5B7FA

Structure of cueo - the signal peptide was truncated by hrv3c protease
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
486
structure length
463
Chain Sequence
RPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase CueO
publication title Biochemical, spectroscopic and X-ray structural analysis of deuterated multicopper oxidase CueO prepared from a new expression construct for neutron crystallography
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 142
structure length 463
sequence length 486
ec nomenclature
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7fA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7fA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7fA03
4A2FA 1BXUA 3FSVA 3QQXA 3ZDWA 3H4FA 2YAHA 3ZX1A 5I6NA 1JVOA 2FT7A 4JHUA 7PAZA 2TSBA 4JHVA 3ABGA 4W9ZA 3T6VA 1IC0A 4YVNA 1B3IA 4UF7C 3EH5B 4HHWA 1E30A 5B7EA 4DP8X 1EZLA 3IN0A 3ZIYA 2BZ7A 1ET5A 3SQRA 3JT2A 4N8UA 2XYBA 2VMJA 3FPXA 2LLNA 3NJHA 1QLEB 2FT8A 4G7QB 1RCYA 5B7MA 1IBZA 4GXFA 4G71B 3TBCA 1A4BA 1AIZA 2FQEA 3EH4B 2HX9A 2I7SA 2AVFA 2OCCB 4YSQA 4FA7B 3T6ZA 4GP4B 1ZDSA 2XV3A 1UATA 1PLBA 2VW7A 1SFHA 1JXGA 3BVDB 1XB6A 2UXTA 3X1FA 3S8GB 5B1JA 4DP4X 3PLYA 2QPDB 1PF3A 2XXGA 2XWZA 3IBOA 3PCYA 5AZUA 3OMAB 3NT0A 3UGEA 1ZV2A 3EHBB 3PXLA 1SJMA 4HCFA 2QPEB 2YARA 3FT0A 4YSUA 3S3DB 1ETJA 2GC7C 3CVBA 1AQ8A 3T6WA 1IUZA 3KW8A 1HAWA 1MG2C 4KOBA 4HCIA 1ET8A 2IDTA 1AS6A 4K9JA 1XB3A 2PP9A 2FJSA 1QNIA 3DIVA 3QJRB 1AZBA 4CSPA 4GP5B 4GYBA 1FA4A 1NIFA 2GHZA 3MBWB 5F7AA 1XMEB 4X4KA 3QJSB 5EHFA 1ZIAA 1PCSA 1PY0A 2FQGA 3X1EA 1AOZA 2ZOOA 3EH3B 2PPAA 4UAHA 1MZZA 3CG8A 2R7EB 1IBYA 1W8EA 6PAZA 1FFTB 1L9PA 1KGYE 3RYMA 5I28A 2BP0A 1SF5A 1ADWA 3DTUB 4KO7A 3FPYA 1W6LA 4GY4A 4YSDA 1GY2A 3WIAA 2XVBA 5B7FA 2BWIA 4A2EA 3NJGA 4TXVB 2IAAC 2YXWA 1RZQA 2VM4A 3H4HA 1A4CA 1L9RA 1OV8A 1JZFA 1T5KA 2EIMB 1OCCB 3AG4B 1TEGA 2BP8A 2PPDA 1OOWA 3WKQA 2H5UA 3D12B 1PNDA 2DYRB 5ANHA 2E86A 3HEIB 2UX6A 5B3SB 2PPEA 2CCWA 2H47C 2QDWA 2TSAA 4DP0X 1BEXA 3AY2A 4G70B 5PCYA 1A8ZA 1A65A 4Q8BA 1NIDA 4ZK8A 1E5ZA 2IWFA 5FC9A 4YL4A 4KNSA 3NJMA 2UX7A 2HRGA 3OQRA 3IEAA 4AX3A 1N68A 2PP7A 1V55B 4A66A 2IDSA 1MDAA 4MFHA 4HIPA 3JTBA 2IWKA 4HAKA 1ILUA 2BP0B 3AG3B 2B3IA 2MTAA 5I6OA 1SHWA 1AANA 5I6PA 1RZPA 3FS9A 5A7EA 2X87A 1W6WA 2W88A 5D4IA 1L9TA 1ZPUA 4YSEA 1MG3C 2I7OA 2PCFA 3V9EA 4AKQA 3FYIB 1TEFA 3ABMB 4G72B 2WO2B 2R7EA 3TA4D 5I6KA 1DYZA 1NIBA 4Q89A 4YSPA 4DPAX 1CURA 5F7BA 3FQ1A 1PLAA 4YSAA 5B1BB 2YAQA 1SHXA 3NSDA 2OJ1A 3ZBMA 3FSZA 1OE3A 3OMIB 2PLTA 3TBBA 2BP8B 3FSAA 4YSOA 2CBPA 1TU2A 3S3CB 4G7SB 5I6LA 4DP1X 1ZIBA 5TK4A 1BXAA 1J5CA 1SFDA 3NJFA 3NJJA 3U25A 4YVUA 2VSMB 5I5IA 1AZUA 3CVCA 1BYOA 1PMYA 2WSDA 1GYCA 2UXVA 3KW7A 2CALA 4DP7X 3WI9A 4AKPA 3PAZA 1NICA 1ZDQA 1FWXA 4KO6A 3UABA 1GY1A 3UACA 6PCYA 1J9QA 4NERA 4P5RA 5TK2A 5I6MA 3WNIA 1AG0A 4BK5C 3AZUA 4P5SA 2XV2A 3FU8A 3NSFA 1ASOA 3GYRA 2CUAA 3QJVB 4FAAB 4HALA 1E67A 1AR1B 2W8CA 2DWTA 2OV0A 1WAEA 2Q5BA 1ILSA 3TASA 4QLWA 2HZHA 1V10A 4A2DA 1GW0A 1JZJA 1BYPA 2IH9A 2EINB 4DP6X 4L0PB 1AS8A 1JOIA 1NDTA 3SBQA 4AI7A 3FQYA 5AKRA 2HX8A 1JVLA 1AG6A 1SDDA 4NB7A 5D4JA 3ERXA 3X1NA 5D4HA 2XX0A 4HZ1A 5I26A 1GS6X 1OE1A 2X88A 1CC3A 2PPCA 2A3TA 1NPNA 3SBPA 2IH8A 4DP2X 2FQDA 5I5MA 5B1AB 4G7RB 4M3HA 4BWUA 1PZAA 2HLEB 1CYXA 2VW6A 1AZNA 2FNWA 3AG1B 4BWWA 1J5DA 1KCBA 2EILB 1WA1X 5E9NA 1NIAA 2ZWNA 3FYEB 1KYAA 2H3XC 2XUWA 2J5WA 3ASOB 1N70A 2XX1A 2BWDA 3UAEA 1BQ5A 4E9SA 1GSKA 1M9WA 1HAUA 4GP8B 1AZRA 3FU7A 3PAUA 3UAAA 2GC4C 1ASPA 3FQ2A 5LDUA 1AZCA 3H56A 1KBVA 1AACA 2J57A 3NP3A 3WKPA 5B1KA 1J9SA 2Y69B 2JFCA 3X1BA 1MZYA 4A2GA 5IY5B 1YLBB 2YAMA 4A67A 1OE2A 2FT6A 2B08A 3X1GA 1JZIA 3NP4A 2BW4A 4DPCX 2EIKB 2YAOA 5AFAA 3G5WA 1E65A 1AAJA 1OCRB 5PAZA 1L9SA 3HB3B 1M56B 2JXMA 3NSYA 1TKWA 4A68A 1SDDB 4E9VA 2GI0A 2J56A 4KO9A 4YSSA 1X9UA 3L45A 2I85A 3WNJA 2IWEA 4F2FA 2HX7A 4HCGA 1GS8A 1KBWA 3V9CA 4DPBX 1SF3A 2NRDA 1KDIA 1WS8A 1AS7A 2Q9OA 1L9QA 3T9WA 3NSCA 2HRHA 3PPSA 1OCOB 1KCWA 3OD3A 1JZEA 4KO5A 2VN3A 3QPKA 9PCYA 3WG7B 1URIA 2PCYA 2UXFA 2VW4A 4KNTA 4AKOA 4QKTA 3IN2A 2GIMA 2PPFA 3NJIA 3MX0B 1JXDA 1ET7A 1KV7A 3QJQB 3TU6A 3ASNB 4E9XA 4BDVA 4WTQA 1J9RA 4BXVA 3FU9A 3OMNB 3S3BB 1BQKA 3FU7B 1OF0A 2WO3B 2FTAA 2QT6A 3ABKB 1CUOA 4KOCA 1NWPA 3GDCA 3EF4A 1L9OA 1OCZB 3X2QB 4UANA 3C75A 1I53A 1XB8A 2GSMB 4N4YB 1RKRA 4EF3A 3CDZA 1J9TA 1PNCA 4PCYA 4NAJA 1KDJA 4PAZA 7PCYA 2XV0A 2XXFA 3NJNA 8PAZA 3CVDA 2YAFA 1ASQA 2AZAA 2GB2A 2ZXWB 2P80A 3NJKA 2BZCA 2EIJB 4AZUA 2P80D 4CSZA 1NWOA 2GBAA 3UADA 1WS7A 1PZBA 3PAVA 1BQRA 2J55A 1A4AA 3SBRA 4ENZA 1A3ZA 2PP8A 1DZ0A 4YSCA 1PZCA 4W1TA 3N55A 4DP5X 1EHKB 4E9RA 1V54B 4YSRA 1R1CA 1WA2X 2DWSA 4E9YA 2BW5A 2JKWA 4BDVB 3T6XA 2HXAA 3NYKA 1ID2A 3GXUB 4E9QA 2DY2A 1WA0X 2VSKB 1VLXA 5I5JA 2BO0A 4RH4A 4YSTA 1JXFA 2AZUA 1NPJA 4JKNA 1JZHA 1PAZA 1X9RA 1NINA 3AG2B 2IDFA 2DYSB 1NIEA 3DKHA 3NJLA 2XU9A 4BWTA 2YXVA 4E9WA 2YAPA 1PLCA 2QDVA 3CDZB 3QJTB 4WKXA 1GS7A 5B1JC 2CAKA 1HFUA 4DP9X 2AANA 2BHFA 3QJUB 3OM3B 2IDUA 2UXGA 4KNUA 2ZONA 2RACA 3IE9A 3T71A 2YQBA 1QHQA 2IDQA 1E5YA 2CJ3A 1CYWA 1JZGA 2AFNA 2FQFA 3S8FB 2XLLA 3AW5A 1M57B 4BXSV 3CZUB 4HHGA 1NZRA 2FWLB 1IKOP 2MRYA 1NTDA 2Y1AA 4F2EA 3ABLB 2YAEA 4E9TA 1BAWA 3FSWA 1JERA 4M4RB 4A2HA 1GR7A 2DV6A 2VM3A 3BQVA 1BXVA 4F7KA 1F56A 1SNRA 2N0MA 3N2JA
chains in the Genus database with same CATH superfamily
1EFXA 1OCWH 1ZLVK 1CVRA 3PGCA 1NC2A 2M8XA 3HMXH 4UYQA 5LUMA 3CDGA 3ZQXA 2W60A 3RWIB 5K9OB 5B39G 1G7LB 3VWJD 1G1KA 3KDMB 3ULVH 1AGEB 4PJEA 4QKXB 3G5ZB 5FLVA 5GGVY 3PREA 5KTEH 2EDWA 3EH5B 3GBDA 3LB6C 5B7EA 2EVFA 3IN0A 3AXHA 1HS6A 2H6UA 3FPXA 2XTJD 5FM5O 3T4YA 1S5IH 3MV9D 1NEZB 2CA4A 2IQAA 5EOCJ 4D0BB 4B9KC 1UOLA 3PGDA 4HUCA 1FIGH 4HH9A 2FWOB 3TO4B 3F64A 3EGDA 4IRJC 5L9DL 1YHPA 1ETB1 1Q9KB 3ZDXF 1CL7I 3WS3A 5IFHH 1E9OA 2CH8A 1CGSL 2QHRH 3H7LA 4MSWB 4U1KB 3GMOB 3MJ7B 5BV7B 4OGXL 2GTZB 4BK8A 4O51B 4RDQG 5AOIA 3WMPA 3NAAL 3N0AA 2HP4A 3R1GH 1MW2A 3PNWA 1G6VK 2NNRA 4PU2A 2H2SD 4QF1B 5EZJA 4GQPH 3VSQA 3H1ZA 1JV5B 1KGCE 2VQTA 4YSUA 1TJIL 1OWRM 3CVBA 3MNZA 4K94C 3NCJH 4NWUL 3KW8A 2AQTA 2BS8A 3SGEH 3AT9A 4MD5A 2NNFA 3DGCR 3E8VA 5BUGA 4HIJB 1DTUA 2GTWA 3EOBA 1AS6A 3L3GB 3MYJA 3O8XC 4FYTA 4F7PB 2HRLA 1BG9A 2FJSA 3T77A 1ZMYA 1JFHA 2AK1L 4N0RA 4Z0XA 5EBLB 2ZJSL 3DX7A 1IGMH 1H8NA 4FADA 5TQ0L 3VXMD 3N04A 2OMUA 1DL7L 2Y1VA 3PWPA 3UTQA 3BP6A 3L3IA 4Y5YA 2XTJB 3LQAC 6PAZA 1MRCL 1TZHA 2EH8L 4MNQA 4E0RA 2BVPB 3MV9B 3OF6D 1G7LA 3DX1A 3Q8AA 2BNRA 2KZWA 4UB0L 3B2DC 3U9WA 1D9KD 1K5NA 3Q5TA 2ZYHA 5B4MC 4JM2B 4JM2C 3HOGA 4LLVB 1NEUA 2DOCA 5T3XD 4ZXBD 2XTSA 3BVVA 2R39A 2NUPA 2G60H 1KPUB 4D0BA 1HOCB 1JZFA 1FL5B 2R4RH 4GXVL 4PJXE 4TNWF 2FR4A 3AM8C 4RWYL 1UKSA 1OCCB 1TJMA 4IRJA 2BRRH 4JLRB 3TJEL 5IBTL 5C07A 4JPWL 1IRAY 3HI1A 3P4LA 2I69A 4HT1L 4F9PC 2GTZA 4LIQE 4N85A 3OMZA 5KYXB 4NN7B 2ZAIA 4N8VB 3VTMA 4YIQA 2QDWA 4DP0X 5CP3A 2V2TB 2YBGA 3FTGB 4LPVA 4DWHA 3FUMA 4TLSA 1LJMA 2P8PB 4PGJA 4K5LA 3O2DA 3ESVF 4QXUH 3AGVA 1L9MA 1N7MH 3O3AA 4FFYH 3VXMB 3UX9B 1VF5C 4JDVB 5HI3C 4ZMLA 1EMTH 4M48L 4OH2A 5HPOA 5INDA 1EERB 4JRXD 1N26A 4N2KA 2JKIS 3BEVB 1DJGA 1V3KA 2F74B 4KK6C 1HT6A 3L3GA 4XVTL 4PLJD 5I6OA 2BSSA 4L8CA 1D9KB 4TSAL 2FBOJ 2XWXA 3ZT7A 3HB3C 1NAKL 5E94B 4U1JB 5CNHA 1QSFB 4NLHA 4H25A 1N5AB 3S36X 4MXQD 1TEFA 1W72B 1Q9WB 4FQQB 4NQVA 2H0FA 1A2YB 3CXDL 4ZXBB 4Q89A 2MH4A 2DKMA 2GQHA 5KJ7E 4AJ0A 5I1HH 3VFWB 1CURA 3CSYA 3FQ1A 4NNPL 2D0GA 4YSAA 1D7BA 3DTXB 4K71B 4NCC2 4MRBA 2ZOTA 5C0CE 4G9FD 5KAQF 3OMIB 1OTTC 1RK0A 4JM2A 5E8PB 4RRPG 4KX7A 5CSGA 4LLQB 4JFXA 4LSSL 4TVPD 5CKGA 4IOSA 4DN3H 5ADPH 5IB1A 4IHBA 3NJFA 1RPUA 3MLWH 4ZS7H 5SX5H 3NJJA 1M05A 3QR1A 1G7PB 1JZDC 1FL5A 4N8PA 3AM8A 2EDXA 3C5ZC 2UXVA 3C8HA 5HGBA 1GIGL 2WB1A 4FFZL 3CLWA 4DVBA 1H9DA 1JSYA 1KY6A 5E0FA 3WTVA 1O0VA 3ILQC 4IMLB 2YO3A 4F9PA 1QBMH 2YZ1A 3UCRA 6PCYA 2HMIC 4WGWB 3BLBA 3ZGIA 3G6JA 4OZFH 3LNGA 3BD3A 4PJ5E 3FU8A 1KB5A 3MXVL 3PV7A 2VSCA 4HDIA 4HFWB 3TNMA 5F9AC 4LHJB 5D7KE 2Q87A 3BFQG 1QFWI 2CHNA 3FTGA 4DEWA 1AY1L 2ENQA 2P8PA 2GW5A 3N85H 5A2BA 1QPKA 2W8CA 1EX0A 2UY6B 3QJHB 2X6MA 4DOHB 5AAMC 3OSVA 1CFMA 4JDVA 3SKMB 4F57H 1LNUB 1D6VH 2DBJA 1MNUH 5IOPA 2YEQA 2AEPH 2BOCB 3BEVA 4GAYB 1E7VA 2VB5A 3RDTC 3QZLA 4K5MA 3SPJA 2EE6A 4AE0A 3GBEA 4X6EB 4XMKH 5MENE 3JWOH 4G9FB 4XCNA 2QVMA 4LRIC 4UT9A 4MAUL 3ZYIA 1A1MA 1AYOA 1QSFA 1E6OL 1MUJB 1N5AA 4FQQA 1DEEB 2M83A 2XX0A 3LKRB 3ZO0A 2HH0L 1A2YA 1WISA 1EIBA 4URTB 1V8HA 4XODA 3GSQB 3QAZC 3SDCD 2DRUA 4NCDA 1BQLH 1SBSH 1DN0A 2BY3A 1O5DT 2EAEA 2VC2L 3SO3C 4ADGA 5B1AB 3GIZL 2FO8A 4MS6A 5JQIB 2E4FA 4XHQA 2ZUXA 3QUGA 1ZE3C 3NZHL 4TL4A 5ICUA 4D7BA 2J2ZA 3CSGA 3W56A 5F7UA 1KNOA 1UXLA 4PRID 2OMTB 4Q6IB 1LWRA 1P5VA 2O5YH 4WHYH 1FH5H 4OIFA 1G7PA 1EO8L 2HT4C 2OP4H 3C5ZA 1R3JA 1BQ5A 4I3SL 4CGTA 3QORB 4O5LL 3QORC 3WELA 1CFSB 1HSAB 1LO0L 2NNXA 3REVA 2NY6D 3MV7A 4Z7QB 4JFDE 1PSKL 3IF1B 4IMLA 1NGWB 3TWCL 3QI9D 2OKMA 3F6LA 35C8H 4UTBH 5H37A 1RIHH 5F0PB 3QG6B 4G3YH 4OCWL 4RAVB 5I2IA 3FHAA 3QUHA 3QNYB 4KHXH 5LJYH 3H9YA 4R2GD 4ZOBA 3A6OA 3NP4A 4UZSA 1MRDH 3LRSA 2VRQA 3WY4A 2CBMA 4K7FB 1CXFA 2QGDA 3I6LE 5EUKB 4QEGA 1J8HA 4PS8A 5AAMA 3DI3B 2XA8H 4MB4A 2R4SH 1X9UA 2B2XH 2UZXB 1MJJB 5I76A 5EBGA 4PBDA 4ZTEA 3RDTA 3SDCB 3VH8B 2IADA 3IJSA 4F58H 3BYYA 5B38G 2AQPA 2KUTA 2MWCA 3QUXD 1OARL 5FKPB 4DH2A 3H9ZA 4LRIA 1EK3A 2NY5H 4TM9A 3FB8B 3UJJL 3BP5B 5GJSL 1TFPA 4HCRA 1O6VA 1PGRB 5K9KB 3X3FL 4N0FA 4PRDA 2HJKB 5LNDA 4EIGB 5JXEC 3WG7B 1DEEA 3LKRA 3VA2C 1B4TA 3Q2LA 4PRIB 3V6OC 3GSQA 3OC8A 5T5FL 5GS2H 5EF1A 3MX0B 2D7NA 1A1NB 2V3DA 2ZNWA 3QJQB 1JF6A 3C6LD 1E5AA 4ODVH 2CJTA 5D7EA 5AYUL 3VJ6B 1JV2B 4H44C 2NY6B 5E56A 5CFHA 3DBSA 1G7JA 5J6HB 1J8RA 5IZ7A 2X70B 3QI9B 3WIIH 4WSGA 1F6FB 1V05A 4WKZA 1U2YA 2AJZB 2AQ1A 4N0UB 32C2B 3P02A 4LSQL 1JZ6A 4X4YB 2JJVA 1QO3A 4R2GB 3GBNL 4UM9A 1AGCB 1QI3A 4LCUA 2WXQA 1RKRA 3QORA 4P49A 1SUJA 4PJBF 3HC3L 4POZD 4P3WA 1TQUA 3CBRA 1D2OA 1JWSB 5IHHA 4F5CA 5JUEH 1UQSB 4O2EB 2XV0A 4DO5A 1EAQA 3L95B 2J8UE 1WWBX 2HWZL 4RAVA 2NY7H 3B2PA 1A66A 1RU9H 4PYHA 4ZFOL 3QUXB 3EBHA 3WTYA 3OKMA 4DFIA 1YEHH 4JO2H 1BZOA 4S1QH 3DC0A 4KMQA 4Y8DC 4AQ8A 1CD0A 4K7FA 4Z3IA 5GISL 3TN0D 4NQCE 5EUKA 1X5YA 5EORL 1WZAA 4OD2B 5LGHL 1F6AA 2EDEA 2WTOA 4EUPA 4LLDB 2AW2A 3LVTA 5F3BB 3P4NB 1P1ZB 5T1LD 1GW6A 4B3VA 2BFGA 3NACH 3SOBH 3F12B 1G9HA 2FEEI 3ECQA 3VH8A 4YSRA 2OQJA 4JPSA 4P4RB 3EFFB 5E9DD 3TVMD 5JQ6L 1OZUA 3C6LB 3O9WC 2JKWA 1M7XA 1R75A 1GVIA 2XWDA 4YO0B 4EI5D 4XOBA 4N2EA 4AL8H 1BBJB 2WLIB 3CVHH 1Z9MA 4TUUA 5JXEA 1MCOL 1HCVA 2GJZA 5LBSL 2EE2A 5FYKH 2WLYA 4FG4A 4PRIA 2BXZA 2WP3O 1WJ3A 4P2QA 1PAZA 3V6OA 2V7NA 4OZIE 3VW3H 1SBBA 3V0IA 2VDML 4OKDA 1ZANH 1CDGA 5CBEB 1UHVA 2O5NA 3DROB 3VJ6A 1JI2A 3QJTB 3OZ9H 4JJHA 1GS7A 2P47B 4JZNA 5DHYA 2ZXAA 4RMWA 4Y19D 4DP9X 2A83B 1MCPL 5C0DB 1I4FA 3MO1B 2OYKA 1OGAE 1RI8A 3CZNA 4MYPA 3ML8A 4ONFL 4GG6F 4HZAA 3VXNB 5HGGS 3BPNC 4X4YA 3WL9B 4BE5A 2ZIDA 4G42B 2F19H 3D9AL 1QAWA 3KE0A 4YX2L 2AFNA 4I18B 5TFSL 3GMNA 2OW7A 4ZMNA 3SDXF 4FTVD 5DHDA 3CZUB 2MKLC 3ZN6A 3TN0B 2XVLA 3CFKB 4JVUA 3GRBA 3GQFA 3MJ9H 3TFKD 2X6AA 4YHIA 2EH7L 1BZQK 1SXZA 2AJ3A 4HXAL 5T1LB 2K70A 3UC2A 5EO1A 4PCTA 5AALA 5SWZE 5HXMA 2ZOKA 3TVMB 5DDHA 5I18L 2QQKL 4DUVA 3N2JA 1UKQA 1ORSB 4YDIH 4KK9C 4JRLA 3BGFC 2FGZA 5FWQA 4H4NA 5AW4B 4OD2A 7PAZA 3E3QE 4G9DB 4LLDA 4BUHA 3KS0J 2B77A 3FRPA 3BP4A 4WCYH 2P5EE 1I8LC 4OKVB 3W39B 3X14B 5L0QB 5I1JH 3EFFA 4JRFA 3O9WA 4MDRA 1ODAA 1UTDA 1OT4A 2FT8A 2MKWA 1TLKA 4RIRA 4YO0A 1K4CB 1NMAL 4Y19B 3V6FB 4QGYA 4N8CL 1BBJA 2WLIA 3TBCA 4AVIA 2XVKA 3PDOB 3R8BB 1M53A 3HIZA 4J3OH 1U3NA 4QRTB 2B5IB 1ZGLP 1QNZL 4PLOB 4YSQA 3VFRB 1KCRH 4P3CL 2YD4A 4NQEE 5FYLL 1JRHL 3RPIA 2W0FB 3IMBA 3UZEA 2QKIC 4XE5B 1C5BH 5CBEA 4XPGH 2CA3A 5L8LB 5D7SH 1E4XI 3I74A 4UUJA 1OQOA 3UGEA 3ELAT 2JJWA 4L29B 3VXNA 3BXNB 1BDYA 1MQKL 3RG1C 4AV5A 3HNTL 4Q2ZA 4WNSA 1AQ8A 2LVEA 5CS7A 1HC1A 4X4XA 3V4VH 4BQ9A 5DRZA 2WVTA 1KLUA 1RLWA 5F1IB 1ACYH 1FSKB 3F05A 4JG0H 3BEWB 4N2NA 3F7QA 2ERJC 4ZX5A 3W0WE 4LP4A 4PD4J 4L5FE 4MMZB 4DW2L 4I0CC 3QJSB 3MRFB 3FCSB 3II3A 3IFPB 1PY0A 2FQGA 2OL3B 4MX7A 4OQTL 4FZ8H 5CP7B 5DUBA 1KF9B 4NBZB 1VGEL 3MRPA 3VCLB 5IR1B 2I07B 5GSRA 2DZEA 4BELD 2XPYA 4FFZA 4U4BA 1E27A 3TIEB 3TONA 1MJ7H 4AYGA 2HAZA 1ADQL 1ADWA 3L1EA 5I16A 4ZQKB 2W38A 4LSRL 3MLXH 4G9DA 3E0GA 3VFTA 2Z91B 3V0AC 3I9IA 1I8LA 4KJQD 4UINL 1G4MA 1HH9B 5G5DA 5DVNA 3O6FD 1U95B 3TA3C 1XCTA 1MCDA 4Q14A 3SJVE 4MXVF 3VXUA 1DBBH 3T0XA 4NKDA 4X2UA 4UILL 5J1AB 3C2AL 1GL4B 2G4GA 3MRCB 4OCLC 4XWGH 3TBTB 3VFUB 3OAYH 1MRFH 5LQBL 2EJ1A 3PDOA 2NZ1A 4OJFH 3CLFL 1N5YH 4J27A 3SDDD 3K4DA 2XZQL 4ABWA 3QDGE 1NOAA 2H5UA 3TBYB 3D12B 1J18A 2NY4D 1ZHKB 4UOJA 2QKIA 2ZICA 2XCMC 2EIZA 4IDJH 4GW5A 4S0TD 4YFEA 4WU5B 1DQMH 1A3RL 1N64L 5DJ8A 5JLZA 1TJGH 3Q8EA 3MLSL 4PWGA 1QLRB 2M2DA 4HK3J 1IC7H 3ZL1A 4BSVB 3W9DA 3RQ3A 1KGIA 2DI7A 4PJDB 2Z0UA 1C08A 1CE6A 3TYGL 4F2ME 3VFMB 4F24A 1HZHH 2WANA 1SYVA 4L8SB 3T0ED 1LQSR 15C8H 4OZGA 3C60C 4NDMB 3RTLA 2UX7A 3IEAA 3D0LB 3VQLA 1XCQB 1UM6H 3U6RB 1EA9C 3ZL2A 2DJSA 5F1IA 4AITA 3IMVA 1O9VA 2EDBA 4PJFF 4JM0A 1MDAA 2IWKA 3MI6A 3TT3L 4N90E 4PSPA 1MFBH 5I6PA 1RZPA 1Q1JL 1W9XA 1DVXA 4KI5D 2A9NH 4F8QA 2A1WL 1R3LB 3KR3L 4L8BB 1MCEA 4KJQC 5FO9B 3GMMB 4AKQA 2WBKA 3WGUB 3O6FB 5IR1A 2L7JA 5KSBB 2BY0A 4GJTB 2CNYA 2A0LC 1NIBA 1UD4A 2WKGA 4A7SA 5BZDB 2XJKA 4G8AC 2P43B 2E27H 2QFPA 4ZQKA 3I9AA 2G30A 4KDVA 4OU3A 1VACB 5K9JL 3FSZA 4NKMB 3SDDB 3OZLA 1XO8A 1XDTT 1ZK9A 4NSKA 3HI5L 3HE6B 3HE6C 1G0DA 3TA3A 2NY4B 3UTSD 4YHYC 4R4FL 4YE0A 3ISWA 4JN1H 5I6LA 4A2LA 1GGTA 3D2UD 4ESKA 5J1AA 5I1LB 4V33A 4KZEH 2YHGA 1OWWA 5EEZA 2WVVB 2WIIA 5DA4A 1LO3L 4AQZA 5BMFL 4QXGH 1MLBA 1P7KA 4GBXC 4FG0A 4KKQA 5L8KB 4UT6L 4PEEA 5BVJB 2ZX9A 4YPJA 4WI8A 3L3KB 3T0EB 3N9GL 4I13B 2KZBA 1IBGH 5J8OA 3TBYA 2BVTA 4Q9QH 2NLJB 1QUNA 3MODL 3U7WL 3B7UX 4WU5A 3BMWA 1AG0A 4XO8A 1RK1B 5IVXF 1F90L 2A4CA 1CPUA 4PQXA 5JHAA 4PJDA 2B14A 3A24A 3IETB 1E67A 1VSCA 4W9EC 4KI5C 4M3JA 3C08H 3VFMA 4F3FB 5T3ZE 3T65B 3ZDZB 1DVFC 1SZNA 3LS5H 2Q5BA 2B15A 5T5FA 3F5WB 3NGBB 3NGBC 3C60A 1ZLVH 1AZZC 4NDMA 5KYUB 5D4QA 4NC0B 4WO4D 5LLIC 2VMFA 1NC4A 1WCBB 5DT1L 3W9EB 1OAXL 3X12B 2EXWC 5CJQL 3T09A 1IEHA 1NCTA 2MPAH 4JM4H 5I9QB 4Z3GA 1JGUH 1FGNH 2DQJH 2JK5B 1B0IA 1OTUD 2XQYA 5AKRA 5FA4B 4AGQA 1BVLA 2X9ZA 4KMLB 2HCZX 2CMRL 1AG6A 4NB7A 5A3ID 1NCWL 5AVWB 3WU1A 1S7SA 3UTSB 4WWKD 3OPZL 3D2UB 3QZWB 5BZDA 2AAAA 1SEQH 2P9RA 4HPYH 4IOIB 5JDSB 1Z3GL 5EZOH 3UTPD 3NIFF 2A3TA 2X41A 4MB1A 4QRPA 4HBCL 4F37F 4MA7L 3ULVF 3TBVB 3PXHA 2WBJD 1Z5YD 4BWUA 3U9PH 3HE6A 3D87B 3DK2A 1HKLL 4Y1AA 4K9EH 4ZFOA 3KPMA 5T3XH 1ECYA 4X50A 3O4OC 1F4XL 4PY8J 3L8QA 1WVZA 3NRFA 5JOEA 3SDAC 5K9QI 3QPQC 3NCWA 1GPOL 2WVVA 3P3SA 3T3MF 4AGLA 1H8OA 4GBXA 2VXQL 4FQLH 3UAAA 1BAGA 3BKJH 1NMCC 1MCLA 4WO4B 4WO4C 1KJ2L 4FFWD 2DBLH 3GSNH 1WCQA 4X9BA 5I8OL 4DN4L 2JFCA 4J7RA 1MOEA 2EDQA 1MVUB 1II4E 1HZKA 1CL7L 3T1FB 5HYSA 3K0YA 4NM8H 4LGSB 3SYQA 3SPVB 3IETA 3S9DB 4M5ZH 5LBSA 3K7UA 1KYFA 4F3FA 1E65A 4HP5A 5AFAA 1DVFA 2DKUA 1G9NH 2OTUA 4DGYL 1YA5A 1A22B 1ZHNB 4L37A 4KO9A 4WWKB 1WCBA 3V7MA 5IHZB 2XRAL 3H3PL 1ICTA 1PKOA 3U0WL 3NCEB 2ODIA 2R69H 2YN5A 2WN2A 1W80A 4ZS6C 4L3EE 2JK5A 4OF5A 4PJHA 5JR1L 2Q9OA 4KGJA 5FA4A 2WBJB 1OCOB 4XNUL 1AXIB 1AIFB 1T0NB 4FC3E 4HUKB 1NKRA 3S37H 5C2BL 4UDUB 1IGJA 4K3DL 4UYPA 4AKOA 3EYQC 3QFJE 3QZWA 3UPRB 4JZOA 4NRZA 2VDKL 4M8RA 3WIHL 3B1UA 5F7DB 4CADB 1BZ7B 5HGAA 5E5UB 3TBVA 1WPCA 3HZKA 5BW7C 2MTPA 3M46A 2WAQA 3ARWA 3CHQA 1YQ2A 4KKBC 2FL5A 1YEDB 2FTAA 3MRGA 5D5ME 3MN8A 4R97B 2DH2A 3SDAA 2AMGA 3TCLB 3CVIL 1G0YR 4UQAA 4HG4J 3B34A 3IB4A 4F15B 4F15C 5HYJB 5CILH 3J7HA 4XMPL 2PO6C 1PDKB 3FH5A 5DQ9B 3B5GA 4AM0A 4ZSOB 4WO4A 2JKNA 4LSUH 3AS3A 3NPSB 4KUCF 4BJLA 3K2UH 5JIIA 4FJ6A 4XMXA 1MFDH 2GSGA 3MRNB 4N3TA 4IU2A 1I3RA 3OKLA 3QBTB 5JNYB 4RISH 1T80A 3LKOA 1C5DA 4LBAA 4HKXB 1NDMA 3WFCH 2AVGA 2ICWB 3CPLB 3QUZB 3NSXA 3QUZC 3RNQB 4HSQA 1RZIB 4ENZA 3WO4B 5IHZA 4S0HA 3LAFA 3MRLB 1A9BB 3FB6B 3SY0A 3OJVC 3P54A 3CD4A 3EO1B 1ZLSH 4KK5C 1EEYB 2EXTA 1DBML 3MLZL 2DWSA 3U0PA 1MAJA 4IQHA 2NQDA 4BK4A 2XI9A 1WD8A 4G1MB 4L8DA 3WTTA 4YSTA 1JXFA 1NCIA 1U92B 2IPUG 1F41A 1NUGA 4RZCA 4U1IB 5BRZA 3JZYA 4PPTA 1BSIA 4PY7B 3VFGH 3UPRA 3P4MB 5HSFA 1NINA 4G8FB 1AFVL 4UTAL 3U7YL 3NFNA 4A2MA 1WBYA 1KC5L 4L9DA 3A23A 1KCUL 1BZ7A 4CADA 2OPCA 5HYFA 5EN3A 1P2CA 4PJCB 2ADGA 3VWKC 3P9WB 4HKZA 2Q86A 2WZ0A 3V2AR 4F7TA 4HU8A 4B50A 4OQTA 5BW7A 5ICZB 4ZPVB 1S5HB 5EBMB 4OI7A 3OM3B 1YEDA 2WQSA 3S8WA 1IBDA 4LLYB 3VFNA 3X3GL 2BC4B 3T71A 4XPFH 1QHQA 3LN9A 1K9TA 1RPQA 1ADQA 3DX9B 4QHPA 4YZFE 3TBSB 3ZTJH 5HYJA 1F11B 2K9FB 2GITA 4D9QD 1EZSA 5MEQB 2PO6A 3T1WA 4B6ZA 4RFEB 1FFPA 4IMKC 1EHLL 4RX4D 5DZNA 4ZSOA 2D0HA 5JIQA 3L3DB 4MZRA 3TZVD 3EHBD 4GKZA 5KBLA 3PQYD 2BP3A 4HWBL 1CGWA 1BGXL 3BSZL 1AR2A 2EDTA 4W6YB 3WJMB 5F89A 4M6ML 4WY7L 1F56A 2ZUVA 4HWEL 5HVGB 2X4PB 3CXHK 1QFOA 5JNYA 4HKXA 2DI8A 4LSTH 1PW3A 3P3YA 4A2FA 1JD7A 3QUZA 1CF1A 4AQEB 1RZIA 3IFNH 2ESVE 3DO7B 3SD5A 1IGTA 1O7DE 3DO3A 4WU7A 1QFWL 2IBZY 3FB6A 5AYTA 3SIKA 3EO1A 2NW2A 3OJDA 1PD1A 2V37A 1ZK5A 2VLRA 4WEBL 1IM3B 1HCZA 1IARB 5J1TC 2HUHA 4M3KB 4BBWA 5B7MA 2EO9A 2AQ3A 3JVGC 4GXFA 3F7PC 1A4BA 4G2AA 5HBBA 1U92A 4J1UB 3V8CA 1QKZH 1INEL 3QCVL 3DV4B 4O9HH 1MFEH 3B37A 4M56A 3QFGA 4PCKA 5KVEL 5GRWA 1KYOJ 2Z65C 3MAWA 4X7TA 4H20H 5E4EB 1Y1DA 1AKJA 3EJYD 1NCGA 4N86A 4GQ9L 5FA3A 5FGCE 4DQOH 4IRSD 3TZVB 1DO6A 1S5HA 3TZVC 3EHBB 3AQZA 3EHBC 3PQYB 3AFLA 1M7DA 1MFMA 4X6DB 1IMHC 1LILA 1AGDA 1NCJA 3HJ0A 4BKLB 3VI3B 4LLYA 5EEWA 2BC4A 1XF2A 3MZGB 1F0LA 4L9LB 1PG7H 4KVCL 1U8PB 4A7GF 1XCWA 4PJXF 5MEQA 4LE8A 4IMKA 2OS7A 2QADC 5CJOL 1S9YB 1M71A 3ASWA 4WTXA 5HDOA 3FUDA 3L3DA 1AR1C 1HH6B 1U33A 1ZTXH 2HFGL 3MBWB 5E24E 1XMEB 3EDEA 4LHQB 2WBXA 1A3LH 4JZJB 1I75A 4JZJC 4WWNA 3EH3B 3OSKA 4UZUA 3WN5B 2YK1L 3QNXB 1CF8H 1SOKA 1KBKA 5TGBA 3T0AA 1SLXA 4UT6A 1RZFL 4OZ4A 3DTDA 3BKML 3K3QA 3N50A 3S2CA 4AQEA 1YO4A 2QVFB 1KJ2B 3LPOA 3ULUD 1FDLL 2A4ZA 2IGLA 4F92B 5JPNB 4M6OH 5BPPA 3LQZB 3OR7A 4LPTA 2WOBA 4JFQB 1MPAH 4A2EA 1TCMA 4U4IA 4BV1A 5JW5B 2ID5A 3KCPB 2WD0A 4L4VD 1IM3A 4RRPA 3I3EA 2G2RB 4XPBL 4IRSB 2VQ1B 5I23A 3OQ3B 4OFQA 3JVGA 4AV4A 4NO3B 2DLFL 2CXKA 3RIAF 1XT5A 4IS6A 1R0AL 1NUFA 3EFOB 4M1CD 4GW1B 2HVKB 3SKOA 2ATPA 5BRQA 2BZDA 12E8H 5C0FB 1NLDL 1OOWA 2FX9H 5TPWL 4JGJA 1R24B 3RY4A 4DGIH 5KBNC 2DYRB 4WUUA 1YEWA 5FO2A 1R3IH 2DTML 5FW7A 4L3CB 2A6KB 4NWTH 2X1WL 2HFTA 2WNXA 4YE4H 5LGJB 2J43A 4G70B 3TZVA 1EQWA 3NN8B 4X6DA 1SXBA 5HHVH 1S9XB 3VI3A 3WN6A 4YGVB 3P9LB 5EU4B 4K8RL 5FC9A 4YL4A 1VADB 5GS3A 2X9XA 5IUCA 2XN9B 3QCUL 5JPMC 3MTRA 2Q8BL 4JKMA 2Y2WA 4JPIA 1A4KA 4GS7B 2J8HA 4GS7C 3HFMH 4MCZA 4ODHL 1FZKA 3NFPA 2EZ0C 4NUPA 1BFVL 1HH6A 3MCLH 1A6TB 2JVUA 1ANUA 4CU8A 3AQXA 1U8LA 3MBWA 4JO3H 1EDYA 2ZT9C 2F54E 4JREB 4NBYB 1JNLL 5H94B 4BFKA 3BE1L 4KMTH 3BAKA 3KYKH 3PU7A 4JZJA 5HDBF 5HHPB 4L4VB 3RWJB 2ZOUA 2VXQA 4Z7VB 1CVSC 2FBJH 4LHUG 4P23D 2A6DB 2OMNA 3KXFA 4AUYA 3K6SB 1MHCB 4PMEA 2H1LM 2N59A 5JW4R 1KJ2A 4RAHA 2BFVH 3H9SD 4XOAA 4GI8A 3RX7A 4M1CC 2YPKA 4XVSL 3SZ6A 5AVRB 3LY6A 1G7QB 2ZUQC 2W1NA 2GK0A 3CQQA 1JNHB 5TF1L 4PWEA 2I26N 2AJVL 4RRPM 1T6WA 3W11C 1A14L 3DX6B 3LPFA 4J28A 4OIIH 5KBMA 2AQ2A 2FEEL 5LVEA 3IJHB 3ARBD 2C26A 1DJSA 3ZKQD 5J7CC 2HVKA 3QWOA 4C4KO 4PRHD 5C0FA 1EXUA 1NCDL 1ZDQA 5IQ7L 1KTJA 2OLDA 1X5GA 1DR9A 3KWUA 2NY0D 4HUWB 3UACA 1UURA 2E9GA 4PTTA 4DK6A 4P5SA 1BD2D 3PWJA 4JRWA 3DJTA 4S1SL 2IJ0C 3O4LA 1M1XA 3AADB 3E1F1 1D5RA 3P9LA 5EU4A 3TJPA 4UTCA 3ZJAA 4JNXA 4NO5A 1VADA 1V10A 2XN9A 3FW6A 2LAAA 5JPMA 2V5MA 3WIHA 3AUWB 3HMWL 4RETB 5E2UH 1HTYA 4P23B 1UM5L 2YBRB 5KJRH 1KIRA 4QHLB 5C86A 3JUYA 1LK3H 5E2WH 4L0PB 2NT1A 1LO2L 3PWLA 5B38A 5IB3A 3K8LA 5LB1A 2HX8A 1RUAL 3ZE2F 3LIZH 1JVLA 4Z1PA 2WSPA 4LPYA 3FTVA 4KQ3H 5EZPA 4FX5A 4KI1A 4XP9L 3VSVA 4IHOB 5KBKA 4G6MH 2DTSA 2NR6C 1CXHA 1WAAE 3CFMA 4LEXL 4QDGA 1EEUA 2L3BA 3RWJA 4X6CE 5DUPH 2WQVA 3K6SA 1B9KA 1GC1H 2XDHA 1YY8B 5CZKA 1QFHA 3HI6L 4PRHB 1MAML 2R0KL 1OB1B 3A67H 1SOXA 3MJ6A 3SE6A 1ZT4A 2NY0B 5FS5A 2PTVA 3QDJD 5MEPA 4ENEC 4R26L 5E9NA 1FVCB 1T6BX 4UOZA 5F8QC 1HILA 4N2IA 1IGCH 1BD2B 1RURH 4WUKH 3V10A 4AEIL 3RWHA 1Q1PA 3VUAA 2W0PA 2GFBA 1IBBA 4QHKJ 4GP8B 1TVDA 4P59L 1QYGH 4L1HA 4PRPD 4O2CB 4ZBJA 1CLYL 4J3OF 1QBAA 4HUWA 5F0JB 3NZ8B 3E8UL 5B1KA 3L5WA 5GS0H 2IC2A 1CFVL 3OKOA 4XXDB 5B3JF 5IY5B 4OZHB 1FORH 2CIKA 2WM0A 2WWNA 2YC1A 1RUMH 3EKCA 4IDLA 1QVOA 4YNYA 5ISZE 3E1ZA 3G5XB 5PAZA 1IBFA 2C4FT 4NHCH 3HZYA 4E9VA 4GSUA 1UD6A 4UTAA 4UOW0 4I88A 4P57A 1E4XL 3BFOA 4X98B 2IPKA 3S88L 2BOBA 3MLRH 1CU4L 2E74C 4YHPB 4OR1A 3DLQR 2VERN 1UADC 3JV5A 5AVYB 1SQ2N 1UYWH 1O6SA 1U21A 3NSCA 4LAJH 3ZTNH 3CK0H 4M7KL 1JHKL 1E50A 4FXLA 2BK8A 5DMKB 2J8UF 1KTDB 4X9HA 3QDJB 9PCYA 3RAJH 4Z3HA 3R4RA 2NR6A 4YDJA 4FFVC 3RVXC 1YN6A 2CJUH 2VDQL 5D1ZI 5EZLA 5FHBL 1HEHC 1TTUA 3GWJA 1R3KB 3EYSH 3IJ7A 5F88A 1DO5A 5JTWA 1YY8A 2AITA 5IJBC 2A73A 4HWBA 3SPHA 1AHMA 5EN2B 4PRHA 4PRPB 5I5RA 3BSZA 3S3BB 4FLQA 1HEZB 4PJ7F 1NWPA 1FVCA 4RVBA 4A1RA 2J21A 2X53A 3BZ4B 2VRAA 4J8RB 1NMBL 1JYWA 2WNWA 3IGFA 4TRPH 3TEWA 1I53A 4M6NL 2OZ4H 3M07A 1CDBA 1PNCA 1WZLA 1N0LB 3HZMB 2AHIA 4KZCA 2EO7A 4EDWH 1WG3A 3PP3H 3NZ8A 1LDPL 3EOTL 1NGYB 5CMAB 4XXDA 1AXSA 3BUYB 5DMIH 4HUVA 3EAKA 5E7FA 4NO0D 1KUMA 1IGIH 1I1CA 1A0QH 3OVUB 4A7TA 2YA1A 3G5XA 2Y7NA 3HS0B 5KW9H 1A9VA 3FHQA 1I31A 4Y4FD 4NUQA 4R7NA 1E28A 2AK4D 4ELKB 3SPGA 1DZ0A 5HI4C 4YSCA 2ITEA 4O02L 2XA3A 4TQHA 4WI4A 2N56A 5T33L 1YSOA 1IV8A 3F6IA 1J5OH 1F86A 3GZPA 2GVYA 3Q6GL 1OGSA 5AVZB 1SYSA 4OCYL 4YDVB 1CK0H 5F6HJ 5I6XC 3GGWB 4K8RC 5AUMB 5I5JA 4ZAKC 1KTDA 2H2PC 5E4AA 3VXRE 3X11A 2EVHA 3QDJA 4GSDH 4ZFGH 1N59B 3FUFA 4KV5F 4BH7A 4GXUN 1R3KA 4AJYV 2AEQL 1I7UB 2X4SB 1YN7A 1QTPA 3PS6A 4PH8A 5TQ2L 2LHAA 1YMMA 1HE7A 5EN2A 1SXSA 2ENJA 4Y9GA 4QNPE 4J3BA 1NFAA 1KB9J 1KGJA 1D7FA 1K8IB 4M8QA 1R6VA 3DJSA 1OGTB 1KULA 3VFOB 2RD0A 1WBZB 5KVMC 4OGQC 4HEME 3TV3H 1I3GH 1BLNB 1NBVH 4NO0B 1K6QH 2JB6B 5IBUG 1FNEB 1CFBA 1JZ5A 3UG3A 4OFKA 3HZMA 3VD7A 4Y4FB 4Y4FC 1XAUA 3QEHA 2UYLB 1QFWM 1J0IA 4KQ4L 4LP8A 2AK4B 5EC1B 4YAQA 1BZ9B 1FFQA 3CUPB 4RFNC 4XBEL 1EGJL 4NENA 4J6RH 5ESVA 1HQRA 2XZAL 2VLJE 4P5TD 4XNXL 1E9PB 3U1SH 5DR5L 5CZXC 1YUHB 5EH1A 1U3JA 5DD6B 2D31B 3AMKA 3DOHA 1QSZA 4WFGD 3GLEA 3PDGA 5FYJE 3UMNA 3EJRA 3QQXA 3H4FA 3SE8H 2YAHA 3DPBA 4YXKH 4AIZB 4OBSA 3TC9A 3N40P 2XWCA 1B0WA 4NN5C 4TTDD 5EU6A 2IQ9L 4HETA 5DQDH 4HSCX 3BT0A 5GRVK 3I2CL 3STLB 4PLKD 4GQQA 2XSKA 2Q6WB 5CFAA 4AEHH 1XGUB 5GGSB 3SGKC 1DN2A 4BQ8A 4YDVA 2EIBA 5FXCH 3WJLC 5JORB 3V4PL 4G43B 4ZAKA 4PB9H 4LZKA 3ARVA 5K93A 1KT2A 2WGXA 3E6HA 3LEYH 4HHAB 5AVSB 3L9EA 4LSVL 4ELME 3JTTB 2LE9A 5DMGC 1SMOA 1XB6A 1CI5A 2NMSA 2VN4A 1NGQH 4MWFB 1W91A 1ID5I 4JDEB 1I8UA 3A3YB 2W9EL 3ROLB 3RIFK 2XWZA 2EDMA 1HK6A 4TNEA 5IQLA 4WIQA 2Q2EB 1A6PA 5HDWA 4C56E 5D70L 5IV2B 5IB5A 3ARUA 4P5TB 4LCWE 4MDJA 4PS3A 3CZFA 1WBZA 4IBZA 2DQEL 1FO0H 3ZLQC 4NO0A 1Z9LA 4K3EL 2GABA 3K8MA 3NZUA 4OB5L 5LN4A 2YMTA 2MCPH 4Y4FA 1H15B 5DZPA 4JKPH 1LEIA 3B9AA 1AZBA 4JRYA 5TE6H 4GO8A 5GRUL 2VN7A 4GUOA 4BFBD 4EDXA 3O0RH 1NFKA 2WNKA 1YUHA 4GMTH 4FLOA 3R18A 2J4WL 2ZOOA 5DD6A 2NNCA 4ZYKB 5KS9A 3LH2H 4N26A 3V5HA 1MIML 1RUPL 5D7IB 2J1ZA 3VSTA 3EJZD 4TV3A 2M26A 3BH8B 2ITCA 4AIZA 3OG4B 5CEYB 1TTRA 2XPGB 5F2FA 2Z7WA 5EB9A 3HUJA 3BLKA 4XH2B 5CAYB 1I1FB 2YUZA 5B7FA 3HBQA 4AE1A 1Q38A 1RIUL 1EEQA 3KYOB 4OSUH 4OJAA 1IFHL 1E8YA 2EO1A 4QWWD 2QSCL 3FTUA 1U3HD 2ZZUT 1XGUA 3DUUB 3SGKA 4OCMC 2H1PL 3IU4H 2C1OA 4NKOB 4PV9B 3VXSA 1NAML 1L9RA 4MA1C 1AHWB 3WJLA 1E4WH 1OV8A 4MBRA 2J5LC 4QTHB 2OSYA 2VDRB 4NT6A 1P6WA 4XZUA 1JGLH 2GEEA 4Z95L 4WF7A 1TEGA 4F8LA 2K3HA 5BXFB 4HHAA 4JO1H 3WKQA 1DSFH 1QUPA 4KX8A 1FZMB 4ZNEA 2X1OA 1I7ZA 2CK2A 3HEIB 1AP2B 4LNVA 5DFVD 1P7HL 1RY7B 4ORGB 1QABA 1U8QB 4XPHL 1Q72L 1TZGL 3F7YA 3CMGA 3EO9H 4OJEH 3KZ8A 5HJBA 4KJYA 2VLME 4KXZH 3VVVA 3ZIMA 1IT9L 2VL5A 5KVDE 1DQQA 1WE5A 4CMHB 1GRWA 4CMHC 3CC5B 1JK8A 3BT2L 1KFAL 1EAPA 3ALXA 3FQNB 1JYXA 4A66A 3O3EA 5LXGL 1C5CH 1NFDB 3LNEA 3FRUB 4L4TD 3H7BA 1DQKA 1KLFA 2HKFH 3VU1A 1A6WH 1W6WA 4PJEE 5A7EA 1KN4H 1TSHA 1L9TA 1RXLA 2PCFA 1ZLWK 3L9RA 5D8JH 4AX3A 3P2DA 1U3HB 5AW8B 4YEFA 4WJG3 1UZ6E 1JBJA 2D03L 1USZA 4FQPA 2C3VA 3Q1EA 4APQC 4DGVH 4UOQA 5FYJH 2DEWX 1KIQA 2FYVA 3BH8A 3Q9PA 4ODBD 1IKFH 2MNWA 2YAQA 3GXFA 5B1BB 1CXKA 4GIOA 4K07A 2XPGA 4WTWA 3S36H 3TPUB 5DUMH 4XH2A 2D3JA 1IX2A 3WOVA 1N2RB 5LG1A 2PLTA 4Y8AA 3ZGHA 3KYOA 4L2LA 4XCFH 5IMLA 2WO4A 2FLRT 3ZZSA 3IAPA 3ZZLA 3QYCA 1NGXB 4PV9A 4NKOA 4UMGA 4TMPA 2CDEA 4NZ8A 3PWUB 1S46A 3BHBB 4A6YB 2YD8A 3UTTD 4QTHA 1I8AA 3CN2A 4M61B 3HR6A 4X99B 4FKHA 4CU6A 1VA9A 4DP7X 3WI9A 2Z4QB 4HJEA 3IRCA 1FZMA 3ECBB 2O1AA 1Q0YH 4HV8A 1J9QA 3OKEA 2WUBL 4GRWB 4NRXB 4FQ2H 4WW2C 4ORGA 2H9GB 4D94A 4P07A 1U8QA 1A6AB 5E8EA 4HX1B 7TAAA 1CZ8L 5CGYC 3RI5K 1AXTL 1SHMA 3QG7H 3VFVA 4Q6YA 4OCSL 1TVHB 5AOZA 4JN2B 4HJ1A 1W0WB 2LFEA 4I3RH 1TKWB 3TASA 4ES8A 1Z5LA 3N42B 3PWPE 3W2DL 4S10A 2IH9A 3AAZA 4L1DA 1BEYL 1J11A 4MNQE 2DS4A 2FGWL 1DHKA 1JWUB 2NX5D 3RZCD 3GSXA 2NOYA 5LN8A 4Q4EA 1H3UA 5C0AA 4PHXA 1JE6A 1F4HA 2BNRE 1X6LA 2DMBA 2Y24A 1XSKA 3HC0B 4NP4H 1HCFX 1SDDA 2RIKA 2WJ7A 4JVWA 5E6UB 2QVTA 2BIQA 2CDFA 4HGKC 4XMLH 5EOTA 5K39B 1USQA 1MHEA 5HHOA 5A2AA 3BAEL 4APQA 2X88A 2W9DL 3PUCA 4X5PA 4XC3H 5J6GB 3ULUH 3ME0A 3UTTB 5C0JA 3N6YA 1QD0A 2IH8A 1BVKA 5DURD 1FCCA 3NCFB 4Z7UB 4M3HA 5F93C 5C07E 3PP4H 3M8OL 4G7VL 4AG4H 1RUKL 3ZDYE 1MHPH 4PREB 4AYDC 1NGXA 2BVUA 3L7FA 5DJ6A 1J48A 1TQBB 1Q9LB 3SCMD 1I1YB 2E7CA 1JHLH 3LD8B 2OA9A 4IIQB 4QAMB 3WNLA 4FL4B 4UI2A 2ZSWB 1J88A 4BFIB 1GOFA 3W81A 5BVPL 1JZ2A 3SYOA 4KKNA 4X99A 4P2CG 3QQ4A 3FU7A 4L0YA 1U8OB 3MLUL 4O02A 2A9AA 4G83A 1MLCB 4IW4C 2AABH 3MRJA 5ESAB 3PABB 3QT2A 1TITA 3ECBA 4ZDHB 2VDNL 5IFJA 2X2JA 2W80C 1MWAH 3C6EA 4HK0B 2P24A 1GGIH 1ND0A 4WW2A 3VMNA 1YLBB 2NX5B 2UZPA 4FYQA 1C12B 3BN3B 1RULL 4HX1A 5M94B 3OKYA 2Q0ZX 1BWMA 1TJHH 1DLHB 1N3NB 2CLZA 4P2OD 4ZMQA 1F4AA 1U8HA 3GSRA 1TKWA 5KVDH 5D5MF 5D72H 1JGIA 4HJJL 3SZKC 4JFFD 1XGYH 3GK8H 1KXHA 4IBYA 2HFFA 4OFDA 2CM6A 2IWEA 4X4MA 5EA0H 1NPUA 3LMJL 1PX4A 3LKPB 4IU3B 1KFGA 4XNYH 3X17A 4U1LB 1G9EA 4Y4HD 1KBPA 1UWGL 1AS7A 5DURB 4L3FA 3QO0A 4PY8I 3GMQA 3T9WA 4JY4B 1TIUA 5JOFB 3ZZQA 4YUEH 3CZSA 5E6YA 2XQYK 2VAAB 3VYPA 3WSQL 3KM1A 5GGQL 2IDCA 2VZSA 3VQ2C 3IDUA 1D5BB 5TE4L 5E00A 4NI3A 3IN2A 3FT4B 3SCMB 2UY7B 2ETWA 5J6GA 2IXQA 1SDYA 3ASNB 5EOCL 4A37A 4E9XA 4ZUUB 1T2XA 4ZQTA 1EGJA 3OMNB 3GMLA 1S7RB 1E2ZA 1DP0A 1EO5A 2WO3B 3MBXH 4XCCH 3S5LA 3K91A 1HXMA 1KACB 3DK0A 3MOAH 4OFYA 2DQGH 3WJJC 3G6JE 1I1YA 5EIVA 2FSEB 5DJCB 2ZSWA 3CBKB 2GAZA 5JA9A 4BFIA 1P69B 5DC4B 3M88A 5AG8A 4OFIA 4P2OB 1CFNA 5DC2A 2ZQKA 3M17A 1YNTB 1ONQB 3B3IA 1MLCA 2FEDC 2XG5B 2JXMB 5D2NC 3GM0A 1D5ZB 4P48A 1XGPA 3QRBA 3NJNA 5T1KD 3L9YA 4PM1A 4HK0A 5GGSY 1KCSH 1XBDA 5I19L 2TAAA 4JFHD 3V4PA 4NCC1 4M7JH 4Y4HB 5TE7L 4CSZA 4N0YH 1TYEB 1E42A 3ATDA 3Q9QA 3S4SA 2Z93B 2WUCL 3CX5J 1N3NA 3FC8A 3UXFA 1PEWA 3CFEB 1T89C 5MI0B 1JNJA 5MI0C 4BE6A 2RTTA 1QSFE 3O11B 2P46B 2VXTL 4XN8A 2FB4L 2YLKA 4YZFF 5BZZA 4LDCA 3MA9H 4I2XB 4H0GA 1URZA 5F71A 5I71B 2FZ3A 5AOJA 3BISA 2ALAA 4BDVB 4KPHH 3T6XA 1AQDB 2P44B 3DIFA 4JY4A 2HJFA 4R8WL 2VSKB 3SBWC 4Z7NE 1XXDC 1IJ9A 3AJ7A 4POUB 1UCBL 2BHZA 1A7BA 3EBIA 4RGMC 4W6XB 1C16B 5GRYA 3EYUL 1CWVA 3AG2B 1ZLEA 4EBQL 3F58H 4AT6B 2XFXA 3NJLA 5I8KH 1D6EB 1FCGA 5ITBL 3HG0A 4PFEA 5LGYA 2A74C 1YG9A 3CHRA 1VFAA 3VB8A 1G1CA 1H5BC 1S7RA 2BIHA 3MV7E 3EFDH 1AQMA 4MQXC 3ROOA 3QJUB 3U2JA 5T1KB 1RH8A 5H35A 3WJJA 3V5DB 1HJBC 5C0RL 1QZNA 3IE9A 4KFMA 4OD1L 5F96L 2FSEA 4NGHH 2HSIA 2B59B 3UOAB 5CP3H 4Y9BA 3M6DA 3WFBL 4FJYA 1S8DB 1Q94B 3V52L 4BXSV 1RZGB 1F13A 1WFUA 4Q0XH 4QOKD 5D2NA 4J3UA 1J8HE 3HZVB 4ZZKA 4N6RA 1BXXA 1F4WH 4DUWA 1KJ3H 3FSWA 1NAMA 4JFZH 2IVFC 4L3AA 4A2HA 3VTTA 4XBGB 2RGSA 2UUDH 5AOMA 2NQ3A 1T2QL 3ZDXB 4Y4HA 1AHKA 3UCQA 3L4WA 2VERA 1TTCA 3P73A 4U0RB 4U05A 5IQMA 1IC5H 2FD6L 1BXUA 2A77H 2FJHB 2B1HH 3NIDF 5F97E 1T89A 3CFEA 5I6NA 4PJGA 1JVOA 4MJHA 3OHXB 3OHXC 2EEXA 5H8DA 2PUQT 2BNQB 4UF7C 2HTLC 5CEZD 5SX4H 5DTFA 3ZIYA 2CE6A 3SQRA 4FG6C 2ZP0T 3Q06A 2P48B 5AW9B 4I2XA 4QJ4B 3ZPDA 3LN4B 1PU0A 3MRKB 4U6XB 1IGFH 1ZOXA 1TZIB 4JFEB 1HHGB 2EABA 1HNGA 3UZVA 4N1CA 1BFOB 3SBWA 3GSVA 4H1LG 2IF7A 2I24N 2O5XL 2VZ1A 1C8QA 1C16A 3PV6A 4JS7A 4XOEA 2A99A 2UZYB 4K7PL 4B53A 4DKFH 3HJEA 1MFNA 4AT6A 4RQQA 5DVLA 2E46A 5DEJA 2ZCHL 4DAGL 2A74A 4JPVH 1TENA 4CMMA 2R0WL 3N1PC 2W0LA 1H5BA 2OMYB 4QOKB 4Y5XB 3WUZA 3EJCA 4F5CE 4WNQB 3H42L 4HPHA 2OCFD 1SJMA 3SYCA 1CXIA 2E47A 1F42A 4QJ5B 2DLTA 2WQUA 2OK0H 3S3DB 1MF2H 4CVUA 3T4AB 3MLVL 3OB8A 3SE9H 5I1GH 3KWWB 3QQ3B 3MV8A 5C7XH 3K0WA 4L4JA 4JG1H 1S8DA 2R0LH 3D18B 1MFCH 4PJAF 4OVUA 1CD1B 2Q8AL 3QJRB 2L0DA 3HVNA 4XP5L 1Z7JA 4NZUL 4R7LA 4X4KA 4JFUA 1YY9C 1JVKA 2WXHA 4X9FA 4MVBD 4XBGA 3DHPA 4HYTB 4JHWH 5HJ3B 3RL2A 3ZE0E 5MEOA 4UAHA 3IDJA 5KG9A 2ZOWA 2BVQA 2FJHA 2BP0A 2QGBA 4XMVA 3RGVD 4LHUA 5E1HB 3C12A 3OKNB 5DD5H 2B1AH 1UM4L 2RQEA 1P4LB 1SLWA 3OHXA 4GY4A 1RMFH 4ISVA 3JXAA 2BNQA 2BRQA 1KJVB 4PRIE 5KSUB 3DURA 4KU1A 4P2QE 3V6OE 3DRQB 2H6PA 3BKCH 5KWYC 3WDIA 4U6XA 4JFEA 1INDL 1G7IB 1HHGA 1P1VA 1GCFA 1PZSA 1PZ3A 1AKPA 3IKCA 3FMGH 4IOFD 4GMSH 3ARFC 1G6RH 1MI5A 2G3ZA 3D3VD 5ALBL 4U33A 1S2EA 1AE6L 1RPKA 1YEJH 2UZYA 2R9HC 5EIIG 5I74C 4NQSA 1H3PL 2V9QA 2AGJL 5ID1B 2ICWJ 1EHNA 4KKLD 3M1BB 1NCCH 2YQ3A 5GPRA 5HDRA 1TNMA 5DJAB 3QUYD 3RTQD 5CF3A 2V7HB 5AKTA 3C09B 3H3KA 1V7NL 1P4BL 2HLAB 3WLBB 4ZJ9A 4WNQA 4Y7OC 2YEZB 4X8JA 2DQCH 3JV0A 5D93B 5D93C 3BZFA 1ZY9A 1I3UA 3QULB 3BPOC 4J3VA 5DZOA 1MFAH 3D39D 1LD9B 3KPLB 3QQ3A 4YLBA 5T1DL 4FABH 5BQ7A 5HGHB 2MSPA 4OLYL 2DL2A 2NZ9C 5JDJA 2LW3A 3DGGB 3UMTA 4MFHA 3GMRB 3RGVB 5AVTB 4NJAH 4FI6A 1HQ4A 3WY3A 1RIVH 2Q2LA 4GKNB 4U6HA 3HHSB 1W15A 2APWA 2QVKA 2IANB 2UVEA 1B4LA 4GAAA 2CKBB 4DQAA 1DUYB 5SWZA 2WO2B 3TA4D 3TIDB 1BAFH 4LKCA 2XBDA 5JHDD 3S6CA 1WZ1H 4U6YA 1T7ZA 5IVNA 4XCYA 4HCRH 1FVEB 2VR4A 3QCTL 4LKXA 4P2RA 2O6PA 2OM5A 4TUKH 3BP7B 4OAWB 1OSZB 2DQHH 3B2UD 3D3VB 3MROA 3I6KA 4C83A 4LEOA 4ZUVB 2G0KA 3US0A 5I8EB 1A6VH 4HLZG 3TBBA 2CK0L 1G0XA 4X7FC 2OYLA 1VHPA 4PGBB 4X42A 4EKXA 4F93B 1ORQA 4TULL 3QUYB 2JKSA 2XACC 1IM9D 4AEFA 1SFDA 5CZRA 2BP5M 4XX1G 1RFDH 1BYOA 4FEMA 2GIXA 3ARFA 3CIAA 1KGUA 1BM7A 3VGFA 1IIKA 5DA0B 3WUWG 2WYTA 4GRLD 1UXWA 2D7OA 4AKPA 5A2LH 1MHHB 3P11H 3HG5A 4FCAA 1NM9A 2DJUA 5ID1A 3D39B 2EXYD 1KN2L 4NERA 3PHOA 3OAZK 1T1ZA 2G75B 3MA7A 4H7VA 2NUTA 1FYTA 1KENL 4AH2A 43C9B 2VDRH 1Q4NX 4QD2E 4H8WL 5D1XD 4FAAB 1DUZB 2YEZA 1DBKL 2KDYA 2B8OT 1ES0A 4MZ3A 4AGMA 1U58A 5KN5B 2WQ8A 3BAWA 4JPKL 4M62L 3QULA 5KOVC 2E59A 3IGAB 1QATA 3CX2A 3MPCA 3IDXL 4QGTA 3PHQB 3B2VL 4LDLB 5HGHA 3RVTC 2CSPA 5FO7B 4OM1L 5G4NA 5DHXB 4W6WB 1J7VR 1NDTA 3EGSB 5AKSA 4GKNA 1YYLH 2IANA 2B1OA 2PMZA 3H2PA 4NFBA 5IB4A 4DPRA 3L5XL 3ERXA 5CJBA 4Z0BH 1FJ1B 1CGYA 1UACL 1IM9B 2X4NB 3B9KC 3CZJA 4LL1A 3VXUE 4E5XB 3LNDA 4PRBB 5DSCB 2QELA 4L1BA 1K3ZA 1FVEA 1TJIH 3SQBA 1ZA6B 4YHZH 1LP9A 4FNLL 3TJHC 1JPGB 1OANA 4GRLB 5E03A 2OXHA 5I8EA 3WLWC 1R47A 2YPVH 4OUOA 3FO9A 1DQLL 2VNCA 5D71H 4R7DA 4LVOB 2PWDA 1XAKA 4ZPTA 1FNHA 1CFTB 1WIOA 4UBDD 1KTKE 3QDMD 4B41A 1C8PA 3K2IA 5D1XB 1SN2A 2BWDA 1HXYA 3RJQB 4YR6B 2VR7A 3MJ8B 1ACXA 1DL7H 2EUXA 1X5IA 1ASPA 1IFGA 4NI6A 1IEAB 5ACZB 1RAMA 4RAUB 3NH7H 2XTLA 2CHDA 1A7QL 4OZGE 1L5GA 2NY3C 1E3FA 2K78A 3N1FC 3Q2VA 4BZ1H 1A5FL 1T5WA 1BIIA 3X1BA 5E70A 3WFDL 3KMDA 1U6AH 2F5AL 2E8YA 43C9A 3MR9B 2LU4A 1QEWB 1GMEA 4WDIB 3IU3B 4XC1L 3EBAA 4QXWA 2Y06L 2P5WD 3PHQA 3ZRSA 4N22A 1TMCB 5C0NC 1R5IB 2NW3B 2X89A 3GNMH 3LNFA 2ARWA 4RWYH 3REWB 1HHKA 2HX7A 3WNJA 4EN3C 5I0WA 1B0GB 1CLZH 1JF1A 4L05A 1KTLB 1K4DA 3MUUA 4HKBB 4BH8B 1K8DB 1NGPH 1QFPA 1S7WB 3EGSA 4HT1H 4W9KC 3LH9A 3NSJA 4PRAB 3L4XA 2H8PB 3QPKA 3P4OB 4X7SH 1N12A 3ISYA 4QHKI 3VD4A 2ZNXA 3B9KA 3BN9D 1U8NB 4E5XA 2C7UB 2J44A 3QDMB 3CSTA 4OCRL 1EAOA 1HI6B 5AB2A 4E41A 3EO0B 4FE9A 2VZUA 5IGXL 1JPGA 4M48H 1GYWA 1I9IL 1RUQH 1X5HA 2WXPA 3I9PA 4MDIB 4ETQA 1LTXA 3ESUF 3DSFL 2QT6A 3BIAX 4XBMA 2QTEA 4XVTH 1UJ3C 1YQVL 4XBPB 5DXWA 2FATH 3K74B 4TSAH 4IBLT 1IAIH 2QTVA 3DHJA 4ZTPL 4FKEA 2YD7A 1MWOA 4CU7A 4PJDE 1I7TB 3A4DA 4WFHD 5AVVB 3O3DA 3CXDH 1YAIA 3L5IA 3QNZA 5CUSH 2P5WB 3OLGA 2BSED 2DWDA 3RX9A 1L3WA 4NNPH 1MDTA 4DCQB 4P5KB 3EZ8A 3VD3A 2AZAA 2ZXWB 5GRJL 1X6NA 1T03L 2P80D 2HKHH 3SN6N 3RWCB 2HFEA 3IU3A 3QUKB 3LPGA 4ODTL 2K4AA 2CCLA 4QNPF 1Y7VA 5D1QD 1MW1A 1WICA 3SBRA 3K1KC 2W92A 2NW3A 4EN3A 1DFBH 4Q58C 3VRLF 1DBAL 4GG6B 4WI5A 3O6MH 4NXSA 5CIPB 4U7MA 4W9DC 2IBBA 5D1ZC 5ANMB 5I1DA 2OXGB 4HKBA 4AMKL 4E9YA 5DWUL 3TEUA 1QQDB 3JWDH 1UB6B 4QRPE 4WI0B 4HJGB 1GMIA 3ZYJA 4G8GD 1N8ZB 4G11A 4PRAA 2D2CC 1RZJL 3G04B 3SDXB 4PJBA 4BZYA 1NCBH 1OCWL 2VXVH 4F8NA 5FEBA 4Y1AE 1PYWA 1H3WM 3U4BH 3E38A 2V17H 4M7LT 1U8NA 4L18A 1M6UA 1MCSA 4ERSL 4BA8A 3VFSA 3GSOB 4AQ1B 1HI6A 2JE8A 2R29L 2HG0A 4ODSL 3RVWD 3EO0A 2X12A 1GCYA 5KTEL 4HUUA 3O41B 2CAKA 4MDIA 3IMUA 2AANA 2QLYA 4MS8D 3H6AA 3QDAA 4IK6A 3JTSB 2JWYA 2O6EA 1UJ3A 4ZTOH 3DVNB 4HMCA 1S7VB 3ILPA 2RACA 4K15A 3VDCA 2YQBA 1FIGL 2IDQA 3LRGA 4PG9A 4AYID 5C08B 3TP4A 4NN6B 1I7TA 2WTPA 3HG1D 4KI5E 3TCXA 4NHUB 3QEGH 4YDLB 1SUHA 3TGXA 5T1MA 2YAEA 2VC2H 2HJLB 5HVHC 3R1GL 2OAAA 2BSRB 5F6HI 5IW3A 2LTQB 3VRIB 4MAZA 3AQYA 2YJLA 4PGEA 1YECH 2DV6A 2ZXCA 5I1EH 2W65A 1FE8H 4YHNB 3Q8CA 4BA0A 1U8IB 3BWSA 3NZHH 5AD0B 2WTRB 5AW1B 4DZBB 3QUKA 4PJHE 2MQGA 2IFFH 5FUCE 3FSVA 2NXYC 1AD9A 5D7LB 1RERA 3HRZB 3HRZC 4Y4KC 2LU5A 1Y6MR 3BX7C 2X2UA 1EO8H 3ABGA 4LARH 4J12A 1JGEB 4MAYD 3IDMA 4GG6A 1LO0H 4UOW1 5D1ZA 1LQBC 4NPJA 1UUSA 3HA0A 4H8WC 3KLHC 5A40E 3IS1X 1IEBB 1IGML 3NQKA 3UH8A 4Q9CA 5FF6B 1SVCP 3SDXA 5HHXH 1AIZA 4HIIA 4M5YH 5FUZL 2WWMC 4HULB 2OJEB 3BWUC 4OW6A 4MMXC 4PGCB 2ZCKL 1T66D 2VR5A 3WYRA 1PZ5A 1JZ7A 2BJMH 2E8ZA 3V0FA 2YMOA 4CKQA 4RMBA 1NEZG 3KD4A 3BD5A 3HG1B 3ULUF 5EF2A 2CBTA 2E9WA 2APBA 3ZKMD 2WZ5A 5FW8A 5L4JA 3PCYA 2XV6B 2BSEA 1LE9B 1UGKA 1U36A 3L2NA 1NBYB 1RJZB 4OFPA 2G60L 1OARH 2VDLH 2NCEA 2QPEB 1A6ZA 3QEUB 5DMYA 2R4RL 4Z7VF 3WFHB 3HAEB 4NQUA 2GUOB 5C08A 2EDNA 3X3FH 4LASH 2BRRL 2R59A 3BO8B 3MUGB 1FN4B 4CAGA 5DJ2B 4LVHC 3VE0B 3V95A 5FYLE 1WSST 1FA4A 5CEXB 4D9LH 2DQDH 4MAYB 1VFOA 2MOGA 5AYUH 2DW5A 1OM3H 4BFNA 3MSPA 2O61B 5D96C 3MGTB 4YHNA 4MNGA 1U8IA 2WTRA 4QXUL 1N7ML 1H0DA 2X05A 4FFYL 5D7LA 3GXMA 2EUWA 3HRZA 4YBHA 1KEMH 2FJFA 4Y4KA 2O30A 4YGAB 1EMTL 4P3DB 1S7UB 3FPYA 1OALA 4S1DC 5GHWH 2PTTB 5MERB 3VQMA 1SEBB 2AP2A 4HIHB 1TPXB 2LABA 5DZLA 5L4MA 5BRZE 3FFDB 3QZPA 3EYFB 3HC3H 5AW5B 5EO9B 3RX5A 3BUBA 5ECGA 2X4UB 3EG9B 4I1PA 1WRFA 2FWUA 1IEBA 3GLDA 4C57C 5C8JA 1RJLB 1G94A 3ULSA 3UJIH 2XG4A 5FF6A 5T8IA 2E5EA 4QRRD 4PJFB 2NNAB 3PL6D 3CFJA 2CRMA 4MMXA 4PGDB 1SVBA 5I1HL 2CJSA 3WHE1 1GZHA 3EDFA 3L54A 3BVNA 1DSWA 4C55A 5L2JB 3Q13A 4H26B 3DI2B 5CJ5A 5LGHH 4B0MB 2ZSVA 4BSWA 5HYJE 2J1XA 3G5YA 4HF5L 4JR9L 5FM4A 4AIOA 1THCA 3MMEB 5A2JH 4MJIA 5E5MA 4DN3L 5I17B 4ZSOE 1S7XB 1RJZA 5A6MA 5JQ6H 3MLWL 4ZS7L 1OM9A 2VUKA 1KTBA 5EZIH 1QRND 3MJWA 3FONB 1P6AB 5DJYB 3WFHA 1XCXA 2HRGA 2GUOA 2DQTH 1Z9OA 1F5WA 5CHNA 3L4YA 2OR7A 2PP7A 3QE5A 1JGVH 1MCOH 3V55A 4ATWA 3IGLA 3K6FA 3OX8B 5D7JC 2V2XB 3IFLH 4AXWA 3MBEC 2X40A 5B8CB 1QBML 3B7SA 3AG3B 5B8CC 2QZ5A 3VE0A 1U8MA 4NQXA 1UOWA 2VDMH 2RH0A 3I02B 3ULVD 3MGTA 2HLFC 3OZKA 4GW4A 3N85L 4IBSA 1JJUA 2VLRE 2CRYA 3BRFA 5DK0A 4TN9A 3RILA 2CDGB 5F7BA 3BPLB 3MNWB 1PLAA 5GGVL 1YYMH 2A38A 1KTRL 2YXMA 1KXTA 3KPNB 4QRRB 3FN9A 4F57L 1MNUL 5IVXB 3PL6B 1H3XA 2PTTA 3FO1A 2AEPL 3DX2A 4U3XA 3WGVB 4YX2H 1KELH 5ABAA 5IMMB 5INCB 4HIHA 2VISB 4XXWC 4XMKL 5DF0A 3BGMB 1S3KH 4HS6A 3CCHB 3EG9A 4XRCB 1J5CA 4J4PC 4N1HB 3RGHA 2Q76B 1ESOA 1XH3A 1PMYA 4PJFA 1NOFA 4PGDA 3H53A 2BVEA 3TEXA 2KKQA 4Z7AA 1I1AD 1QRNB 2QQKH 3QGVA 3TEYA 1BQLL 1QTSA 2UZIL 1RQ5A 2P8MA 4NKQB 3N0PB 5IIEB 3P9MB 3VDBA 3QK0A 3MOQA 3VVWA 2Z31D 3ZL4H 3MMEA 1M7IB 4RGNC 3KLSA 4I4WB 5E23A 2AAVA 1S7XA 1S9WB 2O5YL 3NIFB 2VGLM 3ZDYF 2VLKD 1FH5L 1FGVH 1OGPA 1S7TA 3ZVVA 5I1AB 5H37G 2OP4L 4J2XA 4LRNH 3A6CH 4A2DA 1KPRA 3R7RA 1JZJA 3BKYH 2JIXD 3L3JB 1V3LA 3OB0H 2PWGA 5KVFH 3LXBA 1INQB 5D7JA 2BX5A 1AO7D 2CHZA 3EDDA 3CFUA 3MBEA 1QNZH 1E2VA 4JKLA 5I82A 5B8CA 1PKQB 35C8L 5AB0A 1FZJB 2X4TA 4MJ6A 1JRHH 2NY1C 1RIHL 2ICEB 4UTBL 4M5SA 4ZUTB 3WE1A 1K5WA 3T3MB 5IW6B 4KHXL 2X4QB 2JKLA 4Z78A 4DT2A 3U0TA 2DWXA 1HYSD 1BF8A 4AIEA 4XNBA 3K46A 3R06A 4AYFB 5EBWB 1E8ZA 4YHOH 5KYWB 1A6UH 2H3KA 2R23A 3RU8H 2R4SL 2IH1B 3MZTA 5IVXA 2GJRA 1ECZA 3Q1SH 4I9XA 4GIPD 4L48A 3V5KB 1I1AB 5IMMA 1ZV5A 3MOBH 4MD4B 4XXWA 2CKBH 4RA0C 4BWWA 3BD4A 4ZFFA 5IBLC 2JCCF 4XRCA 2ZKYA 4HEPA 4WUUE 4XPAH 3U9UB 1OAUL 4J4PA 3BCDA 4KUCD 2Z31B 1B6UA 1K2DB 2ITFA 1G5AA 3JV6A 1OD9A 1F8TH 4HKJA 3EOAB 1O9WA 4CW1A 4E9SA 1VGEH 2FYYA 4X6DE 2VLKB 1ZD6A 4HPOH 3KLQA 3VI3E 3EOYG 3FUEA 4Y9CA 2VLLA 1FNSH 4ODVL 2JIXB 1ADQH 3NZSA 4EI6B 1T1YB 3ARED 1AO7B 1PX8A 4A67A 3WIIL 2AJXL 3G08A 1CICB 1CICC 4CA4A 5DQJA 2AI0H 2VR6A 3WEBA 2KZKA 1T7WA 2VJ0A 4Z8FL 1A7OL 3FQWB 4QMEA 4UILH 3VYOA 3G6JF 2R29A 5IK3B 3WHXB 3QA3A 1EZVX 3FTYA 3INUH 1INQA 3M7OA 5AAWC 4BKSC 4O58H 3BWAB 4UNUA 5DVOA 3KXFE 1PKQA 1S78D 1R5WB 1J1XH 3IJYB 3T2OA 2NRDA 3DV6A 2VXSH 1XWVA 2NY7L 4MNHB 5F3HB 1Y18B 1RU9L 1A3RH 2ENYA 1Q0XH 2VN3A 3MLSH 3SB3A 2HVJB 2IH3A 1DLFH 3VH8G 4JO2L 1ZSHA 2KI6A 4S1QL 4XI5D 4P0DA 4AYFA 2CR0A 2GIMA 3TYGH 2OX5A 5J06A 5KYWA 2I9LB 5ETUB 1T7YA 2YGQA 2E7BA 3RWGB 3NACL 3SOBL 3V5KA 5GZND 3ARTA 4OM0H 1JD9A 1JFQH 4FMFA 4G6KH 2ED8A 5JW4M 3ABKB 3CN4A 5IT2H 4KOCA 2ISDA 3TT3H 3AREB 5J0BA 3U9UA 3L6FA 3X2QB 4AL8L 1H6TA 2RFXB 2Y36H 2A1WH 3KR3H 3ZTJG 5HPMA 1T22B 2P8LB 5CKAA 3FT3B 4X8CA 5FYKL 4Z7NF 4RLDA 1ZLUK 3CDZA 3O4LE 5GXBB 4Y7MA 2ZTBA 5L2KA 3D25B 4ATTA 3A47A 2XQBH 3ZK0A 3P0YH 4ANWA 1ZANL 1CTNA 3KHQA 4UQ3B 4QYAA 2XN9E 4HJIA 2AQNA 3O6KH 3OZ9L 3OLIA 4Y16C 2CGRH 2FJGB 1KGCD 4XNZB 2VH5H 5K9JH 4Y9FA 1ZGLB 1RSFA 3HI5H 3U83A 2EIDA 1CICA 3GLZA 2FO4B 1SJVA 4IEFA 5GGUB 4NXKA 5E2VL 2IMNA 3MQIA 4UQEA 4Q4IA 5F9DC 4NZTH 3L08A 5FO8A 2F19L 1BJ1H 3V4UH 3FB7B 5IK3A 1KMGA 2PW2B 3FB5A 3BQUD 2LU7A 4EAEA 4DP5X 1GYUA 3LZFL 5AAWA 2PYEA 2FUQA 2VN6A 1LK2B 5BMFH 1HNFA 4KKAD 2Y4SA 1BQSA 2OMVA 4NZRH 3VD5A 4QHMA 5CR8A 3IBEA 5C0IA 3MODH 1QSEA 2YA0A 3S7GA 3FUIA 2NSQA 3GSUB 4KZDH 4M93C 3FRPG 2D7MA 2HVJA 2AZUA 4H1LA 2VQ4A 4YDIL 2W95A 2ZX8A 4I87A 3IDGA 5SWSB 2JMRA 3LOWA 5KSAD 2MCG1 2VOTA 4XGZB 4AK2A 2I9LA 1T0MB 4R83A 5ETUA 2ZWYA 1E6JL 2ZPKH 3CBJB 4JEGB 2IPUK 4NNXB 1JXJA 1QW8A 3DVIA 4OZFB 2QDVA 3WAJA 5DT1H 4D0CB 3ES6A 3IDYC 5I1JL 3OAZH 3EJPA 4JK0D 4POYA 3FCGA 2OFQA 5ENWB 4CNIB 3QXDA 1J8KA 2N3JA 4FI8A 3SGDH 4FFYA 4M43H 3KJ6L 3UAFA 1E3ZA 2WMPA 3KHOA 4GUPB 5D7IF 3S8FB 4FNSA 4OLEA 2VIRA 5DVMA 2D0FA 2CU9A 3OPZH 3LTVA 2MRYA 3WNMA 4XPGL 5F1OB 1KY7A 1XF4B 2VAJA 3NA9L 4HBCH 4Y16A 2FJGA 5D7SL 5LDSA 2RB8A 1T21B 1Q9OA 3QJOA 4XWOD 1ZGLA 3EBGA 4F7KA 3QIBD 3L45A 1YNLH 1S9VA 3K6NA 5DJDA 5GGUA 3JYCA 4KRLB 3I6GB 3C8KA 2I9TA 3V4VL 3QHZH 3FQUA 1DANU 4UV4L 3GZQA 3IJ8A 4JHVA 2COVD 4WHDA 4W9ZA 3MU3A 1ACYL 1J05B 2X1QA 3V9FA 5HVWA 3K71B 4JG0L 5KSAB 5KSAC 3VGAC 2BZ7A 1NQBA 2FDBP 1ZVHA 1UOVA 3SYPA 3IJEB 3D48R 1YEKH 5T1JA 4FZ8L 4PRHE 5JHBA 4PJXB 3J2PA 4JHAL 2AJYL 1CL7H 5C0CD 2KLTA 1QBLL 1NUDA 5SWSA 3VXOB 5CIPH 1TCRA 3ZE0F 1X5FA 1ZDSA 4XGZA 1YC8A 1T0MA 3UTOA 3MRDA 4ANXA 3MLXL 3ARDD 3FDWA 4NNXA 3BVDB 4Y2DB 4Y2DC 5GGTH 5GGRA 4OZFA 3D8MA 3TL5A 1V7MH 4U2ZA 2ATKB 3GB7A 4D0CA 4DP4X 3AXLB 2XRAH 4U1GB 1PF3A 5F7EH 3ZZ1A 3ZMNA 4GI6A 3FUNA 5BJTB 3PXLA 4HIEA 4G6FD 4PJIA 5AWNH 1S7QA 3P0VH 3QZOA 5LCVH 3RIFF 5JR1H 3UIYA 3QIBB 4XNUH 2N7AA 4OJFL 5DS8B 3D5OF 4UU9B 4I77L 5CSBA 1I85C 4PJ5D 4ZW8A 2MCAA 4JAMB 1W0VA 2Q7YA 3PJSB 2Z35A 4K3DH 4F7EB 3QRGH 4K9JA 1X3DA 2Y7OA 3NTCH 4O2FB 5D7KD 1QNIA 1CFQA 1YEEH 5FYKU 3RURA 5KVEE 4GP5B 1DQML 1TJGL 3HC2A 5ESQA 3KBEA 1G7HB 1IC7L 3MLYH 3T8MA 1T21A 3X1EA 5IJVB 2XKUA 3RUGF 1UA6L 1WZKA 2OTPA 4PR5B 4N2LA 1FL3A 1LEKA 2WC7A 4X80H 1ZGLM 1HZHL 4HZLA 1L9PA 2DDQH 1KGYE 3B8SA 15C8L 4FNUA 5MHSE 4A7UA 4WW1B 5BV7L 3QXVA 2Z34A 3DTUB 5DRWA 1KEGH 1UM6L 3OTTA 5E5LA 5MEND 5C0CB 3ETSA 3QDJE 3CVIH 2I60L 3T2LA 4FQXD 1L0PA 1LMIA 4B5EA 1J05A 1I8MA 3K71A 3QWRD 1BPLB 2KQMA 4YC2C 5KSAA 4XMPH 1O7VA 1MFBL 4UZGA 2FO1A 4W9JC 3ARDB 2QPUA 4HS3B 2A9NL 3V0DA 3IJEA 1YMME 2PXYD 3LKNA 1BOGB 4PRPE 1J5HA 1SJXA 1D5MB 1QLFB 4A7GA 4K0OA 4G6FB 4ANUA 2XT1B 3WUWA 2IGTA 3NJVA 3N42F 1NJ9A 5HY9B 1WT5C 1WFNA 2E27L 4U7KA 3RB7A 5CR1A 1EEZB 1PNDA 3AS2A 4UTBA 4Y2DA 4J3SA 5HDBB 3B2MA 5D9SB 4PJ5B 2ATKA 2MJWA 3GHEH 2TSAA 5D2LA 3VFPA 3UYRL 2HG5B 1V27A 3AY4C 4JN1L 1OTSC 1SLUA 5FLUA 4P05A 1A65A 1DBMH 1CBVH 1ZHLB 3QEQA 4WI6A 4JFDD 3VU2A 4FRWA 3U30B 2YMXH 4JDZB 3MRMB 4NIYE 4JO4H 4UU9A 5IHBA 2WVUA 4KXBA 3KBFA 5DEGB 5AOKA 5ADOH 2GJPA 5LGKA 1IBGL 4HQQH 4F7EA 3CFBB 4O2FA 1WGOA 4Q9QL 4PB0H 4LLUB 3KWTA 2I27N 4UTAH 4FF9A 4FQXB 4X5XB 2AXFB 4LSDA 2VKXA 4JBSA 1KCUH 3Q3GA 5EU6E 5IJVA 4KWUA 4AL8C 1T4WA 1Z6JT 3CVHB 3FYIB 3G5VB 3TXAA 4C4KT 3GLAA 3DX3A 1IVLA 3FCBA 2DM4A 2BHUA 1DYZA 2YUWA 4JANB 5K59E 2PXYB 5HI5D 2YZ8A 3TFBA 4WW1A 1FHGA 1UENA 4CVZB 1JG9A 2ICWI 4U3SB 3LRHA 3DNKA 3B6SA 2OJ1A 3LX9A 5IKCB 4U3HA 2MPAL 4NX0A 4NQDA 2DQJL 3QFDB 3FSAA 3US9A 1JK9A 2CBPA 1EHLH 4DP1X 4H0HB 3HN8A 3KYNB 2VSMB 4XHJC 4HJUA 3BSZH 4Q9RH 4TQEL 3D30A 1HYRC 2DYPB 4HPYL 1WZMA 3K5RA 2AJUL 1WT5A 4JFDB<