2VDPH

Integrin alphaiibbeta3 headpiece bound to fibrinogen gamma chain peptide,lggakqagdv
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
219
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 219
sequence length 221
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdpH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdpH02
4MJIB 4RMSA 1JUFA 2XWJB 4HJJL 1X4XA 5F70A 5EULV 1LK3L 4U31A 4J7RA 5D1QB 4LL9A 4ZTPL 3KJ4B 3UZQA 3BPOB 1XGYH 3WIFA 3FB5B 2G5BA 1E4KA 5E1HB 4Q97A 2AXFA 3HR5A 5BZWB 1RZJH 4G8GB 1L9MA 4M7ZB 5GS1B 3AROA 5HPMB 3VXOB 1WCBB 3HZVB 4EQ3A 5CMAB 1NEUA 4DAGL 4JR9L 3L7EB 3AY4C 2I5YH 5EO0B 2AAVA 1VGKA 1HHKB 5EDXA 4GRWF 2F58H 4L8BB 3U0WL 3SE8L 1FFPA 4XBGA 3D18B 4Y1AB 1I9EA 1MSPA 1V7ML 5DJYB 3T09A 5L88L 1QLRB 1B0RB 3MTRA 4C58B 1CLYL 1C5BL 1JGEB 1F90H 3Q48A 4GG8B 4TUOB 5IG7B 4LMQE 1CBVL 5KZCB 3UEZA 2A6JB 4MA8L 1XT5A 1YEGL 2AVGA 2JELH 4HUKB 1AP2B 2E7LC 1BEYH 3QXWA 2HT3C 4LPXA 5E6YA 1ONQB 4HIJB 5GS0D 1MFDH 1PSKH 2HG5A 3OKDA 4K7PY 3F12B 5AG9A 4KY1L 3U7WH 4U1HB 1BM3L 3OJDB 4WO4D 2GK2A 1OB1B 2BZDA 2WUBL 4P2OD 3RWGA 3GSOB 1QHPA 1F3DH 1AE6H 4MA7H 4OGXL 4KV5F 4XX1G 1BVLA 1EHNA 3V52L 2BOCB 3QFJE 2UWEF 5IF0B 2A77L 3MRDB 1DVFC 4LPWA 4Z8FH 1IC1A 5EWIH 1CGUA 3MA9H 3VXNB 1NMCB 5ID0B 1FNEA 3UC0L 5DVKA 5ICYA 3MJ6A 1FFRA 1T22A 2FD6L 2LV4A 4NNXA 4RISH 5T1MA 3V4UH 3BEWA 2VXQL 3FB6A 1KTRL 1OSZB 2CR3A 4OGYH 2EDYA 5FYJU 1BZ7A 1FO0L 4X5WB 2CDGB 3VA2C 5E2UL 4WHTB 1GCFA 4JM2F 4IRJD 5JW5B 3UTSA 4GS7B 2ERJB 1IC5L 5IFAL 3S4SG 2AJYH 3WNLA 3RWFA 1MRCH 5IV2B 5D2NB 5FDWB 5EO9B 1FG2A 1ZVHA 1RFDL 1KT2B 2EDLA 2PYFB 5LCVL 4EVNA 2YD4A 2H9GB 1B3JA 3WKMH 1T4KB 2R0KL 1UWEL 1RZ8B 2NXYC 1A02N 3ZDZE 3A6OA 3G5YB 1T2QH 4R2GD 3S6CA 2HVJA 2CLZA 3KWWA 1NCDH 1IKNC 3PDOB 2WWKO 1UCBL 4XVJL 1Q94B 4W70A 4QRPE 1XMWA 4KHTH 3THML 5DK3A 1B88A 4NO3A 4OFYA 4R7NB 4PGJA 4PTTA 4EIGB 2NQCA 1RUAH 1GGIL 1O5DT 2FL5A 3BE1L 4A2MA 5CGYC 1H0DB 2YUWA 5BVJB 4X6DA 3BDXA 5IVXE 3D3VD 2XRAH 3OKLA 1IM9A 1NGYA 2R8SH 5JXEC 2Y06H 1EEQA 1WCQA 3KYOB 2GQHA 4ZOCA 1NQBA 3TBYB 1TVDA 1GGBH 3MLSH 3TNMB 5CJXA 1KGCE 1BWWA 5AEAA 3S96B 2QQNL 2EXYD 3DGGA 3QAZB 3VXMB 4OF5A 3TNNB 1R3HA 3X12B 3MV7D 3QUMB 2MPAH 3ET9F 5D1ZC 5DI8B 1I1AC 3LKRB 4L3EE 3T65A 2VH5H 4RGND 3O8XD 5C8JA 3O4LE 4P9HH 1RJYB 2WQ8A 2MOVA 2D7TH 2OJEB 3P77A 1N8ZA 5HYEA 4F2MA 2PW1A 3PWPE 5CSGA 2L4OA 3KLAA 1D9KA 4UUJA 1QLFA 4M3KB 4PJBF 3ZSSA 5HY9A 5I71C 4OKVB 3MUHL 4K71B 3I02A 1A7QL 3CD4A 4YFDB 5DURD 4MQ7B 2LFGA 3VFUB 5KBNC 1JUFB 4M4RA 4NJ9L 5C0BE 2Q20A 4U0QB 1EBPA 3DI2B 4P2RD 1YY9C 4W68A 5FM5M 3KDMA 3WIFB 1UA6H 3ZZ1A 2G5BB 2KH2B 3KR3H 4XH2A 2AXFB 3HR5B 5EFIA 2AERT 3EDKA 2VXTH 3IVKA 1FNGA 1IAOA 1FYTD 4K7FA 4ELMF 3MRPA 2DD8L 2ZSWA 4CKVX 1VGKB 2LABA 2YD8A 3QWRA 4R7DA 4LGRB 1FFPB 4XBGB 2JJTA 1MJUH 5ITBL 4XMKL 4NUGL 4Y5YC 4HC1A 3I6GA 5TDOA 1LGVA 2IBZY 3W2DH 5E9DA 2VDRH 4G6FB 5HDOA 3CMOH 2IPTL 2NW3A 5KSAC 1KJ3L 2IJ0C 1NCBH 1U95A 4YEEA 5SWZA 3KPOA 5J12C 4G6KH 4DGYL 1I7TA 2HG5B 3OKDB 5F6HJ 3NA4A 4AIZA 4BK4A 3C60A 3RX7A 1Z3GH 5B38A 3MMEA 3V4PH 1KBGL 5IMOA 3KS0H 4Q58C 5I1JL 2CIKA 3T0EE 5J13B 5FYKH 1QACA 1T6WA 4JPVH 5EBGA 3RWGB 1BD2E 5ADOH 4BFGA 2FIKA 4Y4HC 2VYRE 3HTLX 1BVLB 2AJVH 3IXAA 4PBWD 2GHWB 3GBML 2YN3A 5DMGD 4GO6B 4WWKD 3L7FA 4FQPA 4HC1H 3EJYC 2A73A 5E5MA 1FNEB 5ICYB 4WNQA 3DUHA 1T22B 1KV3A 1UWXK 4NNXB 5T1MB 2EYSA 3BEWB 1OGAA 2NNAA 3FB6B 2A2QT 1BZ7B 1S7RA 3QUZA 4FP8H 4A6YA 4JZNA 2E9BA 4PRHD 4S2SA 3UTSB 3WUWG 3RRQA 4NN5C 4K55A 4TTGA 3LQAL 4I0PA 3RWFB 4HT1L 3AUVA 3PDDA 1I3UA 1L7TH 1FG2B 4OCMC 2GT9A 4EVNB 5I74C 1IZKA 5GRUH 5E8NA 1DBBH 4H8WC 4M7JL 4AEEA 1IFHL 2HVJB 4HUXA 2CLZB 3QXTA 3KWWB 2AXJA 4YLQT 4Q9BA 4KK9D 4YHYC 4NO3B 5D7IF 4PTTB 4RGOL 3MBXL 3P11H 2FL5B 4HJ0C 5AWNH 3EO1A 1INDL 4U3CA 4X6DB 3KXFD 3K1DA 3O6LL 3OKLB 1IM9B 3LRSA 1NGYB 1L7IH 4C56A 5FKAA 5E2WL 2YWZA 3QIBA 1U3HD 5C0CD 4J4PC 2XV6B 4CAGA 3CFIC 4NZUL 1DCLA 1UWGH 3DGGB 4GG6E 4ZODA 1R3HB 2AEQL 4PGBA 4BQBA 5GISH 4PJFF 5DD3H 4I3SL 3T65B 2CGRH 3BP7A 4ZMAT 5C8JB 2R2HA 1AXSA 2UVEA 4B0MM 5EBLA 1HK6A 1UYWL 5F7FA 1FV1A 4AIXA 3P77B 1N8ZB 4RNRA 4H88H 1OAXL 5JTWA 2PW1B 1X5FA 2R9HD 3KLAB 1D9KB 4UUJB 5J1AA 1QLFB 5HY9B 2B1HL 3I02B 4M7LL 5L2KD 3NABL 3F58H 2EEAA 3PV6A 5EA0H 2NZ9D 4XAWH 2HKHH 3HZKA 1A5FL 3WEXA 5BOPA 1MCWM 3WHE0 1H3TA 3H9YA 3SCMA 1C7SA 3BO8A 3X3GH 3LDBC 1PY4A 3C8HA 5H37H 5I76A 3FO0L 3MODH 3HNVH 3KDMB 2H8PA 3QFDA 4XH2B 5EFIB 4L1DA 4JHAH 4X6EA 5D6DC 4QOKA 1U8NA 1FNGB 3IVKB 3RWHA 1XGYL 2ZUUA 1IAOB 2AV7A 5F7MC 4K7FB 3MRPB 32C2A 3W0WD 2B5IC 4X8XA 1RZJL 2ZSWB 2R29H 3RAJH 2FBOJ 1SY6A 4G42A 1T03H 4HG4J 4R7DB 1DFBH 4HS3A 1S7VA 1DQTA 2H6PA 4OI8A 2I5YL 1GC1H 1I9IH 2IG2H 5T3XD 4GQPH 2F58L 3I6GB 5TDOB 5E9DB 1S7WA 1TCMA 1A1MA 1BBJA 4X6DF 4N0UE 2NW3B 5E8DH 3BHBA 3U48A 1F90L 3RVVC 1U95B 5SWZB 3KPOB 5ABDE 1GGCH 3DSFH 1FRGH 1I7TB 2JELL 4AIZB 3C60B 1JF6A 4WV1C 4DOHE 5D7JC 1BEYL 3UJTH 5B38B 3MMEB 4XHQA 5IMOB 5L8KB 2EYRA 4X8JA 2LTQB 3KYAA 2CIKB 2X4UA 1MFDL 5KSUA 1PSKL 3OGCA 3KPQA 2O5YH 2FIKB 4TUKH 3DOSA 3U7WL 1SY6H 4KHXH 3IXAB 3JSSA 4OIBA 4N90D 4NWTH 5SX5K 1AE6L 4MA7L 1BOGA 3L7FB 1AGFA 3SO3B 4YHOH 3UYPA 2A73B 5E5MB 5BS0D 5FYLH 4WNQB 4Z8FL 3DYMA 5EWIL 5F8QC 1DDHA 3WHE1 3OBAA 3MA9L 4F58H 3QQ3A 4HPOH 2EYSB 1CI5A 4G6JH 1OGAB 2NNAB 1S7RB 3QUZB 4A6YB 4HUVA 4JZNB 5I9QB 2FGWH 4FTVE 1CF8H 4RISL 3V4UL 4S2SB 2VLME 3KPRA 4Y2DD 4OGYL 3MREA 5GQBA 2X89D 2NPLX 2YEZA 3CK0H 4MCYA 2DQHH 3LEVH 1OPGH 2GT9B 2Y72A 1IZJA 4Z7OF 2HTKC 2CDFA 2GSGA 3RUGA 1MRCL 5INCA 2DTSA 2V5SA 5E8NB 4HEME 5GRVK 4HUXB 4PRIE 1U0QA 3FT3A 1L0XA 3O41B 3O4OB 3WKML 4M61A 3ESVF 5IHUH 2YA1A 2ADJA 4Y5XA 4GKOA 3WNNA 1T2QL 2V9RA 1FVEA 1JGLH 2Y7QA 1SEQH 2DIBA 5L2JA 1NCDL 4CVXA 5DC0A 2P7TA 4QTHA 4KHTL 3EO1B 2Q76A 3LRSB 3QEHA 1RUAL 4C56B 5FKAB 2W60A 2YC1A 1AD0A 4WENB 1MCFA 2AJZA 1EIBA 2OR7A 3QIBB 4X7SH 1AI1H 2X05A 1R3LA 2XRAL 4R26H 4KZDH 1WBXB 3LOWA 2R8SL 1IVLA 2EKSA 4YBQC 4CRPA 3L3JA 2Y06L 1N3NA 4XPAH 5DO2C 1MHPH 4PGBB 1D5ZA 1FFQA 4OLYH 1GGBL 3MLSL 4KDWA 3S35H 3QYCA 5J3HC 3B43A 3BP7B 4MSWA 2R2HB 3MCG1 1AXSB 1TNMA 5E6IC 5EBLB 2MPAL 4P2OA 1FV1B 4RNRB 2VH5L 3B9KA 1CDCA 1FZJA 3QWQB 3V8CA 5KS9F 1U8LA 4P9HL 1UB6A 5J1AB 4KI5C 2D7TL 2ED7A 4JLRA 5JMRA 3PV6B 2BVUA 2V17H 4U0RC 3GMRA 5E5RB 3HZKB 3H7BA 3WEXB 2PCPA 2HFEA 1MFBH 1TNNA 4OTXH 3SCMB 3UDWA 3BO8B 3T8XA 3T0WA 2BC4A 4UQ2A 5I76B 5DD6A 1A1NA 2H8PB 3QZWG 3QFDB 5JA9A 3PQYA 2A6DA 4LHUD 1OM3H 4X6EB 4QOKB 1U8NB 4IRJA 3WIIH 3RWHB 2AV7B 5DTFA 1UA6L 4K8RD 32C2B 3KR3L 5K9QG 1KPUA 4U7KA 1MQKH 4L4VD 4XNZB 2Q8AH 4G42B 3QQ4A 4NT6A 3LZFH 4K2UH 4PJEA 3SO5A 4HS3B 1S7VB 2H6PB 2D7NA 1W0WA 4LRNH 1UG9A 1BFSA 3JWOH 3MGAA 5D2LE 1M1SA 2GITA 3MXVH 4EBQH 2HT3D 5B8CA 4NGHH 2OK0H 1MJUL 1S7WB 1A1MB 1BBJB 2C26A 4Z7UF 1B90A 3FO9A 3BHBB 1UB5A 5DT1H 3HAEA 3W2DL 5IHLB 2VDRL 4W6XB 3CMOL 4AZ8A 2EDFA 1PKQA 3D3VA 1NCBL 4ZG1A 1ZK9A 2EYRB 5E99H 4X8JB 2YA2A 4YZFE 2X4UB 4G6KL 3MZTA 1IRAY 5KSUB 3OGCB 1DVFD 1FNAA 5FIEA 4W4NA 3S34H 3KPQB 1Z3GL 4F9LC 3V4PL 5EU6E 1RVFH 3HZMA 3SDYH 5GGUA 5FYKL 5HHMD 4AG4H 4UNTA 4JPVL 3MV7A 4DKEH 5ADOL 3WHXA 1BOGB 1AGFB 2GTZA 3DVIA 2AJVL 1XGRA 3RBSA 4DVRH 2V5YA 3OJ2C 4JFXA 3R8QA 2CQVA 1DDHB 1OP5K 4ZUTB 3QQ3B 4PJCF 4HC1L 4YPGA 3PHSA 3HAEH 4HUVB 3JUZA 1DN0A 1Z9SA 5C0JA 3CCHA 3KPRB 3VXQA 4FP8L 4XPFH 3MREB 2NXYD 5I73B 2A6IA 4YC2C 4NO5A 3X3FH 5EO1A 4AH2A 1ADQA 2YEZB 4MCYB 2EDDA 1HE7A 3O3DA 3ARGC 5FGBC 2HFTA 4P2RA 1NLDL 2CDFB 2GSGB 3RUGB 5INCB 3RU8H 5AZ2H 2HFFA 1L7TL 1AHWC 1QR4A 5GIRA 1FYTA 3M17A 3FT3B 1WBYA 4M61B 4R4BA 5CGYD 5GRUL 5EOQH 1DBBL 2ADJB 4Y5XB 5IB5A 2J8UE 1FVEB 4PJDA 2Y7QB 3B2UC 4Q74A 5JXED 5L2JB 1EHAA 3QNYA 4CVXB 1BQLH 2DLFH 4ALAH 4PRAA 4QTHB 3RP1A 1WISA 2Q76B 25C8H 2HLAA 1I85C 3LH2H 3QEHB 3P11L 5IQ7H 2W60B 3NIGF 2YC1B 5ID1A 1AD0B 1R3JA 1WITA 2AJZB 2YHGA 5AWNL 3V6FB 5D1ZD 1I1AD 5DRXA 1R3LB 1L7IL 2EKSB 3L3JB 2HFGH 1N3NB 1ADQH 5A3IC 1Z0MA 4LF3A 2DM2A 4L29A 1M7DB 1D5ZB 1TJHH 2FYYA 2PO6C 3UZEA 4B53A 3MRKA 4GRWE 1RAMA 1DEEA 1EEZA 1UWGL 1KTKE 4MSWB 5C7XH 4MDJA 2B2XH 4LNRA 1EXUA 5GISL 4P2OB 5IEHA 5DD3L 3B9KB 2CGRL 3PG2A 2GCYA 3MV01 1T2XA 1U8LB 1WFNA 3A67H 1UB6B 3G6DH 4GMTH 5IT2H 4K3DH 4PJ5D 1QFOA 2E6QA 4JLRB 4ZUVA 1VESA 4WWKA 4XCCH 3VXTA 4H88L 3GMRB 5F71A 2ESVA 1YY9D 5FM4A 3JV0A 3SE4C 1SHMA 3H7BB 2PCPB 2HFEB 2ZG2A 1KFAH 2IF7A 4ZNEE 4PJ8C 5EA0L 3F58L 2XWTA 4XAWL 2HKHL 1DSFH 4N68A 3T8XB 2BC4B 1QSEE 4UQ2B 5DD6B 3QPXH 1OVZA 3OKYA 1A1NB 3UTTD 4L4TD 2VDLH 4S1RH 2WLZA 3FFCA 1HH9A 2A6DB 3X3GL 4LCCA 1IEBA 4R0LC 4IRJB 4PRHA 3V6OA 3MODL 3ZT5A 3HNVL 5DTFB 4KV5E 4GBXD 4MJ6A 4WEUD 4Y89A 4JHAL 1KPUB 2UWEE 3VMPA 2H3NA 3RZWA 4LDLB 3QQ4B 3ZE0F 4NT6B 4PJEB 5C71A 1WIOA 2EH8H 1W0WB 4D0DA 2R29L 3RAJL 1LO2H 3GKZA 3MLYH 5KSAD 4OGAC 3VGAC 1T03L 4R2GB 4ZNCD 3D87B 1DFBL 5B8CB 4POUB 4LLWA 5GGQH 4N5UA 4F3FA 2JJUA 4MJIE 4XP6H 1GC1L 4RWYH 1I9IL 2IG2L 3RZCC 5HBBA 3AS1A 3FO9B 3V6ZA 1MI5D 1UB5B 3HAEB 5GSVA 1KULA 1KPVA 1HQ4A 1S9VA 2WV3A 5E1AA 3RTQC 1MLCA 5E8DL 1PKQB 2DYPD 3D3VB 4AT6A 4Y4HD 4POZC 3MJ7A 1GGCL 1J0HA 3DSFL 3NCEB 1FRGL 4MHHI 3QCVH 4BZYA 4M43H 1U3HA 2W9EH 5T1LD 2DI9A 3UJTL 1I1FA 3KG5A 1QRNA 4TVPH 5CUSH 3EJYD 3HZMB 5GGUB 5E2JA 3MV7B 1OCWH 2W0LA 5KW9H 3WHXB 1E4XH 2O5YL 4TUKL 1M71A 4LSTH 4EUPB 2GTZB 1SY6L 4KHXL 4CMHC 1HYSC 1XGRB 4NWTL 5DFVC 3K7UA 4JFXB 4YHOL 1IC4H 4YPGB 1F3DJ 1X6LA 5FYLL 4WUKH 1DN0B 5L2KA 5C0JB 4MAUH 4F58L 3U2SB 4S10A 4HPOL 3G6AA 4G6JL 3ROLA 1CE1H 3VXQB 3ZL4H 2A6IB 1I3RA 1FLRH 4NO5B 2VR9A 4CJ1A 2FGWL 3FHQA 5EO1B 5A43C 4AH2B 1CF8L 3O3DB 1H5BC 4P2RB 2X1QA 4Y5VA 3QUKA 1JE6A 1F2XK 4F7PA 1KJMA 1JZ5A 1BPVA 3LKOA 3FOLA 4EIZC 2HFFB 1FGVH 2EIBA 2YUVA 1QFHA 3CK0L 2R15A 3LEVL 2DQHL 3ETBF 1OPGL 5GIRB 3BGFC 2DDQH 4Z6AT 2APBA 4G7VH 4HSQA 4PJEF 1FYTB 3M17B 1WBYB 4HJ0D 4R4BB 3W0WA 5BRZD 1JVKA 5DA4A 4PJBE 4P4KA 5IB5B 2BHZA 5K9JH 4TNWK 4PJDB 5F1OB 1W0YT 3QNYB 3SGEI 5IHUL 2X2YA 2XXMB 1KSRA 4PRAB 1E4XI 1JGLL 1SEQL 3H9SD 1ZGLP 2HLAB 3EYSH 4H5SA 3VH8G 5ID1B 1R3JB 1QZ1A 2BNQD 4FFWC 1PG7X 5DRXB 4LVHB 3P40A 3VGFA 5IIEA 3LIZH 4ELME 4LF3B 4L29B 4X7SL 1AI1L 4OFPA 3LKQA 4R26L 4KZDL 5JLZA 2FYYB 3MRKB 3QRGH 5DHYA 1DEEB 1EEZB 1MHPL 4M93B 4XPAL 1FIGH 5DMYA 4MDJB 4KKAD 4LNRB 3STLA 4OLYL 4C4KO 1EXUB 3S35L 1O0VA 3MGOA 2VWEE 5IEHB 3QQNA 4KDTC 2IFGA 4KGJA 2GCYB 2ZUQB 3HLAA 4N1HB 5DVLA 1HKFA 1R24A 3S37X 3MR9A 4ZUVB 4YJZL 5MHSE 4WWKB 3VXTB 3ELAT 2ESVB 3U30C 1RUMH 4XNMA 1N2RA 5T3XH 3W39A 4JQIH 4JJHA 2XWTB 4M00A 2V17L 5T5NF 1MFBL 2BVTA 4WFED 3TO4A 2E7HA 4LPTA 4OTXL 5C0NC 4OFDA 3FFCB 1WZ1H 1HH9B 4LCCB 2X1XR 1IEBB 1SJHA 4PRHB 5LBSH 2ID5A 1U3JA 3WN5C 4MJ6B 1CU4H 2H3NB 2X89A 1OM3L 4I5BA 4UBDD 4DKFH 3WIIL 2X41A 4F37F 1WJ3A 2ZCKL 5BCAA 4KROC 4LVOB 4NCC1 4D0DB 1MQKL 3LEXA 2Q8AL 1G1CA 1WIUA 4PJDF 2IAND 4QNPF 3RVVD 4L5FH 1JI2A 3LZFL 4K2UL 5JW4M 2O26U 4LLWB 4F3FB 1FH5H 4LRNL 3JWOL 2D31A 3UP1A 5DS8A 3MXVL 5B3JF 4EBQL 5D7JD 4NGHL 2OK0L 2BRQA 5GSVB 1KPVB 1HQ4B 4MX7A 1S9VB 5DZLA 5LXGH 4ONFH 5E1AB 1AD9A 3LV3A 5CP7A 1MLCB 1CL7H 4WI6A 4MQTB 1XGQA 4RAHA 4WEBH 4YHNA 1T66C 4XGZA 4GRLC 4AT6B 5JPMA 5DT1L 2GEEA 5MI0C 5GZNC 1HHJA 3FQNA 1TQBC 4KJPC 5T3ZH 2ZCLH 3MJ7B 4OD1H 4DGIH 2VLJD 4I0KA 4BM7A 1NMBL 1U3HB 4UAOC 1QD0A 1RIHH 4OLVH 4IMKA 2YZ8A 3MYJA 1A2YA 1E6JH 4JRWA 1I1FB 1QRNB 5E99L 3F8UB 3JV5A 4MJ5A 4KTYA 5CBAA 4OZHA 5FUCC 12E8H 5EU4A 4HWUA 3S34L 3N50A 5D7IE 3V0VA 4EXKA 1M71B 2EE9A 1RVFL 5HHOD 3SDYL 1WFOA 3BJ91 3RGVD 2ZNXA 4AG4L 4DKEL 1XCTA 4LAJH 5FM8A 2NLJA 1CN4A 2VSCA 1X5HA 4DVRL 5IVOA 1MCEA 5DRWA 2WIIA 3E6HA 5L2KB 3NIFF 4KAQH 2HTKD 3G6AB 3JWNC 2CKBH 3ROLB 1VERA 5JHDD 2FSEA 1A3RH 2COQA 5FAAA 3CLFH 3U6RA 1I3RB 1BGXH 4V1DD 3QDJE 4Y5VB 3QUKB 4JN2A 3H3PH 4F7PB 4XPFL 1KJMB 1CL7I 4XPTH 3LKOB 4XP4H 1MFAH 3FOLB 3X3FL 2HKFH 3AY4A 3Q2CA 3EHBC 1JF5A 3OV6A 4LHUA 1X44A 4HGWA 3O3BA 5HTSA 4OV5A 3RU8L 3W0WB 1ACZA 5AZ2L 1LDPH 2UY6A 1BMGA 1BF2A 4P4KB 4L4VA 1A1OA 2XTJC 4KUCD 2H2SC 3FFDA 5JORA 5EOQL 4POYA 1OLLA 3EOYG 5DHVH 5E00A 5IK3A 4J8RA 2E7LA 2J7LA 4H5SB 1ZMYA 4RMWA 4J1UA 1BJ1H 1BQLL 2DLFL 2RJMA 4H25A 3QA3A 4ALAL 1LDSA 2PF6A 2IFFH 4WFGD 25C8L 3SDDC 3LH2L 4XMLH 5IIEB 5J3HD 5E6ID 2GYSA 3H6JA 3LPWA 5EZLA 3LKQB 1PG7W 2W9LA 3WCYA 3WFHA 5JLZB 4LLUA 1CXLA 1RPQA 2HFGL 3JBG7 1ADQL 5C9JA 1NC4D 5DHYB 3VD4A 2YUXA 3STLB 1C12A 1TJHL 4K8RH 1I9RH 4N8PA 1NFIA 5EIQA 3MGOB 3GJFH 4M1DH 3ARUA 3TIEA 1RURH 3GDBA 5C7XL 3HLAB 2B2XL 1MCDA 3GIVA 4X6DE 1R24B 3MR9B 3HNTH 3BIAX 1GGUA 2ARJA 4XNMB 5GRXG 1N2RB 3A67L 3W39B 2FR4A 4GMTL 3G6DL 5IT2L 4K3DL 3VGEA 5BS0B 4OF0A 4XCCL 3MROA 3B3IA 4TSAH 4P46C 4I3RH 3TO4B 1KFAL 3OR6A 4UV7H 4PJIF 1A6VH 3SDXF 1DSFL 2ZG3A 1SJHB 3QPXL 3GO1H 3ULUD 2JB6A 2VDLL 4S1RL 2VB5A 1MAMH 1G0XA 1DTUA 4I5BB 1T0NA 4JDZA 1WWAX 1FIEA 2LQRA 4NN7B 5FHBH 3LEXB 5KOVC 4XT1C 3BPCA 2MNUA 4MAYC 3CH8A 3MV8A 4F15C 3OXSA 2EH8L 4PD4K 2D31B 1YC8A 4N1EA 1LO2L 3MLYL 1I9JH 5DS8B 3IKCA 5JXEA 5GGQL 1PZ5A 4O51A 2RFXA 4MX7B 3K4AA 5JUEH 4KJYB 4XP6L 1AD9B 3I6LE 2VDOH 2X09A 3LV3B 4N0CD 5CP7B 4BQ9A 1RZKH 1XGQB 4LPYA 4RWYL 4YHNB 4XGZB 1V5JA 2XZAH 5JPMB 3IAPA 4XCYA 1JL8A 5FYKE 4HKXA 4ODSH 1HHJB 3FQNB 4Z7OE 1TQCC 2EE6A 1XF1A 5DJ6A 3X14A 5C07D 1I1AA 5D5MA 3ZO0A 3SPVA 1T0PB 1A2YB 3MYJB 4PLJC 1EEYA 4HULB 3AM8C 3UYRH 4MJ5B 2R1XA 4M5ZH 1VCAA 2DB8A 3QCVL 4M43L 4OZHB 5CBAB 4OD2A 5E4IA 2IQAA 2W9EL 3CPLA 5EU4B 2N7BA 4S1SH 3OAYK 3V0VB 1RIUH 4TVPL 5CUSL 1Q0XH 4UT6H 4ZFGH 4APQC 4MGXA 2EDJA 4UU9A 2P8LA 4JQVC 1XCTB 4Z95H 1OCWL 5E0QA 5FXCH 2NLJB 5KW9L 1E4XL 3T1WA 4LBEA 4LSTL 4S1QH 1MJ8H 4OZGA 4UIKH 4CN4A 1YQ2A 4ZSOA 4WVRA 5DRWB 1X3DA 1JF1A 2WIIB 1ZHKA 3E6HB 3ARGD 3PGCA 3FQUA 1IC4L 1QBAA 1K3ZA 1QTYT 2FSEB 3U9UA 3IRPX 1RUKH 4OJFH 4WUKL 3U6RB 1KACB 3ZMRA 4MAUL 3RKPA 4HIIA 4I8DA 3GMQA 1CE1L 4JN2B 3UTTA 3WKNA 3RIAK 3ZL4L 4AY0A 5EN2A 4NC2B 1FLRL 4FN0A 3ZTJG 4BK5A 3RX8A 4LHUB 2D0GA 3MRLA 3B2UD 4HGWB 5MEQA 3O3BB 4L4JA 4M7LT 4OV5B 3OXRA 5KS9E 4GBXA 5IHZA 5I1AA 1FGVL 3GIZH 5CFHA 4MB4A 3TV3H 4L4VB 4Y5YA 2DDQL 5TE7H 4G7VL 1A1OB 1K8IA 5IQ9A 1OGAE 3FFDB 4Y0GA 2ENYA 4R97C 4WFFD 5K9JL 5IK3B 4J8RB 1LQSR 3HN3A 4J1UB 4H25B 3S36H 5JO5A 2WM0A 3QA3B 3WV0A 2HTLC 2FHFA 4WHYG 2PO6D 3EYSL 4X9HA 2XACC 1MI5A 1INQA 4M5YH 3KPSD 2VAAA 4YNYA 4YWGH 4U1LA 5EZLB 1MCSA 3RKDC 3WFHB 3MLPA 3DX9A 4LLUB 2DYPA 1J0JA 2VLRD 4PUBH 5C9JB 3LIZL 1BZQK 3K80A 5JZ7C 4JQXC 1ULVA 43C9A 5DJ2A 2OJZH 1C12B 5ALCH 2GFBA 3TT3H 1NFIB 5T1LA 4M8QA 3GMMA 1GZQA 3QRGL 5CEYA 1FIGL 4KMQA 3TIEB 2F54D 4XHJD 4PJ8D 5HHMB 3GIVB 1EZVX 1FNHA 2R0WH 5HDLA 2HT4C 3EZJB 4C56E 2ARJB 3DMMD 1KIUA 2FR4B 1FSKB 1UACH 4JKKA 4ESKA 1IEAA 4XAKD 3MROB 3B3IB 4UILH 5EUOF 5ANMA 2EICA 1RUML 5T3XL 2CUMA 1WWCA 4JQIL 1J1PH 2LVEA 4M6MH 3OR6B 4GW1A 1C5DA 1CDGA 1JNJA 3OAUH 3NFPA 1G9NC 1UJ3C 4QRSA 2JB6B 1OTTC 2ATKA 2BMKA 3T2OA 1WZ1L 2NXYB 2NXZC 4OGAD 1IE5A 5ACZA 5LBSL 3BKCH 2ZOLA 1T0NB 4UV4H 5DMKA 4JDZB 1MCRA 1JHKH 1CU4L 3ZYJA 3K2MC 4DKFL 3IDIA 4Y8DC 4RMQA 3BPCB 1DL7H 3C5SA 3MV8B 1ZGLM 3QH3A 1T6VN 1Z9OA 3HB3D 4NQDA 3OXSB 3CXHJ 3MACH 4FFVD 3RTQD 5D96C 5BRZA 3FAWA 2OQJA 1WSST 4U1MA 3IKCB 4L5FL 4POZD 3TO2A 1PZ5B 4O51B 4ZS6C 1FH5L 2RFXB 3NPSB 4D9QE 4KPHH 3EDFA 4XZUA 4QXTA 3H9SA 3ROOA 1RIVH 1RUPH 3BP6A 4XCYB 1BREA 4HKXB 5LXGL 2YMXH 4ONFL 4YK4B 4IOFC 1J1OH 2BNQA 1CL7L 5DJ6B 4WEBL 3X14B 5I1CH 1AR2A 1FGNH 1I1AB 3HC3H 5D5MB 3SPVB 1EEYB 4OFIA 4FMFA 5T3ZL 2ZCLL 4OD1L 4DGIL 2UYLA 2L7UA 4RFEA 3U4BH 5DFVD 2R1XB 4DUVA 3OWEA 4OD2B 4RAVA 2IQAB 3CPLB 5C3TA 1RIHL 4OLVL 1B6DA 1E6JL 4PLKC 4W81A 3O3EA 4JPKH 1VEPA 4UU9B 2P8LB 1U41A 12E8L 3N1GC 1KB5A 1YPZF 2YD7A 4LBEB 3ALWA 4NFDA 4OZGB 3NIGE 4IOIA 5FDYA 2R4RH 4ZSOB 1JF1B 1ZHKB 3PGCB 4HK3N 2QADC 3O3AA 4TNVK 3FQUB 5ESVA 1BVZA 4OF6A 4UTBH 3T4YA 2KPNA 3B2VH 3U9UB 3EDJA 3BPLB 1U3YA 1JNHA 2VABA 1SJXA 4U6VH 4N8VG 4PJ9D 4KAQL 3K2UH 4HIIB 4O2CA 3VRJA 1QKZH 2CKBL 3GMQB 4JM4H 3RVUC 1JZ3A 1A21A 3T0BA 3UTTB 1A3RL 4NQTA 5FO7A 5EN2B 3CLFL 1BGXL 2X1PA 3QBTB 4BQCA 5CEZD 3MRLB 5MEQB 4YDIH 4MJ2A 4KDVA 1PBYA 1J05A 3H3PL 3C09B 3OXRB 3ZDYF 3FONA 4XP4L 1MFAL 4GBXB 5IHZB 2HKFL 5I1AB 2XN9A 4CJ0A 4Y5YB 1KB5H 3VFMA 1K8IB 3PHOA 1VSCA 5IQ9B 1LDPL 1KJ2A 3DV4A 4FFWD 3T3PF 4XPBL 3WXVH 2IANA 4JFED 3OSKA 5IBUB 1EV2E 2J8HA 3KPRE 4KQ4H 2FBJH 5JO5B 1MCQA 4IOSD 3VI4F 2JJSC 5HVFB 5DK0A 2NY6D 5D7JA 2ZNWA 3C8DA 1MI5B 1INQB 5D7KE 4YNYB 2IFFL 1JZ6A 4U1LB 4P0DA 3LKNA 3DX9B 4KU1A 3AAZA 4XMLL 2DYPB 4Y4HB 3ZE0E 3LN9A 2D7QA 4WI4A 1Z2KA 43C9B 2VLJA 5DJ2B 4JZJA 3RY6A 2A0LD 1TIUA 4UT9H 4HH8A 2GFBB 2QV2A 1NCAH 5T1LB 3DPBA 3GMLA 4M8QB 1GZQB 3GMMB 2AGJH 5CEYB 3RDTD 3WNMA 4K8RL 1I9RL 5EIIA 3X17A 4M1DL 1KJ2H 5F93C 1RURL 2KL6A 5I2IA 3AGVA 4BZ2H 5HHOA 3RGVA 1BF8A 1J12A 3MOAH 4YAQA 4HKZB 1PYWA 1VDGA 4OI7A 3FB7A 1IEAB 3HNTL 4Y4FC 5M94B 5ISZE 1TJIH 5ANMB 4P2QD 4NN5B 1T5XA 4I3GA 1BIIA 1N26A 3MSPA 1LP9A 2BXYA 1F58H 2Z0BA 3VG9C 4GW1B 1C5DB 3E0GA 1R5WA 5DF0A 4DKAA 3C87A 4GH7B 4TSAL 5JNYA 5FHAH 4QRRD 3NFPB 4I3RL 4QRSB 3L3IA 3BDBA 4GKNA 2ATKB 4KROD 2BMKB 5IW1A 2F5BH 4UV7L 5SWSD 1A6VL 3WNKA 2Q3ZA 4V1DA 3ARWA 2AK4E 4PG2C 1F3JA 4Y19A 5ACZB 3ARYA 3MRRA 1LO4H 3NGBC 2ZOLB 5DMKB 1KN2H 1MAML 1RJZA 3IDIB 4CDGC 4YHYB 3F5WA 3C5SB 3VXPA 3QH3B 3IETA 4G3YH 5FYJE 4NKQB 2CDEA 4NQDB 5J06A 3STZA 5FHBL 5BRZB 3ZKNC 2OQJB 4P23A 1T66D 1CICC 1KLUA 1KPRA 2EYTA 4GRLD 4OSUH 4U1MB 3DV6A 5GZND 3TO2B 1F2QA 3C5ZC 1UZ6E 4NKDA 3PQYE 4LSQH 1I9JL 4XZUB 4RFNC 4QXTB 2FIRT 1JWUA 3H9SB 3ROOB 1PLGH 3BP6B 4LP5A 2C3HA 1U92B 5JUEL 5ALBH 2H26A 1AGDA 2BNQB 2VDOL 1RZKL 2BERA 2ZUWA 5KVGH 3ARVA 5KSBF 4RWHA 2XZAL 5DC4B 5HYSG 1NEZA 5L6YH 5CSBA 4PJEE 2UYLB 4RFEB 3T0EC 1EAPA 4Z78A 4RAVB 4OFKA 3SJVD 3V79C 1W0VA 1IKFH 1IARB 1L0QA 3O3EB 3UYRL 1NC4A 4M5ZL 3Q5OA 3PE9A 1LO3H 3RJQB 1KB5B 4S1SL 4XTRD 3VXSE 3U7AA 1RIUL 1Q0XL 4UT6L 4Y4KA 4ZFGL 4GKSA 2X70A 3R1GH 4UNUA 4IOIB 4L8DA 4Z95L 3P4NA 3EZ8A 2YPLD 3VCLA 1PKQE 4XNXH 3D3VE 3O3AB 3QJFA 4S1QL 1Y18A 1MJ8L 3FQTA 3MV9D 4XP1H 5ESVB 1N5YH 4OV6F 4UIKL 3T4YB 2Q8BH 1JNHB 2VABB 3EHBD 1V3LA 1GJIA 4OI9A 4O2CB 4PP1D 3VRJB 1JWSA 1RUKL 3KPLA 4OJFL 5FO7B 2NW2A 2DL2A 3MV7E 1U58A 3SKUD 3BAEH 3BUTA 5CD5D 2G60H 2H2SD 1J05B 1XR9A 3FONB 4NZJA 2B4CC 1U8OA 3WFCH 2XN9B 1N64H 1TMCB 2ZJSH 5HVGB 4K9EC 1AXIB 4QCIA 5C09E 4HS8H 3VFMB 1T80A 3PHOB 2XZQH 1KJ2B 3GIZL 1HZHH 3DV4B 4BKLA 4ORZC 2X40A 3TV3L 3SDDD 1I8IA 3DECA 5TE7L 4HG4K 2IANB 3NCBB 1A7NH 3N9GH 3MZGB 1CFBA 1TVBA 3BPNC 4PGCA 1UM6H 4X4MA 5DK0B 3NCFB 5D7JB 3S36L 3ES6A 1XZ0A 2N1KA 2DWEA 2Z8VC 3AS2A 3IDXH 3LKNB 2I9TA 2P5WD 5FKPA 1RV6X 4F9LA 3AAZB 3T1FA 4M5YL 1XCQA 4YWGL 3VD7A 2VLJB 1AY1H 1UKSA 1F4AA 4JZJB 3ULUH 2WMPA 4PGZA 3SE3C 3OKKA 4PJDE 5JOPD 5C07A 3GMLB 4QNPE 4PUBL 3I85A 1H3UA 1BX2A 3DHMA 3RVXC 3L95A 1ZHLA 3U79A 4DUWA 3HG1A 2OJZL 3S98A 2UZIH 5EIIB 5ALCL 2F53D 3TT3L 4ERSH 4P46D 5B3JE 4N0RA 1RJCA 4PB0H 5F9WC 5I2IB 5HHOB 1TVHA 3RGVB 4YAQB 5TE4H 3T2NH 1PYWB 2R0WL 1F4HA 3FB7B 4OZFG 5JOEA 1JPFA 3ARBC 2KQMA 4KKBC 3AMLA 3JV6A 2XNAB 5ELIA 1T5XB 3IJYA 1BIIB 1T1XA 1LP9B 1UACL 3KLSA 4MMZC 3SGKA 2VAJA 2DIAA 4XC3H 4JY6A 1IAIH 4YHLH 3CNKA 1OD9A 1R5WB 4UILL 1YQVH 5JNYB 5LWYH 5FGBA 3ARGA 5C08A 4ENEC 2CIIA 3L3IB 2YPKA 1J87A 3LEYH 4GKNB 1EO7A 3VFSA 1J1PL 2YSSA 5IW1B 2OL3A 2D7OA 4M6ML 1J0ZA 1TZHA 3S97C 1AHWA 1TZIA 4WTZG 4V1DB 4L1HA 3OAUL 1F3JB 4Y19B 3MRRB 3W9EA 4KZEH 4Z18A 5CZKA 1RJZB 3PGDA 3O6MH 4ZUUB 3F5WB 3QNZA 3VXPB 2MKLC 3IETB 3BKCL 2ESVE 4UV4L 4LHJB 2CDEB 5A2JH 1G7QA 1JHKL 3UCRA 4RDQF 1LO5A 3STZB 2OMNA 1B4RA 2X9YA 1IEHA 4N9GA 4P23B 1KLUB 1DL7L 1KPRB 2EYTB 4AJ0A 3NIFE 1EGJA 1AC0A 3DV6B 3TH4T 1Z9LA 3MACL 4LLAA 5T33H 1B4JH 1G6RA 4NKDB 5IJKC 1JPTH 3FFCE 2IPUK 1KXVC 1F4YH 1JWUB 4LU5H 1IAIM 4PLJD 3EO0A 5J6HA 2AJXH 4JKLA 4KPHL 5C0FA 2H26B 1AGDB 4PLNC 4TVPE 1RIVL 2ZZUT 2OL3H 3UTZA 3I50H 2PO6A 5IBLC 1RUPL 1NEZB 2MMXA 4APQD 3TZVC 3NTCH 3WJLA 2YMXL 5F7DA 3AS0A 1IAII 4Z78B 3V5KA 4JRXE 5I1CL 1FGNL 3HC3L 4HHAA 1W0VB 4MVBC 2DM7A 1KCSH 1EHXA 2J6EA 5FA4A 2Z8WC 1NC4B 5SX5H 4DK6A 3U4BL 1OQOA 3T3MF 4LAQH 4U0RB 1NPUA 3SE4A 4JPKL 4Y4KB 1UGNA 3GK8H 4GKSB 4GW5A 2X70B 2F54A 1EGJH 1MPAH 3HE6C 4L8DB 4PJ8A 3ZHDA 3P4NB 4KKLC 2CO7B 3VCLB 4X6CF 5F7UA 3L3DA 1ZLVK 1G6RH 4I13B 3QJFB 1Y18B 3E2HB 2P42B 3FQTB 5DEFA 1PQZA 1JTTA 3DMMA 1LP9F 2R4RL 4NM4H 4FXLA 3TFKD 4XVUC 1TDQA 5I1DA 1QRNE 4RIRA 4UTBL 1JWSB 3B2VL 3GBNH 3KPLB 4PRPD 4U6VL 2MFNA 5GGVH 2NW2B 1U58B 1I1YA 3WBDA 5HPOA 2E3VA 3K2UL 1H3PH 1QKZL 4JM4L 1XR9B 4RFOH 2J6EH 1U8OB 1LD9A 3HCVA 5GGSA 5DLMH 3CLEH 4QCIB 1UKTA 1KJVA 3DXAD 1QG3A 4MXQC 1I8IB 3B4NA 2I9LA 3VRIA 1GAFH 1KB5L 2XG4A 4ONGH 4Y16D 1G0DA 3V0WH 1JNLH 3RTQA 2P44B 2Z31A 3CX5J 1TVBB 4PGCB 4PJIE 3WXVL 3SDXE 2VLKE 4BUHA 3RWJA 4Q2ZA 4KQ4L 5JZ7D 4XB8A 2FBJL 1EFQA 3ES6B 1XZ0B 1A6AA 2DWEB 2I9TB 2BY3A 3CSYA 4EQ2A 5FKPB 4K07A 5FV1L 3T1FB 1CGSH 3W0WE 1XCQB 3CAFA 3UBXG 1N6QH 2EIZA 2QEJA 3O2VH 3OKKB 5C07B 5ESAA 3PIQA 4K3JH 1BX2B 3L95B 1ZHLB 4QKXB 4DTGH 2Q7YA 3HG1B 3VG0H 1W8OA 2Y5EA 1H9VA 3TESA 4X80H 4UT9L 4QT5A 1GGYA 3BOVA 2J5LB 1NCAL 3IXTA 2EZ0D 2AGJL 1U8IA 4XXDA 5T3XE 5BJTA 4Y88A 4YR6A 3OJMB 1TVHB 4OQ1A 4V2BA 1CFQA 2XKNA 2P8MA 2J2ZA 2VZTA 2HH0H 1KJ2L 1MCHA 1JPFB 1OP3K 3JV6B 1WC7A 4BZ2L 3IJYB 5FGCB 4F8QA 1T1XB 3MOAL 2RQ8A 3CIQA 1WT5A 2NXZD 4YC2B 3BT2H 4JY6B 3U4AA 3Q1SH 4M9OA 1TJIL 3ARGB 5C08B 1H5BA 2CIIB 2DQFA 4P49A 2Y25A 2YPKB 5FV2A 2VDQH 5DZNA 3WLWC 1F58L 3VFSB 2YSSB 2OL3B 5EG6C 1TZHB 1AHWB 1TZIB 3FRUA 5FHAL 2EDTA 2IMNA 2Y23A 4PJ9A 1L0YA 3W9EB 3BRGC 3ULUF 2Z9TA 4V2CB 5E95B 2F5BL 3BH8A 3VFVA 4JFQA 4YO0A 3PGDB 3LD8B 4EOWH 5IGXH 4I9WE 1LO4L 3MUGA 5K33A 4NQEE 4ZS6D 1KN2L 5D72H 1G7QB 4H20H 1ZA3A 1LO5B 4N0YH 2ICCA 4N9GB 4G3YL 2EEBA 2XYCA 2K3TA 3WS3A 4X6BA 4OD3H 4IOFD 3VWJC 1YEIH 3MBEC 3NH7H 1G6RB 2VTFA 4OSUL 1NFDA 3HUJA 5T3ZE 4JFEA 3EO0B 5J6HB 2VDKH 1WK0A 2C7UA 5T1DH 4LSQL 5C0FB 3D39E 3MQIA 4K94H 4TUJA 3R0MA 3B83A 1PLGL 3IS1X 3UTZB 3DSNA 2PO6B 1KLGA 2NY5H 5DEZA 4WI3A 5ALBL 5F7DB 3QFJD 4LKXA 2OR8A 5KVGL 3V5KB 2YXFA 4HHAB 5L6YL 2AP2A 1YY8A 4KDTA 3OG4B 5FA4B 1X9QA 5CLWA 5CEZH 5ESQA 1WFTA 3BZEA 5HHQA 2RGSA 1WLHA 1IKFL 2QADD 2Y6SC 4I18C 2APWA 1KCKA 2PXYC 4GW5B 2RCSH 4H1LA 3RDTA 2F54B 4NBXB 3G08B 1LO3L 4PJ8B 1HILA 1OP5H 5ERWA 3T0AA 4RZCA 1ZWIA 3L3DB 1FPTH 3PP3H 3RVUD 5DEFB 1PQZB 4HZAA 2X4OA 3R1GL 1SM3H 3DMMB 5I17A 1CR9H 3H42H 4G8EA 4XNXL 1BOYA 4K23H 2QQQA 2MCPH 2A83A 4XP1L 1N5YL 1YEHH 4P2QA 5I1DB 1HI6A 4RIRB 3WN5A 2Q8BL 4CN6A 4HF5H 4OZHE 1WWBX 5JOFA 2MQ0A 1I1YB 1X5XA 3TN0D 5J89A 4LARH 3NCMA 4QRRA 3WFZA 1L6XA 1ES0A 4QRPD 1LD9B 1CDUA 3BAEL 5SWSA 2G60L 3HCVB 5GGSB 3ULVC 5E8EA 2P8PB 3KYNA 1KJVB 2NZIA 3FT2A 3WUZA 5I1KH 3WFCL 4YDJA 1N64L 2ZJSL 3PL6A 1S5HA 1PY9A 5A2FA 4H1LH 3N1QC 2I9LB 5EUOE 3VRIB 4HS8L 5IROC 1HCVA 4ZTOH 3S88H 2XZQL 1BQSA 3KPTA 1HZHL 3RTQB 2Z31B 4X4YA 3VGBA 4ZFZA 4KMLB 2G75A 3EJJX 2IQ9H 1KGCD 5GS2H 1UH3A 4Q2ZB 1A7NL 2X9XA 3N9GL 4U4BA 4FRWA 5DVNA 1FL5A 5ENWA 4ZAKC 1A6AB 3S7GA 5C3LD 1UM6L 3CSYB 3VXRE 1AGBA 1V7MH 1EHLH 3E3QE 3VXUE 3IDXL 2EIZB 4L4VE 5ESAB 3PIQB 1O7SA 3PWPD 1RUQH 2Q7YB 3HRZA 1AY1L 4J6RH 5E4EC 3ULUL 4Y4FD 2XIDA 1UC6A 5D93C 1DQJA 3IXTB 3SJVA 5KANI 1U8IB 4XXDB 2HN7A 4JG1H 3MRJA 1K3IA 2BDNH 3D2UA 5BJTB 1VACA 4YR6B 4NO2A 4PBXA 3EYVA 2UZIL 5C0BD 1CFQB 1BJ8A 2CKNA 2XKNB 2P8MB 4ERSL 3QRFM 3BQUA 3TEUA 1OTSC 3H2WA 1JHTB 4D3CH 4PB0L 1WC7B 4YFLF 1IT9H 1LILA 2GY5A 5TE4L 3T2NL 3VDBA 1WAAA 2Y36H 1EJ6A 2OZ4A 2VXSH 3MOBH 2IEPA 1H5BB 2DQFB 3MV9A 1JYXA 3QUXD 3DX6A 5CJ5A 3C2AH 3AS3A 4XC3L 2Z92A 1IAIL 2YRZA 4YHLL 3FRUB 1YQVL 5LWYL 5DXWA 3BGFB 5F7YC 4PJ9B 1AQKH 3LEYL 2FCBA 1CFSA 3ZKND 3BH8B 3VFVB 4JFQB 4YO0B 1CICD 1QRKA 3HMWH 1YPZE 2JCCA 5TPWH 1LNUA 3MUGB 2KDGA 3C5ZD 4KZEL 3BKJH 5T5FH 1ZA3B 3O6ML 2XZZA 1AR1C 2ICEA 3ILQD 4WI7A 3EDDA 3PWJA 4GFTB 4EI6A 3WS3B 4X6BB 4FABH 4X9BA 1HHIA 4F9PA 5I66A 1GZPA 5FK9A 3SDDA 1NFDB 3HUJB 5D1QC 3TVMA 1RK0A 3KJ4C 4JFEB 4PJAA 4XC1H 4M48H 3I3EA 5T33L 4KJQC 2OZ4H 1B4JL 2ZUSA 2C7UB 1JPTL 4TUJB 2J8OA 1BD2D 1F4YL 4LU5L 1E4WH 1QPPA 2AJXL 1KLGB 2NY6B 3NFNA 5FYKU 1VFBA 4G9DA 3ARFA 3U4EA 3ZDYE 5DJCA 4LKXB 1QR1A 2OL3L 3EAKA 3I50L 2P5WA 3MV8E 3NTCL 3SDAC 4JE4B 5ESQB 3BZEB 5HHQB 3TBSA 3T3PE 1WICA 1KCSL 3ZKXC 3U30B 3NIDF 4MWFA 1CDYA 4H1LB 3RDTB 2P46B 4E41A 4ODHH 3EFFA 1HILB 5L8JB 4U6XA 5ERWB 4RZCB 3VI4E 1ZWIB 1U8KA 4LAQL 4P46A 1RZFH 2E5EA 3C6LC 4HEPG 3LQAC 3GK8L 2NR6C 2DQUH 4K7PX 2K1MA 4JKWA 4U05A 2X4OB 1EGJL 1MPAL 1QEWA 4Z7WF 5I17B 2IPKA 2DLHA 1W72A 4G8EB 4U33A 1G6RL 4QLRA 1ZE3C 2A83B 2F8OA 4P2QB 1HI6B 5B39A 4NM4L 2CRZA 4PRDA 1PG7H 4H26A 3WN5B 5L7XH 2VR4A 5JOFB 2ADGA 5C92A 4QRRB 4JFDA 3BKYH 1ES0B 4ODTH 3GBNL 2F8VA 5GGVL 4KROB 2YRPA 1OTUC 5SWSB 5FFLA 1H3PL 1QBLH 3G6JA 3WDIA 5E8EB 3KYNB 4H0HB 4PV9A 3FT2B 4RFOL 2J6EL 5GRVL 1J1XH 4YDJB 3BH9A 3PL6B 4ZSOE 1S5HB 1F97A 4CU7A 2B8OT 4LGSB 5DLML 3CLEL 4F7TA 5I0DA 2V2TA 3B6SA 2VQUA 3S37H 4X4YB 4ZFZB 2G75B 1NFDF 1GAFL 4ONGL 1W72H 3SKJH 4HWEH 3DNKA 4G8GA 4GS7C 3UTTE 1JNLL 2DQTH 1FL5B 4HV8A 5ENWB 4FQXC 4JFZH 5D9SA 4UAOB 3RVXD 3QPQC 3AM8A 1Q1JH 1AGBB 2AW2A 2XWBA 1S7XB 1KNOA 5LGKA 1NBVH 1ED3A 1SEBA 4JN1H 1QBMH 4EZMA 5IWLC 1YN7A 1YEJH 3BP5A 3BISA 4APQA 1CGSL 3D85D 3HRZB 1OOAA 1P7KA 3G5VA 1N6QL 2EDEA 3O2VL 4KKBD 1DQJB 1JPSH 3SJVB 1I8LA 2VWEC 4J3WA 4K3JL 2HN7B 3MRJB 3D2UB 4ODVH 4DTGL 1VACB 4X83A 3VG0L 1P84K 4NO2B 3EYVB 4X80L 4O5LH 4OCLC 4PJGA 3BQUB 2P4AB 4JHWH 1HOCA 1MI5E 2FZ3A 2NY3C 3X13A 2E9JA 2HH0L 4FFZH 1IM3A 3F12A 5KSBE 1MAJA 2NMSA 5E24E 3R0NA 1S3KH 1RZJC 3MV9B 2O5ZH 4KI1A 5DRZA 3QAZC 1Z0NA 1X5YA 3DX6B 3BT2L 3TGXA 2Z92B 3Q1SL 4QHNA 1HINH 4IM8A 2MCG1 2HRPH 4F33A 4J2XA 2VDQL 4HMDA 1CFSB 2A6KA 4PRPA 3JV4A 4J3OC 4MS8D 2JCCB 1LNUB 5CJOH 2D03H 1F42A 4P4RA 2UZXB 1HEZA 3W5NA 3SDCA 5TQ2H 1FORH 2F74A 4LCWE 2DWDA 1ZLSH 2G2RA 1H3VA 4EOWL 5IGXL 2ICEB 5MEOA 5ANME 3FOMA 1YYLH 1FZOA 1P5VA 1OT1A 3PWJB 1MY5A 4EI6B 1A7OH 5D72L 1A64A 4H20L 1HHIB 5I66B 4N0YL 3BFOA 1GZPB 5FK9B 4ZPVA 3SDDB 3RQ3A 5IBLD 4I48A 3S5LA 3TZVD 3TVMB 1RK0B 5HYQA 4XWGH 4HD9A 1LE5B 4PJAB 3UTOA 4OD3L 4Y16A 3EUUA 1YEIL 3NH7L 4N0FA 3ZKQD 2ITCA 3FZUC 1E4KC 3RNKA 5E2VH 3DYPA 1EVTC 1U8QA 5LJYH 4MVBD 1YECH 2H9GA 3NFNB 2VDKL 1VFBB 4G9DB 3ARFB 4KUZH 3U4EB 5T1DL 4JQXA 4K94L 4W4OA 5DJCB 1QR1B 1K85A 1U3ZA 5DJDA 4NPYA 2P5WB 4HMCA 2EXWD 2NY5L 1G7PA 1Q94A 2R56H 4NQDE 2IBZX 2PW2A 4KKLD 1QSFE 4HLZH 1KIRA 3QI9C 5B21A 1MQ8A 3MCLH 4YXHH 1ZTXH 5CEZL 2YUZA 4MWFB 3EFFB 1GOHA 2NY2C 4JRYE 4U6XB 4XVUD 4FTVD 3WLBA 1U8KB 4P46B 2EDNA 5HGHA 2CSPA 2VSDA 2RCSL 3GZKA 1QEWB 1MJJA 3BD5A 4XPHH 1ZVYA 3CSBA 4X4XA 2HMIC 1W72B 1WAAF 1IQWH 5IMMA 1FPTL 4XNQA 5B39B 4P9MH 1CR9L 4PRDB 5J13C 4H26B 3H42L 1U91A 5IMLA 2PN5A 5DJ0A 4K23L 1JI1A 2ADGB 2MCPL 4PRID 1MREH 1YEHL 4YXKH 4YPJA 4BQ6A 4JFDB 4FZ8H 4OCSH 4HF5L 4M7LH 3QULA 4MXQD 2P5ED 3CVHA 5JQ6H 4LARL 2JCCF 2MQCA 5F3HA 1GRWA 3G6JB 3IDUA 1PJ9A 4F15B 4PV9B 5L8LB 5IW3A 3BH9B 2DI8A 3FKUS 3U83A 1N0XH 5HGDA 3VWKC 4F7TB 2V2TB 5I0ZA 1OF2A 2J4WH 3GSUA 3B6SB 5I1KL 4FQ1H 1ZT4A 1T89A 1R5IA 2Q87A 3VMNA 3QSKB 2X1WL 3IFOA 4ZTOL 3S88L 3OF6D 3QDGA 3ARXA 4M1GH 4ZDHA 1G9NH 2SEBA 5ACLA 4HV8B 2VZVA 3QUMH 2IQ9L 5D9SB 1DQMH 1S9XA 2QHLA 1WIPA 1NUGA 2RBLA 2P47B 2XWBB 5EORH 2FRGP 4AEFA 1KNOB 4CNIA 1ED3B 4KK8C 1SEBB 2XN9E 3TJHC 1KCUH 1E28A 5I8KH 1YN7B 4HAFA 4JCMA 3CVHH 3BP5B 5B38G 1M4KA 4APQB 1EHLL 2XA8H 2AXGA 2EIEA 3OPZH 3QFJA 1P7KB 3G5VB 5DUPH 5HD8D 3PWLA 4Y7MA 1T1WA 1EEUA 4X7DC 1RUQL 2YZ1A 4J6RL 1BFTA 2YD2A 3TC9A 1K4CB 4PJGB 2DQGH 2JJVA 4JG1L 2BDNL 1EDQA 1HOCB 2FZ3B 3NFSH 1MCKA 3WLWD 5DUMH 3F7YA 3X13B 4J3UA 1Z9MA 2QTEA 1IM3B 1E27A 4D3CL 5HHVH 4F57H 2CH8A 1IT9L 4MDIA 5IBTH 4I2XA 4D2NA 5DRZB 4G80A 4D94A 1MWAA 2Y36L 4QHNB 5DVOA 2VXSL 3MOBL 3QEQE 1CIDA 2EDKA 2WSKA 4F33B 4LCYA 5IOPA 4O02H 3LCYA 1MCCA 2AQ3A 2A6KB 3C2AL 4PRPB 3RIFF 4LLMA 3JV4B 4QRQA 4R9HA 3T3ME 5HI3C 3TN0A 1JRHH 3G6JF 1S7SA 1AQKL 4TPRH 3ZYIA 3W82A 3L3HA 4WHYH 3VWJD 4P4RB 1HEZB 4R97B 5BW7C 3SDCB 3M8OH 4JFHD 2NX5E 4QRPA 2F74B 1MJ7H 2DWDB 3HMWL 2G2RB 4X6CE 5TPWL 5MEOB 1GIGH 3FOMB 2NY4C 1FZOB 3BKJL 4IIQC 5T5FL 1LP9E 2Q86A 4QEGA 2WP3T 3IRZA 4MNQE 5DRNA 4JREC 4EJ1C 1C16A 4JHBA 1U6AH 4ZPVB 2JJSA 4I48B 3OQ3B 3S5LB 3P9WB 5HYQB 3A6BH 2NY1B 4HS6A 4Y16B 4FABL 4N0FB 1I3VA 2ITCB 2YRLA 3GSQA 3DYOA 4L8SC 3RNKB 1MH5A 2QSCH 3PXJA 1U8QB 1V05A 4V1DE 1K9TA 1LK2B 1U8HB 4Y19E 4XC1L 4M48L 4CVZA 4G5ZH 4MNHA 2OZ4L 4NKOA 1SVCP 1HHGA 2K7PA 4EEEA 4QXGH 5H37G 5CKGA 1E4WL 5DJDB 1F4XH 4NPYB 5IFJA 2PXYD 2DM4A 1G7PB 2MHAA 4F8TA 1II4E 1YMHA 1Z6JT 2JJTC 3W11C 3BX7C 2PW2B 4PRBA 3REVA 1V7NH 4WFHE 1KIRB 1ZV5A 4NN6C 5J56B 1ZT1A 3PWPA 3CDCA 1TXKA 1B0WA 2WWKT 3O6FC 4PJGF 4Y4FA 3WLBB 2KZ1B 1NUFA 5HGHB 3QIWC 3MV11 5DD0H 4C55A 4ODHL 1MJJB 1DLHA 4X4XB 5KAQG 5C0BA 2DKSA 3TJEH 1PAMA 5IMMB 3KLHC 1RZFL 1GYAA 3JWDH 3C60C 2DQUL 5J1TC 3O45A 4XNQB 1YNTA 1X6NA 2NY0C 2C4FT 4YX2H 1U91B 5IMLB 5DJ0B 3LPFA 3ARDC 3OB0K 4PG2A 3ULVD 3HRPA 3BMWA 1PG7L 5DMIH 3QUXA 5L7XL 3QULB 3CVHB 2VITA 5F3HB 2GAZA 3BKYL 5IVZA 2W1NA 4ODTL 1F11A 3CFEA 3CDYA 3INUH 5HYFA 4Q6IC 4HH9A 4EI5A 1CICA 4JPWH 4AQ1B 5HGDB 1A7RH 1QBLL 3BZFA 1I7RA 3AREC 1OF2B 4JDTH 3GSUB 3DURA 3C5ZA 4KVNH 1J1XL 1MCWW 4J3XA 2HLFC 1ZT4B 4ZAKD 4LEXH 3QUZC 1R5IB 2VIRA 3VD9A 4U7MA 2OTWA 5T1KA 4ZO6A 3TPUA 3IFOB 1E6OH 2IAMD 2E6PA 3QDGB 3S37L 4ZDHB 4I0PC 5I8EA 2SEBB 2WUCH 5C0IA 3CC5A 4HWEL 5AAMA 1T2JA 1S9XB 1W72L 4JZOA 3SKJL 3V7AG 3ULUE 2DQTL 5IW6A 4CNIB 4JFZL 3PABA 1X5IA 1E28B 1NDMA 1J0KA 3IT8D 1Q1JL 2FH6A 4YBHA 2FJHA 1J7VR 5TQ0H 3O4OC 4UI2A 1NBVL 2AXGB 4JN1L 1QBML 3QFJB 2GIYA 3T0XA 3ZYZA 3WL9A 3PWLB 1T1WB 1YEJL 1XH3A 2ZPKH 3PUCA 4Y2OA 1H8OA 5CHNA 1JPSL 8FABA 1TZGH 2QADB 1LEKA 1QSED 4ODVL 4OFVA 3CVIL 3F7YB 3HZYA 3QIBC 2X6MA 4O5LL 1NGPH 3QT2A 5EPMA 1E27B 4JHWL 4MDIB 4I2XB 4RMVA 1AGEA 4G80B 5K9OA 3FN0L 5FO8A 1MWAB 4FFZL 5EZOH 3MUY1 4L9LC 1KYOK 1S3KL 3AXLA 2O5ZL 4LCYB 4UDTA 3HG1E 3MFGB 5IOPB 2E7MA 3QHTC 1U8MA 3OAZK 2IH3A 1AR1D 4LLMB 4QRQB 1HINL 3MA7A 4FHBD 2I24N 3TN0B 2HRPL 4QHKI 1S7SB 1KCVH 4ELKA 2WWMD 3L3HB 1MHCA 5I30H 1GC1C 4P5TA 3SN6N 4QRPB 3SQOH 2APTA 4JM2D 2RHEA 5CJOL 4KJQD 3QUYD 2D03L 5CEXA 3RVTC 4LQFH 4P3WA 2KUTA 5TQ2L 2Q86B 1FORL 3T0DA 5DRNB 1ZLSL 1C16B 4WEMB 3DROA 5J6GA 1NLDH 5JIHA 1I3GH 1YYLL 5C08E 3VFRB 1A7OL 4HS6B 3S3SA 4YGVA 1ZAGA 5F8RC 1NJ9A 3QXUA 3GSQB 4PB9H 4LDEB 1MH5B 3HPJA 4JDVA 3V6BR 4U1NA 4XWGL 3SDAD 4YEFA 4CVZB 4MNHB 3K46A 4NKOB 4GG6A 1HHGB 1U36A 4JHZA 5E2VL 1C08A 2V2XA 1YECL 3O41A 4MYWB 4TQEH 5IFJB 3P4OA 2MHAB 5HDQH 4KUZL 1YMHB 3MJ8A 4KC3B 1FNFA 4PRBB 4XVTH 2VJXA 1NKRA 3REVB 3RJDA 4KVCH 4KRPD 3C6LD 2NR6D 4HKBA 2EDXA 2R56L 1ZT1B 3NN8A 3PWPB 1PX4A 3D85A 4A6YH 1MFCH 4NRZA 3PWUA 2WBJA 1MRDH 4Y4FB 3IFPA 5IB1A 3K74B 3MCLL 4YXHL 1ZTXL 4HW6A 3E1F1 1YMME 1WBXA 1DLHB 4YGAB 2WLYA 5C0BB 1FVCA 5CP3A 1G9MH 3DJ9A 3O45B 4JFFA 1YNTB 3EYQC 2UUDH 4XPHL 3VFPB 2EKJA 4PRNA 1IQWL 4NHCH 3TCLA 3DWTA 3NGBB 4P9ML 4MNGE 3CZFA 4IMLA 3QUXB 3RA7H 2VITB 4OF8A 1MREL 3KGRA 5HVHC 2AK1H 4YXKL 1HWHB 2GAZB 4FZ8L 3S9DB 5IVZB 4OCSL 1A6ZA 1F11B 3CFEB 3PNWA 2Z91A 4NCDA 5JDJA 2WANA 1DQLH 4HH9B 3U82B 4NQVA 4EI5B 5JQ6L 5GRJH 1CICB 1G0YR 3BZFB 1I7RB 3DURB 3C5ZB 5IB3A 3HC0A 3IU4H 5IJKA 4FQXD 4HUMB 2VIRB 4NDMB 1N0XL 4RFNB 4UIMA 1SBSH 2OTWB 3QEGH 1Q38A 5T1KB 5HHXH 2W9DH 3ESUF 1UEMA 2J4WL 3QPQD 4OLZH 5CP3H 5F1IA 3TPUB 5JA8B 4FQ1L 4CW1A 5I8EB 5I73C 4KTEH 5KSVA 3KJ6H 5C0IB 3CC5B 5DMJB 4JZOB 2M2DA 3TZVA 3HAEG 4M1GL 1DBAH 1G9NL 5IW6B 3QO0A 3QUML 1VFUA 1MCPH 3JZ7A 3PABB 1DQML 1VADA 1NDMB 4P3DA 4XP5H 4QXUH 4RMUA 2FJHB 5EORL 3CFKA 4G6MH 1JV5A 1INEH 1KCUL 4TVSa 4Y5XC 3WL9B 5I8KL 5MHSD 3CVHL 1XH3B 2NY3D 2VRAA 2XA8L 2OMBA 4ORGA 3OPZL 1P7QD 5BV7C 5DUPL 3WYRA 5CHNB 3DLQR 8FABB 4LLYA 1LEKB 2FHBA 3ME0A 3DARA 4OUOA 3TYFA 3EOBA 4D0BA 3M07A 2Y4SA 5D1XC 2XI9A 3HZYB 4QHUA 2DQGL 4M8VA 1MF2H 5EPMB 4FTVA 4I0CC 1AH1A 3O9WC 3NFSL 5DUML 1HHHA 2AJUH 1AGEB 5K9OB 5FO8B 5HYJE 3CDGA 5HHVL 4F57L 2O61A 5T5NG 3AXLB 5IBTL 4UDTB 3I6KA 5AD0A 1U8MB 2IH3B 3MA7B 4OZFA 4P2OC 1NSNH 2PTVA 4PRIA 3B9KC 4ELKB 1NBZA 1EUUA 3NIDE 3JWOC 4O02L 1MHCB 4P5TB 4YIQA 2P5EA 4OZIA 1CFVH 2BP3A 4ZUTA 1JRHL 2ITDA 4TPRL 1A9BA 3DGCR 5D7LE 5CEXB 1GOFA 3FZUD 3LN4A 4NQXA 2HJFA 4Z7WE 3M8OL 3QDME 1CDJA 1FL3A 1MJ7L 2GK0A 3DROB 4XMPH 5J6GB 1GIGL 3MPCA 1J88A 2VLLA 1H3WM 4YGVB 1NJ9B 1PEWA 4JDVB 1VHPA 3HPJB 4LOUC 1U6AL 2N7AA 3CFBA 1NAKH 4U1NB 3A6BL 4G43A 3OF6A 4HIXH 2XPGA 4GG6B 4MHHG 1WFUA 4JO4H 2PYEE 2QSCL 1C08B 2V2XB 1LEIA 3QI9D 1VFMA 4YBLB 1BZ9A 1FNLA 3P4OB 4GXUM 1R0AH 4G5ZL 5A40E 4JGUA 3OKMA 2QQKH 3MJ8B 4G9FE 3VJ6A 2NY2D 3GI9H 4XRCA 4QXGL 5A2LH 1KCLA 1J5OH 4FQLH 4TULH 1F4XL 1EX0A 4HKBB 5BOZG 1CD1A 1OAQH 5F9WB 1HSAA 2WBKA 3NN8B 2HMID 3D85B 1V7NL 4JEGB 3PWUB 4NRZB 2WBJB 5IB1B 3IFPB 1NFDE 2D4FA 4YUEH 2YD6A 4JFEE 3V6FA 3V9FA 4UQ3A 4D0CA 1FVCB 1X4ZA 3QDJD 3QB7C 4PGEA 3P2TA 1M7DA 4JFFB 5DD0L 5EH1A 4PRNB 3TJEL 2BNUA 2BY1A 3JWDL 3BZ4A 3L9RA 3HE7C 1W2KT 3TCLB 1DBKH 3V95A 4WO4A 1GH7A 4YX2L 3CZFB 4IMLB 3FQWA 3JXAA 4R8WH 1TLKA 3VWKD 4C83A 2D3VA 4NP4H 3OX8A 1FC1A 1A6ZB 3H9ZA 2BSED 3PNWB 2Z91B 5DMIL 5MEND 5D2LA 4NQVB 2OTPA 3MLZH 5FEBA 3C2SA 2AS5M 3DO7A 5CBEA 3D0LA 2BFVH 5IB3B 3O2DA 5K93A 3HC0B 3VWJA 4CL7A 3INUL 1OWRM 3CFDA 1ZEAH 4Q0XH 4KXZH 4JPWL 3B9VA 2YD1A 4UIMB 1A7RL 4N0UB 4DN3H 4DZ8A 4JDTL 5E7BA 5F1IB 1C5CH 4P2QE 4KVNL 4CW1B 4LEXL 4KK8D 3TJHD 3BZDA 5GS0H 5KSVB 2RIKA 5IESH 4G8IA 2ZCKH 3WIHA 5BO1H 1E6OL 3TZVB 1D5BA 5IFHH 3K8MA 5JIPA 1JYWA 4UOW0 3QO0B 3QR2A 2WUCL 5DDHA 3UXFA 3EOAA 1VADB 4P3DB 5KG9A 3CFKB 5H35A 1FZKA 1S7TA 1JV5B 1AO7E 2IC2A 5L9DH 5KJRH 4JB9H 1QYGH 4I18A 1IM9D 1ORQA 1RULH 2PXYA 3P0VH 5TQ0L 5K9KA 1FO0A 3VDCA 3B5HA 4ORGB 1AC6A 3P0GB 1P5UA 1NLBH 1DBMH 3D69A 5TJWK 3O2DH 1I7ZA 2VERN 4LCUA 4LLYB 5JW4Q 1CWVA 4HUWA 1JTOA 2ZPKL 3TYFB 3EOBB 1NMBH 4D0BB 3O2WH 4QHUB 1TZGL 4FTVB 1E4JA 4LVHC 3UPRA 3L3GA 1JGVH 1JGDA 4KXZI 1HHHB 3WIHH 1VKXA 4HBQA 4M1CC 2FB4H 1NGPL 2D7PA 2FX9H 5HI3D 3CDGB 2W38A 3IDNA 2O61B 2OR9H 3ZT6A 1GGTA 3CU7A 3I6KB 1WWWX 1T1ZA 4LDOB 5AD0B 1RZ7H 4EUPA 5EZOL 3F7VA 4IEFB 4OZFB 3N85H 2NY4D 3WS6A 4PRIB 4AYFA 3O8XA 2APXA 5KAQF 1NBZB 3QCUH 4WW2A 2ZUQC 1A4KA 1LEGA 4YIQB 5F7LB 4PP2A 4CVUA 5SV4A 2P5EB 4OZIB 2ITDB 3K8KA 4WWKC 1KCVL 3OKEA 4MCZA 5IROA 1A9BB 2DRUA 2JKXA 3LN4B 2X9WA 4UINH 5I30L 4NQXB 2HJFB 3F62A 3I6LD 3SQOL 1FL3B 3U2SA 1WAAE 4WUUD 1YYMH 2GK0B 4BFIA 4JVUA 1T83A 5JR1H 5FYKD 2VLLB 4LQFL 3MV9E 1HSBA 4HPYH 3TH2T 3KYMA 4HX1A 4ZAKA 1NH6A 5C6PB 3UAJC 3CFBB 1I3GL 4UOW1 4OF3A 4XWOC 2ZWLT 4G43B 3RWCA 1CFTA 2IAMA 2XPGB 4PS4H 3W11D 3GNMH 4PB9L 3H0TA 3CX5K 2WAHA 4OLUH 4ODBD 2C3VA 5EZIH 1LEIB 2WBWB 1BZ9B 2JCCE 2OS7A 2OXGA 4EUPH 3OKMB 1ZA6A 4PFEA 3ULVH 1J11A 3VJ6B 1U2HA 4LVOC 2D4DA 4XRCB 3O6FD 3I75A 4TQEL 4AMKH 2EH7H 1NMAH 3QIWD 3MRHA 1CD1B 1QNZH 2FATH 5HDQL 1HSAB 1BQHA 4NC1E 1J9CT 2B39A 4X6FA 4XVTL 5DUBA 2BSRA 3KLHD 1SBBA 4KVCL 2IADA 1FZMA 4ZFOA 2R0ZH 4KK9C 2NY0D 4UQ3B 1ROWA 1N4XH 4LRIA 2ZCHH 5CGTA 1MFCL 1ZLVH 4A6YL 4D0CB 4ZNEA 2YD9A 3N06B 3ARDD 1MRDL 1WZLA 3N1FC 2W59A 2N4IA 4PGEB 1JWMA 2GI7A 2V5TA 1YZZA 5DJAA 2AI0H 2FO1A 1HKLH 2BNUB 1G9ML 5FO9A 5FA3A 2X4QA 3BZ4B 3L9RB 4WW1A 4WO4B 3GJFK 4ZO8A 1H15A 4GRWH 3FT4A 2UWEA 3FQWB 4NHCL 3U36A 4C83B 3ARED 5JOPE 3OX8B 1A4JA 1OGAD 4OZ4A 1REIA 2HLFD 2A9NH 3QUZD 4E41E 3RA7L 2DBJA 5ADPH 1G7IA 5D2LB 4OZIF 3MRMA 2AK1L 3DO7B 1DN2A 5CBEB 1G84A 3D0LB 3T4AA 2V7NA 3K8LA 5EZJA 4I0PD 4PYGA 1EK3A 3VWJB 1U8PA 1DQLL 3CFDB 3NCJH 4U1SA 5GRJL 1UH2A 4JM2A 1HNFA 3MLRH 4DZ8B 1DP0A 3O6KH 3QUYA 1HYRC 3IU4L 1IILE 3UTPE 1OHQA 5J9PA 1FDLH 3LPGA 1SBSL 3QEGL 5HHXL 4G8IB 2W9DL 4J3SA 4OLZL 3RUGF 3LRGA 4OIIH 1Q8MA 1IL1A 4HXAH 4JFDE 1D5BB 1CVSC 2V5RA 3UMTA 2X1OA 5D8JH 4KTEL 2BNRE 4MB5A 1MAKA 2C4FU 3KJ6L 5DDHB 3GB7A 3QP3A 3EOAB 3G6JE 5KG9B 3SDAA 1NCCH 1DBAL 5H35B 4ODWA 4YFEA 1FZKB 1S7TB 3KHQA 1MCPL 2X7LA 3GGWA 4P4KC 3U46A 5LGHH 4I18B 4XP5L 3MRGA 4QXUL 1ORQB 4C56D 2PXYB 3MO1A 4G6ML 3SBWC 5K9KB 1FO0B 4OLWH 3D5OF 3EYOA 4NNYA 1INEL 2DIJA 3QIBD 4QTIH 3D69B 1I7ZB 1KENH 4LCUB 2YBRA 3C6LA 3QNXA 1D7FA 4Z76A 4HUWB 4G8GE 4C59B 4HKJA 3WDJA 3KXFA 3KYKH 5C9KA 1OP3H 1BJMA 2VUYA 4AK1A 5F96H 3UPRB 3L3GB 3CH1A 4YE4H 2L7JA 1A9EA 3ZE2F 1JGDB 1Q9OA 1XAUA 3TLRA 4OM0H 1VKXB 5C0CA 1HXMB 1MF2L 5I1HH 4Y1AE 3IDNB 3VGDA 2AJUL 1YJDH 2B20A 1T1ZB 2Y1VA 4HUNB 3F7VB 3R06A 4RGNB 4R90H 3O8XB 1LE9A 3RVTD 5CJ8A 4MLSA 4WW2B 2J1KA 2VC2H 1A4KB 4PIRF 1LEGB 4PJBA 1OP9A 4PP2B 1FL6A 1JTPA 1NSNL 4LHUG 4PJGE 4RGMC 4X5XA 3FN3A 3OKEB 4MCZB 1FAKT 4D9QD 2R0LH 3JTSA 4NQSA 1CFVL 2ARJQ 5DURB 4BFIB 1UZ6F 3TBVA 4C57C 3R8BB 1HSBB 3TO4C 4WGVB 3KYMB 2DKMA 3GSNA 4HX1B 4ZAKB 4FQXA 4XMPL 4M7KH 5F9OH 3ARZA 3IYLW 4O00A 3RWCB 1CFTB 2IAMB 4ELMA 3F7RA 3UZVB 1YDPA 1OQXA 3H0TB 1P2CA 5TGBA 4MB3A 5IWLA 2C3VB 1NAKL 2DMCA 3LKSA 3NACH 5IB4A 1G6VK 4ZUWA 1NFKA 4GRWB 1H3XA 4HIXL 5HDBF 1ZA6B 4JO4L 2NTSP 5LGJA 4XXCA 4U1GB 2CLVA 4NN7C 3I75B 2DLEA 1R0AL 4MQSB 3MRHB 3W81A 2QQKL 1B6UA 3LS4H 1BQHB 4E9LA 4X6FB 5DUBB 4J4PD 3GI9L 2BSRB 1J5OL 4FQLL 4TULL 2IADB 1FZMB 4ZFOB 3MXWH 1OAQL 2CXGA 4CUCA 3EYQD 5F88B 5D2NE 1UH4A 4FQJH 4NNPH 2ICES 1P7QA 3DRQA 4RBPK 5IR1A 5FGSA 4YUEL 3GSNH 1JWMB 3OZ9H 4BELD 1JFQH 5DJAB 3TBTA 4D8PA 3EW3B 2QL1A 5F6IB 5IKCA 2DMBA 5FO9B 5FA3B 2X4QB 3OB8A 1CT8A 4IMKC 3H3KA 4GAYA 4JFOA 4WW1B 5EOTA 4N9OB 1OL0A 1H15B 2B1AL 1GXEA 3FT4B 2EIDA 2UWEB 5JPNA 3ISWA 1D6EA 3U36B 3QJHA 1FAIH 1DBKL 3BWAA 2QSVA 1JJUA 1A4JB 1Y0LA 1OW0C 4OZ4B 4WW2F 3DRTA 2DQIH 4R8WL 1G7IB 3FB8A 3MRMB 5I75B 4NP4L 4LSSH 3KPRD 1SMOA 2ORBH 1LMKA 3T4AB 2V7NB 5BS0A 5EZJB 1VFAA 1U8PB 2FNBA 1WVZA 4U1SB 1T7VA 5LKNA 3MLZL 5EBWA 1MVFA 4JM2B 4LNVA 1JZ4A 3VXME 1XF2A 2BFVL 5D7KD 3QUYB 1JIBA 1ZEAL 2WQRA 4Q0XL 3BD4A 5J9PB 4DN3L 4Y2DA 1C5CL 1IL1B 4QGTA 1I1RA 3FQRA 3T2QA 5B4MC 5KN5A 1XGPA 5GS0L 5IESL 3GB7B 1AGCA 3RPIA 4NQUA 5BO1L 4G6AC 5IFHL 3SDAB 3GSWA 1A7PH 1EA9C 4K8RC 4ODWB 4X4ZA 3E3QC 2X7LB 3GGWB 5BMFH 4KRMB 3U46B 2MSPA 4M9PA 3QI9A 3ZKXB 3MRGB 3F7QA 5D7IA 2D7MA 4ONOA 3DIFA 3BXNB 3MO1B 4DEPC 1YC7A 4XI5C 5D1XD 3EYOB 4NNYB 5CZXC 5L9DL 5KJRL 2D9QB 4JB9L 3B9DA 1QYGL 3GSRA 4KJWC 1CXKA 4QHKJ 1PVHA 3O9WD 5ISZD 1RULL 2YBRB 4KRPB 3C6LB 3P0VL 3QNXB 4KJYA 4Z76B 2PTUA 4ISVA 3I3BA 5J4MA 3QDGE 1NLBL 4HKJB 2C3XA 4OM1H 3KXFB 1DBML 5C70A 3O2DL 3P9MB 5E8PA 3HFMH 1EMTH 3CH1B 1A9EB 5I1IH 1Q9OB 4DJMA 3O2WL 1ZVSA 5C0CB 5EC1A 3ECBA 2AK4D 4BQ8A 3QDJA 5C0GA 3B9KD 4PJFA 1JGVL 4FNLH 3WIHL 1J10A 4KRNA 2FB4L 4OCXH 4QO1A 5DVMA 2FX9L 3Q5YA 3R06B 1M05A 2AEWA 5FYJD 2OR9L 4HLJA 3FJTA 1LE9B 1JZ2A 4MA1C 2WP3O 3KS0J 2DMKA 2IBBA 5GS3A 1RZ7L 2X4NA 2F15A 4PJBB 1NUDA 1FL6B 4HK3J 4X9FA 3N85L 4O4YH 1F02I 4X5XB 3VWKA 3QCUL 2AKRA 3S3PA 1T04A 4S11A 4PLOB 3PQYD 1ZLUK 1FSKC 3JTSB 3H9HA 4LOUD 4P48A 2RB8A 4NQSB 5MENA 3S8WA 4M6NH 3TBVB 3WFDH 4JANA 4UINL 4I2XE 1RZKC 3LB6C 2AEPH 3GSNB 2Q1EA 4FQXB 2Q7NA 1YYML 1ZT7A 4K7PH 1W8NA 5JR1L 5IBUG 4HPYL 2A1WH 4ELMB 4B41A 1WQVT 1YDPB 1V3JA 1P2CB 1MFEH 5TGBB 3F7PC 3LKSB 2OI9C 1XGUA 5IB4B 4ZUWB 1YA5A 5LG1A 4BSJA 5HXMA 3KPNA 3FHAA 4PS4L 3GNML 4XPBH 1KB9K 5LGJB 4OLUL 1NAMA 2CLVB 5EZIL 5KVFH 3VXSD 3GMOA 3FL7A 3U9PH 5KVEH 5I8OH 5HHNA 3ULVL 5GJTH 4YBQD 3UTSE 1CDHA 2VUOA 4AMKL 2EH7L 1NMAL 5DO2D 2DICA 2WIMA 1QNZL 2FATL 2J3SA 1LVEA 2NY3B 3NPSC 1P7QB 4LLQA 2R1WA 1JMZA 3DRQB 3RGHA 2R0ZL 3HE7D 4LKCA 5IR1B 3SKMA 2PUQT 4PY7A 43CAA 3BJLA 5I8CB 2BOBA 1FFOA 3AB0B 1GPOH 1FE8H 5HYIA 2DJUA 3TBTB 1N4XL 2ZCHL 4D8PB 1UXSA 4YK4C 1AQDA 5IKCB 1G7LA 4WHDA 1CT8B 1PZUB 4GAYB 4JFOB 4Q9RH 4UMGA 5EOTB 3G5ZA 4XBEH 5EU7E 4KI5D 1DVFA 1R3IH 2AI0L 1HKLL 5CSZA 5JPNB 2YA0A 1D6EB 5GGRB 3QJHB 1NAMH 5C09D 3MUJA 3BWAB 1JPST 1Y0LB 3UX9B 3DRTB 5BW7A 4RCAA 2FLRT 3FB8B 1X5KA 2IALA 4IIQA 1BFVH 2A9NL 1VFAB 2OLDA 5ADPL 1XIWC 4YH6A 4LHQB 3DVGA 3LQMA 3PHQA 5EBWB 2V9QA 1XF2B 4BA8A 3BP4A 4ZFOL 3Q6GH 4KQ3H 4L8SA 3NCJL 3BPLC 4WUUA 5FECA 5GRYA 3BMVA 3MLRL 4Y2DB 3O6KL 1J8HD 3FQRB 5A16A 2NTFA 5KN5B 1XGPB 2CXKA 2ILLA 1FDLL 4YHKH 1IKNA 1AGCB 3RPIB 4OIIL 2Z8SA 4HXAL 2CK0H 3C09C 3GSWB 5D8JL 5TFSH 4GBXC 1NGQH 3ARSA 2M26A 3WE6A 4XB7A 3QI9B 2BJMH 5D7IB 4QWWC 3DIFB 3K1KC 1MIMH 1NCCL 4IRZH 1Q72H 4YDLC 2NY2B 3O6FA 3GSRB 5LGHL 2EE2A 3KAAA 3QIWA 4OLWL 4ISVB 2IGFH 4ODXA 4QTIL 4M1CD 3TYGH 4DVBA 3EYUH 1KENL 4ZO9A 5E8PB 1FCCA 4OCNC 4WGWB 3RX5A 3KYKL 5D1ZA 2E27H 4L3AA 1ZVSB 5EC1B 3ECBB 1QFUH 3ARDA 5F96L 1H8NA 3MLTA 3QDJB 5C0GB 4PJFB 4YE4L 4GAGH 4OM0L 3ARRA 4LVNC 3BUYA 4FZEH 5I1HL 1M05B 5E9DE 2ESVD 1NC2D 5CINH 4HWBA 3EGSA 1YJDL 3ZKSD 5KS9A 5KVDH 4JO3H 4Z7VA 5TDPA 2XZCH 4Q6IA 3GHEH 2X4NB 5SWZE 3VWKB 4R90L 3AREA 2AKRB 3TA3C 1T04B 4PJ5A 2VC2L 5MENB 3FFCD 3H9HB 3UAJD 5H2BA 2OX5A 3MNWA 4XWOD 2W91A 3BIKA 4JANB 3ZHLA 2VISA 2R0LL 4RDQG 5CD3A 3GEWB 2F9BT 4TVPD 4FG6C 1ZT7B 4OT1H 1RQ5A 4NIKB 5JDSA 3C08H 4L4TA 5J57B 3IFLH 2JF1A 2OSLA 4JRXD 5C86A 2JLLA 4M7KL 2BSTA 4MD4A 5F9OL 1XGUB 3F65A 3QG7H 3L6FA 4BFEA 3KPNB 1SYVA 3GJEA 4HWBH 4JFPA 1NAMB 2DLIA 1Y6MR 3NACL 4JVWA 3T08A 1J0IA 4JJ5A 3GMOB 4TSBL 3QWOA 5DGRA 3S4SA 2NCMA 3LN5A 1JK8A 5HHNB 4M6AA 4X9GA 1OAZH 5KSAA 3ZE1F 5GGTA 4Z7UA 2G9HA 5A3ID 1FP5A 2R69H 2JJWA 3LS4L 5TF0A 1RZIA 3B8YA 1OAYH 1WBZA 3OKNA 4LLQB 2R1WB 3MXWL 4LKCB 3SKMB 4PY7B 5E2TH 1OSPH 43CAB 1QRND 2BOBB 1FFOB 4FQJL 3M45A 1UXSB 4NNPL 1H8SA 1AQDB 1NCWH 3RVWC 4O2FA 1G7LB 4Y4HA 4PJHA 4OKDA 3GSNL