1D5IH

Unliganded germline precursor of an oxy-cope catalytic antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
QVQLQQSGAELMKPGASVKISCKATGYTFSSYWIEWVKQRPGHGLEWIGEILPGSGSTNYNEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARGHSYYFYDGDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational effects in biological catalysis: an antibody-catalyzed oxy-cope rearrangement.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords CHIMERIC GERMLINE PRECURSOR OF OXY-COPE CATALYTIC ANTIBODY A
total genus 43
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1999-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d5iH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d5iH02
4HGKC 3DVNA 2BOBB 1GSMA 3L9RA 4YWGL 4JE4B 1MCOL 1FFNB 1XGYL 2VH5L 1WEJH 2HJKB 5F1IB 1HHGA 3FMGL 1MLBA 2AS5M 5KW9H 3FFDB 4QOKB 2QQNL 5KVGL 1MNUH 5LVEA 5CD5D 4G8FB 2BRRH 3W9DB 2PTTA 4S0TD 5I8EB 2VJXA 5K93A 4HQQL 1OP3H 3ZTNL 4HZLA 4PJFF 3MMEA 4ZYKA 2NY6D 2H2PC 5T1DH 5J6HB 1QSED 4PJ7F 3FT3B 3TC9A 5EA0L 5FYLH 1RHHB 3MRKB 5IEHA 3BIAX 3HC4H 2DJUA 4UQ2A 5C9KA 2GFBB 1FNEA 3OXRB 2CIIB 3JV0A 3UTSD 1Q94A 3PDOA 3IGAB 4YFLF 1VGKB 4GW4B 1QFWI 2H32A 1VDGA 3FB7A 4I3RL 2X05A 2DLTA 2Q76A 4G8GE 2Z35B 3HAEB 1YN7A 3MGTA 4X6EA 5GSVB 5C0GA 2QR0B 5SV4A 3WIHH 1CDGA 2XY2A 3RGVC 4Z76A 1S7UB 1ZXQA 1UZ8A 4DK3A 1TNMA 2DDQL 1NGWA 4YXLL 3EYUL 4LIQH 3SOBH 5TDPB 3ZT6A 1J1OL 5ETUA 3WO4B 1QFUH 4OZHB 1JTTA 4XZUB 3WNNA 1K85A 4LQFL 5FKAA 4PRBA 3SDDB 3SDCA 4JJ5B 3QG6A 3ARFB 4S1DD 2KL6A 4XCEB 3P30H 5F8QC 1OM3L 3C60A 4NHUA 5AD0A 2IAMA 4UILL 5MP6L 2XZCH 1FFOA 1G6RH 4LNRB 4GLRI 5KS9B 1R3IH 1L4IA 4PRAA 4TSCH 1EDQA 3CC5B 4FTVD 4I4WB 4PRIE 1DQDL 4OUUB 3INUL 2NYYD 5EBWA 5LBSH 3P2TA 5E8EB 1S3KH 2NYYC 1C5BH 2MKLC 3CFCL 4FQCL 5E99L 4AG4H 1W72L 3AS0A 5GGVH 2KZ1B 4A2LA 4AEIL 3ZSTA 1MPAL 4HJGB 3SDCB 3IDIB 2F19L 4IOFD 3TBTA 1ZSDB 5B39A 5IJKA 1AH1A 3QIBA 1GRWA 2CD0A 3QEQD 5EUKA 1A6WH 3PNWA 3H3PL 4K7PL 4Z95L 4LHUD 3STZA 5T1KB 4YBLB 3JWDL 4HJ0D 4L4VA 4TVPH 3EJJX 3ULVC 5AWNH 2G2RA 4OFDA 1FLRL 2XKNB 4NQCE 3HB3C 1VFUA 3ARGB 5E8EA 3RNKB 1HKFA 4LSPH 3G9AB 3B9AA 3LEYH 1MWAA 2NLJA 4ZO7A 3MPCA 1UWEH 2Y1VA 4K7PH 2BOCB 3B4NA 3GEWB 1BZQK 5FAAA 3ECBB 1CK0H 2A6IA 3L7FB 4PYGA 5DMKA 1G6RA 4ZFFB 3BRFA 5EN2A 4UOW0 5IROC 4MXVF 5D7IB 1BMGA 1UADC 1EGJA 2O5XL 1SJHB 3LS5L 3IFOB 3VXTA 1UZ6F 4PGEA 5J1AA 1S7TA 1K5NB 3RIFF 3FHQA 2OJEB 4CJ0A 4G6FB 2ZUYA 1QRKA 4KFZC 2O5ZH 3FB6B 1U8IA 1DQMH 3IU4L 1HYRC 3ES6A 3QDGA 1JGLH 5DO2C 5FDWB 4LLDB 4GG6A 4NDMA 4P2QD 1QPPA 1ORSB 3MREA 3W2DH 1HZHH 1ZHLA 2QQLH 1K8IA 2UZIH 2YRLA 3ARGC 2FJHA 1U8KA 2CRZA 4LRNL 1FNFA 5J1AB 1MH5B 5L2JA 5JZ7D 1ETZB 5AZ2L 4Q97A 5F7DA 4BSWB 3JV5A 5DRZB 4JY5H 4RGND 1NAKL 3O3EA 4NQCD 3S5LB 5F70A 3F7QA 3S7GA 1C5DB 3MLSL 1W0WA 1MHPL 1KIQB 3BWAA 4O4YH 3O6FC 3GSRB 3BGMA 3QWRD 1WQVT 4YHIB 5BV7H 4GKNB 1CDUA 5HJ3A 4G9FD 5EOTB 4ETQB 4I0KA 3TN0C 3THMH 4H20L 3DX9A 1ETZA 3CAFA 4Y5YA 1KJ2H 2IBBA 2C7UA 4K23H 4NQXB 2FBOJ 4CL7A 1KC5H 3GIVB 2BHZA 3L5IA 5DD1L 5KOMC 5EU3A 4CU7A 4XNXH 1WC7B 1U3HB 4KQ4H 4PJXA 3TZVA 4PJCE 5FUZH 2BSRB 4ZPTB 1KULA 4LP4A 1CD9B 2G60H 1RUKH 4KPHH 5DD0H 4YGAB 1I3VA 2HFGL 4MNGE 3FZUD 2VABA 2X4NA 3ARBD 4JN1H 3CVIH 2VDNL 3QULA 2ZNXA 3KPTA 4M8VA 4KJPD 4TSAH 1A6UL 2VMFA 4GAYB 5TFSL 4Y4KA 2F58L 1T4KB 5C0AA 4GS7C 4ELKB 2IBZX 2BMKA 4EDXA 4XNXL 1SMOA 3OKYA 3BJ91 3BOVA 1S7WB 3RPKA 4XCNB 2F54A 1WZKA 5D2NC 3HUJF 5EC1A 5GRXG 3VFMB 4E42A 5IEKB 1H3TA 5TDNB 3DVGB 2P5ED 1NMBL 4HXAH 1FG9C 4RNRB 2BNRA 5ILTL 2BSTA 1V3MA 3EYSH 5CCKH 4HIHB 3KYAA 5M95B 3QNYA 4LVHB 5D7IF 1CR9H 5GS0D 1MLBB 4FZEH 1F4WH 1MPAH 1NDMB 4GRLA 1NJ9B 4L8DA 1ZLWH 3EFFB 5IBLD 3GZKA 3LKPB 5DUMH 5HYFA 1CWVA 4JFQA 2G2RB 2Y07H 4YC2B 1U8MA 2GJZA 1YMHB 4ZXBC 1MVFA 5DK2A 1LE5A 1WIPA 5FYLL 3QIWC 3VCLA 5HI5D 3U4BL 1LEGB 3ARDC 4G42B 3FO1A 4Y0GA 4PG2A 4XWOD 2FECL 3TBYA 2CH8A 1KTRL 4HUUB 1UYWL 2J8OA 2VYRE 4IRSD 5EOCL 2P48B 5ITFA 5C0IB 4Y8DC 5I1GH 1G6RB 4ZFFA 2B1HL 4LLQA 3QDHA 2CUMA 5IBUB 2CUHA 5EIQA 3ULUL 3L3DA 4U6XB 1KENL 1WFNA 3UPAA 1RZFH 4H0HB 2DTML 4NCC1 3L3HA 4Y4FB 4X83A 1V3LA 3WLWD 2OXHA 3ILQC 1KCKA 1MHHB 1J5OH 3ROLB 1G6RL 1R3KB 1J8HA 4POYA 1TVBB 3SDXE 1WZLA 3ARXA 5D8JH 2VQ1B 3HS0A 3PHQA 4PPTA 3MRHA 3JV6B 2B39A 4IRZL 2HKHL 5E9DB 2OI9B 5E2UL 4LLMB 4HUVA 1R5VA 4M02A 4XMPL 1NCDH 1DE4B 4ZS7H 1NGXB 4ZPVB 4ZXBB 1LNUA 1VFAA 5HHMD 5IMLB 4GRLC 1A47A 4I0PD 3ZL4H 1NKOA 3V95A 2HFFB 2DOCA 5C0GB 1T04A 4DKDC 3STBA 4JLRB 3U83A 2W65A 4X6FB 3N06B 3ROLA 4WVRA 5MERB 3GBNL 1P6FA 2B4CC 2H9GA 5DD5L 1RZFL 4NNPH 2X4OA 3JWDH 5F9WC 2NPLX 1VB9A 3HE6A 2H1PH 2CGRH 5J12B 2NW2B 3QDJD 1JFQL 1PZ5B 1QG3A 2QQKH 4U1IB 5T1KD 1IQDB 5DJ0A 1A7NL 1IC7H 1MIMH 1AHWB 4M6AA 2PYEB 1WIOA 1TTUA 5CSZB 4RZCA 2R4SH 3NCYS 3GK8H 4PJIA 1E27A 4LCUA 1H15A 4YHMH 3EDDA 4JFFA 3LS4L 3MJ9H 5F7YC 4HIJA 3BEVB 4XPGL 1FCGA 2DLEA 1XEDA 5BVPH 3ABZA 1CN4A 5DDHA 1A7QL 3A6OA 5GGSA 1LEKA 2JKXA 3KAAA 3GMMA 4HPYL 3MXWL 1R3JB 3IDUA 3TZVC 4I0CC 5C0FA 3KJ4B 4YPJA 1P7HL 1RZIB 3ZDYE 3W39B 3VXMD 2R0WH 25C8L 1RUAH 3V5DB 5GRZA 3QP3A 2NZ9D 2EH8H 4YDJA 4P5TB 4TQEL 1NCWH 5I1AA 4AIZA 4DOHE 3QH3B 4UIKL 2AQ1A 4UT9L 1T83A 5FCUH 4G6JH 3HE7A 2WSKA 4IDJL 4XH2B 4D9LL 2ADJB 3WSQL 3F5WB 4CKVX 4NQEB 1AJ7L 3DXAD 4IIQB 3QI9C 2X2YA 3FT3A 3VFSB 1URLA 5LG1A 4JZNB 4NHCL 4J3OC 4E5XB 3V5HB 5BCAA 4LSVH 4X9FA 1QRNE 5CUSL 4AQOA 2H32H 2J6EA 4F8QA 3HZKB 3BQUC 2FHCA 3AXLB 1PEZA 4PTTA 4CMHB 1GGYA 4KKLC 4G9DB 2A77H 4FFYL 5EO1A 4K71C 1JI2A 5GGTL 5DHVB 3QEUA 3MA9L 5LAXB 3MZTA 1YN7B 3MGTB 1DQJA 5J57B 3TYGH 2BVQA 1NPUA 4WO4B 4P2CG 3DVNB 3HKFA 5TQ0L 2DI9A 2NY3B 4XWOC 4P3CL 2C4FT 2HG5A 4WU5B 3SCMD 4NN7C 1N6UA 5E95B 4Q6YA 5D93C 1AP2A 4E41D 3UTSE 3DV4B 2VITB 3F7YB 4K23L 3S35L 4QHMA 2BRQA 2PW2B 1R5WA 3QUYD 3LV3A 4YZFE 2Q86B 2VLJA 3UROR 3LMJH 4S1QL 3CFEA 3DMMC 5CUSH 2LAGB 3T4AA 3V6ZB 2BCKB 7CGTA 3ROOB 4Y2DA 2IAND 3CD4A 5IROA 4I4WA 5E2JA 2APFA 1MCCA 4XHJD 1MELA 3NTCH 1DSFH 2FD6L 1X44A 1KTKE 2J8UA 3RGHA 3D85D 1OT2A 4NKOB 5E8PB 3FL7A 4DJMA 4Q9BA 3LN4A 4MA7L 1A1OB 2JELL 5D2LF 3SKOA 2VZUA 3OPZL 1UWXH 3RVXD 2PW2A 4HFUH 1FO0H 4OBSA 3V5KA 1S7QA 1H0DB 3MRJB 3PNWB 1T66D 3D2UA 3EKCA 3OSKA 4UUJA 1K8DA 4MNHA 3ARPA 1NCUA 2COQA 3WNOA 3B43A 3AM8A 3MLWL 6FABL 1OWRM 4Y5VC 3ARBC 1ULVA 3ULSA 2H2SD 2JIXB 4NRXA 3QIBC 2DLIA 3VXQA 4YHYC 4K7PY 4HF5H 3C60D 3REVB 2J1KA 1A22B 5D1ZD 4DCQA 5ADOL 5GGUB 1BIIA 3KYNB 4ZTOH 1DQQB 3DYOA 3QQ4B 4I3SL 3MRJA 2GTWB 2DD8L 2P5EA 3G9VA 3EYQC 2Y23A 2NY2B 4NKIH 1NUNB 2BNRE 5IB5B 4NC1C 5F7LB 3R1GH 3DTXA 3RVWD 3UO1L 3BE1L 1Z0NA 1BJ1J 1K6QL 1MI5B 1WBYA 2F53D 2AJUH 2WNGA 2VZ3A 3W9DA 4NZUL 4XCCL 3VFPA 2FB4H 4U1NA 1YEIH 2X9WA 1J86A 2BDNH 2VIRA 1IKNC 5KZCB 1OF2A 2VLKA 3IRZA 4FFWD 5C8JA 4O51A 2VXUL 4O58H 5KSVB 3DO7A 1N64L 4JN2B 4JG0H 5FDWA 1AO7A 2UVFA 1KLUA 4N0FA 3QYCA 3I75A 5L88H 3UTZB 1NEZG 4Z95H 1WZMA 4KH2A 4PREB 5B8CC 2E6JA 2R2BB 4MJ5B 4AEIH 1G7LB 1KJVA 1QKZL 3LEXB 3WIFA 2F19H 3G6JA 1KTDA 3SEPA 5L2KD 2DQGH 3MGOB 3MROA 3I50H 5C0CE 3U4EB 2X7LA 1GC1H 1YEKH 2E8ZA 4JPKH 2OP4L 5EN2B 3UAJD 3IFLL 1X5HA 2MOVA 2CGRL 4KY1H 2L0DA 1TTGA 3IDYB 4M4PA 1XR8A 4HWUA 3OB0K 1U36A 4KJYA 2UWEA 4MX7B 4XMKH 1A9EA 3HCVB 5HYJB 3MLUL 4OCMC 1RZJC 4QRRD 3SE3A 3ZLQC 1WTLA 4FXLA 3AAZB 3TPUA 4PJ5B 4M7LL 3C5ZD 2GITB 3VD7A 3DX8B 5E94B 4JLRA 4XXCC 4NOFA 4YH6A 2PXYA 4JKWA 4WGVB 1HEZA 5JOPD 4DAGH 4TRPH 1WSST 1UJ3A 1SM3L 4WW2F 4EI5D 5HI5C 1T7YA 4HDIA 3MLPA 2OYPA 1G9ML 4V1DE 1QVOA 4ZOAA 5IG7A 1WC7A 2WIIA 2R1YB 1T3FA 3KVQA 4A2MA 2FZ3A 1WIUA 2VAAA 4QF1A 2DQDL 3O2VL 3U6RB 2AP2A 3K2UL 1PW3A 2EC9T 5D70H 2RQ8A 1Z6JT 3LPFA 5AYUL 1IAOB 4X6CE 2R8SL 5J06A 4RZCB 5CMAA 1PSKH 5IGXL 1JZ5A 3IDJB 3QQ3B 1S5HB 5GISL 1CFQA 1TENA 1T6WA 3FTGA 2IQ9L 5DRXA 3T04D 5C6TL 1W0WB 1N2RB 1NFIA 1OSZA 2LVEA 4GUPA 4U7MA 1TTFA 2Z8RA 1WBZB 3V6OC 5DWUL 1T2QH 3IDGB 5HJ3B 3LKSA 4NC2B 3D85A 3VXOA 3ARSA 1FH5H 4PRHA 3S4SB 1U92A 4JZOB 3O6FB 3NCMA 3D5OF 3S34L 3IAPA 4Y16A 5JMRA 1E0OB 3U0TB 5JO5A 5H2BA 3CX5K 5F6HJ 5D96B 4MNQD 4PRHD 4JN1L 4BKLB 4J7RA 3CPLB 5ALBL 4D0CB 4YWGH 4GRMB 3QH3A 1RAMA 4BH7B 5TE6L 4L8DB 1RQ5A 3WEXA 1QZ1A 2VABB 2X4NB 3CFJA 2KDGA 4UAOC 3RZCB 4NFBA 3AREB 4HKJB 1I7ZA 2ZUVA 4Y5XC 1NEZB 1PVHA 3GMMB 3L6FB 5J89A 2OTWA 2ICES 3GM8A 4WEBL 4ZTPL 5FECB 3BMWA 4HIIB 3QDAA 4OV5B 2IQAB 1VACB 4PY8J 3KPMB 5D1XC 5I9QC 1EX0A 4Z7WE 3REWB 4KVCL 5J3HD 4M61B 4N1HB 4H1LG 3T8XB 4X5XB 4LLUA 4PJ9B 4LCWA 4XH2A 4WFED 5JIIA 5JOFA 2WBJC 3QDGD 2APTA 2I5YH 3P9LA 1JUFB 5E8OA 4M7KL 5E2VH 3IF1B 3S5LA 2VDPL 4WWKD 3BKCH 5F7UA 2G5RA 1XCTA 4XVSH 3GJFK 4X6DA 1A64A 3T4YA 2QSCH 4GG8A 3H7BA 5IM7A 3E6HA 4I9WD 1X5XA 4KJWC 2A1WL 4GW1B 3ZL4L 5D6DC 3OPZH 5C09A 3VMOA 4JHZA 4U3XA 2XG4A 1N0XH 4M5YH 1WTGT 1U8JB 5IVXA 4Y5YB 4PGCA 3X3GH 3UTQA 4FTVB 4HWBH 4OLUH 4HXBL 2YD6A 4R97B 3IDNB 4QWWD 5IB3A 4NP4L 1JZ7A 3X3FH 1P9MC 2Z91A 2NR6D 4KGLA 4RAUB 4RFNB 5KJRH 4G8EA 5I19L 1P5UA 5FOBA 2PETA 4MD0A 4NWUH 4Y19B 1IBGH 1RHHA 1IQDA 1RFDL 3J8F7 3MRKA 3VW3L 1P1ZB 4K3DL 1BM3L 5KAQG 4N0UB 4R4BB 3MRRB 1BFOB 2DTMH 3L5XH 4LAQH 4NKIL 4YO0B 1Y0LA 5CD3A 3BPOC 1KIRA 4YUEH 2BY0A 2AJSL 2PYEA 5FB8B 1HQRA 4FMFA 2CLVA 1HWHB 2JJWA 4I3SH 3D69B 4APQA 2C3WA 4JCMA 4JM2D 2NX5D 5DC4B 2PXYD 3P73A 1FDLH 5JOPE 1UZ8B 5AZEH 1YZZA 4BA8A 4WCYH 3BE1H 1G0YR 2NY2D 1F4YL 1TITA 4UMGA 4Z9KB 1X5YA 4IDLA 1SEQL 2HFFA 4FP8L 1FL6A 2AXHA 3WO4C 4MCYA 2EDTA 1BGXL 1C1EH 2AXJA 2IF7A 4RFEB 1YMMA 1AI1L 2ICCA 3D9AH 3QQ9D 1MHEA 5L9DL 3K80A 4NUJB 1ORQB 1T7WA 3BH9B 1MY5A 3NFPB 4ZUSB 2NXZB 3KLDA 1Q9LA 1NFDF 1I9RL 4YFDB 3PWUB 4YUEL 2Y25A 3DSFL 1BREA 5LGHH 4X99A 3C09C 2ENYA 5JOEA 3I9GH 5F3HA 1FGVH 2UY7A 3GRWL 3IFNH 2CO6B 3L3IB 1NFDE 2FX9L 4QRUB 1DBBL 2W07A 4J3VA 1QSZA 3TVMC 1QA9A 2E3VA 4TVSa 1MIEL 4YK4C 1CD1A 2BVOA 1NQBA 5GZNC 2P5WB 4LEXH 1MCPL 4HCRH 3HZMA 2Z93B 3DVIA 5JA9A 4QTIH 3LDBB 3QEHA 1CGUA 5H37G 4P5MB 2R4RH 3IKCA 4JKLA 7FABL 1UT9A 4ZUVA 4FNLL 5I8KL 5HYSG 2HMIC 1DBAH 3QWQB 4AY0A 4TUOA 2YPLB 4NO2B 3QZWA 1FIGL 3V5DA 2GTZA 1YEFL 3UC0L 4NM4H 2G9HB 1G7JA 3SN6N 5DMJB 1M05B 3PHQB 4WGWB 3MUHL 1TPXB 2CIIA 1MRFH 3WFHA 5T3ZE 5TDOB 5AAMA 3QHFH 1MRDH 4U2YA 3M07A 4JFDA 5DSCB 2E7CA 5MENA 4F80A 1S9XB 4P2OB 5KSBA 4OGYH 5GISH 1QUNA 2CDGA 3GSOB 1VHPA 4KVNH 3PWVA 5F88B 2ZWLT 4LCWB 4PGEB 1QACA 1CLCA 2CDEB 4G43A 2VDMH 3C08L 4LRIA 5DZLA 3SGKA 1TCRA 3RVVC 1U3HD 3SKOB 1NCCL 3IF1A 3SE9H 4JRXE 2Q1EA 4X4MA 2IQ9H 3B9KB 4M7LT 4XPBL 1DLFH 4M6MH 1OSPH 4W4NA 4PJBB 5CBEA 3SE4C 2MCPH 4O2CA 3H9YA 1QFWM 3V6FB 1TJGL 3B3IA 1A3LL 1ES0A 3G6AB 1ZLSH 5MHSD 2B1AH 3BRGC 3QUKB 2DQIH 1U8PB 2EEAA 1CGVA 5I30H 4HG4J 4EOWH 2ZUQB 4TUJB 3ALPA 1I1YA 3QUXC 4NWTL 4HPYH 1KLGA 4Y5VB 3RWDB 2WUCH 5CKGA 3P4MA 1RZKH 1ZHKB 2OTUB 1FNGB 4TNWK 3ZE0E 2M1KA 3Q1SL 3OXRA 5GSRB 1HQ4A 4X4YB 1PG7W 1MCJA 1DN0A 4KMTL 1KIQA 3U0TA 3ULUD 3V6FA 2JLLA 1GIGL 3CFDA 1F3JA 1HINL 3BH8A 3VGHA 5CD3B 4JANB 4MWFA 1AE6L 1LO5A 3ARED 4IRJD 3GBLA 1W0VB 2HTKC 5SWSD 3BUTA 1YN6B 3FOMB 1YY9D 3NCBB 1XGRB 5HHQB 3MRQA 3RX8A 1ZV5A 2DYPA 2PKDA 4XPTH 3OWEA 3UJTH 5LXGL 2EC9U 3KPSE 1YY8A 1ZE3C 5DC9B 2DI8A 3BKYL 4U1KB 5TH2A 3QI9D 1S7RA 3D39A 4MVBD 2KQNA 3P30L 1OM3H 1QBLH 4H1LH 4NRXB 2ZCLH 4U3HA 1A4JA 3WFEH 2I9LB 5KN5A 4KMTH 5F1IA 1QSFD 4RFEA 4JFFE 4DCQB 1MCWW 1YMMB 1LE9A 1UENA 4LFHD 3WFCH 4ONFH 4CUCA 3LKRB 1BAFL 4M5ZH 3VFOB 4AK1A 1YYMH 4MQXD 5J4MA 4DUVA 1KG0A 1XT5A 4PJAF 4BELD 5FO8B 4JRXB 2NZ9C 3LQZA 3MJ7A 4FFZH 2DJSA 1DQTA 2MQ0A 4PR5A 3QXTA 3LMJL 1XGTA 2HT2C 3H7BB 1DR9A 4PIRF 3UJTL 4HWBL 1XIWD 3I2CH 2XFXA 5K9OA 1JGUL 1IFHH 2J4WL 1H8NA 2Z4QB 2A6KA 1T22B 5C0CD 5DGQA 3SQOH 3KPNA 4I0PB 4WW1B 4XVUD 2R0ZH 3T3PE 1EUUA 5F7DB 1UKSA 3E1F1 3GSNH 4HJJL 1NLBL 5DJYA 1T1YA 2YPVL 4XBEL 1MCRA 4Z76B 2IPTH 2A73B 4PJHA 3MUY1 1J1OH 4K8RC 1FZOA 4NJAL 1GL4B 3AMKA 3O4LB 1MAML 2R1YA 3P11L 4YE4L 5JR1H 1IAOA 2CO7B 3WXWH 1CDJA 3BD4A 2OJZL 1MCWM 3P0GB 4WUUD 1GC1C 1K8DB 4N0CC 4GW1A 4HKZA 2W9LA 4EI6A 3IDMB 1ZLWK 4P2YA 1F6FB 1IGIH 1FNLA 4HWZB 2A9ML 1ZAGA 4IOIB 2N4IA 1Q72H 5ANME 1U6AH 3VDCA 1E4XH 5DRNA 2VDLH 2ZCHL 5JO5B 3DSNA 1I3GH 4OLWL 3GO1H 2FJHB 3FT2A 3GMNA 3HG1A 1JYNA 4JZOA 1X7QA 1C1EL 1T1XA 5GGVY 1UCBH 3V6OE 4X8JA 3DIFA 1CI5A 2EDNA 1VADB 4OFKA 5IP4A 2W92A 3MCKA 1N5AB 2BERA 1PY4A 2CR3A 5DQ9B 1B4JL 4TULL 4L4TA 3CFBB 2UYLB 4P48A 3SDCD 2XKNA 4NQCB 3SE9L 5L6YL 5I1DB 1KN4H 2HLFC 1A9BB 5DK3A 5FM4A 5B38G 4JB9H 4UIMB 3SY0B 1YEFH 2BSTB 1T2QL 3ET9F 5EUOB 2BVUA 1X5GA 1EHAA 2C3VA 4JN2A 4P23C 3VMNA 3QDMB 1A7OH 3CMOL 5D7IA 3MRPB 3RGVB 3RJQB 1NCBH 3QHFL 3NIDE 1OWWA 5LJYH 4PB9H 5BVJB 3KLAB 2ZPKH 4HK3N 4IJ3B 5DVMA 1AHWC 3MV9E 5HY9A 3WS3B 5SWSE 2W1NA 3HMWL 1YN6A 5D70L 4JO2L 3FOMA 4JO3L 1DJSA 3GFUA 5FYLD 3QXDA 5E4EC 5DR5H 4O02L 3OR6A 4IOFC 4N1EA 3QCVH 2EC8A 3MXWH 2D03L 1CLOH 1B0GB 3QO0B 5E00B 3S37X 3VDAA 1XR8B 4B50A 4X80L 2HT3C 3D39D 4KUCF 4FQHA 1N6QL 2ZP0T 3A0OA 4YDJB 4MS8C 4JFDB 3RU8H 4M7ZC 3WHE0 5I1AB 2E7LC 5DVLA 1SHMA 4GQPH 2OM5A 3L6FA 2KH2B 5JXEC 4OQ1A 2VXSH 3E2HB 3DI2B 4PB9L 4POZD 4HXBH 4WEUD 5IMOA 3K46A 3B9KD 3ZHKA 4PGCB 2YPLE 5TF1L 3HPLA 3CUPA 1RI8A 5FXCH 3D3VB 4KRNA 2EE6A 2J88H 4FZ8H 3C9NB 3T1FB 4OKDA 2K7QA 3LPWA 3EUUA 3UYPA 4WTZA 4KKAC 2XXMB 2DL9A 3MBED 1Y0LB 1GIGH 1P84K 3EDJA 4KK5D 3X13A 1J0ZA 5JQHC 5T3ZH 3BX7C 2BVPA 1Q9WA 4QGYA 5C0CA 3L5WA 1A7PL 2BNQA 1KELH 4R7NA 1LP9F 5D7KD 2ZSVB 1KJ2A 3M1BA 3ZTJG 2Y7QB 3MLRL 5LCVH 2I5YL 1MCOH 1AGBA 4N8VA 3GHEH 1Z0MA 2VO5A 5ISZD 2IPKA 2KUTA 4HH8A 1CDBA 3PDGA 5HHVL 1F3RB 2DKSA 2AK4D 4LHUA 3TBVB 3UTQB 4XB7A 5I6XC 1LK3L 2NY5C 3MLTA 4JFXB 4WUUE 2OQJB 4HGMA 2H41A 3BESR 5JIKA 5CD5C 1KELL 3AS3A 4YNYA 3DURB 3NAAH 3NVQA 3BZFB 3T0EB 3STLA 5ALCL 5J9PB 4NWUL 1AQDB 3LPGA 5JHDB 3FOLA 3RWGB 1ZT4A 2GJJA 2ITCA 2J8UB 5TDNA 4C83B 5E8PA 1DFBL 1W8NA 2BXYA 2P43B 5KG9B 4R4ND 5T1MB 4X8XA 5E2TL 1FVEB 2DQFA 1QA9B 5D5MB 4F15C 4LEOA 3GMOB 4LRIC 4P2QA 2H6PA 5DTFB 5MERA 1HYSD 5DA0B 1CFSB 1S7XA 3PABA 4WFFD 3GMLB 3MBXH 1FSKB 4XNZC 4BK5A 5CGYD 1QFUL 3AU1B 1DQLL 3JTSA 4NQEA 1MFCL 4F33A 4C56E 3VWJC 3TBSB 3MUZ1 3WJJA 1KPRB 1K3ZA 3S37L 1UG9A 2EYTB 4PD4K 1QEWB 4DKAA 1HKLL 4HX1B 5BQ7B 2GHWB 2UVEA 2E9WA 3QDJE 4W81A 5T3XD 1J12A 2VZSA 3VFGH 3FQTB 1IVLA 1NUGA 4H1LA 4FFWC 1FQ9C 1XGUA 3GMLA 3GDBA 1CU4L 3KDMA 1HHKA 1MAMH 2NXZC 1L6XA 2AAVA 5DHYA 4HIHA 1ZHNA 3O11A 5JDSA 3MRCA 1N26A 5CFHA 4HC1A 1PDKA 1C08A 1SY6H 5IFJB 3DUSA 1KCSL 2HH0L 2HN7A 3B6SB 1SEBA 1NCTA 5IQ9A 4PRDA 4XPFH 3T2NL 3LHPL 1KB5L 4JHAH 4N0UA 2N56A 4FFVD 2V17H 2D31A 1ZT1B 5E4EB 2JJVA 1H3XA 1TVHA 1NH6A 2I25N 3N85L 4FFVC 3NZHL 1KIUA 1LE5B 5HYJD 3LQAL 4HIXL 1WCBA 1ZTXL 35C8L 2J2ZA 2XWBA 5DUBA 3L1OL 1PSKL 5IGXH 2FGWH 1QSEE 5BXFB 1EMTH 1KBGL 3UC0H 4POUB 3WE6A 4UOJA 3VXSE 2VLME 3MCLH 4P2RE 1CFVH 4P9HL 4LSVL 1CDIA 1JZ8A 3UDWC 4XP9L 2ZCHH 5CEYB 4GRWB 1UQSB 5GSRA 4R8WH 2EDOA 4ZFOA 1ZT1A 3FFCE 4JPIB 1DBAL 3B5HA 2MMXA 1I8MA 4J12A 4ODSL 4O5LH 4HS3B 3X12A 5HGHA 2J5LC 1N5AA 3MCKB 4RFOH 4BSJA 4LCYA 4LCWD 3C6LB 2AV7A 3BEVA 4RX4A 4FQJH 1HZHL 2ITDA 2QEJA 3AY4A 1N5YH 1SJEA 2DB8A 3F6LA 2DQIL 3O4OC 1JPSH 5GPRA 5INCA 4PJFA 5LXGH 3LN5A 5J12C 3BGFB 3S35H 1C7TA 1OAXL 4PJDE 5EU7C 3NFSL 1JPTL 1AXTH 4KI5E 4L8SB 3ZHLA 1P9MA 4DVRH 3BT2H 3MLXH 3C08H 2VKWA 1WBXB 5CMAB 5FK9B 1IGFL 1N0LA 4NKMA 3R8BB 5F9AC 3I6GA 5EU7E 1FO0L 1S9YA 1M71B 3UJIL 1EZVX 4L4TB 1U8MB 4OIIL 4NQCA 4XAWL 1J9CT 5TF0A 1OD9A 3S36L 4MNHB 4FFZL 3UTPD 3MNZB 3GJEB 4PTTB 4I1NB 2EXWD 5I30L 3MV7B 3WUWG 1QSFE 4H88L 3U7WH 3LY6A 4XC1L 1FVCA 4FQHB 3RU8L 4EN3C 3PGDA 2FX8H 5F93C 3GUTA 4R6UA 4LLQB 1AC0A 4DW2L 1S7XB 3PABB 2XIDA 2APVA 1KTDB 4WI6A 2AEQL 2CR6A 2B0SH 1JE6A 3GKWH 4OI9A 3TZVD 4UT6L 1F6AA 1HH9B 3QA3B 3SGEH 2BX5A 3WN5B 2XNAA 1RFDH 1RSFA 4AIZB 3EJYD 4M5ZL 1QQDB 2F9BT 3BQUB 4K2UH 5C0JB 5C0DA 1GPOL 4LSSL 5HDOA 4Y5XA 1VA9A 3BHBA 4HIIA 4OV5A 3BGAA 3VFOA 5A43C 1NGXA 3G5VB 5DI8A 4WTWA 2EDHA 4QTHA 5I76B 2FYYB 1OGAB 5FYKL 3KLSA 2VXVL 3K1KC 3EOAA 5ERWB 2HT4C 4Y16C 3QEUB 4ZUTA 1T22A 2DQCL 4UT7L 3UZEA 4ODWB 1ZT7B 3BN9C 4OCYH 4JREC 3BVNA 3VGAC 4Y19D 1HNGA 4MS8D 5GS3A 3U36B 3K7UA 3FT2B 2LTQC 1I1FB 1AD0B 1K2DA 4LNRA 3SPVA 5I75C 1X7QB 4WWKB 3V6OA 5CLTA 1S9VB 1BEYL 1F13A 2GCYB 2O93L 5EU6A 4L3ED 1G7HA 5ALCH 4NCC2 1GGUA 4NN5C 3PWPE 2JIXA 5K9QG 4D0BA 5LWYL 1CZ8H 3PQYB 4WJ5B 1G9NC 3DUUA 4JKMA 2YPKB 2ZCLL 3RX5A 4EI6B 2FECI 3SY0A 3NIFE 2QQLL 4NO0D 2PTUA 3E6FA 3EHBC 4AIOA 5I1KH 4HGWB 5FOJA 4WY7L 1OY3B 5DJ8B 2ED8A 2FGWL 4GMTH 4KHXH 4XXCA 3VJ6B 2IADB 2UWEF 3LZFL 5JXAH 4P2QE 1YYLH 5EIVA 1RZ7H 3P4OA 1ZLUK 4ZAKC 1OAQL 4OLYL 1ZANL 5HHMB 1HHIB 4BFEA 3MYJB 1FFOB 3HB3D 3LKQB 4PJGB 3JV4A 4M43L 4EUPB 1IL1B 4PJDA 5HBBA 4NPYA 5I75B 1EIBA 3BP7B 1CCZA 4KZDH 4ISVB 2R39A 3OHXB 1RZ8B 4H20H 2HFTA 5FKPB 5DJ6A 1KJ2L 3MOQA 2A83A 2A77L 1TQCC 1CU4H 1MJUL 1XF4A 3MQIA 1BD2B 3KDMB 4L9DA 1YPZE 3VFVB 5EZJB 4NGHH 4XPFL 5I17B 1FNAA 2OSLB 4OF0A 5B8CA 1J0KA 2IANA 4N0YL 3CUPB 4UAOB 3PGCB 4NRZA 4PTUB 3UDWA 1GGTA 5B3NA 1SY6L 5E8DH 3MLUH 3NIGF 5F9OL 5IMOB 5I15L 2DS4A 2R23A 4HC1L 4PJHB 1HIML 3WXWL 1KPRA 1UJTA 3QUYA 5T1KA 4F8TA 1T20A 4X0KA 1ADQH 3KLHC 4UQ2B 5E9DE 4UIKH 1YEGL 3QIWB 2A2QT 4ZMAT 1X5AA 2Q20A 4WIQA 4CGTA 2X89A 3OR6B 1HHJB 3TV3H 2VISA 1ZGLB 1FAIH 3H3KA 4P46D 4QHUA 4XMLL 3NBNA 2VXTH 1EMTL 4OQTH 2D0FA 2Y7QA 2AQ3A 1JYXA 5I74C 4LLYB 1MQ8A 5HDQH 1YJDC 1NCBL 1RUML 3OJ2C 3HNTH 3H0TA 4PRNB 4P4KD 3JWOL 5HGDA 1WCQA 5DRNB 2YD8A 4HWEL 3G6JB 4JPIA 1X4ZA 2X9XA 2C1OA 2L7UA 2FCBA 2DI7A 4LSTL 1S9XA 3T0EA 2BHUA 1NGPH 3HR6A 3TT3L 1MNUL 3ME0A 3S4SG 5EORH 2E5EA 3CDCA 3EYFB 2ADGA 3AM8C 3WJJC 1OAUL 1KNOB 4KZEH 4KUZL 1Q94B 3PDOB 5IW6A 5IB4B 2CDFB 3IVKA 1QFOA 3L3GA 2DQUL 4GKOA 1QBLL 4FS0A 4DKFH 1D6EB 1I4FA 3WFZA 4D9QD 3OKEA 1W2KT 1CD8A 1X9QA 3O8XB 3A67L 3ZKXB 1M7XA 1HEZB 1DVFD 3SE8H 4CVZA 2ZSVA 4D94A 3U2SB 2DM4A 4DZ8A 5KS9E 2DQCH 4UT7H 5BVJA 5IR1B 2XXCB 2ZOKA 4M6ML 1H5BC 4HFWB 2AV7B 4Z7UA 5ICXA 5FKAB 3BPCB 4MMZC 3U7WL 4YHKH 2OL3H 2V6HA 3SGDH 3WS3A 4HMEA 5D1QB 3DMMA 1BEYH 2GSIA 1WJ3A 4R4BA 2IBZY 2W60B 5BS0B 1IC4L 4C4KT 3GSXA 3KWWA 4PGDA 2WBKA 1JHLH 2BJMH 4X4XA 2IQAA 4LSSH 2W59A 2FL5B 5IUSA 1PZUB 1UFUA 5FECA 1QEWA 4J3SA 1XGYH 5CEZL 4UILH 2X4TB 3TZVB 4NKMB 2BSRA 2G60L 4UV4H 4OLVH 3UTTA 5LGJB 4PRIB 3DYPA 5D1QA 3QZWB 5F7FA 5BS0A 3HHRB 4OGAC 4R0LB 3ZDZF 1A1NA 2YK1H 4U1LA 1QYGL 3WD5L 5F7EL 3BP6A 2CIKB 3TJHD 3FN0H 4W6XB 2OL3A 3ZE0F 4BZYA 3EOYG 1GPOH 2NY5H 1PQZA 1JPFA 3MODL 3VW3H 4NZRH 4CN4A 1J8HD 2F8OA 2EIDA 4JJHA 4OLVL 5B38B 3ZYOA 1E28A 2R1WA 4NP4H 5KSBB 3QJFB 4ZNEE 2X6MA 2FATL 2DRUA 2OJZH 4MQ7B 5LCVL 1CFNB 5SWZD 5AWNL 2BVPB 5C0CB 1JYVA 2XWTB 4WTXA 2IG2L 5DJDB 3VG0L 4Z78A 1U8JA 4B41A 5IVXB 1FFQA 2ATPB 5HHOD 1WFTA 1MLCA 3H3PH 1OHQA 4J8RB 4OLZH 5HDLA 3O0RH 3K4AA 4WV1C 4U6HA 1PD6A 3EO0B 4OD3H 4ZFOB 4EIZC 4JFZL 5E9DA 1UQSA 3NACH 2P5WD 4QT5B 3WO3B 5ID0B 5C2UB 5I0ZA 1A3RL 5KVFL 4OCXL 1FIGH 3QDJA 4LVOB 4Y16D 1P7QA 2XZAL 4HIEA 4G9FA 3QEQA 4WUUB 4RDQG 1QR4A 4MLSA 4GXVH 4GXUM 5FB8A 1TJIL 3T0VA 4ELMF 1D5IL 5C0BA 3ZKND 5SX5K 3TT1H 4QYOB 3VXME 3JBG7 1ZLVH 1BX2A 2FATH 5DS8A 4JB9L 3PWJB 2MSPA 4I0PC 1FAIL 5E4IA 1L9NA 3OF6D 5EUOF 4OCRH 3MRFB 4C54A 3PWPA 4LVEA 1DEEA 3BPLC 5MENB 2VDRL 3W0WD 5T33L 1JPTH 2VWEE 1QFWH 2SEBA 1AHWA 3O6FD 2WBJB 4OB5H 2X1QA 3FO0H 2P8LB 4XVTL 1VENA 4N0UE 2FH8A 1FVEA 5D5MA 5F21B 4LK4A 3C8KB 1VEMA 1NBYA 1WWAX 4HCRL 4P23A 2IADA 1CTNA 3MCLL 4MZ2A 1KFAH 4RBPH 3HNVH 5TE6H 2BP3A 1U8NB 1PFCA 1R6VA 4KI5C 2Q3AA 1EFXB 1TJIH 1H8SA 5I1EL 1FGVL 4U1KA 4YHPB 1TQBC 5EPMA 5DA4A 1VFAB 5HHNB 5IMLA 5IB1B 1F00I 1V7MH 2C7UB 3CLFL 3D69A 3SKJL 1ODAA 3KPRD 5T5NG 5DJ6B 4G8IA 2IBGA 4H26B 4NQED 1INDL 1LWRA 4JFEB 4YXHH 3BIKB 4NZDA 3BT2L 3MLXL 4IBLT 3QWOA 5IF0A 3NCEB 1GHFH 1VFBB 5J13C 2Z92A 4LKXB 2JELH 1HH9A 3VMPA 2AABL 1NAML 4S10A 1LILA 1X4YA 4OUOA 4WFEE 5E8NB 5KTEH 2XZQH 3KYKH 4EBQH 5HHNA 1T4KA 2Z31D 3HAEG 3MJ7B 1T20B 3ZHDA 2EYRB 4K2UL 1NFDB 3RIAK 5HDBE 1CBVL 1BOYA 2QKIA 2RCSH 1SYVA 4OBRA 5K9JL 4RISL 5GJTH 1ZS8A 4Y5XB 3FB8B 4L8CA 3SCMB 3ULVF 4NUGH 4L3CB 5ABDE 2R29H 3V52H 2X89D 1UEYA 4L3EE 4GSDH 4NQUA 4P4KB 3MJ6A 3DRQB 3TJEH 5BXFA 3HI6L 2IGFL 4NRZB 4WU5A 1UM5H 1YUHA 3IJYA 2P49B 4XC1H 3PP3K 3IGAA 2DQUH 2NY1D 5GJSL 1NFDA 2J7LA 2RCSL 3S36H 4Z0BL 2VZ1A 1B0GA 3QO0A 5CSBA 5KTEL 3U36A 3V0WH 3BZDA 5D2NA 3BZ4B 1YNKL 1AD0A 3KXFB 4XAWH 2NY7H 3OAYK 1BJMA 1QSFB 5D7LD 3JSSA 3H7LA 3QJHB 2V5SA 4Q74A 2CLVB 5ESQB 5IWLC 3D2UD 1JWUA 5F89B 1U91A 3T0ED 5EH1A 3O6KH 4QHKI 1M05A 1KN2L 3ARFA 2NY1B 2W65B 4XVUC 1UXSA 3UBXG 1YNTA 5DD1H 2E7HA 1QBAA 2YA1A 3ZDZE 1CL7I 3AROA 4W70A 1A2YA 5AEAA 2GIYA 2HT3D 3B9VA 4MAYD 2Y07L 2H3NB 2KQMA 3SE8L 3F6IA 3BUYB 3O6LL 1A6PA 5BJTB 5MHSE 4QRPE 1CDCA 2V9TA 4RBPK 5B3JF 4Z0XB 2E6QA 3VXNA 3VFRA 1I7UA 5HTSA 5D1ZB 2ZOLB 3O2WL 4BQCA 3OKKA 3WFDL 2ZG1A 4NZUH 1I1CA 2AJ3A 1EO8H 1Q1JH 4TVPL 4ZNCD 3M1BB 4OCYL 1AO7E 3DWTA 4G7VH 3GJFA 3WD5H 4PBVC 2GJ6A 2EXYD 4QGTA 5K33A 1I1RA 5A2IH 4P2OC 3BP7A 1Z5LA 1DEEB 4OCXH 5D8JL 4ZD3L 4HG4K 4N8CH 2UUDH 1IGJA 5DVKA 2NY6B 3JV4B 4YDVA 5ECJE 3U30C 5FYKH 3BEWA 8FABA 3C87A 1J5OL 1OLLA 1F4XH 3VFNB 2B8OT 5DJZA 1D5IH 1DBKL 3CVHL 4BZ2H 1D5MA 1TJHL 1PJ9A 3P4NA 1AQKL 5DT1H 5HYSB 2B4CL 1FL3B 4HMCA 3T65A 2HLAB 4S11A 1INEL 3V7AE 4PRPE 1RU9L 4QCIA 5DK2B 3PQYD 3DLQR 4AL8H 2DJ4A 1UCBL 1A6VL 1RULH 3GBNH 3TYFA 4HGWA 3ULUC 1AXSB 2CRYA 4WUKL 4C56A 2Y5TA 2E9JA 3LHPH 3G6JE 4M93C 3LS5H 1R3LA 4KJQC 4LSUH 4HIJB 4ZO6A 1UB5B 4ZO9A 4KJQD 3ULUE 1AQKH 1CZ8L 2V9QA 1U9KA 5SX4H 1U2HA 3SE4A 1FLTX 4JEGB 3QXVA 1UACH 4UBDC 2P5EE 4HMDA 3OZ9L 2A73A 5GS0H 3Q5OA 1HXYA 5EU4A 2R0WL 4CDGC 5DJYB 2YD5A 2OXGA 1KTLB 2FIKB 3NMEA 4LLYA 5D5MF 5IB2B 4HH9B 3SGKC 5IB5A 5HGBB 2HWZL 2OL3B 1JWSA 3I9GL 1K6QH 2WWMD 4G6JL 1DLFL 5C2BL 4CAGA 4W68A 5GHWL 3K8LA 5F1KC 3TO2B 3JZ7A 3CFKB 3BZEA 3QDGE 3T0EE 4MD4A 1UKTA 1T03H 3DXAB 5C0BB 1CXHA 3CSBA 2EDQA 1BLNA 2BOBA 2R2HB 4LVNC 3L3GB 3RWJB 5L88L 2VRAA 2WIIB 1JGLL 3GSNA 3PQYE 5IJKC 3MV8B 5CZVH 2WP3T 5FYJD 4TNWF 1QLRA 1S7SA 4X9IA 3P0YH 4DZBB 3FONB 1BBJA 3A67H 4PLNC 1NBZB 3QIWD 2FHBA 3FQNA 2AGJH 1MFBH 3GIVA 2D31B 1HN1A 2OCFD 3LH2L 5DEZA 3N9GH 4MDIA 1XR9A 2IGFH 2ZSWA 4F15B 5IR1A 2HMID 4QXTA 5I16B 4MB5A 4QHLB 1U91B 5ELIA 3IYLW 4Y4FC 4Y4HA 4KGJA 5HHQA 1UXWB 5IV2A 2HJLB 5EIIB 5DR5L 3SDCC 2BCKA 4M6NH 4ELKA 3UYRH 3FQNB 2YD7A 3W39A 1T0MB 2D0HA 1CS6A 1ZWIB 4GQ9H 5EDXA 3VXUA 4G5ZL 5I1CL 3V4PL 2JCCF 1X5LA 3RGVA 3QXAB 2IWGA 3ESVF 3R06A 5FEBA 3FFCD 3TN0B 3WFBH 1BD2A 4CU8A 5IESH 3MBEA 1A5FH 4RISH 3NIFF 1PY9A 3K8KA 4PFEA 5DQJB 4U1NB 5E03A 2BFVL 4PJCA 2Z8SA 2ZUUA 4KDVA 5IMMA 4WI8A 3TBSA 4L5FH 1QHOA 1AY1L 4JFYA 1BVKB 1EVTC 5D1ZC 3MNVA 4C57C 5CKAA 1CQKA 1KCRH 3GB7A 2DICA 1T0MA 4HFUL 4RGNB 4XCYB 5ISZE 3O45A 1ADQA 3NGBB 1WZ1H 2XFXB 4GUPB 1OSZB 1N59B 4XBPA 5E2VL 1R3IL 5HYJE 1FE8H 4D3CH 2RFXB 4ZAKD 2GSIB 4OQTL 1R24A 3MLWH 4U6YA 3SDAD 4FHBD 2EDFA 1F02I 5B38A 2L7JA 1FDLL 2MJWA 1J8KA 2OX5A 4S1RL 2DF3A 2P1YA 3M8OH 3QUXD 2HYMA 4JFHE 4MJIB 3HI5H 4ODBD 1ZGLM 4RSVA 3S88L 1J0IA 3VG9C 4PRPD 5HPMB 5CIPH 4J23A 4DN3H 2CKBB 2UY6A 5ILTH 2W9EH 3HC4L 4MJ2A 5E1AB 4GT7A 4CVXA 3C9NA 2MPAH 3EO0A 4OZFG 4KTDL 3C2AH 5D6DA 3CFJB 5MEOB 2WQRA 4R3SB 3HG1D 4A6YA 2FH6A 5DVNA 1R3KA 4I3RH 1IAII 1KPUA 4S1QH 1BAFH 5T5NF 5CCKL 5EB9A 2GYSA 1MQKH 4Q0XL 4OLUL 4KUZH 2G75B 5F89A 4D3CL 2VKXA 1VSCA 2AJXL 2FX9H 1WWBX 1T80A 5DLML 1F6AB 4MB4A 3QA3A 4LPVA 1HXYB 5EU4B 3O81A 4N8VB 1LO2H 5EC2A 2FHFA 3KPSB 5I1KL 1JWSB 2WBJA 4PJCF 2B2XH 5I1HL 1CF8L 3VD4A 1IT9L 1I8MB 4JFEE 4XCEA 1JGDA 2FJFA 5CP7A 5EZIL 4Z77B 3NFNA 3GNML 5JXAL 3BQUD 2A74B 2AJXH 5DVOA 3QQ3A 3EBAA 2N7BA 3VDBA 2YD1A 2H1PL 3MRBB 3HZVB 3GBML 4M1GH 4AENA 4WTZG 3MOAH 5INDA 2XZCL 4F9PC 1RVFH 3ZKNC 5CIPA 3EJYC 3STZB 3EDEA 2RB8A 1NBVH 4PJ8D 3O4LE 2FRGP 5IT2H 4YHOH 2Z9TA 4GRLD 4X9BA 4JVPA 4ODHH 4QRRB 4F9PA 4Y16B 5E08H 4RDQF 1NCDL 4G6KH 1H8OA 1VGEH 3IJSA 1JK8B 3F7PC 4K94L 1CGXA 3MV8D 4LVOC 4PJAA 3QNZB 3W82A 5E1HB 5EWIL 5EU6B 4OCRL 1G9NL 5INDB 2Y72A 4KROC 3OZ9H 2NW3B 4OTXL 4UNTA 4KTYA 4UQ3A 3P11H 4CU6A 3MRRA 2VE6A 4U1HA 5KVDL 4EBQL 4U7SA 1NSNH 1QHPA 3VE0A 3BO8A 2CIKA 3UXFA 5FGBA 3E8UH 5F6IC 3HE7D 3OG4B 2AJZB 4U1JA 3G5YB 2QADB 2UUDK 2P46B 4PJXE 4PJAB 3F12A 5GGSY 3T2OA 3TNNA 3RNQA 4GBXB 1HHKB 3TFKD 4MJ5A 4NT6B 1CFTA 2K1MA 1ORSA 4BH8A 5IHUL 1IEHA 3QO1A 1CE6A 1MCFA 1NFKA 3G5ZA 4KY1L 4C56D 1V7ML 1JFQH 4UTBL 1KGCD 2BVTA 5ESVB 4S0SD 5EBLB 4GMTL 4KHXL 1J1PH 2HWZH 4YBLC 5TE7L 1T1ZA 1UJ3C 3MLZH 2Z8VC 1ERNA 1XCTB 2W9DH 2UWEB 4MX7A 5SWZA 4XTRC 3QQ9C 3RWFA 4V2BA 1MCQA 1I85A 1T7VA 2B1AL 4H8WL 1MJ8H 1X5KA 3IFNL 5EC1B 5IEKA 3BKJH 3L3IA 4AH2B 4L4TD 4NQDD 5AZ2H 3QBTB 3MSPA 1BZ7A 1IGCH 4UTBH 5DRZA 2D03H 3QZWG 1DBJL 5DMKB 5DFTA 2VDRH 2AV1A 5ERWA 5HI4D 2DWEB 4B7IA 5B3JE 1U95A 4LPXA 4G8EB 5E6IC 3CH8A 3V4UL 1P7QD 4L29A 1YQVH 3FONA 5F9JA 3MRGA 2BNUA 2GJZB 4LSRL 1CGSH 1LVEA 3SCMC 2YZ1A 2AABH 3MBEC 3KPOA 5EORL 1FG2B 5MEOA 4P5KA 3FB6A 1U8PA 3PP3H 3QDGB 1AE6H 3CDGA 3NZ8B 4P57B 5ID1B 3DURA 1KYOJ 1G0XA 3QIUA 2YR3A 2X10A 2WWKT 3MREB 1FH5L 1RD6A 2FSEB 2QSCL 2WINB 4OIBA 4YGVA 5EU3B 2HVKB 5L0QC 3IXAA 3BKMH 3VFTA 1IKNA 3L95A 2F74A 3GMPB 2BNQE 3C6SB 1XGQB 3PGFL 4QRPD 2E8YA 2IALA 3MV01 3KXFD 5DD6B 2MQ3A 4P4RB 2WLZA 3OKLA 3O3EB 3L3HB 4G5ZH 4Y4FA 4Y4HC 1F3JB 5BMFH 1MRCH 2V9RA 5KS9F 4LEOB 1OLZA 3WIHL 5BRZA 2ICWA 3I02A 1F4WL 3CXDH 5GGUA 1W0VA 4TNVK 3U30B 1D5XA 4NCDA 2YKLH 4LPUA 5EU6E 2HP4A 1T66C 1WFUA 4OZ4A 5IF0B 3EYSL 4ELMB 1AGCA 1Q9LB 2MCPL 3VFTB 4RQQB 1A14H 1KNOA 2ORBL 4M00A 5J56B 5GRYA 5BJTA 4U49A 2XTJC 1U8OA 1D6EA 1I4FB 1UH4A 3MNZA 4CVWA 1WAAA 3Q6GH 1J8HE 3U9PL 1U3HA 4KMQA 4KAQH 4Y5VA 3RWDA 4PJAE 4D0BB 1FNGA 1Z9LA 2XTJE 4TUKL 4K9EC 1J0YA 5C07D 1NJ9A 4NRYA 2GJ6D 1M7IA 1IAIM 5IIEA 4NQSB 5ICXB 1JGUH 4EJ1C 3QI9B 5JLZA 3WN5A 8CGTA 4K55A 4Z7VF 2ESVD 1QQDA 1JNJA 3I50L 2VE6B 1J1XL 4U1HB 4PR5B 3PDDA 2X4QB 1YC8A 1UM6H 2FDBP 5I8EA 2RBLA 1ZKAA 3LKNB 1FCCA 3PWUA 4Y2DC 5GHWH 3OXSB 1X5JA 1B4JH 1MF2H 4TULH 4JO4L 3WFHB 2IG2H 1F6LL 4U6YB 4NZJA 3F58H 5I76A 4YR6A 4LLVB 4FQIL 3SDYL 1OGAA 3CVHH 1WWWX 3D0VA 3QAZC 5DI8B 5JHLH 4GG6B 4M7LH 3MA7B 1G7PB 4MGXA 2CKBL 4LASL 1VGKA 4GW4A 5EBLA 4I3GA 4C58B 1KF9B 3CZFB 4JFHD 5JORA 3E2HC 4R4NC 4YQXL 2CQVA 4QRTB 4F2MA 3VFVA 3GSUB 3NCFB 4X5LA 3DSFH 3R1GL 5E08L 5J11C 1IGYA 4WNQA 1ED3A 5IMKA 5CJBA 2YPLA 4O2CB 2QSTA 4K8RD 3U0PB 1DQLH 4Z77A 3PGCA 1J7VR 4MD5A 3N9GL 4NNYB 1J18A 1HQRB 5HYEA 2NX5A 3GK8L 2YPLD 4DTGH 3BQUA 5ITBH 3MRBA 2XWTA 4ELME 1FZKA 3VD9A 1RVFL 5L2KE 3LQMA 3P73B 1AC6A 3BGMB 4KC3B 1OAZL 1M6OA 2YZ8A 4G9DA 2D2OA 3EJZC 1CK0L 3H9HB 4EDWH 4ZUUB 4OSUL 4I9WE 5FM5M 4P2OA 5BV7C 3IDJA 4L8SC 2JJSA 1E4JA 4LCCB 1BFVL 1CFQB 2UWEE 3M45A 5CSGA 3CX5J 4N0RA 5F1NA 4P2OD 2JK5B 5AG8A 2FJGA 4OJFH 3OTTA 4MD5B 3HNVL 2I26N 4FQ1L 1CGTA 1E6JH 3H9SA 1U8HA 3NFPA 3T0BA 4NM8H 1SM3H 3QIUD 4IDJH 4PJCB 5IMMB 1S7SB 1JNLL 4DZBA 5B39B 3G08B 1DN2A 1W0YT 5EUKB 2F53A 2IFGA 2C1OB 4PLKD 4TYUA 5EBMB 4BFIA 5A40E 4GRMA 1ZVYA 5F9OH 2VR5A 3OHXA 2GCYA 3K2UH 3LH2H 3HMWH 4QRPA 1IL1A 2VLKD 3O8XC 4OJFL 4ZSOA 5F1NB 3KYKL 1HNFA 2VDQL 4JAMA 1FE8L 1R24B 2VR9A 2GJ6E 1ZLSL 2R2CA 3TNNB 1QBML 4HPOH 4UB0L 4OF5A 4WO4D 12E8L 1IAKB 5IHUH 4P23D 5TE4L 3AB0C 2YMXL 5F71A 4NO0A 1T2XA 1E6JL 5DD0L 3VXMB 5E6ZA 3HE6C 3HRZA 5MEQA 3HLAB 1KTLA 2FIKA 5GS2H 4G8FA 4M61A 5LGKA 1VFOA 4FOMA 1UEMA 1V05A 1QR1B 3QUYB 4Z7OE 2LE9A 5FO9B 2VDPH 3BN3B 4YDLB 3HA0A 4R3SA 3FFCB 3TN0D 5F7KC 1BP3B 3REVA 5C08B 4OFYD 1R3JA 4TSBH 3WIIH 5TH2B 4A6YB 3GSXB 4P9MH 4FQQB 4KAQL 3G5ZB 2DQHL 2GSGA 1OPGL 4XPHH 5D2LE 4JRYD 3DTXB 1L7IL 5GGQL 3MV9A 4DN3L 5HGDB 1G6VK 1CXKA 1MVUB 1FV1B 4KK8D 4MAYB 2QKIB 1KCVH 2V2TB 3HI5L 4NKOA 2VLKE 2X70B 3QXDB 3O2WH 2ICEB 3HZYA 5E6ID 4J1UB 3X3FL 1HK6A 1YEIL 3MOBH 4OV6F 4X0KB 4FQXA 2WM0A 1OAKL 4R90H 3EOBB 1FFNA 5FA4B 3ARDA 2XTLA 3C60B 1ZHKA 3CSGA 1HHGB 4EQ2A 1Y18A 3K81A 3QIWA 4PJ9D 3GMPA 1JZ4A 4X4YA 3ARTA 1QD0A 1OP9A 1FC2D 4YDIL 4ZPVA 4ZXBA 3SJVD 3FO2B 4I18C 3MRGB 1U93B 2EDYA 2M26A 5CZKA 1LO2L 2LU3A 2Q87A 4BK4A 1NC4A 2QQNH 5KVGH 5ACMA 4ZD3H 4P5KB 1EEUA 1OW0C 3O9WA 5TQ2L 5GRJL 3INUH 5IJVA 3R0MA 3R06B 2VZTA 5HPOA 3EOBA 1MQKL 4Q0XH 3QNXB 5BRZE 1EBAA 1LMKA 2C4XA 4KUCD 1A14L 4P2RD 3P9MA 3ARUA 4PJBF 2W60A 4NC1E 1TCMA 5F7NC 4OGZA 3S98A 3MRQB 1A9EB 3HCVA 2WP3O 3G5XB 3FQUA 4PJGF 3BO8B 3UPRA 3KJ6H 4ZUUA 2DWDB 4Y2DB 4Z5RB 1P53A 3CLEH 3TPUB 2IALB 3CDFA 3OJDB 4NC0B 5T1MA 4PJDB 3LRSA 4KDTA 5T3XH 3FN0L 3ILPB 4JFOB 1FP5A 4XCYA 5CINL 1EHLH 4XXDA 4YE4H 5B22A 3B8YA 1B0WA 5JR1L 1DBBH 1MSPA 4YXLH 4JFEA 4JO4H 1U6AL 2VL4A 1F8TL 2ESVB 3TBWA 4RWYL 1EEYA 3L7EB 5T33H 5HGAB 4YHLL 1MFCH 1JMXA 1CFVL 2XQYK 5LGJA 1CE1L 4NZRL 2PYFA 4UU9A 1FVDB 5I71B 5EZOL 3C8HA 5IVOA 2X40A 4JQVC 5ESVA 4BFIB 2J4WH 2A38A 3QEHB 2D7QA 4HX1A 2V7NA 1CFBA 3WDHA 3CU7A 3FZUC 4MNQA 1KLUB 4N0FB 4N68A 1KJ3L 1TZGL 4WCYL 4MB3A 1YEKL 1BD2E 4OM0L 1ZA6B 2HH0H 1UYWH 1UWXK 3LKSB 2P5WE 2AJYL 4CADB 3QRFM 4RFNC 4GMSL 4KK6D 3NN8B 3O6FA 32C2B 3T65B 5C9JA 4MJIE 4XWGL 1BZ7B 4U7KA 1YYLL 2JJTC 2NY2C 3CIQA 3WCYA 4DQOL 4UV7L 1I8KA 1TJHH 4ZS6C 2XY1A 5HHME 3KYMA 2X4PA 4FQLL 2VDQH 5FGRA 4TQEH 4LOUC 4MNQB 2DQDH 3O2VH 3ARGA 3VXUD 5CEZD 4QKXB 2ZUXA 5C0AD 3TA3B 4XCCH 2PCPA 5D1QC 4L1DA 3QDJB 3GBMH 3KPOB 1AJ7H 2ZPKL 1T3FB 4Y1AD 2Y36L 5C08A 5FA3A 1BFVH 2VB5A 3DO7B 3C5ZA 5E2UH 1OGAE 1JYWA 1JNLH 4XPBH 5A2FA 2VLLA 2WBJD 1UJ3B 1UCTA 3LD8B 4EI5A 3SDXF 2AGJL 2GUOB 1JP5A 2IPKB 4CJ1A 4L8BA 2F5AL 2CJUH 3MLZL 5TPWH 5MI0C 1SJXA 1KEML 5HHOA 3B9DA 3CLFH 2QQKL 3AB0B 3IU4H 5E8OB 4ETYA 3DIFB 1CGSL 4WHDA 1H5BA 3B2UC 1ITBB 2ZUSA 1MJJB 1D5ZA 1CT8B 2HJFB 3RPIB 5SWQA 2IMMA 2DMBA 3HG1E 5F7WC 1FN4A 1FZJA 2EDWA 3FOLB 3RWGA 1U0QA 1MCBA 2ZG2A 1P7QB 3ILQD 4HIEB 5BS0D 5C09B 5TE4H 1T5WB 5IKCB 3FQWB 1TETH 4MAUL 4JO1L 3TO4C 2AJVL 1LO3H 3N1MC 1H9VA 4QRRE 1G1YA 5I0DA 3F7VA 1WBXA 1I7ZB 5FGCB 3RIAF 3VXQB 3WE6B 2DMCA 2XQYG 1EEQA 3RA7L 2VDML 3W0WA 1KCUL 3UTSA 1DUZB 2IPUG 4IMKA 1A3LH 1QLFA 4H25A 3GKWL 4PLJD 4ORGA 1A4KA 1UXWA 4XPAH 1OP5H 1GGIH 1OSPL 4OM1H 3BP5A 5E8NA 4X5XA 1G7IA 4I48A 3DX9B 4F7MB 3C6LA 3I6LE 4LGRB 1JPFB 5FV1L 1F90H 5IQ7L 4PS4L 4X7TA 4XXDB 5C0RH 2CK2A 4R2GD 3MR9B 2LTQB 1D6VL 3OKOA 1FNSL 5H8DA 3O41A 4PV9A 5KVEH 3C60C 2N7AA 3QFJD 1H3PL 4OD1L 3V5HA 4J4PA 4JDVA 1DTUA 4WFHE 1Z5LB 4M8QA 3VRLE 1NL0L 4OM1L 3IJYB 3PG2A 3VG0H 4U31A 2F54D 3UMTA 1NAMA 1RUKL 4BZ2L 4WU7A 1YUHB 4AYFA 3F7RA 5I8OL 1HWGB 1YPZA 1WLHA 3U46A 2BVQB 5IQ7H 3IFPB 4JPVL 5FO9A 1ED3B 2BFVH 5D2LA 5FYKU 4MNQE 4NO5A 5HYSA 4QT5A 1JGVL 2ILLA 4RWYH 4F33B 1BF8A 2AJUL 3HMXA 3BDBA 4BSVB 3CFKA 4IRJC 3A6BH 4O2EB 3WNPA 3QHZL 1J8HB 1UC6A 3DBXA 4ZUWA 1EAPA 1PKQA 2HKFH 2VQ1A 3WBDA 4TVPE 3IAGC 4D8PB 3ZT7A 3I3DA 1BFOA 2XACC 3RP1A 1NKRA 4LSPL 2E7BA 3PGDB 5I19H 3F62A 2YA2A 2XA8L 2V5MA 3T77A 4M1GL 4YJZL 3VG9B 3ROOA 1QRNB 4LLUB 3N1QC 4PJ9A 1S78D 4APQB 3C5SB 4DEPC 1MCLA 4WI9A 4X6FA 4UV7H 2GQHA 1SJVA 3VU2A 3O11B 5JDSB 2ZOLA 4YO0A 1BJ8A 4LVHC 5TGBB 3VFRB 1EAPB 1PKQB 3BD5A 5TDPA 1NUDA 5ETUB 1T1WA 1UM6L 3U4AA 4M1DH 4ZOBA 3MNWA 4QXUL 3E6HB 3VXUE 2DQTH 2VLRE 1IGYB 2NY4B 4WNQB 4X9GA 2X1WL 2VSCA 3JVGA 1WCBB 4OQTA 2FWOB 1DFBH 1Z2KA 5KVDH 3LQAC 4NNXA 2PYEE 3RVUC 2XA8H 5DJZB 2GEEA 4JDZA 2VXTL 2H6PB 5EBWB 4IOSD 4LLWA 1XAUA 3H8NA 4KKAD 2WWKO 1PG7L 1OQOA 1LP9B 2VLJE 4G80B 3ZKXC 3K4ZA 3S4SA 2YD3A 1HILB 1LEIA 4PJBA 4TVPD 4NO0B 2XKUA 3MYJA 4I2XE 4WFGE 1IGIL 2EZ0D 1MOEA 4KTEH 4QTIL 2DWDA 3SBWC 4ZODA 4XP9H 5IT2L 4CVUA 3BDYL 3BPNC 3O45B 3OKKB 2W0KA 3NABH 5FM8A 5CWSB 4JDZB 2H8PB 3PIQB 1MUJA 3I85A 3R4DA 3P4MB 4MXWL 1XGUB 1CDYA 4LGPB 3Q5TA 1RUQL 1NGYA 4MAUH 1M1SA 2UZXB 1XZ0B 3V7AG 4KXZH 2CRIA 2H2SC 4OGXL 3UPCA 4AEHL 5D72L 2A0LD 4IMLB 3VXUB 4R2GC 3LB6D 4LMQI 4M3JA 3FRUA 3T3PF 4WI5A 2YD2A 1HOCB 1IAIL 2Z31B 4O9HH 5F1OB 1AGFB 1DBML 2R0LH 3Q0HA 3I6LD 4LARL 1FV1A 4CRPA 1H3UA 4IEFB 3P9LB 1NGZA 1QSFA 2WWMC 4YEEA 2X5PA 2DLGA 3O41B 1KSRA 1C16A 5HYQB 3T1FA 1FL5B 4JZJA 4EOWL 4EN3A 4J3TA 2DKMA 3G04B 2EKJA 1XCQB 3CFEB 5CGYC 5ANMB 2VZOA 2EE2A 3CCHB 4CMHC 3RWJA 2A9NL 4RAVB 5ALBH 3HC3L 1ZHLB 1T1ZB 2CPCA 1OQXA 1NBZA 3WHE1 1U93A 3ELAT 1U8KB 1QLRB 3P77B 1NC4B 3FO2A 4NO5B 2BC4B 5CBAB 4NKDA 1NGWB 4PTUA 5I8OH 5HPMA 2E6PA 2HFEB 5IVZA 2XWJA 4TTGA 3N1FC 4HQQH 5FA3B 4NZTH 3EYFA 1RZJH 3U48A 5C0JA 4AENB 4M93B 4PRPB 2YBRB 1KT2A 2P8PB 2CLZA 4GKNA 4ONGL 5GGTH 3SDDC 3KLHD 2VXQH 2X70A 2A6DB 4PRAB 4LOUD 5DUPH 4MXQD 4BQ8A 4F7PB 4RIRB 4YDIH 2X4SA 2ARWA 1Z9SA 4QWWC 1XF3A 5C6WH 5D6CA 1U8QB 4N0CD 3MBEB 3BI9X 3SGJA 3RZWA 4DGIL 4KRPB 4ORGB 5HI4C 1V8HA 4C59B 3S88H 2PYFB 1GYAA 3M17B 2F74B 3QCTL 2QJDA 4IRJB 4XCFL 3QUXB 3LB6C 5ACZB 2IMNA 2MPAL 4MJ4A 4WEBH 5C71A 1IC1A 1JWMB 4GBXA 4QEGA 2XTJD 1U8QA 2F54B 2DQHH 5DK0A 4E42B 4XGZB 3M8OL 4N5UA 4RNRA 5EOQH 4MJIA 3OB0H 3GSNL 5HI3C 2EDDA 3NN8A 4WHYH 3ECBA 4XP6L 4CNIA 3U2SA 1JVKA 2B5IB 2P5WA 3TIEA 1ZLUH 3HZMB 1R5IB 3VXTB 4WI2A 2R2EA 3NGBC 1A7RL 5SWZB 3P4OB 4QNPF 1F11B 1WK0A 4I2XA 3HUJE 2X7LB 2OLDA 4NNPL 5F3BA 1IT9H 1HHIA 3H9SD 1P84J 3MBXL 3QRGL 2DQGL 1HHJA 4UIMA 2R9HD 1MCDA 4JM2C 4QTHB 5KOVC 3TA3C 3CSPA 3V4VL 1IC7L 1JRHL 5T1LB 2EDXA 4BZ1H 4OLZL 1IFHL 2FEDD 5CZXD 2I9LA 2DBLH 3OAZH 2BNQD 2DLHA 1Y18B 1AIFB 4F57H 3IXTB 1OAYH 3DJ9A 2NXZD 1GH7A 4R7DA 4UTAL 3O2DA 3DX7A 5GSVA 1CVSC 3UTTE 3RY5A 5TPWL 5FHAL 5F9JB 4X5WB 2XWBB 1EEZA 4G6AD 3VWJA 5HD8C 25C8H 1JL8A 4FQ1H 1HYSC 4BH8B 4FQXD 2LVCA 2A74A 4V1DD 4GH7B 4IRSB 4HV8A 4IS6B 4Y7MA 5CEXB 3KGRA 1RJZA 1IARB 1YPZF 1Q9OB 3GI8L 2CKBA 4G6FD 4DQOH 4LLVA 1N3NB 2X4PB 1JCKA 4LAQL 3OAUL 3OAYH 2IPUK 4QXTB 4XVTH 1YEDA 4DN4H 1JF5A 4QHLA 5I16A 3B9KA 3W5NA 2Y36H 3WLBB 3LN9A 1TLKA 3NOIA 3V0VA 4L4JA 3UEZA 3MRFA 1EK3A 2Y06L 2AXFA 5IW6B 1JRHH 1N4XH 2AEWA 2P24B 1C5CL 1I8LC 1QRNA 2AK1H 2XN9D 4HW6A 4DGVL 3W5MA 3WIFB 4QRTA 3OKLB 2ATKA 3OKEB 4NNXB 1ZOXA 5L6YH 4QRRA 1BQLL 2JE8A 4W4OC 5HXMA 3NFSH 5C6TH 1SEQH 2MFNA 2AXGB 4HUXB 4S1SH 3OX8B 1RV6X 5EUOA 1BOGA 3W81A 1TZIA 3S3JA 3CXHK 3MNWB 4TTDC 2F5AH 4MXQC 2PW1B 2X09A 1BECA 4YBQD 2YOCA 1HH6A 5I1DA 3T09A 2X9YA 2VLRA 2XZZA 1FGNL 3G5YA 1Z3GL 2NR6C 4NPYB 1Q9WB 1FFPA 1E27B 1YEHL 1E4WL 1ZA3B 3QUZC 3GIZL 3MX0A 5DGRA 3MR9A 4U1JB 3HUJB 2VLKB 3H42L 2W0PA 5EFIA 4CN1A 1YNLH 1ZA6A 5C0NC 1N5YL 4GAJL 1GOHA 4LEXL 4XAKE 3B9EA 4TOYL 1CLZL 1UZ6E 4S1RH 3GJEA 5HY9B 4PRIA 4P46A 4DVBA 2R9HC 5CGTA 2EYSA 4JKKA 4P4RA 2DLFH 2PTTB 3QAZB 3TESA 2FX7H 3Q3GB 1DBMH 1I9EA 2VUYA 1S5IH 1T0NA 5CJOL 5MEPB 2APBA 1YY9C 3U1SL 1A9BA 2I07B 4YR6B 2GTZB 4NHCH 1A5FL 4JM4H 4XNYL 3QXUA 1BQUA 3U4BH 1FIEA 4PJEB 1JPST 4MQ7A 2Q6WB 3SDAB 4DVBB 3ZT5A 1OVZA 3S9DB 5C0DB 5DJDA 3QXWA 4MVBC 3CMGA 2NNAB 4EN3D 4WHYG 3FB5A 4GQ9L 4L29B 3RNQB 1SYSB 4PRNA 3JWOC 4XB8A 5BS0E 5EO0A 1F4XL 1S9WB 1FSKC 4XNZB 4ONHB 1CR9L 5C92A 1T0PB 1JGDB 1ZEAH 4KROB 1I3RA 4PB0H 5CILL 5D7IE 3DI3B 4GKZB 3VWKB 2Z91B 4UINL 3X13B 2JTDA 1T89A 3S6CA 5EU5A 4JJ5A 3ZMRA 2FSEA 1HHHB 3TT3H 1LK2B 3E0GA 1P2CB 3NA9H 5D2LB 3RWFB 4PY7A 3D48R 1VACA 2DTSA 3Q48A 4HUMB 5IB4A 5HVHC 5JPNA 4DFHA 3H9SE 3MJ9A 4P5TC 4P9ML 2BVEA 3UCRA 3DBXB 2NCMA 1IRAY 3BUYA 1AQDA 3MLRH 3VH8G 2Q8BL 4MQSB 4AMKH 5CJQL 1G7MA 1S8DB 5GRUL 4J2XA 4F57L 3DRQA 1KENH 4NKDB 4RGOL 1PGRB 4TSCL 2A6JA 2CMRL 1EH9A 2OQJA 3PQYA 4WJ5A 4WI4A 1NBYB 1HHHA 5AG9A 4Z7UB 1XIWB 4Z0BH 1A1OA 1XF5B 4XHQA 4JPVH 2B5IC 4OD3L 3SQOL 4GG8B 1PX3A 1VKXA 4ORZC 2GW5A 5IQ9B 3V5KB 3C5SA 4ELMA 3K8MA 1JV5A 1AGCB 4LF3A 2X1PA 4ENEC 2ED7A 1A0QL 2A6DA 3W11D 4ZOEA 4K71B 5C07B 1G7IB 4AMKL 4M9PA 1OAKH 4RMRA 3SO3B 4ZUSA 4ZXBD 1DZBA 2Q3ZA 2AW2A 3GI8H 4X7TB 4O2FB 3ZE2E 1LQSR 1RMFH 3VXRD 2AK1L 4X6CF 2NY3C 3B8SA 4YBQC 4JFPB 2XN9B 4KU1A 3O9WB 3BIKA 2E9BA 1XMWA 3IJHB 3JWNC 4NRYB 5C1MB 1DQQA 4ZS7L 4NN5B 3CDYA 1CE6B 3QNYB 2JCCA 1NC2D 2ERJC 5I1JH 4C56B 1K9TA 4P5TA 1MF2L 1P4IH 5KN5B 3WHXA 4IRZH 1KLFA 4XWGH 1IKFL 2P45B 4LU5L 1JHTA 5JW5B 3ZDYF 1MCPH 4FXKB 3U46B 3OXSA 5HI3D 4ZUVB 1MCIA 1Y6NR 2OJEA 2LAAA 1XF2A 4O2FA 3MACL 4MDJA 4PJ8B 3MOAL 2DQJL 1S3KL 3QJFA 1OAYL 4PLJC 4X6BB 2J8HA 1F4HA 1NGZB 5HGAA 4JZJB 3TFKC 3LQZB 4J3WA 3ETBF 5BVPL 1QP1A 4QXWA 1MRDL 4KK9C 5DQDL 1C16B 4U0RC 1P5VA 2EXYC 2GY7B 4NFDA 4FMKA 1MREL 3F8UB 3SKMA 5K9KA 1T03L 2VZVA 4OI7A 3T77B 2CDGB 3GSOA 4LSDA 1KB5A 4PG9A 1G7LA 1KJVB 4OLYH 5EWIH 2FEDC 1YC7A 2PNDA 4MXVE 5CBAA 5D2NB 2EIZA 2DQEH 4KKBD 3AC0A 3HNSH 4HPOL 3BAEH 4UB0H 2HG5B 3D39E 4PYHA 3TYFB 1PKQE 2EYTA 1X5FA 2IC2A 2VITA 2EH8L 5DUBB 5GRWA 1BHGA 3OF6A 4PJ5E 2OR9H 3IETA 3TWCL 4P3DA 4XX1G 2X44D 2HLFD 4WHTA 5F96L 1ZVSB 1DE4A 1RIUH 5C86A 3KR3L 4NGHL 4YC2C 3H9HA 3KYMB 2R69H 3JXAA 3AS1A 2AJVH 1TJGH 1NAKH 3MYZA 5L2KA 5DMGD 3QEGL 3VH8B 4GXUN 4RIRA 4P46C 5F9WB 3O2DH 1IAIH 4O9HL 5I15H 4MLIA 4P9HH 1FORL 4GKSA 1C08B 4MDIB 1PZ5A 3RWEB 3PXHA 2ZG3A 2D7TL 5CJXC 4ZNEA 3CK0H 3QHTC 4PRDB 1MI5E 2NTFB 2J88L 4FABH 5FHBH 2I60L 2XPGB 3TYGL 1CXIA 1Q0YL 1P4LB 4MNGB 5KW9L 2C3HA 3EFDH 1IGML 2HFGH 2JB6A 4K3GA 3RJDA 4CDHA 2WZPD 3VH8A 5IFHH 5D96C 3ZO0A 1FFPB 2YWYA 3T2PA 2ZUQC 4KQ4L 5C09D 4NZTL 2PO6D 3KPRE 5A2JH 4XHJC 1AY1H 5CJOH 1LEKB 5DWUH 3GSQA 3QUXA 3U9PH 1GVIA 3DHJA 3HC0A 4IHOA 1DBJH 2PTVA 3GMRA 4YAQA 5IESL 1OAXH 3VI4E 5DLMH 4AT6B 3QUZD 1RZIA 4XPAL 3WKNA 4HJGA 5GRUH 3D39B 3WXVL 3ZSSA 5DURD 4FQ2L 4ODXB 2Q7YB 4RRPA 2C26A 2BY3A 4XP5H 3U0WH 5BV7L 2EYSB 4E41A 3WKMH 1PLGL 4ZDHA 4BKLA 1QR1A 1TNNA 3O3AA 3MLSH 1XF3B 2AERT 2EYRA 3RAJL 4EIGB 3WV0A 5JNYA 3BFOA 2GAZA 3RVTC 2EO9A 3FT4B 2QQQA 3HUJA 3QNXA 3JTTA 3OKMB 3P9MB 4X9HA 3V6BR 1IQWL 3G6DL 1LO4L 4U1LB 3ZTJH 4Z7UE 4KKBC 5HHXL 4FA8A 2G9HA 1QYGH 4PRBB 4KRPD 3UPRB 4UDTB 2Q6WA 1F42A 1H3VA 4P4KA 5C7XH 2IH3B 4WFHD 5EZLA 1RURL 4PGJA 4K8RH 3RZCC 3RBSA 5T1LA 3MZGB 1F2XK 2RIKA 4FQCH 5E99H 3MXVH 3FQTA 4KROD 4FG6C 4WO4A 2W0LA 3BSZH 3PJSA 3PV6B 3PWLB 2HLAA 4Y4HD 1TIUA 5D7JA 1F58L 3TA3A 4Z78B 3UTOA 5D9SA 3O3BB 3NACL 1YY8B 1AXSA 4OTXH 3HLAA 5ENWB 1A02N 3HE6D 3MRHB 2IH3A 1F90L 1G0DA 5BZDB 3NA9L 5T5FH 5HHOE 4NYLB 1OARH 4OKVA 5DJXB 3OL2A 1UXSB 2DM2A 1IKFH 4LU5H 4KK6C 2D7OA 4OCWH 3TVMA 3TPKA 3EOAB 3RWIA 2FR4B 1L0QA 2A9MH 2DBLL 5I2IA 5DEFA 1MHCA 1IBGL 4MA3B 1MH5A 5L2JB 3NIGE 4JFFD 4PBXA 1BBJB 2C4FU 2I9TA 1S7UA 1NEUA 4WDIA 3TH4T 3VA6A 1J0HA 5J6GB 3RQ3A 1GZPA 1BX2B 5KVMC 2FB4L 4LP5A 2DKUA 4BUHA 5KJRL 5DC0A 1AD9B 4GBXC 1AKJD 1XF5A 3D1MC 5IJVB 3DX7B 2UV3A 1UM4H 4BFBD 5E1AA 1BOGB 4OCWL 5F7EH 2C3GA 4PY7B 4BZ1L 3QHZH 1QPXA 1EA9C 1AKJA 4G7YH 1C7SA 1V5JA 3TO2A 4G9FE 4JFXA 3RL1B 1Z9MA 3QRGH 3KJ4C 4MA3A 4M6OL 5DQ9A 4AG4L 5MEND 3CFBA 1KEGH 5L0QB 5JMOC 1EV2E 1CXFA 3ARDD 1ROWA 1AR2A 1DQDH 3L1OH 5D93B 4APQC 1HSAB 3R8QA 1DQML 4NJAH 2VQTA 43C9A 1QBMH 3ULUH 1F4YH 5IW3A 5I73C 4M48L 4MXWH 1MRFL 5A2LH 4UQ3B 5FKPA 3MACH 4U3CA 2YUWA 4RA0C 4BFGA 3ZKSD 3ULVL 3FO9A 4TNVF 4WI3A 2Y06H 3OGCA 3MV8E 1EJOL 3PP4L 1MY7A 5BW7A 4ESKA 4NUJA 4DN4L 1A6AA 4IOIA 4R4FH 4JR9L 4HS8H 4MDJB 5DMIH 4HCRA 5JUEH 5FO8A 4G6ML 1BVLB 1NBVL 4X98B 3SDAA 4ZSOE 2J6EL 1NC2A 5J7CC 5LKNA 4RFOL 4M8QB 1EFQA 1V3KA 2OSLA 5B8CB 1MIEH 1GGCH 1A6ZB 3F65A 1F3DH 3DETD 1NAMB 5TE7H 5IFHL 4M48H 2RJMA 1WT5C 3D25A 3BJLA 3ZE1F 4KKCD 3FMGH 1EEYB 3L7EA 3H6JA 3P3YA 3ZDXF 3SDXB 3BPCA 4P0DA 2A0LC 5E7FA 4JG1L 3VGDA 2QSVA 1T2JA 3DMMB 4PJ8A 1XFPA 3RWCA 2KBGA 5FUZL 4DVRL 1OAQH 4GKZA 3VWKA 4ZUWB 4YHKL 4J1UA 4EVNB 4G42A 5D1XA 5D1QD 5DJCB 4Q58C 1M7DA 3NPSB 2FX7L 4YXKL 4BM7A 5JW3H 4WHTB 3D25B 5F8RC 5TDOA 4M7ZB 1R0AH 5D1XD 4MA1B 1VPOH 3MV7E 4DKEH 4F58L 2Y4SA 5HYIA 1CICA 2YUZA 2YN5A 4Z18A 1YEEL 3O8XD 5B21A 1CLZH 3PJSB 3PV6A 1UVQB 1JN6B 2EIZB 1FG2A 3QO1B 3ARZA 1G7MB 1MHHA 4ODTL 1EERB 3O6LH 4Y4KD 3ARBB 1B88A 2XG5A 4MQXC 5GZND 5FCUL 3I3EA 5JIHA 4KV5F 3RY6C 4X7FC 5FIEA 4DUXA 1OPGH 2FD6H 2R8SH 1D5ZB 1ZMYA 4NWTH 1P4LA 4EXPX 2BZDA 4YK4B 1G9MC 1NGQL 2YUXA 1JV5B 1KB9K 3G6AA 1IM9D 2ZOKB 2O5YH 1U58A 4Z5RA 5IW1B 1UGNA 3OBAA 3LVEA 3H42H 3NH7H 1FO0A 4D0DB 4TSBL 5C07A 1CDHA 3WMSA 5C3LD 1JNNL 4LDOB 3KPLA 4K9EH 4CW1B 1ZT4B 2ICWB 2VDNH 3U7AA 1GXEA 4M5YL 2BXZA 5EFIB 2H9GB 2B1HH 3KPRA 3V0WL 4K7PX 1U3JA 3TBYB 5C08E 2C3VB 2P4AB 3OAZK 1UH2A 3MRPA 1IC5L 1CQYA 3RWHB 1RURH 1AO7D 4F3FA 4GAYA 1J11A 2RHEA 4PJHE 4JKPH 3EDKA 3DETC 3UTTB 2YA0A 3L3KA 2VL5B 5DJ8A 3GSVA 3QFJB 3WEXB 2F5BH 2H2PD 3QISA 4OLXH 2ADGB 5LQBH 1MUJB 1NCNA 4TUKH 5BOZG 2PXYC 4QCIB 5J11B 5C8JB 4JDTH 3LD8C 4K3DH 1BFTA 3N1GC 2Y9RT 2VDKH 5SV3A 2DYPB 4S2SA 4W6WB 2I27N 3PWPB 5D6CB 1RMFL 2ICWI 3SE3C 2LQRA 4PJ9C 3F58L 4GW5A 3UO1H 1ACZA 4CMMB 3RDTC 4Y8AA 3MJGX 4AEFA 1FYTD 4ZO8A 5TJWK 3ZE1E 4K94C 1HOCA 4YHOL 3MMEB 4ZYKB 5EO0B 3VI4F 2VDOH 4Q6IA 5DHYB 3GSWB 3VXRB 3ARYA 1A4KB 2ITCB 4J3XA 1OCWH 4XNUH 3ALXA 3LIZH 1N7MH 5FYJU 3V7MA 4C83A 2APWA 4FP8H 4U6HB 5FM5O 5ADOH 4LPTA 3QUML 4JQIL 3S96B 1CG9A 1SBSL 1YMMD 2QHRH 4PJEE 1NC2B 1P4BH 3MA7A 1G7JB 4B5EA 1GZQB 3NZHH 4L9LA 4XT1C 5I1EH 1P2CA 3WYRA 1HDMA 3T2NH 1CF8H 2ARJQ 4YIQB 5JORB 1X6LA 1AGDB 4ZS6D 3BZEB 1TVDA 5DEFB 3VD3A 2PXYB 5D7KE 1P7KA 5D71H 3KPNB 4J4PD 3MFGB 3P77A 4NBXB 43CAB 3JTSB 1LO0H 2P8MB 2X1OA 3AU1A 3QCUL 4UDUA 4J4PC 4GKSB 1CYGA 3WDIA 3I6KA 4P9HC 4FXGB 1SVCP 4UT9H 1B3JA 3GSRA 1XIWA 4HC1H 3EO1A 2IAMB 5I9QB 4KDWA 2CLZB 2NXYD 5DS8B 2CLRB 1FLRH 2IH1A 1SVZA 2FR4A 4YDKL 4OD2B 1YEGH 2YSSB 1J1PL 4YPGB 1P7KB 1QNZL 4L3EA 2XICA 3QFJE 3S97C 4ODSH 2HRLA 2FWOA 5JHDA 1I1YB 4A6YH 1D5BA 3TNMB 1E6OH 2NMSA 4IHOB 5D71L 3TBTB 3RUGE 5E24E 3ARBA 2W9DL 4EKXA 1PAMA 4U1MA 4XP5L 3E6FB 1VEPA 3U0WL 1G1CA 4D0CA 4KVNL 3B2VL 1A7OL 3VXSB 4ALAH 2MWCA 4AM0B 1Q0YH 3QR2A 2VSDA 2VXSL 3X14B 4OZIB 1VFBA 1INQB 1T1WB 3O3AB 1YQVL 2D9QB 4JFDD 4D0DA 1IGFH 3MRIA 4E41E 2D7TH 4X6DF 3R0NA 5B4MD 5C0RL 1M6OB 4XP1H 3DOSA 1IAKA 2BOCA 3F7YA 1OL0A 3EFDL 4PJGA 3TH3T 4LSQL 4JRYA 4U1MB 3RTQB 4CN6A 4DAGL 2VH5H 2PW1A 4CNIB 1HH6B 2IFFL 4LRNH 4AM0A 1G7QB