2MQCA

Nmr structure of the protein bvu_0925 from bacteroides vulgatus atcc 8482
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
105
structure length
105
Chain Sequence
b'GHMGSPVSYYFSYADGGTSHTEYPDDSSAGSFILDITSYKKTGNSTKALSWNASGDSWIHVNGSSVSYDENPAKERRTGLVTLKQDESGKTLSLKIVQPGKTSID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR structure of the protein BVU_0925 from Bacteroides vulgatus ATCC 8482
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Structural genomics, unknown function
total genus 13
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13004 BACON Putative binding domain, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mqcA00
4Y1AE 4F2MA 1W0YT 5CKGA 2GI7A 4K8RH 3O3DA 3D39D 4MAUH 1YEFH 2ZNWA 3MV9D 3D85D 4M1CD 4X4YB 3P40A 5CP3A 5EH1A 1BD2A 3BGFC 1AXSB 1J8KA 5IFJA 1DQMH 2OI9C 2BNUA 3M07A 5D7JD 5IMMB 1T5XA 4TQEL 3CCHB 4RMRA 1WIOA 5C7XH 3IDIB 4XBEL 4L3ED 3UROR 1K8IB 4BFIB 2HMID 1LO0H 1A6TA 2VDLL 4J1UA 5AAMA 3MJ7A 1ED3B 1YEHL 5IG7B 2ID5A 1QLFB 5FK9B 3UJIL 1SY6A 4JFEE 3VD3A 1U58A 4JREB 1KEML 1U8KB 5DDHB 5LAXB 4P4RB 3FN0L 1C08B 5DJ6A 3UJTL 3KLDA 1AGFA 1BIIA 2PTTA 4KVCL 3L3JB 4R97C 3LDBC 1FL5B 2BVEA 1GZQA 5GS2H 2XRAL 3FB7B 3QXUA 3V0VA 2WW8A 3S36L 2D7TH 4E5XB 3OKEA 4EBQL 5JXAL 4TVPD 1HQ4A 2FCBA 1U3HA 3QJHA 4RX4D 5HHXL 5FGCE 2R1YA 3S88H 3DO7B 2J8OA 2EDWA 3H9YA 4HD9A 4HWZA 4XCYA 3Q0HA 1F02I 3WHXA 1TZIA 3BZFA 1XF4A 3IDGB 4KWUA 4XAKD 3LN4B 4XZUA 4POZD 4JZOA 1HXYA 3S9DB 1GGTA 1TETL 3JWOL 3HCVA 1MIEH 2BNQE 3O2VH 3SBWA 3D0VA 4GRLC 4H0IA 3TBWB 1HEZB 1QLEL 3SGJC 4NIKB 3DSNA 3KYAA 1XIWA 1ND0A 4FS0A 4XPGL 2ICEA 1U93A 1RU9L 3KDMA 1T80A 1FNSL 2W9EL 4G6ML 1CK0L 3O9WA 4O02L 3FT2B 3SE3A 1TXKA 2Q8AH 5HYQA 3BO8A 2DQCL 2B5IB 2K1MA 3KJ6L 3BVNA 4JY4A 4YDKH 1I9IH 4JDVB 1BJ1H 5BZWA 1T04B 5CBEA 3OZ9L 1VERA 2ZG1A 5IHUH 3MA9H 5D1ZB 1TJGH 4XCNA 3SCMA 4EVNB 1DBJL 2YRLA 1I1FA 2NLJB 4M6NL 4HIJB 3RWFA 4M1GL 3QH3A 2H2SC 4JO3H 2JE8A 2B8OT 2HKHH 2XTJE 4E41D 4JO1L 5KJRH 5DD6B 4RA0C 4U3HA 2YA0A 4G80B 1UH4A 2BX5A 5EIIB 5HBBA 2HFGL 2FB4L 4K7PL 4U6XA 1IAIL 1RUPL 2YPLE 5JIKA 1RK1A 3O3UN 4NOFA 4Z0XA 1I1YA 4QRTB 1I9RL 1AJ7H 3S8WA 2I9TB 5L8KB 4PP2A 2ZUUA 2DM4A 3BPLB 3H7LA 1OSZB 3TT3H 3V6OE 1WK0A 3FFCE 5E6ID 5T5NF 2FL5B 5ESVB 2AQ3A 3GJFB 4JREC 4X9HA 1Q0YL 5GSVA 1U8OB 4NCC2 1EEUA 4CW1B 3MROA 2OM5A 1YEHH 2IALA 4Y1AD 4MNQA 1KACB 1R3LB 1KF9B 1JPTH 2DQTL 4I0KA 5C09A 1A02N 1KB5L 5C0GA 3FN0H 3UJTH 1WWAX 1BVKB 2BNRB 4X5XA 1G6RH 1ZHKA 5I0DA 3H9SD 4J4PC 1R3KA 4PY8I 1P7HL 3PNWB 4BSVB 2VDPH 4Q0XL 1QACA 3MLWL 4EBQH 4OV6F 1CDJA 3ULUH 1IC4H 5ID0B 1PKQA 4OZHF 1OGAB 4ODHL 1J05B 3HC0A 5DJDA 3QHZL 4CMMA 5D2NB 6FABL 3H9HA 4MA7H 2EE3A 3UCRA 4JFED 4NO5B 3BKJH 4JB9L 4AENB 1RZKC 3UEZA 3V6ZB 3TF7C 4XI5D 4XNMB 2F5BH 5JW4M 3U30B 3WE6B 2YK1L 3WNKA 2WP3O 1ETZB 5EB9A 4POUB 2CRZA 4XRCB 4BZYA 4YHKL 4ORGB 4R2GD 5JORA 4H25A 4MCYB 1QLEH 1EGJL 4WEBL 3NVQA 5GGSB 5CD5D 4PJEE 2G2RA 3VXUA 2IGFL 2B5IC 3PWJB 1YNTB 1IKFL 2ZUWA 3TWCL 1F11B 3MRIA 3OMZA 4Y4KD 3NCYP 2Y23A 2D31B 3AM8A 3ZYZA 2Z8VC 3JTTB 5D1ZC 1ZA6B 1OTTD 3KJ6H 3EYOA 1FZKB 1YY8A 2BNQD 3AS3A 4QRRA 1PW3A 3FB5B 3NGBC 1OAYL 1PG7X 1F45A 1DBJH 3ZTJH 4EUPA 3QDGA 1MVUA 1T1XB 1JPFB 1N5AA 1T89A 3HE7A 1UWXK 3INUH 1HDMB 5FOJA 1PZUB 1B2WL 5IQ9B 1UB5B 5AD0B 7FABL 4OCRL 3LRGA 4OCNC 2CLRA 4Z77A 1W8NA 1I8MA 1ZLWK 2FB4H 1GCFA 2CLVA 3KPSE 1F4HA 1IAIH 4P2QA 4EDXA 1KLGB 1FLTX 4K9EH 4WO4A 3W0WB 4LRIC 1LEGA 3BPLC 3PG2A 4QHUB 4PJAB 1OAKH 4C4KT 1I9RH 4KPHH 1JP5A 3CDCA 5J3HC 3MRDB 3HZVA 1OWWA 1FNGB 3VFUB 3O41B 2XTJD 1ZKAA 1KC5L 4G6FD 4GQ9L 5JPMA 4NJAH 1C5DA 3N9GL 2EDDA 2DQTH 4QT5B 5IB5B 3RVXD 4PJ7F 4OLWL 4MJ6A 5SWZD 1FQ9C 4PRIE 5KW9L 3UPRB 4MQXC 1KB5H 1U36A 2UY6A 3ARPA 3DBXA 4P4KB 3PIQA 1MAML 1UACH 3ZHDA 3X11A 1KCSL 3I75B 4W4NA 3MFFB 2Q3ZA 3ARFC 3IFPB 3MV7B 3RVTD 5HYSG 1FNAA 3TPUA 4PJXE 2O26U 5HDOA 2IFGA 5D2NC 1I3VA 1Q72L 4Q0XH 3FHAA 3FFCD 3B83A 3N1GC 2BSRA 3MLYL 4LPYA 4YFEA 1IZKA 2EZ0D 4C83B 1EBPA 3K4ZA 5CWSB 5BOZG 1G7HA 3QHZH 2AJVH 3TC9A 5C9KA 4ZAKB 1JHLH 3WNMA 4JB9H 2YRZA 5HY9B 1A4KA 3AAZB 4MNGA 5IHZB 4NJ9L 3H3PH 4MXWL 2JCCE 1Z5LA 3ABZA 4L8BB 3RY5A 5L2KA 2G5BA 3MGOB 3BMWA 5GRYA 2XWJA 3C5ZA 4F9LA 4PG9B 5HHNB 3IAGC 4YHKH 1B6UA 3SQOL 3DURB 4WW2A 3PL6D 2X4OB 2GCYA 1MF2L 5DHYB 4LOUC 1FL3A 4M93B 4AH2A 1EGJH 2QADD 4WEBH 1D5ZB 1HCFX 1KJ2A 1U8NB 3OF6A 3IYLW 3FTGA 3LMJH 3V4VH 2IGFH 2B4CL 3VG0L 2AJUL 1FE8L 1MLBB 2R0WH 4HZLB 3WJJC 3VJ6A 3S4SG 3TA3B 1WICA 3GMRA 3VH8B 5FGBA 2QSTA 4UT6H 3KPRE 3DXAA 3MRCA 1XGPB 1QBML 2APFA 2FECL 2VDMH 1WT5A 4Z7NF 4JEGB 3HPLA 2SEBA 4U1HB 5J1AB 5CEZD 4NO0D 4MDIB 5EC1A 3B9VA 5C08E 5B21A 5F97E 5D9SB 4HLJA 5GGRY 1G84A 4U1IB 3AVEA 3QNXA 4DN4H 2C3GA 1DANT 5DMGC 4X4XA 1UZ8A 3LKQA 5F93C 4NCDA 3QDMA 1U6AL 1XF3B 4HHAB 4HXAL 4DTGL 1B2WH 2NXZD 2YN3A 5GQBA 7FABH 5C8JB 4OCRH 1NANH 5AZEH 1RUQL 2DIBA 2W91A 1PX4A 3QEQB 4MWFB 5ACZA 1PQZA 2A9MH 2PKDA 1UCBL 4PLKC 3X12B 1NAML 1U95A 2R0KH 4X0KB 2E3VA 4QRSB 5C1MB 1CT8A 1NFDF 3DOSA 1ZTXL 3PXHA 1ORSB 1IGTB 5EPMB 1FDLL 3CMOL 3PWNB 2DL9A 1UENA 3EFFB 3FQNB 1WCQA 2GTZB 3ARGD 2GSGA 4OIIL 3VD7A 1KC5H 4DOHB 5INCA 4P4KC 4Y16D 3N9GH 2AJ3A 3KPSD 3ORJA 3VGHA 2L7JA 5J6GA 1OM3L 4OLWH 4WUUE 2GAZA 4LSQL 4S10A 1IGMH 2ZPKL 5IJVB 1WC7B 2QKIA 5A40E 4NN6B 3NFNB 1EX0A 5EA0L 1T2QH 3I84A 1CLYL 3OJDB 3M1BB 4IRSB 1FIGH 4XNQB 2OQJA 1QVOA 2NNAB 1AGEA 4HH9A 2VZTA 3IJSA 4Z7UA 3MLYH 4HUWA 2YZ1A 5HXMA 5F9JB 4HJGA 2A6KA 2FSEA 4OGZA 4RMTA 5E1AB 5BS0E 3ECBB 4PRID 1NPUA 3QDAA 4MXWH 5I17B 5A2KH 3LS5L 4HFUL 2DWDB 1H8SA 5JMOC 4AEIH 4WU7B 1RFDL 4H1LH 3RY4A 2W65B 5KSBF 3VCLB 1ZHBA 3THML 3MUY1 4M93C 3T0EA 2OZ4A 1YN7A 2H3NA 1MCNA 3TBTB 3I6KB 1BD2E 1II4E 4N9GA 1D5BB 1FBIL 3KPQB 4P0DA 5DMKB 1TFHA 1HK6A 2Q8BH 3U0WH 4JR9H 3RZCB 1J87A 4CU8A 2FIKB 2O5YL 2BY1A 3TA3C 2ZSWB 5JW4Q 1WZMA 3UYPA 4RMQA 1F2QA 1J10A 1XT5A 2CDGA 2JJVA 5SX4H 2B4CH 4M7KL 3VG0H 3WFBL 1FE8H 2YMXH 3U0PA 5F7YC 3T04D 1KPVA 1A6VL 4G7VH 4YXLL 1HH9A 1DN2A 5DJ2B 2BVTA 3GI9L 5CFHA 4PJ8A 1MFDH 3CSGA 1B4JH 3B9KC 4FQXB 2BP3A 1D6EB 4O00A 1QHPA 1AC6A 3GSUB 1YNKL 3ARDA 1A4JA 2FIRT 3HAEG 5FV1L 4BH8A 3QWQB 1OAUH 1JPSL 3VXOA 1H3TA 4PRNA 3FONB 1HHKB 1U6AH 1JMZA 1MIMH 2NR6D 4HXAH 5IROC 3MQIA 1IL1B 1RUQH 2IFFL 3KPRD 4JM2B 2FYYA 5I8KH 1QFWL 4ODSL 4O51A 1FFOA 2HJLB 3MJ8B 2NY4B 2EKJA 1NCTA 1UCBH 1NAMH 4MD4A 3W2DH 1JTOA 5C08D 3CPLA 2XNAB 3MUHL 5E6YA 3CU7A 5HHPB 4OSUL 4Q74A 3CMOH 5HI3C 2J88L 1L7TL 5EO0B 1KB5B 1LILA 2HVJB 3QCVH 4OIIH 1DQJA 4S1RL 4MZ3A 2AKRA 3BRGC 3CFJB 3ULUC 4A2LA 3KPMB 3QXWA 3TZVA 1OM3H 2NY6B 1RMFH 5CJ8A 1NQBA 1I7UA 4IRSC 5EA0H 3MREB 1FYTB 4GAYA 1CG9B 2YEZB 3LHPL 2IAMC 3C5SB 2OJEA 3HI1A 5IBUG 3JWOC 1TQCC 3S37H 5AWNH 4V1DA 4G8IA 2PXYB 1IGIL 3KAAA 2JIXB 1OF2B 4U31A 3MNVA 2EXYC 3MRHA 5E56A 4NNXA 2NX5B 3LQMA 1X7QA 1H3PL 1G7LB 5JDJA 3TBYB 2ADFL 1CGSL 4UB0L 2BOCB 3P9MA 4XVUC 5K9QI 1BQHG 4JM4L 3FRUB 5DYOB 2YKLH 1KB9J 3G6AA 3RZCC 1UM4H 3THMH 1ZLVK 4S1DC 3JTSB 1A7NL 2XY1A 3B5TA 2YD4A 2LQRA 3GHBH 3IU3A 4N1HB 3ZE1E 1D6VL 3EO9L 3SDDD 5C0FA 4TSCL 3JZ7A 1R5WA 4X6CB 5F7EH 1H5BA 4KK6D 1A6UH 5BS0D 4MNQE 3AGVA 4YXLH 4ZG1A 4NKDB 2VISB 3U7YL 4FQXC 1FP5A 4NNPL 4UDUA 3MX0A 5B39G 4LRNL 3UC0L 5F9AC 3FN9A 1PYWA 3RX5A 3KPPB 3ESVF 4GAJL 3CXHK 4KI5F 4IMKC 2V2XB 1J1OH 4K9EC 4I48A 1YNKH 1H3UA 1MCOL 1F42A 2ILLA 4YHOL 1T0PB 4U6YB 5D1XA 3L3DB 1PKQE 4OFVA 3TNNA 1DQQA 1F4YL 5DD3L 1JPSH 3V4UH 4JM2C 1DQLL 2NY4C 1TVBA 2EDKA 4U0RB 1WSST 3LV3B 2X4UB 3NA9L 1P53A 2RQ8A 4UV4L 2IFFH 3B5HA 4HWNA 3M17A 3X17A 3C6LB 5J57B 3MRMB 4Z5RB 4GG6B 1J0JA 5DJ8A 1GPOL 2E7HA 4TUJA 1P4IL 4PTTB 4XNZB 5CJXC 4ZFOL 4E0RB 1UM5H 3VXMA 2X9XA 1ONQB 1R3JA 1OVZA 4Z6AT 3F65A 1E6OL 2KQMA 4NDMB 4LLUB 3OKLB 2PYEB 3ILQC 1U3HD 3PABA 5I15L 4AJ0A 2Q7NA 3JWNC 3CX5K 4LP4A 3B9DA 3R0NA 1L7TH 1S8DB 2IANB 5DGRA 4S1RH 3F7RA 2NY6C 4HX1A 4JFPB 1FIEA 4NC1E 3SDCA 3RDTA 4H20H 1FLRL 4BQ8A 4O9HH 4FTVA 2DJSA 4LSRH 5GJSL 4Y7MA 4OLZH 4X80H 1LEKA 2J12B 4QRRE 3BP6A 2JELL 4PJDF 1PEZA 1MAKA 1YUHA 2PXYC 2J8UB 2XT1B 1TIUA 3QO0A 2PN5A 4XCCH 4OKVB 1XIWD 3VMOA 4Y4FB 3QDGE 4HS6B 1JNHA 2O5ZL 3L6FB 3MRRA 1X6NA 4WRLA 2I25N 1RUKL 3CJJA 3P30L 4A6YA 1SMOA 4H1LB 3O9WD 1WWWX 5MEPA 4KRPD 3QUKB 3MLTA 2BDNL 4DW2L 1RJZA 4KUCD 2JJUA 4KQ3L 3C08H 4P2QE 4BZ1H 4FFYH 3DYPA 4LSSL 4W68A 1KCVH 3WHE0 2LTQB 3SCMD 4XMKH 3TJEL 2PW2A 2VMFA 2VXUL 1VGKA 1CQKA 3MNZA 3RY6C 3SE9L 2X7LA 1T5WB 4DGIL 3HR5A 1A7NH 1UFUA 1B4RA 4AEEA 5T3XE 3OKNA 4PRPA 4X7TB 2BVPA 1D6VH 3EO9H 5D5MB 2BHUA 2NY3D 2KKQA 2A6DA 3OAYH 3GO1L 5GGVH 4F3FA 5J0BA 3OAZK 2Y7QA 3FQUA 4JFHE 3GMMB 3EJYD 5DA0B 4N5EC 2N4IA 4QYOA 3C60C 4LLVA 4NN5B 5CP7A 1GJIA 1I7RB 5TE4H 3SDYL 2HAZA 1G7IB 3PWUB 4NNPH 3BT2L 5JLZB 3VFPB 4KDVA 4LRNH 1RZIA 4HGWA 1FSKB 3U36B 3Q3GA 3M45A 2XWTB 3GSWA 5A16B 3WV0A 1M7IB 2XYCA 4HFWB 2FWOA 1MCOH 1C12B 5E5MB 5A2FA 4YHOH 4QOKB 1DP0A 1UG9A 4D0DB 4OZHA 3CLEH 4MNQD 5LGJB 1S9VB 1DQLH 5C09D 5C0AB 3C6LC 1SBBA 3WS6A 3QIUA 3DX8A 3HR6A 4KK5D 4D9QD 4MJIA 3SKNB 4YHNB 5IW6A 5IIEA 3L1OH 4OLVL 4XNZC 1I8LC 5D2LB 5FECA 5L2KE 5T1DL 1DQDL 3GDBA 1GOGA 2CJUL 4NQEA 4RDQF 1F8TH 4C59B 4CJ0A 3CAFA 3IRPX 1QRNA 4UOW1 4FOMA 5I1JL 5ACMA 1M71A 4UT7H 1E6OH 5DMIH 2R29H 3L3KA 3HI6L 4HDIA 2VLME 2OSLB 2FH6A 1LO3H 5KN5B 5E00A 5EOTA 3QT2A 3CFCL 2EE2A 2HFTA 5GZND 3MMEB 4ZO8A 1KUMA 3OR6A 4N9OB 3SQBA 4P2YA 1JZ8A 2AJZB 4I5BB 5C07B 3RUGF 3DXAE 1DUZA 4N0FB 1EEZA 3G6JF 5E6ZA 3VXTB 4LU5H 1BM3L 4Y4FC 2JELH 2K9UA 2M26A 3OR7B 2HRPH 3MOBL 3LKPA 4JO4L 5DRZB 4WEUD 1GSMA 5B22A 3AS2A 1A6AA 2O5ZH 4OQTL 4CJ1A 1NEZA 3VXUD 1MHPH 1OP3H 4HPOL 3GGWB 3QXDA 3W39B 1EVUA 1RUKH 3QUXA 1CVSC 3RVWC 3O45B 3D25A 4JZNB 3FQXB 4FABL 5I1IL 3HZYB 4JANB 2LTQC 1QFPA 5JHDB 1A9EA 2YSSB 2EDEA 2ZZUT 4OZFB 4X4ZA 4GKZA 4GG8B 4KQ3H 2OTWA 3QFJA 4QRRD 2B4CC 35C8L 4K23H 4HUNB 5GRJL 4LSSH 2IPUG 3KVQA 3PGDA 2YD8A 2X4TB 4U1NA 1U8QA 3TJEH 3R1GL 1CBVL 2X4QA 4K2UL 4XX1G 2VXUH 2XQBL 3QJFA 4HIEA 1KXQE 1WZ1L 3QDGD 3TN0B 2AXGA 3U4BL 3LKSB 3HE7D 1WCBA 1CDGA 3QDJD 1I3GL 1N6QL 4JG1L 4NN5C 2FHFA 1NJ9A 4TUOA 3BN9C 1NGZA 3BP4A 1EHLL 4JHWL 2XKSA 5EC2B 3P0YL 1SM3H 1JNLL 4P2QD 1ZSDB 1FSKC 4PJ7A 3MV8E 4ZUUB 4WO4D 2H8PA 4P23C 2HT4C 4NRXA 1K4DB 4RZCA 3BT2H 3GB7B 2DLEA 3K74B 3CFBB 1CLOL 1T2XA 1RURH 5T3XD 2YC1B 1WBXA 3PHSA 5T3ZL 4G42B 5CUSH 2C3VB 2FD6L 3CX2A 4NQDB 4NUJB 1CFBA 1P2CB 1CS6A 4B5EA 4Z7UE 4PGBA 4PS4H 4KHXL 2QL1A 4NQTA 2GJZB 5TDNB 4GRWE 1JHTB 2DIAA 2VITA 1R24A 1MRFL 3UTSA 1RSFA 3GSQB 4OB5L 4WI2A 4GKNB 4MQ7B 4FXGA 5ITBL 2V2TA 3T1FA 1NSNL 4BKLB 3P9LB 4OLVH 1Z9LA 2BSTB 3LKNB 3IKCB 1SQ2N 1HHHB 4U1GB 5F44A 1T21B 3U83A 1DLHA 1DQDH 2HTKD 3T0EE 4JKWA 1IM9B 4LSUL 3ESUF 4FFZH 5TDOB 3GSVB 2VERN 3IXTA 3T4YB 2VXTL 4Z0BH 3HI6H 3O6FA 4QGYA 4UU9B 4XCFL 1UZ6E 3QNZA 1NCWH 1P84K 3CFCH 4JQXC 1CXFA 1X4ZA 5CIPB 5A1AA 4HXBL 5L2KD 3BKYH 3BMVA 3C5ZD 3WCYA 3ALWA 2D0HA 1A7QH 4TN9A 1M1SA 4EI5C 4QNPE 4XCEA 2VLLB 3QIBB 1IAII 1G7JB 3MOBH 1UKQA 3VXRB 5ISZB 2VLMD 2HP4A 2NXYB 4U1JA 3MCKB 5HDLA 3OF6D 3VFWA 5GGRA 2CKBL 5FOBB 5FO9A 4IOIB 3STLA 2OL3A 2PYFB 3MUJA 5BRZA 1KXVC 3QZWG 5KG9A 3P4MA 5D6CB 1QPPA 1QZ1A 1KOAA 4FABH 3NN8A 3MRNA 2X4RA 1XGQB 3VFSA 3DXAD 4TVPL 4RFOH 5IBTH 2UUDH 1RIHH 2MQ3A 4MVBC 5E94B 1YYMH 5FDWB 5DK0B 5CGYD 35C8H 4JPIB 2VL5B 4J3OC 5GRJH 1AIFB 2Z8RA 1KNOA 3C8DA 3FJTA 1H15B 3R1GH 4WI7A 4PJ9C 1CBVH 2EICA 1NFDA 2I9LA 1WZ1H 2APWA 3JV4A 2W0LA 3VXQB 3S96B 1VPOH 5I1AA 2FX9L 5J1TC 5CHNA 3S3JA 3QDMD 3HAEH 3WLBA 4ISVB 4QWWD 4XP6H 4ZOCA 5E8DH 2VAAB 4ZFZB 1I3GH 4D0CB 1N6QH 3W9EB 4JG1H 3O8XC 5KOVC 8CGTA 3PDGA 2DQFB 3QISA 4ZO7A 4JHWH 1EHLH 3P0YH 1U8MB 2F74B 1JNLH 2OJZL 4JVUA 1MCDA 5EBLB 3L7EB 4P5KA 5CSGA 1ODAA 1B0WA 4HKXA 5ANMB 2E8YA 1QUNA 1KG0B 2VZUA 3BPOC 5E2VL 3OKMA 1NGXB 1AC0A 3WEXB 5I2IA 4M1DL 4G8EA 4ODXB 5J56B 2W59A 2FD6H 2P45B 4V1DE 2A9NH 1M6OB 3HLAB 3T3MF 5EU7C 2HFEB 2Y5TA 4LNRA 1P9MA 3KJ4C 4TRPL 4ZFOB 2X9YA 4OIAA 1YNLL 1U8JB 5JO5A 5E7BA 5HYSB 3RKDD 1A8JH 1NSNH 2K7PA 4XH2B 3EYUL 5IEKA 5GS0D 2XICA 3HMXL 3TVMC 3S34H 1SVZA 3PWLA 5KSBA 2ORBL 1LWRA 4M62L 3HZKB 3HNSL 4OLXL 3IJYA 4ENED 4ZTPL 4LCCB 1UC6A 4XCFH 5EZOL 2QSCH 4Q2ZB 1DBAH 3GKZA 3WIFB 2XA3A 4ZPVB 1JPGA 1A7BA 1NBZA 4HXBH 5A3ID 4Y2DB 2C4FT 4ZXBB 3SGEI 3T0ED 4UQ2A 2P46B 5GGSY 4OD1L 3RPKA 1WEJL 2FJHB 3BPCB 2NYYD 4HC1L 2OR8A 3OKKA 1EBAA 2P42B 3UPAA 2IH1B 3S4SB 2VLKD 2FBJL 4P49A 3GJFK 4WTXA 5I8CB 5CZXC 1G0DA 3KPOA 3AREB 2DQJL 3BP5A 1JJUA 3DVIA 4OF0A 4BM7A 4LCWA 3F58H 3ULSA 5JW5A 5IGXL 5HI5D 5F21B 3PDOA 1MWAH 4TVPH 5I76A 1AHWB 4QTIL 1JZ3A 3QEUA 4P2RA 5JQHC 3NFSL 4JJ5A 4PJ8D 1BVLA 3EYFB 1JFQL 5DURD 3BHBB 3RVVD 1GGIL 3ZKND 3Q48A 1MCWM 2CUMA 3NOIA 3QUZB 1A22B 3VXME 1EA9C 5F7DA 3ARDD 5F6IB 3BP7A 4F7EA 5ESQB 3TO2B 4GUPB 5TQ2H 3ARXA 2FX9H 2ZP0T 2DWEA 1KIRA 2Z31B 2OR9H 3GSRB 1IILE 1IGYB 2OBGA 3DHMA 1NCCH 1BZ7B 2QEJA 2I07B 2BMKB 4FTVE 5J13C 2EIBA 3EZJB 3W5NA 2H9GB 2OJZH 3QI9A 1Y6NR 4RWYH 1C16A 1DE4A 1RHFA 5IJKC 3AY4A 3HFML 4IJ3B 1T4KB 4GBXA 4ODUB 1UXSA 3WSQL 3QO1A 2X4NB 3VGFA 5GGTH 1A47A 1N7ML 5TFSL 3VRIA 2VN4A 2CLZB 1G9MH 4O5LL 1KJMA 1F3RB 3CC5B 1L9MA 5BJTA 3MCLL 2CO7B 3MRKA 3CDYA 4HIXL 2Z93B 5DRNB 4TYUA 4HEPG 4AL8L 4WI6A 3P11L 1NC4A 3AUVA 4WHCA 3TZVD 3TJHD 4ONGL 2WM0A 1JWMA 5CEYB 1YNLH 5E99H 5BV7L 3T65B 3GMNB 2DN7A 3VGGA 4MYWB 3HMXH 1ZVSB 3QWOA 5I1DA 1IE5A 3CXDL 4ETQA 4MJ5A 3O11B 4K3JL 5FAAA 4PRDA 3N85H 2ORBH 2LAGB 1S5HA 4NQCA 4V1DD 2ICWA 4XPFL 1K6QL 2IBZY 2FECI 4XMPL 5FYLE 4PRPE 4FXLA 4ZUVA 1UKTA 5ESAA 4RA3A 1JN6A 4KKCD 1KGCD 2ARJB 1PJ9A 4PGEB 1TJIL 2BVOA 15C8H 4WWKB 1U8PB 2FR4B 4NQXB 5C6TH 4QXGL 4KKBD 5CLTA 3KPLB 3HUJB 3PXJA 5CINH 3QIWB 5FUCE 1CDCA 4KJYA 5FM4A 4CN1A 2FO4B 2FO1A 3SJVA 2P8PA 1WEJH 4HQQH 5J12B 5CJ5A 4JY5L 5ID1B 3ARUA 1W0VA 3AREC 3L5WA 3OKDA 1BF2A 1OP5H 4F7CB 1KFAH 3HE6B 3MJ6A 1LD9A 4OZHE 2EYSB 1CLZL 3TH3T 1AHWC 2DQJH 3DVGB 3BX7C 3SPVA 1PZ5A 4S0SD 3EDJA 4JFFA 1FORL 4MJIE 3GMLB 3VFOB 5IGXH 5TE6L 5DI8A 4HZAA 3IDNB 4ERSL 1KBGL 1S7RA 1S78C 3NFSH 3VXSA 4QRPE 5EFIB 3HPJA 5B3JF 5F6IC 3HAEB 3PWVB 1JFQH 3MJ9A 2EO9A 4NQEE 4PP1D 4YEFA 3GMPA 2AVGA 1QEWA 4R90L 3RGVA 4WFFE 2Z31C 3LEVL 4KY1L 5D1XD 3PQYB 1JF1A 4LEOB 4YDIH 3CLFL 2VABB 3QNYB 1UJ3A 3NCEB 2CIKA 12E8H 2EYTA 2VYRE 3B2VL 2PCPB 1CL7H 3DROB 3DTXB 5GSRB 3WO4C 1HYRC 4KK9D 1JE6A 1CF8L 5JNYB 3ALPA 1GVIA 3HS0B 2FJFB 3FO2A 1CD9B 4P5MB 3I6GA 2AEQL 1KJ3L 3FT4B 4WIQA 4P57B 2YXMA 1C8PA 4BH7A 3IJHB 3UAJC 3STBA 4I3SL 3VXMD 4Y89A 2WUCH 4PBXA 4PJDA 3EFDL 4FP8L 3WFHA 4NC2B 4TULL 4N0CD 3GSOB 5TFSH 3BEVB 4ZTOL 4FNLH 2EDFA 2QR0A 4BQ6A 1FFNA 5IK3B 3EO0B 4Z7OF 4O5LH 4F9PA 1NMAH 3WS3A 3ZE2E 5CEZL 3FO9A 3ULUF 3SDCD 3MCLH 3RDTD 3JBG7 5CCKL 3A6OA 4FTVD 3P11H 4D8PA 3O6ML 2WAHA 4Y8DC 4GW4A 5H35B 4YDLB 2D2OA 2F9BT 4M5YL 3V8OA 5BV7H 5I1LA 2VIRA 5HI4C 3QFJE 5IBUB 3VXNA 2DDQH 3NABL 4PJCF 3D39B 1NBVL 2ED9A 3IF1A 5IQ7L 3MV9B 3MC0A 3D85B 4GW5A 2R8SL 3ZYJA 1H3GA 4QTHA 4P2OC 3IGAB 5DJXA 4K7FA 1G7QA 1F3JA 3ARRA 5D7JB 1K6QH 5DJCB 4XMPH 4M6MH 1I8IA 2X4SB 4U1LA 4G8FA 5IMKA 2ZUQB 5IOPA 4WWKC 1ORQA 4L3EB 4DJMA 1BQHB 1TJIH 1V3JA 3V8CA 1MSPA 1ERNA 3QIWC 3QPQD 4ELKB 3DLQR 4WI9A 1E27A 5J12C 1EK3A 2UVFA 4CVXB 5LKNA 3MRJB 2CKBB 4Q58C 2VQTA 4YQXL 3S36X 4ZOAA 2R0ZH 3MRBA 1QFWI 3AC0A 2JB6B 4QHNA 4L8DA 1K8DB 3FO1B 5FYLD 1NAKL 4PRPD 1NLBL 3FRPG 4XBGB 5KS9F 2FDBP 4PJIB 1AO7A 3T0XA 3BUTA 1JWUA 2IADA 3EOAA 1CLZH 1KPRA 3B8SA 3EHBD 4LP5A 3MRFA 5B39B 2ZJSL 3LN5B 2H32B 3RWGB 4PBWD 5L88L 4X7DC 3SY0B 1X3DA 4HCRA 1SYVB 4ERSH 5IBLC 1KBGH 1VACA 1FZJB 1XCQB 4N1CA 1JGLH 1ADQL 4Y4HA 1NCBH 1KT2B 4OFIA 3FQWA 2WUBL 1GL4B 3QG7H 1N6VA 3CLFH 1LEIA 1Y0LA 5L7XL 4QXTB 3MZTA 3SO5A 3C8HA 1S7XA 5H2BB 3QIUD 3UDWC 4MJID 3TV3L 1SEBB 4MJ4A 5IB2A 1XH3A 2JKXA 1YYLH 5FEBA 1LQSR 1KJ3H 1BQLH 3RUGA 4NQED 5GIRA 1V3KA 3G6JA 43C9B 1YC8A 4GRLA 2YPKB 3B2UD 4OUUB 4I3SH 1QRND 1UQSB 4CADA 4JFXA 5IKCB 1OSPH 2CDEA 1BFVH 2Z35A 3QQ3B 4WFFD 2JK5B 4L8SA 3NCBB 1JWSB 1GZPB 3E6FA 5D1QC 1F4WL 5D96B 3L7FB 2RIKA 5JQ6L 4OZIB 1HINL 1U8IA 4EUPG 4PPTA 5CEZH 4E41B 2NY1D 1A6WL 3SOBL 3LQZA 4YNYB 4K7PX 5H94B 2WINA 4CDGC 1JVKA 5F89B 1S3KH 2VXSH 2BK8A 1I7TB 4M1CC 1FG2B 4M5YH 5SWQA 3E3QE 2N7AA 3Q1SL 1UWEH 5HPMA 5FYKE 3NABH 1BF8A 1NCUA 2NPLX 3CDGA 3TH2T 1JK8A 2EH8H 3OX8B 1QA9B 4AEHL 5IQ7H 3ZDXF 3RTQC 2R8SH 3D69B 2Z92A 1NFDE 2ZUQC 3WNOA 5K59F 2ERJB 2WWKO 2HLAA 2H6PB 3R4DA 4RNRB 2HMIC 1NUFA 2GY7B 4YDVB 3RWHA 4JPKH 4OF7A 3QUXD 4FN0A 5F3HB 5E6IB 3RHWF 3OPZL 4HIHB 1W2KT 1K5NB 4WNQB 3U46A 4UNTA 4W4OC 3QPXL 4N8VA 3X14A 3ETBF 4Y1AB 4YO0B 3PGCB 2DAVA 2YA1A 3QFJD 3Q6FB 1ZGLB 3DECA 4BELD 3OGCB 3EYVA 3MLXL 5I71B 1ZHNA 4F8QA 2WBKA 4RIRA 4YQXH 2X6MA 5INDB 1MCPL 4R0LB 3H9SB 3MFGB 2HJFA 4EQ3A 2FH8A 3WUWA 1OGTA 1ED3A 4O2CB 3BKCL 4WW1B 1NLBH 2BCKB 1UEMA 4G3YL 1CZ8H 1UH3A 4RGOL 2WLYA 4OZ4B 1G0XA 1OHQA 4JFEB 4POZC 1JZ4A 1VADB 2ZJSH 3ARBC 5JOFA 2R23A 4I2XA 3MRPB 3ROOB 4XGZB 4MSWB 4XPBH 3UBXA 4QHLB 4LAQH 1U41A 5DJYB 1JGVH 5FFLA 2UYLA 4J2XA 2RFXB 1ADQH 2KH2B 3C5JA 5DGQA 5KSBE 3WN5A 2A74B 3HHRB 2XZQL 5TGBB 2V7NA 4R2GB 4I18B 1QLRB 4WJ5B 4J3UA 3F7QA 5B38G 3D87B 4TPRL 3RPIB 2E27L 4RQQA 5L7XH 3UTSD 5FGCB 5JA8B 1OW0C 1UGNA 3V0WH 4OI9A 5KVFL 4TNWF 3O2DL 4YHML 1A1MB 1YMMA 4Y4KB 1Z6JT 1HIML 4RISL 1JZ7A 1HEZA 4U1KA 3RHWK 2GFBA 3F7PC 2ADIB 1A7PH 2BNQB 4FQLH 4OAWA 8FABB 4ZUWA 2XFXB 3FFDB 3WLWD 2V9RA 4HT1H 1MHCA 1YEKL 4M61A 1JHKL 1F4WH 4YFDB 3O6FD 2BOBA 5BV7B 2YBRA 4DZ8A 5FB8A 2QSVA 1BOGB 5BW7A 1X44A 2QBWA 1E4KA 1A6ZA 4YGVB 4KTEL 1HCVA 1L7IL 1A6WH 1F3DJ 4LCWE 3SOBH 1MNUH 4HUKB 1LDPL 1MQKL 2DBLH 5HJ3A 1RZ7L 4P2RE 2ERJC 1SY6L 4XP1H 1QR1B 4LARH 5HGBB 2QQQA 4LK4A 4GRMB 4MMXC 4ONHB 5DD6A 5E6IC 1AGBB 4DQOH 2NY0D 3BDYH 5BRZD 3RNKB 5EIIA 4CVZA 1WQVT 5C0JA 2XTJB 2CUHA 3UTZB 5KAQG 4G6FB 3HN3A 5FA4B 2OS7A 5F7FA 1E4XH 3DRTB 5DQJB 2ATPB 5KANG 2D7OA 4DVRL 2F58L 4IIQB 3MNWB 2W0FA 5SWZB 1RUMH 4R0LC 2AV7A 4RAUB 4TNWK 4LRIA 1M05A 2OMNA 1X5XA 3WUZA 1CE6B 2ZOLB 3GJFA 1MCPH 3A67H 4LLQA 5H8DA 1SEQH 1KLUB 4JQVC 4R7NB 1U9KA 2X10A 2BSED 4TSBL 3VW3L 5KTEH 2XZCH 3FFCB 4LMQI 3CVHA 5DK2B 1CFQB 5DD5L 2Q86B 5D70H 4RGOH 2Y4SA 4OM0L 2Q87A 4FFVD 4X99B 5B4MD 4AM0A 2E5EA 1KN2L 1Q9OA 2Y07L 5GJTH 3UYRL 1TMCB 4R2GC 3G5YA 3ARFA 5IF0B 4UQ3A 5HGHA 1OGAA 1HKLL 3T3PF 2LAAA 4HMCA 1S7UA 4NQCE 3KLAA 5CD5C 4AQ1B 4XPHL 4M6AA 1RPQA 2QADB 3W82A 5BXFB 1NFIA 4Z8FL 1TJHL 2BSSB 5K9OA 4Y4KC 2EDLA 4TPRH 2E27H 2PO6D 5HVFB 3LIZL 5KVFH 5BVPH 1JRHH 1OTTC 5TPWL 3O2DH 4S1QL 4YHMH 1PFCA 1AI1L 1T3FB 5EU4A 1DLFL 4GW1A 4HWUA 4ONOA 1HIMH 4RISH 4K55A 1HH6B 1AD9A 1B3JA 4X98B 1FV1B 1NC2A 4XB8A 4YC2B 4EQ2A 3BZEA 1P1ZB 4RMSA 1MFCL 1XMWA 3SJVE 5BV7C 4NO0B 3MXWH 5LGKA 4XAWH 2KL6A 2Y72A 3IVKB 2XOTA 5ECJE 1YEKH 4HUVB 3T77A 3V5KA 5ICYB 4ZYKA 4IOFD 4PJEB 3W9DB 2F5AL 5CP3H 5L0QB 1FZKA 4PRBA 3WJJA 1ZA3B 3BIKA 5L9DL 2I24N 4KTEH 3LAFA 2NXZB 2MSPA 4OM1H 4YHIB 4JFFE 4PRAB 3WO3B 1G9EA 1CXEA 4DEPB 5BQ7B 4OCLC 4YHYC 2NZ9D 3VXSE 4NWTH 3D18A 4HJ0D 2DRUA 2JCCF 1SY6H 4PREB 1I75A 4GKSB 2P48B 2XTJC 1KYOK 1UB5A 1FAIL 5EBWA 3QXAB 4M8QB 4DVBB 3IAPA 5DTFB 2VDRH 3S5LA 4EN3C 3VFNA 4LIQH 3ZLQC 1OAZL 1YZZA 1LMKA 2P1YA 3ARGB 1WBZA 5MHSE 4P3DA 4HUUB 3RVXC 2HH0H 4IIQC 5J6HB 5C0IB 1NCAL 1KLGA 4LCWD 3CD4A 3C8KB 2GITA 2P5WE 2HVKA 4Q6YA 4Y16B 2AK4A 2CDFB 4QHUA 1GHFH 3KPSB 1FGNL 4P2RD 3RA7L 3QRGL 4RAVB 2ZUTA 3U82B 3RWJA 1KJVA 3MRGA 1MRCH 1U92B 4YIQB 1A64A 4PJDE 3R0MA 5LCVL 5B8CB 3TBSB 1NGYA 5CGTA 1JBJA 2EZ0C 3MRQA 4TSBH 4UV7L 3VW3H 5GRVK 5E9DA 2ZCHH 3D1MC 2R2HB 3L3HB 1GC1L 3JVGC 1IVLA 4AZ8A 1JCKA 25C8L 1E6JL 5A2IH 1G7PA 5LXGL 4HMDA 1OCWL 5I8EA 1C5CH 2DJ4A 3GBMH 1N8ZB 3QI9D 1ZT1A 4PRIB 4UIKH 3WBDA 5D7IE 3VWJA 2NW3A 4NFCA 3NCMA 2Y07H 4GBXD 5E2UL 1IM3B 2HN7A 3GMOB 5IR1B 2W60A 1SJHA 5I9QB 2A0LD 1LO5A 3NCCB 1HKLH 4JKPL 4PJXB 5C0DB 1BVZA 3FB8B 3KYNA 4NN7B 2QLVB 4XPHH 1QTYT 1KIPB 1ZT7B 3BI9X 4XP9H 4Z8FH 1TJHH 3MLRL 4IHOA 2A73B 1NC4D 3BWAB 1W72H 3DIFA 3OXSA 5IW1A 3LIZH 3VGAB 1LO4L 1F13A 4U1SB 4YHPB 1VFUA 1BEYL 1Q9WB 2JCCB 3G08A 4YC2C 1I9JH 3CFDB 4PR5B 3PP4H 3F12B 1BZ9B 1RJYA 3SKJL 1FZMA 5CBAA 3K8KA 2NW2A 5IHLB 3VXPB 1EZVY 3X3GL 1R5VA 3EOBB 2X1QA 1MCSA 4Y5YB 4NQCD 4PLOB 3F5WB 2F19L 3HZMB 5KOMC 5FYJU 2OK0H 5FO8A 4YGAB 2ZKHL 4S2SB 2F8VA 3FMGH 4GT7A 1U8HA 4OZGF 3P77B 2NXZC 4PJBF 1Q9KA 5F88A 2APBA 5DEFB 1AO7E 2H26A 1AR1C 2E8ZA 3B6SA 4KQ4H 4ZS7L 2GUOB 1A1OA 3CZFA 5L9DH 4JGJA 4OBRA 3P0GB 5T3XL 1NGPH 4HK0B 2CH8A 3I2CH 3LEXB 3KPRB 5K9QG 3DYOA 3V7MA 4RGNE 3SJVD 4YR6A 2CO6B 3B9KA 1S7SB 5C08B 4NP4L 3U7WL 4KKLC 1DVFA 4YX2L 2H1PL 1ZWIB 4KI5D 1PDKA 3P73A 1FAIH 3U0TA 4JRWA 4CGTA 1A1NB 1CFNB 4Y16C 2VLRA 2HT2C 1MEXL 2XXCB 4NQSB 5L6YL 3X12A 1Z9OA 4BQCA 1NCAH 1EZVX 4JFFD 2AEWA 5CKAA 4X0KA 3ROLA 5FUZL 2VE6B 4L4VD 5ITFA 5IUSA 2D7PA 5GGVY 1IEAB 2HTLD 1S5IL 2YUXA 1FGNH 3G04B 3RA7H 3VXSD 5MEOA 4FQQB 4FXKB 5B8CC 3RUGE 3FQRA 1FRGL 2BERA 2FEDD 3G6JE 3FB6A 4NKOB 5HYFA 3RGVD 4NKQB 5DRWB 4TSAH 3ZDZF 5JZ7C 3QUMH 5DUPH 1G6RA 2MJWA 1IAOB 4AT6B 1RHHB 1WWBX 5F7LB 5I1KL 5MHSD 1QNZL 4NNYB 5F3BB 5K9JH 3O3BB 2HFFB 5AYUH 1E6JH 3MUGB 3NZHL 4B50A 2GHWB 1J0ZA 4HGKC 3ARQA 5DK3A 4HWEL 5I9QC 3LB6D 1AQDA 3U6RB 1ITCA 2AJYH 2DLIA 3ULVH 4NN7C 4PJCA 2IAMA 4XBPB 3GSNH 4G6AC 5BZDB 4OF3A 5TQ0H 4BYHA 2R1XA 4JAMA 4GKOA 3VGAC 3HB3D 3SDDB 3UTQA 4R26L 3DVFA 1P4BL 2JB5H 2MHAB 1VSCA 3CFEA 4EUPH 4M7JH 4UNVA 3L5JA 5BS0B 5I1HL 4F2MB 4U33A 3SGDI 1BEYH 4Z76A 3I6KA 1XR9A 3O3DB 4Y5YC 5T5NG 3RIAF 3BIBX 3SKJH 1WF5A 3RZCA 3OAYK 4FG6D 4M48L 3X3GH 3MUZ1 3NCJL 5IFJB 5C71A 2BNUB 2FLBT 1TTFA 4Y19A 3SE8L 1T5XB 1MCEA 5GPRA 3MGAA 4YFLF 5IMOA 4X7SL 1RZFH 2PTUA 1TITA 4M4RA 1DFBL 2DQEL 5KS9A 2UZIL 1A6TB 4J1UB 4CVUA 4W81A 5I30L 1LE5A 3MJ7B 4PGJA 2VL4A 4PG2A 1H3XA 2AAVA 4LVOB 1AGCA 1U58B 4Y5XA 5T3XH 4QXUH 2BC4A 5I8OL 2I27N 1CGYA 2J5LC 3H3BC 5I1GL 3BZ4A 3EJJX 1JGEA 3LQAL 5DJ6B 2VZSA 4R8WL 1BIIB 3GSUA 2PTTB 1LVEA 4GXVL 2J6EH 4JFQA 3V0VB 1HHIB 1N64L 2DQIL 3IKKA 3MOAH 4JRYA 3KLHD 3OKEB 1J0HA 1HHKA 2H1PH 1WIUA 2C9AA 3O6KL 3F7VA 1HQ4B 5GS0L 1N2RA 1U3HB 1AO7D 1YJDL 3PDDA 3SDXF 3QJHB 4LPXA 4RMVA 1MEXH 2R1YB 2MOVA 4JHAH 3ZE1F 4HWZB 4XCYB 1YMME 3WHXB 1TZIB 5FUZH 1DBBL 1CTOA 3BZFB 1XF4B 1TZGH 4IOSD 1I7ZA 3P4NA 4XZUB 4JZOB 1HXYB 4RGND 5HHPA 3HCVB 1FRGH 4Y4HD 4F80A 3B9EA 3D0VB 5EUOF 2H2PD 5IT2L 4L8CA 1XIWB 1ND0B 2FGWH 4X9FA 5M7QA 4N68A 2ICEB 1A14H 1U93B 3KDMB 5I1KH 2OZ4L 2AJSL 1QNZH 3CH1A 1ITBB 3O9WB 5KVDL 2EDOA 3VMPA 4HH8A 3NZHH 4KRPB 4RBPH 5HYQB 3BO8B 3NZ8A 4K71B 1CG9A 3BVNB 1HWGB 1CXKA 1EUTA 5D6DC 2APTA 5BZWB 1OOAA 4FZ8H 4HWEH 2WMPA 5CBEB 5DD0H 1OP3K 4GRLD 3IDYB 4XCNB 4IRZL 3SCMB 1CR9L 5CSBA 1FFPA 2J3SA 3SDDC 1I1FB 2ZCLL 5FIEA 3RWFB 3O3EA 1HQRA 2IPKA 3QH3B 1QSZA 3KXFB 3HC4L 4NZJA 4KK6C 1AD0A 2ED7A 3MGTA 3W5MA 3H9ZA 1A7RL 2R69L 5CILL 2NY3B 1MVFA 2WK2A 1P4BH 5CZVH 1AQKL 4D9LH 4UZGA 4WUKH 1WIPA 5I1HH 4U6XB 5EO9A 1RK1B 4WDIA 3T09A 4I4WA 3RRQA 4FMKA 2H41A 4Z0XB 2CSPA 3NAAH 4M48H 3ZT7A 2OTUA 3RY6A 1AXTL 5T1MA 4OGXH 1HI6A 3PV6A 3JUYA 5F9OL 1BP3B 4PP2B 3MLUH 1PX3A 1QKZH 4X8XA 2W9DH 1ROWA 1G7MA 1T66D 1N5YH 1TZHA 2DQEH 1S7QA 3T3ME 3MROB 2IALB 1A3RL 4MNQB 5C09B 3VGDA 3C60A 4NHUA 5FA3A 1AY1L 4O2EA 2AERT 2IQ9L 1HSAB 5C0GB 3SKMA 2I26N 3LQAH 4X5XB 5HYJB 3G5XA 1OGAE 2YA2A 1U3HC 2VC2L 2DQIH 4I0PA 2YPLA 3N1QC 5SWSA 1HYSD 4M7ZB 5FKAA 1Q1JH 1BREA 5DZOA 3NBNA 4LPUA 1PKQB 5IWLA 4FQ2L 1N0LA 3HC0B 5DJDB 4CMMB 5FO7A 3IU4L 3H9HB 3G5VA 5FYJH 1LO2H 3LCYA 2NZIA 4WENB 4MD0B 2OXHA 5FGSA 4HF5H 5IB3A 4NZRL 2MKWA 1BMGA 4PTTA 4LHUA 1DBBH 2DLGA 5GGUA 4XWOC 1DEDA 4LLUA 1F2XK 4JO2L 3CH8A 1XIWC 4NGHH 2QHLA 5JORB 2O5XH 4H25B 4XHJD 2EDQA 1WTGT 3C87A 4U05A 3WKML 3U4EA 1JV5A 3O9WC 5I6XB 1DR9A 4KRPC 2G2RB 4K71C 3VXUB 2AJSH 3K2UL 1ZMYA 1YMMD 3MRIB 2ENYA 2YD7A 3IDYC 3OB0H 3SKUD 3SCMC 3EYOB 2VO5A 3L3IA 1YY8B 1CGVA 2C3HA 3BN3B 3MXVL 3WIIL 5T1LA 4QRRB 4LEXH 5FUOL 5MENA 3ISWA 3BGMA 1F58L 1KPUA 4WVRA 4E42A 3ZDYF 1IQWH 4EUPB 4LFHD 1DBMH 3QDGB 2ZCLH 1MVUB 1XZ0A 2UUDK 3ES6A 1N5AB 3HE7B 3QA3A 3HC4H 3EJYC 4QCIA 2HKFH 3QDJB 1A7RH 2R69H 5CILH 4YE4L 4F37F 4GAGL 2CLRB 4Z77B 4YXKL 2DBJA 1I8MB 3DV6A 3U9PH 4OLUL 2CLVB 4P2QB 1J0YA 3TCXA 5KBNC 2FJGA 4HS8H 3RAJL 2XTLA 4WO4B 3H6JA 2DF3A 1LEGB 5K9KA 2X9WA 1EAPA 1PY4A 4DZBA 3HZVB 5JHLL 4KKAC 4Q9QL 1IARB 1MPAL 3BYYA 2E9IA 2VDQL 3V4PL 5E9DE 5IFHL 3S97C 3CU1A 2J2ZA 3H42H 5JPMB 1QFUL 4J3VA 5DD1L 3WFDH 2VDNH 1C5DB 3TIEA 1A3RH 1DEEA 1VKXA 4RFEA 3S35L 4MJ6B 4EXPX 4CN4A 4FRWA 1DN0A 1AY1H 3DBXB 4P23A 3PIQB 4XT1C 5HHVL 3X11B 4YEEA 2GK0A 4NRZA 1QP1A 4M7ZC 1M7IA 1WLHA 2ZUXA 1J8HA 5JDSA 4CKVX 2UWEB 1NAMA 5LGJA 1S9VA 4EKXA 1NDGA 5C0AA 3HKFA 1LK3L 2BSRB 3T2NH 4K3GA 4L4JA 4FQ2H 5GZNC 5TE7L 1G7HB 4DUWA 5FKPA 3RL1A 3IU4H 5C2UB 4XXDA 1FNEA 4MCZA 1CFTA 1A4KB 4MQXD 2VZ3A 4MNGB 1G1YA 1NDMA 1XFPA 1GC1C 1Z5LB 2X4PA 4ONFH 3RWDA 4A6YL 4PGDA 3V95A 5L2KB 4Q7DA 2G5BB 5IVZA 3ARFD 3H7BA 4X6FA 4F37K 2XWJB 3C5ZB 2DQHH 4NKIL 4N0UA 1CDUA 1IEBA 5I6XC 5D72L 4WW2B 2GCYB 3QSKB 4MS8C 1IBGH 1FL3B 4AH2B 3ULVC 3I9GL 1NBYA 3SDAC 4WI4A 1MI5A 2F8OA 4D9RE 4AK1A 3FTGB 2DQUH 2G60L 3K2UH 1AH1A 2IPTH 5F70A 1O5DT 2MQCA 3IXAA 1VEPA 5FYLL 1P7KA 3MRLA 4C56A 2P8MA 3GMRB 3DXAB 3EJZC 4GRWF 3MRCB 1NC2D 4QHKJ 1QPXA 3SO3B 3MXVH 2SEBB 3WIIH 3IDUA 5FUOH 4U6HA 4EI5A 4FA8A 5B3JE 4ZOEA 4OF6A 1T89C 3HE7C 1J0KA 4FQCH 4LOUD 3U1SL 4D0BA 2FEEL 3LVEA 5T1KA 4JZNA 5DSCA 4LCIL 4ZUSA 1J86A 3QNXB 5IFAL 1EFXA 4X4XB 1FPTL 1UZ8B 3BH8A 2VLRE 1FJ1A 3QDMB 5DFTA 1MUJA 1U0QA 4JFZL 3GRWA 2YWZA 4YXKH 1VB9A 5ACZB 1PQZB 3CNKA 1S7VA 3X3FL 1U95B 2IQAA 4X9BA 3LKSA 3G9VA 4K8RD 1CT8B 4PJ9A 2RR3A 4YUEH 4AIXA 1CICA 4KVNL 4YK4C 1VHPA 2JJTA 4DOHE 3MYZA 4KROD 5JHLH 4X4MA 4Q9QH 5AZ2L 2GSGB 5FV2A 1AFVL 3V4PH 5IFHH 2DS4A 4JFOA 3O8XA 5INCB 1HZHL 4Z7OE 2AI0L 2DM3A 1SBSH 5I1CL 1OLLA 5DD1H 2AK4D 3ULUE 4EDWL 2F54A 3HNVL 5J6GB 1FHGA 3CFBA 2GAZB 1V7ML 2HTKC 1WAAF 5F1SA 2DLFL 5GISL 5HHVH 43CAA 1BFOA 2C3VA 4PYGA 1S9YA 2EDYA 2GTWA 4NQDA 1P2CA 4PJCE 4YPJA 1S9XA 4M9OA 2HJKA 4LGPB 2OQJB 4OCXL 1QVOB 3GJEA 5GS2D 1AGEB 1VEOA 1WFUA 5E9DD 5ADPH 4XPTH 3IJSB 4Z7UB 1LK3H 2AEIT 4Q9BA 4BFEA 3G6DH 1ZHLA 4HUWB 5FCUL 4GRWB 5TE7H 4PJHF 1XF5A 4HJGB 2A6KB 2V6HA 5KVGL 4NPYA 4F15B 4QRQA 3C5ZC 2Q7YA 3VWJD 4GSDL 4KJPD 1RJLA 5ALBL 3UTPE 5TDOA 2IEPA 3TVMA 2D03L 1O7VA 1DBKH 4TVSa 2IC2A 2BXZA 5DLML 1ZHBB 3B43A 2O61A 3KYOA 3T0EB 4NKIH 4IDJL 5TF1L 1YN7B 2H3NB 3ARTA 2QSQA 4N9GB 1KCKA 4L9LA 5D72H 4WTZA 4WUUA 4Y19E 3EDDA 1WVZA 3D0LA 4U3CA 2VLKB 5KS9E 3FKUS 4P3CL 4OZGA 4YZFF 1IC7L 2AK1L 2VDKL 2RGSA 4PJBA 5FGBC 4XP5L 2G60H 3U0PB 4JQIL 2ITDA 5ILTL 1KPVB 1QSEA 1AGDA 5E2WH 1WT5C 3SO3C 2IMMA 3BSZH 1IC5L 5FYLH 1HH9B 5CGYC 3L95A 2LU3A 2VH5L 1YPZF 2R56L 1G7JA 4Q9RH 3QUYC 3MZGB 4NKMA 3FAXA 5M94B 4PJ8B 3WXWH 1KTRL 5DURB 4JGUA 4JRYE 5DEGA 3U1SH 2XZAL 3GIVA 3ARDB 4D9RD 4BH8B 4LCIH 1FO0A 5GS1A 1Q0XL 2MNUA 4KGJA 3VXOB 1FL6A 3LKOA 4R4BA 4PRNB 1X4XA 5ETUA 4QLRA 5CJQL 3BESR 2R4RL 1AIFA 3I3BA 2FYYB 2AXJA 2EC9U 3GIZL 4O51B 1FFOB 5IM7A 3CK0H 1R5IA 2UY7A 5F71A 1GGBL 4MD4B 5EU6A 1OPGL 3B9KD 1HOCA 1E4JA 1IGFL 4P46A 1DVFD 3CPLB 2EDTA 2ZG3A 5HVHB 1KLFA 1SJEA 4M4PA 5BO1H 1EH9A 4LNVA 2Z8SA 1INDH 3LQAC 2VLRD 2HT3D 5AZ2H 1YECH 1E28A 5JIIA 1CDYA 1MCIA 1AFVH 1DQJB 2EIDA 4OF5A 1CXIA 2AKRB 1B6DA 1IGJA 4RMWA 3RKDC 5I1CH 3P0VH 5ANMA 4JKMA 5GS0C 4G6KH 1YJDC 3TZVB 4MAYA 1ZT4A 3NMEA 3O2WL 1FYHB 4XHQA 5IJKA 1I7UB 5GISH 5C0RL 5E8OB 4C54A 4GAYB 3V52H 3HLAA 2ATKA 4M5ZH 2OJEB 5C86A 5HI3D 3RKPA 3HI1B 1C7TA 3ZDXE 4ENEC 1FH5L 4Q6IC 2IMNA 4V1DB 4G8IB 5K59E 4PBVC 4F15C 5J4MA 3VFMA 1CFSA 5FCUH 2QHRL 1MFAH 3MRHB 4NNXB 3ULUD 3T4AA 1X7QB 5A3IC 4NBZB 1NMCB 5E8PB 3F6LA 3ALXA 1EIBA 1JGDA 3T0EC 3P9MB 2OL3L 3DARA 4BSWA 4QRUA 2WSKA 5FHAH 1NMBL 2IAMD 3G6AB 4F58L 2EDBA 5TJWK 5TF1H 5EBMA 4X6DF 5E2TL 1JGUL 1QSFA 2DQGL 4BZ2L 2R4SH 4X6CE 2LU4A 2DQDL 4HPYL 2EXYD 3IU3B 3EAKA 1ZE3C 5HGDA 1FFRA 4L3CA 1S7TA 4XC3H 5C0FB 1R5WB 4OZFG 2AK1H 2JJSA 5HI5C 1H5BB 2IPUK 4WI3A 4XP5H 2OLDA 5IESL 2HYMA 4M7LT 1XF1A 1IC5H 4PJ8C 4UILL 3UTPD 5HHQA 2VH5H 2R56H 3RZCD 4UDUB 3ZKNC 2BJML 1YEDA 4KHTL 3ARVA 1IQDA 1RVFL 4Y19D 3AREA 5SWSE 1B0GA 5ALCL 4XMLL 1X9QA 4I48B 4MZ2A 3DUHA 5D1XB 3TNNB 4YHZL 2D3VA 1DQQB 1MFBL 4RDQG 3SDXA 1TVBB 3SE4C 4TQEH 2R4RH 2RHEA 4WU5B 4NZUL 3GIZH 4XBEH 5HVHC 2VDLH 5DJ8B 4TUJB 3UJIH 2C26A 4JRYD 1BFTA 4ZPTA 1ZVHA 3VXMB 5EUOA 1R3JB 3DETD 1KEMH 2W1NA 4AMKL 1CU4L 1TCMA 5E4IA 1MRDL 1KIQA 3EGSA 4OD2A 2Y1VA 4KVCH 2I07A 2BMKA 2CQVA 5KSVA 2X1PA 4Z7WF 3TZVC 2XRAH 4LL9A 3DJ9A 4HX1B 5I66A 3S36H 3V7AE 5I73B 3SDCB 5IEHA 3RDTB 5JXAH 1MJJA 2P4AB 2X70A 4FTVB 3BWUC 3BQUA 1LEKB 3CXHJ 3BUYA 3O2WH 3CUPB 5HHXH 2RCSL 4EOWL 3BP6B 5MENE 5C0RH 2J8HA 1YUHB 3ZKXB 2N7BA 3ILQD 4S1SL 2FZ3A 1KCUL 1F97A 3C9NA 1JNHB 2Z93A 3RX8A 3GHEL 1TETH 3JWOH 3MRRB 2Y06L 4BK4A 1SMAA 2CMRL 3VI4F 4A6YB 1EMTL 4XNXL 1DANU 1F6AA 5MEPB 1UA6L 3BKML 1ZVSA 1YN6A 4OFYA 4XPGH 1RJZB 2AV1A 5TH2A 1RU9H 1W8OA 2ADGA 3I02A 2PF6A 5HGAA 2GQHA 3S3PA 1FNSH 5C2BL 3NACL 4N8VG 2W9EH 4I9WE 4G6MH 1CK0H 2AJXL 1NMBH 4ODTL 4O02H 3CX5J 2PW2B 2YUVA 4DCQA 1VGKB 4P2OA 2EEAA 3MNZB 3PHOA 3U9UA 2DQCH 2ICWJ 2X7LB 3HR5B 5E2TH 4PB9L 3OKNB 1H5BC 4PRPB 4X9GA 3OZ9H 5I1EL 5KSAA 2BVPB 5EN2B 2A6DB 1SHMA 5DJZA 1B0RA 2IF7A 4F3FB 2XQYG 3DUSA 5IB1A 2Y7QB 3FQUB 1J11A 1ZOXA 1JZ6A 1NLDL 5CJBA 5IESH 2XA8L 4GS7B 4M6NH 1J9CT 3MACL 1KV3A 4M1GH 4LBEA 4LLVB 4QYOB 5CP7B 1QRKA 3ZE2F 4JRXA 4UILH 4O58L 4JO1H 2BJMH 1YEJL 3RJQB 5DHVA 1RZIB 1J8HE 2A6IB 2FX7L 3Q2CA 4HGWB 5D1XC 2HFGH 1RVFH 3Q3GB 4K7PH 3P4OA 1RUPH 3QQ4A 3T3PE 3G5ZB 1DJSA 4ZD3L 5ALCH 5C0AE 1T7XA 2HRLA 2FWOB 2BZDA 4YHZH 1EJOL 3GMLA 3TESA 1DTUA 5IB4A 4OZHB 1MFBH 4UT9L 3L3GA 1MREL 3C60D 3QIUB 3DX8B 4DK3A 4MJIB 1H0DA 5IW6B 5IIEB 5EORL 5B3NA 1A5FL 1UWGL 2VUOA 4I13B 4NZUH 1CD8A 1N6UA 2NY2D 1Q0YH 4G8GA 5FECB 4J6RL 1P4LA 4N0CC 2B20A 4N0UE 4NQEB 4X6BA 2A6JA 4I0PD 2YPLD 5SWSD 4J8RA 4N8CL 1QRNB 2RAMA 1M71B 1T1YA 4AMKH 3UTOA 2Z4QA 4LLMA 3L3KB 4HDIB 5JOPE 1MRDH 5I73C 3SDCC 1CGWA 1MI5E 3RDTC 1HILA 4LLYA 4ZFGL 5E00B 5T33L 2L7UA 5EOTB 4HK3J 3UDWA 3IDXL 5ADOL 3LD8B 2NY1B 3MLWH 4LHUD 1UJTA 3OR6B 4C56E 3NPSB 3ZKSD 1MELA 4PLJC 3ZKXC 4ODHH 4OI7A 1DUZB 1FVDA 1EEZB 4PJGF 2DMKA 6FABH 3U30C 4XVJL 1D9KA 5LJYH 3JV0A 4EOWH 3VFRB 32C2B 3P9WB 3LKPB 4X5WA 2WANA 4S1SH 5D1QA 2YK1H 1WFTA 4R96A 5DC0A 1A6AB 1NEZB 1B90A 3Q6GL 4DAGL 2B7DT 2FX8L 5F9WB 5HHME 3QXDB 3VRLF 4KJWD 3QUXB 4UTAL 3QPQC 3CMGA 5KZCD 3D25B 2VZ1A 3VWKA 1UA6H 1OAQL 3BKMH 4DKFL 1A9EB 4LCYA 1C1EL 1T0MA 4GKZB 3CFKA 2OTWB 2WP3T 3QFJB 5T1LD 2YS4A 5MEND 5GZOD 4YHLL 5C2BH 1IKFH 3TWCH 4U1NB 1JMXA 1U8QB 3PF2A 4IRJA 4LDEB 1EO5A 2X4QB 1I1AA 2X4SA 3RTQA 3MBXL 3QJFB 4HIEB 5KANI 2R1WA 4HKBA 2AXGB 4OCSL 3MPCA 1BQHA 1WCBB 4X4ME 4PB9H 3E0GA 3MJ9L 4GS7C 5I19L 3P4LA 5MERB 5JW4R 4BUGA 1OAYH 4LPVA 1NJ9B 4TUOB 1X5AA 1NGZB 1XGRA 3BP4B 4ZSOA 1NLDH 2HWZL 4CU6A 5LGHL 2XA8H 2F54E 2Q3AA 3CVIL 3DX6A 4PJ7B 3TO4A 4YPGA 4I9WD 4O58H 2BY2A 1L0YA 2H8PB 1HHJA 4LCUA 4NRXB 1S7WA 5E4EB 4RZCB 2V5YA 3SGEH 3TIDA 4NQDE 1MWAA 3L3OA 1VFAA 4PJIA 4Y2OA 1GGCL 1WBXB 4JPWL 3S6CA 1NCDL 4ZD3H 2Q1EA 3WS6C 3QIUC 4PGBB 3RWGA 3NH7L 1EJOH 4L4TA 3LZFL 2VITB 4CDHA 1R24B 4NO2A 3UTSB 4QHMA 4O2FA 3ARBA 3T1FB 4P23D 2HT4D 5J06A 1A5FH 4F7MA 3B2UC 1A9BA 5E03A 4GQ9H 1FGVL 2B1HL 1J8HD 1DLHB 3MODL 2XACC 5C0AD 4JFYA 3MV8A 5KW9H 3OHXA 3KYMA 3IXTB 1MAMH 3LD8C 1MHEA 1KCSH 5GGTA 3O6FB 3FOLB 3FO0L 1CD0A 4OZGE 1RZGA 3QNZB 4PJBE 3OBAA 3IDXH 4QF1B 3W11D 2NY5L 4MXVE 1QSEE 4DFIA 3AXLA 5J9PA 1Q72H 3VD9A 4ZAKC 5IVXF 2G75A 4RWHA 1EEYA 4NHCL 4LSVL 4MD5A 1P7QB 4XCEB 3L7FA 4N5UA 4NJ9H 5LVEA 3LEYL 5F9WC 1HSBA 1Q94A 3QUXC 5JOPD 4JFDA 3MR9A 1MI5D 4U1JB 3STZA 3VFWB 5FO9B 1L6ZA 2NY0B 2OL3B 3MLVL 1QBLL 4PJ5A 2CIIA 3Q6GH 5BRZB 5KG9B 3SEPA 3P4MB 3SKOA 3UO1L 1ZANL 3SQOH 5HVWA 5DF0A 4C56D 1YDPA 3NN8B 3MRNB 3S5LG 1MF2H 2X4RB 5I75B 3VFSB 4BK5A 1D7FA 3GMQA 4U0QB 4F8TA 1C1EH 1KELL 1KTKE 4TOYL 5EU6E 2ITCA 4EI5D 1FC1A 2AJUH 4U1MA 1KNOB 1ZGLP 3D9AL 4NFBA 1NFDB 2I9LB 5T1KD 3DV4B 5E6IA 4XC1L 3JV4B 1P84J 3MOQA 4HCRL 4H88L 4OCSH 2BY0A 4WNQA 2XG5A 1EFXD 4HUXA 3ZDZE 1QBMH 1T7WA 5I1AB 5HHMD 5CHNB 3RFZC 3WLBB 3AU1A 3WFZA 1XF2A 4UINL 3VG9B 3LKRA 1JF6A 4MNHB 3SHSA 3K7UA 2HWZH 5ANME 4MVBD 5LGHH 5E4EC 3BD3A 4L3AA 5CZKA 4NYLA 3VD5A 1N4XL 4H26A 4P5KB 3WIHA 1LNUA 2FHBA 4HKXB 4L1DA 1WAAA 4PJ9D 4DTGH 1CICD 3OKMB 4GOSA 5I2IB 3QG6A 3MLSL 4G8EB 1MH5A 3BH9A 4JPWH 1X5ZA 2C1OA 3O8XD 2Y5TB 3NH7H 4P99A 1XGYL 1ZTXH 4D2NA 5F96L 4IS6A 1CDBA 3LZFH 4QEGA 4QGTA 2F54D 3RBGA 4WTWA 3WMSA 2PO6B 1FDLH 4PJHA 5JO5B 4UUJA 1D5IL 3O4LA 1CWVA 4XNYL 4NQDD 4LQ1A 1X5JA 4EIGB 4Z78A 1FGVH 4UIMA 3WLWC 3PWLB 4PJFF 4WJ5A 5KSBB 3MODH 4NN6C 4PIRF 4WHTA 3WL9A 2VJXA 5HHOA 3A6BL 4Y8AA 3LS4L 2ZG2A 1QSFE 3A0OA 4LSQH 2ZPKH 1ZXQA 2Y6SD 3UZEA 3IJYB 2DI7A 1CLYH 5JXEA 1TENA 3HA0A 1OARL 4LVNB 2GSIA 1U91A 4KK8C 1YMHA 1NBZB 4ODBD 2OMBA 3TVMD 4IMLA 1YPZA 1I8KA 4UQ2B 1RV6X 5DZNA 4LGRB 5FM5O 4LSVH 2A83A 4MA3A 4WUUD 3ULVF 3OKKB 2DKUA 2NY0C 1C7SA 4YWGL 4Y5VA 3LEYH 2Z0BA 5AUMA 3LS5H 4HFUH 1K4CA 4Y88A 1K85A 1RIUL 1RFDH 2K7QA 1T03L 3KPOB 4Z7VF 3BP5B 2VR9A 4X8JA 1QSED 3SDXE 1FBIH 3VFTA 4OZFH 5K93A 5CJOL 3VRJA 5K33A 4LCWB 3ULSB 5JW5B 1N0XL 4DGYL 3PDOB 4KZEL 5C3TA 2WIMA 5HGBA 5I76B 3KNBA 2O5YH 2WV3A 4W6YB 3OTTA 3QEUB 4P2RB 1KELH 1Z9MA 1RZ8A 4JJ5B 1BVLB 3H0TA 3WFBH 5E5UB 3RWCA 4M7KH 3EDEA 4YAQA 3HI5L 5EG6C 3D9AH 1A6VH 3E2HB 3UTZA 5EUOE 5F7DB 3BP7B 4F7EB 2Y36L 3L9RA 4R3SA 5FA4A 4H88H 2EEDA 4EN3A 1ZS8A 5CZXD 5JOEA 1U2HA 3GI9H 1BD2D 2CXGA 2RBLA 2DWEB 1KIRB 4IIQA 4FFVC 5E95B 2C7UA 3JV6A 1UM6L 2JF1A 3UTTA 2N56A 2YZ8A 4R4NC 1MJUL 1XEDA 3QI9B 3WHE1 5EU6D 5GHWL 1C16B 1DE4B 4P46D 4R7NA 1N4XH 1VFOA 4YBQC 4U7SA 4GBXB 4EJ1C 1UXSB 3QO1B 3QHFL 1WGOA 1CFQA 5GRUL 1QFWH 4ODSH 2QQNL 3MLSH 4ELMF 4KV5F 5D7SL 1REIA 2PO6C 2WNGA 1IT9L 1KJMB 2WIIA 5ENWA 3REVA 3RL2A 4ALAL 5BJTB 1XGYH 3MRKB 2UV3A 4U4BA 4KMTL 5F96H 3OAUL 3EDFA 1NC4B 2A1WL 2D7MA 4OSUH 5DUBA 3RGHA 1JWMB 4MAYD 3RU8L 4ZUTA 2J88H 1D5IH 5J1SC 5DRXA 1VFBA 4XNYH 3VFGL 3QWOB 5I1DB 3VA6A 1MFEL 1FCGA 4ETQB 5BXFA 3Q5YA 4PRDB 2E6JA 5JW3L 5ACLA 2V7HA 4NQCB 1BBDL 2ICWB 1KTDA 4X6DA 4LVNC 1MY7A 4ZUVB 5ESAB 1JN6B 4I3RL 3LHPH 1E4WL 5CIPH 2VDOL 2FEEI 1RIVL 4NBYB 5BMFL 2AGJL 5TDPA 2NZ9C 4JRXE 2LVEA 1IGIH 4HJ0C 4NFDA 3O6LL 1P5VA 3VGEA 1UCTA 3QQ9C 4KJYB 5JUEL 1J0IA 1H3PH 2R2EA 3SJVB 1F6LL 1Y18A 2ADFH 2P8PB 2WQRA 1CGSH 1QSFD 5D7IF 2X41A 4UB0H 2FHCA 4YWGH 5JW4N 1W0VB 3L5WB 3EOTL 4JM4H 1B88A 2VQ1A 4ZQKA 2WBJA 3U4AA 3WNLA 4GJTB 1LD9B 3ARWA 1WBYA 4WY7L 2W0PA 3HRZA 1T03H 1I3RA 4LF3A 2NTFA 3SPVB 1PZ5B 3PHQA 5CJOH 2I5YL 4JFFB 1N0XH 5DI8B 2V9QA 3CVHL 4AIZA 4L4VB 1V5JA 3QZWA 3GUTA 1S7RB 5ABDE 3E2HC 4TSCH 4G8GE 3VXSB 1AXIB 4LKCA 3HMWL 1QFOA 4NT6A 5A43C 2EDXA 5JR1L 3ARED 3GMPB 4QY8A 1QEWB 3RGVB 4NWUL 5MP6L 1BJ8A 3EKCA 4RRPG 4NSKA 3U7YH 2W07A 1X5KA 2Y36H 2E9JA 4FZEL 4P48A 4MB4A 5CLWA 1UJ3B 2P24A 2CIKB 2EYTB 3UC0H 3CGTA 3QI9C 4GAJH 1UM6H 2P8LA 4Z7WA 4N0YL 4F33A 4QHKI 1S78D 3FO2B 4GBXC 4U0RC 4CL7A 3I6GB 2Y5EA 1F4YH 5DD3H 1JNNL 3A6CL 2A0LC 5DJAA 4BH7B 3HRPA 1EAJA 4UTBL 3L5XL 4PJDB 3NIFE 3NA9H 3RWEA 2R2HA 3QHFH 3L3HA 4XVTL 3WFHB 4UV4H 5J11B 4OT1L 5CMAA 2EDNA 3ZDYE 3I6LE 2QR0B 5DQ9A 5EWIL 4QRPA 1FFNB 3Q5TA 1N26A 4FQIL 1GPOH 1P4IH 3WS3B 3FO9B 3KYKL 3NFPA 3U48A 4PGCA 5D4QA 5C0NC 4D8PB 4IM8A 2DYPA 3BQUD 3MV9E 4PUBL 5I1LB 5I15H 2VIRB 3UAJD 2CGRL 3VXNB 3IS1X 3GBLA 4LDOB 1SJXA 1MHHA 4G5ZL 5I16B 3K81A 3IF1B 4KUZL 2CKNA 1MFEH 3U79A 1FLRH 2PW1A 4GW5B 4QTHB 4TUKL 5JW3H 5GJSH 4URTB 1T1ZA 5DJXB 4K7FB 1BBDH 1VGEL 1MCCA 1I8IB 4FFWD 4U1LB 1BLNA 4G8FB 1D5XB 5IMKB 5IOPB 4I3RH 1ORQB 4K8RL 2UZYB 1NGWA 4RFNB 2YD3A 2MWCA 1YEFL 2VDOH 3O3AA 4ZSOE 4PV8A 4OFYD 4OTXL 4HV8A 1G9NL 4GAFB 4U7KA 2XXMB 5BMFH 2AGJH 5EUKA 1E27B 1JUFA 3HZMA 4KRNA 3P30H 1TTUA 3O6LH 2LVCA 4P2OD 1BJ1J 4TTGA 3BGFB 3L5IA 4KI5C 4LSPL 4NZTL 4TVPE 3T0DA 2OI9B 1LO0L 3P77A 3HG1A 3MRBB 2BDNH 4PJIE 4QHNB 4DW2H 4L8DB 4NUGL 5DFWH 1U8LB 4N8PA 3Q5OA 5KSAD 4UNUA 1KTLA 1KEGL 2Q76A 1AO7B 4L4TE 5EOCJ 1JWUB 1GGUA 5EZLA 2IADB 3EOAB 4G9DA 3SE9H 1KPRB 4MJ2A 3MRFB 4DGIH 4UDTA 4JRXD 2XWBA 2I5YH 2D7TL 1RK0A 2FEDC 3IDMB 1NEUA 1VACB 4RGNB 3GO1H 3RGVC 1N59A 4Y4HB 1A1NA 4LHUG 4I1NB 4WFEE 2D4DA 3FQWB 1I4FA 1UJ3C 3CSYA 4CNIA 4NQSA 3S88L 4HLZG 4NWUH 1IAIM 5FF6B 3SDYH 3RQ3A 3V6FA 1LEIB 1Y0LB 3BIAX 3UMTA 3ZKMC 1MIEL 1JYXA 4NQVA 3FZUC 1HNFA 1NKOA 3TCLA 3LB6C 3O2VL 4M6OL 4N0YH 3T0WA 5IB2B 5AYQA 1FN4B 4W6WB 3EO1A 5C0EB 2L4OA 4G8GD 2V2WA 1FZOB 3RUGB 1JNNH 4JFHD 3V7AG 3OKOA 4PJGA 5GIRB 3IFNL 3G6JB 4GRLB 1NUNB 1OY3B 3OWEA 4JFXB 2CDEB 4N0RA 1KXTB 3L5XH 2Z35B 2W0KA 3VFVA 4L8SB 1FNLA 1D5MB 5F3BA 4XVTH 2HFFA 1FVCA 2BHYA 4WGWB 4HW6A 3OB0K 5GGQL 3E6FB 1T22A 4JFDE 1AE6L 4BQBA 5T1DH 1FVEB 4YDKL 4PJ5E 1I85A 1EO8L 1U8IB 2CJUH 4FQIH 1LP9A 3KYKH 4O4YL 3LQZB 3MA9L 5I1JH 3MO1A 2WINB 5CSZA 5D6DA 2EC8A 4F7PB 1AKJA 1UKSA 4PUBH 4FG6C 5SWQB 1RZJL 1QYGL 1GAFL 1D9KD 3E6HA 5HPMB 2Q6WA 3O2DA 3CDGB 2NY5C 5EOCL 1JK8B 2EEBA 2ZOKA 1X4YA 4KUZH 4TTDC 3GK8L 2HKHL 5D1QD 2Z92B 1OTUD 3I6LD 3R06A 2HLAB 2MHAA 1LE9A 3B8YA 3RWHB 4RFNC 3K8LA 5F72S 1VGEH 1BM3H 5F1NA 3FCTA 1XGUA 2C1PA 4CUCA 4MQSB 4I3GA 3VWKD 4ETYA 3U46B 3D6GA 2WQ8A 4N8VB 3X14B 1YQVL 1KENL 3BEWA 3IT8D 4JO4H 2FNBA 4OTXH 2R9HD 4R9HA 3DVNA 1AJ7L 4P5TA 1G9NH 4WFGE 1TNNA 4ODWA 4LKXA 4OQTH 5DFVD 3H9SE 4HPOH 2MPAL 3ZO0A 3DI2B 3EYVB 2VUYA 2EKSA 2DB8A 1ZHNB 4IRJD 1WAAE 3TT3L 3KLHC 1I1AD 3RTQD 4RIRB 5I1IH 1I9EA 4IEFB 4LSPH 4NZTH 2HJFB 3WUWB 1OGTB 1OTSC 2IWGA 4NUGH 3TN0C 1JPTL 1HKFA 1KEGH 4MDJA 3IS0X 1DUYA 5CEXA 4K2UH 5F1IA 3WYRA 5DVKA 3T0AA 2XQBH 3VI3F 4WHDA 4YDJA 5BVJA 1OQOA 1G6RL 3MCG1 4PJHE 4RGNC 3U4BH 1IRAY 5JOFB 2R23B 4I2XB 4CRPA 3TO4D 1HHIA 4FQHA 3O4LE 4Y4HC 2VDPL 2H2PC 1LK2A 3UBXB 1Q38A 1P5UA 1PAMA 2HG5A 1BBJA 2E9BA 2UYLB 4X6EA 3ULUL 1IC4L 1MCQA 3C5JB 3WN5B 4HKJA 5HHOE 2V7NB 3BD4A 4MA7L 3QEHB 3BKJL 3NIGF 1OT2A 2NQCA 5DVMA 2F5BL 2PR4L 4L4TD 4RQQB 1MCJA 3T0BA 2DOCA 1CLOH 3ARBD 4YZFE 2KUTA 2ZSVA 3T2OA 1Z2KA 1OQXA 1YMMB 5T3ZH 4WHYG 4M6OH 3KWWA 4M00A 4U1KB 5IVXA 1B9ZA 4KHXH 4L8SC 2GFBB 1YPZE 5DS8A 4U1GC 4WFED 3IFNH 4ZDHA 4K3EL 1MRFH 4NO3A 4OAWB 4ZUWB 1IAKA 4OB5H 4ZFFA 1ES0A 3ZTNL 5ITBH 3CFIC 3DX7A 3MV8D 3X13A 1MHCB 1M7DA 1DL7L 5E8EA 4M61B 5GGQH 4H0GA 4BFBD 1AE6H 1BOYA 2BOBB 1EUUA 1WZLA 2V9TA 2YBRB 4DZ8B 5FB8B 4YBLB 4FHBD 1EO8H 4LSUH 5EU3A 4P9ML 1A6ZB 4O4YH 1PSKL 3PJSA 1JYNA 4JZJB 2N1KA 5EIVA 2VXTH 2VTFA 3V5DA 4OCYL 5HJ3B 1W72A 2GT9A 1RZJH 1QYGH 1GAFH 2X05A 3NGBB 3KXFA 4JN1L 5EOCH 3INUL 4KFZC 5ERWA 2A77L 3GK8H 1G1CA 4PRHA 4JFDD 5IV2A 2GJJA 4C4KO 1T66C 3QIBC 4AQOA 1HHGA 4POYA 1U42A 3BPNB 4PJ5D 3F62A 3U2SA 4CVZB 1TVHA 5C0JB 1X5LA 2NXYC 4XX1E 3WXVL 5SWZE 1T20B 3UTTE 4K9EL 2J1KA 4EI6A 2BVQA 3S35X 1YQVH 1KENH 4C57C 1OAKL 1AP2A 3QBTB 4KPHL 3C6SA 2CKBH 3N1PC 2W0FB 3V9FA 2AV7B 2MPAH 2KZ1B 4UBDD 1M05B 1OB1A 1HYSC 5HD8D 5TF0A 4LLQB 4NJAL 5IMLA 3CVHB 1UVQA 2GIYA 2WBWB 2F15A 2P7TA 2H32H 1UACL 4F57L 1HSAA 2Z91A 1G6VK 3IFOA 3BW9A 4WFGD 3FRPA 4M8VA 3TFKC 4AM0B 5HYJA 4JLRA 3WN5C 1Q9OB 1BQSA 1VFMA 5CD3A 3U7AA 3G5YB 4XHJC 3ARFB 2ICWI 3BISA 1ACYL 3DRQA 4PJAF 4UOJA 4UQ3B 5HGHB 5E8NA 3GNML 4PJFA 2WWMC 1S7UB 2AJVL 3KLAB 4OGAD 1JHLL 2EECA 4X6DE 2EC9T 4MD0A 1PKOA 3H3PL 1L0XA 1NFIB 5K9OB 2PR4H 5E2VH 4OD3L 4WTZG 2ADJA 3QUMA 4IDLA 3EW3B 1X6LA 4M1DH 5DR5L 5EU4B 3O4LD 4GW1B 5MEQA 5CEZE 4U2YA 3TNMA 2JJWA 1AD9B 1Y6KR 4DFHA 5C0CA 1NC2B 3FQTA 4DK6A 4TRPH 3BZEB 5DO2D 3PWPA 5HHOD 4K3EH 1XR8A 1QR4A 5DC9B 4LLDB 3ZTNH 3LMJL 5BW7C 4WV1A 4YBLC 3V4VL 1F4XL 2R0WL 4HWBA 4X9IA 1E4KC 3SDAA 3T77B 1DL7H 3EYUH 3V5KB 4QXWA 4ZYKB 2FRGP 3WNNA 5JXED 3GSNA 4UT6L 4JZJC 4XB7A 2B0SL 3MLZL 4PRBB 5F7KC 2VDML 3BIKB 4P9MH 4LCCC 3DMMA 4MHHG 4Z7VA 4PLNC 1PSKH 4M62H 5L2JA 1SYSA 4JN2A 3HNSH 3KPNB 3RNQA 4NRYA 4OLXH 4XWGL 1WUNT 4OCYH 5EU5A 2HA1A 3B9AA 4ZTPH 2DTML 1UXWA 5SX5H 4HG4K 3BXNA 5EZOH 3D18B 3FN3A 3GSXA 4DN4L 4JN1H 4Y2DC 3BPNC 1XGTA 4ZXBC 5E08L 2A77H 4HKZA 1I1CA 3QDJA 3B3IA 4KROB 5EBWB 1YC7A 5AZEL 3S5LB 1IKNC 3VFNB 2A9ML 1WBZB 2EIZA 4OD1H 4P3DB 4PGZA 2R0KL 4HC1H 1UB6A 3WXVH 4Z7WE 2QTEA 2GITB 2HVKB 4XNUL 5C0BA 2CRYA 2AK4B 3SN6N 1QO3A 5T5FL 3SGDH 4HAFA 2FBJH 4N1EA 1Z0NA 4CVWA 1CD1A 3RWJB 1KJVB 1WZKA 3MRGB 1T1WA 3FOMA 4DWHA 3MV11 1K2DB 1NGYB 4LPWA 4EN3D 1IJ9A 4PV9A 3SGKA 3QUZC 4QTIH 4JDZA 3MRQB 2J6EA 4ELMA 1K3IA 5E9DB 3MJGX 3MA7A 1IGML 1GGIH 3IDJA 2F53A 3UTTD 3VI4E 1C5BL 3MV01 4G9FA 4F57H 1G7PB 1T2QL 5I8EB 1CXLA 3FAWA 3MBEA 4J3TA 4KRMB 1ZT1B 2MQ0A 3TBVB 2UWEA 3DUUA 1FIGL 3VWJB 2NW3B 2DLTA 1KYOJ 2HN7B 2W60B 1SJHB 2P5WA 2UZXB 1ACYH 1LO5B 4E9LA 3RWIB 2R2BA 3GNMH 1NUGA 4IJ3C 4MB5A 3DX9B 1XCTA 1QFWM 3KYNB 3V6BR 1FAKT 2EYRA 2VQUA 3HFMH 4AIOA 1P6AB 1L4IA 5A2JH 2GJ6A 3WSQH 4IHOB 4OD3H 5KSUA 4AEIL 5EZJA 1QQDA 3DIFB 3OXSB 5IW1B 5EO1A 1N7MH 5DR5H 3G08B 5B38A 2JLLA 2BHZA 4MQTB 1RJYB 2Q8BL 5DJ0A 3U0WL 3UX9B 1FZMB 4JR9L 5CBAB 2XN9A 2NW2B 4HS3A 3FT3A 2E7LC 4PY7A 1R5VB 1YY9C 4HIXH 4AL8H 2UVEA 4R6UA 2V17L 3HG1E 4ONGH 2BXYA 1OAXL 2LE9A 4XTRD 5D7IA 2YMXL 1F4XH 1R3HA 5FO8B 4YXHL 4G7VL 4HIIA 1U8HB 4GLRH 1S9WA 1Q9KB 3CXDH 5F88B 4KDTA 2H26B 3EYQD 3AFLA 5I18L 3B6SB 4K3JH 4JG0L 2B0SH 1A1OB 2EO1A 3CZFB 3MLZH 4XPFH 1MFDL 1N3NA 2AXFA 3LSOA 4DN3L 1B4JL 3ME0A 3QUYA 4K8RC 1BIHA 2E6PA 4XWGH 2P5EA 1Q9LA 1T2JA 2DTMH 3I3DA 2M2DA 1T0NA 4APQA 4KROC 4YR6B 3B9KB 1OAUL 1G9NC 4HSQA 1DDHA 5E08H 3T2PA 1DVFB 4OV5A 3QR2A 4QXGH 4BSJA 1MIML 2GW5A 2PNDA 2FATL 3TYFA 1HXMA 3P73B 2WBJD 3U0TB 4HBCL 3VA2C 5I8KL 1AR1D 4KJQC 2VLRB 3D2UA 1MLCB 3W2DL 3HE6C 4JY5H 2OR7A 2VWEE 3ROLB 5ITFB 4XNUH 4S0TD 3GI8L 5T5FH 4PYHA 5MEOB 4DKAA