5B7FA

Structure of cueo - the signal peptide was truncated by hrv3c protease
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
486
structure length
463
Chain Sequence
RPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical, spectroscopic and X-ray structural analysis of deuterated multicopper oxidase CueO prepared from a new expression construct for neutron crystallography
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase CueO
total genus 142
structure length 463
sequence length 486
ec nomenclature
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7fA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7fA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7fA03
4MFHA 3FS9A 1E5YA 3NYKA 1BEXA 1WAEA 4KO9A 1AOZA 3UADA 3MX0B 3S8GB 4E9XA 4TXVB 5I26A 5EHFA 4P5RA 1KCWA 1AS6A 5TK4A 1JVOA 1J9QA 1SHWA 4GP4B 2BWIA 2HLEB 4YSUA 3U25A 3CDZA 1L9OA 1IBZA 2PPAA 4E9YA 3IEAA 2ZXWB 1NWPA 1ZDSA 1L9SA 5I5JA 2XX0A 3T71A 2BO0A 1PAZA 2BP0B 3FQ1A 3FU8A 6PAZA 1JZHA 1MG3C 2XXGA 3SBQA 1GS6X 2XV3A 3PAZA 3EF4A 3ZBMA 4QLWA 4AKPA 1SFDA 3OQRA 2YAPA 3OMAB 2TSAA 2E86A 1M56B 2GI0A 3ASNB 3QJUB 4DP6X 2DYRB 2YAEA 2PCFA 2Q5BA 2ZOOA 1NPNA 3S3CB 2FNWA 4A66A 2Y1AA 5I6OA 4F2EA 3QJQB 2J5WA 2LLNA 1PCSA 1I53A 1TU2A 3QJRB 4G7QB 4KNUA 1ZIAA 2VW4A 5B3SB 1PY0A 1WA2X 3X2QB 1MZYA 2I85A 3NJNA 2MTAA 2CUAA 3S3DB 3GDCA 1KGYE 4RH4A 3EH4B 1PMYA 2DWSA 3H56A 3NT0A 1L9RA 1RKRA 1XB3A 3JTBA 3TU6A 3UACA 9PCYA 1L9QA 4YSAA 1OF0A 4E9TA 3MBWB 3T6VA 3GYRA 4BWUA 3TASA 4YSEA 4A67A 5PAZA 4DP1X 3FYEB 3IBOA 2IAAC 2J57A 4Q89A 2CBPA 4G7SB 1GS8A 4KNTA 2UXVA 1SDDB 5B7FA 2YAMA 3ZX1A 2IH9A 3ABMB 1HAWA 2JKWA 1AZNA 4YVUA 4DP2X 1MDAA 5I6MA 1SF5A 5I6NA 2B08A 2CALA 1NIDA 1KDIA 1L9PA 1JXDA 1AZBA 3FSAA 2AANA 3H4FA 1AR1B 7PAZA 1ETJA 2H5UA 1F56A 1AZCA 1E30A 2BW4A 2W88A 1FA4A 2VSKB 3PLYA 4E9VA 2QDWA 2BP8A 7PCYA 1BQKA 4DPCX 5B7MA 4GY4A 1WA0X 4HIPA 2BP0A 1DZ0A 5I28A 2XV2A 2IDSA 2DV6A 2PCYA 1AIZA 2GC4C 4HCGA 4DP4X 2PP7A 1A4AA 3QJTB 4E9QA 3FQ2A 3ABLB 3X1FA 4M3HA 6PCYA 4A68A 1OE3A 3OD3A 1QLEB 3WKPA 4A2DA 1BAWA 1ID2A 3OMNB 3NSFA 4DPBX 3TA4D 1AQ8A 3GXUB 5FC9A 1V55B 3NSCA 1URIA 2PPFA 3C75A 3X1GA 2XUWA 1ASOA 3HEIB 1XB6A 4KO6A 2IH8A 2WO3B 2GHZA 1GW0A 1SFHA 4JHUA 4AZUA 2AZUA 1JZEA 1YLBB 2XVBA 1AAJA 1L9TA 1OOWA 2FT7A 2HZHA 2QDVA 3CZUB 3FU7A 3X1BA 1MG2C 1NINA 1BXAA 3X1EA 1E5ZA 3DTUB 1AS8A 1IBYA 4YSCA 2ZONA 2IWKA 3UAEA 3AG4B 2GIMA 4BDVA 5IY5B 3BVDB 4FAAB 4A2EA 3KW7A 2YAQA 1GY1A 3D12B 2TSBA 1KBVA 2JFCA 1JVLA 1T5KA 3IE9A 4YSTA 3WI9A 1KDJA 3UABA 2XX1A 1PF3A 2GB2A 3L45A 2EIKB 2GSMB 2PP8A 4KOBA 4UANA 2UX6A 1BXVA 2XYBA 5I5IA 2ZWNA 3N55A 3NJFA 1JZFA 3NSDA 3FPXA 5F7BA 1OE2A 2J56A 5B1JC 1ET5A 1GY2A 1FWXA 1NWOA 3QQXA 2GBAA 4AX3A 1OCZB 4E9RA 5B7EA 8PAZA 3SBPA 1PLBA 2W8CA 2YQBA 3PCYA 2OV0A 3S3BB 2AZAA 3SBRA 1QNIA 4GP8B 1RZPA 1GYCA 4HHWA 1PLCA 1BQRA 1VLXA 2QPDB 3FQYA 2QPEB 1AACA 2IWFA 2YXVA 4DPAX 5I6KA 1X9RA 4YSSA 1ET8A 3FU9A 3QJSB 4HZ1A 3DKHA 4G71B 4ENZA 2B3IA 2BP8B 1NIFA 1RZQA 4YVNA 1JZGA 2BZCA 4N4YB 2CCWA 4CSPA 3ZIYA 1ASPA 1WA1X 4EF3A 2BHFA 1E65A 2VW6A 2EILB 4E9SA 4KNSA 2HRGA 2DY2A 1W8EA 4G70B 3IN0A 1OCCB 1AANA 4BWWA 5TK2A 3NJIA 1M57B 1NPJA 3OMIB 3CDZB 4GYBA 5F7AA 2X88A 1NZRA 1W6LA 1WS7A 2HXAA 2GC7C 2XLLA 1CYWA 5PCYA 3SQRA 4DP5X 1OE1A 2A3TA 1XB8A 4AKOA 4KOCA 3V9CA 1SHXA 3NSYA 1DYZA 1GR7A 2I7SA 3H4HA 2I7OA 5LDUA 1GSKA 3FPYA 4AI7A 1SJMA 1AZUA 1FFTB 2IDUA 3NJMA 4HALA 4AKQA 2VMJA 4HHGA 1KYAA 1JERA 1PZAA 5I5MA 3ASOB 5E9NA 2IDTA 1KBWA 1MZZA 5I6PA 3PAUA 1CYXA 2HX9A 2BZ7A 2UXTA 2XV0A 1PNCA 1TEGA 4GP5B 4X4KA 4DP8X 1ZDQA 3WIAA 4BXSV 1E67A 1J9SA 2QT6A 2PPDA 2JXMA 3BQVA 3N2JA 2YAFA 5ANHA 2AFNA 3ABKB 1V10A 1V54B 4F2FA 4ZK8A 3AW5A 2YARA 4A2HA 4G7RB 5D4HA 2VW7A 1EHKB 4JKNA 4WTQA 1A4CA 1OCRB 4A2FA 5B1KA 2RACA 2YAOA 1EZLA 4BXVA 3TBBA 2HX8A 3WNIA 4YSDA 3NJKA 1PZCA 2NRDA 4FA7B 2FQFA 2UXGA 1UATA 1TEFA 1AS7A 2BWDA 3UGEA 4QKTA 4N8UA 2XXFA 1NIAA 1TKWA 3FSWA 2YAHA 4A2GA 2R7EB 2WO2B 4WKXA 2XU9A 2Y69B 3FYIB 1HAUA 4HCIA 1BXUA 2FJSA 1ZPUA 4YSRA 3WNJA 5AFAA 3RYMA 1BYPA 3AG1B 1ADWA 3OM3B 4KO7A 1CUOA 1IC0A 2PLTA 1NICA 4YSPA 1JZJA 1BQ5A 2FT8A 5A7EA 2EIJB 3TBCA 4BK5C 1N68A 3WG7B 5D4IA 1JOIA 3KW8A 3AG3B 3PXLA 1ILSA 5D4JA 4PCYA 3AG2B 3T6ZA 1WS8A 4KO5A 1ZIBA 2YXWA 2EINB 4DP9X 4L0PB 3NJGA 5B1BB 3X1NA 4CSZA 4GXFA 3NJJA 4HCFA 2CJ3A 1NTDA 1SDDA 2FTAA 1A8ZA 2J55A 2OJ1A 1J5DA 4DP7X 3T6WA 3DIVA 2OCCB 2VM4A 4UAHA 4F7KA 1IUZA 3WKQA 2FQDA 2Q9OA 2N0MA 4JHVA 1AG0A 2P80A 3NP3A 1CC3A 4YSQA 3AZUA 4BWTA 3ERXA 2FT6A 2VM3A 2PPCA 4K9JA 5B1AB 2FQEA 3EHBB 2AVFA 1SF3A 2FWLB 3AY2A 3EH3B 5I6LA 3PPSA 4W9ZA 2IWEA 1J5CA 1GS7A 1PZBA 2XWZA 1A65A 4NERA 3FT0A 1B3IA 1R1CA 4Q8BA 1JZIA 3PAVA 1RCYA 3ABGA 3UAAA 2IDQA 3HB3B 1KCBA 2DYSB 4DP0X 1PLAA 2HX7A 5AZUA 4NAJA 2VSMB 2WSDA 3CG8A 3JT2A 2VN3A 1XMEB 3QJVB 4UF7C 1ET7A 5AKRA 1A3ZA 1M9WA 1QHQA 4M4RB 1BYOA 2X87A 2MRYA 2H47C 2R7EA 1N70A 3ZDWA 3NJHA 3V9EA 3NP4A 5B1JA 1HFUA 1NIEA 1W6WA 1PNDA 2EIMB 1J9TA 2CAKA 1OCOB 2DWTA 2IDFA 4HAKA 1ILUA 1ZV2A 3T6XA 3S8FB 2PP9A 2P80D 3FSZA 1JXGA 4E9WA 1X9UA 1CURA 2BW5A 3CVDA 2FQGA 1KV7A 3G5WA 2UXFA 2H3XC 1IKOP 1AG6A 4PAZA 2HRHA 4W1TA 1SNRA 3CVCA 3QPKA 4BDVB 1J9RA 4YSOA 1A4BA 2UX7A 4P5SA 4YL4A 3CVBA 3EH5B 4G72B 3FSVA 1ASQA 3IN2A 4NB7A 1JXFA 1NDTA 3NJLA 1OV8A 2PPEA 1NIBA 1AZRA 3T9WA 3FU7B
chains in the Genus database with same CATH superfamily
4I3SH 5LGJA 1G9EA 2VAAA 4KQ4L 5D93C 4Z3HA 3U0TA 4E9XA 4OZHF 5LBSL 1QATA 4P59L 4PGEA 2JJTC 1KJ2H 1KJ2A 3D34A 2F74B 4QXWA 1JVOA 5C08A 2NX5E 1VJSA 1B3JA 3EUUA 3FTYA 5D1QD 4PJ8C 3RWEB 4HXAH 2HLEB 3OHXB 3EDEA 1L9OA 1H6TA 2K0RA 1I1CA 4NN6C 4ZYKA 4MS6A 4JO4H 4XC1L 3EYVB 1UD4A 1KB9K 2N1TE 1O9ZA 3BGFB 1PAZA 1VADB 3FRPB 1YRKA 3FOMB 4JDVB 4KKRA 4CU7A 1AQHA 2COQA 3HMWL 1KB9J 3V52L 5CAYB 2VLJA 3OKYA 3SBQA 4PV8A 1ETA1 2PYEE 5EMYA 2XWTA 3HNVL 2NNRA 3MZGB 4LSSH 1GJWA 1DL7H 4P99A 4NZ8A 5CUSH 3CHXA 5B8CA 2YRBA 3QPXL 1Y6MR 1M42A 3LY6A 4PUBL 2YAEA 4WZ9A 1WZ1L 1EUTA 4XCEB 3TEZA 3PWNB 3TN0B 3V6OC 2YA2A 3AU0A 4JMXA 3O4OB 4IK6A 3AUVA 5FECA 3KPTA 1NJ9A 2VXQA 5DEGB 2KH2B 2H6PA 4PBVC 4LASH 4MJIB 5A3ID 3EUDA 1UZ6F 3R4DA 3S37H 4BV1A 2HJKB 4LVNC 2VXSL 1HEZB 2JB5L 1BLIA 1UZGA 4XMPL 2BIPA 2IG2H 1I7RB 4JCWA 4BZ2L 3G5VB 3NFPB 1KWGA 5DVMA 3GDCA 4N0CC 2K6YA 4TULL 1F3RB 4KK8D 1DBAH 1EEZB 4L37B 3OXRB 1FJ1A 1T7ZA 2W81C 2AQPA 3LZOA 1YN6A 2JF1A 3GYRA 5HXMA 3ILQC 3JWDC 3Q06A 3IK2A 1FAIL 1T1YB 1FBIL 1R3KA 2DQHH 2CBPA 3D7PA 2BH0A 3FUJA 4XZUB 1SDDB 1JWMB 5FPIA 4DIXA 1ETB1 4L0YA 4XCFH 3ABMB 1M2VA 2APFA 5IEHA 2FVNA 3U36B 4NSKB 2X1WL 3BE1L 1AJ7H 1E27B 1GGYA 2FJHA 3LSOB 4F9PC 4YHZL 3D9AH 2XV6B 2D31B 3DX1A 3PXHA 4JRLA 4YLBA 5HI3D 4IEFA 2XQBH 3LEVH 2IQAB 5TE7L 2HLAA 4WFEE 1ICTA 2BK8A 1JWSB 3EYQC 1JZDC 5HPOA 2A9CA 1VGEH 2OTUB 1MFAL 4LLYA 1SOXA 1KGJA 4GUPB 3ULVL 5F9OL 2DQFA 4IBQA 1W2KT 1UM6H 1Q0XH 3DI3B 4V11A 4P0DA 5GGTH 1YPZF 1RIHL 4F5CA 4RETB 4E9QA 3C09B 2YPVL 1KPRB 4P2QB 1ZLSH 4JZJA 3QCTL 4NYLB 4QRPA 6PCYA 4JFZL 1F0LA 4ODBD 5E23A 3GLEA 5FOBA 4A2DA 4F37F 3HMXH 1BD2E 3QDMB 2VMDA 2IXQA 3O6FD 2DLEA 1OAXH 3VFVA 5GS0D 4OGZA 4Y4HC 5C09E 4F7PA 5JQ6L 3VG0H 2OJZH 2AQQA 2WTOA 3NJXA 1LILA 1GW0A 1SFHA 2G75A 2AZUA 2CO2A 2Z3FA 1MCDA 2R0LH 5LXGL 1S3KH 1XFPA 1D9KC 3D1MC 3UJIH 3AGWA 2O5ZH 4QY8B 2BSCA 3MREB 3EYUH 2VB5A 4QEGA 1OM3L 3X1EA 1AS8A 3AXIA 3BESR 1GAFH 4PJXB 3PWJA 1R17A 2NX5B 3UAEA 2EDOA 3LV3B 1I1AA 4DGIL 3HNTL 1RUQL 3BVDB 5EUOB 3CN2A 5C7XH 4I77H 4I18A 3IMVA 4P9HC 5E1AA 4ZFGH 1GY1A 5CM1A 5AB2A 5IOPA 3MJ8A 5DD1H 4KTDL 2IMMA 1A6UL 4FTVB 5DUPH 2DD8L 1TJHL 2AEWA 4U6VL 1KACB 5EWIH 4JKKA 1XSOA 3PWVA 3MRHA 2PYFA 3PY9A 4IHOA 4B9CA 5HHOE 3ARED 4PJAF 5DUJA 3RGBA 1ZT4A 5IW3A 1FFNB 3OX8B 4S2SA 1G94A 1BLNB 3PDGA 4HLJA 3QDAA 2EH8H 4J6RH 1U3HC 3B9KD 1Y7VA 5F2FA 4A04A 2RQEA 3I50L 2QZ5A 2EKSA 2ZF8A 3L3HA 1CDCA 4TYUA 2VLJE 4M4RA 4LCCA 4I0KA 3QIUC 5EO0B 4LEXL 2ZOTA 3W39A 2YOCA 3OG4B 4GQZA 3EOTH 4ECNA 4WWKB 3CQPA 1M1XA 4W9CC 3RWDA 1AZZC 1G6RA 2XG5B 5FXCH 3B6SA 2V5RA 3LXBA 2YD8A 3WEXA 1Q72H 3CUPA 4I4WA 4AQ8C 1JCKA 3X13A 4CSPA 1GKEA 5HYSB 4FMVA 5AVRB 2F61A 2J6EL 3BCDA 1XHHA 3GKWL 2DQHL 2BHFA 4DH2A 1IT9H 4ODXB 2CPCA 1NOAA 5DJDB 2WJ5A 4D7PA 1A1OB 4GNKB 1YJDH 4KHTH 5KG9A 3WE6A 4MD0A 4A7TA 4LHQB 1CE6B 1WBYA 3MA9H 2PW2B 3RVUD 4EN2A 3SKMB 2P3YA 4Z1PA 4ZMYA 4R4FH 5FM4A 1AE6H 2JTYA 4JRXE 1HILB 2G2RB 1JZ4A 3SQRA 2XFGB 3LRGA 1BZEA 4NKOB 2OJEA 1F4YL 3ARGA 3L5JA 2O72A 1FVEA 4QHKI 3CLEL 3VACA 1GR7A 5IHHA 3SPVB 5AAWA 2WZ6A 1DUYB 3WLWD 3GLAA 1H0DA 5IK3A 3VU1A 5FGBC 5KTEL 2MQCA 3I6KB 3AREC 3MNVB 4D8OA 1PZAA 2IAMC 3ET9F 4NZRH 2IDTA 5HHMD 5BCAA 3HS9A 3MUGB 2BZ7A 1V8HA 4PRIA 1TEGA 2VLLB 1YPZE 4AM0Q 1OALA 5IM7A 2WXRA 3DRTA 1BVZA 4XNUH 1XGRB 1EANA 4XN2A 4E41B 1G7JB 4HUVB 4QXVA 5ID0A 1JHTB 1DVFB 1P6WA 2OLDA 2YARA 1WISA 5HHOB 1MJ8H 1SOQA 4JKNA 3MBEB 5JUEL 2QGCA 4HD5A 5I16A 5B1KA 5D2NE 2VLRD 3OV6A 5HYQA 1WCBB 1IO4C 1FFRA 1PJ9A 1EGJA 2HAZA 4TUKH 1KGUA 3SE4A 4LOUD 4LIQL 2X1OA 3HZ3A 3B3BA 4NO3B 4AUUA 2YJQA 4F8TA 4UI2A 4YX2L 3VXQB 4JZNA 4BINA 3L3IA 4F8LA 5L88H 1BZ7B 2OP4H 4OV6F 3HS0C 4AE1A 2YBRA 2B16A 1OT2A 2ITCB 1TQBB 4IS6A 3LVEA 5AW1B 3NTCH 4KMQA 5GRVL 5C97A 4HIXH 3U2SB 4U6TA 4D9LL 2HH0H 1DQML 3DXAB 2VABA 3MRRB 3OM3B 2WLMA 5HGHA 1ZHLB 1Z3GL 3BZ5A 5MI0B 3BIKA 4PJDB 4NKQB 5D7IA 2C3VB 2A9BA 2E9BA 4R96A 1BQ5A 1YA5A 5DYFA 3HJ0A 4H8UA 3G5ZA 5CP3H 5DYOB 1K5NA 3RL2B 4DOHE 1A9VA 2X4TB 1G9NH 4BK5C 3MBXL 4EI6B 3BZFB 5I9QC 2AGJH 3KW8A 2OI9C 3AG3B 4NNXB 3KHQA 1U42A 5DTFB 2R4SH 5D7LE 4OD3L 3MLWL 1E4KC 1PDKA 1T21A 2APSA 2LAAA 2QR0B 2J8UA 1WT5A 5H35A 4DP9X 1UB5A 3HC0B 3X1NA 2V7NA 5KOMC 4EOWH 5C08B 4LHUD 4N8VA 5HHQA 1YC7A 1IE5A 3IYLW 4MDIA 1HOCA 1HNFA 2A9NH 1EFQA 1AXSB 3QWRA 3F84A 4LSDA 4UAHA 3T0EC 4AIZA 4UBDD 5TQ0L 4EAEA 2VUKA 1J87A 3GUTB 1JI1A 1W91A 1FNHA 3BP6A 5T1KA 1NEPA 1FDLL 1CC3A 4C4KO 4C56B 4N0UB 1IL1B 4F80A 3M7FB 3HIZA 4J3OC 2DQUL 2PF6A 5J56B 1MW1A 1U0QA 2CO7B 2VM3A 3HG2A 1F4XH 3P9MB 3LXAA 4K9JA 4HKZB 4U1LA 4YZFF 5MEQA 4F9PA 1UFGA 4RAVA 3VGBA 4XX1E 1TLKA 2AV7A 3QJHA 5J7CC 1UZ8B 5IR1B 2V17H 3C60B 1P7KA 4X4XA 4ADIA 4G6FD 4GPVA 4XAKD 3JXAA 4Y1SA 4B9ZA 1T1ZA 5E4AA 2CKBL 2MPVA 3PUUA 1PZSA 1KNOB 4LL9A 3CFCH 3DECA 1KTDB 5TF0A 4O2CA 1ZHNB 3OLDA 4TVUA 3DV4A 2ENPA 5EC2B 3H9YA 3O4LB 1N5AA 1TEYA 4UU9A 5C71A 3WFDL 4KZEH 1JPTL 3JT2A 5I1AB 3N50A 1SVZA 3NJVA 4Y7OC 3RB7A 6CGTA 3DVGA 3TONA 3HBGA 3VCLA 1OAKL 2QVFB 1CICA 1XF2B 1IJNA 3PABB 4ERSL 1QEXA 3NZHL 5GZNA 1DJWA 4AGLA 4XMWA 3QORB 3U9UA 3MNZB 1INEH 1AQKL 2J1WA 3M17A 2HRPL 2F8IA 3PGFH 2N4IA 2BSDA 2VZUA 3IJSB 1MIEL 1DQIA 1N70A 5FUOL 3FRUA 3V9EA 4F7CB 2X3AA 1N6QH 1BQHB 2CAKA 2VDQH 3NIFE 4ZFQA 3SDCC 1MH5B 1QTSA 2DRUA 3HN8A 2BS71 4G1EA 2CR0A 2VITB 1V05A 2AQ2A 4M6MH 4UT6H 3UXFA 4MD5B 2O5XH 2DB8A 3OBAA 4JO3H 4UDUA 3HRZC 3D85D 3EO9H 3FU3A 1JXKA 1ROWA 1YAIA 2FX9L 3HI1A 2HRHA 5HD8D 3V4VL 5ICZB 2BSSA 3DJTA 1DQJA 4WI7A 2AITA 4DKDC 4A7VA 5GGSB 2DMGA 4FQ2H 2DQIH 2D7QA 4MDJB 3WS3A 1N12A 1NDTA 2VLRE 3ZK0A 3RTQD 4NQDB 2RCSH 1OSZB 3UYRH 1U8IB 3F7VB 4XMPH 3DJRA 2GFBB 1ZSDB 1XMWA 2GUOA 3LH2H 2W9LA 4GI9A 1VZIA 4U3HA 3PNWA 1E9PB 3LS4H 3ZE0E 4BE6A 1B4JL 1KCWA 4ANWA 4F1SA 1U8LA 2X4TA 3U1PA 5F0MB 4JFDB 2IF7A 4LVHC 5IHZB 3INOA 2C3VA 2DWXA 4EN3B 3KL5A 3SDAC 5H2BA 4HG4J 4ZD3H 3FQUA 4PRAB 3WS6A 5HGHB 5IFHL 5I73C 1L6XA 1IBZA 1U8QA 1VFAB 2EDKA 5EF0A 1JFHA 2OZ4L 2Z0UA 4JRYE 3P3RA 4U3SB 4KK6D 1NWPA 1AD9A 1IGIH 2BVTA 4JG9A 1TTRA 2XX0A 1W80A 1IIIA 3CHRA 4S1DD 4I5BB 2G9HA 3TPUB 2NSMA 3WY1A 5D7LD 1BBDL 4K2UL 5J9PB 1KYDA 4S10A 4HK0A 4KKZA 2X4SB 3C8HA 3CGTA 4FP8L 4AKPA 4P3CH 3H9ZA 3IF1A 5HI5D 3QZOA 2Z8WC 2E86A 5FK9B 2Y07L 1T7WA 2DMKA 3BC9A 2CH8A 3BWSA 3TTSA 1A4JB 5DZPA 5E6RB 2R8SH 5BS0A 4HEMA 5LB1A 5CGTA 3RJOA 3S36L 4EUPA 5C2UB 4EVNB 4M8RA 1QD0A 2LGNA 2V17L 2YD0A 4FL4C 4KROC 3WLBB 3PPEA 4TUUA 4WNSA 3VW3L 2N3JA 4BFBD 4I89A 4FC3E 4JPIA 4KNUA 1MWAH 3APMA 4ABVA 4QXTA 4NC0B 3TBWA 3F7LA 1RUPH 5T3ZD 3WTYA 1LO0H 2NY3D 5KAQG 5D1XB 2A9DA 4FLHA 4XN8A 3WFZA 2C8NA 5B39B 1XR8B 1KGYE 3FB7B 1YQVH 5CZKA 5C9KA 4HCRL 2VUYA 1CFQB 2B0SH 4IRZH 2NQ3A 1OF0A 4O00A 4TVPD 4E9TA 5KVGH 4E41E 4L8BA 5I6XB 3N0PB 5C08E 5ALCH 1INQB 4A7UA 2ENQA 4MAYC 2MMXA 3ZX1A 3LZQA 3S96A 2ZSVB 3BUYB 2SODB 5CLWA 1HHKA 2LT9A 1HAWA 2JKWA 1EAOA 2PW2A 3P4OB 3CXHJ 1WYJA 2P4AB 4LQ1A 4MA3A 4N22A 2Z8VC 4TNVF 4PB9L 2WWKO 1NIDA 5E6IC 1G9MH 4APXA 1GZPA 5A40E 1JXDA 3N85H 4K3JL 4CA4A 1EDYA 5EBWA 1YEKH 4JFWA 4L05A 4Q9QL 1ETJA 3CUPB 1OAZL 1A3RL 3ES6B 3L9YA 4GRWE 4E9VA 1U58A 1G6RB 2XG5A 7PCYA 2AJVH 2VE6B 4EI5A 1RULH 5CP7A 3AWFA 1N9PA 2JCCF 1WA0X 2W9EL 4KKBD 4N2BA 1JK9B 1O9VA 2DQGL 2IDSA 3NCYP 1N64H 4UB0L 3JWOC 5AW5B 3E38A 1RV6X 2MJWA 3FMGL 1C5CH 1JPSH 5H8DA 4R97B 4IOFC 5IB5A 4IM8A 4FTVE 3WEBA 1OGAA 1IKFL 1SBBA 3ORJA 4YBLB 3TH3T 4XZ4A 3IU4L 5EZIL 3MOQA 5D7KE 4P2RE 2BNQD 1J1OH 2DPKA 4NAQA 4TNWF 5DMJB 3C9NA 3ZVVA 4GG8A 5KVFE 3RTLA 3C6LB 3HEIB 4X4YA 5KSUB 2J20A 1WGOA 3MX0A 3O8XA 2GFBA 4XPBL 4FGMA 1BMGA 2MCMA 1N18A 2R2HA 3TFKD 2ICWI 3X14A 2D3JA 3VSVA 4MJ5A 4MZ2A 2E46A 1UWXK 3QZWA 4EN3C 4Z8FH 2R0ZL 35C8H 4POUB 5TE6H 3WS3B 5CZVH 5JTWA 2ZONA 3BN9D 4ADGA 3WIFA 3DK2A 4TUJA 5GGSA 4R4FL 5C0ND 1IFRA 3ULVF 5I24A 3KW7A 2VDPH 3S98A 4K94L 2VN5A 2G75B 1NCOA 2FWOB 3QFJA 5I74C 4OGAD 1CD8A 4MNHB 1DANU 2YRZA 1GL4B 4G3YL 1IC7L 4HD9A 1I9JH 1ZLUK 3IXAB 2AQTA 4N8PA 1MH5A 3ISWA 4GB9A 4QRUB 3RDTC 2R56L 4RGNE 3RQ3A 5L2KB 4G6AC 3IETA 3KBEA 1F86A 4HUXA 2XTJE 5FOBB 2NXYC 1F00I 3TT3H 4W9FC 1MW0A 1IAKB 4AX3A 4UINH 4TULH 4E9RA 1S7XB 5C0JB 5B7EA 3KDMA 2W8CA 1FP5A 4MJ6B 3MLRL 3W11D 1AMXA 4OAWB 2IPUK 2XWDA 4Y88A 1PVHA 5BZWA 1UD3A 1NEZG 2HPOA 2BNUA 3INUH 3QULA 4KI5D 5KSAC 2DQMA 4GXUN 3S88H 1OP5H 4M8UA 1HCFX 2YD9A 1BM7A 2X4OB 1P7BA 3BX7C 3QJSB 3GHEH 4FQJH 4UQ2B 1A6TB 3QI9B 1BPLB 1T66D 3APCA 4XXDB 3ULSB 4FNSA 1U36A 2NQDA 5FKAB 3MJWA 5FFLA 1JNLH 1DJZA 1T04B 2IBGA 4U3XA 4D9QD 5LGYA 4WHTA 3B5GA 3LJ3A 2P47B 4KDTC 1QSFD 1F1AA 1K2DB 5CMAB 1TTGA 1QFOA 4I9WD 5F9JA 3SPIA 5I8OL 2ZSWB 2HRGA 1KZQA 4FFZL 3ULUL 4P2OA 1NBZB 4YHIB 4G70B 1T7XA 4NSKA 2CIKB 4G82A 3PS6A 3NJIA 2OXHA 3DHMA 2VDPB 1U4FA 1K8IB 5KVEL 2E56A 2R0KH 3CAFA 5L2KA 1JD7A 2EH7L 4MQSB 5EZLB 3BEVA 3MUUA 3RL1B 4LDEB 3LKPA 3KMDA 1BVNT 1DYZA 2OSLA 4N0UA 3VMOA 5I17B 1XGYH 4XVJH 4B6ZA 4GW4B 3VXSB 1SJMA 1AZUA 3NJMA 4XNQA 2BFVL 5DZAA 3MUJA 3GMQA 1OB0A 1JGVL 1T83A 1U95B 2HTLC 3VYNA 1P4IH 4GO9A 5I6PA 3ZE0F 2O5NA 4OJAA 3NCEB 1E42A 1EHLL 4N8VB 2AI0L 2CM5A 4X4KA 5HJBA 3V6FA 4QRAA 2CGZA 3GIZH 4LLAA 5E9DB 5HHNA 5H35B 2YAFA 5IQLA 5GRJH 3N1FC 4XO9A 3OXSA 3EBIA 3AC0A 3C8KA 1UJ3A 4PG2C 2VDLB 5C2BL 4LKXB 4H25B 2DMCA 2R27A 3D51A 3QDHA 1KXVA 1DJGA 3B2MA 3QYMA 4ZT1A 4QT5B 3FUFA 1PZCA 1SEQH 1HIMH 1WCQA 3S2AA 3UG3A 5F8QC 1D5IL 1AGDA 1YMMD 1U3HA 4ANVA 4Z76B 2BWDA 5DRWB 3FCGA 1AY1H 4OF8A 1R47A 4AG4L 4A2GA 1HKLH 1C5BH 1VADA 2WO2B 1UXMA 2XU9A 5I8EA 4U0QB 4GMTH 1BXUA 3T1FB 1S7QB 1G7IB 2QKIB 4WY7H 2X42A 1IB5A 3EOBA 4GOSA 3HG1B 1ADWA 3QQ4A 2PLTA 3VI3E 4I1PA 4ANKA 1JRHH 1HC1A 2C9PA 4MNQB 1U58B 2EDXA 3GMRA 4GKOA 4NM4L 1WCBA 3L4TA 3EO1B 5B4MD 3R8BB 3ZTEA 3VU2A 4QRRD 4JPWH 5AYTA 1LDPH 5DVPA 1ILSA 4RSVA 4NQCB 4CADA 3HE7B 3LOWA 3VQ2C 1GZPB 1I9IH 1TZGH 2NY2C 2QLVB 3BFQG 3I6LE 1ZVNA 5E1QA 4AMKH 3MV7A 1MFDH 1C9SA 4TLTA 2QFPA 1N8ZB 4HK3N 5EBGA 4YXKH 2Q6WA 3VXMB 1FNSH 3B5HA 1TSHA 2X6BA 3O3AB 1QTYT 2OJ1A 3UP1A 5IOKA 5BUPA 1E28B 3TA3A 1UOKA 2AP2A 4Z7UA 2GPZA 4UM8B 1KLFA 3LKSB 5C0DB 4LBAA 4X99A 3WMPA 3QXDA 1JDDA 4GQ9H 4NKDB 1SMOA 4JHAL 4U1NA 3OZKA 1MPAL 5TDPA 2B20A 4K94C 4X99B 4XMTA 1F3JB 1XR8A 5GHWL 4KPHL 1WZKA 3ARGB 4HWEH 2GABA 4LCWD 3OKMA 4B27A 4NO0A 4OKDA 1S46A 4EIGB 4FFYL 4P04A 1F4YH 3VXMA 2BJMH 3O9WB 4OR1A 1COBA 1TVDA 1WBYB 1ZLEA 4M48H 3HVNA 4GG6E 4GBXB 4GT7A 4P5KA 3PWUB 1OP3H 1A1OA 4B9IA 1T6BX 4JY6A 1LO2L 2DI7A 3B4NA 3DX7A 4EVNA 4L4VB 1A65A 4NERA 4CADB 3QDGB 1RZKH 3LYRA 3HLKA 15C8L 4X5RA 5KBPA 2GT9B 3ZKXC 5DWUH 4PTUB 5I1GH 4DP0X 1PLAA 2V2WA 1KTBA 4NPJA 5C0CD 2EYTA 1L9MA 4PYHA 3P0YH 3FB5B 4PJGA 3V79C 4P2RD 5D7KD 1A4KB 4JVPA 4QRPD 2QHRL 3SGKA 3QISA 3EOBB 4M4RB 4MQXD 5IHUL 1EO7A 3SKJL 2EDDA 5IB4A 3SGDH 5GIRB 1DANT 1OT4A 3KLHD 1MCQA 1JZ3A 4TQ8A 4JM2D 4YPGB 3WFBH 1HFUA 3GSQB 3P30L 1FIEA 1L3WA 2PYFB 1JZ6A 1EH9A 4AK1A 1KBBA 5E8EA 3ESVF 5D7JD 4Z7OB 5D7JA 2XN0A 1KC5L 5L88L 3NQKA 3CZKA 1KV7A 3IDGB 3KE0A 3PNWB 4JFFB 3BLKA 5HDBF 2MCPH 4H5SB 4U1SA 3ILEA 4UQCA 5EOQH 3IFNH 2F19H 2E9IA 1Z9NA 3FFDA 4G1MB 3UDWA 5IT2L 2JMRA 1OSPL 1U8IA 1A4BA 2AERT 4U1GC 4MS8D 1MHHB 1N26A 4LOFA 4WUUE 3IN2A 5TDOB 2VDNB 3IDJA 1E50A 3NJLA 3UTTE 3VB8A 4OI8A 4XXCA 1UXSA 2X0UA 5C70A 4PJIA 3PHQA 4AUJA 2O26U 2NPLX 2OPCA 4BZ2H 4EPSA 1S6NA 4FABH 1RUPL 1WAEA 1WO2A 2NY3C 3GMQB 3H9HA 2A2QT 4I0PB 3G08B 1OIOA 5DQDL 4B0MM 3ZSTA 3K5RA 2FJFB 4R90H 5I17A 1UG9A 4PJAE 2QADB 5K9JH 2AK1L 4X6EA 3CC5A 3K6OA 3P9LA 4GP4B 3F7QA 1Z32X 4WUKH 4XO5A 5BZXA 4ES9A 2WYZA 5BOPA 2GJPA 4WCYH 4YSUA 3E7JA 4X6CE 2CHZA 2OXHB 3K7UA 3SE9H 2BVYA 1JTOA 4BSJA 4YHIA 1WFIA 3L3KB 1EEQA 3VI3A 5FOJA 1LK3L 4JO8A 4PHXA 2BP0B 3T4AC 5L6YH 2JV6A 4NDMA 1G9ML 5CEYA 1JIBA 4QO1B 4S1RL 3Q2WA 4F3FB 1WSST 2NY6B 1PZ3A 1EVTC 2BIIA 3FQWA 2A99A 3U79A 1HK6A 4PREB 4ZMVA 1HE8A 2VN7A 3CDGB 3PUCA 2F1EA 2K6ZA 4XPGH 3G5XB 4HWEL 4PY8J 1MCWM 4XO3A 3ARBD 3Q2CA 2BNUB 2XQYK 1FVDB 3M86A 2AEQH 4AQAB 4AYBA 5BUAA 3V8OA 3AS0A 5L9DH 3GJFA 4RMQA 3ILDA 4ZNEE 4U1MA 2FX8L 2MOQA 3LRSB 4S0SD 2ODIA 2V5MA 3OQ3B 5IEHB 1MQKH 2UWEA 3H3PL 5E2WL 1GHFL 3S35H 5CLTA 4XZUA 3INUL 4FZEH 3IU4H 3QS2A 3GEFA 4LHUB 5LNGA 1QG3A 1RD6A 4OV5B 4BZ1L 5L8KB 4MAUL 4AEHH 3ZYZA 4U1KA 5SV4A 4BFJA 3NA4A 4X83A 1L9RA 3JTBA 1QLRA 1EJOH 3UACA 3P0YL 4WUUB 2OMWB 2BSBA 4WO0A 2H45A 3VE0B 3DWTA 5FCUL 2AJUL 3D09A 3UL4A 1BYNA 4KNTA 2ENJA 2UXVA 3MXWH 3GJEA 3JTTA 4X6BB 4K23H 1AZNA 3QZWB 1GGIL 4G5ZH 4UQ9A 2X6VA 2Y06L 2ZOKB 1OP3K 1AGCB 4RQQA 1NC2D 2PYEA 3C6LC 4Y5XA 4JQXA 3MNWA 3P30H 2V8MA 3OAYK 3BZ4B 1KJMA 3BPOB 5ES4B 3B1UA 3OB0K 2WXJA 4MNGA 5LAXA 4ATWA 1ZGLB 2OR9L 3Q2NA 2BSRA 3B2PA 3LEYL 3ARFA 2H5UA 3TO4C 3VM7A 1THAA 4I0CC 4YBLC 2OZ4H 3RVXD 4R4NC 2ED9A 1LWRA 1RIUL 5D72H 3DA0A 1G0XA 3TN0D 1FFPB 1J8RA 3NH7H 3UYRL 4M61A 3HG1E 3VWJC 1E2ZA 4GY4A 4WFHD 3KXFB 2OZNA 5I28A 1OGAB 4LCUA 2DV6A 4YXLL 1AIZA 1X5YA 1DQKA 3ZU8A 1E6JL 3HC4L 1LNUA 5E2VL 4FDWA 4PUBH 2VQTA 5JZ7D 5SWQA 3NZUA 3QUZD 3CX5J 5GRJL 4P4RA 1OTSD 1BAWA 1UOLA 2P8LA 3U6XS 1OTTC 3SHSA 3IFOB 3ISYA 4GRMA 3GI9L 3IMTA 3WDJA 3ZE1F 1KIPA 2H32B 1EHNA 1ESOA 3P69A 4G6MH 4ELMB 3CFKB 2IH8A 5SWZE 3VXRA 3U0TB 4UYQA 4AZUA 4OJEH 5E9DE 4MJ4A 4X5PA 1L9TA 1ORQB 4M5TA 4I48B 2K4WA 4KQ4H 1CD1B 3BXNB 1B2WH 4BH8A 4LGSB 2E7LC 1VACB 5JOFB 4OCSL 2VYRE 3WCYA 3T2NH 3N41F 2IWKA 2LU5A 5AOLA 1INQA 4UBDC 4HVBA 4C57C 5LNDA 1M1SA 3KYKL 3RFZA 4JM2C 3CCHB 4RZKA 5D93B 5GGQL 1H8NA 5T33L 4RRPM 5FM5M 5D1XC 4RWYL 2FO1A 1J9CT 1MCFA 2AEPH 4JFPB 3O6KH 4Q0XH 5JW4M 3VRLE 2GB2A 4QWWD 4UANA 1NDMB 3EHBD 2ZWNA 4Z7VE 4FG6C 5F7KC 3FPXA 3ZE1E 1BFSA 4KROB 1JGVH 2J25A 1J1XL 4FL4B 5ACZB 1CU4L 4FD0A 1I8MB 4QXTB 2XZAL 1SN5A 1GIGL 1P4LB 3G9AB 1BWMA 1QRNB 3VXRE 4KRMB 2LHAA 1FVCA 1C12B 3CK0H 4LDLB 4YC2B 4DNLA 2UUDK 1RZPA 3GSOB 2MPAH 3PQYD 3CIAA 4KDTA 1T6WA 4L5FH 4BKSC 2FJGA 4UQBA 5A2BA 3ZQXA 3PFQA 3VQMA 2ICES 1IGCH 3B6SB 1MI5D 3WEXB 3P3YA 4K8RH 3CVIH 3OTTA 3N5AA 2YS4A 4PJXE 1JZGA 4IBWA 4N4YB 3RGVB 3GIVA 2HTKD 3F5WA 5J9PA 3ZGHA 3V55A 3HC2A 3B37A 3MXWL 2KT6A 2EKSB 4MSWA 3WFCL 4F93B 3IMWA 3FUNA 5E2UL 1ZLVK 4OJDH 4LVHB 1P9MA 2H3NA 4S1SH 2ADYA 2B8OT 3BQUB 2DQJL 2R69A 2XTJC 1ZT4B 1W6LA 4LLVA 4WWID 1RVFL 2B9BA 1XH2A 4IHOB 4IYKA 3D30A 4QD2E 3S36X 2KHAA 4B41A 1U8LB 1QEWA 5A2FA 4E5XA 2I7SA 4ZQTA 4OLVH 1P4BL 5KYUB 1QNZH 2D8KA 1P6FA 1SY6H 3ARYA 5ADOH 4HWUA 5F9WB 1ZSDA 3D0VB 1WWAX 2QHRH 3K81A 4RZCA 2XIIA 1JN6B 4B7IA 1CVRA 3REVB 4AYDC 2IDCA 4PJBA 1CDJA 3FCSA 3TO4A 2DD8H 4P2YA 1CFTA 4Z7VB 3MREA 4H2AA 2A83A 4QY8A 4AENB 3O3EA 4GW5A 5J57B 3EGXB 4MNGE 3RWIB 2XQYA 2XZCH 5D8JH 3Q05A 4K3EH 3ULUC 1TTFA 2XJKA 3VRIA 3F6JA 2ZWZA 3BPOC 2MSPA 1IAIM 3GJFK 5TQ0H 5BV7H 3SDCB 3T77A 5TTRA 3DUUB 1HCVA 3SSGA 3W5NA 4X7SH 4C83A 2WD0A 4XCYB 3WNIA 3Q6FB 4QKXB 2W9DH 1Q9OA 5C0BE 1VFMA 2Y3AA 5A2JH 1BZ8A 1OHQA 3L95B 1I7UB 4GMSL 5GJSH 4KXDA 3QWOB 4F7CA 5BW7C 4IHBA 4N86A 3O4LE 4OIBA 4O51B 5JR1H 1RJLB 3L7FA 3FYIB 3E1ZA 4Y9EA 2EECA 4XE5B 3LEVL 3TXAA 4AQ8A 2EXWC 4LBEB 2C4FT 1TCRA 4DETA 3WTSA 2R4RH 1KJVA 4CMHB 2JCCB 3U30B 5FV2A 3QUHA 3AS3A 1BOYA 1SJEB 4KO7A 2ZX8A 3VXOB 3H6JA 1QVOA 1JZJA 3HFML 2ZUQB 1B6UA 1AR2A 2R1YA 3AY4A 5IBUG 5MENE 3S8WA 4NRZA 1A6AB 3PRZA 3PDOA 2WPGA 2VH5L 4TNGA 3EBGA 1U3HD 4IRSD 2BNRD 1MFVA 1NDGA 5F1IA 3K74B 4H7VA 5D4IA 5IFJA 2WP3T 1ED3A 4PPTA 4IMLA 5GQBA 1I1YA 3MA7B 3NPZB 3QAZB 2CJUH 4JEGB 4AYID 2GITB 4KUZH 3ZKNC 2B4CH 4LVEA 4HKBA 1OAXL 2XSKA 3B43A 4YLQT 1NKRA 3RWCA 5CLYA 1J5IA 4LOVA 3L1GA 4PG9A 4RMUA 2LR4A 4CSZA 5IF0A 2DS4A 4P3DA 4M3JA 2NT0A 1VDGA 4YDVA 5GRXG 1JWMA 5D5MA 3ARVA 4FA8A 2OMUA 4JFYA 4PP2B 1T1YA 5HHOD 3IGAB 3MLSH 4KZ0A 1PG7L 2FLMA 1VFOA 2F0CA 1MVUA 4Y16A 5I1LA 1TTBA 4NIYE 4UTBL 4JBSA 1N59A 1T22A 3I3DA 3GUTA 3GGWA 3UP6A 1A14H 1SGKA 3F83A 1KN4H 1WEJL 3KPOB 3JYCA 4L8SA 5HDBE 1A7OL 4PCKA 2PPCA 2UZYB 3BFWA 1AXSA 3RX5A 5C07E 5BUGA 3QZMA 3TNMA 4Q56A 4BCYA 5AOIA 2WXQA 1S7RB 4MKMA 2FWLB 3OAZH 3T08A 2BP3A 5T5FH 4L8CA 3PPSA 2C7UB 2VN6A 2NXZD 5I9QB 1QR1A 4LLMB 4Y4KB 3QE5A 2IPKA 3O6FC 2QR0A 3RX7A 3DUHA 2DKMA 4XCEA 1WLHA 3G9VA 1UA7A 4NNXA 5DT1L 4PRHD 4RDBA 1FL6A 2AK4B 4EI6A 1KTCA 1OK8A 3QUXB 3N06B 5IGXH 5J5EA 1BF8A 2AK4A 3RIFK 5C9JA 3QJVB 2X2UA 1MY5A 4G6AD 3G6DL 4JQVC 4LCCC 4LVOC 4OZ4B 4BFEA 1T3FA 3F12B 3MV8A 2AV1A 5E99L 5IHBA 2Q1EA 4BCZA 1I8IB 4FNRA 2Y1ZA 4NN7C 3CZJA 2FO8A 1FIGH 2EO7A 1M3JA 3QA3B 4QF1B 2N7BA 4JPQA 4WW2C 4HIJB 2R7EA 3TBTB 1NGWA 2YSTA 3GD1C 4FJ6A 1HH6B 4D2NA 4CVUA 4JFDE 4GO6B 1WZAA 4KJWD 4WF7A 1QFPA 1ZLDA 3VFNB 4MWFB 4LL4A 1L0PA 1LGVA 3TNNB 3DDGA 3MBEA 4PGEB 2FQGA 4LSQH 5E8DL 1OPOA 2PO6B 3ATBA 2VAAB 3LRLA 4H8QA 3CZSA 4KUCF 2ICWJ 1G7JA 1SNRA 1RLWA 3QPKA 4NNYA 2EZ0C 1FZJB 5FYLE 1XH3A 4P5SA 4ENED 2E6QA 1HXKA 1PEWA 4ZZFA 4PGZA 1D7FA 1MJ8L 2HUEA 3QFDB 2AK4E 4UQ3A 5D5MF 5I76A 4N87A 5F6IC 5BPPA 5TH2A 3BD5A 5IB3A 2X4NB 5EZJB 3U7YH 1HS6A 3ATDA 2Q7YA 5KVDE 3QZPA 1D3CA 1AOZA 4FYSA 1GGUA 5IQ7H 4HMEA 3GTNA 1O9WA 4IMLB 5I26A 4NKIH 1UQSB 2YIHA 4ZW8A 4U6YA 1XX9C 4GBXC 5LUMA 1UGNA 1FGVH 3DUSA 3UTPE 4F2MB 1J9QA 1L3NA 4ZTPL 2QGBA 1T5WA 3OAUL 3MLUH 1QVOB 5I1JL 5F9OH 4PWGA 5AL8A 4HULB 1TITA 4J39A 3ARGC 3TIEB 1BV8A 4A38A 5LWYL 1HSAA 2EDTA 3S0PA 2JKXA 1T4KB 2DW5A 4JFFE 1QKZH 4B3EA 4JHAH 1BFVL 3RPIB 2NZ9D 2IGFL 3BAKA 4G8EB 4JGUA 4MXWL 4O2FA 1ZT7B 4GFTB 4P9MH 4RFNB 4DKTA 1C7TA 4Z7QF 5SV3A 3FRPG 1PTZA 5DJ8B 4P4KA 1MVYA 4WWKC 2XXGA 1JHLH 1PEZA 4LKCA 1SRDA 3OQRA 2MHAA 5HHVH 2GI0A 3ASNB 2OTPA 1KTJA 3HS0A 3CFCL 4NN7B 1MFAH 1ZA3B 4P46D 2DYRB 4JFUA 1E4JA 2VLRA 2E59A 5D1XE 1RP8A 1JNNL 4LCCB 4LVOB 3HE7C 4Y16C 3G6JA 2Y1AA 1R3HA 4NQQA 4YHPB 4AZ8B 4YWGL 4BRVA 2EIZA 2J5WA 4U1HA 3PDDA 3RTQB 2GYSA 4NQDD 5JPMC 3TO2A 3ECBA 3QJRB 3QUXC 1BJMA 4XCNB 2XG4B 3X3GH 1O7SA 5FHAH 1U8MB 3ZR6A 5J1AB 1JS4A 3IPFA 4L5FL 4QHLA 3VFOB 2NUTA 3NACL 1EDQA 1FYTD 1UD5A 4AE0A 1EFXA 4OZGF 1UFUA 5ABZA 3GSNB 3D18B 3SOBH 5IV2A 5SWZD 1J1PL 5T3XL 4MQXC 4PJBE 3THMH 2QKIC 3H56A 5ANMB 2FB4H 3OJVC 4XODA 3ARFD 4WW2A 4QHUB 4I3RH 1GA2A 5E1AB 3KNBA 4YNYB 5F3BA 3C5ZB 1SN2A 1G6VK 1TCMA 5DR5H 1IBGH 2LABA 4AJWA 1QLEL 3NA9L 5E4EB 4HEME 5CJBA 2MCG1 2RIKA 3KLKA 5C09B 1JV2A 3ARGD 1OARL 4A7SA 2D0FA 5E0FA 4BFNA 4XOAA 4HH8A 5E56A 1SLUA 2W60B 4FMFA 1KC5H 3IS1X 5EIIA 1TTUA 3D3VD 4P05A 3O9WD 1T2QL 3L08A 3U1SL 1KDIA 2OMYB 3IS0X 3HCVB 4Y1TA 4GAAA 5CJOL 3ZRSA 2YLHA 2Y6SD 4HJJL 1RH8A 5FA4A 3WELA 1CTOA 4YMPA 3K2IA 3PLYA 1INEL 2X89A 1RURH 2DTML 2MQ3A 4JFSA 1Q9LB 5AKSA 3E9TA 4DQOL 4OI7A 3GBLA 3DETD 1NSNH 5E7FA 2ZWKA 4DP4X 4JZJB 1FVCB 3QUMA 5K69A 3CFIC 4BFFA 3MJ6A 2P5PA 3BAEL 3IDIA 1E6OL 1TJGH 1TQSA 4J3OH 4LXFA 1A7PH 4UDTB 2UZXB 3N40P 5AVUB 1I8MA 4OZGB 4M7JH 4D0BA 2J4WH 5D2LF 1YYML 1DLFH 3B8YA 1IAIH 4R5XA 4FXGB 5DD6B 4NP9A 4CW1B 1V55B 4JG0H 4F2MA 2WXNA 3IMRA 1DSFL 5GZOD 2NOYA 4YFDB 4JFPA 5DHDA 2YWYA 4PJ7F 1QBLL 3VVWA 2HJFB 3QVAA 3ZKMD 1XSIA 2C4XA 2X70A 3MRJB 5DJYB 2FIRT 2OFQA 4OJFH 1SLVA 2PCXA 5DSCB 4AGOA 1AAJA 1REIA 5K93A 4M6NL 3CZUB 3KWWB 4MCYA 4Q4IA 3WIHA 4QHMA 3T2PA 4AEEA 4DFIA 2VKXA 1LE5B 2X4QB 4K5PA 4JGNA 3P3TA 5C92A 3OKDA 4FFVD 3ZL4H 5KVEH 2HVBA 4PLJC 1WIUA 1PY9A 3IDYC 5GRVK 1FZJA 1OGAE 1UEMA 2DQJH 1IQWL 1BX2A 4GIOA 4NAMA 5AUMB 3WOVA 4OGYH 2BVPA 3MRMA 4FCAA 1AI1H 3VXRB 4FQCH 3UFIA 1AHMA 1CLVA 1U2CA 1WDAA 3U9PH 4JS7A 4ELMA 1IAOB 3IJYA 3HI6L 3BRDA 3I75A 1RY7B 2YK1L 4W9EC 2Q8BH 2QPSA 3EFFA 5JXAL 2RCSL 2UX6A 4MWFA 3NIDF 2NXZC 3P54A 1MFEL 2CLVA 1D7BA 2GVYA 3T3MF 1AVAA 4HAGA 1MN4A 1KXTB 2YMOA 3QQXA 4MJHA 5F9WC 3U0PA 5I1CL 3EIFA 3LS4L 3T0XA 1ONQA 4OF7A 3D39A 1PLBA 5LBSA 1AYOA 3S3BB 5F7DB 4OQTL 4LGRB 3QHZL 4KMTH 4WTXA 1PLCA 5KSBB 3B1TA 3GSXB 1TSRA 5I6KA 1NLDH 4L3CA 4MGXA 1DP0A 2VMFA 1N0LA 2XTJB 4LASL 2ZPKL 3AVEA 4PRHA 4NHCH 4X0KB 2ZXQA 2E3VA 1NANI 2CCWA 4LLWA 3B3IB 2FATH 5CR8A 2A1WL 3DPBA 3TGXA 1WA1X 3MRKB 1HKLL 1BIIA 1KJMB 1NFAA 4J3VA 2ALAA 3HNVH 2JJSA 2WZ0A 1DL7L 2J5LC 2PYEB 1ES0B 4A55A 1TZIA 2BFGA 2YUWA 3WHE0 1EO5A 2GJJA 4PJ8B 4HJGB 4X5WA 3CPUA 4ZYKB 5TK2A 3QEQE 3U0PB 3CDZB 2L7UA 1G9HA 1CXKA 4TVPH 5LDSA 2GY7B 3WKNA 2A7BA 3L54A 1CBJA 43C9A 2DQEL 1M3IA 2VXQL 4DSYA 3ZDXE 3LNEA 5JIMA 4NM4H 3N42B 2IH3A 1MRCH 3MN8A 4AIXA 1C08A 3CFEA 3IT8D 5D71H 2HKHH 2I9LA 4L4JA 5LLIC 3CXDH 4GKZA 2C1OA 1FQ9C 3G6DH 1LVEA 2YSSA 3PL6D 2YZ1A 2WM0A 1LP9B 2VXTH 3CZLA 2AAAA 4JFYB 1H3GA 1TVHB 3HUJF 3AMLA 5DC4B 1MCPH 4DP8X 2XN1A 5G4NA 4P3DB 3MYZA 1FH5H 3I74A 1VGEL 1NBVH 4PG9B 5IF0B 2JVUA 3BW9B 4Q0XL 4ZFFB 1XR9B 4MCYB 3E8VA 3MV8D 2JXMA 3OSKA 2H1PL 1WP6A 5DSCA 3ARBA 3Q8AA 4H1LG 3WJJC 4FEIA 1XEUA 3MUHL 3STLA 3KPRE 2GITA 1OF2B 3FQ4A 2DLGA 4N3UA 5C6WH 1FVDA 3VGEA 1ZLSL 1PG7H 2H32H 4F20A 1J1XH 1G0YR 1KSRA 3WKMH 2V7HA 3WFEH 2F58H 2KKQA 2UXGA 3BWZA 3TTYA 2RD0A 4NOBA 3STZA 1RK7A 4N1HB 1I1RA 1A7OH 2YGPA 3FSWA 3WDHA 4J4PA 4WKXA 1HWGB 2Y69B 5GGQH 5T33H 2OULB 3RWFB 5BRZD 3LAFA 1ZPUA 4RNRA 5BS0E 1EXHA 1IGCL 1QI3A 1ZJBA 4AVJA 2DZEA 1Q1JH 1CE1L 4JDEA 4MXQD 2EDJA 2EICA 2GJRA 2BINA 2G3NA 5I1EH 1UURA 4X5XA 1XIWD 3LIZA 3R06B 2FE0A 3WSQL 1O7VA 2ZQKA 4GKSA 4NQEB 4HWBL 4GG6A 3P9LB 4NRXA 1G1OA 3P4MA 3TJHC 3Q6FA 1ETZA 4JFZH 4WGVB 4HIIB 4X9FA 3RIFF 1N68A 2Z7WA 2FYYB 2RTTA 5I2IB 3VFSB 2CHWA 4P23D 3U7WL 1NUGA 3UEZA 2XWJB 3SDCA 2D03L 5CBAA 4JMNA 1JFQL 2JJVA 4JRXB 4X7EC 1FNEB 3T8XB 4JCLA 5IVXA 3ATAA 2OMTB 3SPCA 4KTDH 2R1WB 3U4KA 5DK2B 5B1BB 4PJGE 4Y9FA 4PIBA 2GUYA 4BUQA 3TO4B 3NDYE 3GBDA 1YNKL 4FNPA 3EDKA 3ZZSA 4M8QB 4PJXF 5F9AC 5BXFA 3M88A 4B9PA 3MAWA 4TRPH 4PRID 3UCRA 2FQDA 2IALA 1UVQB 4S0HA 2WB1A 1ZD6A 2E6PA 1U8OA 2PABA 2J12B 3BVXA 3FW6A 2LAGB 4CC4A 4Z23A 2BM3A 4R7XA 3DIFB 4YDJA 5IV2B 1XD1A 4AXWB 2P5WD 3CFJA 1EZVX 2FT6A 3K5SA 3UYPA 1F4WH 3MR9A 2F5BH 2ORBL 2R2BA 3TFKC 4U0RB 4LB8A 2JQAA 1U8MA 4YPGA 2A6KB 3T0EA 4XMUA 3T0VA 1CQYA 4E2OA 1UOVA 4L1LA 1NGPL 5JYLA 4NBZB 1BZDA 5KYYA 2VDMB 1QNZL 1SQ2N 4MSWB 1BSIA 4PRPA 2XY1A 4MBRA 4O02H 2VRAA 1RL1A 4N1CA 3A6OA 4MNQD 1XT5A 3V0WL 3OKOA 2WKLA 5I8OH 1CG9B 2B4CC 2EYTB 3DYPA 5HDQL 2A6JA 3VFTA 4DJMA 3L5IA 1S7VB 1TETL 4YGVA 2Q20A 3ZL2A 2B15A 3C12A 1I3RA 2BRRH 4F1ZA 3K1DA 3CJJA 5J6GA 2DEYX 1U93A 1VESA 2VMCA 4EQ3A 5SWZA 4DO6A 3HN3A 3RPIA 4JY6B 4JN1H 4XOEA 2N59A 4YBQC 1KBGL 4FE9A 4FNUA 5DJXA 4PBWD 4A7QA 4AW4A 4YHNB 4M1DH 2WBKA 4AITA 1AO7B 2DJMA 3IDYB 3CHPA 4P9ML 4KAQL 3W56A 4JLRB 3G5YA 4UNTA 4GRLD 4M7LL 1FNSL 3ZZ1A 2PR4H 1NLBH 1NL0L 3EGDB 5A2AA 2BW5A 5IBUB 4RBPK 1GTNA 1OTSC 3QORC 3G5WA 3RUGA 3TJPA 2A77H 3M7OA 1QSZA 3CCHA 1EBAA 3VGDA 3QR2A 1FLRL 1Z9SB 1I3GL 3COOA 2X4NA 4U05A 3O2DL 4J3WA 4JPWL 4TSBH 2CA3A 2NY0B 3MLYH 5HSFA 4GSDL 4L3EA 2Q0ZX 3MV7B 3DI2B 4L4VD 2Q2LA 3FS9A 3IJ9A 4EDXB 1DLFL 1F97A 2HJLB 5GRWA 1WHPA 1KFGA 4RAHA 3ZTNL 1I85C 2LE9A 4I0PC 4OJCA 1A9BB 5HTSA 5JW5B 2XN9B 3VXME 3IDUA 4D9QE 4HGWB 5JZ7C 4MBOA 5T1JA 1BVKB 3HG4A 4Y19E 3US0A 1SHWA 2PWHA 3L5XH 4LRIC 4PFEA 3GXDA 2RALA 1FO0B 4U1GB 4CL7A 4KHXH 4JDTH 4HFUH 4PTTB 4FQ1L 4H8WL 2Q86A 4R7VA 3RDJA 2OA9A 3CDZA 4DVRL 2DM7A 2QVKA 4CC4C 5BRQA 1ZDSA 5JW3H 1XCTB 3TVMA 5EUKA 3VFUB 4DUWA 3F12A 1FFOA 2ZICA 4DGYH 5B3NA 2BO0A 1PLGL 4NUQA 3CFBA 1ANUA 2Z34A 2R0WL 4S1QL 2I32A 5AAMC 3V52H 3VG0L 5DRWA 3CX2A 1CVSC 4Y5VA 1LO5B 4K7FB 3ZTJG 5IROD 4Z76A 1JCVA 4PRBB 2YAPA 4JKMA 1UM4H 5KJRL 2ARJB 1ZA6A 1LEKA 1MJJA 2F5BL 5J6HA 4H25A 4JFXB 2GBUA 2FHFA 5DQ9B 1DQLH 3GSXA 3AM8A 1PL3A 1OOAA 1UJ3B 4LDOB 3C5ZC 3NIFF 4YK4C 3S3CB 2WOYA 2ZG2A 1VZGA 4GSUA 3U2JA 4DCQA 5T1LA 4XN5A 3VD4A 2ZE0A 4A66A 1KLGB 4JNXA 3X12A 2LLNA 1E9OA 5DEFB 4ONHA 4WFFE 2R29L 5TQ2H 1UWEL 2L7JA 4NP4L 3JTTB 5CCKH 4IRJA 3BJ91 1DVSA 5G4OA 1DBKH 4QAWA 3Q5YA 25C8H 2XA8H 3ZDYF 2HT3C 1PAMA 1FG2A 4X6FA 4ZOBA 1SJVA 3KPOA 4FQXB 4RH4A 3ZIMA 2AXHA 3OR7A 4AIOA 2QADD 2R39A 3RTQC 2ZXGA 1RKRA 2EVGA 2OR7A 2R2CA 2GY5A 2XT1B 2HCZX 3O9WC 4HU2A 4LNRB 4Y16B 4ZODA 1F41A 3MBWB 3T6VA 5I1LB 1U6AH 3T04D 3KPRD 1FORH 4PJGF 1J0JA 3ECWA 3OWRA 3E8UL 3FT2A 2J57A 2J8UF 1YEHL 3BP5B 5DEZA 1AHWC 4P2OD 2XN9E 4UQAA 5FM8A 1OAUL 3LRSA 3QEGH 3U4BH 4ZMPA 3I6GA 1QFWM 4N9GA 3WJLA 1I9RL 3KR3H 4MASA 3V0VA 1Z66A 5JPNA 2ZSWA 4HH9B 3VSTA 1A1NB 4X98B 4B9GA 4DO4A 5F96L 4Y2DC 4AQAA 5T3XD 1AZBA 5K9QI 4WHTB 5EOCH 3MODH 5DMKA 1GGCL 2UY6A 5EBMA 7FABH 4LPWA 5EPMB 5GZND 1AR1B 3G5XA 3WJLC 3DYMA 1ZHKA 1N3NB 2Z4QA 4HW6A 1AHWB 2I60H 1MKFA 9CGTA 1BQKA 3VD0A 3RURA 2L04A 3RJDA 4YXHL 2D73A 2ZOWA 5CGYC 1SDYA 2P44B 5GPRA 2AQ1A 3FQXB 2IAMB 4ZMZA 5J3HD 3AREB 1DFBH 2PCYA 2GC4C 1IVTA 1JV5B 4H0IA 1MLCA 2NT1A 5JYMA 1EJ8A 3HPLB 3F65A 5DWUL 5I1GL 4K3DL 1BOGB 3HG3A 3LN9A 5MP6H 1G7LA 2EC9T 1UEYA 1LL1A 2ZX5A 3RHWF 1Y07A 3L2NA 4UMGA 1S9XB 3PP3H 4AV0A 5C08D 3HNTH 4FJYA 2EH7H 4DPBX 1AQ8A 3S5YA 4GSQA 1TMQA 3DVIA 4XMLL 2WLIA 1INDH 1RHFA 4OFKA 5FYKH 4AM0B 3U46A 4C59B 1FLTX 3ZO0A 1E8YA 2WO3B 1GVIA 4JHBA 4F5CE 1NC4A 4L1HA 4JDZA 5JO5A 1FRGL 5CO1A 2R0LL 3BZEA 3DVNA 3JUZA 3FFCE 1Q0EA 4NQSB 4TUJB 4NO5B 2LTQC 4PGCB 1M7UA 1S4IA 1OLLA 1UXLA 5CSGA 1EEUA 5LCVA 4ODUB 4JR9H 5D1ZD 3ZTJH 1FN4A 5EH1A 1H15A 4HPHA 1OM9A 2ERJB 2HYMA 4PJBB 3FT4A 3L3DB 3QG6B 5I30H 2Y25A 5ADPL 4PW9A 5IJCC 5AENA 1P5VA 1KCLA 1U3ZA 4OFYD 3VH8B 4KXZI 1H3WM 1LWHA 4L23A 4E0RA 2E7MA 1B0WA 3D12B 2WYTA 3GC3A 4MMXC 1OSPH 3GXIA 1GCYA 4WW2B 3IDGA 3WI9A 2FIKA 1GGIH 1TTCA 3F8UB 5KYUA 5A2LH 5TE4H 3RZCC 1RZ8B 3N91A 4YEEA 5CILH 1E5AA 4PJFF 4GG8B 1DVXA 3RWJB 2B59B 1YUHA 2PP8A 1H6UA 2WN2A 3O6LL 1NMBL 2H26A 3P77B 5LG1A 1ZOXA 1OE2A 2K4AA 1H8OA 1KUMA 4G6JL 4R8WL 2VDMH 1CD9B 4ENEC 3KPLA 2EZ0D 1Q9WA 1Q90A 1A7BA 2X6UA 4U1JB 3DARA 5ICXA 3SOBL 8PAZA 3SBPA 3LQAC 1R3IH 1FV1B 4HOMA 1QNIA 3HBZA 25C8L 1Y0LB 1YEEL 3WY2A 3B83A 2ENSA 5F1OB 4N8CH 1VLXA 1ZANH 3WFHB 1XTMA 3TBVA 1ET8A 2NY0C 1HYSD 5HBBA 3EJPA 2VQUA 4JE4B 2G5BB 3A6BL 4O2EA 3SN6N 4ABQA 4KVCL 5KTEH 1WC7B 4X9IA 1OPGL 3BVNA 1D9KB 5HYEA 3QYCA 4OCRL 1OAQH 4W81A 4P3CL 4N2GA 4GRWB 4J3OF 4P5KB 4IBVA 1T4KA 1CGSH 1T0NA 3ARXA 4GQRA 4G6ML 5IFAH 3IDXH 4CVXB 2VQ1B 4EI0A 4XXWA 2X38A 4ILDA 5DZLA 1EJOL 5F89B 3BN9C 4L4TB 4TTDD 4DP5X 5KSAB 1TQCB 5KSBF 3TJHD 4L8DB 4XMKH 2PN5A 3WO4B 3L17A 4QTIH 1QBML 1SHXA 2CBMA 2WXOA 3MRFA 3JTSA 4FLQA 3MRDA 4M6NH 3ZQWA 4QOKA 3KPMB 4CVZB 3WXVH 2A4CA 5E95B 2DQUH 3KEHA 3KWXA 1BEYH 5C0DA 4NZUH 1KLFB 2NXYB 2EIEA 3IE4A 2UVEA 2D3LA 1EUUA 4FG6D 4NZRL 2XPGB 2APTA 3RDTB 3PYCA 2VDQB 1PSKL 4X7TA 5KVEE 4NQEE 5I76B 1USQA 1GJIA 4K7PL 1KB5B 4LEOB 4Z5RA 1S7TB 4WU7A 1ZS8A 3PQYB 5EBLB 1A64A 4Y19A 2GK2A 3HG5A 3IDNA 4W6YB 1X5JA 3CFUA 5E8OB 1HNYA 3CDCA 4F2FA 3V6OE 4EUPB 4A2HA 5BS0B 5HHPA 4HK3J 1EXGA 4DWHA 1XSJA 2R29A 5JQ6H 3ZMEA 4F57L 2HFTA 3MRQB 4G5ZL 4XP9H 3GMRB 2NRDA 4ETYA 4FA7B 5IG7B 1O7DC 4JREB 2VJ8A 1OKEA 5C0RH 4XWOD 1A7QL 3CBRA 4RWYH 1HHHB 1KLUB 4AC2A 2Z91B 3ETBJ 5HDLA 3DGGB 2Q87A 3WNJA 5GGVL 5EN2B 3GSRA 4M43L 1RAMA 4JN2A 3K6IA 3BEWB 1U8QB 1N6QL 2VR4A 4H20L 5HGDB 4AQ1A 4JM0A 2A9NL 4LRIA 1IAMA 4QXUH 5FCSH 4KWUA 3FH5A 4EQ2A 1RIVL 1PKQB 1H9VA 3VI4F 1O7DE 2D2OA 4DEUA 1A66A 5C0FB 5F8RC 3QUXA 4MAYD 2XTLA 4LVNB 2BNQB 5C6TL 5FYJD 1KG0B 4RMSA 1F58L 3AAZA 3WG7B 4J7RA 2EVJA 2W65B 3MYJB 4LSVH 2ADIA 4UCFA 5C0BA 2GUOB 3MLWH 1T20A 2HTLD 2VDML 3O4OC 4Y4KA 3BN3B 4Y5XB 3F7VA 4YE0A 2HWZH 4YGAB 5F7WC 3T4YA 1P4BH 4NZDA 2AJZB 1QZNA 2J71A 5GS1A 1A6UH 3O6KL 3KZ8A 4AMXA 2PCPA 4PGDA 1NTDA 3DGCR 2FATL 5IB1B 1J5DA 2AABH 4UT9L 5CCHE 2ZAIA 1DVFD 3KPSA 2JSFA 3BOVA 4PRDB 2F8OA 2FEEL 3BQUC 4XNDA 3CQFA 1A6ZA 4OCWL 2E9JA 4XNQB 3VSQA 1AG0A 2Z64C 3APDA 2F7IA 1I7TA 1T22B 2WSKA 2WZ5A 1QASA 3VWJD 4FFZA 3UH8A 4I9WE 4UT9A 1DQLL 5AZ2H 3UAJD 2EVIA 3BRGC 2XKUA 3RL1A 4OCRH 1OGTB 1NBYA 1HXMB 3QUYC 4IOIA 2J6EH 2BVEA 4GXVH 3MMEB 4XP5H 1NGYB 2CDGB 3RAJL 3UMTA 1V7NL 5I6XC 1DVTA 2UZIH 1F1DA 2ADGA 5B3JE 5D4QA 2DWDB 3MNZA 2Z0BA 1T5XA 3CZEA 3CXDL 1PZBA 1ZAGA 4HKBB 4TLSA 1DR9A 4BH7B 5FV1L 1B4RA 3JWNH 4GRWF 3IDMB 2QBWA 3WJMB 1QBMH 2PCFB 3UC0H 1KPUA 4YDKH 3NCMA 4YDLB 4PJCB 4W9JC 1A6AA 4QLRA 4EXKA 4JJ5A 1XMEB 4BZ2A 4S1SL 2JKSA 3DETC 2H6OA 4JFDD 3L5XL 2X4PA 1ZHNA 5GSVA 4AQEA 2AEQL 2ZKYA 2EEDA 3VD7A 4Y4FA 1T5XB 4LBEA 3FQRA 1A6VH 1KV3A 1K4CA 4QYOB 3REWA 5DJ2A 1P7KB 3N1GC 4LSRL 4ZO7A 2HTKC 3BAWA 1A02N 4M7KH 3RY6A 1YEFL 2K6WA 4RAVB 4DTGH 3WUZA 5EOCL 3L3GA 1SUHA 5HHME 1HXMA 1KTRL 4IOIB 4QRUA 1KJ2L 2IDFA 3T1WA 3I9AA 5ISZB 1BDYA 4C56A 4E9WA 3P9WB 3E6FB 3MLVL 4UIKL 1UXWA 1F11B 3K2UH 1DN0A 1IKOP 2EYRA 3H9HB 1MCWW 1TF4A 5A6LA 4PRDA 1D2OA 5L4IA 2MCAA 2A83B 2YMXL 3DX8A 5E4IA 3EH5B 4G72B 5HHQB 4WJKB 1MOEA 32C2A 5E5MA 4QUOA 2EDWA 1DVQA 2V7NB 2VT0A 5HGAA 3T4YB 4UOW1 5T3ZL 3O81A 1CFNA 4N9OB 1QPKA 4LP8A 4OM1H 2ATPA 1JF1A 1RIVH 4KY2A 2Y7NA 2WTRB 1PDKB 1T21B 2XA8L 4F7MB 2NNFA 4FTVD 3S8GB 2ADIB 4PP1C 4OCYH 2VMEA 3AAZB 1AS6A 2P7TB 1YN7B 1Y1UA 2WXMA 2YUXA 4G8FA 5F7HA 2BNQA 5DJZB 3PU7A 1UM5H 2BC4B 4Z3FA 1A9EA 2VM9A 1T1WA 4QRTA 3RU8H 3V5DB 5F6HI 3V10A 4PIRF 4MHHG 3W1ZA 1XXDC 4I87A 4NQTA 1XH0A 3H7LA 1NCHA 3FTZA 2LU7A 3MCLH 1SEQL 4U6XB 1AP2B 5DFVC 2ITCA 3POCA 3QJZA 4QRBA 5KSVB 3QP3A 4FHJA 4HZAA 1ND0A 1C16A 5BRZB 1KMGA 4OVVA 5D2LA 3JV6A 1HHHA 4Y9BA 3CU1A 1JMZA 1G1YA 2F2HA 4TLUA 2Y72A 5L2JB 5KYWA 3VFWB 3VA2C 3CHQA 3ZBMA 4OLXH 1IM3B 3SD5A 1FIGL 5B22A 5HYQB 4NENA 4KJYA 4OZGE 4EOWL 3DHUA 4ABUA 1C1EL 1A3LL 2I60L 4JREC 1S9YB 3BH8A 2NR6A 1BQSA 1PFOA 2P46B 3JYBA 1AKJA 5HHOA 3SYOA 1E4WL 4Y2NA 5H37G 5LGHH 4BK8A 1AGBB 1YDPB 3PWUA 2D7OA 5KVGE 4Y19B 4GQQA 3HE7D 1LK2B 3K6DA 4OM0L 5TJWK 5DK3A 3DRTB 1UGKA 1R19A 2QQNL 4DKAA 2IFGA 1HHKB 5HDQH 3ZKSD 5I75C 3TOPA 1M6UA 2VW4A 2ZWYA 2KQMA 4FXGC 4NLHA 3D05A 3VNZA 4N8CL 3VFRA 4P46C 3NJNA 1HOEA 3L2LA 3MUGA 1ZV5A 3VX0A 3A5VA 2AJXH 5JLZB 1KXHA 4WI2A 1MFDL 2VKWA 1FNFA 2APWA 1YG9A 1JJUA 2LQRA 1JMXA 5LO7A 3S48A 4HWNA 4U1NB 2DWSA 4JZJC 2EDLA 3C6LD 5B39A 2WZAA 4XE0A 4XXWC 4EIBA 2WLKA 2DM3A 5D1XA 4FG0A 3WV0A 1GS8A 1EEYB 3KYNB 3TBWB 2ROYA 3LZNA 4Z3GA 5E70A 3IVKB 3QNZA 4LESA 4PJ9D 4XNMA 2HFEB 1IRAY 2H0FA 2APVA 1NLBL 2PR4L 1I82A 3BP7A 4WNQB 3OC8A 1AGBA 5IEKB 4AYEC 4YUEL 4FQJL 3QZBA 4NQCA 2OMBA 1B0GB 1GYUA 2G9KA 3CFKA 4HS8H 4Q14A 4S1DC 1R5IB 2EC8A 5F1NB 2Z9TA 5FK9A 1F56A 4DN4L 1R5VB 3GZOA 3UBHA 2W92A 2BRQA 1ZVHA 2F8XC 3RWDB 1T89C 4ORGB 3EJZC 3TIDB 1G7PA 1AGEA 3GMPB 3QQ4B 5EO1A 1D5BB 1DZ0A 3JV6B 4G6JH 4R8WH 4AQ1C 4FQ2L 1FGVL 3QJTB 4OLYH 2OI9B 5E6SB 3RG1C 1WQVT 2FX7H 3FQ2A 3RA7H 3T1FA 2I9TA 1OE3A 1CXIA 2E4TA 1MFCL 2E9GA 4M56A 1B0RB 4LCWA 4OD1L 3N43B 5BVPH 1C7SA 4MD4B 3SDAA 2NQCA 3MRHB 3D39E 1A9EB 3FTWA 1FPTL 3KYAA 5CN1A 3D50A 1YN7A 4G8FB 4ZO6A 1URIA 5LGKA 1HX0A 5JW3L 1AXIB 4F7MA 1DBBH 4OVUA 1HQ4B 2WTRA 5C8JB 5M7QA 3FB6A 4U6HB 2XBZA 3VXUE 1USZA 3AADB 2HZHA 3QFGA 5IFHH 2DQTH 5IQ7L 3RZCB 2C34A 1UB6A 5EU5B 1EWHA 4X8JB 3GK8L 4XVSL 2LVCA 1W8OA 4MDJA 2NY5C 4YHOL 5DF0A 3FO2B 4RFNC 1CF8L 1DVFC 2ERJC 5ICZA 3BZEB 1T0OA 2H6UA 5D1ZI 3S88L 2DLFH 5D7IE 1NC4B 2WJ7A 4OZIB 3T8MA 1KBVA 4GLRI 4JFQB 4ZUWA 1UXWB 4I0PD 1VENA 2WIIB 3IFPB 4LPTA 4N6RA 3VTAA 1AZVA 2J88L 2B14A 3JWNE 2RA1A 4G9FB 4N5UA 4A37A 5BQ7B 3NRQA 4YFLI 3VXPA 1SOKA 2W9DL 5HP5A 4F7PB 3HJEA 4RFEA 5KZCD 1ACYL 5H94A 3L1OL 1R5WB 3THML 1KEML 3K0WA 5KWYC 3LKQB 3A6CH 1HCZA 1ZT1B 3FQRB 1NBZA 2W59A 4G9FE 3SGDI 2GG1A 2O61B 5E9DD 4H40A 4HC1H 1TJMA 3HB3D 2IWFA 2R0KL 3K72B 3WIIL 1JP5A 4KQ3H 4YSSA 4DO5A 5EUOF 4GUPA 2LW3A 4G71B 2OTUA 1HHIB 5C0EA 1G9MC 3LZRA 3K2MC 4OFDA 3ISRA 1RJYB 2SEBB 3W9EB 2AC0A 3D0LA 3F64A 4NT6B 3K4DA 3P3UA 3IDMA 3WJMA 2E27H 1A1MA 4X98A 5ABAA 2D31A 1F3DJ 3QH3A 1E8WA 4HAFA 3WEMA 2CSPA 2A0LC 1T1ZB 3S4SG 2DY2A 4N9GB 5G5DA 3EXJA 3KDMB 3ROLB 2G4EA 5J6SA 4HCRH 3R7QA 5FGBA 1ECYA 4Y2DB 3MOBL 2CO4A 2AV7B 3QJHB 3DURB 1L7IH 5H94B 5K9KB 3IAGC 4N5EC 2YEZB 1EXUA 3IXTA 1SUJA 7TAAA 4QHNB 1HZKA 2OL3H 2YPVA 5AW7B 5DI8B 3LB6D 3V9CA 3EYOB 4X6EB 3CBJB 4XRCB 1URZA 4ODTL 5CSBA 1E6OH 4G7YH 5DXWA 5T1KB 5E2WH 1UH4A 5MP6L 2FWOA 3QFJB 5DO2C 3FCUB 4U1IA 4OZIA 4MMXA 1AQDA 1U2YA 3B9EA 3GXPA 4ZOAA 3ASOB 5FR3A 1JPEA 2EE9A 1BVOA 5ENWA 1RXLA 1U8NA 2VISA 4W4NA 3SZKC 3WIAA 4KX7A 5EU5A 1DBJH 1A3RH 4PMEA 3QPXH 5E1IA 1Y18A 4OD1H 5BVPL 4YHKH 3X14B 1IKFH 1EO8H 3EFOA 3O8XB 1TJXA 4CN6A 3EJTA 3UDWC 3WTWA 5C2BH 1N64L 3QEQB 5J12B 1OTUC 2Z31D 1JE6A 1JGUH 4HOXA 1WJ3A 4PRNB 3TBBA 5ID1B 2R4SL 1AR1D 4XVUD 2MNJB 2FH6A 3NBNA 1PKQA 3R1GL 1TEFA 3GSQA 3Q8EA 3WEAA 4JB9L 4N8UA 4LARH 2JNZA 4LCWB 5IJKC 3CFBB 2L7EA 1GSMA 3BWAA 3TLRA 4NC1C 4KKLC 1BJ1H 1NFDE 4HCIA 4OQ1A 5LCVH 5I1HH 2ZUYA 3LH9A 3GSRB 2K45A 2VLKB 2YJLA 4RRPA 2NZ1A 5KS9B 4Q6KA 3LXCA 3WDIA 1BYPA 1WBZA 3A6BH 5D7LB 5CZVL 4JZNB 2Q8AH 1HZLA 4Y4HB 1IC0A 1JDAA 1TO5A 5F1SA 4MA8H 2VE6A 4EI5B 3RWGB 2CXGA 2EP6A 4FLRA 3MRQA 5AVYB 1UA6H 5GJTL 4XTRD 1IBHA 1Z5YD 1R5VA 3QCUH 3KJ6L 1DO5A 4PTUA 1MSPA 4LU5L 4ZOEA 3PP4L 5C0CA 3UJJH 5CD5C 5MHSE 4N2MA 5D4JA 1E90A 2P42B 3FAXA 3KPQB 4OCXH 1WS8A 1IU1A 4WEMB 1WTGT 4KKBC 5HJ3B 2P43B 4PJHB 3QSKB 3P4OA 3F01A 3UG5A 2E9WA 2VC2L 4HJIA 3KYNA 1A8ZA 3IB4A 3LKOA 4OH2A 3LHAA 4XAWH 4KAQH 2VM4A 5I75B 5CJ5A 1HHGA 2Q9OA 1TO4A 1MCJA 2YOAA 3OKNA 3T2NL 2GTWB 4R7NB 4KTEH 1J86A 1B88A 1TQVA 1V3LA 2BCKB 3DROB 3AJ7A 3GB7B 2MPAL 4JUSA 1HHGB 3ERXA 4Z3TA 1E4XL 3TWYA 3ZE2B 2OJEB 1UWFA 4ERSH 1E28A 5JLZA 5LXVA 3LKOB 5TDNB 2A6IA 1Z2KA 2J6EA 2G2RA 1AYRA 1J0YA 3P2TA 3VFRB 1SF3A 4FG4A 3TA3C 2Q6WB 1GZHA 4HIHA 4HS6B 3ARDC 2ZPKH 4WI4A 3CZFB 1DVYA 2W0LA 2WUCH 2XWXA 5A2CA 3WE6B 4ZO9A 5L6YL 1F3DH 4PJHA 2YBGA 3TX4A 1I3RB 1NGZA 2NLJB 3MU3A 3VFTB 1DO6A 3BYYA 3BH9A 4KMLB 4QRRB 2C3WA 4P23B 5DVOA 2CRYA 2X4SA 2ITDA 4M93B 4KHXL 1C5DB 4K3GA 1M1XB 3RVTD 2X3CA 2YXMA 3SO3C 2OTWA 4IU3A 1JWUA 4CBZA 2F19L 1CR9L 5D7LA 2WLLA 1ND0B 1JDCA 5LWYH 4OLVL 2CO6B 3V4PH 5IFJB 1VCBC 5ALBH 3TO4D 5I74B 2FBOJ 1N4XH 3BLPX 1VFAA 1QUNA 2PXYA 4ZX3A 2VZTA 1MF2H 2B1HL 3WS6C 1B9ZA 1HESA 1OCOB 4N2NA 3NVQA 3BGFC 3CFJB 2B59A 2XYCA 5HY9B 2WXLA 1A25A 2A6DB 2R69L 1CCZA 1ZWIB 4Q58C 3VB9A 2Y7QA 1X9UA 1CURA 1MJ7H 3DMMA 4Y1AA 1ZXQA 1MHPL 3I50H 3QUZC 1VB9A 3NPSC 4HX1B 1X6NA 4M9PA 1U8KA 3FDWA 3FFCA 2WXIA 3OXSB 3MGOB 1OHZA 1JF1B 3FUKA 3BKJH 3ULUE 4PG2A 3RGVC 1CFNB 2UX7A 2WXHA 5BJTA 4NO2A 1KPVA 4H0HB 2FBJL 1ECZA 1OV8A 1IE4A 4Z3EA 4N0FA 2EJ1A 1NIBA 1W8NA 1S5HB 5FHBH 5DK2A 1FUNA 2OMTA 4PGCA 5CIPB 2VTFA 4ZTOL 3EJJX 4NWTL 5IUCA 4CKQA 4P2RA 4KI1A 3I02B 4D94A 1OL0A 2J1YA 3FFOA 2PTVA 4HCRA 2A4ZA 5I0ZA 3E6FA 4E5XG 3H3KA 4P5RA 2VITA 5EF3A 5C0NC 1CF1A 3LKPB 3KVDD 3RJQB 1Q1JL 3OLEA 3IPBA 3QJFA 2BWIA 4AL8H 1OD7A 3LPFA 4EDWH 3FF7A 1TLMA 3GZQA 5DQJA 5DVKA 3VSUA 2PPAA 2QVTA 1HHJA 4JDEB 5I5RA 1K4CB 3M17B 2HRLA 3H8NA 1YHPA 4WENB 4Y4FB 3A4EA 1RZIB 3BAEH 4JM2B 4PY7A 1SJXA 5CMAA 3BT0A 3DO4A 3LN5B 2LU4A 4QHPA 2A74B 3FQXA 4HC1A 3BGMA 3MJ7B 1FNGA 2IWGA 3EJYC 2RBLA 4OKVB 3V0EA 3PAZA 4JJ5B 2Z93A 4AEHL 1WWBX 4O9HL 1SFDA 4ZMLA 2X0VA 1I8KB 3J2PA 2E7LA 1A6TA 3QI9A 1XZ0B 5DRZB 4YXKL 2HLAB 3NAAH 1OP4A 5LAPA 2HP4A 4NUPA 4A63A 3MCKB 3QJUB 3QUYB 1QSVA 2PCFA 2BLFA 4IEFB 2ATAA 4MB3A 5GHWH 3TV8A 3BKYH 5AZEH 4YAQA 3QIBD 4E36A 4BH7A 5BZWB 2FNWA 5JORB 2WGXA 2ZIDA 3V8CA 1NCCH 2MNUA 5DJ6A 3GZKA 1J0IA 2CU9A 3ZOAA 4GW1B 3HC3L 3LHPL 1TU2A 3FT3B 1JAEA 1LWJA 5D9SB 1LE9A 3V0GA 5DZJA 5AAPA 5K9OA 1X5LA 3ZE2E 4X6DA 1LP9A 5BZZA 1YMME 3DC0A 3PV6A 2P9RA 4LAQL 4Q9QH 1Z3GH 4ZFOL 1NUDA 2R23B 4H0GA 3SE8L 4HBCH 2YPVH 1VZHA 3JVFC 1I7TB 4IBLT 4JFTA 3WNNA 4M48L 2QQQA 4XAKE 4ZUWB 1L9QA 3H7BA 1L5GB 4D0DB 4R6UA 4PGBA 5F72S 4AJYV 4Z7AA 3VWJB 1MJUH 3SDYH 5CKGA 1YJDC 5IB1A 4WFGE 4XBEH 5DUBA 3U4EA 3JWNG 4M4PA 2HJKA 4RISH 4D8PA 1UB6B 5E51A 2CQVA 3MLVH 3IU3B 3NZ8B 5I6MA 5DEGA 1BM3H 2B08A 2XKNA 3ARFC 2CALA 4TSAL 1XF1A 2B1HH 3V6OA 4F8OA 2L4OA 1NAMA 1L9PA 1HQ4A 3NEXA 3ZTCC 2RGSA 3PWNA 3TN0A 3FUHA 4KFMA 1NLDL 3I9PA 2W65A 2J5LB 3C6LA 1XGTB 4YDIL 2G3MA 4Q97A 1MCIA 5KVDH 4JN1L 2XWCA 3QARA 1ZEAH 2ZCZA 4X0KA 4OFVA 2XDHA 3RL2A 1AIFB 3GTVA 1N0LB 4XB3A 1XCWA 3FUMA 1D5RA 1JUFB 1ZHLA 4MD4A 3SDAB 5KVFL 4DEWA 5DLMH 3ARZA 1O5PA 1MFUA 4JN2B 4M1GH 4DAGH 1VKXA 3DGGA 3EYVA 3D39B 1DJXA 1RPQA 3S34H 3P0GB 4U6VH 1RPKA 4GAJH 3EJCA 1JK9A 3OZLA 4HPYL 3BRFA 2IGTA 4K94H 5DRNB 1XF5B 5D1QA 6FABL 5CEZL 3UTTB 2VXQH 4HS3B 5AD0A 3RWEA 2P5WE 4ZUVA 3NSCA 4P46A 1NCBH 4N2OA 4XVOA 2EXWD 3ALPA 4ETQA 5EBWB 4ZAKB 2GSIB 4RFOL 5ID0B 4BKTC 4JO2H 4NKIL 2E27L 3W57A 4E41A 1WFOA 4M02A 5E4OA 3LB6C 3UX9B 1UM4L 2WK2A 5K5YA 3CLEH 1KB5A 4LEOA 1FO0L 4OLXL 1HI6A 2FD6L 1P0SE 3IVKA 2EO9A