2VDPH

Integrin alphaiibbeta3 headpiece bound to fibrinogen gamma chain peptide,lggakqagdv
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
219
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
total genus 43
structure length 219
sequence length 221
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdpH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdpH02
4KRPC 3EYFA 1UJ3B 1BX2B 3OAZK 2VLJB 4HCRH 4XPHH 4MJID 3RZWA 1QRNB 4YE4H 2FHBA 3TO2B 1HE7A 2ESVD 2CUHA 2AV1B 4WRLA 5KVFH 1JE6A 4JPVH 3V0VA 1T22B 4X6CB 2GK0A 3ARDB 4NQCD 5ISZB 3QQNA 4PGCB 3GDBA 1DUYA 1ZANL 1FYHB 4Q2ZA 2DLEA 4L4JA 1FNFA 3H9SB 3O6FA 4MD0A 1AXSB 1SY6L 3RIFK 4JO4L 1AY1H 3LDBB 1WWBX 3MGTB 4JFDD 3CFCH 1FVEA 4P9ML 4PYGA 2NY3C 1F6LL 4LVNB 4HQQH 2ZPKL 5DWUL 4QTHB 2NLJA 4R7NB 4PJEA 4PRID 3LPWA 4K8RH 4XMPH 3LIZH 4KJWD 2DOCA 4M62H 4OLZH 3RUGE 3CFDA 1FDLL 3BZFB 4WI2A 5EU3B 5L6YL 3BDYL 3VXTA 3UZVB 3MBXL 3VXTB 4PGZA 3QDJA 3PDDA 2EE3A 2OP4H 3OWEA 3DI2B 2B8OT 5EU4A 4JKPL 2RFXB 1VACA 5IEKB 1Z3GL 2C1OA 3BYYA 2P24B 1MUJA 2DL2A 2CKNA 4UQ2B 4KI5C 4K7FA 3VMOA 1CU4L 4OZGF 2YPLB 4U0QB 4FRWA 3MRQA 2DM7A 4XP6H 4YFDB 2J8UB 1MCPH 3PQYD 3FT4B 3MLXH 4HPYH 2NY1C 4NN7B 1N2RA 5FV1L 1QEWA 1TNMA 2SEBB 5D7KE 5DRWA 3D3VE 4XI5C 3BESR 2ZOKB 1CG9A 3O2VH 4NC1C 4X7CC 3MRDA 5L2JA 3BE1H 3TO2A 4I48B 1WWAX 4FXKA 3W0WE 2ZZUT 4K8RC 3QQ3B 3TEUA 3O2WH 1U8OB 3MUGB 1BLNA 1DJSA 1OY3B 3VE0A 3T77B 3FHAA 3C09C 1Q9WA 2BNUB 2X4OB 1P7KA 5EA0H 3K81A 3OKMB 2EDWA 3WIIH 4CAGA 4GLRI 5FM5O 1QLRB 3V8OA 3RKPA 1NBYB 2X4RA 3BPOB 4PLKD 3S9DB 1A4JA 3SY0B 1NGQH 1GOFA 3S8WA 3S5LA 3I02A 4LRNL 2VRAA 1Q72L 4OLUL 5D93C 5I71C 1KG0A 2OL3H 3S35L 2R0LH 2IANE 4KJQC 1CICD 5EU5A 3NCBB 1ZT7A 3KHOA 4ZFFB 1B88A 1AQDA 1CFSA 4G7VL 1HHHB 3BT2L 4I5BA 4A6YB 5JPMB 4ODSL 1D5BA 2EDHA 3KR3H 1S9YB 1M71A 2IADA 3CZFA 2OBGA 1Y18A 3OB0H 2YRZA 5IQ9A 2Y06L 3U79A 4RIRB 5IESL 2BCKB 2M2DA 5DFWH 1OGTA 1SEQL 4TNWK 4ODTH 2A0LC 5E2UL 3KPSA 3FQXA 4F9PA 5DURD 2JIXD 3ARUA 5MP6H 3KLAA 3QDMB 1MJUL 1YECL 3TYGL 43C9B 4JO3H 3JVGC 4OV6F 4U3HA 5J11C 1OHQA 5FA4B 1EZVX 2F15A 1BD2B 1T03H 2FGZA 2VE6A 5FO9B 5DHYB 3B2UC 1PFCA 3PWLA 4PY8J 5TDPB 4N8VA 1RZJC 1ADQL 1Y0LA 2XPGA 3O8XA 4X9GA 3TJHC 2HAZA 3RVTC 1BFVH 1FPTH 4U1IB 2AAVA 1R3HB 1NANI 5FHBH 2Z93B 3MCKB 1E4KA 1FGVL 1I1YB 1QSFE 1KCVH 3OGOE 1T5WA 1PDKA 1S9VB 4WWKB 4NKQB 4D0CB 3MYJA 4Q74A 3UTTD 4MDJA 2P48B 1JF5A 2HH0H 4PTTA 1NFIA 1NGYB 4LASL 1YMHA 4YAQA 1HH6A 1HSBA 1ROWA 3CUPB 4M1GL 3OXRA 5GXBB 3UTTA 3HZMB 1C08B 4P5MB 1TETL 2VKXA 3V0WH 1J8HB 1PX4A 2COQA 1JN6B 4NFCA 4G3YH 1EVUA 4CNIB 3ZYOA 1FYTE 3KYKL 4UI2A 4GFTB 3QJHA 1J7VR 2HLAA 3FN0L 3S36X 4GBXB 3B6SA 3W9EA 1MFAH 1PX3A 4X83A 2B4CC 1MLCB 3HC3H 4LCUA 1YY8B 4PJHA 1NEZG 1CK0L 1D5MA 1WIOA 5GSRA 3U0PB 1KXTB 1KJ2A 3BW9B 3MLTA 4YPJA 1K2DB 4YHNA 1U91A 3V6OE 1MH5B 4HF5L 1K4CA 4LLQA 5IVXB 2R1WB 3F58H 4WFED 3A67L 5T1DH 3PWPD 5C0GB 3BIKB 3GM0A 3OR6B 4JO1L 3IKCA 2HFFB 4QRSB 2FH8A 3VXPB 1JMZA 4E42A 4MNQA 1NCDH 2Z9TA 4BZ2H 5HHOD 2JB6A 1A6AA 4N68A 4WIQA 1KLUA 2LE9A 2KBGA 5FYJU 3W2DL 4E41B 5C0IB 4M7KH 4MJ5B 1VEMA 3U2SA 3VXSA 4KK5C 5D5MB 5I1KH 1E4XH 1OLLA 2YXMA 3NZ8A 1QFWI 2H3NB 1CZ8L 1KFAL 2JJSC 4NBXB 4XNYH 3VXRA 1T6VN 1FO0B 1G6RB 3LD8B 1GGCH 4OUOA 4M8QA 3WFCL 1YMMB 3QIWD 2FEEL 3P4MA 3ZT5A 3MRLB 1U58A 4XC1H 5C8JA 3BUTA 3D2UA 4TSBH 1DBBH 1X5GA 4LLMB 3GSUA 2AVGA 1EHAA 1OSPL 2LU7A 1IC7H 3LOWA 4QHLB 2ZKHL 4L3CB 3ZKNC 4Z6AT 1OTTD 1YC8A 1AO7B 1S7VB 1B6DA 2HN7B 2CKBA 4F7EA 4RGNE 4RA3A 2Q6WA 3T4YA 5D2LE 3ALXA 4JM4L 4JRXD 2H26A 4L4VE 5D7IF 1QLFA 4Z0BL 4GJTB 4RNRA 4RQQB 1B4JL 3S88L 5DT1L 4F7CA 4B5EA 1D6VH 2IG2L 2OJEB 2P8PA 3RKDC 5IB2B 4WDIA 3AMLA 4JAMA 3MMEB 5BW7A 2IH1B 3BISA 4KMLB 2EIZA 2W0FB 4Z7OE 5GRJL 1XIWA 1RZJH 2AK1H 2VIRA 3IETB 5E9DA 1WTLA 4JN1H 1FRGL 4L3AA 4F7MA 5C07A 2IANA 3CDFA 4N5ED 2JK5A 3BSZH 5J7CC 1JZ7A 2MSPA 3VFRA 5DRXB 4LNVA 2H2PC 5GS2D 1SM3H 4AT6B 5HYSA 3D39B 4G6ML 1ZVYA 2ICWI 3VFPA 3KJ6H 3KDMA 1OM3H 2X1QA 1GHFH 1L7IH 1NMAH 5J3HC 4OLVH 1M05B 3S3PA 1VPOL 4QHUA 5MEQB 4YHIB 4IRSD 4LLDA 3TZVA 2P42B 3D3VB 1BFOA 1CXEA 3LEXA 1NAKL 3GNMH 4TRPL 1IM3B 3EO0B 5C0CE 4P46A 1CFVL 1F3JB 5L8LB 3MREA 5EBLB 5F9AC 4K3JL 1B0GB 4P4RB 3OV6A 1R5IA 3IDNB 5CUSL 2VDKH 4LLVB 1A7QL 4Z18A 4QKXB 4ZS6C 3T0EE 1IBGH 4LCYB 3AB0C 3T3PF 4LSPH 4LCYA 3QWOA 1CYGA 1WZKA 5DHVB 4M61B 3X3GH 2MWCA 4E5XB 5MHSD 1YPZA 1JV5B 4O2CA 1F3JA 1D5IH 2BOCA 2BSED 1S7QB 4LIQE 3NACL 3O3EB 1H15A 4UT7H 3LKNB 3BZDA 4PJEE 3LEXB 2NXYC 4GW1B 4HKZA 2QKIA 3REWB 3VDBA 1GAFL 2DQJL 5GRVK 3TBSB 1HDMB 1P4IH 2FD6H 4M7JH 4CMMA 3B8SA 3Q5YA 4E9LA 4I3RH 3B4NA 5D5ME 1JNJA 2Z8RA 4OGZA 3T8XA 1FL5B 3MLZH 5D72L 1KN4L 1YJDC 1SYVB 2DQIH 3O41B 4H1LH 4NGHL 4RAHA 1P6AB 5KSAA 5I1IH 4LLYA 2UWEB 4PP2A 4LSDA 4Y8DC 1IARB 5KVGL 2VN4A 1EFXD 4H88H 4PJGB 5EUOB 2YD4A 5I1HH 3O4LE 2EIZB 3BEVB 3FRPG 5EFIA 5BW7C 2GSGA 1NKOA 5F88B 1VENA 32C2B 5CD3B 2NX5E 3PWVB 3H0TA 5IB2A 3KYMA 4WENB 1XF4B 1V3MA 4Z76B 4Y2OA 4NQSA 1FAIL 1Z9SA 3RWJA 4I3SL 4M43L 3E1F1 4QOKA 2KL6A 4LPXA 2JJVA 2VXUL 5IJVA 1CFBA 4PTUB 4YE4L 3SEPA 4D0BA 2W65A 5GGRA 1VFBB 4L3CA 3H42H 2APTA 3ARGD 2VOTA 2CK0L 4KPHL 1MREH 2IJ0C 1J8HE 1QHOA 1VFMA 3D3VD 1LP9B 3U0TA 2NY6D 3WHE1 1NL0H 3D2UB 1KIQB 2X5PA 3UYRH 1P53A 4ORGB 4X98A 1DBJL 5CGMA 4XPFL 4P5TB 4L4VA 5JZ7C 4KROB 4WUUE 3ECBB 3DX9A 3B8YA 4X5WA 4JHZA 4EUPB 4U1SB 1JZ3A 1C12A 2AKRB 4DGIL 4HIJB 4NQED 3QEQB 4J1UB 3IXTB 5GIRA 5TQ0H 4NDMA 4XMPL 1WVZA 1S7TA 5D5MA 1PYWB 3MJ7A 1RAMA 1RK0B 1U8MB 3F7RA 4MJIE 4P3CL 4KVNL 4X7SH 3CX5J 5DS8A 4NQEA 2BY1A 3DETC 1S7TB 3VMPA 1ORQA 4JKPH 4HBCL 4K71B 4PLKC 3QCTL 4XCEA 3QG7L 2FX7L 1J0IA 3QPXL 4P2RA 2BVPA 1DN2A 2EYSB 3QDGE 4L4VB 3V5DA 3LH2H 3UJTH 1XGTB 4P2CG 3BQUA 4H1LB 2FO4B 2VAAB 2YD2A 1E6JH 2WANA 4JHWL 1WQVT 4RAUA 2D9QB 2C3XA 1NDMB 4PGDA 4RFNB 2X4SB 1DDHA 3EHBD 3ZKMC 1ORQB 1KTKE 3U9PL 4JCLA 3C2AL 1MLCA 3S36L 3VMNA 3KYOA 3ZMRA 4J7RA 4HMDA 1YMME 1FYTB 5CD5C 4TSCH 1ED3A 2HLAB 3QJHB 1FZOB 5EC1B 4FQXC 4L8SB 3QUZC 3QWRA 2WWKT 4WFEE 2NY0B 4Q9RH 1UA6L 3V4VL 1JN6A 3GMRA 1N8ZA 3TCLA 3LAFA 3BP7A 3PWPE 5EOCL 4HLZG 4HKXB 1AGBB 1Q1JL 2PYFA 4LRNH 2GSGB 5F7FA 3L5WA 3QUYB 2IPUG 4Y19D 1A9EB 4UTAL 1LO5A 1MCCA 1F4YL 1X7QB 2CRMA 1LP9A 1MWAL 3FOLB 1MJ8L 5BRZE 1BOGA 5TF1H 4DGVL 2E8ZA 4QCIB 5DR5L 1KNOB 3NZHL 3LHPL 1J1XL 1KJVA 3ILQC 4F33B 3G6JB 2ZUVA 3G6DH 1EHLH 2VITB 4WI5A 5I73C 1K3ZA 2YUXA 4YR6B 2RIKA 4UBDC 5IR1B 4MD5A 1KTDA 2X4QB 1HQRB 4IJ3B 5C9JB 4Z76A 1JGVH 3TO4D 2X1XR 3P0VL 3SDDB 1U8KA 4LP4A 1HDMA 4CMMB 3RX8A 1IT9H 5DHYA 3QH3B 5F6HJ 2QR0A 4LSSH 1IKNA 4NIKB 5FA4A 4HS6B 1L6XA 3UTOA 2VDPL 3ET9F 4JFDE 2BNRE 3LEVH 1Z0NA 2WBKA 5SWSB 3U7WL 3U6RB 1K5NA 2DYPB 4U6TA 1OAQL 4OJFL 3IF1A 4G43A 4NN7C 4NZUL 2BDNL 4JGUA 4WU5B 2H32H 5DHVA 4YGAB 1MJ7H 4R2GC 2WINA 4P2QA 2DYPD 5BZDA 5CLWA 2NY4D 4TNWF 4M6AA 2AXGB 4HPOH 4GMSL 2XZCH 3VFGH 1M71B 2IADB 1UJTA 3MRPA 1S9YA 4KK6D 5EUOF 5KJRH 3IXAB 3KPTA 3LN5A 4FFYH 4WUUB 4Z7UE 1U92B 1R5IB 3IDNA 2BSRA 1B0GA 5GRUH 4MA1B 2VZVA 3MRKA 5D70H 1H3TA 3MNZB 5JPNA 1V3JA 5FOBB 4O2EB 1ADQA 1S7QA 3V6ZA 2W91A 2X4RB 1RI8A 3MYZA 5CFHA 3QDJD 2CR6A 5D9SB 3PWNA 5E8PB 3C60D 5J1TC 3GSOB 2F54E 1TVHB 5SWSD 4KGJA 3UMTA 1Z0MA 1UH2A 5TE6H 1CGWA 3MRPB 3S37H 1MFAL 1A7PL 1G7HB 3HE7C 5CCKL 3MLRL 3QQ9C 1XCQA 3VXMB 4DEPC 3UO1H 3RQ3A 1EMTH 1BJ1H 3MO1A 1WJ3A 2CGRL 4NN5B 4YLQT 3F7YA 4YHKL 4LLVA 3AVEA 2AQ1A 1KLGB 1ZHKA 1A6UL 3TN0C 2DM2A 3O9WC 1QSFA 5C07B 4FQIL 4OGAD 3RWIA 1JVKA 5ICYB 3ZKQD 2BRQA 3C5ZA 3CFEB 2V9TA 5KSVA 2Y1VA 3EOAA 4K7FB 1OPGL 3QIWC 2EC9U 1EO8L 1RIUL 3MRJB 1WFUA 1WISA 5IT2L 5MEQA 5TPWL 5I8CA 4OCWH 4L9LC 4XP9H 3RNQA 1DQJA 1JF6A 4RISH 4BSJA 5BVPH 4KQ3H 2HJFA 4PJAA 5D2NB 3VFVA 5I66A 5EUOE 1CICB 5GGRY 4AT6A 1XF2A 3VRLF 3FJTA 3WJJC 4G6JL 2A77L 2OTWB 4I0PA 4TVPE 5EO9B 1PLGH 4XC3H 1RUAL 1FVEB 1MLBB 2NY5C 3MGTA 4EI6A 3IETA 5E9DB 2NY7H 3MRLA 4TNVF 2HT4C 4Q2ZB 3O6LL 4QRRB 3S6CA 3GIZH 1KPRB 3SKMB 2OJZL 4M8QB 1Y6MR 1DQTA 3IJHB 2GW5A 1NSNH 4EUPG 2C4FU 2PW2A 1OSPH 4MNHA 2E9BA 2H3NA 2PO6D 3BHBB 4M1CC 4L8SA 1R5VA 2F5AL 2YD6A 4JGMA 1U42A 4P4KB 5IG7A 1ZXQA 5JOFA 4FQ1L 3KYOB 1AIFA 3WFDH 5DA0B 1FLRL 4Z7QE 4M48L 5HYIA 3D6GA 3U46A 3ALWA 4M3JA 1MSPA 1S7UA 4M6ML 2Z92A 4JRXB 3GSUB 1KN2H 1T4KB 3H8NA 2EE6A 3ROOA 5LWYL 5HY9B 5JW4M 1A21A 4YXHL 5IVXA 4Z8FH 4V1DD 3A6CH 4KI5D 5I19H 5IHBA 1UXWA 2BVPB 1U91B 5D1ZB 3GSNL 4HKJA 4YQXL 2ITDB 2DLGA 2I27N 5I30H 4UAOB 4HFUL 3WN5B 1AY1L 3VW3L 2ILLA 2XACC 4PJHB 4HQQL 1MCNA 4JY4B 3V6OA 4OQTL 1Z6JT 3TWCL 4K8RD 1U8QB 5CIPB 4AEEA 1WZMA 2MKLC 4JHBA 3IDIB 4OV5A 1UACH 1KACB 1MCLA 4KKNA 4YGVB 4B0MM 1NGZA 4FZ8H 3BIKA 3F62A 1AD0A 2GKIA 3ORJA 2PW1A 2VDQH 2LABA 4Y16D 5HYQA 2ZUQC 4PJBB 5MENE 1CD1A 4WHDA 4YUEL 4I0PC 3PHOB 1PZUB 1CFVH 2DL9A 3R0NA 4FP8L 5GS1B 2VABA 1ZHBA 2HRLA 1JZ8A 3LN9A 1FZKB 4HS8H 5KZCD 5D6DC 3MLVH 4QHKI 5CUSH 2B4CH 4U3CA 3UDWC 4Y1AA 1XZ0A 2XQYG 2EDYA 3QNZB 1RUMH 4WCYL 5BZWB 4LCUB 4WFHE 2D0FA 2EDQA 1DQQA 3VXQB 3W81A 1WZ1H 5AD0A 3D85D 3KPLA 5HXMA 4N9OB 3L6FB 5LGJA 2AV7A 3BDXA 3BZEA 2HT2C 2EECA 1D6EA 3H9ZA 4J8RA 1AR2A 3FO0L 1FL6A 1FO0L 1G9NH 1AGDB 5I1LA 3QIUC 5EFIB 5C7XL 4AM0B 1NGQL 3DHJA 2QV2A 2FZ3A 3ZYIA 1QR1B 3MJ9A 2DQDH 4AIOA 1A14L 2AEWA 1YMMD 3AMKA 4CDGC 4CVZA 3SDCC 3MYJB 4YBLB 3MR9A 2D31B 2YOCA 3MLZL 3MUZ1 1ZVSA 4GLRH 4NRXB 5JMOC 4OCYH 4NPYA 5EUKA 1OAUH 1KGCD 1I3RA 4JFFB 3VI4F 1HSAA 5C86A 4OLXH 1ETZB 3GUTB 2FX8L 5C09A 4KDWA 5FB8A 1S7RA 2AGJL 3B5GA 5I1AB 2X4NA 1U8NA 3KPSE 4GKZA 4XB8A 3OG4B 2Y06H 1QKZL 3X12B 1Y0LB 2XPGB 3WD5L 3C5JB 4R26L 5EU5B 1P2CA 2R8SH 2C3GA 2FSEB 4KKCC 4XPTH 3KLDA 2JJTC 3DROA 4Y4HA 4ZD3H 4L8BB 5DC0A 4JDTH 5F89A 4LSRL 3LQAL 5HGAB 5LJYH 2BJML 2PN5A 5E94A 4ODVL 1JV5A 5E5RB 3WJLC 3KLAB 4IDJL 2DWDA 4OT1L 2BCKA 2VXUH 2F74A 3S7GA 4R4NC 2BNQB 3HFML 3QDAA 1TTFA 1IGFL 4BZYA 4TVPH 5HHOE 3VA2C 4YDVB 1F42A 2ADGA 3BO8A 1A5FL 3L1OL 5AZEL 1I9IL 1YUHB 4DQOL 1CQKA 1XF5A 4D0DB 4NQXA 3D9AH 4O02H 4KZEH 3H7BA 3HZYA 2R69L 3SY0A 4HK0B 4DKEH 3OKYA 1CXLA 2P8MB 4BFBD 1TPXB 3P30H 1RURL 2VXTH 4QHUB 2GK2A 1CDCA 2RFXA 2V9QA 1I1CA 4LHUA 1R3IH 5TH2B 1F8TH 5F1NB 4WGVB 1BLNB 3G6AA 3OXSB 2EIBA 5SWZE 1U8OA 3ARYA 1WC7B 2XQBH 2XRAL 3D0LA 5DRXA 3T65B 3W0WD 2NLJB 4UNTA 4M6OH 3C8HA 2JK5B 4MHHG 3GBNH 2HRPH 3AS1A 2IANB 3DTXB 3P11L 1SMAA 3PV6A 3QDJE 3TVMC 4LCCA 4U6YA 2FNBA 1JNNL 5IUSA 4F9LC 1DUYB 4LLWA 1BBDL 2Q3AA 2BVQA 3MRGB 4HF5H 4U4BA 3RDTC 1DQLH 1T22A 2R4RH 1OTUD 3RGVC 3U9UA 3TLRA 1I8LA 1UM4H 3Q3GA 1G7QB 4NM4H 4JO1H 1ZVHA 3BPOC 1FC1A 5BJTB 5IK3B 3L3IA 4NHCL 2CDEA 4FQJL 1QBLH 2G9HA 3BZFA 5I1GL 3ARZA 4EBQH 3V7MA 4KRPB 1GPOH 1DLFH 3E8UH 4LLMA 4OCXL 2Z91A 4H1LG 3PGFL 1Q1JH 4DWHA 4CN1A 2Z8SA 3QUKA 4PG2C 3DETD 4W4NA 1NUDA 4GS7B 4Z0XB 3PP4H 5ILTL 2AEQL 3M1BA 1PG7X 4P4KD 3PNWB 2V5YA 2WIIB 5FGSA 3ARDC 4JFZL 4KJWC 3QFDB 1REIA 1T7ZA 4GAGL 3HRZA 1DBBL 5C07E 2QHLA 1FNGB 1U95B 4PV8B 3O4OB 4WI7A 4Q6IA 3I6LD 2F8VA 2VDRH 2DWDB 3QEQE 4PG9A 4PJAF 3PWUA 1FVCA 5B8CA 4ALAH 4AEHL 5HGHA 2XKSA 5HJ3B 3MRCA 4NNPL 1J0HA 1SJVA 5FGBC 3T08A 4LSSL 4U6XB 2VC2H 2BSTB 5DD3H 1SHMA 3KPRA 4TNVK 1D6VL 1DEEB 4XXDA 3LEVL 3GMPB 3DMMB 1MRCL 4KI1A 3BKCH 5JHLL 5GGVH 1KJ2B 3QR2A 3UBXA 2X4NB 4Y4HD 3HG1E 1FFNB 2I9LB 4GUPA 5JXEC 1VFOA 5FYLE 2NNAB 3QA3A 4WW2C 2C7UB 2B2XL 5IVXF 2XZCL 4Z77A 2R1XB 3RAJH 5ECJE 1RJLA 2WK2A 3QXTA 5A16A 2EDEA 4G6MH 3IFPA 3L3JB 5CKGA 3BPLB 4PJFE 1A9BB 4OGAC 2DBJA 3EYQC 2XWTA 3AROA 3PDOB 4EN3B 4XP4L 3BP6A 2P7TA 4MA3A 1HH6B 3CUPA 2X7LA 4WW1B 3C09B 3ILPA 3B9KA 4PB0L 1NJ9A 4MDJB 4PRAA 3BGFC 5DJ0B 4DGYL 2QHRL 5E6YA 1S5IH 4DN3L 4OTXL 5LGJB 4JR9L 1Q0XL 2X1PA 4XWGL 5D93B 5I71B 4B7IA 4G6AD 4NZJA 5IFAL 3O2WL 3ULUF 3A6BH 5GRWA 4Y1AB 4WU7A 2W9EL 3ARBD 4N0UB 4U1IA 3PIQA 1QVOB 5SX5H 1FZKA 3QQ4A 3MCLL 2QADD 1HILA 5D2LA 5L8JB 3X3GL 1NJ9B 1DVFB 3ILPB 1GCFA 1VFAB 3PGDB 1DP0A 1HXMA 1ZSDA 2V5SA 4M00A 5F7KC 2P7TB 5T1LB 5GS0D 4UT6L 1AI1H 5M94B 2XWTB 4IEFB 1YYLL 3GRWA 5I15L 1DBML 2Q20A 5E99L 2MCPH 3DVFA 4ZFOA 4G7VH 3KPSB 3BT2H 4NFBA 5INDA 1DL7H 2VN7A 3KR3L 2P4AB 4I3RL 2R1XA 3DLQR 5KAQF 3LD8C 2F54D 1MFDL 4JY4A 5SWSE 2N7AA 2X9WA 1IAOA 3OGCA 4PJBE 3H9YA 5EB9A 1OD9A 3PABA 4A6YH 1AR1C 5C0AD 4XHJC 1RIVH 1BQHG 1GZPA 4JHAH 4EVNB 1MJUH 1YECH 2AEPL 3QXAA 4ELMB 3TO4A 4F37K 1KG0B 2OI9B 2N4IA 3FQTB 3PJSB 2YK1L 5IOPA 4JZNB 2F58H 1NSNL 3HRPA 3EYVA 4RRPG 3CFBB 2DQUH 1FH5H 4OF8A 1QOKA 1XGUB 1S7UB 5B8CB 4XTRD 3RGVA 1FPTL 1HHGB 3MACL 4X4ZA 4QRPD 5BMFH 5K9QI 4GRMA 1YC7A 3CD4A 3CVHB 4KK8D 5C2BL 4LSVH 3QQ3A 4PV8A 2CDGB 3QXUA 1FGVH 2AJVL 4S1SL 5FDWB 4YK4C 4RSVA 4H0GA 2AABH 1RD6A 5E6ZA 5JHDD 4Y5VA 4GBXC 3OTTA 3BRDA 3ARQA 4MXWL 4Y5XC 5HHMD 3I2CL 4NKMB 5C0AB 1F4XL 1FNHA 2MMXA 1XFPA 2AJYL 1BM3L 2BY3A 1WAAE 3EOYG 5JXEA 2R0WH 3MXWH 3RY5A 1YNLL 4XPFH 3RP1A 1CLZH 4HKBA 4H25A 5DJCB 3R8QA 5I30L 4KKLC 4NQTA 3VXRD 2B1HH 5DUBA 1QFWL 1GGIL 2Z35A 3QDJB 4XCNA 5D2NC 1LO3H 1UZ6E 2EZ0D 5H8DA 3LSOA 4L9DA 5ITBH 1KB5L 3IDJA 2YA1A 3WLWD 1GSMA 1V3LA 2V2XA 3ARDD 4NQCB 2W9LA 3C08L 5EG6C 5B3JF 3JWDH 4M6NL 4HUWA 3DECA 3BRFA 4Y5XA 5F7WC 5GGSB 3WNPA 4YUEH 4FG6C 5E4IA 5F6IB 4TTDD 4E0RA 4NYLB 4MJIB 1ZHLB 1RZIA 4NN6C 2R0KL 4BUHA 4Y4FD 4OCNC 3ZKND 5DQJB 1GGBH 1PY4A 4JQXC 1MHEB 1MHCA 3C5ZD 3RL2A 1RY7B 4LPUA 5CZVH 3RNKB 1ZHNB 5GJSL 1JPGA 2PYEA 4QYOB 1HWHB 5JA9A 5IV2A 1G7HA 1RVFL 3NTCL 3I6KB 1MY7A 4QRPE 3X17A 4XPAH 5DJ8A 5A2LH 3S36H 4UOW0 4HJJL 2ZG3A 3T0BA 1TVBA 5DRNB 4DAGH 5IMMA 3FQWA 2RAMA 5E2VL 1V05A 2IMMA 2X70A 4TUKL 4AJ0A 1D9KC 1KTLB 1EEZB 3MV8A 4JEGB 4APQD 4DKDC 1JL8A 5K9JH 4O2EA 3MNZA 4NQXB 1DQML 4M7LT 1LEKB 1ZWIB 4P9HH 3UTSD 3LN4B 2FB4L 4CVWA 3CDYA 1YNTA 2BSRB 2ORBL 4BSWB 3PL6B 4WUUA 4LQFL 4PY7B 4QXGH 2E7BA 4UV4L 3DXAD 5HSFA 1QO3B 3CFCL 3IAQA 1QSEE 2WINB 2X1WL 3CZJA 4YFEA 4LAJH 3NZHH 1NBZA 4K8RL 3BDBA 4HCRL 1F4WH 4MD4A 4M62L 4YBHA 3TPKA 2W0PA 4B41A 1I9EA 4OD3H 1GIGL 2XTJB 2X4UA 4ZQKA 1K5NB 2DYPA 5IROC 1A64A 4KTDH 2UYLA 4R4BB 3NCFB 4OM0H 4K7PX 1U8IA 3FFDB 5EIIA 5J12C 4GKNB 5BO1L 1NGWA 4OD2B 1KJ3H 5KSAD 5HHPA 1RZJL 1CU4H 2AK1L 3S4SG 3SDDA 3KPNA 4XP6L 1ZANH 1AC0A 3CPLA 2ATPB 5FKAB 3BIBX 5IW6A 3LV3A 4J4PD 3HE6A 2F53B 5I8EA 1I1AA 1ZEAH 2YUVA 3DWTA 4ZXBD 2BDNH 1KEMH 3L5XL 2ARWA 4D2NA 3NPSB 4GW4A 5EUKB 5DJXA 1OM3L 3WFEH 4OLZL 1DANT 4YHPA 3PQYB 3N50A 1SVCP 1MCQA 5L6YH 4PR5A 2FZ3B 2EDDA 3ARWA 3HC4H 2R9HC 1MRDL 1JTPA 3SGKA 1ZAGA 1IL1B 3ARFD 3DX8A 4FFYL 5EA0L 4RCAA 3P77B 2HWZH 1JPST 2M8XA 5KVMC 1IMHC 1OQOA 4DKEL 2HVJB 2YMXL 3QRGH 4PRBB 1KLFA 5EZIH 2I07A 1NCTA 1AR1D 1NC4A 5GISL 4K71C 1E4JA 3ZO0A 1I85C 3ABZA 4XRCB 3BKJL 3S35H 3SGKC 1ACYL 2G2RB 4GW5B 3LKPB 1VADB 3L6FA 4KJYB 3N1QC 4HPYL 3UEZA 5IBLC 1DQQB 3VXQA 3CX2A 4XVJL 1ZA6B 3C9NB 4LHUG 5AWNL 2IAMA 5EOQL 5GQBA 2HLFD 2QSQA 2CKBL 4CMHC 2BSSB 3KS0H 4N1EA 4GRLC 4KK8C 4R90H 3UC0H 4LPCA 3GI9H 3MLYH 5ID0B 3NACH 5MP6L 2IPKA 4PGEA 1BBDH 2V6HA 4GXUM 4NT6B 3E6FA 3TYGH 5GRXG 4X6FB 1KF9B 1TQCB 1WEJL 4FQXB 5C0DB 1NAML 3TBVB 2OL3L 1EJ6A 4JY6A 4PJFB 3MJ8B 2PXYC 1MAJA 2WSKA 2NY5H 2FIRT 1BFVL 1Q9KB 1U6AH 5C3LD 3ZE2E 4HEME 4AQOA 3R06B 5E8OB 3O3DA 4ODSH 3KPSD 3QPQC 2K7QA 1JK8B 1GPOL 1EFXB 3P2TA 3BP4A 3NFPA 2EKSA 4KWUA 5DMKB 2FEDD 1G9MH 4MJ6A 2PTUA 1BZ7A 1RHHA 1SEQH 1T1YA 4K23H 1KEGL 3VXSE 3ZLQC 1H3XA 4HEPG 4ORGA 4HLJA 1B6UA 3EYSH 5HY9A 1T4KA 2L7JA 3IDYC 2BSSA 3H9HA 2IC2A 1IM9B 2YC1B 4UU9A 3TPUB 3FQNB 1P7QB 3IVKB 5C0CA 2ENSA 1IGYB 2YPVL 5ANMB 3TJEH 3C5SA 1IEBB 4ODXB 4HDIB 2YR3A 1RPQA 1NGXA 2Y25A 4PJ7E 3IDGA 5E9DD 4X6DF 5JLZA 2BXYA 3C5ZC 4GQ9H 4S1QH 3DRTA 3EOBA 3SDAC 5SWQB 1CK0H 3RWHA 5JW4R 3LKRA 4GOSA 2CIIB 1ODAA 3AFLA 2ICWA 1DANU 4M6MH 7CGTA 4U1GC 3FB5B 5HYJB 2VUYA 1ITCA 4YXHH 1BVZA 2Z8VC 3FRPA 3QHFH 4LLYB 4U1NA 3S3SA 3STZA 4NP4H 5JXAL 3V7AG 3PQYA 3SKJH 2XNAA 4ZPVA 3BUYA 1HNFA 4N8PA 4IDLA 4LL9A 2IGFH 5MERA 1QZ1A 4OBSA 2ADIB 3EHBC 3QCVH 4UUJA 3HE6B 5HYFA 4F15C 3VFVB 3I3EA 1JNHB 4HJ0D 1CLYH 2IAMC 4KMTL 4Z7WA 1RULH 2XN9B 1HHKB 3BAEL 4LGPB 4KHTH 5CHNB 2NY1D 3HC3L 3N85L 4J12A 1TJGH 2R2BA 3TBSA 1FORH 1MHHA 1NEUA 3O81A 4GW1A 1SY6A 4HKZB 4CDHA 1X5IA 1T04A 4PJHE 3FFDA 5EIIB 4YDIL 1TQCC 5EPMA 4CN4A 2V2WA 3FO2A 1F13A 4LEOB 1QBML 5CEXA 4L8SC 4R9HA 2DQCL 5ENWA 3B9KC 2XTJE 4F9PC 4WJ5B 1MVUB 2H6PB 2F8OA 3JV6A 4CL7A 3LRGA 1XEDA 4OTXH 3QIBC 5A3IC 3INUL 1A6ZA 3P4OA 1MIEH 3SDAD 3QWOB 2OSLA 3WXWL 1UB6B 3AUVA 1ZT1A 1IC7L 1YDPB 2R2HA 4JVUA 4BK5A 4MJ2A 3VGAB 1JJUA 2OR7A 1TVHA 4DFIA 4BSWA 3DGGA 2F54B 3VGDA 3MCLH 3ZHLA 3M07A 3IFNH 5I9QB 4ETQA 3RFZC 2WM0A 4ONHB 5L0QC 3EO0A 5CP7B 4N1HB 3IDYB 3CCHB 3KWWB 5DD0H 1RJCA 4PJXE 3TZVB 2KKQA 2NY2C 4E41E 1UEYA 4OZGA 2NR6D 2O93L 5EBGA 5IP4A 4RBPK 5C0FB 3SPVA 5GGQL 5DRNA 3SDDC 1BFSA 5H2BA 4BJLA 1IAKA 5GJTH 3UTSB 1MFDH 5IV2B 2DQDL 5KS9E 4XVTL 4CW1A 2JCCA 2H8PB 2WUBL 1MFCL 4P2QB 5SX4H 4LPTA 3OKLA 1HINH 3MJ6A 5CSZB 2XWBB 3WS3B 3VU2A 2VSCA 3RJQB 4ZUTB 4C59B 1UG9A 5EU6D 3TA3A 3OL2A 3LKQA 4OZ4A 5KANI 1JGVL 1BIIB 3K8MA 2V2WB 1NCBL 5LXGH 5EZOH 1V3KA 1VSCA 2XT1B 1JMXA 1JZ4A 1U93A 4D9RE 4ZYKA 2EE2A 3EZJB 4PJ9A 4YEFA 1QR4A 2J5LC 5I16A 3U7YH 2DB8A 5DD1L 4OJFH 4HS3B 2H9GA 4PRHE 2EDKA 3ZDZE 4LIQL 1N7MH 3VFMA 2H26B 4U1LA 2E5EA 3SE8L 3WLWC 5F7MC 2GFBA 4IDJH 2VZ3A 4B53A 1AO7A 3EIFA 4OT1H 4LEXH 1KJVB 5D6CB 1J05A 4U7KA 2AABL 4EOWL 4QCIA 3UJJL 5FA3A 1AGEA 3EDEA 3MNVB 1LO5B 2GJ6E 4FQCL 4HH9B 4LU5L 5A2KH 4TPRH 4ELMF 1RFDL 5HGGS 3SGDH 3FB5A 1MHPL 1KYOK 4PJDA 1D5IL 3F12B 3RDTA 1YNLH 3HB3C 4DQOH 4NUJA 1U2CA 5FO7B 4NZRL 3L5HA 5DC4B 1JHLH 2XFXA 1T20B 5C0EA 4S1RH 1E6OL 1B9ZA 4NC0B 1HI6B 3FO9A 4OLYH 3P30L 1FYTA 1L7TH 4WGWB 1YEFL 3VXSB 5CEZH 2A6DB 2FWOB 2B7DT 3C5SB 3GMLA 4NQDD 4Z7NE 4S0TD 5D72H 1BJ8A 3T3PE 3FFCA 4AEIL 5KS9F 2X4SA 3RUGF 4KUZL 4IRJD 3LMJL 2WQ8A 1M4KA 2YSSB 1HWGB 4MQ7A 4NGHH 4PJEF 1XR8B 4OD1H 4M6OL 3LRSA 4H1LA 4JDVB 2ICES 3FQTA 4NRYB 4X6DE 4HWEH 3QB7C 5E1AA 2EYSA 1BGXH 2YKLL 3GI8H 3K74B 4EVNA 3IRPX 3BXNB 5F1KC 5I1HL 3MX0A 5DMKA 1DQDL 3MRFB 3QG6A 3BP4B 3NFPB 3MLSH 4AIZB 4APQA 5CS7A 3O3DB 1GZQB 1PKQA 5DS8B 3HR5B 3PV7A 4LSQL 4R7DA 1U8MA 1EJOH 2DRUA 4WO4B 4EI5D 3W9EB 4ZOCA 5EU6B 4JY6B 2E7CA 3T2PA 4HUNB 3IKKA 3GKZA 4FQXA 1A1MA 4XC3L 4QY8A 3TNNB 2ZUXA 1C12B 3H42L 4LRIA 2DM4A 3K80A 3EFFA 2CK0H 4KPHH 2MHAB 3MOQA 2GSIA 4M5YH 1U3YA 3BPNB 3IGAA 1A1NB 1FGNH 1NL0L 4WW2A 1NGYA 5HD8D 1JFQL 1DVFA 1AKJB 1P7HL 1OF2B 3QUXD 3S35X 4U7MA 3ZYJA 3IDMA 3QDHA 3PIQB 4H26A 1T2QH 4WVRA 5FUOL 2QL1A 4D0CA 1V5JA 3U48A 4EXKA 3UBXG 1YEDA 2DI7A 4ISVA 4V1DA 4DGIH 5DJAB 3NGBB 2A74A 4HJGA 3RWFB 2FIKA 4LVOC 4Y7MA 3FZUC 4MQSB 2A6KB 4NWTH 2PNDA 4L4TE 2DQFA 4PJ5B 4OZIB 1A22B 2Y5EA 1EGJL 2E9WA 2R9HD 1S5HA 4NQSB 4XPGH 1X4XA 1AKJD 1HN1A 1YEGL 4Q7DA 1LILA 3IDXL 3ARFA 2X4TB 1LEIB 4BQCA 4N5EC 4M03A 1G0YR 1T1WB 3BJLA 4NO0B 4D3CH 5FYJE 3BP6B 3EUUA 1EUUA 2CJUL 3QPXH 35C8L 1OLZA 1EAPB 3U30B 3OF6D 4ZAKC 2GTZB 2CLRA 2ATKA 3LKOA 1A9BA 2VUOA 1JPFB 5I17A 3FQXB 1Q9OB 2B0SL 4DZBB 3RWEB 3HPLA 1WITA 2XQYK 3B43A 4M1DL 3IU3B 3MRMB 4I77L 3ZKMD 2F53A 2NNAA 4YWGH 2A6JA 5TQ0L 2NY6B 4BZ1H 1FL5A 4LNRA 4PB9L 4A6YA 4F58H 4I5BB 3VD7A 4OI7A 1VGEH 2WMPA 3QO1B 5D7IA 3RAJL 3JUYA 1IC5L 4JKKA 5DMGC 3QFJB 3B3IB 5HHOA 4JKWA 5LBSH 3AC0A 1MEXH 1JGUL 2PTTA 1OGAB 4PJIE 5TFSH 5DK2A 1A4JB 3QWRD 1LK3L 4R4BA 4U1HB 5BXFB 1WIPA 2IPTH 4PV9B 4WI3A 2GITB 1YJDH 1QYGH 4M9OA 2X6MA 1UZ8A 3KPOB 4MNGE 5IF0A 2XWJA 5B39A 1MWAH 4J3XA 4UT9H 1YPZF 4JDZA 1K8DB 1YN6B 3PWPA 4XPHL 3ZE2F 2AJUL 3O4LA 4PY7A 5CBAB 3HG1D 3EDJA 1LMKA 1EBAA 1U0QA 5D1XA 3D39E 4PLJC 5F6HI 3GMOA 4JGJA 5B39G 4P3DB 5F21B 4XNXL 3SQBA 3MRQB 4LAQL 1BFOB 4JN2B 1BHGA 1IT9L 2GI7A 4OCRL 3HUJA 2OQJA 1I3UA 4NO0D 3FCTB 5TQ2H 1OCWL 1SY6H 1S7SA 5CZKA 1UB5B 4DVBB 1M6OB 1IE5A 2CDEB 3NIDE 4AENA 2IALA 1ONQA 2OR8A 2J6EL 3RNKA 3VFRB 3FT2A 2FEEI 5MI0B 3U9UB 4LBEB 4LSUH 3GIVB 1FIGH 1KJ2H 5FM8A 1SBSL 4N0FB 5JOPE 2IFFH 1H3GA 4NYLA 1U8HA 1OT1A 4XPTL 2Q7YA 2APBA 1HIMH 3M45A 4ZD3L 1NAMB 3EAKA 2BVOB 3P0VH 4N0FA 3ARGA 3FONA 4NQDA 4I0CC 3AY4A 4HX1A 2P1YA 3GSVA 1NCNA 4WI4A 1TZGH 5KTEL 3MLXL 4PG2A 1W0VA 2B39A 2IMNA 4NSKA 1YEKH 1NH6A 2Q6WB 2I25N 3UCRA 1WFOA 4DUXA 5F1NA 1ZGLM 4BH8B 3PF2A 1M7DB 4JFOB 3MLRH 4MB3A 2E3VA 2CIKB 3LQAC 3ZE1E 4EIZC 3WKML 5B38G 4HBQA 3BN3B 5JHDA 5F7EL 1RUPL 3WIIL 2EDRA 2IBZY 3VRJB 4N9GB 4YFLI 4JQVC 5FCUH 3DBXA 3T0EA 2JCCF 4J3TA 5LAXA 4PJ8D 4F7PA 2R0WL 4N0UE 1F90H 1ITBB 3RGVD 5TPWH 3NFNA 2YN3A 1F8TL 4MXVF 1QUNA 4Q6YA 3DX6A 1U3JA 3CVHA 2VZOA 1KLUB 4ONOA 2DQHH 4K2UH 3S37L 3RGVB 4P23A 1HNGA 2FHFA 2HFFA 2HKHL 4K3EL 8FABB 1MCOH 3DXAA 5E94B 1EMTL 4JFFE 4PRPB 2VLKE 5HGAA 1TZIA 2G75A 2NW3B 4G6JH 3ULVL 3C08H 4O4YH 3RWGB 1PLGL 2VDNL 3I6GA 3VD9A 4KTYA 4NCC2 4ODUA 3VFNB 2I9TA 3QNXB 4CADB 3TO4B 5EU6E 4EIGB 3X12A 1WZLA 1DQLL 1SJEB 3GMQA 2UY7A 5JQ6L 4JFQB 4JFHE 3U0PA 1U2HA 1YEEL 4HWUA 3VRLE 1MI5B 5C09B 4YDLC 1EO8H 1RIUH 4Z95H 3BOVA 4AMKH 1I3RB 1QBLL 1EZVY 1EBPA 4NPYB 5BVPL 3JV4A 4JFED 5I1GH 2F5AH 4FTVE 5D5MF 4P0DA 1XH3A 2WBJB 2DD8L 3WFZA 3OKEB 5I8OH 4XH2B 4QEGA 5CKAA 3MRHA 4JY5L 3U36B 3GEWB 4JQVA 1BP3B 4YAQB 4NO0A 4OZHE 2Z0BA 1BECA 1ZKAA 2YS4A 3PP4L 4P5TD 3TNMB 5IFJA 3D0VA 2NY7L 2EIDA 1MNUH 1SJXA 1RHFA 1XH3B 2WBJA 4XB7A 4X9FA 4PJ5A 1XCTA 4OZIA 3RU8H 2W9DH 1CLCA 3NA9L 4OF7A 1J1PL 2LAGB 3VW3H 4HLZH 3B9KD 1SYSB 4V1DB 2Z93A 4QRRE 4IMKC 5T3XH 1I75A 3SJVB 4JPKH 4JFQA 3SGEH 5HI5D 1QFOA 3IDMB 5B22A 4AEHH 1MQKL 1JZ2A 5C08D 5B8CC 4I2XE 1T1XA 5IFJB 4HWZB 3PWLB 4WW2B 5FO9A 3THMH 2A2QT 4G5ZL 3ULVD 1RZGB 3PDOA 3CC5A 5CJQL 5I1CL 2WP3O 1RUKH 1NGZB 1UWGL 4GMTH 4YGVA 4YK4B 5JHLH 4QHKJ 3A6CL 5A16B 4LIQH 3KJ4B 3MA9H 4N1CA 1DFBH 3IDIA 2ZSWB 2KZWA 2D0GA 3EJZC 4R97B 4NOFA 4R7DB 5IW3A 1Z9MA 3VXRE 3UXFA 4BZ2L 4P46D 5BRZB 1MI5A 4NWUL 1KT2B 4EOWH 3K46A 4L29B 1OB1B 2UV3A 3O45A 2QADC 3W2DH 5MEOB 3QIWB 3TIDB 1R0AH 3GMQB 1WBZB 3D25B 1ZT7B 1CDHA 4QHNA 3G5XA 3HKFA 1UGNA 4QRPA 3TWCH 1NMBL 1UXWB 1EHNA 4KGLA 5T1KB 4OBRA 3SCMC 2DIBA 2FGWL 4NRYA 3AS3A 4JDVA 1MCIA 4YHZL 2IH3A 5ESAA 4NFDA 5F7HA 5E4EC 1TZIB 2G75B 1G9NL 4PRPA 1XGYH 1S8DA 4YDLB 2M1KA 3OPZL 4P23B 4S1RL 1C1EH 1UVQB 4MXQC 5CJOH 3CMOL 3VFWA 2X44D 2ZUSA 5C0AE 1DBKL 3BPCA 1FV1A 5AZ2H 3CVIL 1PY9A 4I9WD 1IGML 1J5OH 2AJZA 3A6BL 3K0WA 5FYKE 1R5VB 4K94C 1JTTA 2DQEH 2CUMA 1KOAA 4LCIH 1KPUB 4XWOC 3WIFB 1X5ZA 1OP9A 2XKUA 2PXYA 3DUSA 3NPZB 1KCRL 5LCVH 3F7VB 1KPRA 3OB8A 4Z0XA 3HI1B 4YEEA 25C8H 1P4BH 2E27H 3BEWB 3WD5H 4ZUSA 1U8HB 1CVSC 3HMXH 4HH9A 4KK9C 3KXFB 1IKNC 5K9KB 1MLBA 4AQ1B 5C2UB 2XA8H 3ES6A 4KKAD 1J05B 1J9CT 4WTZG 3GJFH 3CLFL 4ZUVB 1PD6A 4J2XA 3F6IA 1YQ2A 1RZ7L 5EO0B 3LZFL 4C56D 5BJTA 3I6LE 1W0VB 5K93A 4U2ZA 2HFTA 4NKDB 2ICEB 4HX1B 3TBWB 2QQQA 3HUJB 2H41A 4Y2DB 5ADPH 2LU3A 4A6YL 1IGFH 5I76A 1RIVL 3ARVA 1YNKL 5C71A 3BZ4B 2BRRL 5E2TL 1JWMB 4K3DH 2FH6A 3QP3A 3BEWA 3HNTL 3CFEA 2FBJL 1G9ML 3RI5K 1VPOH 5ICYA 4HIHB 1R3JA 2YA0A 2GK0B 3WIFA 1QSFB 1FH5L 2WV3A 3D9AL 4LBEA 4PJXA 3KXFD 5E6IC 4LSRH 1EXUB 5FYLD 1TZHA 1AQKL 2R56L 4NWTL 2QADB 3Q0HA 4TVPD 3G6AB 3OXSA 5HGBA 4EKXA 5J1SC 3M8OH 4XT1C 2VDKL 4QGYA 1LD9B 3JTTA 2NY3D 4LHUB 2ED7A 3OSKA 2VXVH 4P9HC 1FSKC 4DUVA 1A6TB 1CN4A 1HXYB 3ESUF 1CGVA 3KYNA 4W4OC 5FOBA 4FG6D 2IH3B 3KWWA 4NHUB 2HRPL 1NKRA 35C8H 3TVMD 3H3PL 1BM3H 2EYTB 3VXUE 3DUUA 1JP5A 2D03L 1IAII 3NPSC 3G5XB 2Q8BL 2NX5D 4QRPB 5D1XB 4RMWA 2GUOB 4Z7WF 2YD3A 3O6MH 4I4WB 1DBAH 1HKFA 4YDKL 4UT7L 2AQ2A 3IXAA 3I75A 5C0JB 4OGXH 3H9SE 7FABL 1P4IL 4M7JL 3BKYH 1UB6A 3RZCA 1RUQH 2IGFL 1T1ZA 4K9EH 4NN6B 1XR9B 4P2OC 3OKNA 5BOPA 4ZODA 4G43B 3TT1H 2VQUA 1Q9OA 1B0WA 3K8LA 1HYSC 1GOGA 1HK6A 3U6RA 4IMLB 5SWZA 4OZFB 3V52H 4C4KT 4U1HA 1EAPA 4PP1C 1X5HA 1CL7H 5DGQA 3WUWG 5E6ID 4RBPH 3GBNL 5IW1A 4IM8A 3B3IA 3P11H 3PQYE 1CGTA 4X99A 4POZC 4IOFD 4GO6B 3RHWF 1F3DH 1Q38A 1PG7L 1QYGL 3ZHDA 1IGIH 5ERWA 1JNHA 1QBMH 4XAKD 5ESVB 1C5BL 1KENL 1SYSA 1JHTB 3P0GB 1KB5A 4AY0A 2A9MH 3OR7A 1FJ1A 3NGBC 1ETZA 3GUTA 4KMQA 1YEDB 2W07A 4Q9CA 5GSVB 5B4MC 3RWEA 4OCLC 4ZXBB 2APVA 2Y5TA 4AK1A 3ELAT 3FOLA 1JPTH 1J1OL 5DFVD 4L1DA 1KB9J 3PP3H 3LKOB 4AM0A 2B5IB 2DMCA 2YEZB 1JBJA 5E5MB 1J8HD 4ALAL 4GAJH 4XNXH 1Q94B 2CMRL 5DJ2B 4JRYE 4KI5F 5J06A 5JUEL 2H45A 5HVFB 3HTLX 5ACZB 1OL0A 3UYRL 4J6RL 5DDHB 4J8RB 1QFUH 1D6EB 1IEAA 4HH8A 1FZOA 4P2OD 5MENB 3NCMA 3BZEB 1A3QA 2MTPA 2XY2A 4LCWA 4UZGA 4DTGL 5ILTH 4N8CL 4O2FB 2IBGA 3MV7E 4ZSOB 1CFTB 1FNAA 4FXGA 5AYUL 2XYCA 4L8CB 4KQ4H 3BD3A 3FQNA 4G80A 3QG6B 5C09E 3S96B 1TPXC 3WFHA 1KUMA 3U4EB 2VXQL 1T89C 1Q9LA 2I9TB 2HT3C 4I3GA 3MLPA 4N0RA 3WDIA 4ZO8A 1H3WM 5HYQB 4KDTA 5EIVA 2EKSB 2VWEC 2ESVA 3P73B 4OV5B 3FB6A 1KPVA 1NMCC 1EFQA 2KQMA 4ESKA 5HHXH 2DTMH 2D2OA 5GGVL 3DJ9A 2A6DA 2GQHA 1ZEAL 1P5VA 4PRHD 4RMRA 4R3SA 3SE8H 1Q0XH 3WN5A 3TBVA 1VESA 4QNPE 3BKML 2JLLA 3L3HA 2GJZB 3HE7A 4L4TA 4NUJB 2LTQB 5GGTH 3WNLA 5D1ZA 2LU4A 2Q8AH 1BEYL 3SE4A 3FO1B 3P9LA 4PJFF 4TSCL 1PZ5A 3WBDA 4U1KB 3ECBA 5EZLA 3CDGB 2LQRA 5F9JA 4Q9RL 4RGNC 4GRWH 2LV4A 2CR3A 4PJCF 2YMXH 4K3GA 4YDJA 3TYFA 1I1FA 1QPPA 1BQHB 1CXHA 5FCUL 5GS0H 1JGDA 3GO1H 1FFOB 1QHPA 2Z92B 3GKWH 1J10A 5D6CA 2XXMB 3DX7B 1JGEB 2QQNH 1DBMH 5E2WH 4NZRH 4DCQB 4D0BB 3MC0A 1JHLL 3IJSB 4PTUA 4HUUA 1VERA 1I3GH 3VXUA 1INDH 1VADA 4GW5A 4DN3H 2E7HA 4UB0H 15C8L 4NRZA 4WEUD 4BFIA 4XWGH 4TOYH 3FONB 1SJHA 2I07B 4MSWA 3KYMB 5IFAH 5DO2C 2F9BT 4G6AC 4LMQI 3F12A 5IKCA 5EIQA 3SDXA 3WSQL 4KXZI 3L7FA 4FQXD 3NCEB 4EDWL 1I7TA 2FX9H 4LVEA 1X44A 5E9DE 3VGAC 4QWWC 2YK1H 3BQUD 4ZUTA 5EO9A 2YKLH 1MIML 3BGMA 3T4AA 1W72H 3FT2B 3OKLB 4RWYH 5CSZA 3QXWA 1JYVA 4AMKL 1CICA 2IALB 3CH8A 3GK8L 4AENB 4U1LB 5D2NA 1H5BA 3GSRA 3KPRD 2ARJB 1UT9A 4PJ8C 1T21B 1N6UA 2ID5A 4RZCA 4XNMA 4UQ3A 4YHMH 2CSPA 4GMSH 3QEGL 5JA8B 1WIUA 4RMQA 3RIFF 5CP7A 4MAYB 1U8IB 3LEYL 2I60L 1CDJA 3GMOB 2VR4A 4XHJD 1IZJA 1MNUL 4XMLH 5CAYB 3WXVH 3SDAB 4C56E 4YJZL 5D70L 1RZKL 1I4FB 4PJBF 2XN9E 4IS6A 4XP5H 4ZO7A 4KKBD 2F58L 1LE5B 5KOMC 2XA3A 2YPVH 1UKSA 3TJEL 4CRPA 1BOYA 5JW3L 4WHYG 5ACMA 5CZXC 2X10A 2WWMD 3P40A 2B1HL 4ZNCD 5DJDB 1D5ZA 5BMFL 1GGIH 3C6SA 4KHXL 4Y5YA 5CWSA 3LCYA 1E4WH 5HHVH 4P2RD 2DS4A 3HPJA 2Z8WC 1EGJH 2A9NL 2CGRH 5JDSB 4YHKH 1CDIA 4QOKD 2PTTB 4P48A 2KPNA 2XG5A 1OWRM 1MHHB 5JDJA 4MXWH 5ICZB 4FNLL 2D7PA 5KVFL 3I2CH 5C0NC 3RY4A 5FYJD 3I50H 2VLLA 1KELL 2DLFH 5DJYB 4RGMC 5BQ7A 5ELIA 1L9NA 3QEQD 1DTUA 2WUCH 3F8UB 1F3DJ 2OSLB 1ZT4A 1U8PB 3GSQB 4MAUL 1I7RA 2O26U 3UTZA 4G42B 5DQJA 4PJ9D 3BIAX 5DWUH 2VQTA 1RVFH 4WNQB 3IF1B 4G8GE 3BAEH 4PJ7F 5BRZD 3VXUD 12E8L 4XPAL 1W72B 2ATKB 3GHEH 1C8PA 2GTZA 4F58L 3L7FB 3ZSTA 3TM6A 3EO9L 4HIEB 1RUAH 1QFWM 3LKRB 2ZUQB 2R2BB 4X80H 5E8NA 3ARFB 3MJ9L 3P0YL 4G8GD 3OX8A 4UTBH 5FYKL 1GC1L 4JREB 4ZO9A 4Z7UB 2OJZH 4YNYA 4OM1H 1ZLVK 1H8SA 2IQ9H 4ZFOL 1JCKA 2EEAA 1CXKA 3BWUC 2CKBB 1YJDL 2R1YA 3O11A 3IJSA 4NKIL 4GQPH 4JO2H 4I1NB 4GAYA 3OKOA 3RVVD 5DUBB 4ZS7H 2EE9A 5DJAA 3ALPA 4QHLA 5H35B 2HFGH 5IBTH 4D9RD 1BOGB 4I2XA 2VDLL 1XF1A 1I1FB 2AERT 5D8JH 3ZSSA 5HPMA 1T2XA 1QSZA 5FUCC 4TVSa 1YMMA 5EZLB 1EX0A 4X6BB 2PYFB 1PZ5B 5DD0L 5F7YC 1EVTC 1UYWL 1UWEL 2VTFA 5BOZG 2XA8L 2AK4D 3GMRB 1YA5A 3MUY1 3VGGA 3HI5L 4R3SB 4AYFA 2R2CA 1CT8A 2C4FT 1CGXA 4MXVE 3K4AA 3EO1B 5GJTL 4N8VG 1CDYA 4F57L 1QQDB 5M95B 3GSNH 3SDCB 1XF3A 2X4PB 2E6PA 1IEBA 2YHGA 5E24E 3MJ8A 1KCUH 3MV11 4LQFH 3MLUH 2MCG1 1FQ9C 2DQGH 1IEHA 1FL3A 5ADPL 1S7XB 4BFEA 1LE9A 5C0CD 3CFBA 4RAUB 5HPOA 2XKNB 3STBA 1AD9A 5C0GA 3WFEL 3MFFA 5DC9B 1ND0B 2VL5B 3BQUB 4PGEB 4DN4H 1EHXA 2P46B 3I3BA 2EXWD 5D2NE 2FBJH 3SOBL 4IOSD 4UOJA 5D7JD 5EORL 2BHZA 3VG9B 1QSEB 5JNYB 3W39B 3BW9A 1I1RA 2YSSA 1HIML 2C1PB 3GGWA 2DKUA 2KQNA 4HUMB 3L3KB 2DQTH 3S98A 1AQKH 1CFTA 2R56H 4FXGB 1Q9KA 4JPIB 3T2NL 4X8JB 1GC1C 5C3TA 1MAMH 4PJFA 4PUBL 4LEXL 2CK2A 4XRCA 1RUML 4ZFOB 4CNIA 2Y6SC 3QRFM 1RQ5A 3LY6A 6FABL 2HJKB 2YWYA 4PRIA 5J8OA 1URLA 4PRNA 2BC4A 3TA3C 4PJDB 5CP3H 4WI6A 1NCCL 2XY1A 3GBML 1AGCA 5L7XH 3HC0B 5BCAA 1VEPA 3AREA 3QISA 1FO0H 2VJXA 3SE3C 3SE9H 3U0TB 1FNSH 3HR6A 4YHOL 4N0UA 4MS8D 3VI3F 5FM4A 3IFLL 1T7YA 1ZMYA 3OKOB 2HA1A 2QSCH 5CEZL 1EH9A 3O11B 5IEHB 5IVZB 2LVEA 1JHTA 1TETH 3UDWA 1XIWD 3SE3A 3JV5A 4YNYB 1G7MA 1ZTXH 2CLZB 3QUMA 4OLXL 1AHWC 3OAZH 1CVRA 4PJ9B 4NUGH 4XNZB 1I9RH 1PAMA 1T0NA 5AWNH 3RUGA 3RBGA 3B5TA 2FJGB 4FMKA 1ZLUH 3JUZA 4HWEL 3P77A 1NFDF 2CXGA 2FDBP 4PJGA 3L7EA 3AS2A 5F9WB 5EN2A 3VA6A 1BIIA 1F58L 3VG0H 4OZ4B 3RZCD 3IFPB 4S0SD 2ZCKH 3UYPA 3UTZB 3PP3K 1JNLH 4OF0A 3UROR 4OFDA 4LSQH 2VLKA 5IB4B 5T1DL 1CBVL 3D2UD 3MUHL 1NAMH 3CZFB 2ZOLB 1JUFB 3I75B 5IWLC 2BERA 4KRLB 1GL4B 5H2BB 1J1OH 1CFSB 5EOCJ 2BZDA 1MPAH 1FSKB 3WUWB 5JR1L 1GGUA 4WTWA 3HFMH 5ICZA 2MPAH 1NEZB 1H3UA 1MCJA 2F19H 2FL5B 5HI3D 4YIQA 3VWJA 1UEMA 5HVWA 2Y7QA 4J23A 3T0WA 1MRFL 4NQEE 4RAVA 5DEGB 1YPZB 1TNNA 5I2IA 3NIFE 4XMKL 1HEZA 2NTFB 5D1XC 3DGGB 5AG9A 5DJ8B 5F3HA 1T66C 4M61A 3QHFL 4XCFL 2R2HB 1CD0A 1ZT1B 2AI0H 4MA7H 1K4DB 3EJJX 3TV3H 1X6NA 4JRYA 3VI3E 1ZHNA 2P5WB 2UZXB 3B5HA 3GMMA 3P4OB 1CG9B 2ZCHH 2BFVL 4ONFH 4S11A 3HZKA 3CVHL 1IC4L 3PL6A 4XPGL 4WJ5A 5HYSG 4HJ0C 3M1BB 2GJ6D 1CLYL 4J3WA 1RMFL 3C8KB 3S34H 4DOHB 1JWMA 3V6FA 2X41A 2YPLA 4PRDA 3VJ6B 1ZLWH 3MV8B 4LLDB 4UQ3B 1IGTA 5IMMB 2K3TA 4Z7WB 1S3KH 4XBEL 3RIAF 4GG6F 4RX4A 1OP3H 1P5UA 3U1SL 3BYTA 5C07D 1UFUA 3T04D 5A3ID 5EU3A 4GRLB 5GRJH 1DFBL 4I77H 2ADIA 5IMKB 5JW4Q 5ESQA 3C6LC 3BGMB 2WQRA 4F3FB 1BQLH 3ES6B 4RX4D 1UXSA 4HFWB 4UV7H 3KXFA 5K9KA 1MCWW 4ODHL 2BVQB 4XBPB 4ZTPH 1IC5H 3O6FB 4KMTH 2B5IC 4OZIF 4TUOA 1TCRA 5GZNC 4O9HL 3Q6FA 1I8IA 3OG6B 5IKCB 2PXYB 2Z31C 2ZJSL 4EN3C 3GO1L 4G8IB 3WIHA 3FOMB 3GKWL 3KAAA 4BFIB 2AW2A 1EAJA 1OWWA 3QHZH 4NRZB 5IMOA 4M02A 2QQLL 4J3VA 3D0LB 3QT2A 3IDGB 1WC7A 3BGFB 2DQCH 2ITCB 1NGXB 1INEL 4JFHD 1R3KA 4F7EB 1WAAA 2HN7A 1F11A 1LHZA 1MCFA 3INUH 3BJ91 3FAWA 3QIBD 5T1KD 1MI5D 4HIXH 4D9QE 1E4KC 4RA0C 3T1FA 3WO3B 1IGMH 1J5OL 2XOTA 2CQVA 2DQEL 5D1QD 3TT3L 4OI8A 3RBSA 3GJFK 5ESAB 1UC6A 4JZNA 5GS3A 3WSQH 4D0DA 4F37F 4N90D 2XZQH 2NZ9D 4LSTH 3QXAB 4I0PD 3FO1A 3P9LB 3SGJC 4R8WH 3CFKA 3BO8B 4TULH 2W0LA 2WBJC 2KUTA 3KNBB 2VC2L 2DWEB 3LB6C 4P5KA 4ZTOH 4POUB 3LS4L 3CXHK 2ENYA 5KAQG 3RVXC 3SHSA 1G7IB 1WWWX 3U7YL 2NCMA 4XCYA 3ARBC 3GK8H 5CEZD 4ELKA 5I1JL 2F8XC 2P5ED 3NAAL 2PO6C 3VFOB 2HMID 5I74B 4S1DC 4WV1A 4XVTH 2CRZA 3IKCB 4QRSA 1KN4H 4WO4D 1HINL 3K8KA 3SO3B 5T1LA 5KSBF 5SV4A 2AXFA 2DQIL 3WV0A 2O5XH 3SGJA 3UTSE 4QRQB 3C60A 4Z9KB 1IGJB 2BRRH 5E2TH 3V5HA 3WXVL 1I7UB 3WDJA 3FQRB 5KG9B 4YO0A 4GKZB 5I8KL 4F15B 2JB5L 4WU7B 5KVEH 3AGVA 5IGXH 4LMQE 4KRPD 4PB0H 4PRPE 4FQ2H 4MCYA 4UDUB 4YPGB 1G7PB 4HSQA 1YEFH 3QXVA 5K33A 3J8F7 4HZLA 5DLMH 3EOTL 4P57B 5HHVL 1I9JH 4BSVA 3REVB 5JXED 5GZND 1NC4B 5D96B 5F1IA 5TDOA 5CMAA 3B9KB 3WFBL 4NKOB 5DK3A 3WMSA 5KN5A 1T7XA 3HZMA 3V8CA 1WICA 1LGVA 5DJ2A 4C54A 1VKXA 4JQIL 5F7EH 3UJJH 5C6TH 1VKXB 4V1DE 1RUPH 1C5CL 4AIXA 4FQCH 1FL6B 5CMAB 4FNLH 3VFTA 2EXYC 4XH2A 2Z4QB 3R4DA 3WLBA 3W5NA 3GM8A 3I50L 4L4VD 2QQKH 2DLFL 5E08H 1G7PA 4LF3B 5JO5A 1I1YA 1LEGB 5HHNB 1FJ1B 3CSYB 5CJ8A 4K55A 4J3SA 3ZL4L 1VA9A 4NZTL 5C92A 4XBGA 5TE7H 2FJFB 5L0QB 3H9SD 5E4EB 5ERWB 1GVIA 4K2UL 1EJOL 3CPLB 5DJ0A 5DVMA 1IVLA 3O8XB 5IBUG 1CTOA 1FFPB 4ZPTB 3UAJC 5GS1A 4BK4A 2IQAA 3WL9B 1NGWB 3KYAA 4LLUB 4PJ7B 3N06B 3VFNA 3CLEH 5E00A 4XX1E 1V7NL 1CLOH 2VQ1B 1RZFL 2N56A 2GTWA 5EBWA 5I6XC 4IMLA 2E7LA 3QCTH 4HK3N 4ZQKB 1FGNL 3L3JA 1QRND 2OLDA 2B1AL 1RU9L 1OGTB 5H37H 2Y72A 2IQ9L 5CEYA 5FUZH 3QAZB 1U8LA 4Z77B 1PG7H 1QFPA 3CMGA 2R0ZH 1FNGA 5HDQH 4APQC 5DQDL 4F2MB 3BH8B 5ALCL 1ULVA 1FFNA 5IBTL 4F7PB 1NBVH 2WIIA 4LLAA 1YNTB 4N9GA 2H2SD 3E3QE 3WNOA 3JXAA 1BVLB 4GSDL 4ZUUA 3U9PH 2YBRB 5GRVL 5INCA 4D8PA 2R23A 3KPRB 1DLHB 4I18B 4OAWB 4ZMAT 1JRHH 3TBTA 1AXIB 2BY2A 1OTUC 1U36A 3CNKA 1EEZA 3QDME 2CIKA 1QLRA 2R29L 2F5BH 2J7LA 5ALBH 5TGBB 5D7JB 4XPBH 3ULSA 1TFHA 5EOCH 1M7DA 4X7DC 5KOVC 2DIJA 1I8KB 2A1WH 1A3RL 1G6RL 2W9DL 3WE6A 5IG7B 3NA9H 4P4KA 2ITCA 5JORB 1U95A 5LQBH 5F7NC 5IM7B 4DTGH 3Q3GB 4N8CH 6CGTA 3MTRA 3DIFB 3MV7D 4YC2C 1N5YL 4XNQB 1PSKH 5ANME 2V17L 1RZIB 1WAAF 5ITBL 3IJHA 2Y4SA 1P1ZA 3FT4A 1A2YA 1F02I 1UQSB 3PGCB 2X2YA 2E7LC 1M7XA 1MCKA 1PJ9A 3PV6B 2VLME 2OYPA 3OBAA 2HTLC 1TJIH 3MRRB 5BS0A 4MX7A 5DK0B 5DHXB 4NKDA 2DQTL 4X4XB 2FHCA 2V2XB 3KS0J 5EC2B 1G9EA 4JFDA 5EC2A 1FFQA 1TENA 5DQ9B 4ZUVA 2B0SH 1A6WH 3LB6D 4PJEB 2ZUTA 4QTHA 3RNQB 3LS5H 3KPQB 2BNRB 4YWGL 4O51A 3H7BB 2EDLA 3HZYB 1OAKH 4GG6A 1FDLH 4LLWB 5DUMH 4X4YB 4OCSL 5L7XL 5E2VH 1T66D 1T7WA 4I13B 4TUKH 2BVYA 3QI9B 4LCCB 2WBWB 4XNQA 4WO4C 4Q6IC 1MEXL 4G6FB 3O4LB 2QLVB 4P9HL 1HCFX 4JFXA 5TFSL 3CMOH 5TJWK 3MBED 5IM7A 2QSCL 1KULA 2Y36H 3VXMA 1FCGA 3ULUH 1WBXB 4XAKE 5IF0B 1QRNA 5DRZB 4DZ8B 4FQHB 1ZTXL 2VZUA 5TGBA 1T89A 1R5WB 5E8PA 1J88A 1U8JA 2GAZB 3VWJD 2CPCA 3VWKD 1XT5A 4RAVB 5DK2B 1NCWL 5EH1A 2V7NB 1ERNA 4L8BA 2J1KA 4Z7WE 3PJSA 3CFIC 1DZBA 4LSUL 5L2KE 4IMKA 1XF5B 1T6WA 2V5TA 4KTDL 1T0MB 3MROB 1FBIH 4LVOB 4Y2DC 5DEZA 3D25A 3PABB 4LVHB 4UMGA 5D1XD 3LN5B 3QZWB 3G6JF 4L29A 2V5MA 2O5ZH 5L88H 3F7PC 1JUFA 4UAOC 1KJ3L 1T0PB 3MRMA 5BZDB 4JFFA 4K3HA 1Q72H 1RZ7H 3HMWL 1TZGL 4NCC1 5TQ2L 2AP2A 3HN3A 3L3OA 2ZSWA 4ZOEA 5GS2H 3N9GH 3E0GA 1NPUA 2J4WL 1JPFA 3U30C 4H5SA 3X13A 2CLRB 2VLRD 5BV7C 5ICXA 3IB4A 5DVOA 1IRAY 1ZS8A 5LGKA 3NFSL 4Y4HB 1AGDA 3QEGH 3VCLB 3WKMH 4ORZC 1DEDA 4XZUB 2IFFL 1P2CB 4MQXD 1HQRA 3LEYH 5C9JA 2CLZA 3QUMB 1SBBA 3RTQA 5IJKC 1S7RB 2FJFA 4QRTB 3CJJA 2K9UA 4X6EB 4OI9A 3C6LD 3SN6N 5IEHA 3VWJC 3DO7A 1KCSL 5KSUA 5BZWA 4LF3A 1F90L 3QNZA 3BKJH 3S37X 1ACYH 3VI4E 2E8YA 1X7QA 3NABL 4QHMB 1BVKA 4JLRB 5DD5L 1RMFH 2WBJD 4YHYB 3L3DA 1P4LA 1OSZA 4W70A 1ORSA 5EOQH 1E4WL 2DICA 3OJVC 4MA3B 5EBMB 1KSRA 4PP1D 3QIUB 3CGTA 4OF6A 4P2OB 4LFHD 2D03H 1OGAD 1A1MB 4L3EA 1A1OA 3MLYL 4P57A 4FQQA 1F6AA 2AV7B 4L4TD 3KPLB 4Z8FL 3HAEB 2C7UA 1AP2B 4DW2H 2IBZX 1GZQA 4L3ED 1BJ1J 4M1GH 5TDNA 1QA9A 5F97E 3HLAB 1TXKA 3IAPA 1OGAE 4I9WE 4ZDHA 4JVPA 4TN9A 2NW2B 4OIIH 4HFUH 5KG9A 5C6WH 4EUPH 5IB5B 3GMPA 2DD8H 2VAAA 4MXQD 1FYTD 2DQHL 2FJHA 5DFVC 1DEEA 2MQ0A 4PGBA 1C16B 1GGYA 4F8QA 3PHOA 4JCMA 4QTIL 12E8H 3ZT6A 1TJHH 2UZIH 1G7JA 4U6XA 2NPLX 3VXME 1CIDA 4JZJC 4Z78B 5MEPA 2RJMA 2OL3A 4Y16A 5HJ3A 3QHZL 4GRLD 1FFRA 4QXUH 4K23L 3T3MF 1EEQA 4HXBH 2VSDA 1I8LC 1GGCL 3TIEA 4HGWB 3EYSL 3KG5A 3SDCA 5ID1B 4XCYB 2AK4A 3MJ7B 1JPSL 1N59A 3T0DA 1IQDA 3RPIB 2V9RA 5BV7B 4QRUB 5D1QB 4HIXL 1N5AB 4HS8L 4K7PY 3V79C 4NKIH 2DWEA 4P5KB 4LCWD 3KNBA 4D9LH 4GRWB 2AKRA 4ZS7L 5KS9B 4OZFG 4S1DD 5TE4H 2RQ8A 3DVGB 3STLA 1G6VK 3X14A 5I18L 5FGRA 5I9QC 1K9TA 2WW8A 2CMRH 3I3DA 1KIQA 2Z91B 5JUEH 1GRWA 2ESVE 4JY5H 3ULVC 1AGEB 4ZTOL 5DZLA 5FV2A 3TZVC 1S9XB 4XXCC 3FHQA 3DRQB 1UM5L 4GMTL 1F11B 1KIRB 4R4FL 4UIKH 1F5WA 2CO6B 3HI5H 3L3IB 5IK3A 4QXTB 3CU1A 1C7TA 3RWJB 3GSVB 2ED8A 1I8MA 1FZJB 3ULUC 2V7HB 1YZZA 3FOMA 1NLDH 3MRJA 3MOAL 3PWVA 1D9KD 5FYJH 4HUXB 2OXGA 2K7PA 3PHQB 3VXNA 3WHXA 4KVCL 2G60L 3FB7B 3N85H 2G5RA 1L7IL 2FBOJ 1B90A 2UWEA 4PIRF 4OLVL 5FDYA 4HV8A 5D2LF 3THML 1IAMA 3UPAA 3L5JA 3ARRA 1K8IA 5HYEA 3GMNA 3MO1B 1ZT4B 1UWGH 2QTEA 1ZLSH 2KH2B 4IOIB 3FAXA 2OMNA 3O3UN 1EO5A 4ZFGL 4DVBA 2CUIA 4XCCH 5DJYA 3EOTH 1B0RA 1ES0A 2L4OA 3BKMH 4M4RA 3NIGE 3KLSA 1F97A 3CFJB 1CF8L 5J6GA 1SEBB 5D7KD 2Q8AL 1QRKA 4NWUH 2PUQT 4PRDB 3GSNA 5KSVB 5IB3A 3TFKC 3HS0A 2PR4L 3PWJB 3G08B 3HPJB 3O6KH 4H20L 5HTSA 1NMBH 3RWIB 5JMRA 1PW3A 1V7ML 1U92A 2P5EB 2LFGA 1WWCA 4KFZC 4E5XA 3ZTNL 3FQUA 1QSFD 5TF0A 1NFDA 3GMMB 3QI9D 4JRYB 5M7QA 5FOJA 4N0YL 1OAZL 5CJOL 4Y4FC 1DBKH 1MJJB 3ARFC 4R2GB 4MWFA 1HEZB 5I74C 3MREB 3PWNB 5A1AA 5SWSA 3G08A 5BXFA 4QF1B 4U6VL 4G8FA 5EPMB 1RJZA 5JOEA 3HNSL 1IBGL 2QR0B 2XRAH 1YNKH 4PJ8B 2APWA 1KCRH 5D7IB 5LCVL 1VCAA 2C5DC 2ARJA 1RU9H 2X4QA 1KTDB 4Q9QH 4XAWH 4LNRB 1MCDA 2DF3A 5FUZL 4R0LC 3W5MA 2R0ZL 4UUJB 4YZFF 5DD1H 5I75C 3JSSA 2EXYD 3ULUD 3GMNB 5C0BE 3DHMA 1KNOA 2N1KA 3TFKD 1YEHH 4C57C 4F7MB 3BPLC 5EO1A 1I7TB 5EN2B 1VHPA 4YHML 3QUZD 2A6IB 3BP5A 1XIWB 4OUUB 2C4XA 4Z7UF 3OKDA 3WHXB 3N1GC 3KJ4C 1MF2H 1MCRA 4HKXA 3V4PH 4WDIB 3MRIA 5GS0C 2P8PB 4MSWB 5HDLA 1MREL 3TCLB 3EOBB 4FFWC 1CDUA 1MY5A 1X3DA 1I8MB 4U1JB 2YD5A 3H3PH 2WZPD 4JM2A 4KTEL 5HI5C 2MOVA 2Q8BH 2B20A 5BS0E 1A3RH 1G6RH 5DURB 1F4HA 2A6KA 3P4NA 1TQBB 5D7SH 2VITA 3P9MA 3G6JA 3ILQD 3X3FH 5JW5B 1E6OH 3KPMB 2XIDA 2D7OA 1XZ0B 1S9XA 2AI0L 2MNUA 1P6FA 3QPQD 4UU9B 4Y89A 2BNQD 4NC1E 4RGMB 1CICC 1L0QA 1CGYA 4I3SH 4M43H 3M8OL 2HYMA 3ARTA 4P23C 1AGCB 1NQBA 2VXVL 1MI5E 4D9QD 1CD1B 1OAXL 1X5LA 4PJBA 4EXPX 2ZCLL 3TH2T 1JZ6A 2HJKA 3RVUC 1BBJA 2BXZA 4PD4K 3MBEC 4MYWB 1OP3K 4PJAE 2FX7H 4P3WA 3ROLB 1H9VA 2R4SL 1N59B 4XI5D 1WK0A 1U8QA 1WV7T 5CIPA 3H2WA 3W9DB 5DD3L 3QAZC 4X8JA 4PREA 3H6JA 4JPIA 1DBAL 4HGWA 3MLSL 4JG0L 1ZLWK 1MRCH 4NZDA 3ROLA 1DDHB 5LG1A 3QEQA 4J1UA 3O6FD 3VXPA 1YEIH 3MRFA 2ITDA 5JIKA 4P4KC 5FF6B 4K7PH 3MLWL 5JNYA 3BXNA 1G7JB 5EU7C 2R1WA 5FO8A 2IPKB 1XGTA 3V5DB 5ID0A 1TIUA 5E03A 4X98B 1ND0A 2VL5A 5T5NF 5IB5A 4QXWA 4Y0GA 3Q48A 1S7XA 2E7MA 4XCEB 2NW2A 1JRHI 4UILL 5JIPA 5GSRB 1GC1H 4NQDE 2ZJSH 2W65B 4J6RH 5GGRB 4YXLH 1N6QH 3P9MB 3GMLB 4KRMB 4WUKL 2X9XA 1UWXK 1IQWH 3RVXD 3WHE0 3I9GH 1RK0A 1T80A 3LH2L 4O2FA 3UJTL 3DGCR 3B6SB 1IGIL 1EA9C 3QDGA 1E6JL 2FECL 1F4YH 4XVUD 1IEAB 5E8EA 3IXTA 4DGYH 1WGOA 4LGRB 2QHRH 2XFXB 1S5IL 5F1OB 1XF4A 1CFQA 5D7LB 1J1XH 1J8HA 5JIHA 4GKOA 4U1SA 2HVJA 4EDXA 2EH7L 1PEZA 4NJ9H 4P5TA 3U82B 5E5MA 2YEZA 3BP5B 3IDXH 4K9EC 4XGZB 4PY8I 1BVKB 3IS0X 2DI8A 3K3QA 1S9VA 4OZHB 4UT6H 5C08B 3IS1X 1H5BC 3MCKA 5I66B 3WNNA 3DNKA 1NGPL 2QSVA 3DYOA 3QNYB 1OAQH 1UKQA 2P5EE 4PS4L 4UTAH 2JJWA 1W0WB 1QACA 1CXFA 4NZUH 3KPNB 5CEZE 5E8NB 4AEFA 2ZSVB 4KQ4L 4PB9H 4ZUWB 5CD3A 1ZS8B 2WNGA 4R96A 3SOBH 43C9A 5SWZB 4OFYA 2OM5A 5EO1B 4LCCC 3LKQB 4KK5D 1E0OB 1U9KA 1JGUH 3ZDYE 1UZ6F 2OZ4H 2UVFA 1LK3H 1U8PA 3GSQA 3RL1A 4RIRA 3RZCB 4ZG1A 2OTUB 3MV01 4HGKC 1M7IA 3TCXA 5E0QA 1NFDB 4Y4KD 1E27A 5E2WL 1D5BB 2Y9RT 1IAKB 4JKMA 3T8XB 5GGVY 1N4XL 5HHXL 4P4RA 3OKKB 1RIHH 4X5LA 5D9SA 1T0MA 4PJ8A 2NQCA 1VGKA 3PWJA 3O2VL 3MV9E 4HZAA 2P47B 5JPNB 3R8BB 5CCKH 1Z2KA 3DOSA 1J0JA 4NHUA 1H15B 5I1DB 2VO5A 3GBMH 4HPOL 3D3VA 4G8FB 5GGTL 1VGKB 3VRIA 1BEYH 3C6LB 1U3HA 2UWEE 2JE8A 4LCWE 4MWFB 3GFUA 3FQWB 3SE9L 4PJIA 1B0RB 1ES0B 2D0HA 2GIYA 4Y5YB 4MZ3A 5CWSB 5D1ZD 1Q9WB 2X4OA 4XNZC 1BZQK 1MCSA 5FK9B 1JI2A 4X0KA 5DRZA 3SKOB 3SGEI 3QDMD 3CH1A 2OTUA 3VFUB 1EXUA 5L2KA 3IYLW 2NY0D 4AL8L 1A6ZB 5E2JA 2P43B 5DRWB 4XP9L 2SEBA 2Z31B 1N2RB 4KQ3L 3SDAA 1H8OA 4FS0A 4WUUD 5F71A 3MRNA 1FCCA 4RMSA 1T7VA 4XTRC 2XICA 3FO2B 1G9NC 4LEOA 5CEXB 2HJLB 4OLWL 1LO3L 1H3VA 3VXNB 3K4ZA 4FQPA 4MAYA 3MMEA 1KB5H 4GG6B 2UZIL 3BZ4A 1W8OA 3UO1L 1JHKL 4BFGA 4XNUH 5J6GB 4OZFH 3CFJA 4GRWE 1LP9E 4F7CB 4RZCB 4XNMB 3VG0L 3CXDL 1EIBA 1VACB 1WF5A 1W0WA 4F80A 4RNRB 2J3SA 5DA4A 4KDVA 1NBQA 1H5BB 5IBLD 1JNLL 4YR6A 2QJDA 2NZIA 3CFDB 3DSNA 3QUMH 4F33A 5D7LD 4N0CC 1K8IB 1W0YT 3SDDD 4KROC 4M8VA 3G5ZA 3STZB 3JTSB 3SGDI 5BVJA 1FG2B 2VLRA 2I5YH 2FLBT 2Y07H 3L5WB 5IROA 5HYJA 3N1PC 4OSUL 3AY4C 4NKMA 4FABH 5DVLA 3L3GB 5FYKU 3RJDA 3STLB 2A9NH 3KGRA 1FO0A 4PGCA 3P3YA 5ISZA 5C08E 4E41D 3TVMB 4ZO6A 3HNVL 5D7LA 1KPUA 4HAGA 1L0XA 1FZJA 3D18A 4NNXB 4W81A 3ULUE 1N5AA 5CP3A 2AV1A 4CU7A 4Y19B 3SBWC 4JM2D 1ED3B 1QLFB 1JTOA 4LFHG 1MFEL 3O6LH 1FV1B 1S78C 4HDIA 1I8KA 4B7LA 4LKCA 3TV3L 3GIZL 1CS6A 1NUFA 4GRMB 3TIEB 3U7AA 4XP5L 2FB4H 5FXCH 4CKVX 3T0VA 1P7QA 3IVKA 1BX2A 4HW6A 4PGDB 2OL3B 3O0RL 1FFOA 5J3HD 3GBLA 1P84J 3RTQC 4IRJB 3SKNA 2FO4A 1U58B 3V6BR 4RFNC 2X09A 3LKSB 1C16A 2OXHA 4KVCH 4OQTH 2HP4A 5A2FA 2Z31D 3GHEL 2YBRA 2HKHH 4K3EH 1MCOL 4BQ8A 4CUCA 3ULVH 4MJ6B 4YH6A 5AAWA 3MLTB 5MEOA 1GIGH 1NANH 1BF2A 3NZ8B 4ENEC 4BYHA 1S3KL 3HLAA 4ZDHB 1QA9B 4GS7C 2LAAA 1QBBA 2NY0C 5F8RC 1CI5A 3NCJH 5EULV 4ZS6D 3U2SB 4JE4B 2IEPA 5KBNC 5I19L 1RK1A 3A67H 3HB3D 1KELH 5J1AB 3MLVL 3P73A 5C0DA 3QUYC 2B4CL 4JO2L 2VKWA 3OR6A 1PBYA 4MAUH 2HFGL 4NT6A 1KBGL 5E00B 3I84A 1ZSDB 3LS5L 4KJQD 1DE4B 1VFAA 4O9HH 1P4LB 5BV7L 2F53E 1FFPA 3SCMB 1S78D 5I1KL 2YPLD 5DVNA 3QQ4B 4FQLH 3EO9H 3HC4L 1A3LL 1UYWH 1D5MB 4MHHI 5E5UB 2HWZL 4X80L 3KLHD 1LEGA 3MJ9H 3P0YH 5HHNA 3RVWD 4P59L 3HAEA 4FZEH 2IAMD 1XCTB 4WWKC 1HZHL 5DUPL 2J8UE 3WNKA 3FFCE 4MAYC 4TSBL 4JM2B 2GY7B 4HG4J 4L3EB 3D0VB 3AAZB 1KXQE 4P2OA 3TT3H 3QIUA 5T3XL 2X7LB 2P5WE 4KK6C 1NUNB 3G6JE 3OKDB 3T0XA 1MQKH 5D8JL 1NFIB 2DJSA 1T83C 2PO6B 3QDMA 3QCUH 3AM8C 4PTTB 5FGCB 3CIQA 4X9BA 1N6VA 3ULVE 4BSVB 4RMTA 4IRSC 3RPKA 3L5IA 3UPCA 5J56B 4UNUA 5T1MA 4MCYB 4UDUA 5GSVA 5CJQH 5I1CH 3H3BC 1Y6KR 4NQVA 3WJJA 1QBAA 3DO7B 4JDTL 4MNQD 5AAMA 3MA9L 4I18C 4PBWD 2I9LA 2XZAL 1EEYA 1KTRL 3BD4A 4GT7A 3RTQB 4U2YA 5JPMA 1YEHL 1WEJH 2GT9B 3NAAH 3FTGB 3T2NH 1SJEA 4J4PA 3HMWH 1HCVA 4N8VB 2D7MA 5TDPA 3N1FC 4OCYL 2QKIB 3REWA 2W60A 1H0DB 3I6GB 2BSTA 1OAYH 2V7NA 5E95B 1LO0H 3TA3D 4XP1H 3AREC 3DXAB 4O2CB 5ICXB 2WWMC 3QO0A 2VNCA 4H5SB 1JGLH 3X13B 5D96C 5DJZB 5I8KH 1QKZH 3K4DA 3DMMD 3DSFH 2JB5H 5KVEL 4FQHA 5HGDB 1J0ZA 3GSWB 3MUGA 4U0RC 4GG8B 4JJHA 3QJFB 5L2JB 1KB9K 3QFDA 4OQTA 3QZWA 5DGRA 1QEWB 3DBXB 3T0EB 3RY6C 1HHHA 3SDXF 2CO7B 2EDFA 4I4WA 4WFGE 2YD1A 1J18A 1MAML 1QRNE 2P44B 1J11A 3NN8B 4L9LB 4Q97A 3GHBH 1ZWIA 1LEKA 3NABH 3FMGH 1OAXH 5JHDB 2G5BA 1ZK9A 5DD5H 4UQ2A 3P4LA 1DSFL 1I9RL 4RMVA 4LPVA 3GZKA 2BNRA 1SVZA 1NLBL 1M05A 2E27L 3OKMA 1NCCH 4DKAA 3MGOB 4G8GB 4QNPF 3HMXL 1F58H 3IRZA 2G9HB 4R0LB 4JFDB