2VDPH

Integrin alphaiibbeta3 headpiece bound to fibrinogen gamma chain peptide,lggakqagdv
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
219
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 43
structure length 219
sequence length 221
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdpH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdpH02
5ICYA 4V2CB 2W0PA 1N2RA 4NO3A 5E00B 2AABL 3BOVA 1OLZA 4FQHB 3ZE2F 5DJ2B 2ITDB 1JV5B 1OSZA 3DXAD 4NO0D 4YHKL 4G8GB 3BDXA 3DTXB 5JNYA 4Q0XL 5H2BB 3QIWB 4KTDL 1R3LB 2GYSA 2WBJC 4LCCC 5IIEA 5BZDB 3TNMA 1U8PB 4TRPL 4G42A 2DQHL 2AERT 3IAPA 5EU7E 4GW5B 3O2WL 3VD3A 1L4IA 4HIXH 3OB8A 2DWEB 3KHQA 1J1PL 2CR3A 4H88H 3D85B 1EXUA 1UVQB 2UUDH 2IANA 5ACZB 2ZWLT 4ONGH 1ZHBA 2FGWL 3I3EA 3RNKA 1FLRL 1A6AA 1JGVH 5IUSA 1J8HB 1A7OL 2I9LB 3O2DL 5EBLA 1DBML 3O9WB 5KS9B 3R06B 4X5LA 1A6TA 4OZHF 1NC2B 3VE0A 1MF2H 3X11B 1M7DA 3EOTL 1L9NA 4A2MA 3QBTB 5DJAB 3R1GH 5M94B 4M3KB 1ES0B 1T1ZB 4JDTH 1JRHH 5CKAA 3WD5L 1WBYB 2VXQH 1NAMH 4Y4KD 3L7FA 3FRPG 1FRGH 5I66B 1HWGB 4G8EA 1JWSB 1LP9E 1CGWA 3L1OH 3HG1E 1JNLH 2W60A 4FXLA 5I1HH 3GI9L 1WCQA 4P3CL 3IJHA 3ELAT 4UB0H 5GJSH 4FRWA 4Z7VE 5E8PA 4HEPG 4K8RH 3LB6C 2BSED 5T1DH 4YHLL 3AAZA 4U1HA 4JHAL 4EDXA 3JWOL 2YHGA 1J0KA 3KLAA 1DL7L 5HSFA 4XHQA 5HYSG 4U2YA 1YEEH 1X3DA 4FHBD 1S9WA 5DHVB 4PLKD 4F7MB 4GW1B 8CGTA 5ID0A 1IM3A 2NYYD 3KJ6L 3P77B 4HAGA 1OTTC 2OR7A 1NBZB 4LRIC 3M17A 5E5RB 5FK9A 2XFXB 5F9AC 2VISB 3WIIH 4M4RA 4OCLC 3V52H 3HC0A 2P49B 1DN2A 5KSAC 1GGIH 1KTDB 4NQCB 4JLRA 1A2YA 4XP5H 3LEVH 4U1NA 3T04D 3T1WA 2AEIT 3HUJE 3C6LB 2J4WL 3QUKA 1BVLA 1H3PH 1JPFB 3QUXC 5HHNB 2QV2A 1OQOA 2BSRB 3QNYA 1HYSC 2HFEA 1LVEA 2FJGB 2XPGB 3GJFH 3DV4B 5D7LA 3RHWK 3QIWC 3GJFB 2NX5E 2VLJD 3B8SA 3O4LA 1EBPA 3EIFA 4NYLA 1YUHB 2JCCF 4L8BA 3U4BH 4PR5B 4LBEB 5E2VL 1XCTB 3HE6A 2IQ9L 4E5XA 1PKQE 1HYRC 5HPMB 5HHPB 1CL7H 1VKXA 3DHJA 1E6JL 2HTKC 1XEDA 5BMFL 4NKIL 2NNAB 2ADGA 1XR9A 2UZIH 5FF6A 3STZA 3MODH 5IQ9B 3O4OC 5DO2D 3VFUA 1Q94A 1OPGH 1OAYH 5GGTL 1KENL 2ZJSL 3T09A 4M7JH 2XKNB 1UCBH 3GI8L 1RPQA 1GC1C 3MPCA 3ZTNL 5KG9A 3TPKA 3HZVA 5IGXH 4X6CE 1KEML 4MSWA 4APQD 3NTCL 4HCRA 1J0JA 4Z7OF 3GK8L 1CXIA 3PDOA 3BP5A 2H3NA 2X4RB 4NQDE 4F9LA 1BOYA 1T6WA 3MROB 3QFJD 1KCLA 3GMQA 3V5DB 3ARTA 1R24B 5L8JB 1SBSH 3FQRB 4WHYG 4TULL 3FQXA 2H26B 4XCYA 5I8OH 1NGYB 3VJ6A 3QP3A 4TSCL 5I16B 3DYOA 4KJQD 1EV2E 5IFAL 5D93B 4JFYB 3GSVA 3VXTA 2NY7H 5CJ8A 3W81A 1P6AB 1LDSA 1KJ2A 4B53A 5I73B 2YPLB 4EDWH 4MQXC 4HKJB 4POZD 3NA4A 3QDJA 1YJDL 5TE7L 3QUZB 5DK0B 1PY9A 4HC1H 5CIPA 1AI1H 3VMNA 4ACPA 2V5RA 3IETB 4OZGF 4JJ5B 2O26U 2W65A 1FIGH 4OLWL 4IRJD 4KQ3H 4NUGH 3FT2B 3PWLA 5CGMA 5JORA 4GQ9L 3BGMA 5A1AA 1KCUL 2C1PB 5IWLC 3HMXA 4HUXB 2EXWD 1RHFA 1SJVA 3CFKA 3FOMA 4MA3B 5F3BA 1AGDB 1B4JL 3P11H 1MH5A 4D3CL 5FO8B 4JDVB 5D2LA 3OAYK 3KPLB 1HQ4A 4LDOB 5KSAD 4MA8L 1MIMH 3WIHA 3RWCA 4ZFOA 3QWOA 4ELMA 2FDBP 3RA7H 5C0AA 1ZHNB 3B9KB 2R69L 2NTSP 3TA3B 1FC1A 3E0GA 1JHTB 1UKSA 5HVFB 5IKCB 1E4WH 4JHZA 4Z7NE 1MAML 9CGTA 1DQJA 2NY6B 2HJKA 2PO6C 3QWRA 4G8GD 1HYSD 5CCKL 1HNGA 1ED3A 5HHXL 1FGVL 3QIWD 2Q87A 3MR9A 2W38A 5HJ3A 5ESQA 3IDIB 3U0WH 1YEKL 1A4JA 1D9KA 3RL1A 1CXKA 5CEZL 2MJWA 3QIBC 2O93L 1AD9A 5C3TA 1D5BA 3UDWA 1P7KB 1ZWIA 2XWTA 2XG4A 3VH8A 3N9GH 4G80A 1EMTL 1ZVSA 3Q5OA 4G8IA 4PJIF 3D85D 1C16A 4QHLA 3C09C 4TUJA 4XVUD 2DBJA 2FYYB 1VCAA 1IQWH 5TDPB 1S9VB 3WMSA 3O6ML 1J8HD 1F3DH 2C9AA 4JFQB 3PWPE 3KAAA 3VWKC 5HYEA 3KPQB 2QADC 4PJ9B 3GSXA 4E41A 2JJTC 3O9WD 3ZSSA 1NC2D 2YEZA 4RMRA 4OZFG 2D03H 4ODHL 4NP4L 4M43H 1Q0YL 4UZGA 4O4YH 1Z9OA 1IGFH 1M6OA 3HR6A 5J13B 3V5KA 4WW2A 4PYGA 4NRZB 3EDEA 5EO9B 5JQ6L 4OT1H 3ZZ1A 2D31B 3E8UH 4GMSL 5C0BE 4P9HC 2FECL 3BVNA 1CU4H 1KYOK 4YHOH 5F7DA 3W39B 5A2KH 3LS4L 5DJXA 4QRRB 1OT2A 4PREA 3SDXA 3QUYC 3MV8D 2NY4C 2CKBH 2ZCHH 2D7NA 1SJEB 3GMNB 4JHWH 4K8RD 3VFRB 2CKBB 1N6VA 4HXAL 4GRMA 1S7UB 3BESR 1HILB 1YEGH 3IDJB 4LSDA 5KVEH 4E42A 4QT5B 3U9UA 4GO6B 4NKMA 1I8KA 1T1XA 3MBED 3RTQB 2Z91B 1CICA 1I1AA 1I85A 4I48B 3NAAL 3MTRA 1ZMYA 2VQ1B 1EO7A 3P2TA 4G9FE 4RAHA 5TDOA 4F15C 2AAVA 2JB6B 4PJXE 2J8UB 1LO5B 3IS1X 5C0FA 3HAEH 4PBWD 1S7SB 1XFPA 3BZ4B 1ZGLA 3RBGA 5ITFB 4J23A 2NMSA 1Q8MA 5DUML 3DMMB 4FN0A 1ZANL 3KDMA 4OV6F 2ZNWA 3NIDE 5DGRA 3H0TB 1D5XB 5EA0L 5CJOL 1SHMA 1MWAL 4PG9A 3B9KC 4FQIH 3C6LD 1ORSA 2FIKB 4X9HA 4JAMB 3BHBB 5EO1B 3MJ9L 4CNIA 3LRGA 4HUWA 5DJDA 3CCHA 4HQQH 4YGAB 5SX5H 4M7KH 4OLUH 4RISL 5HD8C 2F8OA 1EZVX 2EYSB 4N8CL 3NA9L 4HBCH 1Z5LB 2VXTL 2GQHA 4WUUA 3KNBA 4LSPL 1BHGA 3BRDA 2VDQH 5KOMC 3ULUH 3NFPA 5KVDH 1X44A 2Z92B 5GGRA 1D5IH 4MJIB 5DUBA 2DM7A 3FTGB 3NIFE 5IVZB 5EUOF 3TBSB 1GGTA 4R4FL 1CFSB 4LP4A 5EBMB 3GBNL 4WU5B 1DQLH 4PJ9C 3PL6B 4G3YH 5DHXB 3MLVH 1MHCB 2DBLL 4QXUH 5I1IH 1OF2A 1DEDA 3QCTH 4U1GB 4U1LB 5CZVH 2VC2L 3QHFH 1T21A 5L7XL 1S5IH 3IFLL 4WY7H 5J13C 4GRLA 4RQQA 5D70H 1ZA6B 2AK1L 4Y5YA 2XYCA 2HLAA 3MRRB 1RIHH 3GMOA 5IM7A 2IGFL 4JB9L 3EFDL 2Q7NA 4F9LC 1RV6X 1VGEH 5AYQA 4ZFGL 2NQCA 3K46A 3RY6A 1MUJB 5JHLL 4KY1L 2XZCH 5HHME 1GSMA 1VESA 5IHZB 4LASH 3QXWA 4AEIL 4D0DA 1HXYA 2EDLA 4PJFA 3LKSB 3RGVC 2CRIA 3BX7C 4PJ7F 5GGUB 3QCUL 3C2AL 3U83A 2A6JA 2Q76B 1YY9C 4KC3B 4CRPA 2KPNA 4N0FA 2YPLD 4MJ4A 3T3MF 3G6AB 3CC5B 1TZIB 4D8PA 2DQFA 2FB4L 2CO7B 1QYGL 2CDFA 1NCWL 1K6QL 1EJOH 3QUZD 4YUEL 5I1DB 2JCCE 4X6BB 4XH2A 4Z7UF 5AG8A 4ZOAA 4KKBD 3VFPA 1R5WA 3TIDA 5E2TH 3TWCL 1IEHA 5F44A 1AR1D 4LCWB 3SHSA 1D6VH 1E0OB 2X70B 4N5EC 2DIAA 1MI5B 1RZ8A 1UB6B 1XGTB 4JFFE 5T5NF 3WS3B 3S5LB 3BN9C 3NCYS 2OL3H 1X5YA 4C4KT 3SJVB 2B5IB 5D7SH 1KPRA 1U8MA 4K3JL 3FONB 5JXAL 4YHZL 4YGVB 1XGUB 4KUZL 4PRPE 3TYFA 5IVNA 3BZEB 1MRCL 5EU5B 4Y7MA 4LMQI 4F57L 3MJGX 3GNMH 4Z7OE 3NN8B 4RWHA 3OF6A 5LJYH 1Q9OA 4LDEB 4DN4H 2X89A 3HFML 4K7PY 4KHXH 1FGNH 5CSZA 4HLZG 5DYOB 3SDCA 2ZUUA 4M7ZB 3CH8A 1HHKA 4YBHA 3B9KD 1DANT 3TA3D 2V17H 1B0GA 1T4KA 4IDLA 4R4BA 4UTAH 5DD3L 2Q8BL 4AMKL 2NY6D 3FO1B 4M1GH 5IFHH 4P5TB 1MCDA 2AV1A 3DBXA 4KDTC 4GBXB 3REVA 3DVGA 4IRZH 3RX8A 3MA7B 4L8DB 4R96B 5C9JA 1TETH 5CP3A 1D9KC 2EYTB 1UCTA 5C0EB 1PG7L 2XN9A 3O6LH 3UDWC 1TENA 4NFDA 4QRQA 4Z9KB 4L3ED 3QPXH 1A6PA 1MFEL 5C71A 3IXTA 3LQZB 1UM4H 3PHOB 4HGWB 4RGMC 4OFIA 1EBAA 3CXDH 3S36X 4WHTA 4PJ9D 5DK3A 4ZSOB 4AQOA 4S11A 4HG4J 2NY1B 3K1KC 4OCSH 4ELKA 3MA9H 4H0IA 3DUUA 4OAWA 5IHUH 4R26L 3OXRA 2P5WA 4NWTL 3T4YB 3NCCB 2IEPA 3P4NB 4LIQE 1I9IL 1RZJH 3ARGA 2DL2A 4NN6B 2M26A 3FB5B 5DD5H 1J1OL 4EQ2A 4K7PH 5D7IB 4AIXA 1SVZA 5ISZB 5EOTA 3U6RA 4I4WA 1FZOB 4Y1AB 4JY6B 4FFYH 4K3DL 3OPZH 4QRRD 4OTXL 4NO2A 1N7ML 4DUWA 2CDGA 5I6XB 4M5YH 3RDTA 3LKOA 4P46A 5DZLA 1I1FA 3M8OH 4GG8A 3KJ4B 2BVQA 5CBEB 4IMLA 5I0ZA 3CPLB 2BVYA 3GSRA 4HKBA 4GSDL 1HWHB 4NN5C 1UWXH 3GSWB 4S0TD 4AG4H 1T1WA 2XIDA 4KJPC 4UIKH 5HHQB 3DXAA 1QA9B 3RTQD 4ORGA 4ONFH 1CICC 1H3UA 2B5IC 4KXZI 1SMAA 3BAEL 5CGYC 5IF0B 5JTWA 5CSBA 3DETD 5HI4C 4A6YH 3C5ZD 3GEWB 2XXMB 2EE6A 4P2QE 5FM5O 2HT4C 4A6YB 4JREB 3DMMD 5GSVB 3WFEL 4F7TA 2BJMH 5DD0H 4X98B 4M7ZC 4X6DF 1XGQA 5CWSA 3PV6A 5H37G 4LFHG 2I26N 4JFZL 3IDGB 2GY7B 4WTZG 4XCNA 3GO1H 4M1DL 3V0WL 4OD3L 5EC1A 1MCPL 4J3UA 1FL5A 3B9AA 3BKJH 3QFDA 3TZVB 4OKVB 1I75A 1ZKAA 4KGJA 3O45B 3JV5A 4XAWL 5AD0B 1CFNA 4EOWL 2XACC 3LS5H 5FYJD 5C0CE 1WWBX 4UV7L 2DJUA 1SEBA 4YXHH 3ULUD 2GFBB 4MJID 1CR9L 2UWEF 3CZFB 1NGQL 4IRSB 1G7PA 5LCVH 3T0EB 1NANI 1FO0H 1K9TA 2VLKE 1I7ZA 3AY4C 4N0CD 1T5WB 1FO0B 4XPFH 4ESKA 5D71L 4J4PD 3PL6D 5FGCE 4X6EB 1P84K 5GS1C 3S4SA 1FCCA 1J10A 4ZS7L 3TH4T 4K07A 3UBXI 1A7PH 4GRLC 4JGUA 3VRLF 1PVHA 4RAUA 4PJGB 3MLZL 2H32H 2C3HA 1DQDH 3V8CA 3G6JE 1X5JA 4Z77B 5LQBL 4NN6C 1C5DB 3WL9A 3MUGB 1D5ZB 3ILPA 4M61B 3R8QA 4W4OA 1G7LB 3RVUD 3GMMB 4MWFA 2HMID 4HWBH 3D25B 3RY6C 5DXWA 1RJZB 5T5NG 4HK3J 1R3HA 4YDKL 3N06B 3RVWC 4R7DB 2QQKH 1QFUL 1OCWL 1UA6H 1YMHB 1W72A 3QA3A 4XCEB 2AW2A 2P5EB 2E5EA 4KU1A 2FZ3A 4N0RA 3KJ4C 5IQ7L 3D0LB 2EC9U 1IEAA 3FMGH 4H26A 1EO8L 4JM2B 4KVCH 4NQUA 2PKDA 3VGHA 4NNXA 3KHOA 4FZEL 1U8IB 4LSQH 2FIRT 2FJHB 5I74C 5DEFA 4PD4K 5TQ2H 4HWEL 4LPUA 1IT9L 2VLJA 4OZFH 3PWVB 3S6CA 4HT1L 1NC4A 1OGTA 2ICES 5F7KC 2OBGA 5DR5H 3MOAL 4K9EC 4KMQA 1QSFE 3CDFA 3ZKXC 4QHUA 4HKXA 5DLML 4LL9A 1UM6L 2P8PA 4U1MA 4LCWD 5IEKB 1CBVL 5EUOE 4XP6L 1HKFA 1EIBA 4GW4B 2IBZY 1PLGH 4QOKE 2DQEH 1MI5D 4K7FA 4GS7B 3WN5C 3F5WB 1CLYL 5HY9B 2VR4A 4KDWA 4LHJB 1IGCL 3WNPA 4PGEB 2D7QA 3SJVD 4HKZB 4XC3L 5IB3A 3EW3B 1I1YB 1NH6A 3G08B 1KLUA 4G7VL 5D96B 5JUEL 5E8DH 3SDAA 4L4TE 1B2WL 4APQA 2B4CL 1AH1A 1INEL 4OLVH 4TPRL 4JRXB 3CFIC 3MRMA 3R0NA 3V0AC 3TIEB 1NCDH 1HQRB 1H3XA 3SOBH 1QFWL 5JR1L 2ID5A 4H8WH 4PRIE 4Z7WB 5JW4N 4Y2DD 1CLZH 1IILE 4PGBB 4NQEB 4XNXL 1HEZA 5MEOB 3FJTA 5DMJB 2IPKB 4YE4L 4KK5D 1XH3A 3CLEL 3MREA 4JN1H 4P5TD 4AJ0A 4GBXD 4LGSB 4Y5XB 5F1NA 2XA8H 5H8DA 3LN4B 2VXVL 3U36A 1MFCH 5IFJA 2IFFL 1RU9H 1KCRL 3BZFB 3O3AA 4DAGL 3T3ME 4JM4L 5HDBF 3IB4A 1AGBB 1E4KA 4U6VH 5KTEH 4M6OH 4PB9H 2YRLA 1R5IA 2DDQH 1UEYA 2YC1B 3O6KH 4QEGA 1UJ3B 1FNEB 3ORJA 4JR9L 2ESVA 2BFVL 1QLEL 1C7TA 4Z76A 3JTSA 2GSIA 2DLHA 2R1YA 4OFPA 2FX9L 3FQWA 5FM5M 2NY1D 4F33B 4X5WA 4YK4B 1YEJH 3QQ4B 2OMBA 5K9KA 5J57B 2B0SH 3MXWH 1IGML 4QRPE 1P2CA 2ZPKL 5ENWA 2QSCH 3VXPB 5IB2B 3HC4L 1G6RA 3K81A 2VZSA 2R29L 1CGSH 2A9ML 4R90H 4CL7A 4JZNB 5F9OH 2F8VA 1LQSR 5IG7A 3X13B 1IC4H 1IBGL 5IVXA 3RZCC 1D5MB 1A1NA 3MLYH 2I9TA 3PWUA 4GG6A 1OSPH 5ISZD 4GMTH 5C9KA 2X4SA 4NKDB 4ODTH 4Y1AD 1PZUB 5JIKA 3BXNA 4NHCL 3MLXH 1LO0H 1RFDH 3RDTC 4PJCE 2EKSB 4G5ZL 4XZUB 2IAMC 1A9EA 3WSQH 3CD4A 1JGDA 3IFOB 2V7HB 4FFWC 1DBKH 1HH6B 4LLWB 4FQHA 3SBWC 5ESAA 2SEBB 5DJ2A 3H7BA 2Q8AH 5CD3B 3C5JA 3DTXA 3TCLA 3BDYL 1R3LA 3E6FB 4UINL 1F45A 3NCJH 3NFSL 1U8PA 4JQIL 1F8TL 3WNNA 4LLUA 3OXSB 3FT4B 1MJUH 3VRJA 5D8JL 4GW5A 2ZUYA 2YD4A 3DGGB 4TSAH 2DWEA 4MJ6B 4YZFF 1UFUA 3DUSA 3QUMH 3V5HB 5ACZA 2DD8H 5B38A 3VXUB 1UJTA 1WFTA 3SN6N 2HRLA 3P4MA 5EC2B 2I9LA 4Z0BH 4TVPH 1W2KT 6FABL 3O9WA 2BHUA 1NC2A 3S3SA 3LN5A 3TZVD 5JLZA 4FQJH 3LIZL 1F4XH 3EDDA 5DVMA 5T33L 1ES0A 2D4DA 2RQ8A 4QWWC 4XHJD 3SGJC 3B2UD 4EN3C 4NRYA 1KPVB 2X1WL 3OAUH 1NAMA 5MENA 3L3KB 5AYUL 5I66A 1U36A 25C8L 1KV3A 1RUAL 1XGRB 1CFVL 4C83A 3V9FA 1JWSA 3EJYD 4IRSD 5DJYA 2ZCKH 4U0RB 3T0ED 2XTJB 3VMPA 3BPNC 4P9MH 3P9MB 4J1UB 1ZSDB 2CRZA 1NCBH 4YC2B 3MV8A 3O3BB 1RIUH 3U7WL 1GC1L 1WIOA 5DA4A 5J11B 4FNLL 3KS0H 1ZOXA 1S78D 2PR4L 2XA3A 4ZUUA 2F53E 2BVOB 2MHAB 3CFEA 3QCVL 3OHXA 3MBEA 1BFTA 3BSZL 1HOCB 4K23H 1TNNA 3WXWL 1NANH 1FSKC 1LK2B 2HG5B 3OKNB 4ZFZB 2O5XH 3SGDI 5KN5B 4Z8FH 3M1BA 2D0GA 1AHWB 3FZUC 5C08B 2CPCA 4JO2L 5C0RL 1XF2A 3WFCH 4NKOB 1DVFA 2CK0H 3CVHL 1KTDA 4PJAE 4OJFL 2P5ED 4X6DE 3TFKC 3TNNB 3UBXB 1H15B 1LEGA 1L0XA 1LDPL 1OARL 1C5BH 4JM2D 2P24B 5C6TH 3PHQA 3ZL4H 3KR3H 1JPFA 5HHNA 1KYOJ 3V7AE 2MPAH 5D9SB 2XPGA 3GJFA 3DV6B 3ALXA 4JANB 3MCLL 4JQXA 4UDTA 1KPUB 1P4LA 2NPLX 4ZS6D 1Y6KR 4LSUH 2H1PL 4BZ1H 2K3TA 4LBEA 2EDBA 4OGAD 1QFWM 4JVWA 2OTWB 3IU3B 1BFOA 2X41A 1UXWB 4MD5B 2KKQA 2YMXL 1Y6NR 2X9XA 1NLBL 3MV11 1TQCB 1EEZB 5T1LD 1QRNA 4N90E 3KYOA 5IQ9A 4P5KA 5HDLA 5TE6L 4X4YA 1JZ4A 3TT1H 3RJQB 1CI5A 1QKZL 3THML 2GJ6B 1NGXA 4S0SD 4QHNA 4HS8L 4X7TB 5SV3A 2Z93B 3IAQA 3LKQA 2MQ3A 2E9WA 4Q9CA 2DQCL 4XXDA 2XKNA 3VFOB 3U2SB 4NSKB 2V5YA 2EIBA 2ARWA 2XKSA 5FHAL 5BZWA 3SDAC 4Z78A 3IDNB 2VE6B 3HNVH 5DI8B 2D7TH 2CIKA 4CADA 3P9LB 1P4BH 2ZCLL 5J9PA 3UROR 1R0AH 2P4AB 3VI4F 1NAKL 4JRXD 4WFHE 4M1CD 3OSKA 1JWUA 1QBML 1KN4L 5SWZE 1VACB 2Y6SC 2FHBA 4U31A 3V5DA 2NY3C 1TZGH 2WP3O 3BUYA 4NQED 2XTJC 5CS7A 4FQ2L 2LVCA 1LO3H 2H26A 4YC2C 2KH2B 4HH8A 3T8XB 3T1FA 5I16A 4JPVH 4LKCA 3CDGB 1X5ZA 1BFSA 2KZ1B 1KSRA 5L6YL 5GRVK 2DQJL 1QQDA 5IR1B 1ORQB 4FP8H 3D18A 3MRHB 3HNSL 2YUVA 2LU3A 1BQUA 3RKDC 4CU7A 3HB3C 2XTLA 2Y36L 5GHWL 4YHPA 1NFDB 2AK4E 1OAKL 2FR4B 1DDHB 2IADA 3QUZA 3HNTL 3C87A 3MV9E 5D7JB 4Y4FB 4HC1A 3IETA 3N1MC 2WAHA 3KXFB 5KANG 4PBXA 4QKXB 4XXCC 3LHPL 3T4AB 4G6MH 3GSNH 4P99A 4U49A 5LAXB 3BIKB 2OJZH 2J2ZA 5GRXG 2Y23A 1QUNA 5ELIA 4HUXA 1BQHB 1DBBH 4P9HL 5JHDE 1U92B 4MA3A 3TN0A 1AGDA 1RZFH 4P23B 3QEUB 1BJ8A 2UZYB 2VH5L 2NTFA 3EYQD 1NDGA 3MLTB 3MRFB 4W68A 2VZ1A 5DEZA 1RVFL 4UT6H 1IQDA 3U0TB 3QAZB 2J8OA 2YD8A 4RFNB 4F9PA 2F5AL 4PRHB 1FYTB 4PJBA 5I17A 5T3XE 2R0WH 2EH7H 4XCFH 1WEJH 2DQIH 1AGFA 4X7EC 2PTTA 4MGXA 2FATH 3WCYA 5FUOH 5GJTL 1TQCC 5EN2A 3UYPA 5IKCA 4U6TA 3E1F1 1G0XA 4WW1A 4MNGB 2P8MB 3HRPA 4PJ8B 4O2CB 5DC9B 2NXYB 4GRWB 2E7HA 2GK0A 1BJ1J 4KWUA 4WV1C 4KUCF 3GM8A 3VFGL 4POYA 1LEIA 4XNUL 5FGBA 3TC9A 1FE8H 3ARBB 2WWKT 4ENED 4YQXL 4U05A 4NUJA 5D5MB 1P7KA 5F1IA 4NCDA 2J1KA 4OCRH 1YNKL 4L3EA 1C12A 3K7UA 4YDIL 4YFDB 5A3ID 1F58H 1BZ7B 4JKWA 3RGHA 2FYYA 1CF8L 1KXVC 1S9VA 3VXUD 1RJLA 2AJXL 4IJ3C 4JFQA 4TNVK 5IMOA 4BFIA 1KTKE 5IESL 4TVPD 5B39G 1M71A 2AJ3B 2X4OB 1EH9A 1JJUA 4S1SH 2FSEA 3MO1B 4RWYH 3GSQA 1Y6MR 4R7NB 1RHHB 3H42H 2F54B 2KZWA 4J3TA 1PAMA 4OF8A 4M6AA 1CGUA 2X4QA 4WGVB 4PJHB 2OYPA 3UTOA 2WANA 3TBTA 2D9QB 3W39A 3G04B 3UPAA 3EJZC 4MHHG 4DWHA 4KTEL 4QRRA 4FQCH 5JO5B 3IU4L 3IFNH 1NSNH 3AVEA 3RWDA 4W6XB 5C0IB 3AMLA 4LLVB 1CFBA 4I2XE 3VFRA 2CKBA 2AXFB 1FBIH 1S7UA 3CLFH 2W9DH 3VXRE 4HCRL 4QT5A 2A6DB 3ARQA 4PJDA 1E4XI 4AEEA 4PP1C 2WWMD 2Z91A 4I48A 3BPCB 2PXYB 1E6OL 5AAWA 1YZZA 4KJWD 2JB6A 4YWGH 3TESA 2DQTH 3P0YL 3TGXA 4X6FB 3HAEA 5C08D 5J12C 3C5ZA 3BZ4A 4BSWA 1DVFC 1NGWB 5DD1H 3VGGA 4OM1L 4P49A 4EI6A 2YBRA 2GSGB 4RA0C 1KJ2L 5K9OB 1FZMB 2FX8H 3MCKB 2FIKA 1N6QL 3BHBA 3QDGB 4NC2B 1FIEA 3I6LE 3I2CH 3CXHK 3SGDH 5IB4A 1L6XA 2PTVA 2A83A 5KVFL 3OKOB 4LCIH 5E1AA 1FAIL 4FXKB 4OGXH 5C6PB 4GKNB 1IC5L 4J8RA 3HZMB 5D2NE 4DGIH 1CLOH 4Y88A 4M7LH 4MJIA 4Z5RA 4X0KB 3OWEA 5E2JA 4I3RH 3HMXL 3Q48A 3Q1SH 3S34H 4MXVF 1CFSA 1F4WL 3T2NH 4J4PA 4HK3N 3IXAA 3PL6A 2GJ6D 1DZBA 1MHCA 5F1OB 3GJEB 3ROLA 2B2XH 2QTEA 2GAZB 2Y06H 4X4XA 3VXMB 1CGTA 5TQ0H 2W1NA 4L1DA 4U3CA 5GGSY 2L0DA 1AGEB 3L6FB 2VR5A 4XNQB 3WIHL 3MRRA 5F7MC 4X7SL 4FQ1H 1G6VK 4JPIB 3D48R 2PNDA 3V4VL 1Y0LB 2L7JA 1DEEB 5CJBA 1A7RL 4HIEA 1LE5B 2JE8A 1MUJA 1KJMB 4U7KA 4FXGB 5IHZA 3ARPA 5ERWA 4P2RE 3PDGA 2BSSB 3EFFB 4HFWB 4I0PC 4LP5A 2Y9RT 2WQ8A 3DO7A 1A6WL 2X4PB 3MGOB 4ZDHB 4DKEH 1M05B 4XWGL 5GSRB 3CJJA 4WEBL 4Y8AA 4RBPH 4WI7A 1NCTA 3CC5A 1HI6A 2NR6C 1AIFB 4PLJD 1UB5A 5EUKA 1XF5A 2PXYC 4XVSH 4O9HH 4YPJA 4S1QH 5I30H 5GZOC 1A1OB 4QXWA 4X6BA 1SEQH 1PX3A 2GJJA 4NNYA 5D7JD 5ALCL 4Y4FD 4ZQKA 1KB5B 3LDBB 3VG0L 5EO0B 3X3FL 1P84J 4JN2B 5F9JB 1SMOA 4HFUL 3FQUA 1S9XB 3FRPA 1GZPB 3CX5K 5JA9A 2X70A 1GRWA 3UTPD 1S8DB 4XMLH 4S1DD 1NPUA 1XGTA 1MVUA 3S5LA 2V2WA 5EFIB 5F89B 2P1YA 1B0RB 4FFVD 3TN0C 4KI5E 2AEWA 3MLUH 2X1QA 4HF5H 2YUZA 4P23D 3KPNB 5JXEA 4WFFE 2OL3A 5J1AB 3RWEA 2VXSH 2F74B 3C6SA 2IJ0C 4YGVA 5FYKH 3SPVB 4GLRH 3RL2B 4RZCA 5DK2B 4S2SA 1JHLH 1H0DB 3HG1B 4HZLB 4OFDA 4WW2F 3U30B 2FD6H 3SEPA 4F9PC 4PLOB 4PRHD 5A2IH 2BVPA 1IARB 1FYTD 5BOZG 2Q1EA 2GIYA 2GUOA 4Q7DA 4U1JB 1YPZA 4Y2DA 3MXVH 5EZJB 2B1AL 2GY5A 1P4IL 2JIXA 3SDXF 1Q9WB 3EDFA 1KT2A 1N8ZB 4PJ8D 4GBXA 3MRCA 2YPVH 3K4AA 2NXYD 1R3KB 5L9DH 2QQLL 3MA7A 4PLNC 4DCQB 4Y19A 3SY0B 1A6VL 1G7HA 3BEWB 4NWUH 4MNHB 2EYTA 5CGTA 1K3ZA 1U95B 2N56A 3ARBD 4HXBH 3K8KA 3TJEH 1HH9A 3L3IA 3QNZA 5FDWB 4PJEB 3C60A 3HC3H 3O81A 3W2DH 1IFHH 2GHWB 1DQQB 1BX2A 5DQDL 3CMOL 5EBWA 1CDGA 1KELL 3B2VH 4PB0L 3RWGA 1LEKB 3PHOA 1UWEL 2R1WA 4HGWA 3KPTA 4F2MA 4G7YL 1IAMA 3HUJB 4X9GA 1L7TH 3HR5B 3KYKL 2IANE 1HHGB 5KVGL 3FB6A 2R39A 3KPOB 5FOBB 3BKYL 5DWUL 2HWZL 2NX5B 2H2SC 5DUPL 2BZDA 3N1GC 3UTQB 2CH8A 3FB5A 5EH1A 3D39A 4L4VA 2OP4H 2IWGA 3F12B 3LOWA 4C4KO 5EU7C 2VSCA 3ARDB 1PKQB 3VWJB 1MFBL 2GTZA 3KWWA 4ZOEA 3QRFM 4Y1AA 4JY6A 2AJSL 1RUPH 5FA3A 4BKLB 2F5BL 3SDDB 1CZ8H 1Q9KA 5BVJB 5SX4I 2HKFL 1G7MA 4XMKH 1DQML 3MUJA 4HMCA 5INCA 4WTWA 5T3ZL 4MYWB 2FBOJ 3CPLA 3UJTH 1BWMA 2RFXB 4HDIB 5IT2H 5HHQA 5EU3B 4X6CB 3QPQC 4XWOC 4LQFL 4WU7B 4QRTA 4OBSA 3QQ3B 4ZUWB 3B6SA 4U33A 3WFDL 2DJSA 3S8WA 4NQDB 1G7IB 1DLHA 5C7XH 1I7TA 3DX6B 1J7VR 1WGOA 3INUL 5J1SC 4A6YA 4JPWL 2FEDD 1QBLH 1LILA 4AEHH 5GRJH 3O11A 4JFEA 1HDMB 2AJUH 1ZT7A 2XZQH 1ZLSH 3CSYB 3VFWA 3DLQR 1U8JB 5E94A 5I15H 2EYRB 3QDGD 4M5ZL 2DRUA 2XOTA 5MERB 3UC0L 1VERA 1S7QB 4QRSA 2BXYA 2HT2D 4WFEE 3SQBA 1MCSA 3TO2A 3FFDB 1WZMA 1I8IB 4JFOA 5AD0A 4K9EL 1V7MH 3EOAA 5F7LB 3QI9D 5E5MB 1A7NL 5D7LE 1UZ6E 2GFBA 2YD6A 3O4LE 4OSUH 4QTHB 3CZFA 2A0LC 2Q3AA 3LH2H 3ZHDA 1CWVA 3T0EA 1AXTL 4P57A 1FO0A 2HJFB 2BVEA 1AFVL 4PY7B 2R0KH 3ZHLA 3ULVH 2HJLA 5I1GL 2I07A 3UZVB 4HJJL 5CZXC 3VXMD 2DTSA 2ZKHH 1F42A 4OZHA 5IMKA 5HGGS 3SE9L 4H1LG 3TBYB 5D1ZB 3RVXD 2MQCA 1IGTA 5GGVH 3R4DA 2V9QA 2WK2A 5FYLD 1GPOL 2H32A 3V4PL 2AS5M 3QNXA 1K2DA 4PYHA 1NBYB 3GGWB 1XR8A 4XPAL 3GMMA 4KGLA 4NKQB 4XPHL 1U8LA 4PS4H 4HWBA 1RJZA 3EO9H 8FABB 5DMGD 2ATPA 5D72H 3PGFL 1MPAH 4UAOC 4XAKE 4R7DA 4OF3A 4J12A 2P45B 2E7LA 3GMLB 1B3JA 4MAUL 4XCEA 3IVKB 2HA1A 2P8LB 3IF1B 2HH0L 1JZ3A 1OAZH 3MLSH 1F4YH 1KCKA 5GISL 3D6GA 3DRQB 3R0MA 1NMAH 2P7TB 3STLB 4GJTB 1U91A 4QHMB 1IAKB 5J3HC 2JB5L 3RAJH 2FO4A 2IQAA 3OR7A 3VXQB 2NW3A 5KSUB 1MCLA 1DSFL 2BVUA 1GGBL 3D3VA 4HIIA 4OZFA 4WEMB 5LGHL 4NCC2 5TPWL 1KTLA 5I1CH 4C56A 1Q1JH 1AJ7H 1TFHA 1RUQH 3MRLB 3RY4A 5FO9B 3MLRL 5I0DA 3PWPB 3QDJE 3AB0C 5AZ2L 5TFSH 2R9HC 5IEKA 3OKDB 1A3QA 5ALBH 4L5FL 4ETQA 4AIZB 1R3JB 4DN3L 1Q9LB 1BECA 2VDPH 3PWNB 4RX4A 5HY9A 5T1LA 1VFBA 5EPMB 5E6IA 3WYRA 1JPGA 3NCFB 3DVFA 3N1FC 4XWOD 3GBMH 4HKZA 5IOPB 5JXEC 1I1YA 1ZGLM 1GIGL 1YY8A 3G08A 2AXGB 1LD9B 2IPUG 1MCEA 4XPGH 4JO1L 4OGYL 5FYKD 1FNGA 3HG1D 5BO1H 3MLWL 1BIHA 4Q2ZB 4TN9A 4MVBC 1FVCA 5TF1L 5K9JH 4JO4H 4OZIB 1ZHLB 5B3JE 3UAJD 1K5NA 2XWJB 2NZIA 3GRWH 3KPSA 5D2LE 4U3HA 1BGXL 3MRJA 4XNYL 3BMVA 5MEOA 3X14B 2KBGA 1MFDL 1BBJB 2IPKA 1YEHH 3ROOB 4ELME 3UPRA 1ZHKB 43C9A 5BVPH 3DGCR 1JPTL 3VG9C 4MNQA 5GRWA 5C0AE 4NOBA 3CU1A 4Z0XA 4M6NL 5AAMA 1X9QA 5M95B 1MJ8L 4MQSB 1P7QB 3PWJA 2NZ9C 4ZXBB 5EULV 4G9FB 4FQXA 4PJXB 4XC1H 1T04A 3C60C 4TOYL 3MJ8A 3BQUB 4P4KB 1UT9A 4FQPA 1J1XL 4Q0XH 1WTGT 5E2UL 1FNEA 4XB8A 4D0CA 4TQEL 4KTDH 4DW2H 3KPPA 3OKLA 4HHAB 4TRPH 4CKVX 2FCBA 1BAFL 2DQHH 3VXSA 5DVNA 4XBEL 1VFAB 3O2WH 3O41B 3TV3L 3B5GA 5I1LA 4BK4A 2IMNA 4RGND 1BF2A 1T7XA 2V2TB 5IB2A 4HUVB 2NX5D 4E41E 1CFQA 3I75A 3FN3A 2FECI 4WCYL 4YX2L 1NEZG 4JZNA 1D5MA 5J8OA 3ARDD 3S37X 3VWJD 2Y5TB 3GZKA 3CDYA 4B5EA 3EOTH 4OLZL 5FV1L 4KAQL 3SDDD 1CXLA 5HGDA 2R1XB 2WUBH 1OWWA 4OZGA 1ZEAL 2C3VA 1CFTB 3IFOA 4C54A 3RQ3A 1MCWM 2IH3B 4UDUA 2UY7A 4MB3A 3SDXE 2V7HA 1S7WA 2J6EL 3HE7B 5I76A 1TTGA 3OBAA 3OB0H 3SE3A 5CD3A 5SWQB 4CDHA 3GI9H 4Y4HB 4P3CH 4EIGB 3WO3B 3MRQA 3TPUB 3ARVA 5F96L 3STBA 3MLPA 2YZ1A 1QVOB 1BM3L 4YHLH 3V8OA 1S9YA 5C86A 4NQDD 4PUBL 2EDWA 3OXSA 3DURA 2MSPA 4HJ0D 3EO0B 1WFNA 1MJJB 4AT6B 4KKCD 3AU1B 2P44B 4MAYC 1DBJH 4LEOB 3HRZA 2IALB 3QUMA 1J0IA 2AEPL 3VXUA 4NQVB 4MDJB 1TVHB 5K59F 4L8CB 5GQBA 1JGEB 3HZKA 1JF1B 4WJ5A 4I77L 2KQMA 2VKXA 1S7VB 1C5CL 2EH8H 3QO1B 1PYWB 4N1EA 1EHNA 4MJ5B 4RMUA 1BP3B 1W0WB 1QOKA 2OK0L 4UTBL 1KPVA 4ZUTB 2JCCB 2J4WH 1BOGB 3LPGA 5I8KH 1GXEA 1UQSA 5KVMC 3I9GL 2VAAB 4DQOL 4NN7B 1I7UB 3NFNA 4WUUE 4PJIA 3WJJC 5DD6B 1ZTXH 3SE8L 4Q9QL 3BGAA 1FJ1B 3P9MA 1ZSDA 4G6FB 4G8FA 2ZG3A 3TVMB 2YK1H 4L9DA 3O3BA 4JFFB 1KC5H 4U6HB 3ULVD 1X6LA 2AQ1A 4PGDB 1A1MB 2BVOA 2AJVL 5D1ZD 1E6JH 4I18B 5BMFH 3QG7H 4NKIH 1DQTA 5HGHA 3WHE1 1N59B 1G9MH 4C57C 4KTYA 1MVFA 3M07A 4PRPB 1G7JA 3KYMB 1ITBB 2VERN 1HOCA 4CMMB 5DQ9B 2HG5A 3OKNA 1DUZB 2I60H 4ZFZA 3SO3B 5T3ZE 4GAJH 3TP4A 4WFGE 5E08L 1O0VA 5GGTH 3PP3K 5EU4B 1KBGL 3BYTA 3GI8H 4ODWA 3ZTNH 2HLFD 1UWGH 4F7CA 5L0QB 1JN6B 4R3SB 1LHZA 5FUCE 3V0VB 1KEMH 1MNUL 3F6IA 3NTCH 2VWEC 3TNNA 3GK8H 4C55A 2YS4A 1H15A 4X5XB 1FFOB 3I6KB 5F3HB 2CMRL 1L7IL 1IAIL 1U8KB 4JGMA 2VDNH 3IDXL 1EVTC 4TULH 5C0DA 3HZYB 4PJFE 5D9SA 4Y4HC 1GZQB 2W9EH 1FG2B 4LARL 4P2CG 1GL4B 4TSCH 1IAOA 4JANA 4DVBA 1NMBH 1AKJD 1IGYA 3WJLA 5IFAH 4ALAL 2B1HL 2CXGA 1I7RB 4JFDA 4MXQD 1J9CT 1F3JB 1G1YA 2OTWA 1YDPB 5DQJB 3FHQA 1DFBL 3QRGH 2WNGA 3CUPB 4XI5D 3DROB 4XNMA 3L95B 1U8QB 1CT8B 1UXWA 1WCBB 4MD5A 3QXAB 1AD0B 2HVJB 4LCUB 4KKLC 3JUZA 1YJDH 5TE7H 4KRLB 5I75B 4ZFFB 5E6IC 3CH1A 2BC4A 2GJ6A 4AH2B 1ZLUK 4IOIB 3ZO0A 2YOCA 3RWIA 1HE7A 5AZEL 4K2UL 4YFEA 1FH5H 3E6HB 2VE6A 4OLWH 2DKUA 3P9LA 1ROWA 4GQ9H 3FOLB 4QNPE 1KGCE 1KCUH 2Q20A 1ZV5A 4XTRC 5IVXF 2NLJB 3KYNA 3LRSB 4YBQD 4YFLI 1ONQA 1VACA 2CUIA 5E0QA 5JQHC 1SBBA 4ZNEA 4KI1A 4JKKA 4H8WC 1B4JH 2DLTA 4P5MA 3O3DB 2PYEB 4D3CH 1ZVYA 1A14H 2C3WA 4G6AD 2APWA 1HHJB 4LPVA 2R4SL 2OMNA 3DX9A 3QEQB 1MY5A 2PYFB 3FFCB 1AY1H 4HX1A 4O2EB 4QY8A 1P7QD 3MRHA 5C70A 4BQCA 4FZ8H 4ZXBD 4I18C 4ZPVA 5INDB 4FS0A 4FQXC 4G9FD 5L8KB 2VMFA 1AR2A 2R69H 3W11D 4CAGA 1I3RB 3IDYC 3UXFA 3NCYP 4WTZA 5BXFB 1MAMH 3BQUD 1FVEB 4P4KD 5H94A 4P2QB 1MHEB 3ZKSD 5CCKH 1JGVL 4GAYA 5HHXH 2XN9E 1FGVH 5D7JA 5DJ6A 5I8EB 4GH7B 1GVIA 5HYJA 1F11A 2A6IB 1YEKH 2J88L 5CEZH 4YHYC 1P9MC 3G5XA 1U93A 3T4AA 1AQDB 2D3VA 3S4SG 4FFZH 4JDTL 4O2FA 2EIZB 1EMTH 1FFNB 3GSNA 3BIKA 2VXQL 1NAML 1F2XK 4JG1L 1RZGB 4PJ7A 1PJ9A 2XZAH 1FRGL 4PGCA 2NW2B 5KS9F 3RVTD 3CFDB 3EYFB 1MCFA 4OCNC 3Q6FB 4P23A 5DJ0B 2P5WE 3D0VA 1A6UL 3FT3B 1ADQL 1QO3B 5I1HL 5CBAA 3MLTA 3WIFA 3RPKA 3W0WD 2A1WL 4H1LH 3ZE0F 4Z7UA 3VD9A 4LVOB 1ZLWH 3U0TA 3BH9A 5T1DL 3WXVL 1I4FB 2GITB 4DKFH 2AI0L 3OAZK 2E6JA 3ULSB 3MYJB 2ICWA 5JQ6H 4EUPB 4GMSH 1YEEL 2Y25A 4IIQC 5FGCB 5I75C 3HE7D 4LLMB 3SE3C 1NBVH 2VLRD 5FCSH 3ARFB 4O2CA 3MRPB 2XG5A 1NKOA 4Y4HD 5C0NC 1Q72H 2YRZA 1EGJH 32C2B 4B41A 5I9QB 3G6JB 1KJ3H 3ZDXE 2AQ3A 3P4OA 1J0YA 3ARBA 5C6WH 3WHXB 1ZA3B 4HXAH 5E8OB 1KFAL 3V52L 5D5MA 3DXAE 4C58B 4JO3L 3LQAC 4JFHD 1MCOL 1WSST 3CX5J 2FHCA 1ACYL 4NZUL 3ZKMD 4YHMH 5FM4A 3ZDYE 2ZNXA 4JDZA 1WC7A 4YXKL 3RWHB 4G6JL 4LHUB 5JZ7D 1H3PL 3NAAH 1QLFA 4MX7B 3WFBL 5A43C 4QF1B 3WE6A 3AUVA 1F97A 2ZUTA 1FP5A 3EKCA 4M9OA 3U4BL 1X5AA 5CJOH 1MWAH 3QIUC 4QCIA 4RSVA 4BSVA 1MWAB 3DWTA 1CL7L 1YNTB 4RMVA 1RIVH 2D7MA 5IB5B 3U4EA 3EOBA 5JPNB 3L3JB 4RISH 3BP6A 5IK3A 4HIJB 5FCUH 2UZIL 4N8CH 3MODL 3NA9H 3NH7L 1H8SA 2X1XR 3EJJX 5EUOB 5FAAA 4ERSL 1XZ0B 1U8OA 2BSTB 4G6FD 4OLXH 3BEVB 4CU6A 3TVMD 4NZJA 5C0IA 4X80L 4JFFD 4LSPH 1OPGL 1OAYL 2AJZB 3DRTB 4P4RA 4JRWA 1UCBL 2AXFA 4NZRH 1IAIM 4R0LA 3SCMA 5IGXL 3ECBA 4R4ND 1IVLA 4POUB 5GS3A 2HFFB 3RU8L 4L9LC 2PCPA 1CGYA 5CSGA 4R4FH 1I8LA 4O02H 3D1MC 4AY0A 1GGYA 3GBNH 4L8SA 4F3FA 3ZYJA 1PSKH 5DMKB 3V6FB 2DIJA 1NMCB 2WINB 2K7QA 4FMKA 1Q0XH 1KN2L 2WWKO 4PRIB 5L7XH 4X6FA 5I8OL 3IFLH 4LVOC 4JZJA 1A4KB 1IL1B 4D9QD 2AK1H 5DZOA 2GSGA 3MRNB 1MCQA 2IGFH 3S98A 2NY7L 3KLSA 4JB9H 2VN4A 4MCZB 5K9OA 1FZMA 5K59E 2CLVB 1CXFA 2LTQB 1WT5A 2HRPL 1DJSA 4ZFGH 3L3OA 4RGOL 5JOFB 4UQ2A 3DVIA 2YUWA 4LNRA 4YAQA 2OR9H 4JEGB 1OTSC 3OKOA 4IS6B 2WBWB 4B0MM 4AEIH 3UTSA 4BZ2H 4HC1L 4ZAKB 3PNWA 1CN4A 1AI1L 3RVVC 1MRFH 3VCLA 3UO1H 4GKNA 3B83A 3C2AH 3QI9A 3V6BR 1FIGL 5EWIL 2ZUXA 3BPLB 2XY1A 2BNRB 2VLJE 4KQ3L 4BFEA 3GHEH 1F90H 3SKJL 4BZYA 2OQJB 3IRZA 1ZLVH 4YXLL 4YUEH 4QRPB 4AM0A 1BZ9B 3P11L 1GAFL 1NGZB 3P30L 5IROA 3VXMA 4BQ9A 3W9DA 1OGAB 5FV2A 4KV5E 3L6FA 5FO7B 3AS0A 1YNLL 1A3RH 1MIML 1QFWI 2BRRL 3C8DA 1C7SA 1YEIL 4PJCB 2M8XA 1LE5A 1U3ZA 1KJMA 2UWEA 2PYED 2VB5A 4PTTB 4RNRA 4FXGA 5JXAH 1KG0B 5FXCH 3UJIL 3FO2A 1C08B 3KGRA 4IEFB 4F57H 2AV7B 2DL9A 2Y72A 4RA3A 3F7PC 2H2PC 2PN5A 4DEPB 3U0WL 3QEQD 2BNQD 3FFCD 2X4PA 1T0PB 4NOFA 4PRDA 3BP4B 5GSRA 1U0QA 2HN7B 2YKLL 1K8DA 2CUMA 3MRDA 3QDMB 2F19H 2Q8BH 1KCSL 2AXHA 2O5ZL 4YHIA 4P2QD 3EOYG 2VZVA 4WWKB 4MZ3A 3N1PC 5KJRL 4JN2A 1ND0B 5F9JA 1YYLL 4L3AA 5CEZD 4V1DB 4QLRA 2D03L 5I1AA 4M43L 5DURB 4O4YL 1T83A 1H3VA 2ESVE 1IE5A 3H9SB 4UILL 2DI8A 1JMXA 1XT5A 1QLRB 4FMFA 5EFIA 5F89A 5GGSA 4PRNA 3C8HA 4RMTA 3E8UL 2B20A 3FB8B 4YHOL 3VRIB 5GPRA 4LEXH 1FN4B 3HPJA 3MZTA 2F74A 3SPVA 4ZAKC 5DK2A 5D1QB 4L3CB 4NHUB 4R26H 2BOBB 2GKIA 5HHOD 5IVXE 2J5LB 4JHWL 5JOPD 4YPGB 4GG6E 3DHMA 1YEGL 2OZ4H 4U1JA 5E4EB 1XIWA 3NZ8A 2DI9A 2F53B 2MCPL 1U8NA 1Q9WA 1N8ZA 3ARFD 4K3DH 2E6PA 4OTXH 4DVRL 4LSRH 1R3KA 4D0BA 5BW7C 3BH8A 4JKPL 1OOAA 1FL3B 4CN6A 4MNHA 4JE4B 4MA7H 1IRAY 5CP7A 5T1MB 4IHOB 4PJEA 4HLJA 4LOUC 1I3GL 5DHYB 1DQQA 3C5SA 4EXKA 3LCYA 4PJAB 4LHUD 3UYOD 4LSTH 1CD0A 2A73B 2J8UF 4X6DB 4MA1B 3LEYH 5J7CC 1GJIA 3ARYA 3IJYB 4OLUL 3TJHC 4MS8D 1RK1B 3S96A 3HR5A 4HBCL 5DJ8B 3KPOA 2A74B 5K9QI 3ZKNC 4F8QA 1U8HB 3WFEH 3T0DA 4ZTPL 4N8VB 1B88A 1CD1B 2ORBL 2ARJQ 1D5IL 2QQNL 4OCWL 5JIIA 3B5HA 3JTTB 5HI5D 4U3XA 4M1DH 5ANMA 1TCRA 4OD3H 3VWJA 12E8L 3TO4B 2YD3A 5E99H 2IBBA 2HT3C 3LAFA 4UT7L 1KNOA 2QLVB 5MENE 1DQLL 4G3YL 3MLVL 4QXUL 5BVJA 4XAWH 3QCTL 2C7UA 4EOWH 4IBLT 3T2QA 3ULUF 3NOIA 4UV7H 4X8JB 5DTFB 1S5IL 3HA0A 3SCMC 5D70L 3DIFB 1N0XH 1CR9H 2VQTA 3PABB 1RIHL 3MV8E 1KLGB 4Q6IC 5FKAB 1I8LC 3L5WB 4WU7A 5D71H 3QQ3A 3S36L 5SWZB 5FB8B 2MQ0A 4NQDA 5D1QC 5DFVD 4PRID 4HS3B 4LASL 1S7RA 3MRKA 2L4OA 3VMOA 4LU5L 1FYHB 3IDMA 2KDGA 2X4TB 5IW6A 1PQZA 3FO9B 3T65B 4WO4A 4H20L 1E28A 4GKSB 1T1YB 4MQTB 1T2XA 4LCYB 1F6LL 3F65A 3FO0L 5DMYA 3IS0X 4JVPA 2R2HB 3QJFB 5MERA 3H9HB 2CJUL 2DF3A 4UMGA 4RDQF 4Y8DC 1QFUH 3MNVB 2DLFH 1T22B 3VFTB 2PF6A 4HZAA 1CD9B 1I8IA 4EVNB 2DKMA 4I5BB 1NUNB 5E56A 4Q9RH 1EO8H 3MV9B 1JL8A 3GSUA 2BNRD 3I84A 5EOCH 4NCC1 1MLBB 4HWEH 4XRCA 4LVNB 1IT9H 2IFGA 4MLSA 3MMEB 1WWWX 4QRPD 2HJFA 4PY7A 2OL3L 5IJVB 4QXTA 2PW2B 1PW3A 3NPSC 4YIQA 5JHDB 3A6CH 2BNUB 1FZJA 1BFVL 1OGAD 1VSCA 5DLMH 3TBYA 1QRNE 3A67H 3GNML 5DJCB 3TBWA 1DE4B 2ED9A 4KHXL 3L3HA 1UEMA 5JPMB 3QEGL 4OZ4A 2H8PA 1FGNL 5C09A 3VFMB 3N50A 4H25A 2V17L 2EO9A 4Q74A 1UG9A 5HI3C 1WIUA 2X4NA 4G7VH 2ILLA 3HCVA 3REWA 2BVTA 3EGSB 5F7HA 3MUY1 1AC0A 3TJHD 1AP2A 1B2WH 1S5HB 3BP7B 5GZND 3GMRB 2EDOA 4IRZL 3IF1A 3FRUB 1INEH 4PV8B 1TETL 1KXTB 3DRQA 5JR1H 3O6LL 4WI5A 2P7TA 3LV3B 3MNZB 4YDLC 5DA0B 2XQBL 4HJGB 2ADJB 1QR1A 4QHMA 4XNXH 3QDMD 5KSUA 4BFGA 2Y07H 4YE4H 1EEUA 3DJ9A 5B39A 2EC9T 4WWKD 1LGVA 1AKJA 2WBJB 3CXDL 3HS0B 4LCCB 4ODUB 2VXVH 4NJ9H 1J5OH 3QO0B 2IFFH 4NC1C 1TJGH 2EDRA 4V1DD 4UUJA 5DURD 4IOFC 1T83C 1TPXB 3MV7B 1R3JA 3S3JA 4NM8L 5T5FL 1Q9LA 3H9SD 1RZJL 3DX8A 3PWNA 2BOCA 5DD5L 4JR9H 2BFVH 1QLEH 2I24N 4P2OA 2G2RB 3VXOB 5CKGA 2Y7QA 4U6YA 3CFJB 3OPZL 3F7QA 4Q2ZA 4M5YL 1EAPA 3NGBC 4KK9C 4OZIA 5MI0C 1ZHLA 1VGKB 4HPYL 2XWJA 5D7IF 1SYVA 1EEYB 3GRWA 4I2XB 3ZE1F 1TMCB 1XIWC 3BT2L 1TVBB 4UIKL 3X14A 1BBJA 2APTA 2F53D 5F88B 2VDRH 4ONFL 3SKMA 1X5XA 3MV01 3VXRB 1TITA 2DJ4A 4PJBE 1A0QL 1ZHKA 4ODXB 1T03H 1V3LA 3WNOA 2YPKA 4NRXB 1W0VA 5E6YA 3VD4A 4PJ5A 3Q0HA 1D6EB 5D7KD 2YN5A 1WBZB 1H8OA 2OR8A 3I50L 4FQQA 4NT6B 5JA8B 1HHIA 2R23B 5B8CA 4OV5A 2X9WA 1N4XL 3BQUA 2BJML 4P4KA 3OX8B 5DD0L 3CX2A 2UUDK 3QSKB 5ETUA 1IM9A 4ZO8A 3CDCA 5IV2B 2ADIA 1GHFH 4DK6A 3GO1L 4L3EE 4G9DB 3UZEA 1F8TH 5IJKC 3BKJL 3OR6A 4GT7A 1MREL 3RNQB 4EI5D 3O41A 5HDQL 4F37K 2L7UA 3H3PL 5L8LB 1FORH 2EDEA 3LS5L 4P59L 3OKEB 4HUVA 2CDEA 3QUXB 1KIQB 2Y5TA 3TO4D 4YLQT 5MEPB 3RIFK 3LIZH 4KKAD 4XPFL 1UYWH 3W0WA 1G84A 1MLCB 3HI1A 3OJDB 5T33H 4MD0B 3ZTJG 2OSLA 4RDQG 5GS0C 5AYUH 1CFTA 2JJUA 1CVRA 1TPXC 1JBJA 1RUAH 1CFVH 4OM0H 1OT1A 2Z31B 2IH3A 4NIKB 2BCKB 1A02N 1VADA 3BN3B 2ZSVB 2VLRA 2P43B 1I8MA 2NY2C 1T0NB 2G60H 4GXUM 3QH3B 1JZ5A 3O4OB 1F5WA 1UADC 4L4JA 4WFHD 1KIRA 4U1SA 4UBDC 1QVOA 2ATKB 5SWZD 4PJDE 3U7WH 2BERA 3BIBX 4CN4A 4CJ1A 4FNLH 1JHKL 1KOAA 2PR4H 4PJGF 4TTDC 1Z6JT 1QNZH 2APFA 2DQGL 3EO0A 4HIHB 4AT6A 1WJ3A 3DI3B 3QCVH 1FG9C 4AENB 1MQKL 1K4DB 4WO4C 3SDYH 3FMGL 4QHKJ 2IALA 3WUWB 1DBAL 3CZJA 4NQVA 3WXWH 4MDJA 4WVRA 3WS6A 1XF4B 4J3OC 3S5LG 4OCYL 1U9KA 1JGEA 1ZT4B 1IZKA 1RJCA 3P40A 5TQ2L 5GIRA 1H5BA 3GJFK 1IKNA 3VD5A 4BELD 4OJFH 4JM2F 3CVHB 3VGFA 1YN6A 4ZUTA 5DHVH 1LDPH 4GKOA 2FL5A 3F7YA 2O5YH 3MV9D 1BOGA 4PIRF 2NY0C 5J6HB 3O6FC 4Y16A 2QR0B 3QQ9D 4LPXA 4XT1C 1PLGL 4N5UA 1FNLA 1QSEA 1YQVL 2R4RL 3BGFC 4XB7A 2DN7A 1IJ9A 5D6DC 2WP3T 3MCLH 1T66C 4KRPC 3TVMA 1TQBC 4YDJB 3ULUE 2EXYD 2H1PH 2RB8A 3B9EA 3MYZA 4PTUA 4MJIE 3UX9B 1OB1B 2QHLA 1N5AB 1WUNT 5HYQB 1RQ5A 5JHDD 2DM3A 5E8DL 1U3JA 1WISA 2XWBA 1KEGL 1WTLA 4OLVL 4U0QB 3KYMA 1XGPB 3ZDZF 1NCDL 4ONHB 4CMMA 5DQ9A 5TE6H 2EKJA 4H8WL 1FNHA 1QKZH 2N7BA 3THMH 4HS8H 1CLZL 5D2NC 4RIRA 2DYPB 4OQ1A 1JGLL 3RJDA 4LSSH 1QBAA 4U6XB 5GGTA 5DDHB 2MFNA 4EBQH 2Y4SA 4XP1L 1EA9C 5IBLC 1VHPA 1NAKH 4K3EL 5ICYB 1U58A 1RUML 4Z7WF 1QBMH 2Z31C 1KN4H 4Q58C 5SWSA 5TH2B 3IKCB 2EDDA 1N2RB 5H35B 2C4XA 4NO3B 1U8KA 5EIIB 4PB9L 1I1CA 1RJYB 1GZQA 1OSZB 1FG2A 2PO6B 2DDQL 1CE1L 4OUOA 1CLCA 4XCCH 4NZTL 3F62A 1I1RA 5IIEB 2WBJD 5L6YH 1CIDA 3MJ7A 2DQJH 4XBGB 1YEJL 1F3JA 3QIBB 2BRQA 4X9IA 5DQJA 2B0SL 1DN0A 3CSPA 3CUPA 3DROA 2Y36H 1U8QA 3L95A 3MXWL 1CT8A 2D2OA 4QHKI 5CMAA 2W59A 3QXAA 1AD0A 1EXUB 3MV7D 5ESVA 2QSCL 3C09B 1OAKH 4ETYA 5L2KA 3D5OF 4ZFFA 3DOSA 1A6AB 3RUGB 5F9OL 4GUPA 4P2OC 3VWKB 3MLYL 2QADB 1JP5A 1WZ1L 1OSPL 2VITB 4ODTL 3VE0B 2X42A 1M7DB 2VDLL 3E6HA 2EZ0C 3LHPH 1K3IA 4FTVA 3MLXL 3GFUA 3KPRA 1UH2A 2IG2H 3FOLA 4HGMA 3LKPA 3L7FB 1MELA 1R5VA 3WSQL 4PG2C 4NFCA 1YMMB 2HTLC 3F8UB 4G8EB 4GXVL 1DBKL 3O3DA 2PYEA 4R97C 5DGQA 2W60B 2VH5H 2Q8AL 1QTYT 4LIQL 3VXRD 3IJHB 4H0HB 2VDOL 3QUYB 1K4CA 3NCJL 5E8PB 2NY4B 2BNQA 3QEQA 1YPZE 3CMGA 3FFCA 3LB6D 4KI5C 1ZAGA 2HFTA 5F93C 1MJUL 3KLAB 3LQAL 3AREA 5INDA 5E9DA 4XP9L 1U3HA 4XBPA 5B8CC 1S9WB 3UCRA 3MX0A 5CUSH 4ZG1A 3QUML 2CUHA 5ID0B 2DD8L 4Y19E 5A2LH 4DZ8B 3MRIB 2E9IA 4WHDA 1O5DT 4F15B 4Z0BL 1OTTD 4XNUH 2A6IA 3M17B 1EHLH 2W0KA 1BQLH 3DSFH 4YQXH 1NFIA 4OIBA 1T0MA 1RK0A 3EBAA 3HC0B 4FQJL 1NDMB 1YNKH 3LMJL 3GM0A 3I6LD 5L2JA 4Y0GA 1A2YB 1FFNA 4XP4L 5SV4A 4JZOB 4OQTL 1MIEL 4U1NB 5FKPA 1WICA 3OAUL 1RZGA 5LBSH 1FQ9C 1FLTX 5AUMA 1BVLB 1VPOL 5ICZA 3C8KA 3QUXD 1JNNH 5DJ0A 3OQ3B 5IB1B 5DMIL 3QNYB 3MFGB 2HFEB 1T80A 3FT3A 5D7LB 3K3QA 3L9RA 3WLWC 5ITBL 3ZYZA 1NCBL 5EU6B 3ZKQD 4H1LA 1AO7B 3D39E 4L4VE 5HHOA 4L8BB 4TSBH 2R15A 3B3IA 2GITA 4LPWA 3HE6B 4E5XB 3ULSA 1A5FL 5DEGA 2R0ZH 4Y1AE 1U6AL 2HTKD 1RMFL 4LRNL 3ZLQC 5A16A 1XR9B 4LSVL 5FF6B 4K23L 3STZB 1A3LH 3VGAC 5EZIL 2E8YA 3G6JA 3IU4H 1EGJA 1FNSL 3MNWB 5CHNA 3VFUB 1Q94B 2X4UB 4OFYD 3WHXA 1ZA3A 5E8OA 2EDHA 5KG9B 3HZVB 4P3WA 1OWRM 2CK0L 4MSWB 3FKUS 4KDVA 4M6ML 2OI9C 4CMHC 1BD2A 3WDHA 4N0UB 5MEQB 3RWHA 4LHUA 3WNKA 3K8LA 4M62L 2JKXA 4JPKL 5ICXA 3FQXB 5SX5K 1H5BC 4YNYA 4XCYB 4JFEE 3VJ6B 1PZ5A 1IKNC 5LWYH 1GOFA 3GUTA 3G9VA 4LAQL 4LSUL 3L5XL 3UTTA 3RGVB 3GSVB 4BZ1L 2H9GB 3VXTB 4LQ1A 3ZE2E 4RRPG 1KJ2B 1MWAA 1N6QH 1F4HA 3VFNA 5FFLA 4Y16C 5TGBA 5IB5A 4MQXD 1Z9LA 3L3JA 2Q7YA 1JPST 3QDJB 2PW1B 5KVFH 1T7ZA 3V6OA 3TT1L 1FAIH 5HGBA 5CIPB 5B3NA 4RAVA 2VABB 2AJZA 4NM4H 3RI5K 4HW6A 4LHQB 2VSDA 2W65B 4NQCD 3T0EE 2VKWA 3HNVL 1P4BL 3PWLB 5JORB 2APXA 3OTTA 3AXLB 1G9MC 1TNMA 3VFSA 3UP1A 2HVKB 3VXNA 4NO5B 2AVGA 3FOMB 3JBG7 3PGDB 4OZHE 1QZ1A 5DMKA 5HVWA 3MOQA 3BRFA 1MH5B 2ZOKA 2DYPD 1LO3L 5CINH 4JCLA 1J11A 1LK3L 5D2LB 1Z2KA 5FYJH 4G43A 1HQ4B 1QP1A 2GTWA 3DX7A 4P48A 3HE6C 2XXCB 3MRNA 4X7SH 4XPBH 3RWCB 4FP8L 4TUKL 4JGJA 3QWOB 4ELMB 3BW9A 1YEDB 4OI8A 5C0AB 3C2SA 1A7RH 1V7NL 1X5IA 2NY5C 1TLKA 4TNWF 3RPIA 1JYVA 5JOFA 3QULA 2VWEE 3K2UH 1DQJB 2DMBA 2HJKB 2PO6D 3HI6L 5GS2D 1ED3B 3O8XA 2Q86B 3IGAB 5ILTH 3I6GA 3QJHB 1SJHA 1DLFL 3LSOB 5ESQB 1D9KB 3RL1B 1H8NA 3QIBD 1AD9B 1NFDF 3NCEB 1D5BB 4KZEL 4XWGH 3AM8A 3VH8B 3BWAA 1WAAF 2BNRA 3GSNL 1CXEA 3BRGC 4XMPH 3D3VE 1NEZA 3PIQA 1CS6A 1C16B 2OJZL 2VR9A 4TUJB 1J0ZA 4C56E 3OZ9L 5HHVH 5J89A 4K71C 1FHGA 1BZ9A 4PFEA 4RGMB 5ALCH 5KW9H 3VWKD 3ZTJH 4OI7A 2QADD 1HN1A 1UACH 3X3FH 4WI6A 2YEZB 2CLZB 2ZUVA 3EYVA 1OGAA 5GRVL 1OM3H 5IVOA 4UT6L 1X5LA 3KLHC 4JHBA 3BJLA 1YMMD 2R0WL 4XCFL 1WEJL 1TZHB 3BVNB 2AKRA 4HUNB 5DRXA 3KPMB 4UNUA 5F7DB 5FUOL 1G1CA 1KG0A 2DTML 1KJVA 3P3YA 4IM8A 3D87B 4HUMB 5DJXB 4PREB 5J56B 2AV7A 5FHBH 2N7AA 3ESVF 3QUYD 1OAXL 4Y89A 3KPSE 3NABH 2NY4D 4KHTL 1FE8L 4O58L 4CVZA 1UXSB 5ID1A 4U7SA 4GRMB 3AREC 3QHZH 4W6WB 1X4XA 5DRNA 1U3HC 4OCRL 3SQOL 4NN5B 2HN7A 1F58L 3U9UB 1F00I 4NKMB 1IGIH 2VDKL 4MXWL 3QDMA 1I8KB 4MNQE 1T1XB 4GRWF 3DVNB 1CICB 1HSBA 2HYMA 2QQLH 4WUKL 5TDOB 4LLYB 5D5MF 3EHBC 1A6VH 3FCTA 4NQXA 4IMKA 1JTPA 3VFVA 3OJMB 1X4ZA 3HHRB 4V1DA 1RULH 4RWYL 1ZGLB 2YD7A 3GB7A 3H42L 3KDMB 2OS7A 4DGYH 2J7LA 2AQ2A 4WFED 4OCXL 3LEXA 3H9SA 4Q97A 4PG9B 5D1XA 1KELH 1ORSB 3I02A 3VXSE 1UWEH 3LPWA 4HV8B 1HCVA 4HUWB 1FNAA 4G7YH 5DJDB 3CCHB 2ITCA 4ZUVA 5HD8D 1IKFH 3FN0H 4FQCL 3AC0A 5EU6D 5I18H 1QD0A 3KNBB 1NSNL 4WUUB 4YH6A 4QXGH 4D9RD 1AO7D 4OI9A 5CEXB 5DWUH 4FG6C 5TDNA 2W9LA 3HPLA 3U9PL 5DUPH 1P1ZA 4M8VA 4PJHF 1FBIL 3NFPB 3UBXG 3S35H 5GGRB 4ODSL 2OZ4A 4JFPA 1UWXK 3RHWF 1OQXA 1I9JH 1MFBH 1TJHL 1I9RH 1P53A 4OZGE 2F5BH 1JTOA 3G5ZA 2Z0BA 2D0HA 2DQTL 5GS1B 4ZOCA 1FCGA 1T21B 5T1MA 4IHOA 1NL0L 4GRLB 4RQQB 2MNUA 3QISA 4WW2C 5JW3H 1T3FA 1MJ7L 1V3MA 2XV6B 2FJFA 4KK8C 4JFXB 4XAKD 5IM7B 3E2HB 1VA9A 4KZDL 4MQ7B 1ITCA 5IBTH 1KCVH 2ZUQC 4O5LL 3HI5H 1OW0A 1PG7W 3WFDH 5CAYB 1NCAH 1EFXB 2VLLA 4LCIL 2VZOA 3INUH 4EI5A 1SQ2N 2DMKA 3VXUE 1A7QL 4JKLA 4PJFB 3MSPA 3RGVD 2H6PA 4KJYA 3ILQC 4UIMB 2Q6WB 3UJJL 3UTZB 4TVPE 2LABA 5FIEA 3MBXL 1QG3A 1CLOL 1YY9D 4N0FB 4M7LL 3IFPB 4M5ZH 5FYKU 2FEEL 4NO0A 3JTTA 5I74B 4D8PB 2R56H 1I85C 1I1AC 4H0GA 3QDJD 3S34L 1JK8B 2YXMA 3T2NL 3PXJA 4U1KA 1GOHA 4KK6C 3V6OC 4UV4L 4XH2B 2EDTA 1MOEA 2R2BB 3GIVA 1R5WB 2ENSA 4NDMA 3ZKXB 4KROC 4PJIE 1CGXA 4X8JA 2N4IA 1A7NH 4TTGA 4P3DA 4LGRB 1LMKA 4DUVA 4N5ED 2ZSWA 2QSTA 4LDLB 3WN5B 1N5YH 7FABL 1AXTH 3B4NA 1M4KA 3BN9D 2VUYA 1AFVH 4QGTA 1QFHA 5CJQH 1U8MB 4WWID 4HJJH 1S7XA 1OAUH 5DS8B 2AP2A 3LKRA 3SE9H 1JWMA 4HGKC 4R2GC 4Y4KA 3GIZL 1U3YA 5DRWA 2X4TA 3VA2C 1GPOH 1Q9OB 2F15A 4NJAH 1T1YA 4DKEL 5CSZB 4UI2A 1IAII 2V7NB 1HHKB 5C0AD 4QRUA 2OLDA 5FUZH 1YEFL 3H9ZA 1B0GB 4XPHH 1BQHG 1JGUH 1T4KB 2R2HA 3H2WA 3PGFH 1OY3B 3U82B 4D2NA 2AV1B 3QWRD 4XVSL 3O8XC 3JWDC 3REVB 4MAUH 4BH7A 1SEQL 3DVGB 4ZUSA 4EVNA 2HH0H 2V9TA 5C9JB 1MHHA 1D9KD 3JV6A 4EXPX 2XN9B 1RI8A 4ISVB 3AM8C 3K8MA 4Y5YC 5IEHA 3E2HC 2JB5H 1JTTA 5C0JA 4X4MA 4NGHH 5FUCC 4K94C 4XMLL 1MAKA 3PP4L 1NCCH 3JV4A 4JFDE 1GGBH 1NKRA 4K7PX 2P48B 1YYMH 5IJVA 5TPWH 2PW2A 4WHTB 4F8TA 4ZO6A 3R8BB 2VXSL 1XCQB 1CDJA 5MP6L 2R8SH 4MZ2A 2BNUA 3ISWA 1NFKA 5AZ2H 5DJCA 3OXRB 2P5WB 4XX1G 3MACH 2N1KA 2IPTH 2GJ6E 4N1CA 1W8NA 4DN3H 2YRPA 3BD5A 3ARGB 3NACH 3VFMA 5C07B 3MOBL 3J7HA 3RZCB 4F7EA 3EYOA 5E2WL 1MY7A 1D3CA 4YBLC 5E4IA 3U6RB 1GIGH 3JWNC 3LKNA 5F6HI 1JCKA 2F58H 3EYUH 4JO1H 1J05B 2E9BA 4OGYH 2B8OT 2YPVL 1S5HA 3X12B 3BP7A 5L9DL 2CDGB 3RDTB 5TF1H 4ZNEE 3LKOB 3FRUA 3HMWH 3G5VB 2IAMB 2YA2A 4GG8B 4UOW0 3TJEL 4DK3A 2QKIA 1DUYA 3GSRB 4HKBB 3MNZA 5LXGH 1T1WB 4KJPD 3HC3L 3NPZB 3W2DL 1IFHL 1IGJB 4ORGB 4Y5VA 1CICD 3B2VL 4LF3B 3H3KA 4QYOA 4X4ZA 5T3XL 1RZ7H 2WBJA 4LCCA 4ODUA 1Y18A 5CGYD 3MRGA 4M6NH 4Z95H 4N9GB 2FX7L 4IMKC 4PJEF 1L7TL 5HI4D 4MDIA 4ZOBA 3RBSA 1G9NH 4CVUA 1OTUC 2HT4D 1SY6H 4UT9H 4TOYH 3V6ZA 2VZ3A 3MV7A 3SDCC 4F7TB 5A2FA 5HYJE 5D1XC 1IC1A 3QFJA 1OL0A 1XGQB 4OIAA 3PV6B 5CWSB 1J1XH 5E2UH 1XF3A 2EDFA 5B4MC 3HUJF 2OTPA 3L5HA 4U7MA 4TQEH 1ZE3C 4XCNB 1X6NA 2G2RA 4LNVA 3VXOA 4X9FA 5EC1B 1BAFH 1EUTA 5I19L 3UTPE 3QFDB 5CD5C 3P0VL 4MD4A 4XBEH 5F9WC 2MKWA 4PJ7E 4E0RB 2COQA 3TV3H 4NQSB 4AL8H 1CDYA 4XMKL 5GS0L 4EN3B 2I5YL 3OKMB 3CGTA 1F3RB 2RJMA 2D7PA 5I71C 4WCYH 2QBWA 3UJTL 2OXHA 1K8IB 1TVBA 4Z7UE 4I3GA 5IT2L 2GCYA 1I7ZB 3BPNB 4P0DA 3ES6A 4HUUA 3RRQA 4ODXA 2X05A 1AGCA 5ADPH 1AXSA 4NRXA 4OKDA 2DB8A 1WBZA 4KVNL 5C7XL 4IRJA 5T3ZD 4GRLD 4RAUB 5KSVA 2FWOA 4WFGD 4X6CF 1HSAB 2J6EH 3ARGC 3SKNB 2Z4QA 3OX8A 1T5XA 1VEPA 4AYFA 1ZLSL 2XICA 3ILPB 1FSKB 5D5ME 5I15L 2NXZC 2UYLB 1Z9MA 4LRIA 1BM3H 2FGZA 1R3HB 1RZKC 5F1KC 3UYRL 3RVWD 1EFXD 4HH9B 5KSAA 2GT9A 4P46C 3QA3B 5JDSB 2FZ3B 4KRMB 2YN3A 1IEAB 5IMMB 1CL7I 5E00A 2X1OA 4KRNA 3QUXA 2ITDA 3WDIA 1JV5A 5DEFB 2G9HB 3LH2L 1OVZA 5K33A 4G8GA 5EIQA 1E27B 1RURL 2JELH 5H2BA 3QIWA 5MEPA 3EDKA 3ARXA 2W92A 2G5BB 1NC4B 5BZDA 3VDBA 4MD0A 4UTBH 5F7NC 4ZO9A 2ZKHL 4RFEB 2VNCA 5FM8A 5EZLB 4PV9B 4OD2B 3H9YA 3FAXA 1M7IB 3D85A 3I9GH 4DQOH 2P8PB 4U1MB 1UVQA 5GGVL 3QYCA 2EDKA 1B90A 3MRBB 4ZD3L 4W4NA 1JZ2A 4K7FB 5DVKA 1J8HA 3SE8H 2E7BA 2MCG1 4KXZH 5MHSD 5KS9A 3QH3A 2IH1B 3R06A 1AE6L 2EC8A 3ULVF 1F3DJ 2MKLC 1BEYL 5IB3B 5CJ5A 3X11A 2ATKA 5D72L 1KLUB 3G6DH 4OFYA 1CDBA 5DJAA 1T1ZA 1OAQH 3SDAB 4HIHA 1WBYA 4Y4KC 1N64H 3OF6D 3U4AA 3MLSL 3MRMB 4H5SB 2D4FA 1HINH 4QGYA 1ZT4A 2NY3B 3S37L 4OGZA 5E08H 3KG5A 1JIBA 4R8WL 4Z7NF 2IBZX 5F1NB 1MNUH 5E03A 3U36B 5IFJB 1T7WA 3CK0H 3EAKA 4U4BA 1VEMA 3O3AB 3WO4C 3O2VH 5DHVA 1X5KA 5TFSL 3DUHA 2CMRH 4OF6A 4PLKC 1IAIH 1NUGA 2QR0A 2VDMH 3UTSE 4GW1A 5ALBL 4F7MA 4KFZC 2NYYC 4W4OC 3P77A 1JE6A 1R5IB 3BPOC 4LARH 4OF5A 2HAZA 2ESVB 1NBZA 5F7UA 2XFXA 2VISA 3JTSB 3GBML 2GSIB 2R1YB 3FQWB 1X4YA 3BJ91 4XPGL 5K9KB 4NQCA 1OP5H 3Q3GB 5BO1L 2V2XB 2P5WD 2RCSL 1P2CB 1LO2H 3BD4A 4JO4L 5ENWB 3C6LA 4ZTOL 5DFWH 2EEAA 2HFGL 3ARGD 5IWLA 2QHRL 3VXME 5C07D 3GRWL 2BSRA 1TVDA 2YD9A 2FJGA 3RZCD 2I9TB 4KPHL 3DV4A 2V5MA 4GG6B 3SGKA 2X4SB 4TNWK 2EEBA 4U6XA 2WLZA 1YUHA 1A6ZB 4OZIF 1MHPH 3BXNB 1G0YR 4PR5A 5DJZB 1XCTA 3RDTD 3AS2A 5HPMA 5HHPA 1A9EB 2UWEE 2IAMD 1IEBB 1OP3H 5TH2A 1JGDB 2NNAA 3IKCA 5H35A 3QEHB 4XC1L 5EIIA 4FFWD 5ESAB 5LVEA 1RJYA 3H7BB 2PO6A 4Y5VC 5DO2C 3C5JB 2J3SA 3TCLB 5IMLB 2R4SH 4WV1B 4DW2L 4DZBB 3VRLE 4XBGA 3QIBA 4LLUB 4PJXF 4DGVL 3VRJB 4APQC 4OIIL 4OUUB 5DVOA 2E3VA 1MFAH 2CLRB 2IMMA 2X4RA 3DUSB 5FEBA 3MROA 5B38B 3NIDF 1F13A 1R24A 3RUGA 2DLEA 3FQRA 3OG6B 3P4MB 4IJ3B 4NC1E 3VWKA 2JJTA 1NGYA 2J88H 4Z7QF 2VITA 4KJQC 3VW3L 3FL7A 3LN5B 5EZOH 5JLZB 3FQNB 4JFYA 4QWWD 1QFOA 3LZFH 4M93C 5EORL 3S7GA 2WUBL 2O61B 4NRYB 4EN3D 4JG1H 1NAMB 5BS0B 5MENB 2YPLA 4NNPH 1E4KC 1NLDL 1YMMA 4C83B 1Z3GL 2BY3A 4POZC 3HKFA 4HKJA 1BVKB 5FYKE 3A6BL 5BV7C 1GCFA 2V5SA 5DJYB 5DK0A 1A6UH 3NIFF 1ADQH 3QHTC 1PFCA 2A1WH 3QUYA 3MV8B 2K1MA 4JJ5A 2XY2A 2DI7A 3WXVH 2AI0H 4ZUUB 4DJMA 4IRJC 5GXBB 5KSBB 3FT2A 1WBXB 3CFCL 2C5DC 1V5JA 3CFEB 2AEQH 2C1PA 2R2EB 4XVTL 1DBJL 2EXWC 3OHXB 3MBEB 1ODAA 1I3VA 4JRYB 4DZ8A 4LAJH 3MRIA 5FO8A 4PJEE 3M1BB 4JDVA 5A2JH 1JFQL 3BE1L 2EH8L 3KPLA 4S1RL 3FZUD 1KFAH 3Q6GH 1EPFA 5J12B 1XF2B 4JO3H 2ICEB 1DVFB 4J3VA 1NDMA 1MCOH 4WENB 1ACYH 4JZOA 4NZUH 3TFKD 1WLHA 1O7SA 1LEGB 1ZHNA 3B9KA 3TA3A 3PHQB 4YXKH 1XMWA 4G6JH 5I8KL 4ZYKB 1JHTA 3L3GB 2EDJA 3O3EB 1XF1A 3WFBH 5IB1A 2DLIA 5I1KL 4GRWH 1ZTXL 4RGNE 3H3BC 4WHCA 1YA5A 2KUTA 4UDTB 1JZ8A 5F97E 3IDIA 3F58H 5EU6A 1NC4D 1P4LB 2YK1L 1AO7A 5HDBE 3PQYE 5F7FA 1KC5L 1WITA 5LGJB 4F58H 15C8L 5ANME 5E24E 1BFOB 1CG9B 2DIBA 3QG7L 4XVUC 1G9ML 2YD1A 1FDLL 5TDPA 4ZPTB 1QRNB 3CU7A 4WI9A 3KYOB 1P7HL 4P5KB 3NH7H 4X4YB 3KPQA 4ERSH 4PJ9A 3O9WC 1NGXB 4MB4A 2I60L 4QHNB 4HS6B 3LKQB 3MNWA 4GAJL 2YSSB 4X80H 2JK5B 1HKLL 2X4UA 3MGAA 4XXDB 1UWGL 5BZWB 3SDAD 4Z78B 1TJIH 2CIKB 4CADB 1T20B 2OM5A 3RU8H 1X5FA 5J9PB 4I3SL 4NRZA 1YECL 5EO9A 1MEXH 2D31A 1WV7T 4N0UA 1JWUB 5MEQA 1Z9SA 2UY6A 2NY5L 2Y6SD 1RD6A 2VDNL 5BRZB 2NY3D 3BUYB 2XTJD 2W9EL 4U1IB 1EDQA 1FVDB 1KN2H 4DOHB 3T1FB 4LKCB 4I0PB 3QDAA 1NMBL 4K8RC 1SJEA 3GMNA 1JF5A 3RGVA 1QQDB 2H9GA 4BQBA 1HILA 3D18B 3IDJA 3T77B 2X1PA 1EZVY 2CR6A 3QRGL 3RKDD 4I8DA 2HRPH 3HB3D 4YHPB 3MBEC 4RGOH 4MMXC 5GGQL 3RTQA 4J3XA 1KACB 2PW1A 1BMGA 2IADB 2VQ1A 2M2DA 3VA6A 2ESVD 2J8UA 1LO5A 5I1JL 1S7SA 2VABA 3L5JA 5F1SA 4KQ4L 3S3PA 5ITFA 3FQTB 4YZFE 1FH5L 3DMMA 5EWIH 3SKOB 3EUUA 1T2QH 3H0TA 1D5XA 1KULA 4G6KL 1SM3H 3SKJH 1IC7L 3AXLA 3C6LC 4YR6B 5JIPA 2YA1A 2JF1A 4JAMA 2HVKA 4YXLH 5EO1A 3ULVE 4NO5A 35C8L 3PGDA 3WKMH 3TN0B 1JNHB 4R9HA 2EYSA 1QACA 1GAFH 3VGEA 3SGKC 3P30H 1Z5LA 4JQXC 2NTFB 1A14L 1FL6B 4OD1L 1NDGB 2DQDH 1T2JA 2E7CA 5C09E 1IQDB 2BX5A 1YNLH 1PDKA 4LKXB 1AY1L 2BRRH 1P69B 3OKYA 2VLME 2Z92A 3JSSA 4FZ8L 4PJBB 5I17B 1YEDA 1YEIH 3FTGA 1I3UA 1AGFB 2PTTB 5IVZA 1JPSL 2EDYA 3TBSA 4RBPK 5EN2B 1HCFX 5F72S 5EBMA 4WU5A 3UJIH 4JG0L 4WW1B 1LO4L 4KDTA 3OGOE 2Q86A 5LKNA 3IGAA 2GK0B 4U1LA 1ZT1B 3QJHA 1DR9A 1LEIB 3LSOA 3MUZ1 4QTIH 1IZJA 4RCAA 4NUJB 5FYLH 1ZA6A 5F1IB 1ZS8B 4YHNB 4ZFOL 4L3EB 1C12B 4FFZL 1L0QA 2YKLH 1J12A 1KCSH 2K7PA 2O5ZH 1T89A 1UM5H 2XZAL 3SGEI 1RJLB 5IMOB 4BFIB 3OAYH 4DKDC 3OG4B 4KMTH 1M71B 5KJRH 4L1HA 1YYLH 2CLZA 2FSEB 3LKSA 5D93C 3GSQB 1W0YT 5GGUA 3X3GL 1HNFA 3RWJB 2E9JA 3MCG1 4DKFL 2Q76A 4UILH 5I73C 4OFKA 5BS0D 5MEND 1OD7A 2X4QB 2JJVA 3G6AA 1TZIA 1TZHA 3KPMA 3TBTB 2GK2A 3K74B 3QUZC 5I1DA 2G5RA 2WV3A 3EJZD 4EEEA 4OZIE 1NBVL 4MLIA 5C2BH 1KB5H 1YN7B 1DCLA 4KKBC 3SE4A 4Q6YA 2VL5B 1Q72L 1EGJL 3BKCH 4HPOL 2GI7A 3NZHH 1G7QB 1MCCA 3KXFD 1KJ3L 3RWDB 4BUHA 1EFQA 1M7XA 1UXSA 5CILH 1AR1C 4LCWA 3T0XA 3OV6A 2BMKB 1MI5A 4PJDB 1UB6A 3WS3A 5IHLB 3GDBA 4PP1D 4YHML 4PJ5E 2MCPH 3G6JF 3DVNA 3ALPA 5F7YC 4JRYD 3SJVA 4DVRH 2HKHH 2APBA 3FONA 4JKPH 1GGCL 5ACLA 4LLYA 1XGUA 2OX5A 2XRAL 3BZEA 1LP9B 5EU5A 1X5HA 1U2CA 3HAEB 3VI4E 3C5ZB 3NN8A 4BSWB 1UENA 1DVFD 3WFHB 4EI6B 3GBLA 2LAAA 2YBRB 5I2IB 5DYOA 1I3GH 3TT3L 4LLDB 4Z7VB 3EO1B 3TA3C 2ZUSA 3F7RA 1NUDA 4PD4J 5E8NB 4HV8A 1RIVL 4M03A 4Z7QE 4RFOL 2NY6C 3FO1A 1ZK9A 4P5TA 5IB4B 1YC7A 1AQKH 5FCUL 2A83B 4X7DC 2EE9A 5E1AB 4L8DA 4R96A 4OLXL 5FGBC 1HK6A 4XPTL 5DC0A 5CEXA 5C0EA 2ZZUT 4ZTPH 1DTUA 2VXUL 4J8RB 4NZRL 2ORBH 2QQNH 4OCWH 5F8QC 3W0WE 4Z5RB 3TH3T 2A77H 4N9OB 4M8QB 12E8H 2AGJH 3LQZA 3L5IA