1D5IH

Unliganded germline precursor of an oxy-cope catalytic antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
QVQLQQSGAELMKPGASVKISCKATGYTFSSYWIEWVKQRPGHGLEWIGEILPGSGSTNYNEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARGHSYYFYDGDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CHIMERIC GERMLINE PRECURSOR OF OXY-COPE CATALYTIC ANTIBODY A
publication title Conformational effects in biological catalysis: an antibody-catalyzed oxy-cope rearrangement.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1999-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d5iH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d5iH02
1NEZG 3G9VA 1CFVL 2IH1A 1N5YL 4LIQE 1BOGA 1T0MB 2EH8H 1DSFH 4FN0A 5E2UL 3RJQB 3T2NL 4NKDA 4MB3A 5IB5B 2UWEE 4PRPE 5EN2A 1H3VA 1QO3B 2I9LB 1ZEAL 2WBJD 4HIXH 5KS9F 1X7QA 4HX1B 3BW9A 3RWDA 3QEQD 4R2GC 2C1OA 4HGWA 3TPUB 4DK6A 3BD3A 2F54E 4P46B 5EZJA 3TBYB 1OCWL 4B41A 2HT4D 5AWNH 4X5LA 1EGJA 1RULL 4LSUH 5SWSA 4YWGH 3ZTJG 2G75B 2O5YH 3MBXH 5EUOA 4DGYH 3NCCB 1LD9A 5I1IL 1JZ3A 4IRJC 5L0QC 1YDPB 1UACH 4KUZH 5IB1B 4PUBH 3V5HB 1LEKB 4X5WA 4JDTH 4FZ8L 2VTFA 4MA3A 2W1NA 3FHAA 4QCIB 4YDVA 5FV1L 3U36B 4XTRD 5E56A 1KCUH 1MCDA 3EHBD 3ARFC 2FX7H 4PJDA 4RZCA 3VI3F 5MENE 4F8TA 5AUMB 3SN6N 4LLWB 3WNPA 1QR4A 3QIBB 4KJWD 4XZUB 5JNYB 2I9TA 5LGKA 3WS3A 2NZ9C 3JTTB 4YHPA 3CFEB 3MRHB 2VXUH 1U92A 2E7CA 3J7HA 2VWEC 5D7SH 3P4LA 2XN9E 2XOTA 1RJLA 1H5BB 5ENWA 4CAGA 5EUKB 4K94H 2OR7A 1MFCH 2B0SL 4HF5L 1CGUA 1CGWA 3QHZH 5C08A 4M62H 2VLRE 1HIMH 5FYLE 4GKZA 1MLBA 2N1KA 4Q6IC 4X6DE 2YD8A 3PG2A 4KHTH 1MQKH 3CCHB 1ZV5A 4NZDA 4OCSH 1VEOA 4JVUA 4GRMB 4P9ML 4RIRB 5EU6B 3E2HC 3SGJC 5J6HA 3ULVE 3QA3A 5KAQG 3BPNB 4TUKL 1E6OL 1AY1L 4HIEB 1OWRM 3EOTL 3GSXB 3CVHA 3MRFA 4OD1L 1OAUH 1F02I 5JTWA 4M5YH 3KLHC 3RY4A 1GGYA 4AH2B 2MCPH 4G6KH 3DO3A 5ICZB 1EEYA 4NNYA 2WINB 1VEMA 2E9BA 1U3ZA 4Y4KB 1BD2A 1B90A 2ITCB 1WC7A 2P8PB 3R06B 2AKRB 4JKKA 1DBMH 2D9QB 3WO3B 1JNLL 4ERSL 1TPXC 2HKHL 4J3UA 4ONHB 2GHWB 2ADJA 4NQCD 4YPJA 3GJFK 2YA0A 3S4SG 3CMOH 4OFYD 1D3CA 3ECBA 5E2WL 3SDXE 1E0OB 2I60L 3QIWD 3WL9B 1BECA 2Z8VC 4WEBH 3UPRA 4R8WL 4J3OC 4YDIL 1OAQH 1DQJB 1Y6KR 3SKMA 5E94B 1NFKA 5T33L 4N0FB 1I1YB 1KN2H 2DJSA 5HHOD 3X13A 4HUXB 3VWJB 4L9LC 4N8CL 3TJEH 2ZUSA 4I3GA 5ECJE 4FQ2H 2Q3ZA 5CWSA 1MHCA 3OAUL 4I9WE 4U7KA 3MNZA 4IS6A 4XCEB 3ZSTA 1H8OA 4F37F 4JRYB 3SE3C 1UQSA 1CS6A 2OL3L 4ODHH 2NY5H 5D70L 5SV4A 2AK4B 1X5JA 5C2BH 1U91B 1XR9B 1INEH 1ZK9A 3KYMB 4PJHA 4NNXB 4OZFB 1IL1A 3QAZC 4JVPA 4L3ED 2YZ1A 5C71A 5T1LD 3VFSB 5K9KA 4G6FD 2ORBL 3WIHH 2IBZX 4GMTH 1MREH 3A6BL 1T5WB 1T66C 1ZGLB 5CILH 1A7QL 4U31A 5I1JH 3QDMA 1EHLL 3LS4L 4P2OC 3GMMB 5IFHH 2DLIA 2G9HA 1OAZL 4K7PH 4M48L 4I13B 3VFUA 1N4XL 4S1DC 5GGVH 2DYPD 4POZC 1DVFA 1VDGA 5HHMB 3ZYJA 4CN1A 3SDDC 5JW4Q 1VFUA 5CZVH 1A6VH 4LP5A 3W39A 3G08A 3GSQB 1J5OL 4H5SA 2E6JA 1JGVL 4YE4L 1K4CB 5DMKA 3GBNH 1OGTB 4PB0H 5JW4R 2FJGB 4IRSA 5DJZB 1MNUH 2KDGA 2P5ED 3ZDYF 4Y4FB 4KVCH 3TA3A 2DQCH 4UTBL 2VKWA 4UDUB 3BKCL 3QFJE 1T21B 4Z5RA 3FRPG 3GHBL 3NA9H 1ACYL 2P8LA 2W0FB 3MBED 2WLZA 3SDCD 3REWA 2XT1B 5HYSG 5SWZB 4PJBF 1S7RA 4JN2A 1WBZB 3VFNA 1OHQA 5GRJH 2F9BT 5C0AE 3W81A 4KHXH 4E0RA 4K55A 3HMWL 3NFSL 4R7DB 1HILB 1LEIB 5INDB 5D72H 2BX5A 1RV6X 5INCB 1IGCH 3JBG7 4QRPA 2NY0B 4H1LG 5CP3H 3I50H 3VW3H 1VPOL 1U8QB 2NY6D 5FXCH 4GH7B 3FO9A 1U8JA 4TN9A 4OCYL 1NAMH 4JANA 4EN3A 4GW4A 1X4XA 3QZWB 4LLMA 1U8KB 4E9LA 3FT2B 4OAWB 2H26B 3HC0B 4OGAC 1JZ7A 2CDGB 4PP1D 3ARRA 3SJVA 4X0KB 3IGAA 1CLCA 4MNHA 2W60A 2VXVH 3TYGH 4AT6B 5IESL 1UB5B 4Y1AA 3DLQR 3I6LD 1AD0A 1EO7A 4JFDA 1M7IB 4RFOH 1NC2D 2A6KA 4DTGL 4MLSA 4NBYB 1SY6L 4H0IA 4HMDA 4AEIH 5IOPA 2KBGA 4ZFFB 5DT1L 5BS0D 4K71B 3LVEA 4R4BB 3CH8A 4FQIH 4JZNA 5TJWK 4X99A 3GMNB 1WSST 3C60A 3VI3E 3K8MA 4PLJC 2XZAL 1TCRA 3UTSB 1GRWA 1RU9L 1C5CH 5TDPA 2IPUK 5D93C 1X6LA 3ARXA 3A67H 1V8HA 1KXVC 1Q9WA 3D2UB 3RWEB 3WLWC 1G7JA 5JOPE 3MV8E 2J5LB 3U0TA 3ULSB 4E41D 4C58B 1CBVH 1Z5LA 5C0GB 2MSPA 3LEVL 3DV6B 4UNUA 2E9WA 2X5PA 4G3YL 1AR1C 5D1ZA 3UBXB 2YK1H 2B4CL 2BVUA 3BDBA 1QHPA 1JWSA 4JY5H 1TVBB 3B5GA 1A0QH 3QI9A 3QT2A 2VL5A 5DFTA 2R56H 1VFBB 5DD6B 1G0XA 5HD8D 1J05A 2GFBB 5I0DA 3LAFA 1QKZL 2OTPA 1UZ8B 2H1PH 2PYED 4JLRA 3IF1B 1LO0L 5FO7A 1HKLH 4XMKL 4OQ1A 5I19L 4NQTA 4WWKD 5CBAB 4ACPA 1EZVY 2VKXA 4P2RB 3BXNB 4PJ9D 2C3VB 1Q0XH 2BNUB 5FIEA 3OWEA 4G8GE 2C7UB 4XMLH 4KAQL 1MCEA 1CICC 5I30L 2A83B 4PJFA 3N50A 3NCYP 5TE4L 1C5DB 2X05A 4P2QA 1BVKB 4QTHB 5JMRA 4FQXC 1DR9A 5E08L 5JOFA 4DQOL 1FSKB 1XH3B 2CD0A 5DVMA 5FM8A 1FFNA 4GBXD 3ZHLA 3VFTA 2OR9H 3ILQC 5D7JD 4KVNH 1IE5A 3MV9D 1NCCH 1IEHA 4MA1B 3L3IA 3U7AA 5E8NA 1MHEB 3VFGL 2CUHA 3V8CA 3MLXL 4D9RE 3KDMA 1VFMA 1S5IH 3HPJB 1CFNB 5CBEA 3HCVA 4NO0A 4FZEH 1FFRA 2Z91A 4JFHE 4FFVC 1XAUA 5C2UB 4NQSB 1S7VB 5IB4B 3GO1L 2Q6WA 1G7QA 4K3DH 5EBLB 2HVKA 4HJ0C 1OPGH 4TSCH 3CFJA 1MF2L 2AAVA 3HZMB 2CLVA 1MWAA 4ZODA 3KLSA 4F7CB 5DS8A 3TBVA 2CDEB 2Z0BA 4XBEL 5D1XA 4OV6F 5BO1L 2Q86A 4JDZA 1MFDL 4EI5B 1CGTA 3TCXA 2ED9A 2JK5B 3O3AB 4P48A 4S2SB 1LDPL 3D39B 3VFRA 3PL6B 3OKNA 5B22A 2R29L 1PQZB 3F7VB 1N3NB 3VXUB 2EIZB 1KELH 3AVEA 5DI8B 2NW3A 2YWZA 3EZJB 5I1EH 3MLUH 4V2CB 1RUMH 3EBAA 4JKPH 1LMKA 1GGIH 5ID0B 3K8LA 5FA4B 1JK8A 1BHGA 1OGAD 2VC2H 3ARED 1T0PB 4QOKA 3P9MB 2G60H 5AEAA 1AKJA 5CEXB 1CZ8H 4I0PC 4KJPD 2LVEA 4P5KA 2IWGA 4H88L 5FGBA 4IDJL 4I18C 1QPXA 3EYSL 3QXVA 4HKBA 4UOW1 2HJKB 4FFWD 4POUB 4FQCH 5D8JL 1CFQB 1JWMA 3KLHD 4QEGA 1WZ1H 4G42A 1BWMA 2Y25A 4Y4HB 2YXFA 3ALXA 3WD5L 2E7LC 2Z31A 5IB2A 4HWZB 1XCQA 3LV3B 1FCCA 3GJFH 3CMGA 1T7XA 2R8SL 2YRPA 1DUYA 5AZ2L 1GSMA 1W0VB 4NQED 4OLZH 3FB5A 1GZQB 5C0CB 4ZDHB 4EVNB 4PJBE 1NBZB 2HWZH 3PP4H 2LU4A 4G5ZL 4WW1B 5D6CA 4JQXA 4HUVB 4F9PC 5JORA 2ZKHH 1CU4H 1BVZA 1EK3A 5FKPB 4U6VH 5CHNA 2CRIA 2EICA 2Z93A 4HJGB 2IC2A 1S78C 3BN9C 2DL2A 2WMPA 4P49A 3O4LE 2COQA 2V7NA 1AO7A 1I8KB 2BNQA 3BZDA 4WW2F 4JO3H 4LLDB 5KSBB 4JHWL 2G5BA 3V2AR 3DUUB 3GI9L 5BW7A 1I7TB 2FO1A 4R4FL 1RUPH 4RMWA 2AJUH 3WN5A 2X10A 4N5ED 3C5ZB 2E3VA 1WWAX 5H37H 4LDOB 2WW8A 1UCBL 2YPLD 3OB0K 4GMSL 4LCCB 3W0WD 1CG9B 2Y1VA 1G1CA 3WLBA 1T0MA 3EOAB 3BEWB 4RMVA 3AGVA 1BAFL 5IB5A 3CX2A 3BKJH 3QJHB 1T7YA 4KKCC 1QO3A 2I9LA 3SQBA 2EXYC 5IK3B 4HX1A 4XNZB 3TPUA 4YAQA 3KPMB 4P46A 4MJ4A 2VOTA 1T66D 3U2SB 3HE6D 2G75A 1T7VA 1T2XA 4LVOC 3L1OH 1NSNL 2B5IC 3MOAH 2X9YA 3ZYIA 1R0AL 2ZG1A 1R3LB 3ARUA 1AIFB 2PNDA 4POZD 4F37K 4PJCF 3H6JA 4KTYA 3IDYB 1RK1A 2W65B 4KC3B 5DRNA 4QCIA 4JG1H 3OSKA 1JTTA 1PVHA 2ATKB 3B9DA 2BNRB 1F8TL 3KLAB 2VZ3A 1AGDB 1P69B 5AUMA 2GY7B 4LLWA 5EDXA 1JYXA 5F1SA 2W91A 2EDNA 3QIBA 3IETB 4XZUA 2EDFA 5JNYA 1I8MA 1GC1H 2B1HH 2IAND 3JTTA 2LQRA 3CFEA 1LO5B 3MRHA 3ARDB 5AYUH 1S7UB 2EEAA 4GKOA 1PKQE 1GCFA 1X5LA 4PJIF 2AEQL 1INQB 3LSOB 1H5BA 1KIUA 1EAJA 5EUKA 2XY1A 2QQLH 4W70A 1JNNL 4QO1A 4YGVB 2OJZL 3CFIC 5GS1B 1WICA 2OBGA 4MGXA 2BHZA 5J1SC 4NQUA 4NC2B 1TQBB 3GM8A 4DUWA 1FL5B 3CCHA 3DUHA 4C59B 3MREB 5HBBA 3RFZC 3TWCL 5JXEC 2AS5M 5IVXF 1GIGL 4GRMA 1FRGL 4RIRA 5EU6A 4WO4C 1CLOH 4DVBB 5H35B 1HI6B 1FNLA 4PLKC 4R4NC 4RAUB 4OLUH 5TGBB 2XTJE 1EEQA 2P24B 4HIEA 3IVKB 4LCWB 3GSXA 3UJJL 4I77L 4JM2F 5FHBH 4JRXB 2VDKL 4M1GL 4NJ9L 4G7YH 2VLLB 4OGAD 4OSUH 3EFDL 4HDIB 4UNTA 4XP5H 5KZCD 4XPAL 5ICZA 4U3CA 5EC2B 4L1HA 2EE6A 2WINA 3F12B 4Y4KA 1IBGH 3OAYK 3IJYB 2ITCA 2P8PA 3NIDE 3R06A 2AKRA 3LDBC 4RDQG 5D1QB 1NFIB 4P2YA 2D0FA 5GGQH 3QH3B 3MLYL 1NEUA 1I9IL 1YJDL 3NH7H 3JWDC 3EAKA 4ONHA 3X3GL 5ESVB 4JGMA 4RMTA 2V9QA 3WL9A 3ZE0F 3QHFL 4YBHA 5KN5B 2P8MA 3CVIH 1CL7H 1DQJA 1EEZB 5E94A 1J8HE 1XCTA 4YHLL 4KK6C 3VD7A 3S34L 4J3XA 5BJTB 4HUXA 5CMAB 3U46B 3VWJA 2DTML 3L7FB 1WCQA 4OV5B 1CXKA 3B5TA 3KPRD 3MRJB 1CT8B 4XCEA 3LS5H 4MNQB 4JRYA 1F58L 1ZHBB 3VXSB 2X4OA 2A1WH 1RJCA 4K3EH 4M1DL 4OKVB 3RUGF 2AK4A 4DKFL 5F9JB 4EXKA 3OKKA 2WBJB 3O2WH 1U91A 4AIZB 1XR9A 1IGYB 3KYMA 3BRGC 4NNXA 4OZFA 1JF1B 3NFPB 1IAKB 3VFSA 5GJSL 1F13A 3DO7B 1FC2D 3PHQB 5FYKD 5J3HC 2MKWA 1CDUA 2NMSA 1T5WA 2BJML 2R2BB 3MRQB 4K07A 1ZGLA 1KJ2A 2VXTH 4K3GA 4WHYH 1G9NL 3T0DA 4JPWH 3GMMA 2E7HA 4ESKA 5DQJB 1MIEL 1R5VB 3NGBC 4NNPL 3RRQA 1HHKA 2ZG2A 4MS8D 4GFTB 4ETYA 5D2LF 3GK8L 1K5NB 3VI4E 4Z95H 1QHOA 5E9DE 3VGEA 1ZHNB 4P4RB 4Q0XH 1A7NH 4I0KA 3TN0B 3D48R 4XXCC 3GSQA 4YX2L 4B7IA 5FB8B 5HXMA 3CX5J 2P5WE 3IU3B 3D1MC 4CL7A 4QXGL 4X83A 1K4CA 5E6ID 4OZGB 1NC4B 5JHDD 4ELMB 5I18H 1OGTA 1ADQL 2FJGA 3QJFB 4PRHB 4YZFE 1LO2L 5DJZA 2VDOL 1IGJB 2J7LA 1I8LA 1OAXL 4Y4FA 2W9DL 4Z7UF 4I3RH 5KANI 2B7DT 4UDUA 1VEPA 1T21A 4XNXH 4ONGL 1R6VA 4KDTA 3GIZL 1KYOJ 2BY2A 5SWZA 3TT1H 3S35L 4M9OA 4M4PA 4C54A 1WBZA 5L7XL 1DQML 3D69B 4WEMB 4HCRL 1K9TA 4R7DA 1HILA 4JVWA 2FX8H 4IJ3C 5INDA 2DI9A 4CN4A 3DETC 4ZD3L 1LEIA 1QFWI 4PJEE 5CJOH 1RD6A 3AC0A 3WHXB 5KVGH 1JPTL 3HUJE 1JHKL 3LMJH 1N7MH 2OI9C 1U8QA 1CIDA 4UBDD 1BGXL 3DXAD 4JFED 1DN2A 1U2HA 4MDJB 3QZWA 1F4WH 1U8KA 3ULVC 2ICCA 3FT2A 4OAWA 2H26A 3T0XA 3HC0A 1KCSH 4JB9L 4QHLB 2A6DB 4X0KA 3TO4B 3L3JB 4AT6A 1RZFH 3LKNA 1UB5A 3C6LD 4F80A 5T5FL 5I0ZA 1Y18B 4G7VL 4M8VA 2J6EH 4JFFD 1M7IA 1IQDB 2Y6SD 4NQCB 1FG2B 3QIWB 1CFSB 4R4BA 2H41A 1BFOB 3ZL4H 2M8XA 2GTWB 3HC3H 4KQ4L 5DDHB 3GMNA 4KK9C 5DJ0B 5GRUH 4GQ9H 3K1DA 3I3EA 4UT7L 4DGIL 2R69H 2K1MA 2OK0H 5LCVL 2DQTL 5TFSL 4DKDC 5HHOB 5TQ2H 2AXFA 5I6XC 4XPFH 4IRZH 3D3VD 3MRGB 3VA6A 3D2UA 3AXLA 3RWEA 3UYRL 3GRWL 3ULSA 5LWYH 3H7BB 1G7IB 5C0GA 2R1WA 3DV6A 3MV01 1EO5A 4R0LC 4AL8L 3UBXA 2Q7NA 1G7PB 4L3EB 1ZMYA 4BFBD 1TVBA 5T1LB 3K2UL 3RWCB 1E6JH 1G9EA 3MRCB 3OKDB 1FO0H 1VFBA 1EFXB 4KMTL 5DD6A 2GFBA 1YEHL 3SGEH 3WS6C 1S78D 5IVXE 4PJ8B 1UZ8A 1RUKH 1XZ0B 3EDDA 3CVHL 3IF1A 3EYQD 3NPSB 1DJSA 3MMEB 1U9KA 2DYPB 4KMLB 5I1KL 5MHSD 1AXTH 1J12A 3CFDB 5CBAA 5GS2D 5ALCL 5FKAB 1RY7B 3RX5A 4P2RA 4U1NB 3BXNA 4HXAL 3KYNB 2C3VA 2BNUA 5DC4B 1KENL 3MSPA 3OB8A 2Q87A 5ELIA 2V5YA 4OZHF 1Q0YH 1J0JA 3VFVB 1C5DA 1V3MA 1BVKA 4QTHA 3LEYL 4NC0B 3DGGB 2P5EB 1SMAA 3I3BA 2EE9A 5ISZE 1JHLH 1W8OA 3FN0L 1XH3A 1SEQH 3B4NA 4P57B 5DGRA 1TXKA 1BWWA 3ZE0E 1O7VA 2R39A 3TIEB 1LK3H 3B3IB 3NFNB 3BKYL 3MBEB 1IC5H 3SDCB 2UUDK 1YECH 5F3HB 4FABH 3P11L 4CMHB 4KK5D 1MHEA 5IHUL 1HH6B 3DYMA 2JTDA 1X5KA 4RFNB 3HPJA 4RMUA 1JZ8A 1RZJH 1CFNA 1ZHKB 3U0WH 3RVWC 4XMPL 4CADB 2NCMA 4NQSA 2DLFL 1S7VA 3TIDB 4FOMA 5IB4A 3T0EA 3F62A 5EBLA 3VRIB 5I71B 1OAYH 5GGSB 4M61B 4P9HH 2VLKB 3HZMA 2IF7A 3BGFC 4UIMB 2FGWL 2R0KL 3B2VL 1LO4H 4DUVA 2FB4H 2VDPL 4F7CA 2EEBA 2E9JA 2CDEA 1MY7A 4HIIB 1ORQB 3KJ6H 5CAYB 1J9CT 2VLJD 4EI5A 2OZ4H 2JK5A 3O3AA 1NDMB 4I2XE 1R3JB 2HFFB 4F7EA 4S2SA 3VG0H 1KEMH 3D39A 4AEFA 1DEEB 2WQ8A 3PL6A 1PQZA 3F7VA 1N3NA 3VXUA 5LKNA 2EIZA 2MPAL 1NC2B 4YXLH 4ZTOL 3FQRB 4IOIB 5I15L 2NXYD 5DI8A 3HB3D 3GSNH 2ZUUA 5BS0B 1H3GA 5ID0A 5FA4A 5JPNB 5CP3A 4U05A 1A21A 1L7IL 3TJHC 5CEXA 4PLKD 4YXKL 3DNKA 1P9MA 3DTXB 1LO3H 5IMMB 2RCSH 2HJKA 3FO0H 4DN3L 4A6YH 1CFQA 1U8OB 1M4KA 2G2RB 4Z7UE 1JRHH 4RMSA 1AGEB 4Y4HA 5IROA 4HT1L 2ED8A 4QTIH 3HZYB 1DBAH 4HWZA 4X9BA 3LV3A 3IDMB 5DMIL 5TE6L 3U7WL 2N4IA 4XNUH 1EPFA 3VXME 3PWUB 1W0VA 2L0DA 2DL9A 3C09B 3LEXB 1GZQA 3WO4C 3TGXA 4ZDHA 5C0CA 4EVNA 1RUAH 5C0ND 1NBZA 4PRDB 3WXVH 3MQIA 2NXZB 4HUVA 1FAIL 3VDCA 5C09E 2K7PA 1CR9L 5K59F 3DIFB 3N1QC 4AQ1B 1HEZB 3QXTA 3ES6B 2QQKL 4HJGA 2XRAH 5I8KL 2PYEB 3QBTB 2AK1L 3MLRL 1K4DB 4HSQA 2AJXH 4BZ2H 3BPLC 1I8KA 1OF2B 3BH9B 1NAKH 4WWKB 4LLDA 1GGBH 1S5HB 5KSBA 3DWTA 1MCRA 3DUUA 1I7TA 2B2XH 4WI6A 3U1SL 2CLZB 3E6HA 3BGMA 4JHAL 2FBJH 5F8RC 3C5ZA 4DKEH 4YHZH 4BZ1L 5C07B 2ZPKH 4D9LL 3WJJC 1IM9D 4LCCA 2V5TA 1Q9LB 4NRYA 1CG9A 1EA9C 32C2A 1ERNA 4M5ZH 3EOAA 3BEWA 1BQHB 2BHUA 4R2GB 3QJHA 3LY6A 4NZRH 5I1LB 5KVEH 1JYNA 3O41B 3V0WH 3TT3H 4NN6C 5IK3A 3KPMA 3P40A 5D7JB 4IRJB 4P0DA 3U2SA 4PLNC 5L0QB 3Q3GB 3INUH 1TETH 1R3LA 1AIFA 2P43B 3UPAA 5DVNA 2FR4B 2BFVL 4P3WA 4QNPE 2W65A 2ZSVB 4L9DA 2ZZUT 2WANA 4LARL 4Q97A 4NZJA 2ATKA 4YHKL 2E6PA 1A7RL 1QFWL 2BNRA 3NCJL 2PXYC 4YDJB 2QTEA 1T22B 3KLAA 1AGDA 2EXWC 3MRDB 5I2IB 4LPUA 1IGFL 3CDGB 3IETA 3SKJH 5HHXL 2ITDB 5JA9A 1LO5A 1ZT7A 1KB5H 3ARDA 1BZQK 5DQDL 3OHXB 4R3SB 2GSGB 1UKSA 4PJ7E 2C1PB 4LPWA 1INQA 2MFNA 3LSOA 4OZIB 4XPTH 5DD0H 4RA0C 1IT9L 3WKMH 1T2JA 3GEWB 2FECL 3V52L 2ATPB 5JW4N 1I3RB 2XN9D 4CMMB 3QUXD 4OLYH 1LGVA 2P7TA 4FP8L 4YGVA 5GS1A 1Z9OA 3QNZB 4DZBB 1UJ3C 3WFBL 4KRNA 1OGAB 1FL5A 2RIKA 5FYLD 3E2HB 3MREA 3FKUS 3BE1H 3IAQA 4DVBA 1EHAA 1HK6A 4NHCH 5FYJL 5H35A 1HI6A 3W11C 3RZCD 3GMLB 4RAUA 5IWLC 1A1MB 4F3FA 2P24A 3IVKA 4LPXA 5F44A 4JRXA 1SBSH 2VLLA 1F4HA 4HZLB 2VLME 4HDIA 3QR2A 4U1SB 2DJUA 5EZIL 5EC2A 3NAAL 3KXFB 3F12A 3T2NH 4NQXB 3IJYA 2VDLH 5D1QA 2VH5L 1TPXB 1NFIA 1OAKH 2FH6A 2I27N 2H8PB 3QH3A 2Y23A 4XAKD 1IKFL 1JTPA 1KIPB 4MVBD 4S1RL 2AJVL 3RU8L 5ESVA 3GHEL 5CCKL 3U82B 1OCWH 3DARA 4G6ML 1EBAA 5FYKH 4LQFL 5KN5A 5I1IH 3TZVA 4BELD 1EEZA 1MWAL 4XVJH 5BV7H 4LVNC 3FQXB 2FRGP 1QBLH 5D7LD 4ZQKA 4FZ8H 5BJTA 5CMAA 3U46A 1F5WA 3TVMC 5EULV 3L7FA 1RSFA 4OV5A 2V5MA 4I1NB 1U3JA 3LZFL 3MRJA 3MA7B 1CT8A 2EDRA 2R2EB 2FJHA 3P9LB 2AJ3B 2YPLB 1CIUA 4GG6B 1IZKA 4U1GC 4TVPL 4I9WD 1AH1A 1ZHBA 3VXSA 4OKVA 4KUCD 5EUOF 5F9JA 3TCLB 3QAZB 1T03H 3GM0A 1YNTB 2WBJA 4AIZA 1QLEL 1IGYA 1PYWB 3ESVF 3IJHB 1JF1A 3NFPA 1FN4B 1IAKA 3DO7A 4EDWH 3SPVB 3PHQA 4XWOD 4NQDE 1FNAA 2UZYB 3K4ZA 3V6OA 5GQBA 3HE6B 4HPOH 4P2OB 2R2BA 1G9ML 3MRQA 4HF5H 5J56B 4PJDF 1F90L 5DQJA 4X7TA 1R5VA 5HYQB 3UZVB 4UTAH 2GAZB 3V5DB 1K5NA 3UTTA 1YY8B 1ZHNA 4P4RA 1A3QA 3ESUF 3TN0A 4Q9RH 5MEQB 3TNMB 5FB8A 1QLFA 4K7FB 4Q74A 3IU3A 2RB8A 4RA3A 1PSKL 3ETBF 3VD9A 4OZGA 2ZUQC 1NC4A 4ELMA 3EOTH 1F2XK 4JG0H 1ZSDB 3QJFA 4PRHA 4WUUA 2QSCH 4ZUWB 1IGJA 1PY9A 1FNFA 1GXEA 3K4AA 3IDIB 4ALAL 5DJ2B 1ED3B 2EYSB 5CIPH 1HYSC 4FMKA 4OQTH 4L3CB 1MCSA 4S1QL 2H9GB 5BOZG 1KCVL 2MQ0A 2RBLA 4ERSH 3O9WC 1WIPA 2ZSWB 3SEPA 1CDJA 3D69A 2V5SA 3VFMB 2EIEA 5T3ZE 4G8FB 4GLRH 1QSFD 1P84J 5E2WH 2I60H 4Y5YC 5C0AD 4R8WH 1UWXH 4M6AA 3UBXI 5KVMC 3U4AA 2AERT 5FGCE 3WHXA 4HMEA 5DTFB 3ZT6A 3U48A 1A02N 2Y5TB 4TQEL 5FUOH 2OM5A 3HI6H 2QHLA 5JQ6H 4MDJA 5DUBB 4JN1L 4QXUH 3QWRA 5F6IC 3MA9H 2XTJC 5BQ7B 3KPSD 3VCLB 1F4AA 3G6AB 5KZCB 3S36L 4QHLA 1PD6A 3SCMD 2A6DA 3V4VL 3TO4A 1YEFH 3L3JA 1G7MB 2RFXB 1RZGB 4C55A 5DXWA 4C56E 4NT6B 1DFBL 1VGKB 1Y18A 3MFGB 3BP4B 1QSEE 5HGBB 1IQDA 4G8IB 5TDNB 5IW1A 4NQCA 1MH5B 5I1HL 4OFYA 2Q76B 5EU7E 1FG2A 2RAMA 3QIWA 1CFSA 1BFOA 5DF0A 1WISA 2GTWA 1HOCB 5DDHA 3D87B 3VE0B 5IB3B 1A7QH 5DEZA 3U7YL 1EJOL 1OAZH 4HS6B 5D93B 1N4XH 4AEEA 3MUJA 5HHOA 3IDNB 4Z7WB 4MHHI 2XQBH 4PJHF 1FDLL 3G9AB 5GS2H 4GKSA 4WIQA 3Q5YA 4X8JB 4YUEH 3O8XC 5LGHH 1JYVA 3CX5K 2B39A 5C6TL 3H7BA 1U8PB 1G7IA 4UV7L 2ZCKH 4OBRA 3U6RB 1JPFB 3DHJA 4NUJB 4PYHA 2EYRB 4LHUD 5B39G 1NGXB 4LL9A 4D9QE 1G7PA 1L9MA 4L3EA 4M7JL 1MJ8L 4UTBH 3DV4B 5T1LA 4NCDA 3RWCA 3K3QA 4JPIB 5F1KC 3MRCA 3OKDA 4XI5D 1EFXA 1WJ3A 1MCWW 4Y2OA 3L6FB 4PJ8A 1XZ0A 1CXHA 2GK0B 1UADC 1MPAH 1IC4L 3MR9B 2DYPA 4O51B 3CFDA 5JR1L 5FKAA 3NFSH 4OIAA 4LDLB 4CGTA 3GSWB 4FG6C 1N6VA 1JI2A 2I26N 2Y06L 3CK0H 5F97E 1XIWA 3LQMA 2I24N 4NYLB 5F7YC 3HAEH 4L4JA 5E6IB 5IBUG 5JHDB 4RQQB 4Y19E 3VFVA 4XCNB 2UZXB 4JEGB 4OCYH 2O5ZL 2P5EA 3HNVL 3HMXA 1N0XH 2NX5E 2IADB 5HDQH 1U41A 1REIA 1Q38A 1RZ7H 1WFOA 4ODUB 5IQ7L 3JTSB 5ICXB 3TIEA 2A77L 3WNKA 5HGDB 3B3IA 3NFNA 2X70B 5DEFB 3SDCA 1QNZL 2GEEA 4MXWL 5F3HA 3BDYL 5DHVH 1HH6A 2X4NB 5A2LH 3V5KB 1BF8A 4H20L 3SKOB 1NEZB 3TP4A 1V3LA 4ZO9A 3T0VA 1ZHKA 3JV6B 4CADA 2ESVE 3MYZA 3PIQB 5FECB 3TIDA 5D2NE 4WW2C 2CR6A 3UJIL 2HMIC 1JJUA 7FABL 2A0LC 1JF6A 3WJLA 1JIBA 3VRIA 5BVPH 3PGFL 4ZO6A 3H9SB 3WFHB 5GGSA 4JZOB 4M61A 2VLKA 4CVWA 1EAPB 3OKOB 4X9HA 4JFEB 4UIMA 2WUBL 3I2CL 3PDDA 4XC1H 4MJ6B 5SWSD 5C86A 2ZCLH 5CIPB 3LQAL 5B3JF 3V6FB 4LVEA 4Y5VB 4HIIA 1ORQA 1FNHA 1P4BL 2HFGL 3LEVH 4OTXL 3W9DB 3OXRB 1NDMA 1R3JA 2HFFA 1C5BH 3S96B 3OX8B 3IFLL 4G3YH 1J18A 3LKSB 1DEEA 4KJYB 1PKOA 1A9BB 2H2PD 4TSAH 5IHLB 4JFFB 4NKOA 4JZJC 1NC2A 1CGSL 3FQRA 4IOIA 5DQ9B 2WAHA 2DDQH 4NFBA 4G9FE 4NOFA 2ADFH 5DC0A 2GUOB 5L2KB 4YDKH 1JYWA 2EH8L 3QDGE 1DSFL 4H1LH 4I0PB 5JPNA 1YEGH 1O5DT 4BUHA 4WWID 3RIFF 4I18B 4HIXL 1LO0H 3BIBX 5D7IB 3DTXA 3MJGX 5FFLA 5B21A 5IMMA 3WIIH 1OM3H 1BZ9A 5IEKA 1LE9B 2G2RA 1MI5E 4LSUL 4LBEB 4YWGL 1AGEA 3MBXL 6CGTA 2EKSB 3HZYA 4LSVL 3EJYC 3IDMA 1I1AC 2BVPB 3FRUA 5C08D 1UACL 4KUZL 2X4TB 5A2JH 4GXUN 3PWUA 4JDTL 3LEXA 3QPQD 4Y0GA 4HMCA 3MV7B 4PRDA 4X5XA 3TBTB 3UBXG 5HVFB 1BFVH 4LEOB 1S9KC 5ANME 2FJFB 3DIFA 4XNMB 3DYOA 1HEZA 5ETUB 1JMXA 2AV7B 3ES6A 3C8HA 3P2TA 2PYEA 3HNSL 5GHWL 1RURH 4HQQH 1WFNA 4PJFF 1K4DA 3OG4B 2LAGB 2HVJB 4XT1C 1OF2A 3ARQA 3BH9A 4FTVE 4WWKA 1S5HA 1UEMA 2QADC 4V2BA 3O4LD 4QRQB 2CLZA 4K94L 1BD2D 1MFCL 5K9JH 3QHZL 1G0YR 4JM2C 4N0UB 4M62L 5C07A 1T1XB 3H9HB 1HIML 1YMME 4N90D 1Q9LA 2EZ0D 3S4SB 1BQHA 5E0QA 1XF4B 4KHTL 1MQKL 5IGXL 5I1LA 4BQCA 1WT5A 1MRCL 3O41A 4U6YA 1NFDB 4OCSL 5E99L 3FZUC 4XBEH 5D96C 4X4YB 4MHHG 5BO1H 1MFDH 3E8UL 5D7JA 4C83B 4IBLT 4LVOB 4NFDA 2B5IB 4IRJA 4RISH 1OAUL 1CE6B 2OTWB 3Q3GA 4EI6B 2VIRB 5JW4M 4M5YL 2FEDD 1WIOA 5DD5L 1F4YL 1FFPA 3RGHA 4FRWA 2MCPL 4G6KL 4Z77B 4MZ2A 5JUEL 2ZSVA 3STBA 1KJMB 4PIRF 3QISA 1HHGB 4ONOA 4X7CC 2V2XB 4MSWB 2HFEA 3TH4T 5FYLH 3MJ8B 4YDJA 5DMYA 4IDJH 1T22A 3MRDA 5I2IA 1GGTA 1I9RH 4G6JH 3CMOL 2ILLA 2Q8AL 3CDGA 3DYPA 2ITDA 3AUVA 4WEBL 4L4TE 1B0RB 4GSDH 1OAQL 2EDYA 2GSGA 3OHXA 4R3SA 5J4MA 2VLJB 2C1PA 5AZ2H 3TNNB 3ZDXF 5IM7B 4P4KC 5CEZD 1KN2L 5DHVB 4XP1H 4JCLA 2ATPA 4RBPH 1I3RA 2MQ3A 2YHGA 4CMMA 4RWHA 4MWFA 3BP5A 3QNZA 4DZBA 3NCMA 4ODHL 2NY5L 2Q7YB 3F8UB 4RGND 5C2BL 2MKLC 3VGGA 3SGJA 3KLDA 3MZGB 1PFCA 4IRSD 5MEOB 2EIDA 4U6TA 5MERB 2J8UE 2V5RA 3GMLA 1R3HB 1A1MA 4L8SC 1G6RB 3U9PH 3H3KA 5MI0C 3IJSB 3GI9H 5CGYC 3UEZA 4PRBB 4R4FH 3F58H 5CILL 4Y2DC 5I1JL 3RL2B 3OPZL 1CXEA 4HZLA 3C08H 5IFHL 3EDJA 5FDWB 4K7PL 5HYIA 1UCBH 4GMSH 4U1SA 3QUKB 5GGVL 3LDBB 3KXFA 2B4CC 2D31B 2EDWA 5CZVL 1A6VL 1BAFH 1URLA 2I25N 1A14L 2H8PA 3T4YB 1S9XB 4H1LB 5E5MA 1KIPA 5J9PA 4QRPD 2DQIH 1ZLSH 5T3XE 4BH7B 2ZJSL 3GBNL 4M7KH 3G6JE 1G0DA 4PB0L 5EO9B 2VDRH 1MCFA 1M7DB 2IPKB 3DX9B 1MNUL 1NCDH 3HI1B 1HN1A 3RWGB 4HKJB 4HS8H 4L9LA 2O5XH 3FQXA 3ZZ1A 2FYYB 2FWOB 2PTVA 1JVKA 1HQRB 3SJVD 1UH3A 1OP3K 1J8HD 1OP9A 3NA9L 4Y8AA 4XPBH 3O8XD 3SE3A 2J1KA 4OGXH 5IFAH 3MA7A 4Y1AD 2B20A 2R2EA 4GG8B 1HXYB 1IKNC 3L3GB 2EDHA 3P9LA 2AJ3A 2YPLA 4GG6A 1F8TH 4NQVB 5GRJL 3VXRE 3PJSB 1QA9B 3TCLA 1T5XB 5CSZA 1PZUB 4C57C 1YNTA 2YUXA 3S3PA 2V17L 1H3PH 1PYWA 3IJHA 1YEIH 2UWEB 1FN4A 2NR6D 4PRPB 2FL5B 3I50L 3SPVA 3VW3L 1KCKA 5DFVC 4HC1A 3HE6A 4HG4K 2F54B 4P2OA 3MXVL 1NAML 3HE7D 3NGBB 1CLYH 4S10A 3HLAB 1FAKT 4H8WH 1JNNH 1L7TH 3THMH 2QBWA 5HYQA 4ZOBA 2GAZA 4B7LA 3V5DA 4FG6D 5FYJU 2WP3O 3QPXH 1YY8A 1M71B 2VXVL 2ERJB 3TYGL 5EORL 1NMCB 2X44D 3NZHH 4OD3H 1EERB 2YZ8A 3WCYA 5MEQA 3TNMA 1FRGH 4FFYH 3RWIA 4K7FA 2CQVA 5KJRL 5ABDE 3QI9D 1L9NA 3TM6A 1W72H 4FXKB 1ZSDA 2V6HA 2VYRE 4ZOEA 5MENB 1N6QH 1G1YA 4YHMH 4FQIL 4ZUWA 2NYYC 4U1IB 3MYJB 3EFDH 4W4NA 3IDIA 5DJ2A 3VA2C 4ZPVB 1ED3A 2EYSA 3NN8B 4XPAH 2ZG3A 2UY7A 2XN9B 5F9DC 3QUXB 3OL2A 5EU4B 4L3CA 2H9GA 3A67L 3MLYH 1YMHB 5D7KE 3OJMB 5FYJE 2ZSWA 1ACZA 5J13C 4IJ3B 4OGYH 1CBVL 3MGOB 4OCXL 3X3GH 3VFMA 4G8FA 2VE6B 2VLRB 4P5TC 2HMID 1MOEA 2Z35B 2Z4QB 4X6DB 4WFFE 5C0EA 4NZTL 3SBWC 4JY5L 3RZCB 2EDQA 5JOEA 5DTFA 4GAJL 2C3WA 2R56L 3S34H 2Y5TA 1FGVL 3GKWL 1MVFA 2DTMH 3PNWB 4L8DB 5DUBA 4OLXL 5SX4I 4GXVH 4AENB 3VCLA 5BQ7A 3G6AA 1HKLL 3HZKB 1OVZA 1TDQA 2YD5A 2D0HA 3BJ91 5KG9B 1INDL 4DKFH 2RFXA 1C16B 2VQ1B 4NO0D 1JFQH 5BZDB 3FJTA 2EDEA 4NT6A 5HVGB 1VGKA 4KZEL 3BP4A 4XX1E 5C92A 5HGBA 3GMRB 2UZIH 5GJSH 5TDNA 1DLHB 3CDYA 1MH5A 2Q76A 3H7LA 4QHKI 5J11B 4CVXB 1HOCA 5IB3A 3VE0A 5DVOA 5J1AB 5JLZB 3SDXB 1P7QD 1MIEH 4NNPH 1NGPL 4HS6A 4JJHA 4ZUTB 5IHBA 4TVPE 5I6XB 2FLRT 4LSPH 4AIOA 3IDNA 2OR9L 1P5UA 4Z7WA 5D1XD 4WUKH 4G6AC 4KVNL 4PP2B 1NCCL 2W92A 4IDLA 3MJ9H 2KL6A 1I1AD 4X8JA 4POYA 5F7DB 3ZDXE 3KG5A 1BJ8A 1B4RA 4R0LB 1U8PA 1R3KB 1JPFA 4NUJA 5SV3A 2EYRA 4FZEL 3MPCA 1UKQA 3ULUE 1NGXA 4QOKD 5DMGC 2H45A 4KY1H 3RIFK 1OAXH 1AKJD 2DAVA 3DV4A 4K3DL 1MJJA 1HZHH 4JPIA 3QQ4B 5F71A 4DKAA 5IG7B 1U3HC 4P5MB 4ONGH 3OR6B 3PWVB 3L6FA 3BX7C 3G5ZB 4KRPD 5C0IB 3GIZH 4YPGB 2VO5A 2YEZB 3BUYA 4P3DA 4X4MA 2JCCF 3UPCA 2Z31D 2BY3A 2ZUWA 3MR9A 2APVA 4O51A 3OJ2C 5I73C 2DLGA 4FQHB 4MQXC 2R9HD 3BPCB 3GSWA 1VSCA 4NYLA 1JPTH 3T3PF 3FQWB 3MUGB 5JHDA 4RQQA 5I1EL 4KQ3L 1BGXH 4JKPL 4XCNA 4QWWC 1FPTL 4ZYKB 5FOBB 2VC2L 1WF5A 3HS0B 3UYPA 4ORGA 1CZ8L 2VDNL 2IADA 5DR5H 1EGJH 1JMZA 1WAAA 4ODUA 3Q1SL 4JB9H 3JTSA 5ICXA 1XF3B 3W82A 1PW3A 2MHAB 1JGDB 5HGDA 4JGUA 2X70A 3QFJB 3ILPB 5DEFA 1WZ1L 1J8KA 4HXBH 1RJYB 4G7VH 5B4MD 2X4NA 3V5KA 5EWIL 3HN3A 3SKOA 2ENSA 2ZNXA 1NEZA 4OZ4B 1UWEH 4NO2B 1ZT4B 4OLZL 5B8CC 3JV6A 2BOCB 4EDXB 1AGFB 5FECA 3PIQA 4J3WA 5C0AB 1KJ3L 1QYGH 4NDMB 4NRZB 1QRNE 2HWZL 3PP4L 2WK2A 1W72B 4FNLH 4UT7H 4DGIH 3BGFB 3H9SA 5LCVH 1CU4L 3WFHA 4JZOA 5TFSH 3BD5A 1Z0NA 1EAPA 2XKSA 3OKOA 4U6VL 4JFEA 2F8XC 3GMQB 3Q6GH 3SE8L 4MJ6A 5CIPA 3V6FA 1T80A 3ZKXC 3ZTNL 1I75A 4P4KD 3NACL 4GXUM 2HRPH 3W9DA 4CN6A 4HJJH 3OXRA 3S96A 3OX8A 1UWGL 3LKSA 4KJYA 5DVLA 3C87A 1RUPL 1A9BA 2AJUL 1A3RL 3DMMC 5C8JA 5LAXB 3S97C 4PFEA 5DQ9A 1XGYH 1U8IB 1V05A 1TITA 2GUOA 4PJ5E 5L2KA 4I0PA 1M1SA 3K0WA 4UT6H 4LPYA 3BKJL 3SOBH 3WYRA 2HJFB 2HKFL 1MUJB 3QDJE 4I18A 3CVHH 1U36A 4AIXA 5D7IA 5I8CB 5FK9B 5I1KH 4EZMA 3RGVC 3R4DA 4KRMB 2E7LA 5ALCH 1LE9A 4ODVH 3ARVA 4HBQA 4LBEA 2EKSA 4KDVA 1KENH 1XEDA 3L1OL 4HGKC 3RTQC 3PV7A 2BVPA 2X4TA 5JQHC 2CPCA 4LASH 3CLEH 5HTSA 1UM5L 4PGCB 3MV7A 4OB5H 3BIAX 4JFXA 4F9PA 3TBTA 2DBJA 3BVNB 1XGPB 4LEOA 1BMGA 5D5MF 2DQEH 2DQFB 5T5NF 5EU6D 4KXZI 3ZKND 1S7QB 1OP3H 2JJVA 2FJFA 4XNMA 1V7MH 2CIIB 5ETUA 1G9NC 2AV7A 3S35X 4GRLD 3HR5B 5AZEL 3V4PH 4KI5E 3MCLL 3P11H 5IHUH 5AYUL 3FQTA 3OR7B 2HVJA 4O4YH 4I0CC 4GO6B 1IAIM 3CXHK 2IPTH 3IAGC 4OD2B 4L4VE 1MIML 2DLFH 4IOSD 4QRQA 4Y4KD 1DEDA 1ZANH 4K7PY 4N0UA 3U4BH 1T1XA 3AU1B 3H9HA 1WV7T 1K85A 4G8GB 1WBXB 4J3TA 5JZ7D 1P6FA 3P0GB 2OCFD 3S4SA 4NN6B 4WI7A 1XF4A 2FGWH 3B2VH 2H32B 1ZVSB 5F7FA 3UZEA 1CD8A 1NFDA 2KZ1B 5J6GB 4X4YA 4N0CD 5E7BA 2XG5A 4OLUL 5C0FB 4TTGA 4C83A 1UXWB 5DJ6B 1CE6A 2OTWA 1OB1B 5FHBL 3VWJD 1F4XH 4EI6A 5CEZH 4K23H 1LE5B 1JBJA 2VIRA 3O6MH 5F88B 2NNAB 5DZOA 4OSUL 4Z0XB 5I15H 2MWCA 3Q5OA 4JRYD 4LOUD 4UOW0 4Z77A 1C7SA 3K46A 2DWEA 3EOYG 1IBGL 1HHGA 4MSWA 2PXYB 1L7IH 3MJ8A 4G9DB 4LRIA 1EUTA 2BRRL 1HCFX 4XX1G 4HBCL 4PGBB 5D2NC 2DM7A 2QJDA 4FA8A 1QSVA 2NYYD 4GRWH 3R1GH 5SWSB 4OI9A 4LPVA 2XZQH 3X17A 5CLTA 1B0RA 4HIHB 1EXUB 4KJQC 3CVIL 3U7WH 3RWHB 2VLJA 4WY7H 5AD0B 3TNNA 5IM7A 5DHVA 4XHQA 4AG4L 1QBBA 3CU7A 4XP9L 5HHMD 2JCCE 4KROC 1P53A 1TENA 5CEYB 4WFGE 4MD5B 3LS5L 3FAXA 1PBYA 4P5TD 3G5YB 1EHXA 2A1WL 5JXEA 2Q7YA 4K3EL 1KLGB 3H42H 4CRPA 4BSVB 3MLPA 3WNOA 1Y6NR 2MCG1 4PD4J 3O2WL 4JFPB 4G80B 4YHPB 5F7EH 4U7MA 4R97C 4RFEB 3C9NB 3ZMRA 4LCUB 3CJJA 3WDHA 5MERA 4OCMC 4HH9B 3ROOB 1R3HA 3KPPB 1G6RA 1OSZB 3FRPA 4QRRE 1CQKA 4O02L 2VDQL 1BEYL 5IMKB 1HHIB 1FLRH 2AEIT 2VXTL 5IUSA 1AHWC 3RL2A 4JPWL 5SWZD 4D9LH 5FDWA 3WIFB 4L5FH 3EFFB 4WCYH 3QUKA 5HYEA 1MSPA 1BVLB 4MAYC 2A9NH 1QFPA 4M1CC 4Z95L 2D31A 4MMZC 4ZXBD 4TPRH 3ZT5A 4WTZG 4Q0XL 3DJ9A 4GAFB 4C4KO 4HKXA 4PJBB 3T4YA 3B2UD 1S9XA 4H1LA 5KSBF 5E5UB 5C9JA 2NY0D 4BH7A 3U9UA 1A7OL 4WI8A 3RVXC 5EO9A 1W0WB 2CK2A 2OP4H 2IPKA 5GZOC 3DX9A 5JXAH 2H2SC 3TLRA 4HUWB 4LVNB 35C8H 4I3RL 4PG9B 3HI1A 3VDAA 3WNNA 2Y36H 3RWGA 4HKJA 1P6AB 5E7FA 1DTUA 5CGMA 2BFVH 2FYYA 2FWOA 3DI3B 3EIFA 1HQRA 4XNXL 3EDEA 2YD6A 4NNYB 4YGAB 3O4LB 4HLJA 1WC7B 4U1GB 4PG2C 2X6MA 4X6FB 2N7AA 1HXYA 4GG8A 1OP5K 3L3GA 1QFWH 1QVOB 1UEYA 2IFFL 5J12C 4NQVA 2W59A 3BP6B 3PJSA 3ZE2F 5KSAC 1QA9A 1T5XA 3ECBB 4MXVF 2FX8L 3UTSE 1OQXA 1CE1H 3RKDC 5BRZE 5F9WC 2N56A 3KPOB 3L3KB 1KB9K 4JPVL 4WFED 5GS0L 2UWEA 4PRPA 3AB0C 3VD3A 2FL5A 5KVGL 4DEPC 1U3HD 3LMJL 1MEXH 2C9AA 2F54A 1X44A 5GZND 4NQDD 1HE7A 5HHQB 3HLAA 2IQAB 3EO9H 1PEZA 4U0RC 4MQXD 2IMMA 1UKTA 1I1FA 4WVRA 3WFBH 1GOFA 1RZFL 3FB8B 3JV4B 1F6FB 1TZGH 1P1ZB 1NL0H 4AY0A 2YUZA 3B8SA 4QWWD 5DJDB 1QFHA 4FXKA 3BT2L 2R4RH 5MENA 1HHJB 3ZL4L 2YRLA 5D5ME 2GITB 4U1IA 3MYJA 2DKUA 4MCZB 1S7TB 4GQ9L 4ZSOE 2G9HB 4ZPVA 2OK0L 3VFUB 3NN8A 4GAGL 2XIDA 1PKQB 5TQ2L 2X4SB 2XN9A 3O9WB 2R0WL 1I7ZB 4XPFL 2L7UA 4P2RD 2VH5H 5EU4A 3DSNA 4WRLA 5DRWB 3IDXH 1YMHA 4KKNA 5LWYL 3MGOA 4Y5YB 5CCKH 4G6MH 2VE6A 3BIKB 2VLRA 3DVFA 2XY2A 4MJIE 1S9VB 1KXTB 2NY2C 2JF1A 2Z35A 2Z4QA 4X6DA 3UTOA 3SO5A 2DMCA 4H26A 4IM8A 3RZCA 2Q20A 3TA3C 3AAZB 3BH8B 5H8DA 2E6QA 5IJVB 3I6GA 2R0LL 2KUTA 1KLUB 2XTJB 3PNWA 4L8DA 1X9QA 3HZVB 3N85H 3LZFH 1ZLUK 1RUKL 5F21B 1HSAB 4AENA 1AQKH 4QHKJ 3HZKA 1UG9A 2C4XA 1IAOA 1BPVA 2X1PA 3WFDL 2M2DA 5KG9A 4B0MM 1C16A 2VQ1A 2V2WB 5BZDA 3EDFA 1QLEH 1RZKC 5F7UA 5I9QB 3FO1B 3T0ED 3UP1A 3GMRA 5FAAA 3P4OB 1N6UA 2K7QA 4NIKB 1Q0YL 3SQOH 2HTKC 1QSED 4MXQC 4LHJB 4CVXA 3MV11 2BVOB 3VFWB 2D7MA 4EN3C 2ZOKA 5J1AA 4OFIA 1JHLL 5JLZA 3SDXA 1F90H 1SEQL 4Z7QE 1XGUB 3SO3C 2F15A 1AGCB 1S7XB 1VACB 3JV0A 1R5WB 3OKLB 3IDUA 5AAMA 4EI5D 1LK3L 1J8HB 5C3TA 4PP2A 3O8XB 3RTQD 1SYVB 3FL7A 1YECL 3D39D 3CGTA 3PL6D 4NUGL 4BZYA 3O6FC 5F7DA 1Q8MA 4R0LA 1TZIB 2P44B 3PDOB 3L5WB 3KWWB 3U0WL 5F7LB 3GI8H 4JZNB 4JPKH 4HZAA 1SQ2N 3QDAA 4PJAB 1SJXA 2UVEA 2VL4A 2CKNA 2AQ2A 3QQ4A 3JZ7A 3WS6A 4MQSB 4HUUB 1OTUC 4P9HL 5IG7A 3P0VL 4P5MA 3HE7B 5IQ9B 4JREC 3OR6A 3PWVA 5HYFA 1LO4L 1S9WB 2JJTC 3G5ZA 5C0IA 2FB4L 4YPGA 4J12A 4S1QH 1MCWM 2YEZA 4M7ZC 4LSRH 4YBQC 1G7JB 2DQUL 4OZGF 4Q6YA 3MOQA 3KJ6L 2X2YA 4DCQA 4JGJA 1PGRB 2OZ4L 4FQHA 1OARH 1KEML 3I6KA 5EFIB 5C0CD 4JR9H 5DVKA 4V1DE 3CFBA 1YQVH 1YQ2A 3NZ8B 3FQWA 3MUGA 5IR1B 4LDEB 5CSGA 2P5WB 5GGTA 4O2EB 2EDTA 5FOBA 4ZYKA 3QNYB 3HS0A 2DWDA 3OV6A 1V3JA 4JN1H 1YNLH 4ZFOB 4P59H 1N26A 1LO3L 1XF3A 1B0GB 2RCSL 2MHAA 5DHXB 1JGDA 2E7MA 3FO0L 3QFJA 3ILPA 5IW6B 1RJYA 5ADOL 1DBAL 1NCBL 1Q94B 2VZVA 3ABZA 3C5ZD 3DI2B 4KFZC 1J86A 4XRCB 5IV2B 1SYSB 5J7CC 4OZ4A 4XNUL 2BVEA 4NO2A 5I1HH 1ZT4A 3L95A 3RY5A 4EDXA 1AGFA 5C0AA 1PDKA 1RUAL 3HC4L 4NDMA 4NRZA 3WXVL 3B5HA 1W72A 4WV1C 4PJEB 2QEJA 3ROLA 2Y9RT 2J8OA 4X6CE 3GMQA 1FDLH 3HUJB 4PJXF 2Y4SA 2XRAL 4ENED 4RMQA 3QQ9D 4DAGH 3DVNB 3KDMB 2AJXL 1GGBL 4KROD 4QRTA 4N1EA 3LD8C 1OOAA 2FBJL 5LAXA 1ZA6B 2RJMA 3IFNH 4DKEL 4YHZL 4JKLA 2IBGA 4F57H 2ZPKL 5F7KC 5C6WH 2BNRD 2IAMC 1U8IA 3GFUA 5HDOA 3BZ4B 5J06A 2JB6B 4NZRL 4QHUB 3LIZH 2HJFA 1BP3B 1MUJA 1P7QB 3M1BB 5JDSB 2GJJA 3TBVB 4HH8A 5EZOL 5I8CA 4X7DC 5FK9A 2OXHA 5E6YA 4LSSH 4HK3J 8FABB 1I1AB 3OKNB 3SY0B 3DBXB 1TETL 4B50A 1A3LH 2PR4H 2X9WA 2LVCA 3VXPB 3MV8A 2AXGA 2GSIB 4YO0A 5IIEB 1DBKL 5FHAH 4PGCA 4QOKB 1T83C 4LCWE 3BVNA 1XGPA 1AQDB 1EDQA 5TF1H 2DQFA 3FN9A 1S7QA 1JV5B 3OQ3B 4HKBB 3OXSA 4U1JA 3ULUC 4NBZB 4OFVA 2CIIA 3G5XB 1OP5H 3SKJL 4YDLB 1QNZH 4JRXD 3CDCA 3HR5A 3BDYH 3QWOB 3ZO0A 3FB6B 3KJ4C 2VZTA 4YFLI 5IVXB 2QADB 3L5HA 1A6ZB 4H20H 3OR7A 2OQJB 1DUYB 3MJ9A 5DD0L 1CDIA 1IQWL 4KGJA 4OD2A 3NCEB 2HRLA 4HLZG 3RBGA 3WJJA 4OLYL 1SVCP 1KSRA 7FABH 1HWHB 4Z7OF 5KVDH 5SX5K 4G8GA 1WBXA 3PGFH 4XPHH 1F42A 2X1XR 4EKXA 4OZFH 2IGFL 4PRIE 5DEGB 2WUBH 3I2CH 1FNGB 4UZGA 2H32A 2A73A 3NIGF 1ZVSA 2NY4C 4U6HB 5HPOA 3BE1L 5D96B 1MJ7L 3S36X 3LQAH 3BAEL 3TZVD 5J6GA 4NHCL 1N2RB 2KKQA 2WBKA 3GDBA 5ISZB 4M7LH 1KJ2H 5C0FA 1B6DA 1UXWA 1EX0A 2HFGH 5DJ6A 1JF5A 3BQUC 4OF5A 4OTXH 4MNQE 5GGSY 1OB1A 5DMJB 3VGBA 1LE5A 3N1GC 4LSDA 5F88A 4S1SH 1RAMA 2NNAA 3GB7B 5LBSL 1R5IB 4Z0XA 1ITCA 3PXJA 3P3YA 2OJEA 3QEQE 1A4KB 3VXSD 3WLBB 2YR3A 2BCKB 1PZ5B 2VDLL 3HG1E 2GT9B 2PXYA 1OAKL 3Q48A 4HWNA 1EVTC 1FYTE 4G9DA 4K8RC 1EIBA 5EU5B 4YAQB 3OZ9H 4P46C 4PGBA 1M6OB 5FYKL 3G5VB 3M8OL 3Q6FA 5K9QI 4LSVH 2IH3B 4HIHA 3KHOA 4P4KB 1EXUA 3ZKMC 3RWHA 5AD0A 5CZXD 4XVJL 4ZO8A 1UA6H 5BV7L 1RK1B 2HP4A 1QBLL 1HQ4B 1J1PH 5DRNB 4QF1B 5ID1B 3UTTD 3DUSB 3LOWA 4I2XB 3TN0D 4NM8L 3B9KC 5CEYA 4M93C 4MD5A 2PW2B 2HYMA 2Y5EA 1RIVL 3G5YA 3MLWL 5ITBH 1KLGA 1ZLUH 1NC4D 4RRPG 4BSVA 2H3NB 1T03L 1I8MB 4JFPA 2NPLX 4G80A 4PRHD 3HNSH 4WUUD 4HULB 4RFEA 3C9NA 5GHWH 4OF7A 4L8SB 4LCUA 1NGZB 2HH0H 4HH9A 5MI0B 2QKIB 4LPTA 3ROOA 3KPPA 4EDWL 1JGLH 1OSZA 2ICES 1X5FA 3TBWB 4Y2DB 2YD3A 4HPOL 5IMKA 5GRWA 1HHIA 1P4IL 3O81A 3RWJB 1KCRH 5C9KA 3T0BA 4Z7UB 1F97A 3WIFA 4XP4H 3EFFA 4UTAL 1BVLA 1KTDB 2HG5B 1F00I 1MRDL 3VXMB 5IGXH 3LCYA 3EUUA 2P47B 3T65B 1J0HA 1MRCH 4Q9RL 5E99H 4PJBA 1FH5H 1MRFH 4YEEA 3X14B 4KDWA 5DO2D 3X11B 3E8UH 4JG0L 4GRLB 2WWKO 5C09B 1W0WA 2P46B 4ZS6D 3NIFF 4TRPL 3TH3T 2QSCL 5T3XD 2ZP0T 4HUWA 4LAQL 2VUOA 4PG9A 3UDWC 5KBNC 3QWRD 5DD5H 1F4YH 4LSQL 5JUEH 4PJXE 1YPZF 1D5IH 3EJZD 3O4LA 4KI5C 4H25B 3TO4D 3KNBB 3QWQB 4NCC2 3T8XB 1FIGL 4OQTL 4X6FA 1QVOA 3IU4L 1A6AB 1LP9E 3BP6A 2I07B 1JNHB 2Q8AH 1ZLVH 3KPLB 3KPOA 1A22B 3L3KA 2P8MB 1FBIH 1XCTB 3GSRB 2XI9A 5DRXB 4XHJD 1AC0A 2EECA 5FUOL 3HI6L 4LCIH 4NGHH 2LTQB 4ZUSB 5JQ6L 2DQHL 5HHQA 3QIUC 4QXUL 2IQAA 2IFGA 1XF1A 3MA9L 4B5EA 1KNOB 3U4EB 1Z9LA 1GVIA 3N9GL 2X4OB 5FF6B 1YEFL 3DHMA 2CUMA 5B39B 2WP3T 3FFCE 1OWWA 2CO7B 3FB8A 3OKKB 2YN5A 3JV4A 4XXDB 1MCNA 1MY5A 4OZIF 1QUNA 1P1ZA 4NN7C 2XZCH 5DJDA 5I74C 1EFXD 2VQUA 5TE7H 5ITFB 4YNYA 1HHJA 3F7RA 4OCNC 5GGRY 2GITA 1KJ2B 3FO2B 3FONB 2F74B 1PAMA 4MCZA 4PJ8D 1S7TA 3OPZH 3MRPA 3T2QA 4M8QB 4RWYL 5J1TC 1HHKB 4MJ5B 3VDBA 4YHIB 5HHVL 1PKQA 4YBLB 2X4SA 2XQBL 4PJ7B 1CWVA 1VGEH 3O9WA 1I7ZA 4TTDC 1AFVL 1A14H 3HPLA 5J13B 4WENB 3BJLA 5DRWA 1U8MB 1XIWD 4YUEL 3RVUC 3RX7A 5LGHL 4P5TB 3PHOB 1F2QA 4KZDH 5IBUB 4Y5YA 4PR5B 1TTUA 2ZCKL 1WCBA 3BIKA 3QUMB 2ZJSH 1S9VA 1A8JH 5TPWH 4O00A 3S3JA 5F7HA 3SDYL 4Z7OE 5A3ID 5IBLD 1K8IB 2OR8A 3NABH 3AAZA 3AMLA 3BH8A 5IJVA 3IT8D 3NIGE 1X5XA 3LPGA 4NOBA 1DL7H 1KLUA 5J57B 3HZVA 3LN5B 4BJLA 1T2QL 1HSAA 4OF0A 1ZA3B 2HT3C 1MPAL 4Y16C 2FDBP 3CZFB 3IKCB 4ZXBB 2PO6C 2V2WA 2YRZA 4DVRH 5HY9A 3CK0L 2V17H 3FO1A 4I3SH 3HHRB 4HWBA 1FIEA 3MTRA 4ONFH 3P4OA 4RGMC 3N1FC 2VLKD 3MXVH 5K9QG 5K93A 5KS9E 2BVOA 3VFWA 3WUWG 4GG6F 1N0XL 1XGUA 4TNVF 5HDQL 3I6LE 1AGCA 1RZ7L 1S7XA 1VACA 1R5WA 3OKLA 1T1ZA 4K94C 1J8HA 5EORH 3LKNB 3O8XA 1SYVA 2DLHA 5BS0E 1AXIB 5C0DA 5CSBA 3RDTC 4BH8B 1TZIA 5KJRH 3PDOA 3TV3L 1UB6A 3L5WA 4N5UA 4GW5B 5F1NB 4XVSH 1X4ZA 4P23D 3KWWA 4TOYL 4N0YH 5GS0D 1FV1B 1QFOA 1ZGLM 3T2PA 1IVLA 3D9AL 4PJAA 2M1KA 4L1DA 2PTUA 1NBVH 4OT1L 4IIQC 3ULUD 1U3HB 5BVPL 2YBRB 4HUUA 3D25B 4H0HB 4CJ1A 2AXFB 3CXDH 4E41E 3HE7A 5IQ9A 4NQDB 4JDVB 1S9WA 4XC1L 4R9HA 1G6RL 4N9GB 5SX5H 1K2DB 2ZCLL 1CLZL 3AXLB 5I73B 3UTPE 2CLRB 4OCXH 4QGTA 1PY4A 2IBZY 4NC1E 4EEEA 5IBTH 2R1WB 1ITBB 4KKLC 5H37G 2F5BL 2DKSA 1C5BL 5F7NC 5EFIA 1IAMA 4LSTL 5DUMH 4NZTH 5E9DA 4TSAL 3FAWA 1IC7H 5C1MB 1J88A 3V7AE 3NZ8A 4OLWL 4GAJH 2DDQL 2NXZD 3JWDL 5IR1A 1FGVH 3VXTB 2ADFL 4F15B 2P5WA 3GKWH 4AK1A 4O2EA 4YDKL 4U7SA 3QNYA 1YEGL 2NY3C 2R15A 2GI7A 4K7PX 5GRVL 4OLXH 3P73A 5E2VL 4ZFOA 4PB9H 4NRXB 3KPQB 5LXGH 1B0GA 2XWJB 3WIIL 2YD2A 1OM3L 1INDH 3OMZA 2BSRB 4ZUUB 1T04B 3EO1B 5IW6A 3IXAB 4RSVA 3HNTH 4KZEH 2X09A 3H9ZA 2X89A 2LE9A 1Q94A 2C4FT 3QXDB 5B8CB 5IV2A 4XRCA 3L3OB 1SYSA 1YPZE 5C07D 3PDGA 5GRYA 4OCWH 3LN4B 3JUYA 5ILTH 4DGVH 4ODTL 1WFTA 3MO1B 4R2GD 1BFVL 3MV9E 5EIVA 4AJ0A 1NGPH 4PJEA 5IP4A 4J3VA 3PHSA 2RHEA 3UAJC 5E8PB 5E5RB 3T3MF 4EJ1C 3LHPL 5FGCB 4PRNB 4HFUH 1T4KB 3P77B 1T6WA 3HUJA 4HAFA 4IRJD 3ZKXB 3DX6B 3DURA 3ZKMD 4MA1C 1RURL 4HQQL 4N1HB 1Z6JT 4D0CB 3DVNA 2M26A 4Z8FL 5EOCJ 5CJ8A 4DW2H 1BF2A 5TDOB 4HEME 1QG3A 1RQ5A 2IQ9L 5KTEL 3LKOB 3DSFL 3PWLB 3T0EB 3ARFD 5K9JL 1ZA6A 2IG2H 2ADIB 3HRPA 4Z7WF 4C56B 3O6KH 1HINH 4LP4A 1M05A 1KPRB 1QSEB 1RUQH 3ZDZF 3BZ4A 3U79A 2NZ9D 3CUPB 1W2KT 4WFHD 1MELA 4ZTPH 3VFPB 2JB6A 4OZIE 3T1FB 4QHUA 1P7QA 3M1BA 5JDSA 4OFKA 3UC0L 3RGVB 2QLVB 3C2AL 1C08A 1A2YB 4AMKH 4CW1B 3EGSB 4D0BB 5HYJE 2XQYK 1YY9C 4F7EB 4RISL 3RTQB 8FABA 2ENYA 1I1AA 3SY0A 3DBXA 1OGAE 2DLTA 3BYYA 2DQJL 4ZPTB 4KKAC 2X41A 2CMRH 2X42A 3VXPA 5HI5C 2GSIA 4KQ3H 1X3DA 5IIEA 3BD4A 2IPUG 1VFAB 1FPTH 1I8IB 4J6RH 3FCTB 2DM2A 1AQDA 5FYLL 2VDNH 1OTSC 4U2ZA 3BZFB 4XCFL 2ZUTA 3GIVB 2MTPA 1JV5A 2GW5A 3Q1SH 4W6WB 1FVEB 4LF3B 1I9RL 4G6JL 3G5XA 4F7PB 1TJIH 3ZDYE 3FT4B 3L9RB 4NQEE 3QWOA 2FEEI 3FB6A 4Q7DA 3ULVL 1MAML 5IVXA 2FZ3B 3LB6C 4GSDL 1CF8H 5EWIH 1A6ZA 2OQJA 4JO4H 5T1MB 4JFOB 5IMLB 2VXQH 1D6EB 3X3FH 1C8PA 2P42B 4XPGH 1DQDL 1I9JL 4JM2A 4XP1L 3KXFD 4YQXH 3UO1H 5HI3C 4MA8H 1KJ3H 1WAAF 5CS7A 5L2JB 1NMAL 1A9EB 4L4VD 5ICYB 3LKQB 5BMFH 1EV2E 1WGOA 5DEGA 1AJ7L 1FNGA 4Y19B 3SE8H 4U6HA 25C8H 1VERA 3TFKC 1GOHA 4XC3L 3ZTNH 1N2RA 3FTGB 1CQYA 3NACH 5ISZA 4ZFGH 1I1RA 3GGWB 3H3PH 2NX5B 3RVVC 1KV3A 3U9PL 3EYOB 2AABL 3QIUD 2QV2A 3W0WE 4FQPA 4MZ3A 1UWGH 3E6HB 4UDTB 3F58L 1A3RH 5E2TH 3BGMB 3GB7A 5BZWB 1R5IA 3C08L 3OKEB 4X6EB 3CC5B 1RZ8B 1EMTH 1WEJH 2YWYA 1G6VK 4NRYB 32C2B 3ME0A 1A4KA 4QLRA 3EO0A 2BCKA 1PZ5A 1SJEB 3VJ6B 2GT9A 2HKFH 1KIRB 2VR9A 4YK4C 2ESVB 5D2NB 2P49B 4XCYB 5EU5A 3T2OA 1EO8L 2DQIL 1ZLSL 4ZAKC 2OSLB 1M6OA 4M7KL 3G5VA 2VDRL 4P2OD 1U8LB 1NCDL 2IH3A 4P4KA 4JM4H 1JRHI 4S1DD 2F5AH 1TZHB 4HS8L 3SDDD 2X4PB 2LU7A 4J3SA 2O5XL 4TTDD 3MGAA 4KROB 1E28B 1HQ4A 3UTZB 1SY6A 4UB0H 1UM5H 4QF1A 5ID1A 2R23B 3DUSA 5D6DC 2AXJA 4XPBL 3PP3H 4OGXL 5D7IF 5IFAL 4I2XA 4OIIL 2PW2A 2IANE 4JQIH 2BSTB 4EQ3A 4R97B 3D85A 2VITB 2H3NA 4WGVB 1HWGB 4G9FB 3S37H 5AZEH 3RKPA 4AEHH 3MCLH 3MLSH 1ZT7B 1H3PL 3QDGB 5GGTL 4L8SA 1NGZA 1YEIL 3ARDC 5T3XH 2QKIA 4JFQB 2XXCB 3BRDA 3TBWA 2HA1A 4Y2DA 4RX4A 1MIMH 1CLYL 3RWJA 4H8WL 4Z7UA 4HKZB 5HJ3B 5KAQF 1L7TL 2P7TB 4K9EH 3THML 4Y16D 3WHE1 5GS1C 1KTDA 1TQBC 1MFEH 2HG5A 3QPXL 1KUMA 3VXMA 1A64A 3QB7C 4R6UA 4LMQE 3NZHL 4OD3L 5HI4C 3T65A 4EBQL 4I48B 3L5JA 4FFYL 3X14A 4C4KT 4Z76B 3QCVH 4KWUA 3X11A 4F3FB 1W72L 4GRLA 5ANMB 5C09A 1N6QL 1MQ8A 4YHML 4KK8C 1MHHB 4YC2C 2DMBA 4F8QA 4X4ZA 1D7FA 2NW2B 5H94B 3M17B 4H25A 3KNBA 1IKNA 2VXSH 3UX9B 4FTVB 1X5GA 3T8XA 5A2IH 4KKBC 1KBGL 4NJAL 5FOJA 3VH8G 4U1KB 5FYKU 1ULVA 3QUZC 5K9OA 1A6AA 4RNRB 2BRRH 4OGYL 4HBCH 5F9WB 2BVYA 2I07A 1JNHA 1YMMB 2YOCA 2UVFA 4KV5F 2AEPH 3KPLA 4PLJD 4YH6A 4DEPB 3TZVB 1DUZB 2K9UA 3QQNA 4TNVK 5SX4H 3KPRE 3GSRA 5DRXA 1J0ZA 4ZQKB 4AG4H 4XP9H 2LU3A 4ZUSA 1J10A 2VZ1A 4U0RB 3WLWD 5DA4A 1CFBA 4UV4L 4J8RB 1ZLWH 4GXVL 4DN4H 2FJHB 3RL1B 1KNOA 3U4EA 2PUQT 2XTLA 3B8YA 3PQYE 4QHMB 5F9OL 4YFDB 2DIBA 1AR1D 5FF6A 5B39A 4RMRA 1JFQL 3K1KC 2WBJC 4XXDA 5E4EB 1D9KC 3D6GA 4YLQT 3QRGH 3IS1X 5A40E 4D2NA 2UZIL 3O11B 2YKLH 4FQ1H 2ZOLB 3HMXH 1T1YB 4O02H 3B6SB 2VDQH 5ITFA 1S7SB 2HT4C 1BEYH 5EU3B 1NCTA 3I02B 2HN7B 2VUYA 3FO2A 3FONA 2F74A 3SKUD 2YMXL 5I8EB 4L4TB 4ISVA 4M8QA 4X7TB 2D0GA 4MJ5A 4YHIA 1TQCC 4LSPL 1TNMA 2EEDA 4WUKL 5DK2B 3PWPE 4XBPB 3UTTB 4PJ7A 2BP3A 3KPTA 3VFOB 3MJ9L 1X5IA 4XTRC 1CICD 1U8MA 1QLFB 4P5TA 3PHOA 3EHBC 3NCFB 3MRNB 4FQXD 4PR5A 3QUMA 1A7OH 3SBWA 1I85C 3O0RL 4KJWC 4WUUB 4KY1L 3BSZH 1NKRA 5I1CL 1TIUA 4BQ9A 2DQDH 2WM0A 3BHBB 1HZHL 1K8IA 3UJTH 3ILQD 1XF2B 1CK0H 2J8UB 4UNVA 2W38A 2X9XA 1EFQA 3MGTA 2VR5A 3VGAC 4Y89A 3LN5A 2PKDA 2FD6H 1ZA3A 4JFZL 1B88A 1EBPA 2IFFH 5D71H 1UM6H 4FFVD 3CZFA 3IKCA 4ZXBA 4M6OH 2FGZA 3I3DA 3ARBC 5SWQB 1PX3A 4HJ0D 4JPVH 3SGKC 5GS0H 3DXAE 3VMPA 2G5RA 4LFHG 3W9EB 3H9SD 1GC1C 1D6VH 1JPGB 3ULUH 2EDOA 4Z7VF 5LQBH 3SO3B 4NFCA 8CGTA 3MODH 3G6JB 3P4NB 5DR5L 3L5XH 1KEGH 1EGJL 4MNGE 1DCLA 1YY9D 4JFFE 5I75C 1QLRB 1S3KL 3U30C 5A16B 3O6FB 1D5ZA 2UWEF 4M3JA 2BXZA 4HXBL 3FOMB 4PJCE 2YD4A 1YNKH 4BH8A 3V6ZB 2D7NA 5IW1B 3P9WB 4GW5A 5F1NA 4F33B 1UWEL 5IEHB 1L0YA 3GBML 3QEGL 3D5OF 3BT2H 1FV1A 1B4JL 2F19L 5L2KD 2WSKA 2VRAA 3VXRB 3QIWC 4I0PD 4BK4A 5E2JA 1XF5A 1DQQB 3ZLQC 3AS2A 1QYGL 2WV3A 2GYSA 3D3VE 4FNLL 1U3HA 4JREB 2YBRA 5DC9B 4GAGH 3QXAB 4X4XB 3D25A 4PBWD 4BFEA 4HUKB 4NQDA 5IT2L 3Q6GL 4JDVA 2R0WH 4S11A 3LB6D 4N9GA 4WU5B 4GKSB 1K2DA 4PJIE 1X5AA 4I4WB 3CFKB 2CLRA 2HRPL 1ORSB 4HJJL 5GS3A 3MV7D 3T04D 3O2VL 4J23A 1XGYL 3VXTA 3C8DA 2ARWA 2R0LH 5MHSE 3BN9D 3QP3A 4UT6L 3SOBL 3MXWH 4GAYB 4WTXA 1A6UL 1KJVA 2X4UB 3KAAA 4NRXA 3KPQA 1BZ7A 3NPSC 2XWJA 2YA2A 3R0NA 3WFDH 4X6DF 1I4FB 4ZUUA 1E4KC 2BSRA 4ODVL 4OI7A 1T04A 3EO1A 1DE4B 1X6NA 2XA3A 3IXAA 4GT7A 3O3EB 3S3SA 1XIWB 4TNWF 2ICEB 5C0BE 4DJMA 4AM0B 4WI9A 3QXDA 1ZE3C 5B8CA 3L3OA 4OLVH 4Q9QL 3S6CA 3LN4A 5GSVB 3CLFH 2D7QA 2DIAA 1CDYA 4JJ5B 4KXZH 4KKCD 3CLEL 4LASL 1OSPL 5FUCE 4WV1B 3MO1A 2EXYD 3C5JB 4OB5L 4FFZH 2DQEL 5E8PA 4KV5E 4PRNA 1CD1B 1G84A 1V7ML 1T4KA 3P77A 4S0SD 1JGEB 5GJTH 3DX6A 3MBEC 3V4PL 4CBPA 4M4RA 4NUGH 2XNAB 4NM4L 4D0CA 2C4FU 3SE4C 1GOGA 3SGDI 4O4YL 1Q1JL 5TDOA 3DMMA 5CJQL 2IPTL 1X5ZA 3QCUL 3SDXF 3LKOA 4KRLB 3PWLA 2IAMB 1QPPA 1ZVYA 1ZANL 1MFBL 2ADIA 3JV5A 2NZIA 3U4BL 4C56A 3RUGE 2ARJB 1KPRA 1QSEA 1NMBH 2NY6C 3P0VH 3CUPA 1TTGA 3JWNC 3VFPA 3T1FA 2DBLH 4CVZB 4Q9BA 3RGVA 5IMOB 2DQUH 4KUCF 2A2QT 1A2YA 4FXGB 1UWXK 4CW1A 3K8KA 4PP1C 3EGSA 4D0BA 4YHYC 2AJYL 3RTQA 4LLVB 1FORH 1F4XL 5CEZL 4K23L 3HA0A 3O6ML 5T1KB 4XBGB 3LRSB 4NKOB 2D4DA 4ZPTA 5D2LE 3H2WA 3TEUA 4P23B 9CGTA 1VFAA 4K2UH 5JXED 3QHTC 1I8IA 2XWTA 3FCTA 4WO4D 5LGJB 3BI9X 4XGZB 3BZFA 4R4ND 3GIVA 3CZJA 1UM4L 4D3CH 5IKCB 1TJHH 1FVEA 4LF3A 3J8F7 4IOFC 1BZ9B 5IEKB 3KJ4B 4FMFA 2E27L 4F7PA 6FABH 3R1GL 5KVFL 3FT4A 2XZQL 3L9RA 2CGRL 4NO3B 1KGCE 1NGWB 1CXIA 3VXOB 1YEKL 4OFDA 5ADOH 3BESR 1NCBH 2FZ3A 3T0WA 3FRUB 4WY7L 5T1MA 3GNML 4JFOA 2JJSA 3C6SB 5IMLA 1D6EA 1JCKA 4JHBA 3S8WA 4N68A 2EIBA 3C09C 5DWUH 3QUZD 4LEXH 3HC4H 4X5XB 5L2JA 1A9EA 4NC1C 1EJ6A 5ICYA 3LKQA 1UH4A 3P30L 2IEPA 4BSJA 1QSZA 4F2MA 2NY4B 4EUPB 5HD8C 3H42L 4OGZA 4Y19A 5F7EL 4PRID 4LKXB 1R24B 4HC1H 5C0RH 4KK6D 3EYUH 1TFHA 3BQUB 3FTGA 2Y7QB 4XCCH 3ELAT 3GGWA 2NX5A 2KPNA 4Z7VE 1U58B 3EYOA 2ADGB 1FLRL 3MUZ1 4L3AA 4PJ9C 4UDTA 3LQZA 1JZ6A 3AROA 5BZWA 3WSQH 4LKCB 3OKEA 4X6EA 3CC5A 2FATL 3D18B 4L5FL 1RZ8A 5DRZB 4DK3A 4WCYL 2FHBA 2AJZB 4FQQB 2A9NL 5F1IB 2CO6B 2D7OA 4TPRL 2W9LA 1D9KD 1SJEA 3VJ6A 4MYWB 3CSYB 5IF0B 1KIRA 1MCPH 4U6YB 5T1DH 1DQLL 1WT5C 2EC9T 2ESVA 5D2NA 5J3HD 4XCYA 1RFDH 5EZOH 3FMGH 2EDKA 3HG1D 4GBXC 4PRPD 4X9IA 1QRNB 3BISA 5JW3H 1FYTD 2OSLA 3QSKB 1AE6H 1BQLH 5D7JC 1KG0B 2VSCA 2B1AH 1S9YB 2F54D 2OP4L 4WEUD 1U8LA 5JXAL 3B9VA 3O3BB 35C8L 3FFDB 3MRBB 3ZE1F 3I75B 4HUNB 2Y36L 1FFPB 1OT2A 1TZHA 3EDKA 2X4PA 4OUOA 1E28A 1DBKH 5A2FA 4XWGL 2X40A 4ORZC 3UTZA 1F11B 3B9KB 3OJDB 3BOVA 4M93B 4PV8B 4UAOC 2R23A 2WZPD 2J88H 4O58H 3ARFB 1AP2B 4UI2A 2HFEB 1IILE 5MP6H 4CU7A 4M9PA 4MD0B 4FXLA 3BYTA 3FQUB 2BSTA 1ZOXA 3VWKC 2VITA 3E6FB 4G9FA 1CE1L 4PJ5B 5MEND 1F45A 4QXTB 3QDGA 4QGYA 3UXFA 3QDJB 1ZS8B 4JFQA 3GRWA 3S7GA 1F3JB 1J7VR 2FHCA 4NSKB 1IQWH 4ZFOL 1MEXL 1AHWA 4PGJA 1MI5A 5HJ3A 4HKZA 5B3NA 2NY7H 3BP7B 2R0ZL 3EO9L 4HV8B 4MAYA 3QG7L 4Q6IB 1NGQH 4MWFB 5AYQA 1RZJC 3BP5B 1DANU 2LV4A 4M00A 4BFGA 4JY4B 3DETD 2IGFH 3NCYS 3ARBD 4X7FC 5GGRB 1JZ2A 4UINL 2HTLC 2VLRD 1PLGH 3AREC 3V0VB 1YC7A 2A6IA 1KN4H 1S8DA 1MJ7H 4I48A 1TZGL 4KJPC 3BAEH 4OZHE 4P9HC 4Z76A 1NL0L 4FFWC 4RDQF 3DRTB 1HDMB 2R4RL 3OAZH 5ANMA 3ULVD 2WWKT 2CDFB 4DFIA 3SKNB 4HUMB 1X4YA 1MHHA 5LBSH 3C5SB 1QTYT 4XP6H 1KFAL 5GRVK 2NW2A 5E6ZA 3ALPA 5H94A 4ZNCD 4XAKE 4PG2A 3M17A 1QRKA 4PGEA 4FTVA 4LU5H 1GH7A 3L7EB 4U1HB 1NLBH 4U1KA 3IDXL 1TTFA 4L4VB 5HVHC 5B38A 5KSAA 4LNVA 5E5MB 4RNRA 5J9PB 2YD7A 4BYHA 1P7KB 5GPRA 1YMMA 1BBDL 3OKMB 3BEVB 5L8LB 2FIKA 4KK9D 2A6JB 4M6NH 5D7LE 3M8OH 1YYMH 1DUZA 3QO0B 4L9LB 4P99A 1YN6A 3MOBL 3QIUB 2CH8A 2F53E 1BM3L 3N85L 4NPYB 4NM8H 4J8RA 4N5EC 4HLZH 4UMGA 3RL1A 1AQKL 4N0RA 4PJGB 2D4FA 2A74A 1RIVH 4QHMA 2VDMH 3MLWH 2JKXA 3QUYC 3HAEG 5CSZB 2J2ZA 4NN7B 2Z8SA 1II4E 5I17B 5I1DB 1CD0A 2XV6B 4GUPB 5D4QA 5I74B 3FFCD 1MJUL 3O11A 2ZOLA 3ORJA 1T1YA 1A7BA 2E5EA 3SQOL 3B6SA 1RIHH 4M43L 1S7SA 5EU3A 3KYKL 3I02A 1I7UA 3QXUA 1P4IH 2HN7A 3HE6C 5ACMA 2W07A 2WNGA 3F6IA 5I8EA 4L4TA 3SDDB 2VQTA 1YEJH 1ZHLB 2VABB 1Z0MA 5DK2A 4XBPA 1A5FH 1MRDH 2VN7A 1JPSL 3VFOA 1I3GL 5JIKA 3T0AA 2JCCB 3RWIB 2GK2A 1GJIA 4UILH 3MRNA 2FO4B 1EZVX 4GJTB 5EO1B 2DM4A 3GI8L 3P0YH 4TRPH 2Z9TA 4JPKL 4LAQH 3U0PB 3BHBA 5K59E 2QR0B 5DUPL 1ZVHA 4U0QB 3ZTJH 4LSQH 1T89C 1XF2A 1IC1A 2GJ6E 4N1CA 2J8UA 3MACL 4U1MB 1FIGH 4QRRB 3QFJD 1QSFE 4LSRL 4Y16B 4TNWK 3IDGB 3IU4H 2PO6B 3RVWD 1GPOH 2GY5A 2BC4B 5LJYH 1OARL 2XYCA 3BKMH 5SWQA 4LNRB 1J1XH 5C0EB 4JR9L 4RGMB 1YQVL 2Z92B 4RBPK 1U95B 3T77B 4JHZA 1LEGB 5ALBH 2NY1C 3W9EA 1H9VA 1MAKA 3KPSE 1JPGA 3JWOC 4P3CH 4YHNB 5EZLB 1A1OB 4TULL 5L8KB 2DQHH 4QRSB 5M95B 1JPST 3G6JA 2MOVA 1YNLL 3P4NA 4P59L 4LVHC 3MC0A 4TVSa 3N9GH 1QLRA 3F65A 4IMKC 5A16A 3OTTA 3O6FA 5FCUH 3RDTB 3ZE1E 2AVGA 3FOMA 3RHWF 1H0DB 1IGTB 3KS0J 1QFUH 4HPYH 1YEDA 4AQOA 2O93L 2YC1B 5GISH 3S5LB 3RY6A 3V6ZA 2BMKB 3WFZA 4F33A 3R0MA 5IEHA 1IAII 3DRQB 4R90H 2XPGB 4FHBD 4KTEH 3TJHD 3VXRA 3IAPA 1CGYA 4IIQB 1DQQA 4JFYB 4ZS7L 5BRZB 4RWYH 4DWHA 2O61B 4HD9A 1MCOH 4IOFD 1CDHA 3MNVB 4PRAB 3QXAA 2JJTA 4X4XA 5HHVH 5IFJB 1KLFA 2BK8A 1AFVH 5EIQA 4Z7NF 4MB4A 4WU5A 5I16B 4EXPX 4I4WA 3REVA 2HFTA 4DAGL 4HEPG 2CJUH 3MLZH 3CFKA 1ORSA 5JOPD 4HWEH 3MV8D 3UTPD 2CRMA 1RMFH 1BJ1J 2F58L 5EOCH 5FUZL 3SDYH 4KH2A 1IEAB 3IFNL 1MJJB 4F57L 3BUTA 5DURD 2NY3B 2PW1B 3VU2A 1HSBB 3LIZL 1KYOK 4GAYA 3BUYB 4P3DB 1T2QH 5BV7C 5D5MB 2X4UA 1K6QH 4MS8C 4ZSOB 3WEXA 3VXNB 1VKXB 1I4FA 4LSSL 2DQGL 1DE4A 1CICB 4GRWF 3O3EA 2ICEA 4OCRH 4BUGA 1J11A 4AM0A 4HS3B 2Y07L 1QP1A 1A3LL 4FQLH 2PR4L 5C7XH 3O2DA 3W5MA 4FQXB 4X98B 1YC8A 5GSVA 4G8GD 3KPNB 5E6IC 1YEEH 4JJ5A 5FM5M 3RPIB 5FHAL 4OM0L 4WV1A 1CYGA 2EDJA 3A6CL 3C5JA 1DLFH 4JY6B 4MJIB 4CUCA 1CDGA 4PTUB 1A6WH