTL 3KPLB 1A3LL 1ZLSH 1NLBH 4H1LG 3RZWA 4HEPG 1FYTD 1O5DT 3OXSB 1MQ8A 5E56A 1L9MA 2D31A 4EDWH 4P4KB 4AENA 1A6TA 4GQ9L 4ETYA 1GZQB 4IJ3C 5F88B 4YAQA 4OI7A 4PGBA 3WXVL 1QRNE 3VDAA 1BF2A 3CC5B 3VDCA 4JRXB 2HJKA 4LLQB 1EGJH 1RUAH 3BN9D 4LDOB 2Y9RT 1JK8A 3MUGA 4U7KA 4F7PB 5E8PA 4PGJA 3OKDA 1HKFA 2ZCLH 4XVJL 3L9RB 3ULUF 1RHHA 3EDEA 2CR6A 5GSVA 1AD9B 3V0AC 2BNRB 2PTTB 1NAKH 3ZE2E 3KPNB 5F3HA 2AGJL 1FG2A 4P2OA 4MWFB 1A1MA 4KK8C 5L0QB 2XZZA 3IU4H 4HK0A 1HDMB 3CX2A 3VFGH 4HWZB 2EEBA 3DX6A 3HLAA 2CGRL 1UZ8B 3GB7A 1QEWA 1LDPH 3C5SA 3G6DL 5HYEA 4ZQKB 4PJ7B 5FO8A 3JV5A 3NAAH 4NFDA 2HH0H 3TCXA 1OGTB 5KAQG 4HGWB 1G0YR 5B8CC 5ICZB 2KL6A 5JXEC 5K9OA 5E24E 3RU8H 2GSGA 4WO4B 2BOBB 5F7LB 1VDGA 1B0GB 3MA7B 1KXTB 1MCHA 3QI9B 2PXYB 2JB5H 3W9EA 1VACB 4FQXA 1N0XH 3QXVA 4DVRH 1IFHL 1JHLH 2YPKB 1NC2B 2CXGA 3IS0X 3G5XA 5CJ8A 2CIKA 1U3YA 1JI1A 25C8H 4LASH 1K2DA 5ISZD 4JN2A 1NJ9A 4LKXA 4L8DA 4MJIB 5EIIA 4G9FB 5E5MA 6FABH 2A6KB 1KB9K 2WP3T 1CICD 3D18B 3MOBH 1FYTE 3I6KB 1FO0H 3WLBB 5ITBH 3TO4A 2XICA 3QNZA 1T0NB 2DMCA 2YHGA 3C5JB 3IYLW 5FF6A 3MMEB 3C2SA 2V2TB 3TYFB 1ZLUH 2J3SA 3LAFA 2HT3C 3K81A 2YUVA 4FFWD 2VXVL 1PD6A 3PDOA 1TIUA 2MPAH 2RR3A 3QDMA 4K8RH 3K80A 4XVUC 5AEAA 5JHDB 2AQ3A 1T21A 3FQXA 2IBBA 3NTCL 2PYEB 4MS8D 3X3GH 4HKXB 4ZS6D 1A0QL 2GJ6E 5L7XH 4OZ4A 1KC5L 4U0RB 4ZFFA 4LLYA 4OQ1A 3V6FA 3HFML 1PX4A 1LWRA 4RISH 3VWKC 2WINA 4R4ND 4UINH 3PGFH 1D5XA 1U2HA 3BIKA 1TVHA 4XMLH 3PWNB 3B9KC 1RZKC 4GSDH 5HDLA 5T5FL 1JZ8A 4P3WA 4LL9A 5LXGL 4I18A 2K7QA 4HMEA 4LEOB 4DZBB 5JOPE 2NY4D 1DVFB 3VXSB 4LVOC 4PJ9C 4WFGD 4PJFF 1UADC 5C6PB 5DQ9B 3WUWA 2R8SH 3SE3C 5HHQB 4LLMB 4FQ2L 1CT8B 4EDXB 5D9SA 5SWZD 1HKLH 4Y19D 2AXFA 3C60D 3KPRA 5SX5H 1QNZH 5T3ZH 2X4PA 5GJSH 5LAXA 2G2RA 2ZNWA 5DUML 3QFJD 2Q8AH 5JHLL 4TN9A 2DQUH 2HAZA 1AHWC 3WHXB 2FATL 3SO5A 5I18H 1EEZB 3UTTB 3B8SA 5KSBF 4YHIA 3MOQA 3U0TA 3L6FB 5L9DL 3QEQE 4IRSB 5I75B 2HFGH 4X7TA 2NY7H 1YEKH 4U6VL 1LVEA 5FYJU 4H0IA 4EZMA 1BM3L 4Y5YB 5ESVA 2EYSA 3LKRA 2FL5B 4H25B 5HHVH 2PTVA 5FHAL 2PW1A 3DX7A 3UP1A 1M7XA 3OZ9L 4IMKA 5D7SH 3GMMB 4JO2L 2A9NH 1SJXA 4JHZA 4UV4H 2D31B 5C2BL 3LY6A 3P0YH 4AENB 4E5XA 1A6TB 5F7HA 4YAQB 4PGBB 4LPTA 3GKWH 2FBJH 3UPRA 3PV7A 5CD3A 2HJKB 5EA0L 5D70L 4AJ0A 2ITDA 1JPTL 1JK8B 3MUGB 5E8PB 3OKDB 5EOCH 2PR4H 2XQYG 4FFVD 1RHHB 1G0DA 2P5EE 3X13A 1P6FA 1F4YL 5GSVB 2IQ9L 3E2HB 4POYA 1EGJA 3D39D 1BD2E 5F3HB 3PGCA 1FG2B 4P2OB 1NKOA 1A1MB 1EO8L 3EBAA 3C6LD 4HK0B 4HDIA 2C1PA 3V4UL 4PRDA 2D7TH 3DX6B 3I9GL 3HLAB 3QAZC 4LPXA 3GB7B 1QEWB 2GAZA 4J4PD 1KCSH 1Q94A 3QCUL 2XXMB 5SWZE 4Y19E 2BOCA 5FO8B 1R5WA 1QLEL 1MHPH 1NCAH 3ULUH 5CKAA 5K9OB 3MUHL 3QH3A 4M43L 3QEGH 2GSGB 3IDIA 1J05A 5CS7A 3BRGC 2YMXH 3O9WA 5CJOL 3PGDA 1HHHA 3VGAC 4Q9CA 1AO7A 1JGVL 4FQXB 4WI5A 3UROR 1IM9D 3QUXC 2MKLC 3C6SA 3G5XB 2CIKB 1K2DB 3ZTNL 1SYVA 4JN2B 4WHYH 5TDOB 1NJ9B 1YPZE 1L0QA 3OAYH 4LKXB 1CL7L 4L8DB 5F93C 3O4LD 3MLUH 5EIIB 5MEPA 3IDNA 5E5MB 1UXSA 1UWEL 1J5OH 1OAQH 4KPHL 4O51A 4TVPE 5EORH 1CXFA 3HRZA 3SQOH 4PJXB 3TO4B 3LN9A 5HD8D 2WMPA 3QNZB 4RAUA 1A21A 4HT1L 3VGHA 3HG1D 5FF6B 4JKPH 1GGTA 5A2IH 2YZ1A 4FNLL 4GOSA 2DAVA 2QQLH 4JZJC 4JR9L 3DO7A 2DDQH 5E8NA 5LWYH 3PDOB 4F37K 1IL1A 1X5IA 1ZHKA 1BBDL 1HHGA 1T21B 4C55A 1E4XI 3FQXB 1KENH 3A0OA 5I30L 3B2UD 2J88H 4PB9H 4NQUA 4XP9H 3BT2H 3ZHDA 1J1OH 4QHLB 4OGZA 3V6FB 4PY8J 2JLLA 4NSKA 2WINB 2R2HA 4GAFB 1I7UA 3MFFA 4MSWA 1D5XB 3BIKB 1TVHB 4PY7A 5B39G 2XQBL 5H8DA 2V7NA 4KQ4L 2QADB 1C5BH 2R1WA 1N26A 2ZJSH 3DGCR 1DQDH 4I18B 5IBLD 3ZDZF 3NIGF 4QTIL 2YPVL 4XPHH 1XFPA 1EEQA 2RFXA 1TETH 3D3VE 4QHMA 2O5XH 4PRPD 3VW3H 4GKSA 4O02H 3UMTA 3MV01 3C87A 4L4VA 1KN4L 3WUWB 5DO2C 4ZO7A 1WLHA 4KKAC 2YUZA 1E4KC 5D1XA 3CSGA 5D9SB 1X5FA 2FD6H 2AXFB 3KPRB 1V7NH 1VFUA 4K3JL 2X4PB 4TNVK 1DSFL 1YQVH 2CDGA 5LAXB 3P77A 3ZKXB 2G2RB 4NZTL 5K9JL 3VGFA 3CMGA 3C09B 5DR5L 3PDGA 1SBBA 4RRPA 1J8HA 3CX5K 4NNPL 1A4JA 4NOFA 3BH8A 4YHIB 3LMJH 3U0TB 3VRLE 3JUZA 1RZKH 3E6FA 4X7TB 3ALXA 4DK3A 2UUDK 3HG1E 4WFFE 2HA1A 2EYSB 3LKRB 5ESVB 1ORQA 5C09E 1DDHA 2VC2L 3LH2H 1R3IL 2PW1B 5C3LD 4LNRA 3DX7B 4KZDH 1NL0H 4F7CA 4XHJD 3B9VA 4Q9RH 1FCCA 1LK2A 3TH4T 4X5LA 5TQ2H 4MCYA 2ARJA 2E8YA 1IBGL 1LP9A 4E5XB 3CMOH 3WLWD 5HDQL 5DMJB 3D0VA 1WT5A 1ZANH 2APTA 3UPRB 1HILA 4KDTA 5CD3B 5K33A 2H32A 5CUSL 3R1GL 2AJYL 5D4QA 1F4WH 2ITDB 2YKLH 4GRWE 2AS5M 1NLBL 1PEWA 1LEKA 5D93C 12E8L 3MV9D 3TBYA 1OP9A 4U7SA 4W70A 2EDOA 3FT3A 3ARVA 1CDBA 4Y88A 3PGCB 4Y4KA 5E4EB 5F8RC 4A2MA 4HDIB 4M1DH 2HMID 1IAIH 4PP2A 5HHXH 2C1PB 4PRDB 4QXTA 3QXAA 4ZTPL 2GAZB 1Q94B 3MUJA 4PGZA 3EOTH 2BOCB 1G9NL 1QFWL 4ZOCA 4H1LH 1R5WB 1MCOL 5L8KB 5FDYA 5BRZB 1VESA 3QH3B 4ZTOH 3H7BB 2JJSC 1UM5L 3IDIB 1J05B 1G6RH 3GKZA 4FQLL 3O9WB 3PGDB 4HPOH 1HHHB 1H15A 4M1GH 3MGTA 1AO7B 5EZOH 3EO9H 1LDPL 1A22B 1KF9B 1D6VH 2IWGA 5EU4A 5F44A 3C6SB 5F71A 5HBBA 1AE6H 2EYRA 4G6KH 1ACYH 3NAAL 5IB1A 2CSPA 1IAKA 3K46A 1I8LC 5MEPB 3IDNB 3SDDC 3RU8L 4Z7UA 1UXSB 1OARH 2E7LC 4O51B 2YD9A 1RVFH 3HRZB 1MHEA 5GISH 3BE1H 4RAUB 4TQEH 2AEQH 3OV6A 3CFBA 5I8EA 4RGOH 5IHZA 1BAFH 1JHLL 1QP1A 1OAXH 4CADA 4IRZH 4LSQH 5ETUA 3DXAD 3BPOC 4LU5L 3DO7B 5E8NB 3W0WA 1WIPA 1IL1B 1ZHKB 1HHGB 6FABL 4GBXA 4NYLA 4PRAA 5JXEA 3L5HA 3MV9E 5B8CA 5I73C 1R3JB 4YDIH 4IRJC 3QWOA 3KPMA 1I8IA 2A6IA 3IFNH 1FFOA 4OCSL 1K3ZA 4I0PD 2VXUH 5J13C 1S7QA 4JHAL 4NSKB 4KJPC 2WAHA 2IADA 4LQFH 2R2HB 1PG7L 2ADIA 5B22A 1I7UB 3MFFB 3UO1L 2VERN 4LAJH 3TNNA 1FH5H 5D6DC 4PY7B 1EERB 3ZKND 3ZE1F 3SBWC 2V7NB 5D8JL 1J12A 1S9WA 3U2SA 2R1WB 4LRNH 4U0QB 3OG4B 1HQRA 2RFXB 5A1AA 4GRLA 4F80A 2XOTA 4QHMB 4GKSB 2VH5L 2ZZUT 4L4VB 5F7WC 3SGDH 4L3EA 4NQVA 4WEMB 3G6AA 5D1XB 3PV6A 5DD6A 5HI4C 5FYKD 2RB8A 3CDGA 2CDGB 4EOWH 3P77B 4GXUN 3V4PH 1F58H 1Q72L 1UYWH 1TZGH 3EHBD 5EB9A 3A6BH 4KK9D 3WV0A 2RBLA 1JGUH 3HI5L 4C83A 3T2NH 1UQSA 3GIZL 1T1XA 2FLBT 1L9NA 2VAAA 1J8HB 3BQUC 4UAOB 4M8QA 3FKUS 3VXQA 1V3JA 1A4JB 3BH8B 4G6MH 3ARRA 1KJ3L 1BQLL 3LKOA 5B21A 4OT1L 4AEEA 2R8SL 2P49B 1H3GA 4ORGA 1JZ5A 1ZHLA 3E6FB 4HPYL 1HIMH 4XP5L 1B88A 5CD5D 2Y4SA 2B2XH 5T3ZL 1ORQB 3SKUD 1LDSA 1DJSA 2NXZB 4F57H 1BECA 1DDHB 1J1XH 1MNUH 4XBGA 4LNRB 2IPUG 5HHOD 5CGYD 5GRYA 3CVHA 4F7CB 2H2SC 3GI8H 1U3HC 2EEDA 5CZXC 3TLRA 2Z31D 3B83A 1LK2B 1EA9C 1OQXA 4HBCL 1UCTA 4MCYB 5EU6A 2ARJB 4CMHB 3LQAH 3NVQA 4PJ9A 1LP9B 5DJAA 2HFGL 1AQDA 2VZUA 2BX5A 3WBDA 1P5VA 3SE3A 4TRPH 3T77A 3D0VB 1LMKA 2X10A 1HILB 5C0AA 2H32B 3GNMH 5I8OL 3LD8C 2DQGH 1I7ZA 2ZWLT 2ICEA 5AZ2L 4ZXBC 4UUJA 4JFZH 3K4AA 1LE9A 5MEND 1X5YA 3L95A 3TBYB 4OM1L 5D7SL 5C08D 1X5JA 3NGBB 3FT3B 1AHWA 3RUGE 1IT9L 5DA4A 4KKCC 5DK2A 2GW5A 1TVDA 1L7IL 2FBJL 2W9DH 4PP2B 4PR5A 4QXTB 4J3UA 2P5WA 3VXUA 4OFVA 3CH1B 1N6VA 5IBUG 1DANT 4Z7OE 5FYKE 4H5SA 2PR4L 1UGNA 1KCUH 3LQMA 1PSKH 4Q6YA 3N1QC 4WY7H 4NOBA 3GBML 1NEZA 3KS0H 1ZLVK 4U1KA 3B4NA 3QHTC 1H15B 4H1LA 4FQIH 3MGTB 1NANI 2OTPA 1LE5A 5JO5A 2D7TL 3SDYL 3BHBA 5F7UA 3QQNA 5EU4B 1IQWH 1QG3A 3TT1L 5E95B 2EYRB 5T1LD 4BA8A 5IB1B 4JY5H 1IAKB 5IFHH 1QHOA 2GJJA 1NCAL 4Z7UB 4CJ1A 2K3TA 2VDKH 5HHOE 1DEDA 1VPOH 3N06B 4L1HA 2YMXL 5ICXA 1TLKA 1MHEB 3ARXA 1KB5H 2FX7H 5IHZB 4CADB 5ETUB 2KPNA 2E6QA 4ODBD 1JV5A 2V17H 3WJJC 1LO0L 3TCLB 4V2BA 3UPAA 4BZ2L 3P30L 5DMGD 3I85A 3W0WB 3MLUL 4QTHA 4X0KA 3C8KA 3RVXD 1B9ZA 4GBXB 2R2BA 4NYLB 4PRAB 5B8CB 5MENE 5EORL 5KJRH 4NWUH 1NFIA 2N4IA 3KPMB 2I07A 3QWOB 1I8IB 2A6IB 5DC4B 1FFOB 1NCBH 4H0HB 2ED7A 1ZE3C 3P4MA 2V5SA 4DKFH 1S7QB 3BKCH 1AKJA 4XBEH 2IADB 3QUXA 1FDLL 5JOFA 1DQQA 3TNNB 4HCRH 2X2YA 2DDQL 4OLZH 5EUOE 1HCVA 4XPBH 2VQUA 3ARZA 2QSCH 2C4XA 2P5EB 4G80A 4XC3H 4O4YL 3U2SB 2ORBH 1KENL 2EDJA 1IKNC 1MQKH 3MLWH 2J88L 1HQRB 1P69B 2CO7B 3BSZL 4KHXL 1J1PL 3MUY1 3OAZK 4XP4H 2CDFA 2J6EH 5E2TH 4K71C 1N64L 4L3EB 5DVOA 4NQVB 1KN2H 5C0ND 3DI2B 4HUKB 5IVXE 3PV6B 3DRTA 4XTRD 3MR9A 5F9WC 5DD6B 4JZJA 4OF0A 3SKOA 3I2CL 3T3MF 3CDGB 4OSUH 1F6AA 4HIJA 4R96A 9CGTA 4ZUUB 4FTVA 1HXYA 2C4FT 2G5BA 4NGHL 4YPGA 1C5BL 1RIHL 2ZJSL 4JY6A 4OLWL 5DYOA 4C83B 1UQSB 3IFPA 1T1XB 3ULVH 2O5XL 3VW3L 3NACH 4M8QB 4O02L 4UZGA 3VXQB 4PJEE 3O2DA 5GGRA 3RIAK 4JG0H 3LKNB 4OZGA 1I3GL 4ORGB 1ZHLB 2MJWA 4EI6A 1CBVL 5F1IA 2AK4D 1I1AD 5GS2D 4LLVA 4JM2F 3QISA 4XAKE 1NCWH 4XBGB 4R3SA 3CVHB 1T22A 4U1IA 5DTFA 1UACL 4LRIA 1T80A 5IFAH 4UTBL 2NPLX 5EU6B 4LVOB 1DEEB 1MF2H 3LMJL 3AFLA 4PJ9B 4C4KO 1RZKL 1NC4A 1JHTA 3HNVL 2Z0BA 2C26A 2JB6A 5DJAB 4I9WE 3RVWC 4RMSA 3O11A 3T77B 3CVHL 4TVPL 1FYHB 2ESVD 1E4KA 4AYFA 3ZDYF 5C0AB 4GAGH 1I7ZB 1VENA 2ICEB 4TTDD 5KVGL 2GK0A 3MC0A 4UUJB 1P7HL 4QRPA 1GRWA 1LE9B 2WSKA 5J06A 1RUQL 2X89D 1NL0L 4KZDL 5DURD 1WWCA 3L95B 4RFOH 5FM5O 3SE9H 4Q9RL 1GGIH 1AHWB 2FX8H 5TQ2L 4ODHL 4JRYD 5T3XL 3MV8D 5J12C 2Q76A 2VZOA 2XNAA 4MDJA 2I5YH 5DK2B 1AIFA 1MCEA 1ZANL 1K5NA 1YEHL 4M62H 4PR5B 4PREA 5DHVH 4LHUD 1AR1C 2P5WB 1F4WL 2NXYC 5DDHA 2XFXA 4XB8A 5JUEH 3RKPA 3GSNH 3JWOL 2Y72A 4I3SL 4Z7WE 4H5SB 4YBLC 4Q7DA 2YRPA 1SM3H 3HUJE 3D3VB 5TH2A 1OTSD 1RPQA 2I9LA 4KWUA 1N2RA 4D0BA 4HUNB 3HE6C 1NEZB 2YPLA 4U1KB 4X6EA 2CIIA 4H1LB 2IEPA 2QL1A 4P0DA 1G9MH 3S36X 3VH8G 1LE5B 5JO5B 4GG6E 4UT6L 3BHBB 4I2XE 5DSCA 1PW3A 4OLYH 3UC0H 4CAGA 2AK4E 1MFBH 1WGOA 1VKXA 2UZIH 5FAAA 5HGGS 1EHAA 1MCJA 3OB0H 2VDNL 4RIRA 1TNNA 1BGXH 5F9OH 5ICXB 4Y8AA 4HUWA 2DQHL 5H37G 3UXFA 4OLVL 1XCTA 1RU9H 5EZOL 2JIXA 4PRHA 1SJVA 2MFNA 1OGAD 3MRFA 2WBJD 1MCRA 1JV5B 2B20A 3SHSA 4XPAL 1AE6L 3HS0A 4G6KL 1GH7A 3ZE2F 4Y1AA 1KB5A 4QTHB 3P0VL 4X0KB 3C8KB 2R2BB 5DD5H 4OFYA 5IGXL 1U8NA 4Z8FH 2JJSA 1FRGH 1AR2A 1P4IH 1NFIB 1UZ6E 4HKJA 2I07B 5GISL 4Y5XC 4XPGH 4JRYE 1M05A 2EC8A 3VGAB 5C0DA 4RGOL 3P4MB 5C70A 1NBZA 3MV8E 1AKJB 2RAMA 3QUXB 5JOFB 1DQQB 3NN8A 1JGLH 2DLGA 3QO1A 4H88H 4HXAH 4JZOA 2E7BA 1RULH 3O2WL 1PKQA 4R2GD 4G80B 1DQJA 2QHRL 1F90L 1I8LA 2IAMD 3FMGL 5DGRA 2BSRA 4JFDA 3SDDA 1B4JH 1IZJA 1MFDL 4YDIL 2E7LA 3U4AA 4RGMC 1EEYA 1AY1H 1VFBA 1ORSA 2CDFB 4Y4HD 2Y23A 3TJHC 2VXUL 3MREA 4HWUA 4N68A 5CSZA 4LQFL 2VDLL 1A7OL 5IUSA 3DRTB 1JTTA 3MR9B 2GUOB 1ADQH 5INCA 4JZJB 3SKOB 4RA0C 2J6EA 1Q0YL 3HAEA 1F6AB 4HIJB 4R96B 5KOVC 4FTVB 3FQRA 1HXYB 2G5BB 1CDJA 4YPGB 1X5XA 3GI9H 4JY6B 1F4XH 1NUFA 2IPKA 4KDWA 1EH9A 4V1DA 5DYOB 1QBMH 4K2UL 2ARWA 4IRJA 1TITA 5DHYA 4PP1C 2CRIA 4RSVA 2DN7A 1FE8L 5GGRB 1KPRA 4OCXH 3R8QA 2OYPA 4OZGB 5JW5A 1CZ8H 5DK0B 3WD5L 4EI6B 1MCDA 5CEZH 2MHAA 1MEXH 5F1IB 2RJMA 4LLVB 3O2DL 3SBWA 5TE6L 3BWAA 2Y6SC 2EDTA 2ZUVA 4R3SB 3J8F7 5J1TC 3HZVA 5FYJE 1T22B 4U1IB 5DJYA 3D0LA 5DTFB 5T1KD 5CJQL 1DQTA 1FSKB 3QIBC 5B39A 4LSPH 5GGSA 5GRVL 3C2AH 1NC4B 1JHTB 2JB6B 1KCLA 4KZEL 1FPTH 3MODH 4JEGB 4RMUA 3O11B 2W59A 3VMOA 2OCFD 4PJIF 1CE1H 3OKKA 5C0CD 1CGUA 4F57L 5SX4H 1CXLA 2GK0B 5F6HJ 1J1XL 3ILPA 2DM4A 4QRPB 1MNUL 3DROA 5ADPH 1ZLUK 2C5DC 4KDVA 4I1NB 3AU1A 2EDBA 1W8OA 2VDOH 2ZKHH 3BQUA 3VXMA 5DJ0A 5B3NA 4MB3A 1DLHA 2LVCA 3A67H 2E3VA 2Q76B 1NCDL 2XNAB 1F6LL 2AW2A 4MDJB 3ALWA 1IM3A 1AIFB 1SEBA 4LLWA 2Q8BL 2VXQH 3CK0H 2HT2C 4M5ZH 4PREB 1M1SA 2XZCH 4KJWD 2DQGL 5DDHB 2XFXB 3U4EA 1S8DB 1ZAGA 3PP4H 3DETD 3O81A 1K4CA 1ZSDA 2B39A 5KANG 1MCBA 4YDJA 4WEBL 5DHVA 4IOFD 3M07A 5TH2B 1HCFX 2I9LB 4ZUSA 2ED9A 1BFVH 3R4DA 1U3HA 3FO0H 1N2RB 4ONFH 4D0BB 3GSNA 4QOKD 5JQ6L 4AT6B 5K59E 1N5YH 2YPLB 4X6EB 2CIIB 5IB3A 5DD0H 2EDQA 2FX9L 4CDGC 2VXTH 4ZS6C 5DSCB 3VI4E 4TULL 4N0CD 4OZHA 1QFUH 3QHZH 3VD9A 2GITA 1VKXB 1OAZH 2AABH 4TUOA 4XI5D 1CVSC 4PJDE 4RIRB