5B7FA

Structure of cueo - the signal peptide was truncated by hrv3c protease
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
486
structure length
463
Chain Sequence
RPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical, spectroscopic and X-ray structural analysis of deuterated multicopper oxidase CueO prepared from a new expression construct for neutron crystallography
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase CueO
total genus 142
structure length 463
sequence length 486
ec nomenclature
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7fA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7fA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b7fA03
2BZCA 2HXAA 1JVOA 1BXAA 1PZBA 4P5RA 4UANA 2XYBA 4UAHA 2WO2B 1AZCA 1DYZA 4N4YB 1WA1X 1NPJA 3CG8A 3CDZB 2VSKB 2IDQA 4QLWA 5B3SB 4BK5C 1NTDA 1CURA 2VM3A 4PAZA 4A2FA 2Q5BA 1RKRA 2I7OA 1ID2A 2PP7A 2XUWA 2GSMB 2GBAA 1BQRA 4HALA 4A66A 1GYCA 3S8FB 1GS7A 3CVDA 1GR7A 2YAEA 3AG2B 1A3ZA 1JXGA 1PAZA 1AG0A 2QDVA 3CZUB 3T71A 4CSPA 2GC4C 2YAQA 1PMYA 1HAWA 1AIZA 1MDAA 1L9TA 5A7EA 5D4HA 4JKNA 2HRHA 2TSAA 1BXVA 2GHZA 3DTUB 1SFDA 4YVUA 4E9YA 1JZJA 4DP2X 1NWPA 1HFUA 1X9UA 1I53A 4HIPA 3FYEB 3V9EA 4QKTA 1KBWA 2BWIA 3OMNB 4F2EA 2DWTA 1KBVA 2EILB 3AZUA 3EF4A 4E9XA 3T6WA 4A2DA 2J56A 1A4AA 2VSMB 4DPCX 1GY1A 1IC0A 1W8EA 1SF3A 4GP8B 9PCYA 1E67A 5I5MA 4G70B 2J57A 3WKPA 1XB6A 3BQVA 4DPAX 2FQFA 4JHUA 2CUAA 8PAZA 2PCYA 1E30A 2FT8A 3FU8A 1PF3A 1NZRA 3UADA 5I5IA 4AX3A 4MFHA 3OM3B 4YSCA 2DV6A 2JXMA 5I6LA 1FFTB 2FNWA 2FTAA 4G7RB 2J5WA 3OQRA 1ETJA 1XMEB 3FSAA 1JOIA 3NJIA 2BW5A 5I5JA 3V9CA 3TBBA 1QHQA 4HHWA 3S3BB 1BQKA 3PAZA 2IH9A 1WS7A 2CAKA 4BWWA 2PPDA 2CALA 2XVBA 1JVLA 4YSDA 3WNIA 2UXFA 4DP1X 5I26A 4Q8BA 4KOBA 4DP6X 3NYKA 1J9RA 4F7KA 3FQ1A 1AS8A 1J5CA 3CVBA 4HAKA 2AZUA 2NRDA 1VLXA 4HCFA 2AVFA 3FU7B 5I6MA 3ABMB 3IEAA 1OE1A 1SJMA 2AZAA 3PLYA 1PLBA 2B3IA 2UXGA 2MTAA 2YARA 4KOCA 4AKOA 1JXFA 3TA4D 4FA7B 4TXVB 2VN3A 2UX7A 4X4KA 1YLBB 4YVNA 2XLLA 1XB3A 4M4RB 3WG7B 2BHFA 2YXVA 4A2EA 3X1EA 5F7BA 4BWUA 1SDDA 3SQRA 5AZUA 4JHVA 2FQDA 1PNCA 1KV7A 3NJNA 3GXUB 2XXFA 3FU7A 1A4CA 1ZV2A 3NT0A 2HX9A 4G7QB 1NIEA 2VW6A 2JFCA 4KNTA 3L45A 2EINB 3IE9A 5F7AA 1SDDB 4E9WA 3FYIB 1ZDQA 3H56A 4KO5A 2QT6A 2H3XC 1TEFA 5IY5B 3NJMA 1TU2A 1JXDA 1ET5A 3FS9A 4N8UA 4AI7A 5B7FA 1W6LA 3QJQB 2QPEB 3UAAA 3EH5B 3WKQA 1DZ0A 1V10A 2I7SA 4NB7A 5B7EA 3EH3B 1AAJA 2R7EA 3PCYA 1ASOA 2ZXWB 1NIDA 4PCYA 1PY0A 3T9WA 2XX0A 4DP8X 1J5DA 3GDCA 1WAEA 3JTBA 3T6ZA 4E9RA 1AR1B 1FWXA 4A67A 1MZYA 2BP0A 2FT7A 5D4IA 2FQGA 4E9SA 4W1TA 2BP8A 1OCRB 2XV3A 1ZIAA 4M3HA 4HZ1A 2GI0A 1L9RA 4G72B 3DKHA 4YSTA 1BYOA 2IDUA 1OOWA 5ANHA 1GS6X 2YAFA 2W8CA 5B1JA 1URIA 4KO7A 4P5SA 3NJJA 4BDVB 1A4BA 2HRGA 2R7EB 3WI9A 1IBZA 3G5WA 3TU6A 2DWSA 3WIAA 2HX7A 1WA0X 1A65A 1AACA 3T6XA 3UAEA 1XB8A 2IWKA 3H4FA 3CVCA 3TASA 4YSSA 1N70A 1CYWA 2IDSA 1X9RA 3EHBB 3U25A 1AANA 1PCSA 1BXUA 1PLCA 1SHXA 2BP0B 1L9SA 3OMAB 1WA2X 1MG3C 2FQEA 2EIMB 2IH8A 3NP3A 1BYPA 1RZQA 3FU9A 3X1FA 2GIMA 1OCCB 4DP9X 1KCWA 2X88A 2YAMA 2IDFA 2YAHA 2BO0A 3RYMA 2DY2A 3FPYA 1NDTA 2VM4A 3NSYA 4E9TA 2IDTA 1ZPUA 2Q9OA 5E9NA 4EF3A 1FA4A 1A8ZA 2BWDA 1E5YA 6PCYA 3IN2A 5I6OA 5I6KA 5I6NA 1UATA 1SNRA 4WKXA 2N0MA 4AKQA 1ZIBA 5PCYA 7PAZA 1ILSA 3AG4B 3MBWB 1J9TA 4L0PB 4YSUA 2W88A 3QJVB 1KDIA 3DIVA 7PCYA 2IWEA 2HZHA 2RACA 4Q89A 2XX1A 3IBOA 2PP8A 4G71B 4BWTA 1V55B 3FSWA 2H47C 1GSKA 4YSOA 5I28A 3FPXA 3S3CB 2ZOOA 2QPDB 4DP0X 5FC9A 2GB2A 4E9QA 1SFHA 2YAPA 1HAUA 1PLAA 3PAUA 4YSEA 3OMIB 4CSZA 3FSZA 4KNSA 2B08A 3JT2A 2XV2A 1ZDSA 5AKRA 5LDUA 1M9WA 2WO3B 1ASPA 1GW0A 4GYBA 2H5UA 1L9QA 1BEXA 4RH4A 4DPBX 4KNUA 5B1KA 1IKOP 1EHKB 3ASOB 1OF0A 4HHGA 3PPSA 4K9JA 4HCGA 1AS7A 1B3IA 3N55A 4DP4X 1SF5A 4F2FA 2QDWA 4A2HA 1ILUA 1OCZB 1QLEB 2ZWNA 2YQBA 3GYRA 2UXVA 3NJGA 1CC3A 3X2QB 1ET7A 3S3DB 1AOZA 2PPCA 3UGEA 1RCYA 1EZLA 2CCWA 3NSCA 3H4HA 1GY2A 3FQYA 2PLTA 2VW7A 5I6PA 3BVDB 1KCBA 2FJSA 2TSBA 2IWFA 4FAAB 2WSDA 3EH4B 3HEIB 1ASQA 4DP5X 3T6VA 1RZPA 5TK2A 4NAJA 4YSQA 1L9PA 1L9OA 3QQXA 3FSVA 2JKWA 2VMJA 2BP8B 2Y1AA 1NIAA 3SBQA 1MZZA 2CBPA 2FT6A 1MG2C 2OV0A 4W9ZA 1NIFA 2YXWA 3ZDWA 1OV8A 4BXSV 3QJSB 1AZBA 3HB3B 3NSDA 1KDJA 1KGYE 3KW8A 2FWLB 2P80D 3ABLB 5TK4A 3UABA 2XXGA 4BXVA 1TEGA 3UACA 3SBRA 3QJTB 1AZNA 2A3TA 3AG1B 4AZUA 3X1GA 2DYSB 1E65A 2BW4A 4UF7C 2EIKB 3TBCA 2X87A 1AQ8A 2AANA 2OCCB 5EHFA 3KW7A 2YAOA 1AS6A 3ZIYA 2PCFA 1PNDA 3C75A 1ADWA 4YSRA 1GS8A 3QPKA 5B1AB 3AW5A 4A2GA 1TKWA 2I85A 2XWZA 4A68A 1E5ZA 3PAVA 2CJ3A 1R1CA 4ENZA 4AKPA 1PZCA 4YSPA 1M57B 1T5KA 1J9QA 3ABKB 1J9SA 2Y69B 3NJHA 3S8GB 2P80A 2UX6A 4YL4A 4DP7X 1JZHA 1NICA 4GXFA 2VW4A 4GY4A 5B1BB 4NERA 3N2JA 3ZBMA 3FQ2A 1BQ5A 1CYXA 4YSAA 3FT0A 2BZ7A 4GP4B 5B1JC 3QJUB 1AZUA 3NP4A 1QNIA 1ET8A 2GC7C 4WTQA 2J55A 3AY2A 2AFNA 3IN0A 5PAZA 5AFAA 2LLNA 2MRYA 3ERXA 2IAAC 1KYAA 1V54B 1N68A 1M56B 1OE2A 1JZFA 2HX8A 2OJ1A 2EIJB 5B7MA 2PPEA 3NJFA 3NJLA 1NPNA 1AZRA 3MX0B 1OE3A 1IUZA 2E86A 1BAWA 2HLEB 3NSFA 1F56A 3D12B 3ASNB 4G7SB 5D4JA 3ABGA 4GP5B 3SBPA 1NINA 1JERA 3WNJA 1IBYA 1NWOA 3NJKA 3PXLA 3QJRB 2PPAA 3X1NA 2DYRB 2XV0A 4HCIA 2PPFA 1AG6A 2ZONA 1OCOB 4KO9A 1JZIA 4ZK8A 1WS8A 2PP9A 3OD3A 2UXTA 3ZX1A 1NIBA 6PAZA 4E9VA 4KO6A 1PZAA 1CUOA 1SHWA 3AG3B 1W6WA 1JZEA 3CDZA 3X1BA 4BDVA 2XU9A 1JZGA
chains in the Genus database with same CATH superfamily
3KNBB 4HS3A 2GIYA 2Q3ZA 4RMUA 1PZBA 3U0PA 1MCBA 3GJFB 4N4YB 2FZ3A 2BY2A 3T1FB 4Q6IB 1EQWA 3SGJC 5ANMB 5I82A 2XN0A 3NRFA 5DJXB 4ELKA 2Z8RA 5D7JB 1U2YA 2I7OA 2OTUA 2W9DL 4JFEA 4HJEA 5BCAA 3V0WH 1T5XA 4L4TE 1LDPH 1UZ8B 5LBSH 1H9VA 2VLKD 4IRJD 4HUWB 3HS0C 4ODVH 4F58H 4HALA 1M1XB 3K2KA 5C0DA 3FT9A 4F7PB 3AG2B 4MCZB 3OKMA 5CCKH 3ZRFC 1N9PA 3OSKA 5T1MA 3TP4A 1I8MA 4JRXA 1NC4B 2YPVL 1QI5A 4LASL 3IDUA 4M43H 4Y9CA 1BXVA 2FSDA 3C5ZB 2MKWA 4G7YH 5IQOA 3BT2H 5I9QC 4YE4L 1UM6L 1JZJA 4FZEH 5IF0B 1NWPA 2H6PA 4WFFE 2AMUA 3FB5A 3STLA 1YN6A 4F15B 4JPKL 1K6QH 3OGCB 2RB8A 4XRCB 2NY0D 4MQ7B 3VH8B 4S1DD 3V0IA 4XPBH 4BFFA 2DWTA 3S2CA 2R83A 3EF4A 4QXUL 4LAJH 5I1KH 1NCBH 5HPOA 3NZSA 2XQYA 2HMID 3BH8B 4DPCX 1WZMA 4U1IA 3GBNH 1SJHA 5JORB 1E67A 4I8DA 4CBPA 2WUBH 5EBWB 4F8PA 2J57A 4U05A 1NEPA 1QBAA 1NEZA 2J1ZA 2XN9D 2KT6A 2Z92A 3VSUA 5D2NB 1P4IH 3DO7A 1TTFA 1WBZB 3CXDL 1RIUL 2QSVA 4JHUA 4ZUUA 1KTLA 4HGKC 3QI9B 4DGVH 4JQVA 1QSFE 2GTWA 4XGZB 3JWOC 5I5IA 3DX4A 3ULUH 1QQDA 4TNVK 4LKXA 1I1RA 4AX3A 4GFTB 2PW2A 5DEFB 4MFHA 1DSFH 4W4OC 4XBMA 3R8QA 2ZXEB 1OGPA 4JFED 3SDXA 3TH4T 3KLHC 3L08A 2PTUA 3SB3A 4ISVB 1XZWA 1VFBA 4UTBA 1EJOH 1KIRB 3MRQB 5AENA 4MXWH 4OF3A 2EKJA 2EECA 4HSAC 5BZDA 3QDJE 2EABA 4BWWA 1XWVA 1EK3A 2JSFA 4AGOA 3T77A 2F7RA 4DAGH 3NCYS 1RJZB 5DK0B 4HKXA 1FFPA 2A4ZA 1I9IL 3F8UB 1LO0H 4FQQB 3V5DB 1XF1A 1A7PL 2EYTA 4XI5C 1LVEA 5CSZA 3VCLA 3P0GB 1ORSA 3VW3L 1KXTB 2Z92B 1WV7T 3D87B 1A7OH 2AK1H 3DETD 3HJEA 5IB3B 3CVBA 3MCKA 2BSRB 4Z77A 2P5ED 2HMIC 1FGVH 4TSBH 3MVSA 1CLCA 1W9XA 3Q43A 4LSSL 3HNSL 2OMNA 4XCCL 4N2AA 3LXCA 3CMGA 3V8OA 3MLZL 4AEFA 4RFOH 3LVTA 4NQEB 1Z32X 1DJHA 3DPDA 4X4KA 1IX2A 2ROYA 3CVHB 3KE0A 4U4IA 4PGBB 3CHPA 3B3BA 1AD9B 4N6RA 2Z31B 2ZUXA 3MBXH 1HNGA 1JZ8A 4IDJL 1TJHH 4PJAB 5D7JD 4LZKA 3HC3H 3NJNA 3OKOA 3EH1A 4GKZA 5IBLC 4L5FE 2FLRT 1KCRL 1UOWA 4JO8A 2BSRA 1G94A 3UYPB 4EZMA 4NM4H 4Z77B 4ZMOA 4FHKA 1IL1B 5LBGA 1S7UA 2ORBH 4U1GB 3MRFB 1DVFA 1ZDQA 4Z7UA 4NO0D 4GG6B 3UTSA 4EI6A 1HDMB 4AT6B 3T2LA 2OTWA 1PW3A 1YJDC 1AE6H 4CVZB 3QSKB 2PO6B 4NC2B 4WUKH 2DEYX 4GT7A 1FRGL 1B2YA 2O6FA 3QUXB 4QHUB 4BBWA 1EPFA 2I7SA 4HUUB 5EEYA 5DJDB 3GTNA 3MRIB 2DYPB 1F8TL 2ILLA 3B2UC 4EN3C 2XT1B 3VXRA 5I73B 2RJMA 5LVEA 12E8H 1RMFL 3TJEL 3JTBA 3TCXA 4FA6A 1SBSH 2YGQA 5HDRA 1H19A 1CFQB 1UH4A 5LAXA 2J8UF 2A6KB 4X7SL 1DO6A 1RURH 2FQGA 2KI6A 1YYML 2VXQH 2YFOA 3AUVA 3NIFE 3QWNA 3Q9PA 4TOYL 5GSVA 1I9RL 4C4UA 4DGYH 1K8IA 4NQUA 3V52L 2XWJB 4L8CA 2XTLA 4UTAA 1I8IA 4M4RA 1FZMA 3WUWA 5CIPH 1KXQE 5BQ7A 2FHBA 3OMZA 2DL2A 4HU2A 3PY9A 1ZE3H 4MDJB 3BWAB 1O0VA 2RHEA 5HYJE 1LD9B 4ODHH 4JL2A 5E1IA 3PNWB 1AY1L 5DHVB 3KDMB 1S8DB 2N1TE 4FLQA 1JE6A 3DX2A 1AP2A 1MELA 4Q4IA 3GIVA 4R0LB 1H0DA 1T0NA 2J4WH 4KH9A 4J7RA 43C9B 2QJDA 3NCFB 1BLNB 1JWSA 5I19H 1S5HB 2F0CA 3QQ4B 3VGFA 4TVPH 4PR5B 5T5NF 2L3BA 2FQEA 3QNXA 1YMHA 2CMRH 2V8MA 1P4IL 1T2JA 2TRYA 4GJTB 1V27A 4WV1A 5KSBF 4YHPB 5KS9A 2V7HB 2F54A 4JN2A 3WN5B 5HVWA 4GAJL 4JHWL 2CG9X 5I8CA 3NCJH 3X1FA 5T1MB 4U1GC 4X7DC 2TRHA 3V0AC 1OCCB 4DP9X 4HFUL 3OPZH 2BFGA 3RYMA 4BZ1L 2I24N 4R3SA 1ORQB 3DXAB 4PJIE 3QEHB 4V1DB 4E9TA 1YUKB 4OQTL 4B9JA 4X8CA 4AUYA 1IQWH 3QUMH 2ITFA 2KL6A 4I48B 5F97E 4E5XB 5BOPA 3REWB 2HKFL 5E51A 4HETA 4GUPA 2W92A 4NZUH 1RERA 1DZBA 2X9ZA 2H2SD 3KH3A 2R27A 4U1MA 4W9LC 1S9XB 4YSUA 3G6AA 3L6FA 3FO9B 5IGXH 4FFZH 5K9OA 4BCXA 1LEGB 2NUTB 4E42A 4XN5A 2PW1B 3PGFH 1SDYA 5J6HA 4UT6H 1SEQH 1ZANH 5I71C 2IGTA 1BIIA 3ZDZB 1GGYA 2QKIB 2ZCKH 4MAUL 3BE1L 1WFIA 2HG5B 1ZLUH 3GINA 2AJYL 1ZXQA 1R6VA 5IFJB 2MQ3A 1BVKA 3JWDL 3MRCB 1AQKL 2BOCA 1EV2E 3OR6A 2D03H 2YBRA 4DUWA 4JB9L 1KGUA 4XPFH 4GYBA 2BSTB 3ARWA 3D0LA 4FNQA 4KNUA 3Q2LA 1ZLDA 2HKFH 4LCCA 2V3EA 4NLHA 4HHGA 1HSAB 5D7SH 2FIRT 4BSWA 2A1WL 3IRCA 1KY6A 3ULUC 5E8DL 2ALWA 1AGBB 3D3VD 4PJFE 2VLLA 3PDDA 4D3CH 3GF8A 3HMXA 3TJEH 3S5YA 3NCJL 5LGHH 5I1IH 2Z1KA 1CC3A 4WEUD 2H41A 4Q9RH 1J0JA 3RDJA 1G7JA 4FMVA 4J5VA 2CMRL 1DFBL 4CKQA 4JO4H 1FRGH 4DQOL 3H4HA 1MRFL 5I6PA 4PR5A 2F1BA 3B9KB 1QEWA 1KCBA 4A7UA 2GEEA 4WUUE 4QR7A 4EJ1C 3BWUC 1HKLH 1KF9B 4PRAB 4UMGA 1KG0B 2YEVB 4JDEB 1RSYA 1Z66A 4BUGA 4YHOL 4MASA 5KVFH 3HS0A 3DXAE 3QDMD 4V1DE 5DHVH 1EEZA 3VXPA 3MV9E 2DBLL 4NM4L 2AQPA 5TF1L 3CVHA 2CBPA 2ARWA 2H26B 1DQQA 3PUCA 5K9QI 4KHXL 5IJKC 2H6UA 2YXWA 5MP6L 4N28A 4F92B 1W0YT 2RA1A 4XNYL 1QI4A 5HVGB 1A22B 4M3KB 1BBDL 1G7JB 1S4IA 5ICZB 3TTSA 2C34A 4OFQA 1IBBA 4HCRL 1AZNA 4AZUA 1JUFB 2QHLA 4FNPA 3K91A 2YPLA 5L9DH 1A1OA 4WWNA 3H7LA 3IETB 2AANA 2EDBA 3BWUF 4JFFA 2RQEA 2WLIA 5LB1A 1U4FA 3OJVC 5E70A 5LN4A 4U3SB 2UZPA 3QIBC 5L4FA 2Y7SA 4OBRA 4IRJA 4L4TA 4A2GA 1NFKA 5GGSB 2VISA 2G60L 3PAVA 4XC1H 5DJZA 1IC4L 2B1AL 1Y07A 4BFKA 5JW4M 1J9QA 1LWHA 2CUIA 2J1XA 2A74C 3HI5H 3G04B 5CGTA 3QWRD 3V0DA 1B4TA 4ODSH 2MCPH 3ARQA 4WWID 1XVSA 4XPTH 1UA6H 2PWFA 4JCLA 2B15A 4KFZC 1JF1B 3CSPA 4PS7A 4TNEA 1VSCA 2VXQL 1HXYB 1Q0XH 1FL5A 3NCCB 2LT9A 2PYFA 2IANE 3FQWB 3IRPX 3ZRCC 1FP5A 2ZAIA 3MBXL 1BYNA 2GFBA 1UOVA 3HC2A 5AVUB 3LHAA 5I1EL 1RZJL 2OXHA 2B16A 2IXQA 1XGRA 2BX5A 3ZUCA 3CZJA 5IEHA 1N68A 4XVTL 3QXDA 3LVEA 5T3XE 5HHMD 2IQAB 1NCCL 2H4EA 4WW2F 2GTZA 2NNXA 3R0MA 5DK0A 3HG1B 5A2JH 1ZA6A 3MX0B 5DQJA 3LZNA 1IUZA 2IH3A 3NJVA 3MLWH 4DIXA 1MF2L 4DFIA 3T09A 3D12B 3GIZH 2QELA 4JVWA 5JUEH 3DHMA 1DEDA 5F7UA 3D3VB 5A7BA 4C58B 4W6XB 1WIPA 4QKXB 4KJQD 4TL4A 1DO5A 4B6ZA 4EN3D 1OCOB 2P43B 1FCCA 2P3YA 2P8MB 5LXVA 1AVAA 4GW1B 4P2RB 3ZX1A 1FC1A 3BT2L 1F86A 4FTVA 3G6JB 1U8NA 4WI3A 4D7PA 5J1TC 1RPUA 1ZD6A 1S5IL 4N6QA 1A25A 1WRFA 5IJDC 2QV4A 5IEHB 4PCSA 2GBTA 3DC0A 3I6GB 3BSHA 3N1GC 1I1FB 4FCHA 2WTRB 3EDKA 1XIWC 2G5BA 3AT9A 4KXZH 3U36A 1ULVA 1DSFL 5E5MA 1EH9A 1OCWL 3R7RA 4PGEA 1BMWA 4A38A 3G6AB 2JKRM 3UBHA 4QRRE 3BD3A 4EUPB 4HYTB 1ORSB 5HHOA 2W81C 1RIUH 4LCVA 2ZZUT 1P2CA 2F53A 2F58L 1DQML 4LRIA 3QCTH 2WXOA 1VZIA 1E7VA 1OM9A 1U8IA 5DEZA 1O6TA 2VDMB 4ZAKC 3DARA 4K3DL 2YAEA 3SDCB 4GW4B 4L3CB 4PB0L 2GJPA 4S10A 2NR6C 3IKCA 1BZDA 4OZ4A 1PMYA 3K72B 2VDRH 1SVCP 4ZMNA 4QTIL 4WTZG 3ZYIA 5A7EA 1VESA 2PUQT 2WNGA 1TLMA 2WBJB 4J4PD 2NT1A 2A4CA 3ROOA 1LL1A 4X9BA 2FAUA 2R0LH 3EFDL 2XIIA 2YMOA 4OKVB 3UBFA 3VXSB 4X5WA 3SDDC 4DN4L 2YD8A 2VITB 4X6FB 2AV7B 1UB6B 2LVEA 4JJHA 4P5TD 1TPXB 3QUYA 2C3VA 3MYJB 1OK0A 2A38A 2E27H 4EVNB 3RAJL 4PWGA 3BWAA 2XN9E 4LSPL 5TQ2H 1XB6A 1LXMA 1JGDB 1F3RB 3HE7B 5BVPL 3V0WL 3FXIC 5C8JB 1W2KT 2JWYA 4UOQA 4XZUA 2AC0A 5AKVA 2BS9A 1I3RB 1P9MA 2WNKA 3DRTB 2WYIA 2YD3A 3FU8A 4LCUB 4XO4A 1LNUB 4YAQB 5IQNA 4BCYA 4ZQKB 1B0GB 4PV9A 4BZ2A 5IMKB 1J9CT 2VR7A 4L4JA 1D5ZB 3QCVL 1X5ZA 3U4EB 2Q2EB 4JO5A 5D1XB 3V4VH 2JJVA 1FFTB 3P3RA 1HT6A 2FBRA 1QFHA 3JVFC 2RFXA 2X4SB 1T2QH 3WNPA 3JWOH 4XN1A 4OTXH 1C5BL 1AFVH 5JORA 4X98A 5DC9B 2OSYA 4IMLA 2BVPA 1BZ9A 2IH9A 4J28A 1SYVB 1A6PA 1WFOA 4H0GA 1VKXB 1HWGB 1TTAA 4I13B 2CKBB 3O3BB 3X12A 3OB8A 1GHFL 3KPOB 1OW0C 2HN7B 3QEHA 5EU3A 2NRDA 5F1OB 1LO5A 3KM2A 4RGND 3U9UA 1WO2A 1OE1A 2CGRL 1PSKL 1NAMH 1B0RA 2FEDC 4WTWA 2IALB 3O9WC 1S9XA 3DDFA 1E4KA 3RGVA 5ECGA 1F0LA 3H3KA 3A23A 3JZYA 3GHEL 4LRIC 5IM7B 1PD1A 3UP1A 5FO8B 4CJ1A 1BF8A 4APQA 2VE6A 4Y4FA 4A2EA 1MHEB 5I76B 4GXVH 3WMQA 5IG7B 1SYVA 3ATFA 2O4EA 2K8MA 4Y5XA 3ARDB 1EJ6A 4MA7H 3GXUB 4AMXA 1SXZA 5E2JA 2FX9L 1OK8A 5AOLA 3L9EA 3L48A 3RJDA 2BLFA 3Q9QA 4R4BA 4TRPH 3C6LC 4L29B 5EWIL 3MBED 4JHBA 1HVXA 4QHNA 4HISA 5CJQH 1BFSA 1JGUH 4KMQA 3BSGA 2UWEA 2E6PA 1RZ8A 3FT3B 1Z5LA 1S3RA 3I6SA 4P4KC 5EZIL 3FN0H 4N8UA 2BVEA 1GCFA 3ME0A 5IJVB 3DOHA 3AS3A 4NRYA 3UAAA 3GSQB 2XQYK 4OZIA 5C6WH 5DC4B 5KSBE 4X7FC 5KVFE 3V4LA 4DK5A 2GI7A 4PJGB 2MJWA 1HESA 4PCYA 1NIDA 1CE6B 5CJ5A 2BY3A 3DO3A 2XX0A 2VQ1B 3D3VA 1F4XH 1NL0H 1TZGH 1SHSA 3GDCA 3H9HB 3QEUA 3T0EB 3CX5K 1FC2D 3T6ZA 1ZTXH 3L1GA 1T1ZA 5AUMA 1WFMA 3IDJB 3HBZA 4OCYH 1N59A 4P99A 1PZUB 3ZMRA 2OTWB 3DVIA 4KGJA 2FZ3B 1R3HA 3KG5A 4HIIB 1KN4L 3K1DA 4Q6IA 3O2VL 3ZKQD 1NCUA 2X4UA 1JWUB 1OOWA 1XSIA 3VXUA 3UTZA 3LS5H 4I4WB 4CC1A 2CA4A 3MRIA 4W4NA 1EDHA 2OW6A 1UENA 5KVMC 3WI9A 1GPOL 3PWUB 4DSYA 4XP5H 3V6OC 3UGUA 2Q7YA 3DSFL 1KY7A 3K5RA 4YHML 1IC5L 3JTTA 1HQ4B 5AW5B 3WHXA 4XPAH 2A7BA 2DMBA 2A6KA 1FFNA 4O51B 4AVHA 3KYKH 1X9RA 5T3XH 4K5MA 3U25A 1MFAH 3IU3A 2DQHL 3P2DA 5C0IA 1QBBA 1QFWI 1R3IH 1MG3C 4UM8A 2W65B 4PUBH 1A8JH 1AGFA 4BK8A 1G9MC 4IBVA 3CPLA 3QORB 3VXNA 4OD2A 2OX5B 1ICTA 2EDQA 1BFTA 2YOCA 4ADGA 5IJBC 4KZ0A 5HYSG 3CPUA 1RZQA 5IVXB 4Y16C 4Y7MA 5DJAA 1IRAY 4Z95L 1QTSA 3OGOE 4ZX5A 4HKZB 4M48L 3WS3B 5IJKA 4RGNB 1N7ML 2DY2A 4DN3L 5CILL 1XR9A 2X1QA 4LGRB 1MCEA 2J73A 3CDFA 2E0PA 5TGBB 2B4CL 4LKCA 2BNQA 2OQJA 3JTTB 1G9HA 3VSVA 4M5ZH 5I6OA 2V6HA 1QR1B 3KJ6H 1OIOA 3PP3H 2H7WA 1JD9A 5LGYA 1J9TA 1U8QA 2BVYA 4U1KB 1MAML 1ZGLA 3FB8A 3HNVL 1WIUA 4HAFA 2GCYA 1AHMA 1LO4H 5ESVA 1S5IH 3IBOA 4UAOC 3ZL4L 3Q5TA 5E7BA 1J8HD 2ZKMX 4DEWA 4NGHH 1GSKA 3FZUD 1J5OL 1H8SA 2R56H 4YSOA 3TVMA 5IB3A 2QPDB 5AW1B 1DBAH 1U30A 1XH1A 2X4QB 4QRPD 3Q6GH 3QWRA 3F12A 2HLFC 1PLAA 1QACA 3QEUB 2X4RB 4TUJB 3U7YH 3KPQA 2VRAA 3L7EA 2DQGH 3VRJA 3ATEA 3BP4A 4UIMB 5TH2A 4GRLB 2AJXH 1B4JL 3SJVA 4MS8C 1GW0A 1ZVSB 2NNFA 1MSPA 3OHMB 4PJHE 3MLWL 4NO3B 2AXGA 5DCCA 4XHJC 3VYOA 4K94C 2OTPA 1NLDH 3RQ3A 1GGUA 4X5RA 3QWQB 5I18H 1RZIA 2VAAB 5A43C 3DVNB 4JRYD 3VFUA 2CBTA 4P4KB 3DTDA 1QVOB 4X6CA 1Z3GL 4KPHH 2LAGB 3HE6B 3VDBA 3QUZD 4N85A 4IBZA 1EZVX 3RA7H 2DIJA 2J6WA 2VXSH 3MNZB 1L9MA 3ZL1A 5HJGA 3SO3C 5C0BD 3MGOA 2OMWA 4NKOB 1KCUH 1NCAL 2UYLA 3A4EA 4Q97A 3NSCA 1EJ8A 1LEKA 5BRPA 4QTFA 5C86A 1XEDA 5D96C 1QWHA 1RLWA 1R3LA 3BH9B 3FUFA 3NAAL 2XN9B 4XCEB 4XPTL 2J71A 2VZOA 2MIZA 2Q76B 3AQYA 5FB8B 3EYSH 2NQ3A 1EFQA 5D7KE 5JIQA 2VZ3A 3DA0A 4ZD3L 2WLLA 2W07A 4PYGA 4ZFFA 1D2OA 5E2WL 3LEXB 1L9OA 3QQXA 3LPPA 5D7JA 1DHKA 4XH2A 3T8XA 2A9ML 5KS9E 2XOTA 4YE0A 4ELMB 3HRZA 3QDAA 2P5PA 2H3NB 2KLTA 1OGTB 4XMKL 4PJFB 5FO7A 1MHCA 1MNUH 2EEBA 4UWQB 3ZTDC 3S3JA 1KPVB 4LPXA 2D7TH 5I2IB 1AGCA 3CXFA 5KYWA 2XHNA 3P77A 3U46B 3UTSD 3HBPA 4FFTA 3SE8L 1X7QA 5I9QB 1U36A 2EH7L 4JZNA 4ODXA 1GOFA 1OTTC 3FMGL 2GAZA 4JFXA 4LEXL 3CH1B 4N1EA 3LN4B 3MXWL 1JRHH 2VDNH 3QORD 1XGTA 4Y5VA 5AW4B 4EZKA 1F4AA 4F5CA 2CNZA 4JFQA 3FCTA 1KJ3H 3VXRB 3VM5A 1BWMA 3LMJH 4WNSA 4EPSA 2KQMA 4DETA 4NN7C 1A1MB 4FE9A 1P5UC 3NG5A 1QD0A 4HHAB 2DQFB 2XWEA 3S96A 1F6LL 3O11A 3WAJA 3QR2A 1E9OA 3BOVA 1J9SA 4NHUB 1HL9A 2QQNH 1FZMB 5GJSL 3TT1H 4Z7QB 1FNEB 1KFAL 3EXLA 1HEHC 1RUAL 3M8OL 3TBVB 4NNXA 3ZDZF 4GY4A 4TSCH 3M07A 5FKPA 4B7LA 4BELD 1FFOA 4ODXB 2YD6A 1H3WM 1WYJA 4WV1B 5HHXL 2RCSH 4MQTB 1CLZH 3IXAB 4UZSA 5GS3A 3QJUB 3TA3C 1H5BA 1QRKA 3O41B 3O6LH 5EOCH 3MNZA 4JL1A 1BLNA 2WXJA 3HAEH 3LX9A 4I48A 1Q0XL 5GS0D 1M56B 3A6BL 1JZFA 2YS4A 1KNOA 1UZGA 2QGCA 4NZTL 4PI0A 5FUOH 1C8PA 3WEXA 3IDNB 5D7SL 1TFPA 5CJOL 3K2UH 1GZQB 3QRLA 1TR7A 1V3MA 5HXMA 4OF7A 4XWGL 5F3FA 3VTAA 5I8CB 5MHSD 1RL1A 2WKOF 4F2MA 1T0PB 4X9HA 3FF8A 3LKOA 3LN5A 5JW4R 1N4XL 6CGTA 1J88A 3B6SA 3B2MA 4JB9H 5LCVA 2GQHA 3QJRB 4CW1B 5DRWA 2WOBA 1AQKH 1DUYB 2C8NA 5I15L 4GSQA 3IM1A 1AGFB 2CHZA 3MOBH 1T0MB 4B96A 3CIQA 1UXSA 1D3CA 3RL1B 4WHTA 4LSVL 3OAUL 4IEFA 3BIKA 1AC6A 5TFSH 2A5UA 4KJWD 2JXMB 4ZUVB 4XVOA 2HJFA 4E9VA 1R24A 4Z7WF 1X7QB 5KSAA 2Z34A 4H5SB 3LQMA 4FFZL 2Q86B 4LP8A 4Y1TA 3WXVL 3QYNA 4PW4A 2DQCL 4ZW5A 5CKGA 2E7LA 3C8KA 4UAHA 2JI3A 3UZQA 5HI5C 2X4NA 3PP3K 3UYRL 1QR1A 2WCPA 1XIWB 5IW6B 2GSIA 1NTDA 4ZW7A 3FB8B 2BSEA 4G8IB 3RY6C 4Y5VC 2F7QA 1E90A 4HPOL 3N9GL 3POCA 5KVDH 4GW1A 2HFEB 2GSMB 4PJHB 4Y2DA 4EI5C 3B5GA 1A3LH 4PJ9C 5HYEA 3FU3A 1R17A 3AU1B 2F5BH 3EDFA 2OR7A 3QGVA 1FNGB 4KTDL 2Y6SC 2OW7A 1IAKB 3IGUA 2DQCH 3T71A 5FFLA 2EEDA 3LKPB 3NSXA 4WWKA 5D7LA 1B0WA 4PV8B 3KBHE 3WMSA 4BINA 4TVPD 4I85A 1UACH 3QNYB 1BFVL 5IQ9B 3VQ1C 1EEZB 4YVUA 3ZO9A 4G9FA 3RFZC 5KBPA 4XNZB 2OXGA 2WAQA 1T83A 3KLLA 3RZCC 3DXAD 4NUJB 4V1DD 4M9OA 4CMHB 4GIOA 1TTCA 1C16A 3LKRB 4JQVC 1QEWB 5I0ZA 4H8PA 4PRAA 1IAOA 1WCBA 5JOFA 2AK4D 1XCWA 4WO4C 3ZHLA 4HX1B 1CN4A 1MCJA 3QDJA 1Y7VA 2XRAL 2EIBA 4H1LB 1I1AB 1KCSL 2CGZA 3FUKA 3WKPA 4J3WA 4DPAX 3QIWB 4RISH 4KTEH 3MFFB 3T4AA 5FO9B 1DQQB 5C0GA 1Z5LB 2CUAA 2YSTA 5BV7L 5FO2A 1QLEH 3T04D 3FTXA 4HWBH 3D4YA 1CICB 4ENED 4YSCA 2DV6A 4XWOC 2JXMA 4IKLA 4ZUVA 2R1WB 2NSXA 1O6VA 1Q1JL 3ZKMD 4BFOA 4FNSA 5HDLA 4D7BA 2ZCKL 2ED8A 4MAUH 4A6YH 1ETJA 1GZPB 3EHBD 3F7KA 1BEYL 4G8EB 4B9KC 1P6FA 2A9BA 5IW3A 4LARL 3WE6A 4DPRA 1WZ1H 2ICCA 1WS7A 3G6DL 3ZRSA 1G9EA 5JOFB 2YLHA 1MWAB 2HT2D 1XH0A 4CUCA 5GGVY 2PWDA 3WFCL 4FFWC 1TSRA 2FEEL 5A16A 1TJGL 3WXWH 4LU5L 3NYKA 4I9WE 1AS8A 4W81A 4OZIF 2AXFA 5CEZL 3ABMB 2OXHB 2R2CA 3UBXG 2PR9A 4IRSD 2A99A 1SJMA 4BFBD 4GUPB 2WANA 2MTAA 2V9TA 3GXNA 3KVPA 2D0GA 4X6DB 4NIYE 1MN4A 5T3ZL 2UX7A 3GBLA 3UJJL 4WFEE 2EH7H 3MCKB 4HS8L 4CRPA 4FXGC 4IBQA 3MA7B 2D9QB 5E03A 2QQLL 4L3EA 3GXDA 4G1MA 3TBVA 3PWLA 2ZXQA 1NFDA 4PWJA 1LHZA 3NA9L 4R8WL 4MWFB 4WIQA 3W9DA 2X0VA 3BPCB 4UZUA 4NQVB 3VWKC 5HBBA 5HY9B 3WIIL 5DMGC 4YX2L 3QXWA 1EVTC 1CDGA 1NIEA 2G9HB 2A9MH 4G7QB 1WWCA 2Y36L 4LCYB 3VG9C 3WN6A 5C3IA 2EINB 4LP4A 4DGWC 3EBAA 1D5BA 3CMOL 3F58H 3WO4C 1SN0A 1YG9A 5D1QC 4HIHB 2QVKA 1Y1UA 3Q8CA 4J27A 3V95A 5TGBA 3VFRA 4JJ5B 4ETYA 4F8OA 2ZWSA 5FOBA 5AYQA 1J5HA 3FAXA 2HFFA 1ED3A 4AQ1C 4Q14A 4MB3A 3BW9A 5FUOL 3D51A 4W9FC 3U6RB 3ZKND 2HT4C 1PYWB 5CP7A 3HCVA 2IAND 4P46D 4BA8A 4OGXH 43CAA 1O75A 3LY6A 4O00A 4X0NA 1S2EA 4H88H 3ULUL 3T3MB 4OI8A 3B6SB 3DV4A 1G5AA 1Q9LB 1RJYB 4PJ5B 2NYYC 1A9BB 4WU7B 5CD3B 2AKRA 3NEXA 2CDGA 2B77A 5ERWA 2AK4B 3EJCA 4RMRA 4MS8D 4W1TA 2EUZA 3P11L 4I77L 5JW5A 2DDQH 4KQ3L 4X7TA 1KN2L 2WLLB 2JTDA 2Z35A 2A6IB 2WMPB 4ZOAA 1CGVA 4YHKH 1K2DB 1R3KB 2GVYA 2HT3D 3NIFB 4GRWH 3UZVA 2FB4H 4KWUA 4P5SA 4DO4A 3VX0A 4DO5A 1D9KC 4EBQH 3D25B 2H9GA 5ESAB 2WZ0A 4Z7VE 3D0VB 3U6RA 1AQHA 4G3YL 4TNFA 1XL6A 3T0DA 2ADFH 5B1CA 3B43A 1O7DC 3QFJB 4LLAA 1EX0A 3ECQA 4MD4A 1HXKA 2G75A 1KB9J 2VITA 3H4FA 2BIQA 5HHMB 4G7YL 2C9PA 5IBTL 1G6RL 1SMDA 3L1OL 3NIDB 1N59B 3SKJL 1RJYA 4PJ5A 1A02N 1SXSA 3T5WA 2UVFA 2CDGB 5ERWB 3D5OF 2RH0A 5LGJA 3TEUA 3ROOB 3E3QC 2JMRA 4UNVA 3ZQXA 2I9TB 2P5EA 4QPEA 1VIWA 5EIIA 4Y5XC 3FU5A 2P46B 4DUVA 1SOXA 3PDGA 2VL5A 5CILH 2GIMA 4QOKA 1T0NB 4TSBL 3S35X 2YAMA 1H9DA 1HQRB 5DVMA 4OGAD 4Y4FC 2VM4A 3GSWA 2CIIB 5E9AA 4IRSB 3KYMA 4IBWA 1DBBH 1SLUA 3IPFA 1NAKL 2XRAH 1U3HB 3RPKA 3QJHA 2YRLA 3VFRB 2VUOA 2HKHH 2ZCZA 2V7HA 5C09A 3MV01 2DS4A 1KDIA 3P77B 5E4AA 3U46A 4U1LB 3MV9D 3P9LA 3V7AG 2CRZA 1OAUH 3OHXC 3MRMA 2WY3B 1XF3B 1PYWA 4TUKL 5C0CE 3S35L 4BWTA 3AROA 5DHYB 4PJDA 4LCWE 1UA7A 2WHVA 2X6BA 5GGUA 1U58A 3CXHK 3U83A 1YQVL 2DI9A 2JK5B 3OKYA 3RLSA 5F0MB 4PRHD 1X5AA 3KGRA 3P3SA 5KJRL 3EDEA 1ZVNA 5GIRB 1HWHB 1UT1A 2BP5M 5T3ZE 5EBMA 1AHWC 1X5KA 2GCYB 1WTGT 2WMPA 5A2KH 1TO5A 3HHSA 2Z64C 1T1XB 3W3BA 5G5DB 1QLFB 4TQEH 5C71A 3W11D 4N26A 1NLBH 2CIKA 2DWDA 2FBJH 4EI5B 4FYRA 2QDWA 4IEFB 3RPIA 3QZOA 5H94B 5DTFB 3WEAA 1WUNT 2W94A 3AXIA 4RX4D 4WFGD 4ETQB 3GMRB 1XCXA 4JHAL 5FYKD 3BLBA 4BQ6A 2O6DA 5BW7A 2VOTA 3CFBB 4XVUC 1PLGH 3L95A 1C08B 4KAQL 2VLME 3NIGE 5DHDA 5FW6A 3DIFB 2XDHA 3BQUC 3TPUB 3TNNB 5EN3A 2ZPKH 1PPIA 2OJZL 4C57C 2GPZA 5FK9A 1I1FA 2YGPA 4X6BA 2A74B 2FJHA 3CE1A 4F20A 5EF1A 4X5XA 1IM3D 1NH6A 4YR6B 3MODL 3TO4C 3T6VA 4TV3A 1KELL 4GEIA 2OMZA 3SE3C 4JFDB 2WINA 2GTWB 1S7SA 3R1GH 4OFYD 3VGAB 2XG4A 4F57L 1Z7JA 3LYRA 1AKJA 4I3RH 1S7RA 1PKOA 2NPLX 1RFDH 2DAVA 5FYKU 1AZBA 2Q3XA 4ZFZA 4AZ8B 3QXUA 2UYLB 1KDJA 3DX6B 1D5RA 3SCMD 1ETB1 3ABLB 4TQPA 1TETL 3UPAA 4KZDH 5DJZB 4BFIB 3MBEC 5I8KL 3QJTB 4N8PA 5EEWA 4XMPH 2DLFL 1G84A 4AH2A 1NGQH 2MNJB 1S6NA 3RZCB 3ULVH 3BKJL 3IFOB 2WIIB 3SE9L 2EYTB 5CSZB 4A7VA 1BSIA 1OPGL 4F80A 5T1KA 1P5VA 3CWGA 2IPTL 2YK1L 4HMDA 3WENA 3H9HA 2O5YH 5DD3H 4BZ2L 2BPBA 5I0DA 1KTRL 1YC7A 4JO3L 4WKZA 1FDLL 4C56D 1TZIB 3ABKB 4NBXB 1ZT7A 4WW1B 2DQMA 1AMYA 4NAQA 1H15A 3ARFC 5T1DL 3EYQC 4ZX3A 4XVSL 2HG0A 1KN4H 4NZDA 2QFRA 5AB1A 2OJZH 3LN4A 4PIBA 4PRPA 4N6RB 2BH0A 3GSVA 4LDCA 3EBHA 4NDMA 3SDAD 2JCWA 4NUMA 5B1BB 4OCYL 3ZBMA 1KB5L 1A7QH 3NFNB 3QRBA 2YQ3A 2BZ7A 4IHOA 2E76C 4UZGA 5E2VL 3VD9A 2J6EL 2VR4A 1ZKAA 4WHYG 4F1ZA 4LDOB 3GTTA 4ZS6D 2Q6WA 2NY0C 1S3KH 1KT2A 4L3AA 5KYXA 2ISDA 3RWFA 4KH2A 5C0DB 4URKA 5IROC 3TV3H 2PPEA 1HZKA 5JQIB 2R69L 4H0LC 4N5EC 3C6SA 5EZIH 4Y9EA 3TV8A 4G82A 3ULAB 2V2TB 2WXHA 3EFFA 2ZX6A 3N04A 4PRPE 5D4JA 3VWJC 1N6QL 4JR9L 4LCIH 1JERA 3TN0B 3NJKA 2KC0A 1NUDA 1TQTA 2XETA 4E41D 2PPAA 3QFJE 3X1NA 5F21B 1MJ8L 2H6OA 1F41A 4N90E 1YQVH 5J7CC 4YFEA 1ACZA 3IJ9A 4JZJB 5ID1A 5EIVA 2Z91A 4G80A 2WBXA 5K39A 5KSUB 1VRSA 1MW2A 5A2LH 4F8TA 3D39E 1TZAA 1DQLL 2CIIA 4BQ9A 2WLNA 2Z93B 4GQPH 2C9SA 4YK4C 2CRIA 2PXYD 4GFXA 3SE6A 3GMNB 3A4FA 3IJHA 4OVVA 1IEBB 4OVUA 1HE7A 3BQUB 4LSPH 5TQ2L 1OQOA 3Q13A 5AAPA 2Z31D 3EYVA 5AG9A 2ZUVA 1B90A 1BBJB 1GGBL 4KK6D 4TUJA 1UOKA 3FHQA 2PP7A 3SZ6A 2BNUA 1RUML 3V0FA 3QH3A 1F97A 4RZKA 4XHQA 5AB0A 3OX8A 5EU4B 2P5WA 2Q10A 1JXJA 1T20B 3CN0A 3DX8A 1SXNA 3TH2T 1WF5A 4XOCA 4ZUSA 4OD3L 3BVWA 1OP3H 3SCMB 1MXGA 3WL9A 2IO5A 4OKVA 3X17A 2DD8H 2VAJA 3CZNA 2VDQB 1RH8A 3AT8A 1GR7A 1UT2A 4FYTA 4ZDHB 1YYLL 4L3ED 1IEAA 2ITDA 1LO2L 1VENA 1AGEB 2ICEB 1CFSA 3NQIA 3DRQB 3QC5X 3V2AR 4B9IA 5D1QE 3GSQA 4YHPA 3BHBB 4LHUG 3U7YL 4ABWA 3PJLA 1BFOA 2GHZA 4IHOB 4R7DB 3IK2A 3KWUA 1UQSB 2MOQA 1IAMA 4FF9A 1XGQB 4M6ML 3FW6A 4MKTA 1X9UA 5F93C 2BCKA 2K6ZA 4KKBC 2GT9B 3APDA 3DJRA 3WY4A 5JHDD 3HE6D 3SZKC 1Z9PA 3MRKA 5E1AA 3Q5YA 3SQBA 3TBWA 4YHLH 1PVHA 4XCEA 4H25A 2F15A 3QULB 2DM7A 1EZSA 3MI6A 3KYNA 4UI2A 1W8EA 1YECH 5I5MA 1KN2H 5DYFA 5LQBL 5FYJU 2NUTA 4E42B 5F6IC 3IDGA 3BN9C 1F90H 2X4SA 1IEAB 2JQMA 3BQVA 3K8MA 1WE5A 1AD9A 1ODUA 3DMMC 3PWPE 5FOBB 1MJJA 3ARFB 2FT8A 2FSEA 3LIUA 4KKRA 4DK6A 5EPMA 1NZRA 4WWPA 1E4WL 3RVWC 1MCSA 1J8SA 1TU2B 1TZHA 2WXLA 1HIML 2OI9B 3B2UD 3EJYD 1G6RH 1ZJAA 1O6SA 3HZYA 4N0FA 4NIKB 4OSUH 2X05A 3ZOAA 2FJFB 2FNWA 1R19A 3WUWG 4U3HA 5SWZA 4F3FA 3D52A 5C70A 3JYBA 1IZJA 4X6EA 1ZLVH 4KGLA 4M5YH 1OAXH 3IJSA 3UTTA 2CUMA 4OGYH 1DVYA 3QORC 5ILTL 3WEBA 4GBXC 5D2LB 3KGTA 3MNWB 3S3BB 2EYRA 2YQGA 1CK0L 2E9WA 3GJFK 2CAKA 3I6LD 2VXQA 5FHBL 5A2CA 1FVCB 1JHKL 5H37A 3UEZA 4XMWA 3ULSB 1IC5H 2PO6A 3O6KH 3HI5L 2XXMB 5I26A 3N41F 4KOBA 5C08B 4F7KA 1QUPA 4HAKA 1OKEA 1FO0A 5E6UB 3AAZB 1J1PL 3O11B 5IOKA 3BZ4A 4JHZA 5D7EA 3BYTA 3ECVA 4JG5A 4OIIH 3CC1A 4Y16A 3QZBA 1KV3A 5LHDA 1TFHA 5HGDB 1O6SB 2A77H 1XGUA 3HZYB 5ICXA 1ES0A 4NO0A 4LE8A 2WXKA 4WDIB 2WNWA 4LBAA 4X4XA 4KY2A 1MCCA 1AD0A 4RRPM 1QYGH 3ZTEA 5T3ZH 4PGZA 3ILQC 4M4RB 3X11B 2BHFA 3WIHH 1BWWA 1KPRB 1S7WA 1U92A 5F3BB 4WAFA 1CICC 2L7JA 3DOSA 4K3GA 3KXFB 3IDXL 2XWTB 5F7FA 4U1HA 2PXYC 4UQ3A 5GRUL 3FFDA 4IIQB 3D6GA 2NT0A 5DA4A 5GZOA 2OMXB 2OMUA 1KCVH 2P24B 1FO0B 1QFOA 2JFCA 2TAAA 1I1AC 5JW4N 1UHVA 4LIQE 3SQOH 5CLZA 2MPAL 3THML 1MHHB 1ZK5A 4PJBA 4X7EC 4PJGE 4Y4HC 3GMQA 5HI4D 1ET5A 3FS9A 2AERT 3O3AB 2A9AA 5GGRY 5DZAA 3RIKA 5F96L 1NCCH 1UB5B 5KBMA 3A6CL 3UJJH 1S46A 3MYZA 1N2RB 2PYEB 5D1ZA 2LLGA 3MOAL 4N9GA 3GBDA 4O02A 5DEGA 4QRUA 5I1IL 5JHDB 3SE9H 2Y1VA 5KSAB 1VEPA 3DUUA 3HR5B 4YLQT 1RZ8B 3FT3A 4MNQB 3RVTD 5BO1H 2VR6A 3D18B 1JZ5A 1AMXA 5EEXA 1KBGH 3LKNB 3B2VH 3MA9L 4KZDL 3HTLX 4NN6B 1FFPB 4FQQA 4FTVE 1A64A 4OCNC 3ULSA 1W72L 5BRZA 3M46A 3DX7A 1ADQA 2E6QA 4IK7A 2P28B 1NANI 3HOGA 4G8IA 2K0RA 4C4BA 4IOIB 3VXUE 3AB0C 3C6LA 5B1JA 3DYMA 4N2NA 4KK8C 3NFPB 2ZXBA 1A4BA 1SY6A 4ZFZB 4AZ8A 3QK0A 1FYTE 2QTVA 4KITB 1W72A 1MCRA 4JGMA 5JXAH 3K5SA 2V3FA 3RPIB 1WA0X 4QAWA 1BVKB 4YDMA 2X6CA 1BW8A 4OFYA 2ADJA 4ETQA 4F7TB 3ARBD 4NHCH 4R7NB 3VX1A 5KW9L 4UOJA 3H2WA 3IGAA 2CK0H 3AXHA 3FJTA 3ULVE 5GJTL 2YJQA 4MS6A 3D18A 2QPUA 4WJ5B 3BAJA 3N0AA 2QQKH 4LHJB 4O02L 2VKXA 5JMOC 4MHHI 3PWUA 1BPVA 4N2FA 4IQHA 4UNUA 3WN5C 2YUWA 2VLKB 1F6AA 1MW3A 3PIQB 5KZCB 2YO3A 3WNKA 4X8JA 4YDJA 2HFGH 3V8CA 4S1SL 1TZ8A 4IBLT 1YSOA 4MD4B 1XAUA 4FTDA 3AMKA 1P1ZA 1KYUA 2P52A 4UCFA 5HGHA 4NHUA 5TF1H 5ADPH 1JV5A 5ACLA 3VGHA 2AJYH 1UZ6E 2YXMA 4HH9B 5I6NA 3JV4A 1C7TA 1CD1B 2I60L 2IADB 4L0PB 3WXVH 2OR9H 5ANME 4AC2A 3MRJA 5FYJE 2OMBA 2QTEA 4GG8A 5A2IH 2NY0B 5F0PB 2DMHA 4YQXH 1GYAA 4DQOH 1QRND 3H42L 3FPXA 2I60H 2K9UA 2ZOOA 1HHIB 5HHOB 2GB2A 2H26A 1QKZH 3HG0A 5EN2B 5F2FA 2LE9A 4NO5B 3MRRB 3BMVA 5F3HB 1EGJL 5FFOA 3S88H 3G9VA 1ZWIA 4ODHL 3VXRE 2HVJB 1BQSA 4G8EA 2X4OA 1QFUL 4D3CL 2XV2A 5FHAL 3KS0H 3SJVE 5AD0B 4OCLC 4HFUH 4WKZB 1HWWA 4PW3A 3BAEH 2NY3D 3V4VA 1DN0A 4DPBX 3POHA 2P8LA 2AEWA 2BFVH 4NKDA 3QCTL 3BWSA 1CD1A 5CZVL 3KM1A 3CV5A 3VI3E 2YPKB 3N55A 4K3JL 5D7IF 3HJ0A 4OV5A 3MNVA 3SGDI 3ZT5A 2YA1A 3TX4A 5EOTB 2Z91B 3QFDA 4G80B 4JRXE 1KBPA 1JPSH 1MJ7H 3FL7A 4HWZA 2HKAA 3PL6D 3S3DB 3T8VA 1D7DA 1A2YB 1A9EB 2R2HA 1P4LA 2FHCA 2NNCA 3N06B 1JHLL 3GMNA 4PB9H 3CFKA 3PJSA 2ZOKB 2IQ9L 5I74C 3VI4A 2IG2H 3L3DA 4FEIA 5MEQB 4I0PD 4WHCA 3M8OH 4JQXA 5IBTH 4JFFD 5EU6A 1DJYA 2BP3A 2CGYA 2PTVA 2PW2B 5GGTL 2QR0A 3DURB 3R19A 5BXFB 1ADQH 1L9PA 1WISA 4H1LH 4XAWL 2VMJA 3MV7D 4ZQKA 1V3KA 1NIAA 2K78A 4NN6C 1JBJA 2NY5H 2MMXA 5EZOH 1M7UA 3CH1A 1KGIA 5GGQL 3VGAC 4YS4A 5T1JA 2QMJA 2BCMA 1SM3L 2HYMA 5I30H 3QJSB 1R3LB 3JWNE 1MCNA 2WLZA 1JDDA 3ZO0A 2BZDA 4RESB 1C08A 5HVHC 3JV4B 4J8RB 3UABA 3SDYH 5TE7H 1VADA 4L8SB 1N5AB 5HDWA 5K39B 5KSUA 2FVNA 3MCYA 2OPCA 2A0LD 3BW9B 1A5FL 2JTYA 4M7LL 1BPLB 2KQNA 2WOYA 3TBCA 3RFRA 3FH7A 4XMVA 4ELMA 1ESOA 4ZYKA 1AQ8A 3EG9A 4B9FA 4OCWH 1ZA3A 3HZMB 1KTBA 4WNQB 3L3IB 3M1BB 1G1KA 5KOVC 3UL4A 4M02A 3HNSH 1HJCA 3QPKA 4PJXB 2ZOTA 5HDQH 5EFIA 5K9JH 2A2QT 3DV4B 2F8VA 1JI1A 1EMTH 2R29L 4OLVH 3VTMA 4ABUA 1GGIL 3NK3A 2BXYA 1R1CA 1CT8A 1EXUB 1UB5A 3BWZA 4ENZA 1HTYA 3DJTA 4DEPB 1UADC 1N2RA 1T5KA 3VFTA 1P7QD 3US0A 1A7PH 2IGFL 2ZSVB 3NJHA 3K71B 4NUPA 2Y5EA 4ODSL 2QSCH 4YLCA 5JQHC 3F58L 1KB9K 4FMKA 3VE0B 4AM0B 5TJWK 2DYPD 2ZSWB 2Y1ZA 4GSRA 4S0TD 1D9KD 3UFIA 3QYCA 2NW3A 4GMSL 4RNRA 2EC9U 1YNTF 1IARB 4PGEB 4H7VA 1MCDA 2R29H 1GOHA 4PBDA 5HHOD 1AZUA 4YWGL 1GGTA 1QNIA 4O2CB 2ZD0A 2XN2A 3RTQC 3TZVD 2QQLH 3AY2A 2EUWA 1GH7A 2MRYA 3MLPA 2W38A 1TENA 4D9LH 1E3XA 4TNWK 4XNZC 4FXKC 3WNOA 1H15B 4KKZA 4HIXH 5DGRA 3MGTB 1KG0A 4JS7A 5GRZA 5FA4A 4L9DA 3IF1B 4O2EA 2A9DA 3G6JF 2NMSA 4UOZA 2R29A 2E86A 2E7BA 1B6DA 3ZSTA 1JP5A 2GK0B 2R51A 3VSQA 3VWJB 3O41A 4EQ3A 4GP5B 3SDCC 3EYQD 4NRXB 3C5SB 2O72A 3TVMD 4WF7A 3B7RL 2ORBL 3I3DA 1CK0H 2IANB 4YPGB 3EJQA 2Q1EA 5I75B 2AXFB 3C8KB 1S7VB 3M1CA 4LEBA 1GGIH 3Q8AA 4X83A 4XP4L 2EVFA 1GZQA 2VDLH 3F7RA 5KVEL 5HDQL 5C0FB 4GIPD 2IG2L 2OYPA 1SVBA 1WZKA 3AG3B 3GZQA 2ITCA 2ZUSA 1FIGH 3EYOB 5MI0C 4RAVA 5F1KC 4S1DC 1WZLA 4UV4H 2VERA 3DK0A 3MV7E 5ID0B 4PWEA 3JYCA 1JVOA 4PIRF 6FABL 5ABZA 2ZNWA 4L4TB 2H32A 3T65B 2YKLH 4M03A 4ODVL 4QLRA 4HWBL 1R33A 5B3SB 5J5EA 3I6KA 4JFFE 5JIPA 3DBXB 3AREA 1OPOA 4XRCA 1ANUA 3C5SA 1T7ZA 3S8WA 5L8LB 2CBMA 2IIJA 1VFAA 4POYA 5I1GL 4JJOA 2FECL 3LNDA 4QXUH 4Z9KB 3BUYB 1Z1WA 3DYOA 4MZIA 1DBJH 2DQGL 4GIAA 1F58H 2XACC 3ELQA 5JIIA 1BD2D 2IH1A 3QUYD 4MXVF 5JMRA 2GSIB 3L3JB 5D71H 2W65A 4WO4D 5FK9B 4J39A 3ES6A 3L9BA 2R1XA 1I31A 1SOKA 2EH8H 1INEL 2BSBA 2HRHA 2C4XA 1A1NB 2JJTA 2YPVH 4LASH 5DTFA 4CC0A 1NGXA 4OI7A 3X3GL 1AI1L 2JKSA 4LPTA 3RFZB 2VDRB 1RD6A 1UA3A 1I85C 3L5WA 4B9ZA 3VG0H 1NUGA 3HW7A 5EZPA 3RI5K 3FYEB 3IJEB 4GKOA 1QAWA 4O9HL 1L0XA 4NC0B 5E8NA 3GMPA 3GNML 3OLGA 5E6IA 3S37X 1LE5B 4I7ZC 1I9JH 4PRIB 1V7ML 1V8HA 2WM0A 3MGAA 4NZRL 2AGJH 1VEMA 3ZL2A 3EJSA 2VTFA 3OVUB 1DLHB 2D4DA 3KPSB 1QWUA 3L4VA 1OD9A 1A9EA 4WO4A 1NDGA 3CC5A 3UZVB 4I2XB 4P23D 4EDWL 4F24A 5E2TL 4HPOH 1S7RB 4AVKA 2N7SA 4K23H 2EDWA 3OPZL 4YC2B 2YD2A 3O3AA 3UG5A 1W0WA 4Q6KA 4Y5YC 1OAJA 2WQUA 3ZW3A 5MI0B 2APFA 3V5HA 3RFZA 2AAVA 1UVQA 2D73A 4LCCB 4MQXC 4PW9A 3DBSA 3T3MF 2J5WA 5EF3A 2EE3A 3MC0A 4L29A 1U4EA 1Q9WB 1ZHKA 2X2HA 5GJTH 1KULA 4MBOA 1QG3A 2QGDA 4ODWB 5CEZE 5DS2A 2A73A 4A37A 3VM7A 3CZKA 3RWIB 2XVBA 3HI1A 3KLAA 2CKBL 5B39A 3B4NA 3B37A 2GHWB 5T3XD 1UURA 3QISA 1BLIA 3MOBL 4TRPL 3TFBA 3MRPA 1XF4A 2FUTA 2DKSA 3OKLB 2AJ3B 5DK2B 1ZT7B 4Y4FD 3IDIA 4EOWL 4PRBB 4CDHA 4L4VB 1B4RA 3HUJF 4MZ3A 4X6EB 3QWOA 1P4BL 4XN2A 4ZRGA 5AZEH 1WUZA 1BHGA 1FE8H 3FTGB 3TA4D 5EC2A 4N8VA 1RURL 3BRFA 2W95A 2CHDA 2A9NH 3A6BH 3VU2A 2GUOA 1UOLA 5DQDH 3GHEH 3C6SB 4Y88A 2XLLA 4HOWA 4MD5A 5F7BA 1MIMH 1NGXB 2AW2A 4CN4A 5I8EB 1NFAA 4X6DE 1Z9SA 5JHMA 1LQBC 4URTB 2O26U 3C08H 5GGUB 3RDTC 1CD9B 3BUBA 2Q6WB 1K4DA 3BIAX 4NKIL 5IK3B 2W59A 3PE9A 2FO1A 2AEOA 2BJMH 1GJWA 4JFDE 2GY7B 1XF4B 4DT2A 1TQBB 4G42B 4WK4B 5CEXA 5I17B 3IE9A 3ETBJ 4NQDE 1K8IB 5F7AA 2DJUA 4GRLD 4PRBA 4O51A 1RUKL 4JDZA 3KAAA 1OSPH 1YEEH 3SQOL 2CLVA 2J6EA 4WHDA 4A55A 1TEFA 3A3YB 3NJMA 4ACTA 1F42A 1OPGH 4WNJA 4M6AA 3WEMA 3QAZB 3CBKB 3QZNA 1OHZA 3BQUA 2I26N 4YO0B 1X5IA 3ZE2B 4NT6B 3EGDB 2H0FA 2XFGB 4NB7A 2IWGA 5B7EA 4Z3TA 2P48B 5I8KH 2EQDA 2R7EA 4QDGA 4ANXA 4QYOA 3HN3A 1IMHC 4R7VA 1A1MA 5BW7C 1FZJA 1H5BC 2NZ9C 4ZZFA 2JELL 4Y2DD 2CRMA 1J5DA 2JJSA 3CFBA 2JKNA 2YMXH 2XTJD 4JN1H 1PSKH 1OLZA 2QKIC 3ZE0F 1HE8A 4BZYA 4FQIL 5I71B 1OAZH 3QZWA 5J56B 4E0RA 1ED3B 4X99A 1YEIH 3J2PA 5AOJA 3DV6B 3KPSD 3RAJH 4ENEC 2G75B 2FGZA 4OUUA 5CSGA 1BAGA 2VZTA 4NP4L 1HI6A 2MPAH 3THMH 1GMEA 5AL0A 5ANHA 4KZEL 3BKCL 2EZ0D 3BQUD 2HRGA 4LQ1A 4NUQA 4BZ1A 1UD2A 1ZTXE 2NX5D 4P2CG 1F45A 4H8WH 1I3GL 4N2BA 4MAYB 2G4EA 2VDQH 2DPKA 4F37K 4PSRA 1L7TL 4DAGL 2BIHA 3MFGB 2J2ZA 3MU3A 4K8RH 4NQEA 1N6VA 5TQ0H 2MKLC 2OMVB 2JCCA 4PJDF 5FM5O 3T0EE 1P84J 1X5FA 2J1KA 3FBQA 2NNAB 4ONHA 2W5PA 5HHPB 4AL8C 1LDSA 4K7FB 3U7AA 3BCFA 3NTCL 2IH1B 3RY5A 2J7LA 2E27L 4B3EA 1EAQA 2YEZB 1IGTA 2ZXDA 4PG9A 3BLKA 2HH0H 5CNHA 1U9KA 3KD4A 2V4LA 4W9HC 2HUHA 2IDFA 3FB7B 1BP3B 3BAIA 3HE6A 4H13C 4JRXD 1NDTA 4PJ8B 5HDBB 4O58L 3K71A 2K1MA 4R6UA 4PJDB 3GKZA 4RBPH 1UM5L 3U4KA 6PCYA 4EI6B 2X4PB 4N24A 4WKXA 2BIPA 1P0SE 3ULUF 1FBIL 2E8YA 2C5DC 3RI5F 2WVSA 3IWUA 2HZHA 4UBDD 4RQQA 2Z1PA 2WYHA 3NFNA 5IFHH 2FEEI 3QO1A 1YEHL 3GS7A 5IW6A 5A2FA 1FNFA 1C1EH 4HCRA 4R2GB 3SJVD 3D85B 5EU7E 3CBJB 5JNYB 2PCXA 1P7QA 2VQUA 3MAWA 4K3DH 4E9QA 5IB4A 1HAUA 3PAUA 1F1DA 4P5MB 3WJLC 5C97A 1TJXA 3IDJA 4UYQA 4G6AD 2WZPD 3RWFB 2AJSL 1U8LA 3KLDA 2CDEA 2EXWC 3OQ3B 3O45B 1M9WA 2J8UE 3Q8BA 5HGDA 4UTAH 1URLA 1LM8V 1YYLH 2J5LB 4AYDC 1CF1A 2WBJA 4M6NL 3TWCH 4ELDA 3BPOC 3CSFA 3DGGA 4MB1A 5B1KA 1PL3A 3O2WH 3O6FD 4LNRB 4J3TA 1R47A 4Z7AA 4WI2A 1YECL 1FN4A 3V4PL 3QRGL 3SYAA 1NCIA 3HZKB 3K6FA 1KIPB 2EXSA 2ZAGA 1URZA 4DH2A 1VA9A 2VO8A 2YMXL 4X6BB 1ZSHA 2J8UB 3GGWA 2EDFA 2Z9TA 3RVVD 4X2UA 3RTQA 3L3KA 2VDLL 3ARUA 1G7LB 1UGKA 4X4XB 1R3IL 3AY4A 5EORL 3L3GA 1GY2A 2HTLD 3BAKA 2VW7A 3RNQA 4RFEB 1VPOH 3RKPA 3VQMA 3P0YL 2GKIA 5HHPA 3QQ3A 1VFOA 2R1YB 4U3SA 2FK9A 4HEPG 4DP5X 2VLJB 3EOTH 3GMQB 3KXFA 1LO2H 2GEQA 5D2LE 4W9IC 3VXOB 4M8VA 2PCPB 4JUSA 3CU7A 4N8VB 4DOHB 2C1PA 2UY6B 4PJ7B 4NI6A 2XFXA 3NZ8B 4R96A 5GZOD 2OV0A 4HKXB 1NIFA 4MCYA 1A3RH 2JKTM 4YPGA 3Q3GB 3FO2B 3L4WA 3NBNA 3LQZA 2BVPB 1T4KA 3P69A 1KGYE 2ZP9A 4XI5D 1RZJH 4FD0A 1OM3L 3OKNB 3UZEC 1CQYA 4QRQA 1QPKA 1UCBL 2CO7B 3FK3A 3KPPB 2ARJA 4UF7C 2A9NL 4HCRH 3MV8B 4JM2B 1G7HA 4IBSA 4JDZB 3L5WB 4FG4A 4YSRA 2VDMH 2DQTL 1GS8A 1U3YA 3H0TA 4LSQL 4POZC 5CLYA 4UYPA 5DC0A 4AENB 1U8JB 2BNQD 1XGRB 2PYED 1HL5A 1NKGA 1A7QL 1LMKA 1T0MA 4DZ8B 4NC1E 1U3NA 4E9LA 1U8LB 3RILA 4N0UB 4PVLA 1TTGA 2LAAA 4U1IB 3P9MB 5HJBA 4JDVA 5KSAD 1C5CL 3FO2A 2WIIA 1HHGA 1KB3A 2QKSA 4P0DA 4JM0A 3DX7B 3OB0H 4YL4A 1QTPA 2ESVA 3VFNB 2MNUA 3UG4A 4TUOA 3T4YB 3T2NL 4JO3H 4PJHF 5CR8A 2KZ1B 2PTTA 2FX9H 2ZXAA 2MQGA 3KXFD 5SWSB 3HIZA 3JVGC 1BQ5A 3B3IB 2WWKT 1NMBH 5E08L 2V8LA 3MROB 5DFAA 3DIDA 2EKSA 2BY1A 2P5EE 1A7RL 5HY9A 2APSA 1NC4A 5PAZA 2LLNA 2IAAC 2VR8A 5HGHB 2VQ4A 4ADJA 4WW2C 2NY7H 5TDNA 1VACB 2WWNA 4LNVA 3Q2NA 4XMPL 4KK8D 3MJ6A 3TT3H 4KHXH 2ZUYA 4XXCA 4D8OA 5B39B 1T66D 1I75A 2E8ZA 1F6AB 2HPTA 3QUKA 2ENQA 4G7SB 4AYBA 1YEEL 5I0VA 3N43B 1CIUA 2ICES 1NWOA 2X6UA 3BKYH 1E6OL 2AJ3A 3PXLA 1OVZA 3HFML 1WWBX 1YQ2A 4J23A 1XTLA 1YNLH 2XV0A 4JGUA 1UTDA 2WWOA 1MHCB 3UTTD 4TS6A 4HEPA 4ZK8A 4DNLA 1KIUA 1NFDF 3NQKA 1H6TA 2WB7A 5EU5A 3FZUC 4ONGH 3ILEA 1QSFD 1DANT 2HVJA 1RZKH 1I7ZA 3MGTA 1IM3A 1BX2A 1NA8A 1SHWA 2WSPA 1MEXH 1QP1A 2GJZB 2OMTB 5AVSB 2PO6D 4JM4L 5CCGE 2OSXA 1YPZA 3K6SA 3WE1A 3WBDA 2R39A 1JTOA 4U0QB 4HG4K 3HNTL 5CSBA 4RISL 1YUHB 1OGAB 4RMTA 1BJMA 3FTUA 2VXTL 5DFVD 3SPHA 5B3JF 1IBGH 4PAZA 2XZCL 2E6JA 4RX4A 4X5WB 3RVUD 4PLNC 1GTFA 3BGFB 2XUWA 4XPFL 4BK4A 2VLMD 4F7MA 3SD5A 4JUTA 3TJPA 3MRFA 5FYLE 5GHWL 4EQ2A 4XP9H 4K8RC 5C0FA 1PAMA 2JCCF 4GAJH 4PQXA 3D30A 3BDYL 3RIFK 3RIFF 1RQ5A 5JYLA 3EYVB 1JXGA 5IFAH 1MH5B 1AG0A 3CSBA 3MODH 3WO3B 3H42H 3UTPE 3WCYA 2OYMA 4KI1A 1AIZA 4YO0A 4QCIB 1X5GA 4JM2D 4NCDA 4DN4H 4XTRD 3LPFA 2CDEB 4HV8A 1AO7E 3EO1B 4GSDL 5TDOA 4AYFA 1CWVA 5JHBA 3P2TA 4TSAH 1JZ3A 2FO8A 1L0YA 4NO2A 1AXSA 1SFDA 1XR9B 1A6AA 2VLKE 4NENB 3IFLL 1JK9B 4P57A 2BNQB 3TIDB 1HQRA 4JAMB 1UXWB 4HQQH 2IXQB 4AEEA 4UOW1 1H8NA 1JNNH 1MJJB 3JSSA 1A14H 35C8L 2QKIA 4PB0H 4S1SH 4YHNB 4R90H 4TQEL 2IPUG 2C26A 2HKHL 4G1EA 3QUMB 2N1KA 1X3DA 3ES6B 4LCWD 4JKPH 2J88L 3MR9B 2HTKC 2XPGB 3C6LB 1EIBA 4OF8A 1J87A 3MA7A 3M45A 7CGTA 2DEXX 2H2SC 5C0BB 4ABQA 3BP4B 4RGOH 2ALAA 1QFWL 4F9PA 3Q5OA 4K71B 1KUMA 2OI9C 1UUNA 3IMVA 3VQ2C 1ROWA 1X4ZA 1ZT4B 4XMZA 5ITFB 4EUPG 1ITBB 2J4WL 2IALA 4M3JA 5L7XH 5I6LA 3H9SE 5DI8A 3SO3B 1QO3B 1RZGA 4WSJA 5DJ8B 5B8CA 5AAWA 1OT1A 1RV6X 4Q9CA 5D72L 3VD5A 1WDAA 3TOPA 1LEIA 3F62A 3CXHJ 3FTYA 1JMZA 1TQVA 1T1YB 4MAZA 3SE4A 2Y7OA 5HJDA 5DUPL 3KEHA 3SY0A 2CUHA 4PLJC 3ESMA 4R2GC 5I1JH 4H44C 4XC3L 1U21A 2PPDA 3GXIA 4XMLL 4ZSOE 3UC0L 4KHTH 5D9SB 4FABL 1EGJA 2L0DA 3S7GA 5HDBE 4F91B 5L2KD 1AD0B 3OAYH 2XPGA 2BDNL 3P30H 4JG9A 4Y8DC 1R5WB 4BFEA 5CM1A 5AYTA 1QRNA 5I0XA 1PEWA 2MCAA 1SJEB 1X5LA 5C0AB 1BM7A 4Y1AD 5BO1L 2OA9A 3MNDA 2MHAA 5EIIG 1QSFB 1Z0MA 1MCPH 4R4FL 3VD2A 3QG6B 3G5XB 3PLYA 2VXVH 2UXGA 2Y06H 4FFVD 4D94A 1N6UA 4CL7A 2YARA 4B27A 5BVJA 3MBWA 4PRDB 1F8TH 4OLXL 3RB7A 1YDPA 4PJXE 5FA4B 4I0PB 4FA7B 5E4OA 5DZVA 2ZICA 4YVNA 1UWFA 4C4KT 1AXSB 2WINB 4Z7WA 3TEXA 3CDCA 1U3JA 3SKJH 5I1EH 4JHVA 1QSVA 2Y06L 3E6HB 5D8JL 5D1XC 2FR4B 3SIKA 3RDTB 5H37G 2IPKB 4K73A 5AWNH 4YWGH 5HHVH 2UY7B 2WP3T 4LVOC 2VUKA 4CU6A 3TF7C 3RG1C 1RU9H 4D0BA 2D7PA 4FQHB 2X0UA 5EU7C 1D7CA 2BHYA 4XE0A 2WBKA 1CDHA 3BVNA 5D1ZB 2WKOA 3W5NA 5INCB 4KK6C 1RZ7L 1I9IH 4NP9A 3OKDB 1L9NA 4FABH 3LPGA 2WXGA 1XCQB 4DHLA 3BCDA 4LVHC 1IBFA 4PJAF 3RBSA 2XPYA 3AM8A 1EJOL 5J3HD 5C0EA 4GBXA 3WKQA 3I75A 3D4CA 4X4ZA 5F1NB 3NIGF 1WEJL 5K9JL 3LZFH 2ZUQC 1TKWB 4IGBA 2R2BA 5DO2C 3SKMB 5CU9A 1KMGA 4UMSA 4L23A 1Y6NR 5CJBA 4OGXL 1L3WA 1CZ8L 5A6MA 2V17L 3QDJD 1G7PB 4J2XA 3OR7A 4JKKA 2ZE0A 4FXKB 1W16A 1BQLH 2WGXA 1U3HA 4PLKC 3ARGB 5IMMA 2O6PA 5EF0A 4M7ZC 4HOMA 1I4FB 3HS0B 5LKNA 4XCYB 2QR0B 3W38A 1KLFA 1EEYB 4M8UA 5DJXA 1BYOA 2IDUA 2V5SA 1URIA 2VH5H 3Q2CA 2IGFH 1UYWH 4BYHA 2R7EB 3LXUX 1LO5B 4LGPB 3N43F 4U6YB 1FAKT 4OW6A 3I75B 1MDTA 4MVBC 4GKNA 5F1NA 3CLFL 3TU6A 3HUJB 2JK5A 1Q94B 1AACA 3BFQG 3T6XA 3N40P 5AVZB 3LQAC 3CVCA 4L37A 5AWNL 4QF1B 5GZNA 3ZE0E 3RGVB 3U30C 2VXUH 3V6OE 4PJEB 3OF6D 2VE6B 1J05A 2CM5A 3PHQB 4AE0A 5BV7B 1L9SA 3OMAB 1NBCA 1QX1A 2O6CA 4AG4L 1CGWA 4UT9H 4ZT1A 1HX0A 3WKML 5IFAL 1AKPA 2WNXA 5ALBH 2FWUA 1OAQL 4M9PA 3SDYL 4D9QE 4AE1A 1LD9A 4PY8J 4GBXD 4XOAA 3O9WD 4ZTEA 4C56B 1GJUA 4PHZA 4K3JH 5D1QB 2E75C 2X88A 5CEZH 4CU7A 1NCBL 2YAHA 2BO0A 1P53A 1KYFA 1VFUA 2FH6A 2UY6A 4WFGE 1L6PA 5CZVH 2XKSA 2H1LM 1JNLL 1PZ5B 3W9EA 3PDOB 4WTXA 1Q9WA 3WFCH 2YGNA 1RJCA 2AJZB 2FYYA 1YNKH 4YE4H 3U2IA 3UJTL 4HLZG 5JA8B 1AGDA 1CE1H 4L4TD 5K59F 1EBPA 5AZ2L 4HBCL 3NOIA 4Y0GA 1MEXL 4Q89A 4Z18A 3MLVH 5T1LB 3HCVB 4RDQG 1WBYA 3QXAA 1TTUA 3SDCA 5C92A 3AXLA 1M4KA 4Y2LA 3GSUB 3K2MC 3VCLB 1N0LB 5D72H 3DJZA 4J3OH 5GGVH 4CSSA 5GS2D 3MRPB 4PJXF 2P4AB 4NPYB 5C6PB 5TDNB 2I32A 1A3QA 4DTGH 4F58L 4AITA 4FXKA 4LPYA 5DURB 2Z65C 3TYGH 4G43A 1BD2B 2B08A 3NN8A 2V5TA 2W9DH 1MQ8A 3FTSA 5GGSA 1KYDA 1VGEL 2QPFA 1RZGB 1KCLA 1HSBA 4UM9D 5K9OB 1EEYA 3DRQA 3PPSA 3P54A 5CCHE 4A04A 4EXKA 4HCGA 4XH2B 2OSWA 3T8XB 4AEHL 1ZHBB 4BFRA 3WIFA 4DK3A 4EDXA 4BZ1H 4HEMA 4Z7NB 3T4YA 5IROA 1ACXA 3OKLA 3ZDYF 1RJLB 3TN0D 5BMFH 3FONA 1IKFH 1S7VA 3UDWA 5J8OA 2VERN 3KHOA 1XL4A 3ARRA 3SDDD 2KLRA 2VABB 4FL4B 5D5MB 5TE4H 5IVNA 1AGCB 2C3XA 2P49B 2N0KA 3QDJB 4F8NA 5I8OH 4JRLA 5KYWB 5CO1A 5IQMA 1XSOA 2ED6A 4NS0A 1UWGL 1CYGA 3O0RL 5AL8A 1FO0H 4J8QA 1TZIA 5AAMA 1DVZA 4TVPL 2Y5QA 1X4XA 5C0IB 4L8DB 3AGWA 1P7BA 2TSBA 2K3HA 2IJ0C 2MHAB 4MA1B 4NQEE 4HS3B 4ELME 1ZLSH 4G9FE 4DOHE 2DMKA 4XAKE 5I16B 2MEJB 2HSIA 1BXXA 1ZHLB 1EA9C 5EPMB 3GSWB 4XTRC 4PMFA 5D93B 2DN7A 4XP9L 4O2FB 3BO8A 4LSUH 1G7QB 1WTLA 3PJSB 1OV8A 3QO0B 2HFGL 1N8ZB 3F6JA 5JIKA 3TESA 4DVBA 3RURA 5IW1B 4HW6A 4F7PA 2FWLB 2WPGA 3FUMA 5D5MA 3GPEA 3OHXB 5FYJL 3WTTA 3VTTA 3BZFB 1I9RH 3L3JA 4RETB 4UILH 1HYRC 1KPUA 4MD0B 4KX8A 2C9XA 2EIKB 5JPMA 5G55A 4WI7A 2P8MA 2V2TA 2B0SL 1G4MA 1A7NH 3MBEA 3TTYA 3BSZH 2E5EA 2XBDA 3C75A 4FL4C 3F3HA 1XCQA 2Y07L 3ZE2F 3OWEA 3AW5A 4NQXA 2VC2H 1OGAA 1HYSC 2GJ6A 1VJSA 5E6RB 4R5VA 4A68A 3JUZA 3SYQA 1OF2B 3LRSB 5DMKB 4YDLB 4JFPA 4XNQB 5DWPA 3G3LA 4O2FA 1PFOA 2NOYA 2VC2B 4Y5XB 3F6IA 4DGIH 1WWWX 4L8CB 3QO0A 4XPHH 4RIRB 1JYNA 2APWA 1OTTD 1JFHA 3O4LA 4ECNA 3L3IA 3QHFL 4KVNL 5FYLL 5JOPE 2O5ZL 2JCCB 2QQNL 2WQXA 5E8OB 3TO4A 3LDBB 4JE0A 4P46B 3VDAA 1RPKA 3OR7B 5JLZA 4EDXB 3F7PC 3QI9A 4ALAL 4BQ8A 1VDGA 2QGBA 4LBEA 1KIQA 3ARFD 3MACL 1XF2B 4LPWA 4WTQA 2D3JA 2EDDA 2R0ZH 3QJXA 2VT0A 5EOCL 3MXWH 5TDPB 1UH3A 4P48A 3BP6A 1OE2A 1UUSA 4PEEA 4GSXA 4P5TC 4RNRB 5I1HH 3N50A 5E4EB 3FO0L 4UM9B 1QHPA 1QW9A 2G3ZA 5DDHA 3T77B 5JW4Q 2VMCA 3MLXL 3MXVL 1XMWA 2Y2WA 3TS8A 1T7XA 5DR5H 5MEND 4FJYA 4MNQE 1D5XA 1TQWA 3ABGA 2YUZA 2NZ1A 2GG1A 3GBMH 4FLRA 3N42B 4A6YB 3GUTA 4PLKD 4PP1C 2VR3A 3L3HA 5JW3L 2WLYA 3CDYA 3DHPA 3FQUA 4PRNB 5D6DC 5F7DA 1BIHA 3PXHA 3D2UB 3Q44A 4QHLB 4UINH 4O2EB 1F3DH 4R7XA 5GRVL 4ZXBC 1BOGA 3UIZA 2NR6D 2YOAA 1FZKB 1Q1PA 2FX8H 3I2CL 4KO6A 5CGBA 3V4VL 2XIBA 5ITFA 4X4ME 1K4CB 1CUOA 1PD0A 4PG2C 4KXDA 5CBEB 4ZNCD 8FABA 5TDPA 4FP8H 2D3VA 1NLBL 2FBJL 2FUQA 3MV7A 4IIQC 3QYMA 2ZCHH 4ODBD 5J13B 3IMBA 4RVBA 1FAIH 2XYBA 2DD8L 1U93A 2X9YA 3GI8L 3M17B 4YBQC 4KPHL 4OFVA 2KPWA 3UAJC 3T0ED 1M1XA 2VM3A 3OL2A 2DJSA 3D85D 2FD6H 4UM8B 3KWWA 3VRIB 3E6FB 4XBEH 3U9PL 5F9OL 3LEVH 3D48R 2NCEA 3MV9B 3L4TA 3O2DL 3FOLA 1ZEAL 2Z7WA 5TPWH 3V0JA 1K5NA 1OB1A 4HZLA 5L8KB 4WI6A 4TNWF 1PAZA 3ZKXC 2WK2A 1W91A 5JXED 1YNTB 1X5HA 3U36B 1PY4A 4Z7OF 3B83A 4QHUA 3MV11 1AIFB 3NPSC 4HGWA 1KCUL 1CB4A 3RGBA 2R2EA 2WQ8A 5CINH 25C8L 2FL5B 3FOMA 2XWBB 5DMYA 4JO1H 3O2DH 1A6UL 2NY1C 2DW5A 1KBWA 5FUCE 3RPBA 2X2IA 4E0RB 4E9XA 3HNVH 1OTSC 4MNQD 3P9LB 3KLHD 2R1YA 4JCMA 5I6XB 2OFQA 5KVDE 1PY9A 1QEXA 2JJUA 2CWRA 5K9KA 1MIEH 4A7SA 3LHPH 5CS7A 1NAMB 5LQBH 5D1ZC 3V9FA 2ENPA 4G6JH 2RQ8A 4U33A 1YMMA 5D2LF 2VLJD 4KRLB 3SJVB 4HXAL 1HC1A 4J3UA 4OUOA 4KRPC 5F72S 4YC2C 2VN7A 3GK8L 1B88A 3K6DA 4AQ8A 4WW2A 1MJUH 4X6DF 3MLYL 1YEJH 3I9GH 1QPXA 4MJJA 1EO5A 5F7LB 3Q6GL 3GSXB 2FTAA 1WLHA 4QHMB 5CINL 3RWCB 3BDBA 3KPSA 4PJFF 4G7RB 5FDYA 2J1WA 3OQRA 4OH2A 2ADFL 4K55A 1FL6B 3ARBB 4JFDD 3TFKC 5DK2A 3K0WA 3HC4L 2C3VB 3MYJA 3O6FB 3WHE0 1M2OA 4FZ8H 3QVAA 1SHMA 5GRYA 4EBQL 5KBDA 3J8F7 4MSWA 3OV6A 3IVKB 1IBDA 4G8GE 3TYFA 3VRLE 2RIKA 1JRHI 2Q20A 4KVPA 5BQDA 2EIZA 3MV8D 1CFVH 1MLBB 2YPKA 5D1QA 2OSLB 3BISA 5LWYH 1OZTG 3KWWB 2NQCA 1J9RA 4OD3H 3QIBD 3BD5A 3LPOA 4R3SB 2C9QA 4O58H 3EO9H 3K4ZA 1DDTA 2Z0BA 3ATAA 2NYKA 4ZFQA 2ICEC 5ACZB 5K1JA 1L4IA 1Z6JT 1HCZA 2FJGA 3V7AE 2JNZA 4HJSA 3F7YB 2AJUL 1C5DA 2YA2A 3V0GA 4KDTA 4KOCA 1CFSB 4YLBA 1JF1A 1NOLA 2GTZB 2X09A 4QNPE 5AQ0A 1IE5A 3QR0A 3CHOA 2IH3B 3NJXA 4KKQA 5DD1L 1UJTA 3S4SA 4BWUA 1SDDA 3SQRA 5IQ9A 5AZEL 4HMEA 4MVBD 5BZWA 4KDTC 2HG5A 5SWSD 2B1HH 3PWPA 5E2VH 1PJWA 5KSVB 3LRLA 4RGMB 1S7UB 2NLJA 7TAAA 1LQSR 3FT4A 4BKTC 2IBZX 1I3GH 3V55A 2DI7A 3EJZC 3QORA 3VXNB 3QG6A 1MJ8H 3DX9A 5LAPA 1WCBB 3AY4C 2WYZA 3BKCH 4NX0A 4MAYC 4I2XE 4O5LH 4YGVA 3WFEL 4LAQL 2EUVA 1A4KB 3HG4A 4H20H 2BMKB 5E2UH 2XCMC 5DFTA 2DMCA 2H3XC 2EXYC 4FNRA 4ZTOL 5IY5B 3IXTA 3BJLA 3EW3B 4CADB 3MFFA 3T4AB 1MI5A 3ZT7A