5B7FA

Structure of cueo - the signal peptide was truncated by hrv3c protease
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
486
structure length
463
Chain Sequence
RPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
publication title Biochemical, spectroscopic and X-ray structural analysis of deuterated multicopper oxidase CueO prepared from a new expression construct for neutron crystallography
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
total genus 142
structure length 463
sequence length 486
ec nomenclature
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7fA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7fA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7fA03
5I28A 1I53A 3U25A 2XUWA 3AW5A 1PLBA 2UXTA 1BQ5A 4A2EA 4UF7C 1RCYA 3S3DB 1JZIA 2PP7A 5I5MA 4YVNA 2QPEB 1NDTA 3GXUB 2GSMB 4F2EA 2FWLB 1L9OA 3DTUB 5EHFA 3PAUA 3FYEB 9PCYA 1E30A 4YSCA 3FU9A 2W88A 1JZHA 1NPJA 2YAEA 1IUZA 3PLYA 4YVUA 2W8CA 5PCYA 2GIMA 4FA7B 4W9ZA 1OCRB 4M4RB 1HAUA 1XB8A 2XLLA 1EHKB 3T6WA 4PAZA 1AZCA 1KCWA 4E9XA 4HHGA 1E67A 3DKHA 5PAZA 1J9QA 3WG7B 2EILB 2VSMB 2HRHA 2YARA 2QPDB 1ASPA 3X1BA 1JOIA 2N0MA 4CSPA 1NPNA 2JKWA 2AFNA 4DPCX 4Q89A 2DY2A 5I6MA 7PCYA 3H4HA 2FQFA 3TU6A 1JZFA 1CYWA 1PCSA 1SF5A 2UX7A 1ASQA 1AIZA 3N2JA 5LDUA 3PAVA 1J5DA 1NIFA 2E86A 1GSKA 2PPEA 3TBCA 2Y69B 1OCZB 3SQRA 2VSKB 3NSCA 4A2HA 3FPXA 2HLEB 2YAQA 2CUAA 3QJTB 2WSDA 2H5UA 1BXVA 1TEFA 4P5RA 5D4IA 1NWPA 4YSRA 2XX1A 4HCGA 4A2FA 1W8EA 3V9CA 3FQYA 4WTQA 3UADA 2IWFA 1AS8A 2PPFA 3T6XA 1AZBA 3GYRA 3S3BB 3NJIA 3PCYA 4KO9A 4A67A 1MDAA 1ZV2A 5TK4A 3NJJA 3NT0A 4KNTA 1J9RA 3RYMA 3V9EA 4E9QA 5AZUA 1YLBB 2FQGA 1PNDA 5AFAA 3EHBB 2AZUA 4YSOA 1AZUA 4G7RB 4YSEA 1JVLA 2HXAA 3CG8A 4E9VA 3MBWB 3PXLA 3WKQA 1GY2A 3NJHA 3QPKA 4A2GA 2H47C 3QJSB 1PY0A 2IH9A 1E5ZA 3MX0B 4YSTA 1KDJA 1N68A 4Q8BA 2BWDA 4UAHA 5B7EA 2CCWA 3H4FA 2I7OA 2TSBA 4NERA 1NIEA 1F56A 3BVDB 2H3XC 8PAZA 1NIBA 3FQ1A 1M56B 2XV0A 3KW7A 4HZ1A 2GHZA 3GDCA 4YSSA 1M9WA 4KO5A 3L45A 2YQBA 4HCFA 2CAKA 5I6NA 4YL4A 2GB2A 5AKRA 1WA1X 1IKOP 1PF3A 3FQ2A 4W1TA 2HRGA 1DYZA 2YAFA 1GS6X 2FQDA 1JVOA 3WNIA 2WO2B 2EIJB 2LLNA 3S8FB 3EH5B 4BXSV 2VW7A 1PZCA 1NTDA 1WS8A 1PLCA 4HALA 5I5JA 2XV3A 1OOWA 1DZ0A 2P80D 3AZUA 4L0PB 2IWKA 1IBZA 2J56A 3OQRA 4GXFA 2VW6A 2IDTA 3OD3A 4DP1X 1NIAA 2EINB 4N8UA 5I6PA 4BDVA 3UAEA 5I6KA 1JXGA 4P5SA 3NJMA 1L9RA 3EF4A 3TBBA 1RKRA 3NYKA 2MTAA 1W6LA 1ZIAA 2DYSB 2XWZA 1A65A 2UXFA 3TA4D 4BDVB 3FS9A 2UX6A 4KO6A 5FC9A 4DP8X 4GYBA 1GS8A 3ABGA 1V55B 3FYIB 2IH8A 1PNCA 1MG3C 2B3IA 2ZONA 4AKQA 1CURA 1AZNA 1ASOA 1BQKA 1L9TA 1GY1A 1A8ZA 3T6VA 2Y1AA 4E9SA 4UANA 1JXDA 2FTAA 4YSDA 1E5YA 2J55A 6PAZA 1IBYA 1NWOA 2IDQA 3ASNB 2XXFA 3T6ZA 2QDWA 3FU7A 1R1CA 1B3IA 4E9WA 1SF3A 1ET7A 2CBPA 1SNRA 3FT0A 4G70B 3NJGA 1A4BA 1AS7A 3X1GA 2FT6A 2NRDA 4HAKA 3WIAA 2BP0A 4TXVB 2IAAC 2IDSA 3FU7B 3AY2A 3S8GB 4BWTA 1QLEB 2GI0A 1ID2A 2PCFA 2I7SA 2BP0B 2P80A 4A66A 4DP6X 1HFUA 3UAAA 3ZX1A 3FSWA 2A3TA 3IE9A 3ASOB 4DP4X 1OE3A 1MZZA 3ZBMA 2DWTA 3JT2A 1AQ8A 1GR7A 4KNUA 1IC0A 3CDZA 3AG3B 3IBOA 3S3CB 1JZEA 3AG1B 3CVCA 4ENZA 3IEAA 2OJ1A 1BXAA 4BK5C 3OM3B 4JKNA 1V54B 2GC4C 3D12B 2ZOOA 3CDZB 1OCOB 2JXMA 1PMYA 2HX7A 1TKWA 3G5WA 3X1FA 1TU2A 1SDDA 2XVBA 4KNSA 2VM3A 3QJQB 1CC3A 2YAOA 2CJ3A 5TK2A 4QLWA 1RZPA 1SDDB 2PCYA 1FA4A 1L9PA 2YAPA 4HCIA 3UABA 1J9SA 4AZUA 1L9QA 1AG6A 1SFHA 4YSUA 2X87A 4NB7A 1V10A 3IN2A 3NJKA 1E65A 2ZWNA 1PZAA 5A7EA 1KCBA 1OV8A 2BWIA 4A68A 1UATA 2BW4A 3OMIB 1A4CA 2UXVA 1VLXA 4GP5B 1BYOA 1FWXA 4JHVA 3N55A 4GP8B 1AR1B 1L9SA 2PP9A 1RZQA 2DWSA 2FT8A 1PAZA 4DP7X 4NAJA 3NJNA 3NSYA 4DP9X 1M57B 2QT6A 4CSZA 4GP4B 1ETJA 1KGYE 3JTBA 1AS6A 4KO7A 4F2FA 2IDFA 1GYCA 5B1JA 2BZCA 2IDUA 1ET5A 1CUOA 1KBWA 3NSFA 5F7AA 2BP8A 2FNWA 1XB3A 5B1JC 4PCYA 2PPAA 2GBAA 2WO3B 4YSAA 4BWUA 1AANA 1JZJA 2VM4A 4G7QB 2R7EB 4DPBX 1NIDA 2BP8B 1AG0A 3FSZA 4KOBA 5B1BB 4G71B 2UXGA 1KYAA 4AX3A 4RH4A 4E9RA 3BQVA 1J5CA 4G7SB 2Q9OA 3X1NA 3UGEA 1J9TA 2HZHA 3X2QB 4E9TA 5I26A 1GW0A 3EH4B 4JHUA 5B3SB 1NZRA 2BHFA 3EH3B 3FSAA 4BWWA 3DIVA 2AZAA 5IY5B 2PP8A 4A2DA 4KOCA 2BW5A 3TASA 2YXVA 3ZIYA 1OE1A 4ZK8A 5I5IA 3NP4A 1ADWA 3NSDA 3QQXA 4HHWA 3ZDWA 5D4HA 2AVFA 1JXFA 2FT7A 1BAWA 1OE2A 2XU9A 5B7MA 2XX0A 3FU8A 1JZGA 4N4YB 1X9UA 3IN0A 2ZXWB 1KBVA 1MZYA 1URIA 5B7FA 3CVDA 2XYBA 3WNJA 5I6LA 1JERA 4DP2X 3QJVB 2B08A 2MRYA 4G72B 1X9RA 3ABMB 3HEIB 3WKPA 1ET8A 2JFCA 2AANA 2OV0A 2VMJA 3SBQA 7PAZA 2PLTA 3SBPA 4YSPA 3T71A 1TEGA 4FAAB 1NICA 2EIKB 1ILSA 4X4KA 2BZ7A 4BXVA 2I85A 1KDIA 2HX8A 3ABLB 1AACA 4DP0X 1SFDA 3OMNB 4AKOA 4YSQA 3KW8A 5B1KA 4F7KA 4EF3A 3FPYA 2RACA 2TSAA 3PAZA 5E9NA 1BEXA 4DP5X 4WKXA 5ANHA 2DYRB 4DPAX 1AOZA 1EZLA 3X1EA 1AZRA 2PPDA 2DV6A 2CALA 3FSVA 2XXGA 2FQEA 2PPCA 4HIPA 1FFTB 3OMAB 2QDVA 1SHXA 1ZPUA 2J57A 1A3ZA 2HX9A 2YAMA 3CVBA 3UACA 2J5WA 1NINA 1MG2C 3WI9A 1OF0A 4M3HA 4AKPA 1WAEA 3ABKB 1AAJA 1N70A 3CZUB 2GC7C 3AG4B 1HAWA 2YAHA 5F7BA 1CYXA 3QJRB 1ZIBA 3NJFA 1WS7A 3NP3A 2Q5BA 4E9YA 1BQRA 3QJUB 4GY4A 2IWEA 1ILUA 2X88A 1ZDQA 1BXUA 1OCCB 5I6OA 5D4JA 1PZBA 5B1AB 1WA2X 3HB3B 2XV2A 2YXWA 3PPSA 1BYPA 3C75A 3H56A 1A4AA 3ERXA 4MFHA 1XB6A 4AI7A 1SHWA 1T5KA 1KV7A 1QNIA 3NJLA 2R7EA 1WA0X 1ZDSA 4QKTA 2OCCB 2BO0A 2FJSA 1GS7A 1XMEB 1QHQA 2VN3A 3AG2B 1W6WA 3SBRA 3T9WA 6PCYA 1PLAA 2VW4A 4K9JA 2EIMB 1SJMA
chains in the Genus database with same CATH superfamily
4XBPA 2YLKA 1TJGH 1KLUB 4K3GA 4P46D 3GXFA 5E0QA 4A2EA 4F3FB 3M17B 1FZJB 4GMTL 2I9LB 2A1WH 2OQJB 4I48A 4MD5B 3PIQB 3Q3GB 1NDTA 4ZPTA 5E0FA 5JA8B 3AXHA 2ZSWA 3CZGA 3MKKA 1KLFB 4NZTL 2W9EH 9PCYA 3HMXA 4WO4C 1HESA 5FOBB 4G7YH 2ICES 1C5BL 5EU5A 1WFTA 2PWEA 1JVKA 1VRSA 4LKCB 5E95B 1WBZB 4WWPA 1KOAA 4MAYB 4Z7VA 1TQVA 3QWOA 4JPKH 4PD4J 4HF5L 4LDLB 4GRWE 4XMTA 4ANWA 4HD9A 4PMEA 3U1SL 3KDMB 5KAQF 2QQNH 2JK5A 1J9QA 2NY1D 3T1WA 3KS0J 5J3HD 2Y22A 2A9ML 4QJ5B 1NPNA 4J4PC 3STBA 4Y2DD 1OP5H 2OMBA 2F5BH 3PDDA 2BSDA 1QW8A 3CU1A 4JW3A 2OJZH 5DMKB 3CIQA 3QUYD 2CLZA 5I2IA 3I9AA 3UBHA 3PAYA 4HC1H 1CL7L 2OAAA 4NWTL 3AVEA 4BM7A 4UT6A 2X1QA 1Z3GH 3H54A 2XA8L 1AE6L 1YN7A 4P46A 2VN5A 5DK0A 4ZO6A 4E2OA 4JR9H 2AW2A 3DI2B 4GRMA 4OT1L 5G2NA 4ONHA 5JHLL 4Z7NF 5JORA 4KZ0A 3JZYA 1ANUA 3QUZB 3QWNA 1S7SB 5A7BA 3D25A 3WUWA 4OU3A 4IRZH 4CVXB 4BKTC 3Q6GL 1CYGA 1WD9A 4PM1A 3WMSA 5KBDA 3X12A 3GYRA 1MCKA 1I75A 1CLVA 3GJFB 2C1OB 4N3TA 5JHBA 4QXGL 2DMKA 1NBYA 3M07A 2XJKA 4AYBA 2NLJA 3QORD 1I31A 1AXSA 4Y5XC 4KVCH 3SJVE 2WWOA 3QIBB 5GS0D 1OTSC 2A83B 3KPLA 2R1WB 4JUSA 2YD3A 3NGBC 4TSCL 3PQYB 4B9IA 4I18C 3MTRA 5DTFB 4HIEA 1IEBB 2EDDA 3QUYA 1JGLH 3MRDB 5E2UH 3DETD 3NCJH 2BWDA 2R27A 4O2CA 2XN2A 2A9NL 3TT1H 1DJGA 2R0ZL 1NUNB 3BIBX 1DBKH 1OSPH 5BS0E 4ZMVA 3PFUA 2IWGA 5GZOC 1S46A 4NBXB 2XV0A 3KWUA 1KCKA 2B8OT 1P4BL 2G0LA 3J8F7 3MNWB 4OJFH 1QBLH 3F12B 1KIPB 4R3SB 1VSCA 4B5EA 1LTXA 3E6HA 4OF7A 1T20A 2CQVA 1FZKB 5GSRA 1X5AA 3Q2VA 1LP9F 3DUSA 1OIOA 4Z95H 1AD9B 2E6PA 4M8VA 4W1TA 1FNFA 3CFDA 3KPSD 4JM2D 3VH8G 3OBAA 3AAZB 4X7FC 5IM7B 1YHPA 4GQ9H 4UQ2B 4ZRGA 4JFEB 3IDIB 3AM8A 4U0RB 3VQLA 5IJKC 1NAMB 1CFSB 4Q74A 4UDTB 2DPKA 1E3XA 1UT9A 1VFBA 4OCSL 1W9XA 4OZFB 4V2BA 2ENQA 3KL5A 3QORA 4R2GB 2FB4H 1WO2A 1IT9H 3NCYP 5ALBL 5IVXA 1M71B 3UAFA 1E6JL 3GZQA 5I6PA 2UZIH 1CD8A 1UKQA 2J8UE 5DRZA 1AHWB 3O6LL 3VX1A 5GGVL 4BDVA 3RFZC 4BK4A 4OZGF 3QUXB 3SPVB 5AW0B 4JEGB 5E4OA 5LBSH 3S36L 4BGLA 3TA4D 1DE4B 4JO1L 3V4VL 3IRZA 4DZ8B 5ETUB 1Q90A 4B3VA 3KGSA 1TFHA 3PWNB 4OLZL 4Y19B 4L4TD 2AJUH 2NNCA 3NA4A 2G9HA 2F2HA 5T5FA 3MRNA 4FFYL 4R83A 2BSED 4LE8A 4PJEF 1AZNA 2RD0A 4OCYL 4H20H 3QSKB 3OKMA 3T6VA 2FBRA 4PRPD 4XP5L 5ITBH 1UB5A 2DDQH 4NAQA 2AJVH 1B4RA 1HQ4A 3MLZH 1CFNB 5KS9B 2EVGA 2IDQA 5FPIA 3HRPA 3ZE2E 3OXSB 2EIZB 4NRXA 4QMEA 4JG1H 4HDIA 2DM7A 3LRSA 4V33A 1A1NB 3KPSA 3ZDXF 4JM2A 3BCDA 2J2ZB 5HHMB 1G0XA 2VLJB 4IKIA 3ABZA 4K4KA 2XA3A 4YIQA 3KBPA 2NQCA 4HUXB 1TCRB 2Z31D 1CS6A 2O61B 5F1IA 2XWCA 4YR6B 4HAFA 3HN8A 2DQFB 4Y16B 4NENA 2AEQH 1HHIA 1QRND 1S7UB 3BH9B 3MODH 3O3DB 4CGTA 5JW4Q 3ILDA 1KULA 3V6OA 3ZKSD 4HUVB 3NPSC 3CLEL 1LMIA 1RMFH 2OSWA 1ZHBA 1A25A 2OMTA 4BK5A 4F7MB 3NN8A 3S9DB 4J6IA 3TN0D 4ENZA 2GCYA 3GHPA 5FYJL 4ZMZA 4TVPH 1TTFA 3EJYD 3OM3B 1ZHKA 4OR1A 5D93B 5JQHC 3M1OA 2A6KB 4X98B 4BZ2H 1AQMA 3HVNA 3K71B 2X1XR 1WEJL 3E1F1 5JUEH 5F1NA 2V5MA 2Z35A 4L4TA 5CIPA 2HRLA 5LCVL 2B15A 3U48A 4MA1B 1A9VA 3ETTA 3LIZH 3FO0L 1NCAL 1KYUA 3O6KH 2BSEA 4ZQKB 1P53A 3UTTD 5EDSA 3U46B 3I74A 3HBGA 4QHPA 1SMOA 1KXHA 2JXMB 5T5NF 4MJIE 3C87A 2Q3AA 4PRPA 1QA9B 2L8AA 3RX5A 1ZT1A 5H94B 5ID1A 1FAKT 5DEGA 4OFVA 4JHZA 3RPIB 5E6ZA 1F58L 3L5WB 4IMLA 4F37K 1NC4D 3CNKA 5DRNB 3O3EB 4Y0GA 5SV3A 3VG0H 2FYYB 3VSUA 2SEBB 5IGXH 2IAMD 3BUTA 1U8MB 3UXFA 2F8VA 5EU3A 4K9EH 3VGAB 4NKQB 2P46B 3DSFH 2Z31A 3KHQA 2YEZA 1N2RB 2DJ4A 4YDJA 2HPTA 1BYOA 3PWJA 5D7HA 2VKXA 1U93A 1MXGA 5C1MB 1RZQA 4ELDA 1QRNA 3SGJA 1RIHH 1UVQB 1ETJA 3SJVD 2IDFA 2LR4A 3TN0A 4FXKB 4ZMXA 2MHAB 4JJ5B 3WFZA 2BZCA 1ET5A 4K3JL 1U6AL 3MRRB 1EJFA 4OAWA 2F8OA 4O5LH 3MV9B 3WTYA 3UBGA 3CCHA 2GBAA 2WO3B 4XZUB 3MLSH 3DX7B 2OS7A 5E8EA 4WQOA 2P9RA 1RURH 2XXCB 3UTTA 1T2JA 2HYMA 3C09B 5JW3L 4Z7WF 1GAFL 1HIML 1TCMA 3MJ7B 2RQ8A 3ZHDA 2UXGA 3BZ4B 4PJGB 1G1OA 1X3DA 5KG9A 3EH2A 1P84K 1N8ZB 3QFGA 3A5VA 2DICA 4YAQB 1JNNL 5CBEB 3L3OA 1A5FH 1X6LA 2CRYA 4JDZA 4NN6C 2HVKA 3TTSA 5I26A 2F54E 2YXFA 4UT6H 2OSYA 4Q2ZB 2IAMA 3EH3B 4HLZG 3K6SB 4UNTA 1O9WA 2EE9A 3D33A 2Q10A 5DD1L 5AALA 2YXVA 3DJZA 3QUKB 4R4ND 2NTFA 4IGBA 4N5ED 1ADWA 2G2PA 4CC4A 2A6DA 4U6XA 3GJEB 1CTMA 5J12B 4NQXB 2C9XA 5E9DB 1CDGA 4QOKD 1FV1A 1MQKL 2C7UA 1RAMA 3US9A 1JGDA 5LG1A 3C5SB 2LVEA 3O2VL 3GKZA 2X3CA 9CGTA 4JN2B 4JO3L 4N28A 4PJ8A 4ZMAT 5C6TL 3WNKA 4Z3GA 5E5UB 2Y36H 3D2TA 5C8JB 4PJAE 1O9VA 5EO0A 3C6LD 1SYSB 1SXBA 4MD4A 4Z5RA 3CFKA 1IAOB 4MDJB 1ETZB 4Z7AA 3HB3D 1W15A 3RL1B 3WKPA 3VTMA 1U8OB 1JG9A 3IJSA 5MI0C 4JREC 2O5NA 1N0LB 4S2SB 4X7TA 3OHXC 2WBKA 3KD4A 4PJ9C 5IVZA 5E7FA 1W72L 4B9FA 3EO9L 2ZUXA 4XP6H 3APMA 2BZ7A 1JNLL 4UU9B 4WFHE 3VRJB 3ZGHA 5IMLB 4C83A 4MMYA 3LSOA 1AACA 2CWRA 3U9PL 3P3RA 4X6FA 3RGVA 3OKEA 1SMDA 2JJUA 2VR9A 3F00A 3BVWA 3FB6A 4F7KA 5HDOA 5DT1H 1WAAA 5D96B 3BUDA 1A6WL 2PXYC 5HVHC 1CXEA 1MFDH 3VFRB 1A0QH 2TSAA 4I4WA 1FBIL 1PDKB 5BZWB 3B3IA 3Q48A 3MLPA 2JJTC 3HS0C 3E7JA 4X5QA 1QWHA 4HIPA 4PJBB 4A39A 2W65A 3CFEA 1JCKA 4X9HA 2I07B 3A4DA 5F9OH 1FIGL 2WHVA 3CVBA 3LS4L 4QOKA 5EIVA 5FR3A 1OF0A 5CP3A 1B4JL 1X9QA 5I0YA 3BQUD 3VM5A 4MASA 1FHNA 3GMRB 1PQZA 5JO5B 2X0WA 1CLOH 5F21B 4OQTL 2IOMA 4IOFD 1EK3A 1YMMD 4X4YB 3OB0H 4HIXL 1HAWA 1VEPA 4JZJA 3OWRA 2J8UA 3C6LA 2LFGA 2QHRH 5I8KH 2VR3A 3HE7C 1EA9C 1WFOA 2RTTA 3D5OF 4JCWA 4KJYA 4KXAA 3C5XA 1LEGA 5HYJD 4RFOL 4QD2E 2GIYA 1MJJA 3RB7A 4OD2A 5GS0H 4KWUA 1WA2X 2K1MA 2NDFA 3DVNA 2H0EA 4WY7L 2ENSA 1F97A 3JSSA 1CMOA 3VXNA 2OI9B 4YMPA 4AI7A 5E2TH 3VXQB 1MRDH 3HUJE 1T5KA 4LEOA 1XF5A 4OFYD 5K33A 4MJID 3STLB 1CI3M 1ZDSA 2GAZB 5KVFL 5JPMA 2ZPKL 2XACC 4WU5A 4IDJL 1XBRA 4GAYB 4KRPC 5T5FH 4XC3L 5I1KH 5HYIA 2WLLA 4K9JA 3AS2A 5FKAA 3GSVA 1OEZW 1WCQA 4F93B 2MCMA 1SBSL 4HT1L 3MN8A 3QEGH 3V0DA 2X9XA 1R5IB 2FCBA 2EDWA 5L2KB 2VR6A 4YS4A 4X5RA 3RWJB 4KMQA 3X11B 2D7TH 3CZFA 3L3DA 2CCVA 3N50A 1P6AB 3LEVH 4NWUH 3DX1A 1RD6A 3MZTA 3BQUA 1ZGLB 3F05A 1GC1L 4ZQTA 5F6HJ 3GSRB 1YQVL 1L5GA 1ZY9A 4Y4KA 5IG7A 1PZUB 1QZNA 4WO4B 1NPJA 2AVGA 1YMMA 4A7GA 1U2YA 2GUOA 5KANG 4TSBL 1AGEA 1J1PH 1TJGL 3TFKC 3C8KB 3I75A 3OR7B 3AUWB 4G8GB 4LSUH 1KCWA 5ADPH 3HJ0A 3KH3A 4R9HA 4DGIH 5C0BD 1D6VH 5HYJA 1U91A 3VD1A 4GW5A 3ZTCC 4D0BA 5ACLA 1HXYB 2VSMB 4UOQA 2FL5B 1H8OA 3H9SA 3TONA 4MKMA 4KHXH 1EEQA 2QQKL 4L37B 4JZOB 1KCRH 1XTMA 1S78D 2XETA 3AWFA 2UUDH 4PHXA 3QI9C 3LZFL 1I1FB 3FDWA 2QV2A 2VUOA 4OFYA 2ZYHA 4MJIA 1RUPH 2GJPA 3HE6D 5IHUH 1LO3L 4BKLA 2HUHA 2YUZA 4ATTA 2ADFH 3G9VA 3VSTA 2LQRA 4N5UA 4ZFZB 3FUMA 3S97C 2FJGA 3RNKA 3UYOD 2YD2A 4Z7NB 2NY0D 4RFNC 4U3SA 1DDTA 3ARED 3SQRA 3WOVA 2PTUA 4Q9QH 3QK0A 2YRZA 4PGBB 3DOSB 2FSEB 4QAMB 2QBWA 1BVKA 4QY8B 4I9WE 3ECQA 1HYRC 3T65B 5D7LB 2TRYA 4QHLA 5EO1B 1LO2L 3OAYK 4NQDB 4EIZC 5AZ2H 4HEPG 3ZRSA 1R3IH 2YIHA 1WBXA 3ZSTA 3QDMB 4R7XA 4MX7A 4NYLB 4YBQC 3A67H 4NJAH 3ARXA 1RJZA 5C7XL 1NEZG 3MLUH 5D2LA 3U0PA 1WG3A 5IV2B 2FZ3B 3ARSA 3T6XA 3N91A 1FUNA 1Z3GL 5LNGA 4CW1A 4DUVA 1NGYB 1MJUL 5A40E 3O11A 2FAUA 3GHBH 2LU7A 1Z9LA 4P2OD 3ARDD 5CJ8A 5DS1A 4JR9L 2QQLL 3WS3B 3RYMA 4AUUA 5C0BA 1YYML 3PNRB 4PREB 1ZA3A 2H9GB 1EH9A 4RZCB 1U8IB 2OR9L 4WV1A 3Q0HA 4Y5XB 1LE5A 1XGPB 3VVVA 4XNUH 3GSWA 3NGBB 4NO0B 4HHAB 4QRBA 1GHFH 3B56A 4WFHD 4I18B 3HE6A 1Y0LA 2CLRB 3EGDB 3HFFA 2A9DA 4R4BB 1KYOK 3PWVB 2G3ZA 4L1DA 4NQUA 4TL5A 5KVEH 1CFBA 3NQIA 3BZDA 2EDNA 4YHKH 3TA3D 4UAHA 5CR1A 4P57B 4FDWA 3AREA 1F56A 4B9KC 4KTYA 3MRMA 3I02B 3LPFA 2HT3D 4IU3A 1CXKA 2IG2L 2R9HD 3QQ4A 4M29A 4HZ1A 1LP9B 1FLTX 2Y07H 4ALAH 2F68X 3ROLA 3MBED 1FNSH 4UOW1 5LKNA 3GRGA 1OAQH 4I0CC 1A4JA 4OFPA 4ABWA 1EHAA 1U8CB 3TYGL 4NO3B 3MLTA 1CDUA 1CU4L 5GGRA 5TF1H 2HJFB 2Y0SA 1IGCL 4QRUB 5DI8B 3M88A 3CFTA 1EZVY 3NCJL 3FQRA 3MUZ1 4FQQB 4FHJA 2FQDA 1P7QB 3WNIA 1F6LL 1VENA 2VQUA 3CZNA 3TT1L 4F9LA 5D55A 5HI4C 1IC7L 3V8OA 5L8JB 1OSPL 3AROA 2YK1H 3BW9A 4OUUA 4LCYB 4FJ6A 1IKNC 2E7LC 5HJBA 2FX8L 3ARDA 1WP6A 3LOWA 7TAAA 2MPAH 3OJ2C 2W92A 1OOWA 3ZO0A 5CJXA 4OJFL 4OZGB 4DTGL 4YHNA 2H6PA 4LGPB 1ES0B 1H6TA 4L3ED 1EFXB 2VERA 3AQXA 4U49A 3WEBA 1E5AA 3FHEA 1LEIA 2ROXA 5A2CA 4U4BA 5D1QA 1G7MA 3RFZB 3HLAA 4MJ6A 5C0CD 4PJEB 2VXVL 3B3BA 2UYLA 3TA3A 3H3PL 1FVEA 2P47B 3LKSA 4PGZA 3SY0B 3ULVE 3O3UN 2IH8A 1KYFA 3JWOL 1IT9L 3GMMB 2GPZA 4NC1E 5FWRA 4O58H 5IKCB 1IMHC 3T2QA 4YWGL 1U9KA 5DUMH 3MBEA 3L3IB 4Y5YA 4JQIA 3ZDXB 2ZWZA 3ML8A 1EERB 5I8OL 3PS6A 3T6ZA 4LPVA 4B9CA 3WEMA 1LILA 3X1GA 5FECB 4UOZA 2GTZB 2AJUL 4B6ZA 4ODHL 4NO5A 2IDSA 3CN1A 3BPCB 3DHUA 1BOYA 1FNHA 4Q0XH 4ZAKC 3RJQB 2APSA 4AV0A 5HHQA 2CR0A 4YNYA 1XGRB 4XAKE 3WFHB 5KBNC 3EUUA 2OX5B 3SZKC 4K23L 2WKLA 3CIAA 5JW4M 1BLIA 3D9AL 5CP3H 4N86A 5CLWA 2VMDA 3T2NH 4BE5A 1BEYH 1AQ8A 4L3EA 2W91A 1BAFL 4MCZA 5JNYB 1YEGH 3NPSB 4LRNH 3HMWL 1S9XA 1KGIA 2HWZH 5LDSA 1ZTXL 3OB8A 5C0CA 1V54B 1F6AA 4G8IA 1OCOB 3PGFH 4XCNA 3IJEA 3TNNB 4NOBA 1NCBL 1AP2B 1SDDA 1UZ8A 2BRRH 4CVZB 4OFKA 2W07B 4Z78B 2FJFA 2XY2A 5DQJB 2AQTA 4LSVL 4HIIB 5IT2L 4ZD3L 3VGEA 3TNMA 4HGMA 3QJFB 4NRYB 5TPWL 2WQWA 4HSCX 1DQMH 4F15C 5BO1H 5DZAA 2GT9B 3PUCA 4HJEA 4F7CB 1AG6A 1KJ2B 2EEBA 5DRWA 1S5HB 1E27B 4PJFF 4FNSA 4C56E 2C3HA 3FU0A 4CNIA 4CU8A 3DGGB 4X83A 3O6KL 1KB5B 4IEFB 4HS8L 5ESQB 3AMLA 1FE8L 4WGKA 1BF8A 1AR1C 4PJCE 2NY2D 3ECVA 5FDWB 1AGDB 2WINA 2YGPA 4LFHG 5E00A 1MJ8L 4UYQA 4JO4H 1CVRA 1M57B 2QT6A 4HW6A 4Z7UF 1AGFA 1CZ8H 5D4QA 1QKZH 4B41A 4QHUA 2WSPA 5JOPE 3FUEA 5B1JA 1LK2B 2AV1B 4U1IB 2HMIC 1IGJA 1EEUA 3RVXD 5LAXB 5FF6A 4WU7A 4EKJA 3BP5B 4Z7WB 1EAPB 4FS0A 1DVXA 4PCYA 3FQUB 5DJ8B 2GSIB 3VD0A 4QGTA 5GHWL 1AO7E 1JZ3A 3IETA 3UMNA 1KTLB 2F18A 1QHOA 5D5MF 3IVKB 2QADD 5DJ6B 4NQSB 4GBXD 3QA3B 1PZDA 4GKNA 4G9DB 1NFAA 3JV6B 2CBMA 2XRAL 4LLQB 3KJ4C 2YD5A 2OMVA 5DCCA 1T4KA 4HIJB 4L4VB 3PWPD 4LLDA 3R06A 5TE6H 2VDQH 4D0DB 3VQMA 1M7IB 5F96H 4JHUA 4XP1H 5T33H 3FC8A 1PGRB 1BREA 4NN6B 4QHNA 3V4UL 2X6MA 3FTUA 4XNQB 3V55A 2H0FA 4JM4L 1WC7A 5DFVD 2WXMA 3ZE0F 4KU1A 4L8BA 1AFVL 3PF2A 1BCIA 2D2CC 2VZSA 4B53A 4YEFA 4OVVA 4AQEA 2QZ5A 3BWAB 2WWMD 5C09E 5AB2A 1U42A 1JXFA 5BMFH 4RRPA 1OE2A 1L7IL 4EZJA 4Z7OF 5E7BA 3IN0A 1ND0B 2YGQA 3LKOA 4AYEC 1S3KH 3K4AA 4YLBA 5J6GA 2FEEL 3WHE1 5CD5C 2LU4A 3VGBA 1TTBA 2Y4SA 3GPSA 3GZPA 5DK2A 3CFBA 1DEDA 1DQJB 2PCPA 3W5MA 3DYPA 1IGYB 5FO8B 4D7BA 2VSDA 5HYQB 1OGPA 3JWNH 1NFDF 1FNEA 5DD3L 4XHQA 2AXFB 3LZRA 3QJOA 3CZEA 1ET8A 4UTAA 5K93A 4WO0A 4K3DL 2NYYC 4RQQB 1PIFA 3RP1A 5MI0B 3RUGF 4WHTA 1J8KA 3TWYA 3H7BA 1QBMH 3ULUL 3FCBA 3OKLB 3OHXB 3L95B 4GBXA 3D07A 4PJ9B 5EC1B 4KK9D 3EO0B 4CJ0A 3ULVD 3N40P 2I85A 3ES6A 1KDIA 1KPVA 4HPOL 4HKZB 5EZPA 2I9TA 3MROB 4TS6A 1T04B 3QWRD 3OTTA 3PG2A 1HWWA 3EUDA 3PWPA 3IMSA 5DD0H 3VYNA 1G4RA 4KKZA 1J0HA 3FFOA 3WSQL 4RA0C 4IK6A 1ZLVH 1CLCA 4BSVB 3UTQA 1U58B 2HG0A 5KJRL 4WHDA 3G5ZB 4TNGA 5SWSE 2RACA 5ITFA 1A4KB 1I3RB 2PXYB 4DP5X 4G5ZH 4MA8L 4ZOEA 4AL8C 4Z3HA 2I32A 1DVFC 3F65A 2PPDA 1NCUA 1XGZA 3RU8H 4XPGH 2F7QA 4G1EB 3DXAE 4XP6L 1FFTB 3HS0B 2XTJE 3LRGA 4XX5A 2DYPB 2VXSL 1TJHH 1MG2C 1H3UA 3QG7H 4NQVB 4W4OC 5CUSL 3ZGIA 4AG4H 2CIIB 4FP8L 4Q6YA 3R19A 2DEWX 3OV6A 3WNPA 3BLPX 1D5BB 1JFQH 5EZOL 2M1KA 5K39B 2X4QA 5C0FB 1A0QL 3GXIA 3MNZA 4JRYD 4TYUA 5CBAA 3KHOA 2BDNH 2JLLA 3AADB 3EBGA 5IBUB 3HE7B 1UM4H 4AV5A 3QCVH 1ZEAL 1X5LA 1ZTXE 4POZD 4AEEA 4TQ8A 4M61A 4KQ3L 5F9OL 1OAYL 2PKDA 5LXGH 1W0VA 2GVYA 3WN5C 1T66D 4NO2A 3FT3B 1WFMA 1CGSH 4JN1H 3QZPA 3VRIB 4LSQH 1CLOL 3HW7A 1KGCE 4JL2A 3QWRA 1N12A 2EO1A 4PW3A 3KBFA 1O6SA 2ICWB 3REVB 1QYGH 4Y2LA 5FM5O 1O75A 3T9WA 3EXLA 4XOAA 2VXQL 4Q7DA 1OWRM 4HV8A 3GSNB 5EU6B 4PVMA 4FZEL 4ANKA 2J4WH 4KRPB 4PJ7E 5C9KA 4G6AC 4UIMB 1ZVNA 4C56D 1SJVA 2JJSA 3DX9B 4ZMYA 2B1HH 4OLYH 4LCUA 3GMLA 1S7XB 4JQIH 4PJIE 1Q94A 1TZAA 1D5XB 5E2TL 5FYLL 1JUFB 4K7FB 3FO1A 5EHFA 4WGVB 3PAUA 3ARPA 1Q4NX 2VDMH 3ROOA 3LKRA 1QLEH 2JCCA 4UQ3B 2D9QB 1C5CH 2ICEA 5PCYA 2YAEA 4FULA 4BQCA 3QPXH 4WAFA 2G5UA 1NDMB 2Y25A 5HGBA 4JRYA 2G60H 4KK5C 4PVNA 1AVAA 4FKKA 4LNVA 2BY0A 5JOPD 4WJG3 3QIUA 2V7NB 3JTTA 4PJHE 3TH4T 5T1MA 2DAVA 3MSPA 1DFBH 2NSQA 3BUPA 4MNQD 1YRKA 1GCYA 1F4AA 3KVDD 1A9EA 4YHYC 1AO7D 1VGEL 1IM3B 1QATA 2XWJA 3RHWK 2WXHA 5AKVA 1JDDA 4HH9B 1ONQB 1NAKH 3QI9B 3EFDL 2NCMA 3L4WA 4RNRA 2A7BA 1BHGA 2VDNL 2CGRH 5IR1A 3W11C 4LSUL 5J6SA 3KXFD 4HD5A 4PRIE 1HSBA 3MTXA 3W2DH 1LO4H 2R69A 2BNQB 3BSZA 3S5LG 3WFDL 4RFNB 1CTOA 1R75A 4C56A 5SX5K 4YQXH 1GSMA 3QJTB 4NQCB 4YFLI 3ZY7A 4FMVA 1JPFB 4LDCA 4WI0B 2FO4B 3MUUA 1U92A 4ESKA 4OUOA 4R96B 3STZA 2Q7NA 4MNGB 4PJCA 4F8PA 5CEYB 2NUPA 4ZNEE 1RUPL 5DLML 3V7AG 1DUZA 1GIGH 3S35X 4LLVA 5ACZA 4BH8A 3QQ9C 2PPFA 4J3SA 4DT2A 4K5PA 5GRZA 4LCWD 1T1YA 3LB6C 4I3GA 3WYRA 3GO1H 3A4AA 1HH9A 5F0MB 1KPUA 4UYPA 5C0EA 2UWEE 1MUJA 3BPNC 4AQAB 1ZMYA 4E9QA 1QSFE 4N0UE 5AZUA 5G5DB 3D05A 2G3NA 5AFAA 2R23B 4IHOA 4W6YB 2CUHA 4MNQA 1R3HA 4N1HB 1AO7A 4NJAL 5AVYB 1RERA 3EFOB 1R3LA 1OANA 1LL1A 3QPKA 3ULUE 2ZSVA 5CKGA 3QJSB 2JH2A 2VITB 3RZWA 5DJZB 4M9PA 3GHBL 3TIDA 4B9YA 3KXFA 5K59E 2ZXAA 3D52A 4MLIA 5KYNA 4G80A 4QRPD 4B50A 3DRTA 4WJ5B 5E8PA 1KBGL 1RVFH 4E42A 3QARA 3L1OH 4RGOH 4G5AA 5SWSD 1BFOB 4PWKA 1UQSA 5AW9B 4G8EA 2GYSA 2ATAA 3FOMB 5HHNA 3A22A 5CINH 4EKXA 3JWDH 1TYEB 2OMXA 3DXAD 4ZYKA 4HCFA 2HKAA 1OT4A 4GRLC 3BX7C 2XTJD 5EOCH 4G9FE 3S96B 2N4IA 1RZKL 3AT9A 3WD5L 3K0WA 4MJ5A 1M2VB 5KVEL 4YHKL 1MEXL 2YAFA 5JYLA 3TWCL 1JE6A 4NPJA 1ZWIA 2BJML 4ZSOE 4HWUA 4LCWA 4URKA 4UDUB 4FMKA 4E41D 1DQQB 4AE0A 2AK4E 2ATPA 3QZWG 2AMUA 4HXAL 3VGFA 4WVRA 3L8QA 4W9IC 4OD1H 1HE7A 3VDCA 3AZUA 3CSFA 5DC2A 4PB9H 5I8EB 1VB9A 3BWZA 2FJHB 3B2VH 1MI5B 4HJ0C 3SPCA 4G42B 4EIUA 2D7PA 3CVHH 3LCYA 4JFSA 5I15L 1LEKA 1YMHB 2FR4B 1F90L 1K6QL 2R2CA 2VUYA 2Z65C 2NNAB 1HCFX 2EDQA 4DN3L 2NPLX 3TIEA 1E7UA 3ARGC 3LKPA 2UXFA 3U6XA 2YRBA 2ZAIA 1T22A 4WUUD 4WTXA 4UTAH 3QDAA 2P5EB 3DECA 2YK1L 5IFHH 3ABGA 1UG9A 2MPAL 3LXBA 3SQOL 4JY4A 2K9FB 2EDKA 4QRPA 1L0YA 3P0VH 1X5FA 4L1HA 3Q06A 3P9LB 1A7OH 3RG1C 5SWSA 3FTVA 2C3VB 4G6FD 1AKJB 3VYPA 3E3QE 4HMDA 3IFPB 4NLHA 2ADIA 2J3SA 3DXAA 3V5HA 3LXAA 3F7YB 4XN4A 4MXWL 1UTDA 5AWNH 3T2OA 2Y7QB 1EQWA 1HDMB 3WNMA 5FYLE 4OCLC 4XMPL 5C0AA 5AOLA 3D1MC 1TTUA 2IAAC 4H8VA 3QQ3B 4E41A 4ZMTA 5LLIC 1IB5A 4J28A 1QWNA 4K2UL 4ZAKB 5BRPA 3WCYA 5I5RA 4O58L 1OAUL 3T8VA 1QEWB 5CP7B 4TNFA 2WXKA 3O45B 3QEHB 1TZHB 4M7ZC 4H8WH 3KLLA 2ROYA 5AW3B 3T0EC 2ZOUA 1KC5L 3U9WA 3BFWA 3AG3B 3OLGA 3RWIA 5IHHA 3UJIH 4MHHI 1CFMA 1JGUH 1UACL 2ZYRA 1XCWA 1N59B 1IKFH 1Z5LB 1TYJA 2BERA 3I9PA 4P5KB 3RTQA 1Z1WA 1P6FA 3HG1B 4I0PD 4Q58C 2E27H 2GC4C 4YPGB 4WUUA 5AEAA 3H6AA 3S7GA 3QUMB 4ANUA 2G75A 3FBKA 3LKNA 4TLTA 1FZMB 1ZLUH 4Y5VC 1PFCA 2H1LM 4FG6D 3FUNA 2Z8RA 3FKUS 3MYZA 3KPNB 2DZEA 2OXGA 5DJCB 2VM3A 2Q6WB 1OGAD 1E8YA 4PRID 3VXPA 5D7IE 4GFXA 4Y7OC 4PJ7A 2EZ0D 3L5IA 1DCEA 4I2XB 5JMOC 3UTOA 1X5JA 4PJFB 3FQWB 3OLIA 1CN4A 2NR6C 2HWZL 5FYKD 5J1TC 1J9SA 2BFGA 4WI9A 3C5JB 4LB8A 1DCLA 4IBUA 1DVZA 1WTLA 5DR5L 1XXDC 3HAEA 3FO9B 3UG5A 4P8QA 2VLMD 1IVTA 3BEWA 3QDGE 4GUCA 3R1GH 1PFOA 2RCSH 2WWKO 2R29L 1DO5A 4FFZH 1G9NH 1KIUA 3B2XA 4JFQA 5E9AA 3ZU8A 2BRRL 4HUWA 4ADJA 4E5XA 2WUBH 3CFUA 1RPUA 5F7DB 4Z7UB 2JNZA 3DHMA 1EXUA 4F9PA 4UTBA 1AR1B 3CXDL 4MYWB 1YEHH 3EJZC 4FQ1H 2DWSA 5BRZE 2BNUA 3QO0B 1QSFD 3NJNA 5BO1L 4PRDB 3NZ8A 3ZQ9A 3WNOA 2OFQA 1MIMH 2O1AA 3TV3L 1PYWB 5KJ7E 2PUQT 4UILH 2AQ3A 3D2UB 4OB5L 3RZCC 2H6OA 2R4SH 4MTMA 3LNDA 1Q9LB 5HSFA 4OW6A 5D5MB 4X6BA 2VMEA 3JWNG 2Z91A 4I0PA 4PG2A 1FFOB 2XPYA 5E6IC 3L5XH 1XB3A 3SE9L 3C5ZC 1NBCA 4R7VA 3HG5A 3T2LA 4HZLA 3V6ZA 3MFFA 1MFEL 1RLBA 2VLKB 2W9DH 1LD9B 1WQVT 2ZOLB 5DVOA 3WKYA 4FLSA 5J9PA 1OGAA 4PRIA 1BW8A 3FSZA 3WEXA 2PTVA 5EZLA 2D0FA 4JO4L 1KYAA 4P3CH 3ZTJG 4RFEB 3SDXB 2V6HA 3PWUA 4J3OC 1J5CA 3ZE0B 2XNAB 3KJ4B 5HI3D 3EYFA 3FCSA 5G4NA 4JBSA 2XVGA 3F5WA 1G6RL 4I1NB 3SDCA 3UH8A 1ACCA 2GKIA 5IY5B 3BSZH 4G9FD 1CXLA 4KOCA 4NFDA 3K2UL 5EG6C 4J3OF 4ZK8A 2XCMC 4LGSB 1JRHI 2C4FU 3BYTA 4LLUB 2BMKB 5CU5A 1UXSA 3FO2B 5ECJE 2H45A 3SDAD 2AJZB 3CTTA 5DU7A 4YXLH 4YXHH 3U7WL 1NFDB 3VFUA 3HZKA 4ERSL 1QSFA 1T1XA 5ALCL 4RBPK 2VDQL 4AWJC 1OCWH 1CICD 5T33L 3PGCB 4PWFA 2EXWC 3CFQA 4Y4FC 5I6LA 1B9ZA 5ISZE 5BUAA 2JI2A 3RUGB 2ARJQ 5T3XL 1I3GL 3V7AE 4AT6B 4HIHB 4CU6A 4N8VG 1MAJA 3RWEB 3FN0H 1AYOA 5F7EH 7PAZA 2EDTA 4QUOA 1QO3B 5IW1A 1GZHC 2VL5B 1FPTL 3GRWA 3JYBA 3KPOB 4AGOA 1F8TH 4M4PA 5JDJA 2Q2LA 3CUPB 4KKLD 4ZUUB 3ME0B 1T0OA 4CMMA 5LQBL 3U2IA 4X99B 3P73B 5IIEA 1WWBX 3P4OB 2YEVB 3BOVA 1G7JA 3DV4B 4KROC 3C2SA 2YSSB 1I4FA 1H3TA 3MRIB 5GXBB 4YDLC 3UJJL 2AAAA 5L9DH 3TYFB 1I8LA 3PY9A 5IHLB 2IV9A 4TUOB 2MCPL 1NJ9B 4IRJC 5BNXD 3TL5A 2E8ZA 2AEIT 5JIPA 2L4OA 4PJ5E 4JG0H 3G5XA 4DPAX 5LGKA 3WXWH 4JY5H 2XG5B 1DVFB 1RK0B 1E3FA 4GUPA 3VH8B 3SDAA 3EFFB 2XG4A 3RY5A 4UM9B 3WTTA 1RHHA 1YCSA 3BVXA 1NDGB 2BVOA 3I6KA 2V3EA 3AXIA 4YDKH 1JWSB 1OTTD 1YN6B 5DD0L 1CICA 3CZUB 4TNWF 3U4BH 3OAZK 4UUJA 1B0IA 1J8RA 5HDQH 3ET9F 5KBKA 1BG9A 4JKPH 3FZUC 2CO2A 3PYCA 1W2KT 1BQRA 2Q76B 2QGEA 3RU8L 4IDLA 3D39B 1CBVH 2QZQA 4DPRA 5IK3B 3FQXB 4U1JA 1TJHL 2HN7A 1JZ4A 1AGCB 4R5XA 4I89A 4MFHA 5D1XE 2V8LA 1U8QB 2ZKYA 2VXQA 1F1AA 4GJTB 2FJSA 3KVPA 1VZGA 3U0TA 2DI9A 4I3SL 3FH5A 4A55A 4HHGA 4PJXF 4AH2A 1RIUH 1DN2A 3AACA 3ARBC 4XC1H 2IFFH 4U1NB 2AGJH 3B2DC 2P5WE 4GSXA 1BZ9B 1CCZA 2COQA 5I5MA 4K9EC 5IHZB 3IWVA 3IXAA 2ITDA 2D3NA 2NZ9D 1IFGA 4A2LA 3CLFH 3UBXI 3TO2B 3MXVL 5IFJB 4Y7MA 3LKQB 4ONGH 3RJDA 4LESA 5EPMA 5MHSD 3ILQD 3RPBA 2BOLA 4ODBD 4O02A 5EN2B 4XVOA 6FABL 3EOBA 1ZVSB 4RWYL 4JNXA 4UWQB 4AENA 4OLYL 4S1RH 1KBBA 1TIUA 1QTPA 2D8KA 2Z8SA 3AJ7A 1UXMA 3DHJA 2W0PA 4WI8A 1D3CA 2G3XA 2HA1A 3SKJL 3UYPA 4B96A 2WIMA 2PABA 5IOPB 2LLGA 3F7RA 4H1LG 1KJ3L 4KTDH 2B20A 4YHYB 4A1RA 4L23A 2DB8A 1C5CL 3C12A 3RKDD 4Z7VF 4MGXA 3V0VB 3QCUL 1FYTB 2WTRB 4H25B 1JZFA 3K72B 3PWLA 1VKXA 3SDDB 2NX5B 2AQNA 1RUQL 1JZ6A 4IBSA 2NY7L 4JFVA 4JQXA 3RA7L 4ZW3A 2D0HA 1AY1L 4J2XA 4X0KB 1DFBL 2RHEA 5SX4I 4P46C 1TEFA 1B6UA 3VXRB 5F72S 1FP5A 2JWYA 1F11B 1DJXA 3IWUA 4LPYA 5EIIB 5LNDA 3P3UA 4HWZB 4U1MB 1VADB 1X7TA 3B9KD 4K8RD 4TSAH 4Y8AA 3BP4A 4UNUA 1FFNA 1QLRB 1MFCL 2VDRH 3IS1X 3NJIA 3P4NA 3PJSA 3BPLC 5TK4A 2NYZA 4RRPG 1QR1A 4O4YH 4KQ4L 4UTBH 3TZVD 1XSIA 1VF5C 4FNRA 5JHDB 2WK2A 5DJ0B 3MBWA 3BPNB 3OGCA 5T3XE 4KXCA 2Z1PA 1IFHH 2AJYL 4I5BA 2GK0A 4NX0A 3O2DL 4NSKA 1ZKAA 4TVUA 4LKXB 3AMKA 5MENE 2NY1C 2VLLA 5FUCC 3N5AA 2JKRM 2QL1A 4XWGH 5J3HC 3PXLA 1UGKA 4UQBA 2DQCL 4K0OA 3SO5A 1NLDH 4NRZB 3GSQA 5INCB 2XZQL 4NZRL 1E5ZA 4YSTA 1OHQA 2LU5A 3CPLA 2HG5B 3QUYC 1GGUA 3ATAA 4S0SD 1CDIA 2DQEH 4BA8A 2X4NA 2IIJA 4LF3A 2WLIB 4LU5H 5T8IA 4HPYH 3VU1A 1C5DA 1ZT7B 4XZ4A 2J7LA 4IOIA 1IC5L 1L0PA 5FYKH 3FUDA 4FTVB 1U8LA 1VFMA 2O26U 3HI5L 1QTSA 4L9LA 5EV7A 4PJDE 4J12A 4N0RA 1WK0A 4GRLB 4FQJL 4GMSH 3OKOA 1DYZA 3B9KA 3LQZB 3GSUA 3O3AA 3F58H 4JFPB 1O7SA 5T1LD 2X2HA 5JOEA 3P02A 1PLCA 2K6YA 4ETQA 3L1OL 5TF0A 5E94A 2X6VA 3TZVA 3ATBA 4MJ4A 2P80D 5BQ7B 2R2HB 4K7PL 3AM8C 1EMTH 2XZZA 4JFOA 2NW3B 5CCGE 1DBAL 3JWDL 3FUFA 4XN9A 3QORC 3ZDYF 2QKIA 2YRPA 3M86A 4HOZA 5GS0C 2CA3A 5F70A 1DUYA 1WCBA 2R2EA 1QPKA 1OF2B 2H0JA 3ARGB 4ZUSA 4XCEA 5EOTA 3PHAA 1KCUL 3NK3A 2COVD 2H8PB 3SE3A 5K9KA 4MVBC 4NPYB 3GRWH 5IVXF 3BZFB 1EEYA 3DETC 5AB1A 1CURA 3LZOA 1ZS8B 4ZPVB 1E5CA 4IKKA 3H2QA 4JFWA 5JPNA 4FQCH 4JPVH 3VI4E 1F45A 2V2XB 1JHTB 1K8IB 3EZJB 1R24B 1WV7T 2P5WD 4UT7L 5J1AA 5M95B 1NWOA 1WD8A 3BXNB 4ENED 5FGBA 3FUKA 5FWQA 3PJLA 3BUIA 1ET7A 3RWCA 1X5YA 2D0GA 2FT6A 3FSOA 3H53A 4XHJD 5DFAA 4EDXB 5CJQH 2BP0A 2Y2YA 4TXVB 5T1LA 4K3EH 2H3NB 3IU4H 4JM2C 2ESVD 3P0VL 3DPBA 1HXMA 2O6EA 3ATDA 3GGWA 3T77A 4DEPC 2ZUYA 2P80A 1JXKA 1J8HB 4KY1L 3FSWA 4GKZB 5FCUL 1D7BA 4M7ZB 4P59H 5EBWB 3MV7E 3FCTA 3CBJB 4WK4B 5AWNL 5JLZB 4JM2F 1FVDB 2IBZY 3T0EB 3IF1B 1SVZA 3OGOE 3V6OC 4ZX3A 3GMOA 4EUPA 1VAHA 3N1GC 2HLAB 3KWVA 5HHOE 3VNZA 4BK5C 1CG9B 5KN5A 1YUHB 4L05A 4NT6A 2GJ6B 4UMGA 3HZYB 5EC2A 1GGIH 5FGCB 4WJKB 4P4KA 2V17L 5FO9B 3HCVB 1YQ2A 3WLBA 3KR3H 4Y5VB 4CC0A 4M43H 5SV4A 5F1OB 2GI7A 4AMKH 4XT1C 4ZS7L 2GEEA 5AVWB 2P5WA 1AIFB 3L7FA 4NQQA 4TUKH 3UJIL 4OLVH 3Q1EA 4PBXA 3GBMH 1KNOA 3O8XD 1F86A 3MOAH 5GGQH 4PGJA 4NKIH 4XNYH 4NM8L 4WSGA 1NCCH 1JPGB 4YX2H 4BHUI 2ZAGA 1NAMH 4JLRA 1DSFH 4PGEA 4OZFH 5ANME 1FG2B 3NIDF 2MCG1 1SLVA 2BW4A 1A4CA 4F15B 1JCVA 2ESVA 4JX0A 2PN5A 3L48A 4KKRA 2CO1A 2Z31C 3ZTNL 5HI5D 4LLWA 3HZMB 4HKJA 3D3VB 5CJ5A 2D31B 2EJ1A 4WWOA 3GBLA 2IANB 3KPQA 4MJ2A 2EDHA 3NSYA 4WI4A 4LSPH 1FN4B 1LNUA 5T3XD 3VXTB 3BAXA 3NACH 1VEMA 1RH8A 3SGJC 2BP5M 4PW9A 1MCJA 2YGVA 5F7NC 2IDUA 5MEND 3RZCB 3QR0A 1T7YA 4FFZL 4WHYH 3VNYA 1FDLH 3TN0C 4HS3B 1QSEE 1PZ5A 2WUBL 4ORZC 3C6SA 3EJYC 5E6IB 5L4IA 3L08A 3CLWA 2VAJA 3IMUA 1QEXA 3VX0A 3IFOA 2X4RA 4H0GA 5DMGD 2YGOA 1YEHL 4ZUVB 2BP8B 4FQ1L 4RAHA 3HHSA 1L0QA 3P4MA 4HWBL 5DURD 4YHLL 1MIML 4F7EA 1DLHB 4Y8DC 1G6RA 2P3YA 4HKXB 4H0HB 2R4SL 1QMUA 2VABB 4N1EA 5HGGS 4ALAC 5D9SB 2BOBA 3EYUH 3VFVB 1TITA 2Y6TE 5B3SB 3L3OC 3DIVA 4KTGA 2AZAA 1F3RB 2Q87A 4LOUD 3VXUB 2VUKA 2W9DL 2IAMC 1OE1A 4AUYA 3U30C 1J1OH 2GK2A 2ZXCA 4FHBD 1NEZB 3WLWD 2CMRH 4OCRH 1BZOA 4IGBC 2ENYA 4N3UA 3I2CH 2F53E 2CHXA 4CC4C 3ARTA 1FL3B 1KTCA 3GZKA 4OCMC 5T1DH 1KJMA 3LV3B 5C70A 4PTUA 4U3CA 1WHPA 5E5MB 3UEZA 3K46A 4FQXD 4MSWA 3B34A 2B3RA 3BKML 2XWTA 4Y4FB 5MENA 4NN7B 4FI8A 4PJ8C 2MRYA 2FO1A 4G72B 4GUOA 3FTZA 1X9RA 2WVVA 3EOYG 3S35L 1BVNT 2UY7A 1YEFL 4GI9A 5CCKH 3ZE1E 1C08B 3SBPA 4U6YA 4JRXA 3V8CA 2X0UA 5GZND 3BGMA 1Z9OA 3EYOB 4EZLA 4YXHL 4IJTA 4YXLL 1E9QA 4R26H 2MTPA 2ZP0T 1KN4H 3PGDB 4X4KA 4Q4EA 1SYVA 3RQ3A 5EF1A 3I50L 3F85A 1E2VA 2TAAA 2YD9A 2IVFC 4XX1E 2JKXA 4IBYA 2I60H 4NZJA 1ZD6A 3KGUA 1A47A 4X5XA 2XZCL 3BIAX 4KROB 1VERA 3LZPA 3VXOA 3UZQB 3KW8A 3MA7B 5E1HB 3DMMD 2Q7YB 2YBGA 3RGVC 3V0WL 5I30H 3FPYA 4YDLB 1T6VN 2RA1A 1QUNA 2YA1A 4CBZA 5LJYH 1XZWA 3TBSB 1N5AB 3I9IA 4PJDA 3CSYB 2WP3O 4GAFB 3WY1A 1TVBB 4B0MM 5LVEA 2LTQC 2F58H 1OGTA 4IRJB 4UQAA 4G6JH 1HI6B 1TPXC 3MREA 2CALA 3BT2L 4YL9A 2HFTA 2D03H 2LLLA 3R4DA 4BH7B 4R4NC 4N5EC 2J57A 4YBHA 5L4MA 1FGNH 1XF3B 3EGXA 1WAAF 2J1ZA 1QFUH 4JDVA 5CILL 4K8RH 2ITCB 1N70A 2DBJA 2X4UB 5L9DL 3V5KA 5BJTB 3AG4B 4FQXA 3VI3E 1CYXA 4YGVA 1IAKA 4MCYB 3RIFK 5KYWB 1NC2A 1Q9KA 4QRQB 4JFDE 5EUOE 1I85A 3QZMA 4G3YH 2B2XL 2Q3XA 1A7RL 1AC0A 2YKKA 4JZJC 4Q9BA 2J1WA 3C6LC 4GY4A 1YEJL 2N56A 1QLFB 1MW3A 1JS4A 3N0PB 3HB3C 3S5ZA 5GZNA 1CFTB 2K6ZA 4ZDHB 1CQKA 2O30A 3NEEA 4WK2B 2HB0A 4AGNA 1PL3A 4IRSD 2N7BA 4UQ9A 4M1DL 4X4XA 3EZ8A 4OIAA 1JXJA 2J8UF 2WC7A 3MGOA 4PJXB 5DA0B 3R4RA 5IJVA 1RK1A 1YA5A 1E4XI 3DVGA 3L5HA 2WXGA 4OFIA 1QVOB 3VI4A 5HDQL 2YUXA 3CQQA 5F97E 2CIKA 3DMMA 2W94A 5JPMC 3HI6L 5K1NA 1F4XH 5HDBE 2E7MA 4NFBA 3S5YA 3UTSD 4L2LA 1QFHA 2ARWA 3HI1A 1A1OA 3ZZ1A 1YUKB 4FQ2H 3AW5A 5DC0A 2CBQA 3ARBB 2H32A 3BD5A 4KKBD 4M7KL 5E1IA 4XBPB 1FZOA 5KVDH 2G4EA 3Q01A 3W0WD 3C2AL 4HGWA 5LWYH 3IMRA 1XF2A 3UERA 4NZDA 2NNXA 3FYEB 2FX7H 3KEDA 3QRGH 3HTLX 2ZXBA 4I48B 1MW2A 4H2CA 2ERJC 3IKCB 3RGHA 2W8CA 3BQUC 2ZSWB 2IFGA 5LGHH 4AC4A 2VDPL 3KVQA 1OL0A 4JUTA 4Y4KC 5CJBA 4BZ1A 1VACA 1D2PA 1U30A 4GQQA 2Z6FA 4HH8A 4IOFC 3Q7JA 2CDGA 2AGJL 2MQGA 5EU5B 5TE7L 1TQUA 3VGGA 4AXWA 4PS4H 3O0RL 1IVLA 3CXFA 3WG7B 4Z7VB 3QWOB 4AYMC 4BFGA 4KNQA 3COOA 3LXCA 1S7WA 4DKEL 2EUWA 3WJJA 1RV6X 4PUBH 4IRSA 4X4ME 1USZA 4C54A 4A7GF 4FKHA 1MHEA 2JK5B 3NEXA 1UM6H 3NIGE 1HL5A 1RJLA 2YXMA 4LARL 4MB3A 4AE1A 3BKCL 1ZK9A 3RI5F 3NCCB 1ZJAA 2OYMA 2ZCLL 2A74A 1OSZA 1R6VA 2GTWA 3UTSA 1DBML 2VDLH 3UO1L 1RZJC 2CLZB 5I2IB 3B6SA 1MRFH 1A6UH 1YY8A 4KK6D 5DHDA 5AVTB 5GS3A 5H4YA 4M62L 2H5UA 1IGTA 2ADGA 1ZJBA 1K8DA 1BQHA 4KTDL 1A1MA 1YN7B 4P46B 1TQTA 4WTZG 5DK0B 3SPIA 2QVFB 4AM0Q 2W9LA 2GJZA 4A2FA 4GRMB 4ZMNA 3MGAA 4ONHB 5JORB 2F53D 3WN6A 3DURA 2GQHA 2DRUA 5HJDA 5KWYC 3V0FA 3D25B 5JIKA 3WUWB 4AVKA 1KCSH 1JZ2A 2VERN 3DX3A 4U6TA 2VZ3A 4G7VL 1FORH 3BPLB 2Y7LA 4XPFL 1EEZA 4WZ9A 3X12B 1NCDH 3ZPDA 1J5OL 3JWNC 4N2OA 3AU1A 1F0LA 4ILDA 1E42A 2X2YA 4G6ML 1XD0A 1AZUA 1NBYB 2VLRD 4N0YL 4YE4H 5D2LF 4R4FL 3ARZA 5D7SH 4TN9A 2DH2A 5H37A 1CD0A 1AHKA 2NLJB 2YD7A 4FXTA 1UZ6E 1AXSB 1EGJA 4WV1C 5KSBA 2NY1B 3BO8A 4BQ9A 4YN3A 1J87A 4XMXA 3VSVA 1FAIL 3CN2A 3IJ7A 3N85H 1S78C 3KPLB 1MFMA 1YAIA 3GMNA 5EZIL 3HFML 3NH7L 3WKMH 1L7TL 3HE6C 4O4YL 4AQ1A 4XNXH 3NABL 3CHOA 3KM1A 5GGVY 4WHYG 4HIEB 5HPMA 3W39A 3D7PA 3QUYB 3F8UB 4WFFE 3DTXA 4XXCA 1M56B 2NY0C 4O2CB 3AREC 4NI6A 3KWWA 3U0WH 4UIKH 1OAXL 3QNYA 2X3AA 1JPSL 3QRLA 1JN6A 3T8MA 5IQ7L 2FHBA 1XSOA 1NLDL 5DVMA 4POYA 1WA1X 4NXSA 4GSDL 5CD3A 4HUCA 1VHPA 4JHBA 2J1KA 1FCGA 3E6HB 1T20B 5GSRB 2ED7A 4M5SA 5JXED 3DUSB 1B0WA 1KZYA 5L7XH 3HNSL 2PW2A 3CFDB 4WI5A 4LU5L 5DS2A 2YC1A 3ZDYB 4HJTA 4F9LC 1GJWA 4HUNB 5DRXA 4ANVA 4JFDD 3CHSA 2N7AA 4L8SA 2J56A 5DZ9A 3ARDC 4GXFA 1LYQA 4NGHH 2VW6A 4F5CE 2VLRA 5CJXC 4N8UA 3ZQWA 5ESVA 1GZPA 1VFBB 2RAMA 2CHZA 5FV1L 3QORB 4GMSL 4IJ3C 1G1YA 2KPNA 5IVXB 5CLTA 3F58L 2YOAA 5D1QC 5DRZB 2J72A 4BDVB 4D9RE 3K8LA 2W1NA 3MLVL 3OAWA 4H26A 1MPAL 5CR8A 3WFEL 4EE2A 1G1CA 1M05A 4Z7QE 3TA3C 4L3AA 3QXWA 3L9RA 2G9HB 4XWOD 1KYOJ 3ZO9A 3MRNB 4F7PA 2HT3C 3FN9A 1JXDA 2FTAA 2ED6A 3GLZA 5C0JA 2R9HC 5EU4A 4WFED 1EJ6A 1QTYT 3OKMB 1FNAA 1MCDA 3MBEC 1I9EA 4Y5YC 5F7LB 1P7HL 1HILB 3CFJA 1HYSC 5I1GL 1K5WA 1UB5B 2D7QA 1JGEA 1HQ4B 5GGTH 1TQCC 4M8QA 4OSUH 5J89A 5C3LD 4OZFG 3SKMA 3LAFA 5JXEA 4NRXB 4BWTA 4HDIB 3LRSB 5DQDL 2EH8L 3ZR6A 4DVRH 3TCLA 3VI3A 3KPSB 3SPJA 4JM2B 4L0YA 2IBGA 2DJMA 5C0IA 4P2RE 3A21A 3O4OC 1HFUA 1IGFH 1R47A 2W95A 3MGTA 4YIQB 1ZLWH 1EZSA 3T0WA 3FT1A 4DEPB 5F1IB 3QEQA 4M03A 2DQMA 1JK8A 4Q4IA 1GR7A 3BN3B 1D6EA 4NENB 2ODHA 3K2KA 4GIOA 1HHIB 5FV2A 1A3LH 4M5YH 5HHVH 2YA0A 1KTKE 3DYOA 1I7TA 2LAAA 1FNGA 1PLGL 1SMAA 1X6NA 2WBJD 1ZHBB 2KH2B 2OMTB 3D12B 1RJCA 3IU4L 3NN8B 2GCYB 1P7KA 1HINH 1MHCA 1ZHKB 3CHRA 2B4CH 5F1NB 4G43A 2Z35B 4L4TB 5CIPB 4P59L 1BD2E 3NFSH 1ITBB 1G9EA 3UYRL 2EEDA 3JQOB 4MB5A 4GW1A 4AK2A 4LAQH 3O81A 4QEGA 4MMZA 3NIDB 4QTIH 1JHLL 4PRPB 4PCSA 4PRNA 4NB7A 3R8QA 1ZT1B 5ID1B 2OP4L 2WXIA 5DEGB 5C0GA 5A7EA 3IFLL 4IMLB 4R5TA 2BWIA 1RY7B 4H8QA 2H32H 1PKQE 3GD1C 4K5MA 3QHZL 5GRUH 4I3RL 4M43L 3IPFA 1HTYA 1MCQA 2EUXA 1OB0A 4S10A 5DRXB 3UOAB 3TO4D 5EU3B 3P77A 3UJTH 2V9TA 1HOEA 1DJYA 1EHNA 2Z31B 2YEZB 4YDJB 3U2JA 3PWJB 1HNGA 4MXVF 4RGNE 2GABA 3E0GA 1U93B 3G6DH 3VG9C 3BZEA 1SEBA 3ECWA 4EO5A 3HC4L 5A43C 4BZ1H 1GYCA 1QRNB 1UURA 4GIPD 2X7LA 4L29A 3F7VA 2O93L 4Q9RH 3DHPA 1YDPA 4A6YL 4EZMA 2YD6A 3O4LA 1VCBC 1Q1JL 2QSCH 2WBJA 5B1JC 1ZGLP 3TN0B 4P0DA 1P7BA 2DI7A 4QRTA 4F2ME 2HVJA 4OAWB 5IW6A 1NIDA 3FW6A 2CBTA 4WI7A 1J10A 3CCHB 3IMVA 1WWWX 3EDJA 3KLHD 3Q9PA 2L7JA 1CFVL 1URLA 5E8EB 1A7NH 1BQSA 3NACL 4WFFD 5CKAA 3UTTB 1QQDA 1REIA 5GISH 1RUKH 1U2HA 2N3JA 3W3BA 1YYLH 3W9EA 4ELKA 4GAGH 2VH5L 3ZTEA 5C9JA 3MLYH 5IFAH 3CK0H 1MCCA 4R7NA 5GRWA 4WFGD 1I1AD 2GW5A 1JD7A 5HVWA 1UD5A 3L3OB 3P2TA 5FHAH 4JDZB 3GM8A 3VWJD 2HVKB 3ZIYA 2BSSA 4LOVA 2BCKA 4XBGA 4X6DE 3E1ZA 2IAMB 4P3WA 3U30B 5EOQH 3JVFC 3JUYA 3TO4A 4XBMA 1NGZA 2YEQA 4OJDH 5LUMA 2NTFB 4IGBB 3BUQA 2NY2C 1ZS2A 2APBA 2A6DB 2W5PA 4U6XB 4YXKL 2H6UA 2JB5H 4R6UA 5A2KH 2HUEA 4BV1A 2X4OA 3FOLA 5L6YL 1FV1B 2C7UB 5MERA 3MRFA 1JGDB 1JTOA 4M48H 3G04A 1G87A 5K9QI 4P9HC 3UDWA 1I7ZA 3Q1SH 5CZVH 1NCTA 4PJ8B 1TXKA 2ZAHA 5J57B 4GB9A 1RZ8A 2CG9X 3LZLA 3RVXC 5EO0B 2CMRL 4MD4B 1DL7H 4Z5RB 3CFKB 2KZWA 3GB7A 3I2CL 3V52H 2BVPA 2WCSA 5T1KD 1CTNA 3IJSB 1ADQL 2WXLA 5I0DA 2QADC 1KJ2H 4KITB 4X7TB 4GBXC 2AS5M 4DP0X 1UCBL 5IVZB 3M7OA 1PD6A 2VWEE 1DZBA 5KVDE 4XNMA 3H3KA 4C83B 4MMYB 4FFTA 5TD4A 2VZOA 3LSOB 1I1AA 3INUH 5CGMA 4X6FB 4YC2C 3RGVB 3OKEB 4Z0XA 2FWSA 2WNXA 3K5SA 3DRQA 4IS6A 5B4MD 3QAZC 3VWJA 3FB6B 2BC4A 2FD6L 5K5YA 5KVGL 4KVNL 4N6RA 5DFVC 2LTQB 2EC9T 4N2BA 3P0YL 1TPXB 2AJ3A 4CVUA 1RLWA 1KXQA 5L88L 4I4WB 4FNLL 2Y9RT 1A3ZA 2WWMC 3U6RA 3B3IB 5DQ9A 1XWVA 4LNRA 3QZWB 2X4SA 1H8SA 4P2RD 1WAEA 4S1DC 3T3ME 3U7YH 4AKPA 3LNEA 4HWEH 4LEEA 5H4ZA 5IJCC 2CHDA 2W65B 3CFEB 1JF6A 1QACA 1GGYA 2F7OA 4FN0A 4GQZA 4H8WC 3BAEH 4O9HH 1F4HA 4QOKB 4F5CA 5I30L 4LBEA 5IEHA 1S9VA 5D6CA 1P5UA 3IDUA 1PQZB 3NJFA 1WS7A 3QW9A 4MD0A 4FNUA 3KLAA 3VJ6A 1AD0A 2AEPH 3GI8L 4MQTB 4E9YA 5IZ7A 3KYAA 2X88A 4JZJB 3SGDI 2J8UB 3C6LB 3BCFA 4LVHC 1PZBA 2X9ZA 3HB3B 2EICA 3D48R 4HCRH 2CPUA 4KJYB 4UQDA 4XGZA 1BJ1H 1WVZA 5T1KA 4Z0BH 1LEGB 3EIFA 2HKFL 4H88H 1U4EA 3HNVL 4DGVL 4UOW0 5SX5H 1NFKA 1MJJB 3MXWH 3QQDA 4OD2B 3FFCD 2R7EA 3DVNB 4KK9C 3PQYE 2CRIA 3ULVC 1V3KA 4MS6A 1ZANH 3MCLH 3VXNB 2VO5A 1CWVA 2L7QA 1IQWL 2WIIA 5KZCD 4QT5A 4HQQH 3RL2A 4LPUA 2DD8L 1KGYE 1XF5B 4KY2A 4FEIA 4LEOB 3CBRA 3D50A 1S3RA 5JPMB 3VFTA 3U82B 4WU5B 2M2DA 3NESA 5GJSH 3ULVF 3OSKA 3CXHK 2WLLB 3NJVA 2DWXA 4WTWA 5FKAB 3NBNA 1A6ZA 4XO9A 4OGYH 2ILLA 2JJSC 1G9NC 1BBJA 3LYRA 3MNMA 2V5YA 4F2EA 2XXMB 4LGRB 3VFGH 2D7NA 1N6QH 2OSLA 5FS5A 1GC1C 12E8L 4P2RA 2XY1A 4YSCA 5KVMC 1Q9WA 3CZFB 1JD9A 1JZHA 3L3DB 4YVUA 5IOKA 1LO5A 1ZXQA 2EABA 2GIMA 4MQSB 2ERJB 1LQSR 4A63A 3BQUB 3ASWA 1U36A 2ICEC 3ZYZA 5E8OA 1L5GB 4Y4KB 3BE1H 5IG7B 4PAZA 4HBQA 4JFEE 1GYUA 1YMMB 4Y89A 5EWIL 1L4IA 4E9XA 2GUOB 5KVDL 3FH7A 1L6XA 1AGEB 2ZUWA 3I75B 3LHPH 5LWYL 4C59B 5C07E 2E74C 2A2QT 2JCCF 3QIUC 1QD0A 4POZC 2ZCKH 4CSPA 5ABAA 5HYJB 1U91B 2DQIL 1W91A 4GW5B 4D0BB 1G7LA 1CPUA 1JGVL 2DY2A 1T66C 1OWWA 3H9SB 3LVEA 3SCMD 3FFCA 3SY6A 3I84A 4BUQA 1MREH 1X44A 1YJDH 5I0VA 3QUHA 3RNQA 4FXGA 2IV8A 2HTKD 3T0AA 5JHAA 2C9QA 2APVA 4MJIB 4Y19E 4BKLB 4FC3E 4ZTOL 5B38A 5KYYA 5EBMA 2HLEB 1LLAA 5IP4A 4PBVC 1XIWD 2FJGB 3BEVA 3BHBA 4JL1A 3RNKB 1MCOL 2G5BA 5FA3A 2XQ0A 4U3SB 5G55A 4P99A 3ZKXC 4N8CH 4NQEE 2FWUA 1BVKB 5KS9E 1AQDA 4NOFA 2J88L 1OSYA 3H6JA 4QHLB 3MNVA 4V11A 4FL4C 2VR8A 4MB4A 2DQDH 1WBXB 5BV7H 2DIEA 2YMXH 4MX7B 1MY5A 1JV2A 1TLMA 5HHME 1A7PH 4KJQD 1O6VA 3QXTA 1RJZB 1ORQA 5C2UB 4U0QB 4P07A 5D2LB 4KNTA 3U0PB 2G4GA 4IU2A 2G30A 4XP9H 1G5GA 4GPVA 4GNKB 4PJCF 4TL4A 4MAYD 4CW1B 1R0AL 2G2RA 2FYVA 3O11B 5A2FA 1Q0YH 3Q2NA 1P9MA 1YSOA 2W59A 1NBZA 3OC5A 5C0BB 4F24A 4NZFA 3AY4A 2JVUA 3V2AR 4B3EA 4E9VA 1IAIL 1ZA3B 5E2WH 2CPCA 1ETA1 1OAKH 3SCMA 1P4IL 4WV1B 1TSRA 1LE5B 3D09A 5IVOA 2OZNA 2X6UA 3OHMB 2CO4A 4KJPC 3GSWB 5I1CL 4FABH 3PRZA 4DCQA 1DN0A 2ZCHL 1MAML 1NCDL 3HE6B 1Y0LB 1J05A 4DO6A 3C60B 3S3SA 3LEYH 2XICA 3FQ1A 4BBWA 4CKVX 2H1XA 2WY3B 1XIWA 2NY0B 3L45A 2YQBA 3AREB 4OIIH 3DV6A 1J1XH 3MRMB 4PGCA 3UBXA 4X6DA 4IU3B 2BIMA 3TS8A 3QQ4B 5KVGE 1BJ1J 1EAOA 3K4ZA 4PRHE 5I76A 5AKRA 3ROLB 1TJIH 3CFCL 2R8SH 1A4JB 2EDMA 5E2VH 3MLTB 5GGRB 3S8FB 4FYRA 3A6BL 3IPEA 2HRPL 1D7DA 1EFQA 4HALA 1Z9SA 1WICA 3FQRB 4RMTA 2QQQA 3IAGC 3E2HC 2Z0UA 4G6KH 4LOEA 3IGAB 3BIKA 4N87A 3TBTA 3VXSA 5JXAH 1P6WA 3BW9B 4OUUB 2IDTA 3O41A 3ARDB 4M5ZL 4U6VL 4P5SA 1BSIA 4YHNB 2WOBA 2H6PB 4CADA 1J8SA 1W6LA 4C55A 5A16A 4IJ3B 3M1BA 2D3LA 2Q8AL 1LEIB 4P2CG 5A2IH 5D1QB 3TCTA 2ZKXA 3WE6A 3PQYD 3RLSA 1IGMH 3MV9E 4GG6A 1MCPH 3HLAB 4MJ6B 2OTPA 4P5TD 3FYIB 1M4KA 2B1OA 2WXNA 4EN3D 5I1IL 2UYLB 3TA3B 4NGHL 4TNVK 2D4DA 1CD9B 1FVEB 2YPLD 2BNRB 2Y5QA 2VJ8A 5CJOH 3LKSB 4M6ML 5JYMA 2A9BA 4PJGE 3MA9H 1BOGA 3VM7A 1I3UA 5EEZA 4OD3H 3JV5A 3CZJA 1WDAA 3WHE0 3TFBA 1P4UA 3L9BA 3FT0A 3MBEB 1F2XK 1NMAH 1XF1A 4X80L 2P45B 4Y5YB 3WTVA 2Z7WA 3QJXA 1F4YH 3I3BA 5IB4A 3IDYC 3RY6C 1TQCB 1EAJA 1SJHA 2JI1A 4LXFA 3AS0A 1QLEB 3P3SA 4NO5B 3VTAA 2ZUQC 4DP6X 2ED8A 4XP4L 2OZ4L 4ELMA 1MAKA 4CJ1A 4WNJA 3D4YA 5HHQB 5E9DE 3O4OB 4YNYB 2APFA 3JT2A 4DK6A 3D4ZA 4PFEA 1V7NL 3SGKA 1JZEA 5C07D 3P54A 2Z7UA 5GGTL 3WL9A 3D06A 2BIOA 1MFBL 5M94B 4L3EB 1NFIA 3MLRL 1QRKA 4MCZB 3AFLA 4LP8A 3RTQC 1WIPA 1S9XB 4DVRL 2XFXA 1CL7I 1S7VA 4HFWA 1TKWA 4OLUL 5C0CB 2QSTA 4XH2A 4P5TA 4JRWA 4J8RA 2FUQA 4KNSA 3L1FA 1IGFL 1F6AB 3FU3A 4G8IB 5D72H 3SOBL 3VWKD 4EN3A 5KBPA 4DAGL 5LGJA 4XCNB 2YPLA 3IJEB 3GTNA 2EYTA 3HA0A 5E6SB 1SDDB 5HYSA 1UZ8B 1PG7H 1U41A 1XEDA 4W9JC 1ZLEA 2PCYA 1SRDA 2ISDA 1I1RA 4OBRA 2FJFB 3OF6A 2APWA 3UABA 1N26A 2X70A 2ICWJ 3ZHFA 2ZT9C 4NQED 1H9DA 3TNMB 3ECBA 1MF2H 4BFRA 2ZWNA 2I24N 4PJ7F 3MQIA 4J7RA 3OPUA 4A68A 1IC4H 4AW4A 4GP5B 3FB5A 4P3DA 5DRWB 2HT2D 2QTEA 3FK3A 4ODVH 1X5IA 4CNIB 2WZ6A 1PY4A 5E08L 5IM7A 3NUKA 3VB8A 3L5JA 4PJBE 1GPOH 1OD7A 4HJ1A 5BVPH 4LAQL 2DLGA 4QXUH 2QEJA 4F9PC 5C3IA 3S3JA 4A6YA 2ORBL 4BIKA 1S5IH 1TMCB 4UCFA 5C07A 2WINB 5E00B 3VG9B 4N8PA 4M7LH 2ZCZA 1PG7W 1F18A 1AGFB 3ZR5A 5GRUL 3B5GA 4QHUB 2Z3FA 4BWUA 4F80A 1RZGA 4I0PC 2NY3D 4PG2C 4DW2H 4PSRA 2DJUA 1IGJB 2P42B 3KNBA 5FF6B 1DVTA 4WU7B 2E3VA 3PREA 3ELQA 2FEJA 4N68A 3VWKA 2C9UA 3QVAA 1FLRL 2ZX8A 4FG6C 2WSKA 4LIQH 2N59A 3IETB 3G6DL 2ZXDA 2OMUA 1QI5A 2EZ0C 1SEQH 3X1NA 1Q72L 4Q9RL 2AJXL 2JJWA 4ZW6A 4GKNB 5CZKA 4NQEA 2QSCL 4OZIA 2OMVB 4N20A 4PRHD 3LEXA 2OJEA 1T4KB 2PP8A 4LLDB 2KDGA 3R06B 3SDCC 1RHFA 1QP1A 3OAZH 4QHNB 3OX8A 2XX0A 1WC7B 2Y06H 5L2KE 3TX4A 2L04A 5ILTH 4L8BB 4XRCA 3ZMNA 4PB0H 4ZOAA 4AQEB 3K2IA 4F57L 2DI8A 2PYFA 2IJ0C 5B7FA 2XYBA 1LDPH 2NY2B 4CL7A 3CK0L 3GS0A 1L9MA 3LKOB 2HFEA 3ZRCC 5J6GB 4XMLL 1R5WA 5DK2B 1MIEH 1J18A 4RZKA 2CDEA 3CFBB 2PCPB 2WUCH 4P2YA 1R5VA 4OM0H 2J1YA 4OFQA 5ADOL 3DIFA 1S7RA 3SBWA 1QBBA 4RSVA 5DJAA 4X4ZA 1FNEB 1TZ8A 3KPRE 4HKBA 4G8AC 2KS0A 2OYPA 5DEJA 3X3FH 3E8VA 2JB5L 1CF8H 2MIZA 4WHTB 3H7BB 1IBGH 2QADB 1NCJA 3HC0A 4HMCA 3HRZA 4GBXB 1DBBH 4M48L 1M6UA 2H2SD 3MRCA 3ES6B 4BHUA 1KPVB 1H3GA 1NBQA 5H94A 2I9TB 4F37F 5HI3C 1A8JH 4WUKH 3P1VA 4JO8A 2EIBA 3WS6A 3D85D 4PRHA 5BVJA 3PWPB 5E9NA 5K59F 4Z7NE 5C92A 5DS8A 5KBLA 1M53A 1I8LC 4YC2B 1GH7A 3QYMA 4FI6A 1HEZB 2DV6A 2OMZA 3QAZB 3ISWA 3UTQB 3RVWD 1G0DA 4MA7H 5ITFB 1CLZH 1KJ2L 5D7LE 2J5WA 4NQDE 2EDLA 1MVFA 3SDAC 4GXVL 1EWHA 2Y2TA 4RMUA 1KB5L 1RFDL 4GEJA 2ADJA 1SM3H 3RPKA 1T21A 1CICC 4O2FA 3K3QA 2PR4H 3PP3H 2P8MA 1IL1B 2A4CA 2F5AL 3HBQA 3I3EA 3ARYA 1BXUA 5FUZL 2X4QB 1TETL 3MNZB 5CBAB 2ZICA 4LVHB 1QFPA 1BYPA 3H56A 4ZO9A 4LHQB 4WENB 4D8OA 1AHMA 4FQLH 1AGBA 4M61B 1YNLL 1N5YL 2BK8A 4KKCD 3PE9A 4PV9A 4KKLC 4O9HL 1W0VB 1L0XA 4NO2B 1YPZA 2DOCA 3SBRA 3WIFA 1PEWA 2E9JA 1L9NA 4OJEH 1PLAA 4Z8FH 2VC2L 1SJMA 2YZ1A 5SX4H 3D85A 2QVMA 3T0BA 1O6SB 3E9TA 3TEYA 1COBA 2VXUL 1PLBA 2LW3A 4AV4A 2DLFL 3G5VA 3OG6B 4YHOH 4EQ3A 4HISA 4Q2ZA 1V5JA 1RCYA 3U2SA 1LP9E 1NUDA 4H88L 4BQBA 5AVSB 2XN0A 3MXWL 2KLTA 3UX9B 4LCUB 3GMLB 3H2WA 2GJRA 2X12A 3ILEA 5AUMA 3V6FA 3FU9A 1Q94B 4PWEA 4K3HA 6PAZA 4FA7B 1YEWA 5IBUG 3DGCR 3FO1B 5HHPA 3NRPA 1OTTC 1HAUA 2CRZA 4M1GL 5I8CA 2XVLA 2B0SH 2BXZA 3ROOB 3LKRB 2JCCB 1MJ7L 2ICEB 1JWMA 4HK0A 1T6WA 2BHYA 2V5SA 3J2PA 3EYSH 4QPEA 3T4AA 2WJ5A 2UVFA 1J11A 4R8WL 5HGBB 1OARL 2YQ3A 4JRYB 4OZGE 3FH8A 1ASPA 5J6HA 2CXKA 2JKWA 3QIUB 1FRGH 3JTTB 2CM6A 1BECA 3NCEB 1MOEA 5T1MB 3S3PA 2BH0A 3ZW3A 1RP8A 3ZMEA 1A9EB 1XT5A 2XWJB 2E56A 4PJEE 2Q8BH 3BE1L 3PAVA 1J5DA 1NIFA 2E47A 1ZVHA 5I9QC 2DQJL 5JDSA 4RNRB 1QSZA 5E99L 4JQXC 5IR1B 2R39A 1KGWA 2WSDA 1HSBB 4C4KO 1H19A 2WNGA 1P4LA 2K4AA 3L1GA 1EO5A 1HWHB 3WFCH 2EVJA 2CUMA 4C56B 2LU3A 3ZKXB 4R7LA 2XX1A 4QDGA 1XMWA 1UWGH 3QHFH 1MREL 2CA4A 4L2YA 2OL3A 1RUAH 2C1PA 1U92B 3GMPA 4GINA 2RJMA 3SGEI 3V0IA 2NZ9C 4J3BA 3STZB 4FL4B 4PJCB 1AZBA 1T03L 1GOFA 4XVTH 3PCYA 4LHUD 1DUZB 1FVCA 1JYXA 1CDYA 2CNYA 3ILQC 4LLVB 5ACZB 1ZV2A 3EOTL 4BH8B 5HBBA 1IGIL 4OGZA 1X5MA 2Y1VA 3OAUL 4PD4K 1RULL 1T1YB 4AQ8A 4RAVA 4KX8A 1UA6L 1Z9PA 1HH9B 1KPUB 5C0EB 1TYRA 5B3NA 5L4JA 4M6OL 4DWHA 3K4DA 3KPRD 2IGFL 4IHOB 1JAEA 4A2GA 1A7QH 4M7JL 2DQDL 4MNQB 3SYCA 4ZMWA 4LASH 1R3HB 3FRPA 5TDOA 5I73C 2ZZUT 5B8CA 2XN9E 4U31A 1R3LB 5AL0A 1NCGA 1NGQL 2ZSVB 1S4IA 2OXHA 4UINL 5DMIL 2B9BA 2QPSA 3UO8B 1VFUA 1WSST 3U1QA 3IU3A 3UTPD 4TLSA 2XZAL 4B9ZA 3WTXA 4EI5D 1N0XL 3TIDB 4E9LA 2GHZA 3KXFB 2QJDA 4G80B 2ZP9A 3DRTB 3WHXA 5E8PB 3ZHLA 4E42B 4JHAH 2E6JA 2OR8A 5E2WL 3VDBA 1SOXA 3GSNL 4ZZKA 1MELA 1GVIA 2XIIA 4XVJL 1FSKB 1UQSB 4X8CA 4G8EB 1HHHA 5HHNB 2PYED 1E43A 2OMXB 4L9LC 4ZYKB 3CMOH 4AGPA 2EIJB 1KFAL 2LLNA 2Q0ZX 4MJJA 1DVYA 2ICCA 4LHUA 4K8RC 3B9KC 4XBEH 4LMQE 4XPHH 4MJ5B 1KEMH 2O5XH 5C0DA 3D30A 2J6EH 3WFBH 3RBGA 2FE0A 3NQKA 1ZWIB 2XV3A 5DXWA 4LCWB 1BPVA 4OF8A 4X9FA 1JK9A 3P3YA 1J1XL 2ATPB 1X5XA 3OQRA 3E2HB 1KGXA 1ZA6A 1ECYA 3TZVC 4DP1X 5FM5M 2EINB 1FH5L 3ZT6A 5SWQA 4YDVA 5JQ6H 1TJIL 1LHZA 3MACH 4LEXL 3KPRA 1A02N 2ZX9A 5E2VL 2QKIC 3FQ4A 2XBZA 3BKJH 5F0JB 3RGBA 2EUVA 1LEKB 2WZPD 5FC9A