5B7FA

Structure of cueo - the signal peptide was truncated by hrv3c protease
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
486
structure length
463
Chain Sequence
RPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
publication title Biochemical, spectroscopic and X-ray structural analysis of deuterated multicopper oxidase CueO prepared from a new expression construct for neutron crystallography
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
total genus 142
structure length 463
sequence length 486
ec nomenclature
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7fA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7fA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7fA03
1SJMA 4JHVA 2OV0A 3CVDA 1JZFA 1UATA 3KW8A 4M3HA 1CC3A 1KCWA 3T71A 3ASOB 3QPKA 3MBWB 2IDFA 1ASOA 1ID2A 1PNDA 3UAEA 2IWFA 3IN0A 4UAHA 4PAZA 1AAJA 3WKPA 1SDDA 4KOCA 2VW7A 5I6MA 2RACA 2MTAA 3X2QB 1QLEB 2FT7A 5F7BA 4DP2X 2P80D 1RKRA 7PAZA 1NTDA 1MG2C 7PCYA 1I53A 2AFNA 1KGYE 1NIAA 2FNWA 4GP8B 3OMAB 1SDDB 1XB3A 2W8CA 1V55B 2PCFA 2PCYA 4KOBA 2AZAA 3TU6A 2XXFA 4PCYA 4DP8X 3H4HA 4DP0X 1TKWA 2DY2A 5B7EA 4L0PB 1NIDA 1J5CA 3WI9A 1CYWA 1EZLA 1CURA 2A3TA 1J9QA 4HZ1A 3OQRA 3N55A 3EHBB 2YQBA 1ADWA 1EHKB 2VN3A 4GXFA 4KO6A 3PAZA 2DYRB 3JT2A 1W6WA 2FQGA 2IAAC 4NERA 3PAVA 4G72B 3TA4D 1JZJA 4GY4A 1OE2A 4KO9A 1PLCA 3FSVA 4AKOA 4G7SB 1ZIAA 2DYSB 1AOZA 1L9QA 1BQKA 1PLAA 4MFHA 2WO3B 1R1CA 4DPCX 1OE1A 2XX1A 2IH9A 3ABKB 1IKOP 2BP0A 3T6WA 2UX7A 3IBOA 2XYBA 1OCRB 2ZWNA 2BP8A 3PLYA 1JVLA 2QPDB 1JOIA 3NSYA 1AQ8A 3FT0A 3TBCA 4E9TA 1E5YA 5I28A 2I85A 3ZBMA 5B1KA 3FSAA 1BYPA 1GY2A 2HX8A 3AZUA 1QNIA 1GSKA 5AKRA 4A68A 2FJSA 2EIMB 2BP0B 1SHXA 4HHWA 2DWSA 1KBVA 1KDJA 3S3BB 2BP8B 4W1TA 1E67A 1JZIA 1L9SA 2YARA 1V54B 5AZUA 2FTAA 4A66A 4DPBX 1ASPA 2XWZA 1HAWA 1L9TA 3NJIA 2VMJA 3AG3B 3MX0B 2PLTA 4N8UA 3BQVA 3TASA 1E65A 2UXVA 3G5WA 4GP4B 5D4JA 4DP1X 3C75A 4YSDA 2TSAA 8PAZA 3IN2A 4KNSA 3FSWA 4FA7B 1AANA 1NINA 4AI7A 3OMIB 3SBRA 1BYOA 1AR1B 2XUWA 3NT0A 1WAEA 4AX3A 4HCFA 3FSZA 4AKQA 1BXUA 1BXVA 2ZOOA 4YSAA 3EH3B 2XV3A 3FPXA 4E9QA 1IBZA 2Y69B 3CDZA 5I5IA 1ZDQA 1NWPA 2IDUA 4QKTA 4ENZA 1WS8A 2Q9OA 1WA1X 1OCZB 4X4KA 4HHGA 2HLEB 1NICA 1A4CA 4G7RB 4BWTA 4E9XA 1NIEA 2EIJB 1M56B 1SFHA 3CDZB 3PPSA 1BQRA 4F2EA 1IC0A 2BO0A 1PF3A 2GIMA 4RH4A 1TEGA 1GYCA 3X1GA 4AKPA 3ZX1A 3NJKA 1KBWA 3NYKA 3PCYA 3AY2A 1M57B 1AZNA 1WA2X 3WNJA 1RZPA 3FU8A 3OM3B 3HEIB 1J9TA 1PLBA 2QPEB 4HCGA 4UANA 6PAZA 1M9WA 1SF3A 5B7MA 5PCYA 4A2FA 1AZRA 2LLNA 2BZ7A 2YAFA 2TSBA 2W88A 4DP9X 2J55A 3PXLA 3N2JA 1MDAA 4E9VA 1ILUA 1WA0X 5FC9A 4UF7C 3EF4A 1DZ0A 2B3IA 4Q89A 4E9RA 2CBPA 5PAZA 1T5KA 4KO7A 3CVCA 4A2HA 5TK2A 1OV8A 1NZRA 3NJLA 2HRGA 5B1JA 2UX6A 3AG2B 3AG1B 4BWWA 2PPDA 3NJNA 1GS8A 4YSCA 2YXWA 1PCSA 2YAOA 4JHUA 3CZUB 3ZIYA 3BVDB 5EHFA 2BWDA 5I6LA 1NPNA 1A3ZA 1VLXA 3NSFA 1SF5A 2CUAA 3WIAA 2NRDA 3ABLB 1L9RA 1W8EA 3NJGA 4KNUA 3U25A 4Q8BA 2ZONA 2I7OA 2PPEA 1ASQA 3S3DB 2XV2A 1MZZA 1NDTA 3GYRA 4AZUA 4YSUA 1HFUA 2J56A 2Q5BA 1A65A 1PY0A 1AIZA 2HZHA 3S8FB 2IWEA 3NJFA 3ZDWA 1A4BA 1RCYA 2YAEA 5B3SB 3T9WA 2J5WA 2PPAA 5A7EA 1NPJA 2UXGA 1NIFA 2HX9A 3QJSB 1FA4A 4YSSA 2E86A 1ET7A 2FT8A 4DP7X 2HXAA 2YAMA 3GDCA 5D4IA 5AFAA 3UAAA 3FQYA 4HIPA 1JXDA 3IE9A 4YL4A 3RYMA 2I7SA 3D12B 1BQ5A 5D4HA 3V9EA 3ABMB 3DKHA 1PNCA 4A2EA 9PCYA 4BXVA 1KDIA 2CCWA 3FPYA 1J9SA 4P5RA 4DP6X 2X87A 2J57A 1AZBA 2PPFA 1PZBA 1ILSA 1JXGA 1XB6A 5B1BB 4YVNA 4YSRA 4CSZA 3X1FA 1OCOB 4M4RB 1NIBA 5E9NA 1AACA 1WS7A 3FU7A 5ANHA 2FQFA 3OD3A 4NAJA 1CUOA 1BEXA 2IDQA 2XLLA 4HALA 2H47C 3AG4B 1N68A 3NSDA 2IDSA 1IUZA 1E30A 3WG7B 4KO5A 4YSOA 1AZCA 3FU9A 2N0MA 1BXAA 3CG8A 1AG0A 1NWOA 3IEAA 1FWXA 1PZAA 2PP9A 3KW7A 3WKQA 4DP4X 3X1EA 3S8GB 2BZCA 4HAKA 5I6NA 1KV7A 3FU7B 4F7KA 1ZV2A 2PP7A 3QJTB 1QHQA 4YSEA 3NP3A 2PPCA 2HX7A 2HRHA 3GXUB 2EIKB 3FQ1A 4W9ZA 5LDUA 3ERXA 3T6XA 1CYXA 3T6VA 1PMYA 4EF3A 2YAHA 4QLWA 4NB7A 2XX0A 3H4FA 1JZGA 3CVBA 3SBPA 4K9JA 2R7EA 1BAWA 5I26A 2BW5A 1JERA 4DPAX 2PP8A 3TBBA 4A67A 3EH4B 2VSKB 3UGEA 1ET5A 2GHZA 1JVOA 3NP4A 2EILB 2VW4A 2XV0A 2CALA 2WSDA 2JKWA 2XU9A 2P80A 4JKNA 1DYZA 1L9OA 3FQ2A 1AS8A 2IWKA 2JXMA 2R7EB 5I5MA 2X88A 3X1NA 1L9PA 2QDVA 3QJVB 4E9YA 1A8ZA 2IDTA 5IY5B 2DWTA 2VSMB 3OMNB 4YSPA 1PAZA 3FS9A 4WTQA 1TEFA 2FQEA 5I6PA 3DTUB 2BWIA 1XB8A 2FT6A 3JTBA 1KCBA 3QJUB 1SFDA 4TXVB 1OOWA 1B3IA 4G7QB 3UADA 1AG6A 3QQXA 2OCCB 4G71B 3QJQB 1IBYA 2FWLB 1PZCA 1GW0A 2QDWA 1KYAA 4HCIA 3ASNB 2GC7C 3NJHA 4YSQA 1JXFA 4FAAB 2YXVA 2YAQA 3FYEB 2GC4C 2B08A 4WKXA 1HAUA 1ZIBA 1GR7A 2CAKA 1J9RA 2GSMB 1XMEB 4BK5C 5B1AB 1ZDSA 2JFCA 1GS6X 1GY1A 4BXSV 5TK4A 4CSPA 3SQRA 2VW6A 4N4YB 2DV6A 4ZK8A 1A4AA 1JZHA 2ZXWB 3ABGA 4YSTA 1X9RA 4A2GA 4BDVA 5I6OA 4F2FA 1J5DA 3NSCA 2BHFA 3WNIA 1SNRA 4E9SA 2CJ3A 2GI0A 4G70B 2EINB 5B1JC 1AS6A 3H56A 3DIVA 1TU2A 2GBAA 1AS7A 2BW4A 1AZUA 3UABA 2UXTA 2Y1AA 2AZUA 1ZPUA 1E5ZA 2H5UA 4BDVB 1FFTB 1YLBB 2QT6A 3PAUA 3S3CB 2OJ1A 1GS7A 1SHWA 2GB2A 3X1BA 2AANA 3QJRB 1URIA 3T6ZA 4BWUA 1OF0A 1OCCB 3UACA 5I6KA 5F7AA 4YVUA 4GP5B 1MG3C 2XXGA 2MRYA 2YAPA 3L45A 4DP5X 1RZQA 1ETJA 2WO2B 2IH8A 2XVBA 6PCYA 1OE3A 3SBQA 4E9WA 1W6LA 2FQDA 3EH5B 2AVFA 4P5SA 2VM4A 2H3XC 5I5JA 1F56A 3HB3B 1JZEA 1ET8A 3AW5A 5B7FA 1MZYA 4GYBA 4A2DA 1N70A 2UXFA 4KNTA 2VM3A 3V9CA 3NJJA 3NJMA 1X9UA 1V10A 3FYIB
chains in the Genus database with same CATH superfamily
3W56A 1JGVL 4C8XA 1A0QH 4YNYB 2VMDA 9CGTA 4ZUVA 1JZFA 2WXLA 2R1XB 4QGYA 4Y4KD 4LEOA 1U95B 4FFYL 4FNUA 3CFMA 4IRZH 3SDAB 5JYLA 1XH0A 2BXZA 2PUQT 1H0DB 3PHAA 5B38G 4OF0A 3D2UB 1E4WH 2GVYA 4D0BA 1JZ8A 2RACA 3F64A 3QNXB 1QLEB 4X9IA 3V10A 2KH2B 2P80D 3VWJA 1M7IA 2FL5A 3CSFA 2DM4A 2AABH 8FABA 3CGTA 3EYFA 2YD9A 1Q0YH 2EXWD 2VDQH 3QNZA 4UV7H 4B97A 3C09C 3X12B 3L48A 1DSFH 5JXAL 1JZ3A 3TEZA 4G9FA 4BSVB 4K3GA 1MFUA 1NMAL 1WZ1L 3HVDA 4KK8C 2BVOB 2EYTA 1FO0L 5CP3H 2WMPB 2ZCZA 3D3VB 3DGDA 1DDHA 1XSIA 2DI9A 5EFIB 2W0LA 2EIZA 3CK0L 1P53A 3CSGA 4JCWA 3IVKB 1YEEL 5F9OH 4NAMA 5CJOH 4YZFE 4F8NA 3CZEA 4Z95H 5GRUL 3EYQC 1ZLVK 2DBLL 2YUXA 4G1EA 5FHBL 3DV6A 4ZJ9A 1FRGH 3WFBH 1E8YA 1EHNA 4KQ4L 4UNVA 3H55A 4A6YB 4S0TD 5JOPE 1CFTB 1EHKB 1HHKB 5FO7A 2ZP8A 4AQEB 1ZA3A 4P46B 3A67L 2AW2A 4NX0A 2IAAC 3VFPB 4IIZA 3WJJC 4CVZB 4U1NB 1J48A 4AY0A 5C9JA 5CCJA 1OHQA 3UTTD 1DQKA 3BH8B 4N2FA 3FT4B 3KWVA 1P6WA 4G7SB 4KI1A 1A4JB 4GFXA 4XB3A 2WTRA 5CWSB 1ZS2A 4B41A 4BQ8A 3NESA 1FJ1A 1L0XA 2P5WE 2XG4B 2ZXEB 1AY1H 1NCAH 4PGCA 4YDVB 1K4CA 3ARFB 2G2RA 1A9EA 2WSPA 5EEYA 3AT0A 3MUUA 1WZLA 2Z8SA 2ATAA 2EUWA 1FVDA 2YGNA 4KJQC 5SWSD 4TNGA 2YD2A 3DI2B 4L8SA 2I85A 2E46A 3FW6A 3UZVA 4PJGA 4MAYC 1RFDH 1T7WA 3HCVB 1SJEA 2AXJA 2MKLC 3HPJA 4J3OF 5JNYA 1BBDL 2YPLD 2I24N 3B9KC 2OI9C 5EZOH 5HHMB 2YGQA 5MEOB 1AE6H 2G5UA 2X4QB 3GINA 4Q97A 5MI0C 3KYOB 3IF1B 1IGIH 4Z7WF 3LXAA 4HIHB 2JKSA 2V8MA 3T4YA 4IDLA 1IM3B 4MA7H 3GBDA 2Q2EB 1JI2A 3FCTA 1FL6A 2WOYA 3HPLA 4PD4J 3BVUA 3ZU8A 3IN2A 1KG0B 1TQVA 2CHWA 3BKJL 1OQOA 2ZF8A 2UZPA 1QA9A 3RWFA 3U4BH 2WYIA 3FBKA 1EO5A 3QDME 2OMTB 3OGCB 4P5TA 4JHAH 4KKLD 1TJGL 4HJUA 1AOHA 3GXDA 4L0ZA 5T3XE 4YPGA 3ZDZB 3F7KA 2V2WB 2E9BA 1CGSH 4PRHA 3OTTA 3BAWA 2OR9H 1U8MA 3VTAA 3KBEA 3CFQA 3VJ6B 4KK5D 3DPBB 3QEQB 3BGFB 3NCYP 3FB6B 4NQQA 1E6OL 4NO3A 4EUPG 2YEZB 2KPWA 1ZANL 3N1GC 1K85A 4LPWA 2L0DA 2DLFL 5HHNB 1FYTB 3VGAC 4GEJA 4JL2A 4LGPB 5AVWB 4M4PA 3CBJB 4HPOH 5KUKA 3FXIC 4G9FD 5C08E 2L3BA 3FU8A 2EKSA 4GLRI 4KTYA 1B4TA 3EHBD 2V5YA 2ICWI 1HL4A 4POUB 2AI0H 1UOKA 1MAJA 1G6RB 2E7MA 2IBZY 1CFTA 4IHOA 4F7EA 3M7FB 4ZMNA 3SE8H 3V55A 3HZKB 4M1GH 4UBDC 5BUAA 1J05A 4UV4H 2W88A 2Z8RA 4B50A 1ZK9A 2Z3FA 4LPCA 1G7QB 5C09E 3ZL1A 5FC9A 5FM8A 3IYLW 4M5SA 1JF5A 5J7CC 5D1ZC 3VDAA 3FT4A 1L9MA 4A2HA 3K2UL 3HN8A 4M5TA 1JP5A 4ODXA 4U1GB 3IDNA 5DEFB 1NFAA 2VXUH 2Z31A 2NY5C 3D39B 3QUXB 4BZ1A 4XE0A 3OSKA 3RURA 2NZ9C 1DQMH 3ZUNC 3GRBA 3DBXA 1MN4A 4I2XE 4F33A 4Z7WB 3K0WA 1QW9A 4R3SA 3HZVA 1QFWM 3UJIH 4ACPA 2ZX7A 5FEBA 4P2QE 1W80A 4M56A 4PJHF 4G8EB 4AGOA 4OZIF 5IB5A 2EECA 4WUUA 3B6SB 3QJHA 2A4CA 4KNUA 2LR4A 3U25A 2JJUA 2YRPA 3UDWC 1FLRL 2IEPA 3PNRB 3U2SB 3S5LG 2VYRE 1NSNH 4F3FA 1NDTA 2OSWA 2Q5BA 3LQAC 3UBGA 2VDNL 4BHUI 4EO5A 3JVFC 4IU3A 2IWEA 2AJ3B 4TSAL 3FQNB 2NY7L 3ZDWA 1KV3A 3CFKB 5HDQL 3V0VA 3HAEG 4LSVL 2UXGA 2HX9A 4AE0A 1QRNB 3TH4T 1P69B 2CDFA 4PRID 1VZGA 2WXIA 5F7UA 3EDJA 3KPNA 1GH7A 4HXBH 1UOWA 4MXVE 1TETH 5ILTH 2SEBB 3C5ZD 3UAAA 2JJSC 5IW1A 2X7LB 2J6EA 1ZVHA 2WVTA 3CFBA 5D4HA 3WNKA 5KWYC 3TYGL 3H3KA 1HZHH 2EXSA 3I2CL 1N12A 2VLLB 1FPTL 1ILSA 5B1BB 5IVOA 5DZOA 3NZHL 3EO9H 1DQJB 5FGRA 1D5MB 2F18A 4OZGF 1WS7A 1B4JH 1I1YB 2FQFA 2JTYA 4N0FB 4TNWF 2CMRH 5AENA 5DD1H 4I4WB 1N68A 4JL1A 4LOVA 3SKOA 1JWMB 4O2FB 4WJ5A 3A4DA 3DMMC 4KO5A 4ZMXA 3VXRA 2FVNA 4HX1B 4PJCF 2AGJL 3FRPG 4IMKC 4YK4C 3U0PB 1LVEA 5J3HD 3WJLC 4K73A 2ZXCA 2MNWA 5AOKA 2YZ1A 4PMEA 5I17A 5SV3A 2Q7YB 2BZCA 4PRHD 3DX7A 4JJHA 1QHQA 5E6RB 3TBSB 3QIWA 4R4ND 3UEZA 3QUYA 3U36B 5SX5K 4YHYB 2IXQA 1BX2A 1A1OA 1ZXQA 5DHEA 4YHZL 1LE9B 2IFGA 4Y4HD 4QOKB 3ERXA 1CDCA 1DQVA 2JCWA 3I6LE 2H41A 5FHAL 3T3ME 1F2XK 4J5VA 4PJHB 4GRMB 4P05A 1KJVB 3PL6B 5LGHL 1B0GA 1DLFH 2V7NB 3O3UN 5ECJE 4D3CL 4H8HA 2ZNWA 2R0KL 4MKMA 1QYGL 2ENPA 3NQKA 1ETA1 4PRAA 3CIQA 4JQVA 4ZUUB 3OKEB 5HGGS 3GC3A 3RTQC 1JERA 3ZDYF 4YLQT 4NN5B 4OJCA 5DHMC 2HN7A 4PIBA 4HIQA 3WE6B 4X9HA 5I0XA 3MCKB 4JRYA 1R3HB 1IBBA 3REVA 2BH0A 2WIIA 1YUKB 1G5GA 1R5VB 3G6JE 4PRNA 1P5UA 5TF0A 3QCUH 3UTZA 2WLLA 4MWFA 1DBKL 4Z7WA 1MRCH 1DYZA 2OPCA 2R27A 4HCRL 4XMPH 5HDWA 5DJYA 1E2ZA 1JRHH 3SHSA 3WIHH 2UV3A 4LLMB 1QTSA 3S2AA 3X1NA 2VXQH 1L0YA 2ADIB 4XXCA 2O6CA 4YFDB 3D4GA 3V4VL 4DGVH 1AP2B 3F2LA 3E1F1 1XGRA 3QFDB 1BLNB 2FQEA 4N86A 3TVMA 5J13C 4M8VA 2XRAH 3O6KL 3L3KA 3SDDB 2W92A 1QSEB 2FT6A 3O4LE 3GNMH 5I76B 5L4FA 3E9TA 1BFVH 4TSCL 2ZUTA 2BOBA 4C83A 1GA2A 1AG6A 3MDJA 3KLAA 4MMYB 2AMGA 1GAFL 4HS8H 1AO7A 4WFFD 3JUYA 1XCQA 4WUUD 1JXFA 1T0MA 4FZ8L 3KAAA 3LZRA 3QJZA 3W5MA 2B08A 2OZ4A 2NR6C 3LMJH 5FA3A 4XC1L 2MPAH 3LN5A 1S7VA 1LD9B 4JQIL 2Q3XA 4FP8H 4J3BA 1IT9H 4QXGL 4XE5B 4NQEB 5AW1B 4OGYH 3QNYA 3OHXB 5DHVH 5KG9B 4EEEA 5FGBC 1NCDL 2ZXAA 1QP1A 3QAZC 2VLLA 3O11A 5FUZH 5KSBF 1NOAA 4KROD 2CGYA 4AC2A 5C0IA 1GGIH 4F2FA 4PJ9C 1H8SA 3F7QA 1YEHH 3D0LB 3MODL 2EDYA 1M71B 2P47B 2GI0A 1O7SA 2EINB 4XXWA 5K69A 5I24A 1E4KC 3DIVA 5DRXB 1VAHA 3IJSA 2DLHA 3D25B 3L6FB 3EOAB 4PJEF 4MMZC 1D6VH 1RK0B 3SKJL 5AZEL 4DW2L 1MY5A 2LAAA 2UY6B 3ZDYB 2QT6A 2OP4H 3KHOA 2WC7A 2F53B 3ARBB 3QJRB 3DLQR 1UGKA 2EO9A 3O6FD 4FTDA 5DQDH 3TBSA 2NQCA 4JFQB 5M95B 2XZAH 1A25A 4JZJA 4GO9A 4ZFZB 3VU1A 2WBJD 1TU2B 2XQBL 2MRYA 3RVWC 4OY9A 5K1JA 3EFOB 3VTMA 1KC5H 3D33A 3Q2VA 1Q94A 5GS1B 4GFTB 1EK3A 4YFEA 4XVTH 2WNWA 1W6LA 4PJHA 4HD9A 1GZQB 3OZ9H 4OZIA 1N64H 3B2XA 1J8HA 3GB7B 3QIWD 4X6CB 3QUYD 3PDOA 3B7UX 3QK0A 4HPYH 4I0KA 4GYBA 3DO7A 5I8CB 4S2SA 1A7QH 1EPFA 1SN2A 3X17A 4FABH 2DTSA 2EVFA 1IU1A 4ZXBB 3SPVA 1JPTL 2XZCH 3F84A 2LABA 3ECVA 3IMWA 3FFCA 4WI0B 4I1PA 4P4KB 2CHXA 3H2WA 2C9PA 1TVHA 5FDWB 2GIYA 1QBBA 2V7HA 2WV3A 3KDPB 4X8JB 4J3OD 3L5JA 1XZ0A 3HC0A 1RERA 1G9MC 2X6UA 2QHRL 2H0EA 3MTRA 2F58H 1KBPA 2ZSWA 5F7KC 5L6YL 3WNMA 7PAZA 1MIEL 1NTDA 1TO4A 3QI9D 1DE4B 2VDOL 2EDQA 4TNVK 1LWJA 2HVJB 2AFNA 1ONQB 3LSOB 4N0UA 1U30A 1NIAA 2WQSA 2X2UA 3VRIA 1R3LA 2X4TB 2E7CA 4GP8B 5DJAB 4Q9QH 3SE3A 4OZGA 3VG9C 4IW4C 4Z7UF 3TVMD 3M1OA 4RDBA 5J0BA 3H4HA 3RWIA 1C8QA 2DY2A 4WKZB 5B7EA 1GYVA 1UB6A 3ZY7A 3BE1H 1MCIA 5A3ID 3BLBA 1IKFH 4PJCA 5DFVD 1IEAB 2QQLL 1T7ZA 1LD9A 4AC4A 2A9NL 1FSKB 4MNGE 3DHJA 1HCFX 3FFOA 3ZE2E 1NCOA 5D70H 3HMXL 1T4KA 1XQ4A 1U3NA 2ZAIA 4GMTH 3VCLB 1KEGH 5JDSB 5K9OB 4OH2A 2ATPB 5ISZD 3HVNA 3QA3A 3P4OB 3ARQA 1P84K 5HVHB 3KLHC 2PCPB 3FQRB 4B5ZA 3KNBB 2MTPA 5IJKA 1QVOB 2VRAA 5D93C 3OAYK 4RRPM 1YNTB 1JZJA 2NY2D 1WRFA 4PGDB 5JIDA 3DROA 1GTNA 4JRXE 2CWRA 4BSJA 2BNRE 3EH2A 4U6HA 3SO5A 4JFFB 4J8RA 4XN7A 5D2NA 2VQ1A 3VQLA 3DRTA 2UY6A 3W39A 4ZZFA 3R4DA 3O9WD 1P4IH 3D48R 5AW2B 2P3YA 4LL1A 1AGDA 3IMTA 5IMMB 1PKQA 1TTRA 4G7VH 1UT2A 1SDYA 2PXYC 1HE8A 4KUZH 5B39G 3P9LB 4I0PB 4FQLL 1RK1B 3TBCA 1E5YA 4UQEA 4WCYH 2HJFB 2D7MA 3FSAA 1BYPA 3BZFA 5DEGB 3GMLA 4JFXB 3VGDA 4S1DC 4R8WH 5A2JH 1GZQA 4XC3L 4G9DA 4XCCL 3GB7A 3OKKB 1SHXA 3KYKH 2DWSA 2H6UA 3FRPA 5L2KE 3SGDI 3I9PA 3RWJA 1BZ7B 4K3HA 5T1KB 4NM8H 4FQ2L 3A3YB 4U6VH 1B4LA 1ZV5A 1MXGA 2WBXA 3TBVA 4FFZL 4F37F 4Z3EA 1UB5A 1OTUC 2KUTA 3VB9A 1FN4B 4QXTB 3RZCB 4G5AA 1J8HD 1RU9H 1M6OB 1K72A 4NUJA 4ZMQA 5C0ND 1XEUA 4Z7UB 1D7BA 3CVIL 3FSWA 4EPSA 2XYCA 1JGUL 3NT0A 2APXA 1QUPA 3KCPA 2K4WA 1X7TA 3MLYL 4MHHI 1O5PA 5D1QB 4Z7VA 4H1LH 1IGML 1ADQH 4O2CA 2NY3D 4LASH 5GGSB 2AAVA 1CLZL 2KBGA 3MLWH 2J1ZA 1ZEAH 3FFCD 2KC0A 3SYCA 4RMBA 5DDHB 1JNLH 1QWUA 1JNNH 4RMVA 1XDTT 5DHVB 1Q1PA 1VADB 1RZJH 4L29A 4WEUD 4NI3A 5FM5O 5IVZA 3TYFA 4OJAA 4UTAA 1IX2A 2H2SD 5AYTA 3S98A 4QHLA 2Q9OA 3PY9A 5KSBA 3FUEA 2Y7NA 2QVKA 3SPHA 4UOW0 2HLAB 2XPYA 1KXQA 4OBRA 5GS2D 4D8OA 4PBWD 2QPSA 5ACZA 3B2UD 1NIEA 2IPUK 5AG9A 5MEQB 4GBXB 1LK3H 1SFHA 2B14A 5IMKA 4PMFA 2O93L 4PWJA 1F3JB 1A6PA 4PJEA 5FV2A 4UOZA 4MCZA 1VIWA 3OAUL 4HIXL 4M48L 2XTJC 4MS8C 1VKXB 5IFHH 4NQCA 3SJVB 2AEOA 3QUHA 2WBWB 4Y19E 1R46A 3OM3B 4Y4FB 3NCJH 5EDXA 2RCSL 4Q58C 3J07A 5E00B 3CCHA 2R69H 8CGTA 1S9VA 2AKRA 1VA9A 3RY6C 2Y06H 2ITDA 2R2HB 3G5YB 4UTBH 3SGEI 2XNAB 1BP3B 2B1OA 3BP7B 1A3RH 4UF7C 3RRQA 3VXUA 4GH7B 4B0MB 4TUJB 2B3IA 1F42A 4AYDC 5ICZB 2CO2A 5E9DB 3RVVD 5FYKU 5E03A 4UQBA 1CN4A 2VDLL 3FOMA 4OZHE 4PSRA 3V5HA 3NJLA 5BVPL 4UB0L 4RISL 2P8MB 4LT7A 4JM2B 4KMTH 1CICC 4L4VA 4LBEA 1HL8A 5F7DB 1AQDB 4GIAA 4N2AA 5ALBL 3K5SA 4JY4A 4P9ML 4DZBA 4ZMPA 2HH0H 4JG0L 2G2PA 2NDGA 3SY0B 3APCA 1EEYB 1OAUH 2ZPKL 4LU5H 2EVIA 1ZSDA 5KVDH 3GSOA 1CXHA 4PEEA 4L3CB 3J2PA 5DJCB 5FF6A 4PJIF 4FNTA 3VFVB 1Z9OA 4MD4A 3UZEA 4B3VA 1H3WM 2VXQA 4LPYA 3MNVB 4E36A 1RVFH 4QNPF 3AM8C 1JDDA 1P1ZB 4AG4L 5CEYB 3PNWA 1A6AA 1KXVA 2BIPA 4OF7A 3OKKA 4LMQE 1AIZA 2BWQA 3RNQB 4J8QA 2BFVL 4I48A 3NJFA 2DKSA 1L6PA 2IADB 2X6BA 3LN4A 2WWKO 2ZG3A 1C1EH 4JKLA 3BOVA 4MVBC 4QTFA 2DMCA 3DUHA 1A2YA 3FDWA 3PQYB 1CL7L 2ERJB 3BJLA 3RVUD 4ALAL 4J3TA 3RUGF 5FM4A 4Z7UA 5AFAA 3MLZL 2B2XL 5IQ9B 3CQFA 2F54A 3KL0A 3AUWB 2QZQA 4OCXL 3CXHK 5CEZL 5DSCB 4ZFQA 2HYMA 3UBXG 7FABL 4L4TB 2YD0A 5GGSA 1LO0L 1IGFL 2VXSH 4ZDHA 4B9ZA 1J9SA 4M7ZB 1PD1A 2Z91A 3IU3A 2F8IA 5F7FA 3PIQA 3VXTB 3FN9A 4CU8A 1U8LB 5EZPA 4TRPL 4YXHH 5AB9A 2JLLA 2Y5EA 4WTZG 3V4UH 1XL6A 1JSYA 4M6NL 5AVYB 2AK4E 4GO8A 5CINL 4ELMB 2X40A 5E2WH 4WO4B 2EDMA 1KPVB 2COQA 4OF3A 4PWEA 4PM1A 4UNTA 3SDYL 5ABAA 2HJLA 1PZAA 1T7YA 3EOBB 5I1KL 3UPRA 3R8BB 1RSFA 4XHJD 1TOXA 1CE1H 2ARJB 1ZV2A 1Z1WA 3UTPE 4K9EH 4R5TA 2N56A 4M6OL 2VSDA 4P3CL 5BOZG 3QIBB 3QWQB 4HJIA 4YSEA 3LKOB 2PPCA 1G9HA 2IPKA 3QWNA 5D1ZI 5EEUA 4PTTA 1HHHB 1XH3B 1TQTA 4ZPTB 1T1YA 3VD1A 4AJWA 5E4EC 1I3VA 1QO3A 1KELH 2AEIT 4YHOH 3RQ3A 1E0OB 3UYRL 1NLBH 5DS2A 4ZI8A 1NQBA 4NQCD 5DZLA 4BFGA 5ANMB 1UWGH 2MWCA 2PR9A 3QPXH 1T21B 5IGXH 1N3NB 3NPSC 1DQDL 2DMHA 5E2UH 2E7LC 2BW5A 5E1HB 4DPAX 1OGAB 3CBKB 4U1HA 1JS4A 4EI5C 1Z32X 3DUSA 3V2AR 1H9VA 1HX0A 4NKDB 4C56B 4QRRE 3IGUA 5K1VA 2IWGA 1NUGA 4N68A 2JKWA 2Z4QA 2D7OA 5C71A 1MHHA 5BXFB 3VXUD 4U2ZA 4LE8A 2BFGA 1AS8A 2R29A 3ZKSD 1Z5LA 5FECA 2M1KA 3U48A 2LT9A 4Z1PA 1VFAA 1MCWM 5I0ZA 4CJ0A 3GRGA 3RGVB 5ICXB 4DZ8A 2IDTA 4N8CH 4BCXA 1Y6MR 2DWTA 1ZT4A 3EADA 4Y7OC 1T1ZB 1BEYL 4L4VD 4H1LB 4WTQA 1IEBA 3WDHA 4BH8B 4WJG3 3DNKA 1X6LA 4XNAA 1F11A 1P1ZA 4OLVL 1XB8A 4NPJA 3RDTA 1K8DA 2ADGB 4D7PA 4XBMA 3NA9L 1KCVL 3MROB 2R4RH 5EU3B 1IBYA 1P7QD 3OLDA 2I60H 3W11C 5LJYH 4P59H 2GC7C 4XP6L 1GKOA 4K3JL 1OAQL 1W0VA 3TV3L 2WZ5A 1OGTB 4EBQH 2YC1A 4CVXA 1UWFA 4YN3A 3U6RB 3HG3A 1KCRH 2GC4C 4APXB 1G7MA 1MF2H 2NXYC 3RPBA 5B39A 3BVXA 4I18C 1LLAA 2VH5H 5KS9F 3QWRD 4MDJA 5FYLH 1A6ZA 2FLBT 3WEMA 1ZY9A 4ABVA 1I9IL 3CZKA 2P5EB 1GS6X 1ZWIA 4LL9A 3TNNA 3DIFB 5IIEB 3FO0L 3KVPA 1YHPA 3QZMA 2APFA 3C60B 1CT8B 2VW6A 4YMPA 3IKKA 1KCUL 1YN6A 5CMAA 2FNBA 4AJYV 1IM9B 1OARH 3F6JA 2BIOA 1BZEA 3JSSA 5KVEE 1HDMB 1OP3H 5I6OA 3FUFA 2F54D 1MIML 2Y36H 3QXUA 1K3ZA 2RB8A 2F9BT 4H0IA 1SNRA 4JB9H 4K8RH 2I69A 3T77A 3U9PH 2BC4A 3M1BA 1RK7A 3TC9A 5DRZB 3ESPA 2F08A 3HS0A 4WAFA 5IVNA 1HCYA 3F7YB 3V0IA 3GMPB 3O0RL 2UXTA 4HQQH 5IB4B 2EDNA 4PJBF 5EU6B 4L5FL 1TJIH 5JZ7D 2ARJA 4YAQB 1RUPH 2FJFB 1MWAB 2ZKHL 1WFTA 1URIA 3OSVA 4HV8A 4R90L 4LRNL 5E7BA 4B9IA 1UM4H 2J21A 2R9HC 3WMQA 5I1HL 3MFGB 3IPEA 5KSAA 1CZ8H 1U6AH 3LKRA 1YUHA 2YLKA 4OJDH 5BO1L 3HG1E 1ZGLM 1U4FA 3MRBB 5SWZA 3E80A 1A7NL 4PI2A 5I2IB 4P5SA 4CKQA 4PJIA 1YPZB 5T3ZD 3S88L 2K0RA 1E9PB 2UZIH 2UYLA 2WNGA 3MBWA 2NY4C 3HLKA 1EH9A 3BPLB 2QQNH 5IHLB 1RUML 4A2DA 4QRPD 2G5BB 1NBVH 1NKGA 1B2WL 4OJEH 2C3VA 4XXDB 4WFEE 3P0GB 4S10A 2KDGA 3BWUF 4X6BA 4ZTPL 1QUNA 3ARGB 1GOHA 4URKA 5KYYB 3KW8A 1EZSA 1YRKA 1H19A 4OCWH 1LDSA 1PNDA 1AD9B 4PJFF 3Q2WA 3RUGA 3Q3GB 2BVQB 3WSQH 4NUPA 3FQWB 5ICXA 3WKPA 2J88H 5GGVH 3R0MA 3NZSA 4NBYB 1TYRA 1CLYH 3V52L 5JQIB 3FO9A 5AKSA 1XCXA 4NRXA 4HEME 4XNXL 3GBNL 4NENA 2GTZB 3EKCA 2CXKA 4YDLB 2ADGA 4LMQI 3QSKB 4MAUL 2VO8A 4UT6H 1G1YA 2A73B 4NO0A 4IOFD 3WN5C 3MMEA 4XOEA 3B8YA 3LKSA 1X7QB 2F8XC 4MA8H 1XB3A 2W8CA 3D18B 2X44D 2CLRB 4LSTL 4X0KB 3BWAA 4Y9GA 3U6RA 3SDXF 1WTLA 3RDTD 4GSDL 4APXA 4F2ME 3W0WB 1RUAH 5L8KB 2BS9A 5HBBA 3WI9A 4LNRB 5HHPA 4OUUB 4MA3A 2ENJA 1GGCH 4XMUA 1J9QA 3FTSA 1XWVA 4TSBL 1CFBA 1CT8A 4DJMA 1EFQA 4NKOA 2EE3A 5I16A 4CU6A 3OQRA 3N55A 4ODHL 4PY7A 5DJXB 1NAMA 3U1SL 4MCYA 3GZPA 1HXYA 4BQBA 3MRQA 2X3AA 5E0QA 3SO3B 3WHXB 3WKYA 2VDKH 5LGYA 2R69A 4Q6IB 2W9DH 4MDIA 4XP9H 4X4ME 1ACCA 1DHKA 3CUPB 2JF1A 3GJFH 4TTDD 4ES9A 3C9NB 1OE2A 4Z0XA 4G8IA 3LZLA 1JNJA 5JXEA 1BPLB 5CP7A 3HJ0A 3GRWL 3BWSA 2QTEA 1WK0A 2DQJH 4LQFL 5DO2C 4MXWH 1CWVA 2XN9E 1J86A 1KCLA 2H7WA 1OAKH 5HHVH 5IB4A 3WL9B 1R1CA 3MO1A 4DWHA 3OWRA 1DEEB 2G60L 3QRGH 3KDMA 3NAAL 4Q2ZB 5F3HA 4JQXA 4WY7H 2R0LH 3GIVB 5I82A 2GJPA 1J1OL 1YEWA 2F7IA 2PYEA 3A4AA 4HOXA 5BRZE 4WSGA 3QG6B 1JAEA 4N8VG 2F74A 1ZT7B 3FHEA 4DK3A 1LMIA 5D8JH 5B1KA 1OAJA 3QZWG 3P3TA 3EZ8A 4IIQB 1MCPH 1DN0B 4DESA 1PZ5A 32C2A 3KBPA 1E6JH 5DWUL 2ZUSA 2XA3A 4A68A 5DK0B 3HB3D 1IAMA 2EIMB 1EJOH 2BP0B 4JGMA 4KH2A 3TO2A 2WLYA 1KBVA 3L7EA 3S3BB 4WDIA 1W72H 4WK4B 4OD1L 4DN3H 1QSFE 5LNGA 1V54B 5KSAD 1ZCRA 3CZFB 4M7KL 4H0GA 4QCIA 3VSUA 3OR7B 3DIDA 4IGBA 4XWGL 5SWZD 5JW4R 2Y72A 3FTYA 4PB0L 4ONGL 2PCXA 4OV5A 2HKHH 5CN1A 1H15B 3C75A 3FQUA 2VDPH 1FNEB 4Y0GA 4Y16B 2YFNA 4OLZH 5D7LE 1T80A 2CO6B 2I26N 3OMIB 3QO0A 2XUWA 3C5JB 1QSVA 4UU9B 4QF1B 4WNQA 5IG7A 5KS9A 1XF1A 5EBWB 2KYIA 4JFHE 2G4GA 3RX7A 5IFAH 1UM5H 2YSSA 1IRAY 1BD2E 2X09A 2N0KA 3DHPA 4MD5B 2V17H 4NRYB 1CJYA 4PREB 4AGMA 1MPAH 5KEZA 1B0RB 3F8UB 1KLGA 1NWPA 2YJQA 2CH8A 1OWWA 2C4FU 5LG1A 1N26A 1TJHL 1WA1X 2CGRH 1JV2A 1D6EB 5KYUB 4HMDA 3FTUA 3HC3L 3L2NA 1H3TA 1LEGA 3PP3K 4HC1H 3EO1B 2NY6B 1MHPL 4TQEL 4E42B 1QLRB 4MJIE 3Q6GH 1ZLSH 2CBQA 4C55A 3CDZB 4GMSL 2UUDH 1IC0A 1KIPB 1KB5H 4HFWB 2HLFD 2XFXA 4DKDC 4N1CA 4V1DA 4PLKD 4J3WA 5L4JA 3KPRE 1PSKH 4MZ3A 4PV1C 5LAXA 1HL9A 2FO4A 4PJBA 3DRQB 1R75A 2XWRA 3HE6A 5I30H 3S4SB 3FB5B 1F18A 2ZOLB 4MXQD 2QR0B 3IJ7A 3NRFA 1Q9KB 4GJTB 4GXVH 4UANA 3H8NA 4BUGA 4F7TA 3WUWA 4CUCA 5D72L 1O6SB 1MLCA 1I7TB 2EDHA 1DJXA 2TSBA 2GG1A 1TTAA 2C9SA 2BVPA 2WNKA 5GGRA 4Q89A 3L3OB 4ZUSB 5PAZA 5TE7L 2V37A 5T1LB 1R19A 2R15A 4LSPL 1LO3L 3O3AA 1INQB 2H9GA 1YY8B 2QSCL 3K2IA 4HSCX 3IWVA 5C6TH 2PPDA 3NJNA 4H8PA 4YSCA 3IRCA 3BKCL 1FFRA 1WFMA 2EUZA 1IC5H 3CZUB 2DKUA 3S5YA 1TQCC 5JXED 3WFEH 3RA7L 1E27B 4KK5C 1I9JL 4QJ3B 3FQXB 5DTFA 5BS0E 3V6ZA 4RQQA 1JYWA 4NNPL 2KDYA 2BERA 4PH8A 4YHIA 3VWJC 3ABLB 4ZAKD 3R06B 4PJFA 3UERA 2OQJB 4F57H 4NKIL 1HXMA 4H26B 1JPEA 4ORGA 4KJPD 3WDJA 2WVVA 2EABA 2PETA 4YSUA 3C5XA 4LCWA 4P57A 1MLBA 2PYED 4GAJL 4MX7B 1VEMA 3B7YA 3EHBC 2ZICA 1NCWH 4DO5A 4XMXA 1HTYA 4UTCA 3BP5A 3MJ9L 4GEIA 4ZS7H 1S3RA 4K7FA 3BX7C 3VFOB 5B8CA 5I73C 1PZUB 4JDZB 3D2TA 1XCTA 4LVOC 5HP5A 4X4YA 1WQVT 3GDCA 3FO1A 1BOGB 1M7DA 4Y16A 4AQAA 3FQYA 4HIPA 3SDXA 3G5VA 1WGOA 4YL4A 1IQDA 4QF1A 3MC0A 4AM0B 3HRZA 1GC1L 2EXTA 1YCSA 2XG5A 4IGBD 2WXFA 2J7LA 1PLGL 1RHFA 5A7BA 4WWKB 3NTCL 2LE9A 5KAQG 4L3ED 1JNHA 4H8WC 1LK2A 4PRIB 5K33A 2ROXA 4O2EB 4JW3A 1MEXL 1SN0A 1KZQA 4LCYA 2BX5A 5DU7A 5ANHA 1F6AA 2IDQA 3KR3L 4A2LA 3M8OL 3K6SB 2VDKB 2K7PA 2NTFB 4GSXA 1EXUB 5FW8A 3WG7B 1BVLB 2FBOJ 3GJFB 1NM9A 4MQXC 3ECQA 1NJ9B 1FYHB 4X7SH 3WGUB 2N0MA 4YUEH 1EGJL 3LVEA 4HFWA 4PW9A 3WFHA 1MCBA 2OL3L 4FZEH 5HY9B 5ERWB 4A7UA 3DK0A 4D94A 5IJCC 1DVFA 1NC4B 3AXIA 4LVNC 5HHOE 4XGZA 4MNQB 4L8SC 5LBSA 2W1NA 4O51B 2VR8A 4W9LC 5DR5H 1WBYA 4KMQA 1YJDC 2X4OA 2HKFH 3BFOA 2A6KA 1FL3B 1Q9KA 2FEDD 1MFVA 2EIKB 5IW6A 5EUKA 5FYJL 4AQOA 1EEQA 1X5FA 4UUJB 4YHLL 2FEJA 4H2AA 1NCCH 1MNUL 3CPLA 4YQXL 1MFEL 1YNLH 2Z64C 3ZTNH 3BAEH 4LLYA 1CF8H 3BMVA 3HE6D 1MFDL 3SE9H 5EOCL 2BMKB 4KKRA 3L3OA 2AK1L 2X4UA 2WO4A 1DVQA 4PY8I 5E6ZA 4A67A 3SZ6A 5H35B 3LRKA 3U30C 3NIFE 4PTUB 3O3EB 2FHFA 4Y4HB 1JVOA 2VJ0A 1W16A 3Q7JA 2K9FB 1I1RA 3MZTA 3ML8A 4JKNA 4OLWL 3QH3A 4HW6A 5FIEA 1L9OA 4P5TC 2ZWSA 3KPLB 4UYQA 3S7GA 4S0HA 2Y07L 1X5JA 3NFNB 3R0NA 1MCRA 2VDPB 3VMNA 4YPJA 1KIRA 2Y22A 2LU4A 2YQ3A 1H5BB 1A8ZA 2FUQA 1JYXA 2WWOA 4RIRB 4Z7NE 1BW8A 3H9ZA 3LRMA 1JCVA 3T3PF 4X9GA 4TPRH 1FNGA 3J7HA 5HYSG 4U7MA 5ID0A 2XBDA 4EDXA 1MELA 2GITA 2YKKA 2X2HA 3QXDB 4BFOA 3QS3A 1ZJAA 1TYJA 3RG1C 5I1EL 4R4NC 3ULSA 1SVZA 1B3IA 1FBIL 2PWHA 2P4AB 1FIEA 1WZ1H 5AB1A 3S3SA 3UTSE 4BQ6A 1GW0A 1FO0H 1SPDA 1YC8A 2QELA 3P77A 3P9MA 4NKMB 4UT6A 3VVWA 1M53A 4B96A 5I0YA 4J4PA 3OJDB 5IM7A 1HH9B 4FAAB 5JHBA 2GTWA 2W9EL 2ORBH 3CK0H 4AT6A 2FO1A 3KPSB 2DM2A 5FS5A 1J9CT 4WKXA 1YEEH 4LCWD 1DUYB 3QORD 4FQCH 3BT2L 4OGAC 3LNHA 5ITFA 2CAKA 1Y0LB 3F7RA 2DBLH 5DVLA 1KB5B 5FHBH 4KQ4H 4ODUB 1IBDA 4PV9A 4JFEA 3VFRA 2WUBH 3EYSL 4L1TA 5C86A 3EDKA 4WI8A 4RRPG 4N2MA 4FERA 1B4RA 1OB1B 2X12A 4KX8A 4NT6A 1CXFA 4XCNB 3LZFL 3BJ91 1LEIA 1RXLA 4O2EA 4A2GA 3QDJE 5ID1B 4M6AA 3OB0K 3ZSTA 5DQJA 4NDMA 2FZ3A 3GMRB 2C9VA 5DYFA 3BP4B 5TF1H 2OMYB 2O5YL 4TNWK 3ZTJG 2Z31C 5E5MA 1KACB 1U8PB 5EZIL 2I07B 5EZLB 4FHBD 2DQDL 2EZ0D 1XR8B 1ORQB 3BYTA 3HE7B 4N2IA 2B1HL 4HS3A 2GEQA 4KROB 1NBCA 1BQHB 4FTVD 3MOBH 3S36X 2DWXA 4JFVA 1WBZA 5F1IA 4F24A 2MOVA 2QJDA 2Y4SA 3W37A 1OF0A 1P4LB 2Q8BL 1HH6B 2YAPA 3F58L 2BRQA 5L2JB 5M7QA 2DLTA 2XN1A 1N0LA 4DP5X 1CQYA 3FUNA 1BBDH 1D2PA 4WV1A 3CC5A 4BM7A 1DVFD 1OE3A 3I9AA 4ZT1A 1CE6A 1R3IH 4M7LT 4X9YA 1F1GA 4G11A 4OFPA 5D6CB 1CU4L 5IK3A 2ZOWA 3O6FB 4TLTA 2OTWB 4WI6A 2C1PA 2I25N 2BNQA 1MW0A 5EIQA 3UTTE 5I8OL 5IHBA 4FKKA 1JI1A 5AUMA 3K81A 1LO4L 1IGJB 2WBJB 3DUUB 1W72A 1F3DJ 3OPZH 4QO1A 1FVCA 3BKJH 4DO6A 2A38A 1JK8A 2ZX5A 2ZUQB 3DXAB 1ED3A 3K80A 5B38B 3H42L 1GZHA 1I3RB 5KW9H 4M3HA 1D5ZB 4X5WA 1UH3A 1KCWA 3T71A 1U0QA 1TJGH 1WPCA 1ASOA 2IDFA 2XC8A 4HSAC 4HUXB 4W6XB 2ICEA 4DHLA 5EU4A 4MGXA 3LD8C 4NP9A 3AS1A 4Y89A 5SWSE 5KYWB 4IYKA 1A1MB 2PYFA 3JTSA 4OGQC 4RAVB 3HAEH 3IXAA 3KM1A 4R7LA 3VRLE 2XA8L 3IDMB 4KVCL 4LQ1A 5T3XL 5HYFA 2V9TA 2H0PA 4QWWD 3IDYC 3AMLA 5C07B 3WLWD 2YPLE 1E6OH 1K2DA 2V3EA 1Q9OB 3BIKB 1MW2A 3DYPA 3P40A 1ZANH 3O6LL 3U0WH 2AJZB 3ROLB 2CHZA 3VACA 2DLFH 2AZAA 2XXFA 3NZ8B 3E7JA 3ZUCA 2CK0L 4ZUTB 3QO1A 5BV7H 1G7HB 3QIWC 3N0AA 5BQ7A 3QUYC 3QI9B 1A47A 2G9KA 4CSSA 1UWXK 1UTDA 1NOLA 4M61A 3C6SA 4ODUA 5HDBF 4G7YH 2EDEA 5GHWL 3GSVA 5HVFB 5HVWA 4B9GA 1OB1A 3P73A 2VKXA 2X4RB 1JGIA 3D9AL 3ZKXB 4FS0A 4KO6A 5T33L 1IC4L 5FUOL 1VERA 3IDUA 3K2UH 4J3OC 3REWA 4U1GC 4W9GC 4JFED 3PJLA 2HT2D 3EJUA 1AZZC 1Y18A 1WUNT 2C4FT 4WW1B 3K3QA 1PEWA 1P5UC 3FTWA 3CFEA 1V8HA 4B3EA 5KJRL 2GIXA 3HE7A 3PWPA 5I75B 2WO3B 1OKEA 3APFA 2IH3B 3V0EA 3TWYA 5ISZB 4P9HL 4JPIB 3AREA 3VMPA 3AXLA 1EJ6A 2R56H 2W59A 4JDVA 4XXCC 4PVBA 3GMNB 4FLQA 1P4LA 4FA8A 2NX5A 3AROA 1FLRH 4G6AD 4I0CC 4G9FE 3HW7A 4E41A 4O02L 5EORH 5HYJA 2NYYD 5IQOA 3ZE1E 25C8L 1RZKH 2DYPA 3OKMB 2ZSVB 2SODB 5ICUA 5A3IC 2VDNH 3FH7A 4C59B 1K9TA 2A9DA 2GUYA 1T6BX 5DFVC 5IMLA 4TSAH 1NFDF 4LCCB 4FQXA 3O9WB 1JPGB 1PG7L 5EUOB 4QHUB 5HDQH 2Y23A 2FJSA 3VFNA 2D4DA 3TBYB 1CDGA 2ZYSA 2XY1A 4CBPA 4LSVH 4JN2B 3AWFA 4FI7A 4W1TA 1X5XA 1FZJA 2WLNA 2R1WB 1EDQA 2GCYA 4O58L 5C0BD 2EDTA 2DS4A 2FO8A 1FO0B 1DLHA 3BQVA 2YGVA 1ECYA 3TZVB 1I7RB 3G5WA 4HK3J 1BZQK 4JZOB 2B5IB 5D1XD 5LN4A 1U91B 2TSAA 3KVQA 1BM3L 3VXMB 3TYGH 2NY2C 4J3UA 1AANA 4X99B 5IT2L 1HI6A 2BNQD 3I2CH 1MCOH 4HUXA 1WAEA 3IJ9A 3SKMA 2OYMA 4CADA 1M1SA 5CD5C 4JPVL 3ZTCC 2XV3A 4N6RB 4YSAA 4HSQA 3ARDA 4J3SA 5HDBB 3A21A 5IF0B 3B9EA 4XXWC 3E1ZA 2WXJA 1WDAA 4ZOEA 1RIUL 3RFZA 4EUPB 1OCZB 2R2BA 2WKOF 4R96B 1EFXA 3OR6A 4AYID 4EIGB 4Y2OA 3VQ2C 3V7MA 3NVQA 3W38A 3QYNA 3TFBA 4G7RB 4A2MA 1NGXA 1YY9C 2LFGA 1OF2B 2Q2LA 4FGMA 4L8DA 1ZE3C 1XCWA 1NDGB 2ADFL 3L2MA 2CJUL 4OCYL 4PJGE 3W9EB 3HNSH 1TEGA 3VXNA 4KKAD 2F5AL 4JZJC 3L16A 3B3IB 2WOBA 3N91A 2Y5QA 1QTPA 2AQ2A 4YHZH 4NZTH 1FZMB 1TQUA 4OU3A 4NWUL 1AZNA 1U92B 3BSZL 4YXKH 4N24A 5FHAH 1J9TA 2BRRH 4Z7IA 1N5AA 1M9WA 3D69B 3PL6C 2GFBB 2BJML 2WKGA 2CD0A 1A7BA 5LGHH 2OX5B 4O9HL 4A2FA 5CN2A 4D3CH 5C0NC 4PGBB 1QYGH 3PREA 1AQKL 1ZMYA 3PABB 4AQ1B 1ILUA 4FA6A 3CVHL 4JG9A 4BZ2L 3FT2B 2NY3C 3GZOA 4M7LH 4LARL 4LSRL 1NGYA 3C8KA 4HK3N 1BQLH 1EAJA 4GG6B 2GK0B 1DBKH 3L5WB 5A6MA 4P5KA 5KYXB 4AGNA 1BOYA 2H2SC 1KBGL 2X4NB 5K59F 1Y07A 2YUWA 4RRPA 4X2UA 4PP2A 5JW5B 2DW5A 3V9FA 1OTSD 3QAQA 4M3KB 4PRHE 4KI5F 2C26A 2JKTM 4U0RB 3IJYB 1ZVSA 2BWDA 3B2UC 4HH9B 4NUQA 4BCYA 1TZIB 4U0QB 3S5LB 1D5BA 3NSFA 3O6KH 3SDDC 1ZHKA 3GIZH 4Z7OF 3GWJA 2GSGB 5J1AB 5BZWA 1F4XH 2I7OA 3ARED 1RZGA 1DJIA 4OD2B 3LRSA 4P2RA 3IJEA 2Q7NA 4GRLA 3QXAB 3SPGA 3BD5A 1HFUA 1GAFH 3HAEB 5EBLB 3SE3C 2H3KA 1U8NA 4M8QA 2YN5A 4FZ8H 2NX5D 3LYRA 2X2JA 4RESB 3I84A 4C57C 4JANA 5BOJA 4Y5YA 2A9CA 4E41D 5CF3A 1RCYA 3O41B 2VT0A 5HYJD 2H1LM 3BEWA 5IQ7L 2MIZA 2DYPD 2AP2A 4D9LL 4XC1H 3QJSB 4C58B 4K2UH 3RWGA 2NNCA 4FQXD 4JQIH 4JZOA 3TZVA 2CBTA 4DP7X 4F37K 1KB3A 2KT6A 5E8DL 4N90D 4QXGH 4MB1A 3MLXL 4Q74A 4B6ZA 3E3QC 1RJYA 2KZKA 1JUFA 1AR1D 2X1PA 3OHXC 4L1BA 1Z3GL 3G08B 2NY0D 4LDLB 35C8H 3ZOAA 2KLRA 4QTIH 4XH2B 4EQ3A 5HPMB 4HIEB 1KTDB 2ZX8A 3T2NL 4NWTL 3VGEA 3GXPA 5J4MA 2CCWA 2O30A 3HR5A 4QRUB 4LPVA 4NJ9L 1J18A 5IJKC 3OAWA 3MRPB 3QWOB 4NKQB 4POZD 1A4KB 4AXWA 7CGTA 1LM8V 1BEXA 4RA3A 5AZEH 5D2NC 2J2ZB 5DZNA 1YEIH 4DW2H 1E30A 3ARDD 4HUNB 3HN3A 3LKQA 3IKCB 2YPVA 1Q9WB 3LH8A 4WFFE 1JGDA 4WUUE 3W9EA 2P42B 1V5JA 2BSTB 4L3FA 4BFRA 4QY8A 1KJ2H 1MJ8H 2ZWZA 1EFXD 3ECBB 1TCRA 1FZMA 4JHZA 3WHE1 3K71A 3UGUA 5BZXA 3GXIA 2HRHA 1JL8A 4HU8A 4R2GC 4Z3GA 4HLZG 4H8QA 3RVUC 3D69A 4KKPA 3UCQA 3EYOB 4LESA 2VE6A 4MHHG 4MQ7A 4XP4H 4A1RA 3V8CA 4MA1C 4PJDF 1KTRL 1CDJA 2CDEA 2VDNB 3B5GA 4K9JA 3UFIA 1NFDA 3BPCB 1JPTH 4XPGH 3M7OA 1NFIB 4DEWA 2B39A 3ATFA 3O45B 4MJ6A 3V6FA 1R5IB 1K5WA 1P6AB 4M5YH 5E8NA 5TH2B 2Y5TA 3WY4A 5LGKA 3MQIA 4R84A 3THML 3ET9F 1RZ7H 3ZL4L 2QHRH 4NC0B 2QADD 3OG6B 5E1AB 3BCFA 1FL5B 2J1XA 1OT1A 4LSUL 4R0LB 4TVSa 4WHTB 3CHSA 1CFQA 5DMIL 3ROOB 1TIUA 1IJ9A 3N41B 1MIEH 3VXRE 4AVHA 2VDOH 2O61B 3UAFA 2B59A 3MPCA 3SIKA 2W65A 4N9GA 4TV3A 1TEFA 3B56A 4XHJC 1IAII 1B2YA 2NW3B 5AW6B 3DTUB 2EVGA 1JPST 2ZUYA 1DO6A 1T0NB 3MA7A 2WTPA 3O6MH 4TVPH 5D9SB 4Z0BL 2D7QA 2XPGA 2DLGA 3VAEA 2AV1A 2C7FA 1UUNA 2D7PA 3QUZD 5FYKD 2AEWA 4LP5A 3WNOA 1DJHA 3QGVA 3D06A 1H3XA 2WKOA 1G4MA 2QQLH 4P2RD 4GRLD 2A9NH 3Q1SL 3TO4B 4U1LA 1DFBL 3V6OA 2NXZB 1FVEB 2IJ0C 2WGNB 2FCBA 3HMXH 1Q1JH 5C0EA 2HTLD 5H94A 5C0GB 4ANUA 3ARYA 1GTFA 1P7QB 5DD5H 4N0YL 3MLRH 3UP1A 5HVHC 4YBHA 4JFZL 4JRYE 5FGCE 5DJ6A 3VFTB 3ARVA 4L3AA 1I3UA 1X4YA 1VF5C 2VAAB 3HUJB 4FD0A 4FHJA 2NY5L 3ASWA 2PWEA 3NEOA 4E9SA 3KZ8A 5KOMC 1I4FB 4U1JB 1AKJD 1OXYA 2XKNB 4P2OA 2Y1YA 4D7BA 4OAWA 3QULA 1LWHA 4ZMAT 3D30A 4RFNB 4WENB 4XOBA 5ABZA 1R0AL 3W57A 1FAIL 4CGUB 1KPRB 4ISVA 2OJ1A 1SHWA 3BN3B 3QFGA 4FQLH 3L3IA 1J0HA 2ZP0T 4Z77B 3MUGA 3EJQA 1Q0XH 3QJFB 1R33A 1X44A 3UZEC 4MASA 5C0AB 1AO7E 4YVUA 2H32H 1JD9A 3LOWA 2GY5A 2XXGA 3LQAL 5EEWA 4XC3H 3V4VB 4ICXA 2J8UF 2WXHA 1KXVC 3V5DB 4G1MA 2XVBA 4X5XB 5JHLL 4KZEL 1L0PA 3HA0A 1WICA 4JO2L 3G6AB 3ZGIA 5KJ4A 5IJVA 5I1DA 1UZ8B 2H3XC 3TA3D 2AV7A 2X1XR 2IGTA 1XHHA 4FFZH 1OM3L 1XF2B 1XF5B 3ULUF 1SLWA 3RZCC 5F6IB 2N3JA 4OGZA 1KGIA 3FN0L 4HS6A 3CVIH 2Q1EA 3I6GA 1H8OA 1E4JA 2E7HA 1DJSA 2OV0A 3FONA 3MLYH 2G2NA 5HVGB 4I3RL 5AEAA 2GJ6B 4L4JA 3AQZA 1IGMH 1HESA 3ASOB 1YSOA 2WQ8A 1CLZH 1EBAA 2FSEA 2VN6A 1P5VA 3DVNB 4LZKA 3OF6D 1HOEA 4FQPA 3V0AC 2VR5A 2BVTA 3H85A 3V0GA 1KLFA 2CO7A 3VA6A 2MTAA 1DVSA 5F7BA 5JZ7C 3GLZA 1U8IA 3MKGA 5KANI 2NW3A 1TZHB 1IKNC 5DLML 3SQBB 5EIIG 2DQGL 4MNHA 3Q48A 1YN7B 2FIKA 1MAML 2VUYA 4N26A 3Q6FB 4G8GB 1V55B 5FK9A 2AAAA 4K3DL 3IDXL 3QQ4B 4HGMA 4M48H 2EYRB 4HIXH 3WIFB 1T5WB 4OZIE 1JMXA 2OCFD 3O2DL 1YEKL 1J8HE 1NIDA 2NYZA 1H6TA 2IQ9L 4Y4FC 4ZUWB 1KEMH 5A2BA 2RCSH 3CFCH 1CURA 4W9EC 2A3TA 2V3FA 3RKPA 3S37H 3QZLA 1KJ2B 3K6DA 5FO2A 1F02I 4RDQG 1JWUB 1REIA 1D9KA 1XIWB 5CSZA 1WC7A 4TOYL 4ZFGL 2QKSA 4LOEA 3FFCE 4H44C 2VAAA 4M29A 1UT1A 3LRGA 5IV2B 4Y9CA 1C5DB 4W9KC 5J1TC 2F15A 2EH7L 2VDLH 1U42A 3KPQB 1ITCA 1I4FA 3T4AA 2E6PA 5BVPH 2QVFB 4UB0H 4ZTOL 1G7PA 5IOKA 2IMMA 4PJDA 4N2OA 5ALBH 3UG3A 3MREA 4ZOCA 5IB3A 1K5NA 4P9MH 4K0OA 1KFAH 2VXVL 1U41A 4QYOA 3RX8A 2VLKA 4Q9CA 5CEXA 4WW2F 2E75C 3MOAL 4NXKA 4ZW6A 4AIXA 4BINA 3F05A 2ZPKH 2JSFA 4Z77A 4N0UE 1KCSL 3BVVA 2ZCHL 3H7BB 2XYBA 4P2OD 3WFDL 2OMVA 4F8TA 4OZGE 1R17A 1S7UA 2ATKA 3FFDA 3QEUB 1Y7VA 4RGOH 3BRFA 3IJ8A 5GQBA 3EDFA 4AG4H 3M46A 3RDTC 4XVJL 1CF1A 2GUOB 1SYSB 3MX0A 4YIQA 1K8IA 4LXFA 3KG5A 3IXTA 2BFVH 2EIEA 2VDOB 5DRNA 2H0FA 4PJCE 1GSKA 4ZMTA 4R7DA 4OFVA 3C6EA 5HGAA 1SVCP 3WLBA 2CIIB 3FCBA 3KPOA 1CL7H 4ALAH 2ERJC 3CN0A 4XZ4A 4KI5D 3WTWA 3DBSA 3B1UA 4Y2DB 5FA4B 3FCGA 2B2XH 1CXEA 3MLZH 1ZGLA 1FDLL 2OMZB 3TNMA 1UACL 1OTTD 5D4JA 1M7XA 4OCXH 5DI8A 5F3BB 1X4ZA 4TTDC 5CEZH 1QR1B 5C09D 7FABH 2VDML 3BEVA 4AI7A 4B7IA 1LO0H 1IGFH 2V9RA 2R23B 1LE5B 3H9HA 2VRKA 3CHRA 3T0XA 4AKQA 4HK0A 1T5XA 5DMJB 1FORL 1FZKB 3VI4F 5D2NE 2HFGL 3WEAA 1RH8A 4OKDA 5I74C 1SEBA 4DF9A 1AZVA 3FT9A 4N28A 4PQXA 2OTUB 1PKQE 3HFML 5E51A 1WO2A 3HS0C 2EC9T 5EIVA 2LW3A 3K8KA 1R24B 3STZB 4X4KA 3MRGB 3N04A 3BGMB 2E0PA 4KFZC 5D2LB 2JIXA 5EWIL 5I1KH 5HJGA 3P11H 5JOFA 4ZNEA 1RJLA 3U1QA 3QQ4A 4F2EA 1R3JA 1PF3A 4RH4A 2MQ3A 3JZYA 4M6OH 1GYCA 3HB3C 4P3CH 5G5DB 3T8XA 1DBAH 1J11A 3GF8A 2EIDA 4XNQB 2QEJA 1WV7T 5KSAC 2MOGA 4JO8A 1G94A 1KJ2A 2AQNA 2EEAA 4H8UA 5D96C 4OM0H 3TF4A 1XGUB 2Q10A 1PX3A 3P2BA 1D7CA 3UYRH 4PJ7B 3D85B 4KRPD 1NEPA 2MCAA 1AZRA 2H32B 2YAFA 4JCMA 1DQDH 3IDJA 1IBHA 4IJ3B 2B1AL 4YDIH 3ML9A 2J8UA 3FBQA 4QRTB 4TYUA 5I6XC 4Z7VE 1OK0A 4UIMB 4Y1AA 1AFVL 1K3IA 1D9KD 1I7UB 4XRCB 2RHEA 2EYSB 1EBPA 1IC7L 2HRGA 1BBJB 3MV9A 1E2VA 4K5MA 1G9ML 5B3JF 2Z7UA 3N40F 1I8KB 4L9LB 4OIFA 2YXWA 2CLVB 3V5KB 2R0ZL 3POHA 1THCA 5JHAA 2IFFH 5KSBE 3IMUA 1PQZA 4X98A 3TTSA 3BHBA 1BEYH 1KXQE 1XF3A 1O7DE 2F5BL 4ZYKB 3W3BA 5J1SC 5CD3A 4GRWH 2J4WL 2ZNXA 1WZAA 2RFXB 3DHMA 3MV7B 1Z0MA 1N10A 2CRIA 2GUOA 3PHQA 1L9RA 3PWLB 5CR8A 2HLFC 1S9XA 4FQHA 4PLKC 4ZQKB 3NA9H 1KCVH 1RZJC 2E56A 2OMXA 3K6IA 1ASQA 4PJEE 2ZUVA 1TR7A 3VI4B 5EF1A 3MRLB 5L8JB 4K3JH 1OAQH 4NQCE 4OLEA 3TV3H 2CIIA 3ILQC 4MXQC 3V0WL 2G3XA 4BGLA 3TOPA 4PJ8B 4APQA 5E8PB 3ZVVA 2K3HA 1M2OA 2E86A 4FLOA 4ZAKB 3NCXA 4HGWA 4AYSA 5I18L 1HL5A 3UBXB 1SHSA 3FO0H 3A5VA 1CCZA 4LCIL 4Z8FL 3FOLA 3VXUE 3IFOB 1KCUH 3ME0A 1ZGLP 2ZT9C 4CAGA 4LAQL 5TPWH 1WT5A 3WY3A 1BIHA 1I8UA 4ZMWA 4AJVA 4QT5A 5KBMA 2OA9A 2WXMA 4AENB 4NHUB 5GRWA 3FCSB 3RX5A 4P5RA 1MIMH 5AG8A 4ELKB 4JK0D 2WQXA 2X87A 4MLSA 4XVUD 4ZFFB 2IH1B 4L4VE 3M17A 5KVEL 2JKXA 4JG5A 4LVHC 3WTSA 5JXEC 3L4YA 1TNMA 1USQA 2P44B 3FU7A 3ILPB 4H40A 4M6MH 2X4SB 2XLLA 12E8L 4HALA 4V2CB 1JYNA 4G6FD 4JHWL 3TN0A 1AGEB 3ZIMA 3HI5L 4ZFOA 5DCCA 2VDLB 3VH8A 4UOQA 4JQXC 2X6AA 2GI7A 4N22A 1PTZA 1JJUA 3J27A 4L3EB 1S7XA 4LRNH 1U9KA 3G04A 3TXAA 5FW6A 1E42A 1NCTA 2DLIA 4HAKA 2ZZUT 1XF4A 1UZ6F 1WYJA 2I9LB 3ARUA 1YDPA 1U8HA 4WW2A 2JIXD 3ZKQD 2K3TA 5BO1H 2HFFB 4OT1L 4PJ5A 1A7NH 2DN7A 1FG2A 4QRFA 1FNSH 3D85A 5FOBA 4FMKA 3S88H 2ESVA 3T6XA 4UM9A 1N4XL 3N42F 3HIZA 2VJXA 5J12C 3BPLC 3H4FA 4XN5A 5CJBA 2OR8A 2VLMD 1B2WH 2F54E 2X10A 5DUBA 1VRSA 5BJTB 1CD1A 1LTXA 4L18A 1U58B 1VESA 4IGBC 4K3EH 4FQIL 3RWDA 5CFAA 4L8CA 1TVBB 1SMOA 4PRPB 3MRKB 2WM0A 3IFPB 5FKPA 2Q6WB 3TBBA 5LWYL 4XZUA 4PU2A 3MRJB 2A83B 3U4KA 3VFWA 3WKML 1CTMA 1I8KA 4RMSA 3RL1A 3N9GH 1IAOB 1MCCA 3HZYB 5F3FA 5LGJA 3FRUA 3ATBA 4HKBB 3E8VA 4I1RA 3SPCA 5ITBL 2CKBL 4ABUA 2DOCA 1U8QB 4Y1AD 3ZQ9A 2WB7A 1PPIA 1R6VA 2DM7A 5DMGD 4ZYKA 5AW7B 4H4NA 3V52H 4JDTH 4R4BB 4XNXH 3T0WA 4UINH 3MV9D 2WXPA 2PABA 4KJQD 1F6LL 3Q44A 1DBBL 3ULUD 4MAUH 2IOMA 1G9NH 1ZHBB 4ZQKA 4CMMB 1L0QA 5CUSL 4FYQA 1MRDL 5KSUA 3PJSA 1KCBA 4X7FC 1TENA 4JFDB 3DVGB 3WTYA 5T3ZE 2AXGA 4G7QB 3JWDH 43C9B 4XX5A 3B9KD 2ALAA 4EIBA 1BGXL 2CNYA 2B4CC 2V5TA 4GSDH 4KJWD 1I9RL 1QNZL 2V8LA 1CGUA 5GSRA 2JK5B 3MNZA 3QQNA 4OCLC 4QRPE 1WCBA 2ITEA 2K1MA 4ZO9A 3BW9B 1F4WL 4FLHA 2JB5H 4AGPA 1XGZA 3ZT5A 4M8UA 1E50A 1OT4A 1E3XA 4WQOA 3HE6C 4W81A 4GKLA 4K9EC 4ODHH 5EB9A 2XWBB 1EZVY 1E8XA 2VLJB 1GY1A 3U1SH 1WGVA 3AACA 3SOTA 4OIBA 4APQD 3PWNA 1KLUA 2Z0UA 4AENA 2XBZA 5JIHA 4KXCA 1SY6L 4Q6IC 3VXSB 5DS1A 4IRSA 1RMFL 5BW7A 1X9RA 3DMMA 3I3BA 2PTVA 3PHSA 1D7FA 2APBA 3KL3A 4Z7QF 5DJ2B 5C2BL 1JZ2A 3E2HC 3QORB 5IOPB 3WJLA 4QXUL 4LQFH 4NNYB 1ZLWH 4LGRB 3FHAA 4EIZC 4HOZA 3CHXA 2G60H 3E0GA 5IHWA 3NAAH 1TMQA 4KFMA 1T3FB 3WV0A 1NBZB 4Z78B 4X7DC 1I1AB 3BWUC 2QPFA 1J1OH 3QFJB 5EN2A 3WXWL 4ODTL 1MFCL 1G1CA 4DOHE 3UZQB 4TVUA 4W70A 2BIIA 5L7XL 3MBEB 3TN0D 3CLFL 4YHML 2NLJB 4XBPA 5F7AA 2LLGA 1KGJA 4JG1L 2O5XH 5DWUH 4AUYA 1O6TA 3F83A 3DPDA 3VI3F 5TE6H 4A7GF 6PCYA 3S36L 4U6YB 4AZ8B 4GRWB 2B15A 5DQ9A 4XCFH 4OD1H 5AOIA 1G9EA 1NPUA 1PL3A 5IROA 3FB8A 4FTVB 4AW4A 1EX0A 3B1TA 4UBDD 3HBPA 5I5JA 2DQTL 5IFJA 1A6VL 3L5XL 5EC1A 4XWGH 2OFQA 4PJ5D 2JLPA 2JE8A 3VFUB 3QDHA 2Q6WA 4ONGH 5B8CC 3D08A 1KOAA 2ESVD 5D1ZD 5MHSD 4HETA 3WMPA 4UM9D 4Y16C 1YEFL 1P7HL 2Y6SC 3BH9B 3H9YA 4LIQH 3NCEB 4PRDA 3HRZC 4Q4IA 2NZ9D 1PG7W 3R4RA 2XTLA 5I1AB 3KXFB 3GHBL 3VXQB 4JRLA 2NCMA 4UAHA 4PAZA 4FJYA 3K72A 1MCWW 2KI6A 1UJTA 4XNZC 2BNRD 1SDDA 4GW5B 4M1CC 4QRQB 1W0WB 3KWTA 3ETBJ 2VDRH 1YMHA 3HC3H 4TQEH 2QVMA 1MHPH 5GJSH 3X11A 1HIML 2ZKWA 4KXDA 5JW4Q 3CAFA 3NPZB 1KGYE 3BZ4B 4KXZH 3TF7C 43C9A 1OO2A 4N2LA 1L5GA 4ZSOA 4HG4J 2VL4A 4QHKI 2FUTA 5EBMB 2L8AA 4RA0C 2ITCA 3ZYIA 1S8DB 1DVFC 3CD4A 3BW9A 4FEMA 5GGUB 4PCYA 1KN2L 4NGHL 5SWZE 1VFBA 1AQHA 2H6OA 5TD4A 4PJIE 3FN3A 2IALA 5F93C 4G3YL 2XWBA 2A9BA 1LXMA 3N44F 2ZUXA 1YQVL 5IWLC 3OKDA 3WO4B 4TNFA 3IS1X 2ARWA 3I74A 1HU8A 3VRJA 4X8XA 4ZW8A 2NTSP 3AS0A 2CLZB 5FLUA 4N1HB 3VI3B 1RL1A 1I8IB 4XCEB 3PV6A 3L3OC 5IOPA 3AWEA 4Z3JA 3GHEH 4MMZA 2WLIB 4F58L 1NMCB 5J6GB 4G72B 4XO4A 3PUUA 4AV4A 4MMXB 1LO3H 4YR6A 3V0JA 4ZPVA 1CLCA 3RUGE 1E5BA 3L5IA 1QFPA 4A04A 5DJ0B 4IRSD 1I31A 1HQ4A 1ZS8A 3DMMD 2VISA 4F15C 3H54A 4QWWC 5K5YA 1WHPA 5DWPA 3RA7H 2DQEL 1I9JH 2OW7A 2UWEE 3MUY1 3FQTB 2BY3A 1TNNA 3O81A 3BUYA 4N8VB 3KJ6L 2IH9A 4I5BA 4L37B 4IMLA 2VXTL 4EZJA 2P8PB 3IAQA 3MU3A 4Z3TA 5IVXE 3QZWB 3BO8A 3GM8A 2CCVA 1EEZB 4I9XA 3U0TA 4KKZA 1M6UA 3BKYL 5C0FB 4AH2A 1P2CA 1U8JA 4NLAA 3N40P 2NNXA 2VUOA 4GAJH 4PWIA 1I82A 1MCFA 1JDCA 1T1XA 3CH1A 4GQZA 1OGPA 3MJ9H 4J4PC 1KDJA 1NOFA 3I9GL 5AZUA 1KIQA 2IO5A 1L9TA 3IMSA 3RWHA 3O8XA 4XOCA 3VYNA 4GW1A 2BNUB 4QRBA 1T6WA 1NKRA 5IROD 4A7SA 4JKPL 3DX9B 4DKAA 4IU2B 2J43A 2PW1B 3PWJB 1XVSA 2CUHA 4O5LL 1PLGH 4U3SB 2AJSL 5F8RC 1U8KB 4GLRH 3UTQB 3NTCH 5DURD 3GSUB 1EHLH 5D7IF 3RY5A 3B43A 3RL2A 1MEXH 1J5OH 1GZPA 4HUUB 5C0BB 1Q4NX 1QKZL 4WSJA 4YXLL 2C3HA 4YX2L 1AIFB 1YYML 4ENZA 3SZKC 2J25A 5D1XB 3BZ4A 1COBA 2V2TB 5INDA 5DF0A 2PYEE 4G6AC 1EGJH 1G7LA 2NYYC 3MCYA 5EC2B 5HYQB 1MAKA 2EIJB 5CZXD 3NIDB 1SUJA 1OW0A 1KPUB 2A0LD 1NGZB 2AXFB 4LEXL 4BBWA 3NN8B 3BZEB 1E2WA 1HSAA 2DEYX 2E8YA 2WN3A 4O4YL 3EBIA 2NR6D 4I87A 4PRBA 1PU0A 1KGWA 3QUGA 2NPLX 2YPKA 6CGTA 4YHKH 3L4CA 4J28A 5FYJH 3WJMA 3JTTA 4WV1C 4AQZA 4U49A 5KVGE 3I6SA 1LWRA 3ZTJH 5EDSA 5IJBC 1PGRB 4G80B 1MFEH 2D9CA 5E08L 1N2RA 2GY7B 2HJKB 4NN6B 3IRZA 4LP4A 3V0DA 1VEOA 5AVUB 5IB1A 1ZA6B 3UJJL 1MFDH 5EOCH 3FUHA 4KRLB 3GMQB 4M00A 3UG5A 5C0RL 1S5IH 4X6DF 5T1DH 5MEPB 1ZSHA 3LB6C 2R8SL 2DH2A 4E9VA 2ZQKA 4LF3B 4A7GA 1NKOA 2CRYA 2W0FB 3E6HB 3IFLL 3PWVB 3ARZA 4PJ9D 2JKJA 2VUKA 1J5IA 3BPOB 5KS9E 2PO6B 3GSNL 5DFWH 3OJ2C 4YC2B 2MHAA 3T0EB 1CFMA 4OTXL 1GZHC 2B0SL 3EDEA 4WJKB 4NO2A 3VWKA 4BJLA 4E0RB 2Y07H 5H2BB 2YUZA 3P30H 1TTGA 1BF8A 5DJDB 2ICEC 5GGQL 4QTHB 2OCJA 2A4EA 2VL5A 3P2TA 2RA1A 2AK4D 2ZOUA 1TZ8A 3TIDA 3L3JA 5DMKA 1MHCB 5EHFA 3VMOA 1NC2B 1NPNA 2WNXA 4FXGA 4AEIL 1CDBA 1JYVA 2DWDA 3CMOH 4RCAA 4ZBJA 1A21A 4KKAC 4PV8B 3RVWD 4HF5L 4LDCA 1FBIH 3JVGA 1PY9A 1Z66A 5LNEA 1IVLA 2D3JA 2R0WH 4L23A 4V1DE 1S7QA 4J2XA 3SKUD 5JLZA 1NMBL 5H37G 4J27A 3QDGA 2O72A 4PJBE 1DL7H 3SKNA 3VXOB 3S8FB 1BFOA 5IESL 2J20A 2W9EH 4X4XB 1U3HB 5GISL 4NQDD 3ZDXF 4RGNC 1OHZA 1CD9B 3T9WA 1MH5A 3DGGB 3RAJL 1U93A 5A7EA 1H3GA 1NIFA 5EU5B 5J8OA 2NY1D 2VIRB 1ACYH 5C3TA 3GGWB 4IU2A 2J5LC 3PUCA 4BFIB 4JY6B 1VSCA 1RULL 4F7PA 2LU7A 1PX8A 3LZFH 1FFPB 3DKHA 4TUOA 2P8LA 4WIQA 3O8XD 4ORZC 4OGXL 3QVAA 4DP6X 3WHE0 4S0SD 5MERB 3TCLB 2O5YH 4YVNA 4BFBD 3RJDA 5EZIH 5C0CA 2CPUA 1IIIA 3BDXA 5F1NB 2IPUG 4LKCA 2OKMA 4X6DB 3HE7C 4WEEA 3VQ1C 5JPNA 1KIUB 4DGYL 4YSOA 1SOQA 3BQUA 1OSPL 4P3WA 3NFSL 4BSWB 1KPUA 1CG9A 4PJFE 4NM4H 3WFCL 1D5IH 2AXFA 1CLOH 3UYPB 4X4ZA 1MJJB 3KW7A 4LK4A 2QLYA 1M4KA 1XAKA 1TQWA 1Y1DA 4DP4X 2O6FA 1JFQL 4LCWE 4UT7H 2Q8BH 4NXSA 5EO1A 4F7KA 3F58H 2PMZA 4NS0A 2XN0A 4OFDA 3BAJA 3G5XB 4G5ZL 3M45A 3NFPB 1RUKL 2E6QA 4F9LA 1S9WA 5G2NA 3DJRA 4OZFG 1CU4H 5LDUA 4Q0XH 1ZA6A 4K23L 4HD5A 2Y7QA 5KBPA 3SCMB 3GMQA 1AR1C 1FH5L 4JBSA 5ADPH 2NY0C 4LFHD 3GLEA 2WTOA 4Y5XB 3S97C 3SDXE 4ENED 1W91A 4OQTA 2W0FA 4LNVA 3RX9A 3ZL2A 1KULA 2R7EA 4IOIA 3F7VB 5FYLE 4P3DB 2A6JB 1ZHLA 1S9YA 3H42H 3P4NB 4AEFA 3NIGF 1URLA 1Z9SB 4OKVA 1I75A 2E9IA 1T7VA 4AQ8A 3ULVF 2E76C 3MUHL 1M1XA 2WXOA 4AYBA 3CFDB 4JO3L 5CJQL 1YG9A 5EPMA 5AKVA 5F88B 4HWBL 2RH0A 2H3NA 2YD7A 3LEYL 3ARDC 3ILEA 4QAMB 1XFPA 5CILL 5HYSB 2CCLA 2X88A 4GAYB 5FKAA 2XA8H 2HG5A 2ZOTA 3IU4L 3PGCA 4OIAA 3RWEA 4W4NA 2BSRB 3CSYB 2ICWB 3VFMA 1PAZA 1CFSB 1UJ3A 3RFZC 1N59A 1JV5A 5CCHE 5D7IA 3O6LH 3CSPA 3NSXA 4KJYA 1JHTA 5BZDB 2CHDA 1LEKB 1CPUA 2F1EA 3B2PA 1PCXA 4H88L 5IQMA 4PJAE 2OJEA 4MS6A 5F1OB 1BV8A 3MNWA 1BJ8A 4HKJA 2R2EA 2YA0A 3TJPA 3CN4A 2OL3B 3H9SB 5GHWH 1ORSB 5A1AA 4W9JC 3GBML 4MSWA 3S96A 3QQDA 1K6QL 5ESAB 1ZIBA 3GK8L 5TDPB 3U2IA 4C47A 5J11B 4HWEL 3IMVA 4ZZKA 3M86A 3T0AA 1GYUA 2QZ5A 3GO1L 1OPGL 3D9AH 3EGDA 3ZKXC 4KXAA 2WINB 3QR2A 2G9HB 5KN5A 5T33H 3QUZB 4UT9L 1ES0B 1IC4H 4YDKL 1DJYA 5DJ8B 1K4DA 1V3KA 4D9RE 4L5FE 1FFNB 5JQ6H 5JR1L 2QADC 4UM8B 3LEXB 4ATWA 1MVUB 5K9JH 1GGBL 5I15H 5JHDA 3K8MA 2X38A 4Y5VB 3HG5A 1EUUA 2WLHA 4YDJB 4P9HH 1AZUA 2AHIA 1BJ1H 1ZPUA 3FUMA 4P2QB 4QHMB 4YE4H 3UYPA 4BDVB 1XH2A 2YWZA 3IPBA 2X0WA 4F5CA 4TUKL 1U3ZA 4PR5A 2OS7A 3RBSA 5C0CD 5F89A 1H9DA 1DSYA 1FNAA 3BVNB 4WWPA 3S35L 3MRFA 1AKJB 5INCB 3BQUD 2XTJD 4F8OA 4CVWA 5C97A 2D7NA 4MS8D 4EKXA 5BNXD 4XMKL 4GRLC 1PG7H 4OFKA 5AVRB 3RU8H 5ADOL 4ZW3A 1F41A 2A74B 1XTMA 2FHBA 4EMZA 2XWJA 3DOHA 3HBQA 5D5MF 2VITA 4LHUA 4ABWA 3BXNA 1IAIL 4Q52A 4Y5YC 2PW2A 3DSNA 5D7JB 4S11A 1CXKA 1R5WB 3ZZLA 4JFEE 2NT1A 4OCSH 4P3DA 4PJXF 4DH2A 4NHCH 4WTXA 2X1QA 3TZVC 3ZHFA 1F13A 1ZLDA 3MJ9A 1LHZA 5LN8A 2FX7L 3HZMA 1BM3H 4P23A 1LP9F 1JWSB 5IT2H 4X5RA 3OLIA 3F6IA 3T2PA 2JV6A 3QR0A 2VLRA 1SEQH 2WCSA 5FWRA 1MVFA 1UATA 3H3PL 4XVSL 3FB7A 3CWGA 3BCDA 1RJZB 4H8WL 3P9WB 2IV9A 3P4MA 3OKOA 1YEJH 5I66B 3VDBA 2R59A 2ZE0A 4GAYA 4DSYA 2EDLA 2H0JA 2K9UA 1VZHA 3VNZA 4B9CA 2QKIB 2H1PL 4KOCA 5L4MA 1JF1A 1UG9A 4E5XA 4H5SB 3SYAA 3LKNA 3MV8A 4DGWC 1RIUH 2H6PB 1OQXA 4RWYL 1UXMA 4FQQA 1U8CB 1UVQB 3HLAA 3GEWB 5I1CL 1VDGA 2VZOA 4R97C 2Z7WA 4M7JH 5E8OA 4OCYH 3MLTA 4HDIB 5DJZB 3P69A 4JDEB 2JB6A 4HEPA 2HVBA 1EJFA 1SXBA 2AF2A 3T04D 3TU6A 4IKKA 5DK2B 1YJDL 4MVBD 1MRFL 2P5WB 1S7WA 2YBRA 4OLXL 3MRRA 4ODBD 3BSZH 5MEND 4OLUH 2BNQE 3LX9A 3CJJA 2VTFA 4O9HH 2QMKA 1HHJB 3D0VA 4M5ZL 4GB9A 3GLDA 1AQKH 4FXKB 4EI0A 1BZ9A 1ZXKA 5E6IA 2C7UA 5AW3B 1V3LA 5AYUH 3AQXA 3W9DB 5JPMA 1S3KL 2L7UA 5GSVA 1C5CH 4BZ2H 5E2JA 4WU5A 3L95A 4A39A 5IUCA 4LARH 4LSRH 3SGDH 2Y7OA 3F7LA 1GXEA 4JREB 1TF4A 2Y6TE 4HWZB 4ESKA 1FZOB 4U1MA 1YMMA 1T22A 3CXDH 1UA6L 2BVYA 1TLMA 4PG9B 2Q7AA 2CDGA 2F7OA 4P2QA 4X50A 4WWOA 4HLZH 1C16B 2IAMB 2LAGB 3Q01A 4CN4A 3LIUA 2KHAA 1AGCA 2CGZA 5JHDD 3MSPA 3ES6B 1MCJA 3BVNA 3L81A 4RBPK 3D6GA 2Z35A 5INCA 1JOIA 2APWA 4GUPB 3LVTA 1E5AA 4QHNA 1AQ8A 3QDMB 4JFSA 5GGTH 5HHQB 1J5HA 4RGNE 3B3BA 3EGSB 3LPOA 4BRJA 4JY5L 1X5YA 2ETWA 1S7TB 4KKNA 1YQ2A 3QHFH 4FC3E 3D5OF 2OBGA 5IQ7H 1QRKA 4D9LH 4R5VA 5IB2B 3OKNA 2EXYD 2DIBA 5ENWB 1HAWA 4M93B 3C8DA 3LIZA 1XSKA 3MLXH 3V6OC 3HMWL 3TJEL 4CC1A 1BLIA 1JFHA 4CN1A 4LHUD 1J8RA 3RNKB 4EI5D 3KH4A 3ZTEA 4XOAA 5BV7C 3OAZH 1OSZB 3MNMA 4YSDA 1X5IA 2V2XA 2EE6A 1KYOK 1RIHL 4ODVL 5LNDA 3MCG1 2F19L 4NJ9H 3K2MC 1W8NA 3FSZA 1XGPA 5C08B 1CBVH 3PGDB 4P23D 2DH3A 3QR1A 3I50H 4G6KL 3PWPE 2VLRD 4BZ1L 2BSBA 4AVIA 3T65B 2OSLB 4CKVX 1HZLA 3F01A 4JGUA 4MD0A 3BPNC 2I32A 1LO5B 2G75A 1WS8A 2HFEB 5C09B 4HKZA 4KTEL 4LLDA 4JAMA 5BS0D 2ADYA 2NX5E 1PYWB 3MGAA 2A7BA