1D5IH

Unliganded germline precursor of an oxy-cope catalytic antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
QVQLQQSGAELMKPGASVKISCKATGYTFSSYWIEWVKQRPGHGLEWIGEILPGSGSTNYNEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARGHSYYFYDGDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational effects in biological catalysis: an antibody-catalyzed oxy-cope rearrangement.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords CHIMERIC GERMLINE PRECURSOR OF OXY-COPE CATALYTIC ANTIBODY A
total genus 43
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1999-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d5iH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d5iH02
2IFGA 1DQDH 2HT4C 4KGLA 2DQUL 5LAXA 3V6OA 4XPTL 1JHLH 1V7NL 1U8PB 1MSPA 4FP8L 4XPBH 1AXSA 5B39B 1IGTB 5DC4B 1DVFA 3OAUL 2W38A 5J6HB 3C8KA 2CUIA 4JZNA 2YA2A 4GW1A 4KHXH 3KR3L 4HXAL 4NQCE 5GRUH 1WFTA 4CNIA 5E4EB 3SKNB 1AXTH 4PJ7B 3VFTB 3LV3B 2IALB 5AD0B 3EYUL 2QSCH 1MFBH 2NY2D 4MB5A 4KUCF 3ZT5A 1Z5LA 4JFPA 2YZ1A 3QIBA 5CBAA 1KENH 5CEXB 3GMOB 3ZTNL 1CIDA 7FABL 1W8NA 2GJ6A 4M9PA 5DQDL 5HVHC 5I71C 1IGIL 1QBBA 5TDPA 2VISB 1D9KA 4J3OC 4JO1L 2AV7A 3HC3H 1I3RA 4CMHB 4P9MH 3S34L 2ERJB 4DKFL 3KHQA 1MVFA 2D7OA 3OGCA 2E7MA 4WCYL 5FO8A 1M05A 5C07E 1BVZA 3D85A 1T4KA 5L8KB 4JFXB 1IEHA 2UVEA 1MFCL 3GSNA 3GKWL 3EO1B 5DSCA 2VLLA 5D1XC 1K3IA 3LKOA 3VGDA 3OTTA 4P5TC 1EEZA 1WWAX 3WJJC 1P9MC 2EXYC 5K93A 1GC1H 5HI4C 1X5AA 2F19L 2HT2D 5LGJA 1RULH 1EUTA 5IBLD 4EI6A 4PLOB 5EU6B 3WLWD 2AJZB 1MCCA 4NWTH 1P69B 3QPXL 3WS3B 3SCMC 2V7NA 4AEHH 5FYJE 2QEJA 3HI1B 4P5TA 1MCJA 3RUGB 2GTZB 4NRZA 1P9MA 3G5YA 4OV6F 1R3HA 3M8OH 5IR1A 5FCUL 3C5SB 2X9YA 1ED3A 1QSZA 5C6TL 5CIPB 1TVDA 2WINA 4EI5D 4X6DE 3VWJA 2X4SB 4XWOC 3QEQB 2AJZA 2IWGA 4PD4K 5C0FB 4PJAB 1NCNA 1ACYH 2YD7A 2B1AH 2QQLH 3JTSB 2CO6B 3BKJL 3GSVB 3GIVB 4LMQE 2E8ZA 4BZ1H 3U2SB 5JORB 3PP4L 1FAIH 4J3UA 4MXWH 2JTDA 2V9TA 2YUVA 3U9PL 3WLBB 5BZWA 2Y06H 1NC4A 2ARJB 3UDWA 5FUCC 2W0LA 1SJHA 4LSPH 4P2OB 1J18A 1TVBA 1MCWM 4G7YH 2OP4L 1WZMA 2QQQA 2BFVH 4QT5B 3RAJH 3VXRA 4HUWA 1KFAL 4Y5VC 1A6TB 3D0VA 1C16B 4HC1A 4OD2A 3OKEB 1SEBA 1FYTB 5BS0A 3FOMA 3CSBA 4P46D 4X6EB 4PJHB 4PJIF 3UTTA 4KC3B 4FXLA 1QEWB 2WWMC 4LSPL 4O9HL 2B39A 2DI8A 2CR3A 2XG4A 4K94C 2Y06L 5CD5D 3QNZB 5I1EH 2FLRT 5FV2A 3A67H 4GXUN 1J87A 1DN0B 1PKOA 5ALCL 4RMWA 1GC1L 3Q0HA 3EYVA 5CHNA 5DTFB 1MCQA 2AJVL 3FB5A 3G08A 3RU8L 5BXFB 1T89C 4X99B 5C6WH 2NCMA 1IARB 2J88H 4QHMA 3IJYB 4C56A 4XC3H 3RWDA 1V3JA 5DRXA 1AKJD 2E27H 1CGYA 1JMZA 2PO6B 1P5VA 5KVEH 1S7QA 2MQ3A 5HHQA 3QDJE 5C70A 3WCYA 1PQZA 2D9CA 3V4PL 5IIEB 2GJZA 3JVGA 1HH6A 1Z3GL 3MGOB 3H7BA 1U8LA 5D1ZC 1MEXL 1Q0XL 3KYAA 5KW9H 1HE7A 1JTPA 4HUKB 1NGWA 2IH1A 4YDIH 3QPXH 4JCMA 3DURA 1XF5A 4S1RL 4G8EA 3S36H 5FHBH 3MCKB 1QLRA 1Y0LA 1NC2A 1TLKA 4Y8DC 4J12A 4NO2A 1Q1JL 4NN6C 1R5IB 4RMTA 1H0DA 3RA7H 3IS1X 4G80A 1RI8A 3ULVF 3GMMA 1NCTA 4IEFB 4ZS7H 5SWZE 3VXSB 5HHVL 5D7IE 1G9NH 3LH2L 1F8TH 5DJDA 2R15A 3FFDB 3IDYC 4QXTB 4YHZH 1FAKT 1G6RB 4FZ8H 1F11A 5DMKA 1CWVA 4OLUL 3S34H 1R0AL 4Y0GA 5FF6B 1XF4B 4K3GA 5IK3B 1G7QB 4IIQB 4XVTL 3AB0C 1A6ZB 1QSFD 5FO7A 1I7ZB 4ODUA 3VFPB 5FUZL 4G7YL 2Z91A 4MNGE 1QSEA 5M94B 1OWWA 2YPLA 2KBGA 3NIGF 5E7BA 1AE6H 4HF5L 3VFRA 5D7KE 4X80H 1KCRL 3QEUB 2ZOLB 4L3ED 4QRSA 2MSPA 1HH9B 4IOFC 3NN8A 3DGCR 1S7RA 2VDPH 3BHBA 1N5YL 3PWPB 2PF6A 4ZD3L 2VLME 1DBJL 1UADC 2X42A 5DRWB 2A6JA 5J13B 1INQB 2GAZB 4TNVK 5CUSH 1AO7B 4ZOCA 4KTEL 4OZIA 4PJ5A 2SEBB 1H5BB 3NABH 4P2OA 1R3LA 1AE6L 2EDHA 1A1OB 4HUVB 2NW2A 5GXBB 2AQ2A 5AZEH 2A9NL 4PJ7F 3FCTA 5IT2H 5KSBA 3MLTB 4PRHE 2F54D 2OJZL 1I1AD 2NY0B 2GK0A 3ZKMC 2IAMB 5DC0A 1BVLA 5JUEH 1BQHG 4H1LH 1IAMA 3RDTD 1CICD 5F9JB 1MLBB 5DFVC 2B1HL 3DVGB 5EG6C 1UT9A 4AJ0A 4M6NL 1JF1B 2GSIA 4JG0H 4DAGL 3RFZC 4WU7A 3LKNA 5DJXB 3HRPA 3TYGH 1Q9WA 4CJ0A 1R3JB 5HI4D 4JY5L 1MY7A 4PR5B 3DETD 4XC1H 3RX5A 4ZS7L 4M7ZB 1JPST 1WIOA 2QKIB 4U1SB 1SBSH 2VABA 3TVMA 2H1PL 4P23B 1FNEA 4M5ZL 3CFEA 3DJ9A 1A5FH 1FC2D 2B20A 4Y89A 2ZOKB 1CL7H 3WNLA 1JZ4A 1XZ0B 4KMQA 4YGVB 2DDQL 1W8OA 5C07A 4FQHA 1P7KA 4EXKA 2Q76B 1XIWD 3N1MC 4NQVB 4MJ4A 4I4WA 5FHAL 3TO2B 3LQAL 4HX1B 2XG5A 3HRZB 4E41B 3EOAA 5ERWA 2H2SC 3S6CA 5HGDA 4RX4D 3SGKA 2VOTA 5IVZB 3EYSL 3UTQA 5HHOB 1KELL 2Y36L 4XPFH 5D1QA 4ORGB 3MCLH 2GJ6E 4AG4L 5EU7E 1DVFD 1CZ8H 3MRCA 4G9DA 4G6FD 5TE4H 1HILA 1S7XA 5BOPA 4OZFB 2X05A 4QT5A 3EJYC 3W9EB 3MJ9A 1FFRA 4HJGA 4UIMB 4O2FA 2HN7A 1MHPH 2EZ0D 3WDHA 3ARRA 1WBZA 2D4DA 3QYCA 2DJUA 2D7TH 2A2QT 4OSUH 1BFTA 2OMBA 1KPVA 4KJYB 4U1MA 1I7UB 2BHZA 1FZOA 4KZEH 3BEVB 4ZTOH 3QCTL 4MNQD 5JOPD 5GRJH 1VFBB 3BMVA 1U9KA 3VXQA 3TZVC 3CVHH 2GT9A 2HWZH 5IR1B 4PS4L 1HHKB 5GRVL 4OBSA 1IT9H 2R4RL 2IBBA 5K9KB 2MJWA 1KACB 3TBYA 4OGYH 1ORQA 1YEIH 2YPLB 3MUJA 2RGSA 2CRMA 4YDVA 3SKNA 2DI7A 3PIQA 4XXCC 1IM9B 3BKMH 5D7JD 4J1UB 5IHZA 3CSPA 5JHDA 1XGYL 2GW5A 4QTIH 1RJYA 2AGJH 1ZLSH 1MJ7H 4FXGB 2ORBH 2WUBH 1K8DB 1RUAL 1H3VA 1G6RA 2HJFA 1JBJA 1MH5B 3EYFB 2BNQB 3CMGA 1INQA 2NY2C 3QIUB 3PWJA 5AEAA 3RIAK 1EJOL 4DZ8B 2B1AL 1T03L 1M1SA 2BHUA 4XXCA 4ODXB 2NY7L 3JV4A 4PRIB 4O51B 1X5YA 3ZT7A 3O2DL 2OCFD 2CUMA 2DD8L 4WO4B 1JGEB 2HLFC 1EXUB 3M45A 4GG8A 2N7AA 2Y5TA 3L3IA 1BZ7B 1SBBA 1RZJL 1OAZL 4N0UB 3J7HA 1T4KB 1XR9A 3G5VA 5CLTA 4NKIH 3BZEB 1LO0H 5GZNC 4OJFH 1IZJA 5EUKB 2OLDA 2GT9B 5F1NB 4I3GA 2XV6B 3BGFC 2NY4D 4UB0L 3VGAC 1TVHB 1IBGL 3ZSTA 4BM7A 3ECBB 3A6CL 1FNHA 1OAQH 1FORH 1CBVL 4P49A 3BP4A 4JFZH 4M7ZC 4XP6H 4O2CA 4F7CA 4PJFF 1KGCD 3IFPB 4HLJA 5EA0L 1R3IH 3NN8B 5AZ2L 2M2DA 3D48R 4BSJA 1NH6A 2Y7QA 4K7FB 4WTZA 4LKXA 2EKSA 3U0WH 5KW9L 1MEXH 1URLA 5CJ5A 2XT1B 4DZ8A 1LD9B 4KQ4L 2ATPB 4HKBA 3VRJB 3STZB 4L5FH 1UVQA 4ODWA 3U6RB 2OK0L 15C8H 3U9UA 2ICEB 4CMMB 3IB4A 5C0CA 3C6LA 1N64L 3ILQC 2EEAA 4YDKL 2VIRA 2WZPD 4XXDA 4NC2B 2C3XA 3F7VA 5I1JH 3UTTD 1KCVL 3O45B 25C8H 1UWGL 1YYLL 4LBEA 3Q1SH 5HGBB 2QSCL 2FX9L 1U8KB 1JN6A 5KSUA 3VGEA 5ADPL 1I9RH 4DN4H 3U0PA 5DJYB 5EOTA 1BFVL 2CIIA 4NNXB 1Q38A 2NX5E 3GMPA 2BK8A 3SOBH 2Y72A 5FYLL 1CXFA 4LRNL 4X98B 5CSZA 1DLHB 3QEHA 3TBVB 2MHAB 1NL0L 4PJEF 3PUCA 1B4JH 3HNVH 5H35B 5GZOC 3TO4D 4JREC 4NJAH 1A6PA 3RVWD 4K2UH 1MIMH 3DX7B 2EYRA 3LRGA 1M6OA 3MYJB 1RZ8A 3LHPL 1WBZB 4M7KL 3SKJL 3JZ7A 4XMKH 2FSEA 5C0ND 2D7NA 5ILTH 1JYNA 3BZ4B 1RJYB 1OOAA 4TPRL 4GKSB 2Y1VA 4MXWL 4N5UA 3RWDB 5EBMB 1L0QA 5JA9A 3RGVC 1ZKAA 4X7EC 5I75B 4WWKD 1CGSL 1NLDL 1IC4H 5F72S 3N50A 3HUJE 1U8QB 4RAUB 2YWZA 1VPOH 2GI7A 4KK9D 3UAJC 3CLFH 4BH8A 1J1PH 1SYVA 5DZOA 4GBXC 3C6LD 4N90E 1QVOA 5IWLA 4KY1L 4P46A 5E2TL 3PQYA 4LSSL 3IFLH 3ARXA 5F7FA 3MV9B 2KH2B 5CSZB 4PY8I 4OQTL 1XCTA 2YHGA 4FTVD 4GSDL 1QNZH 4LSVH 2XZAH 2VLJB 4EI6B 3P0VL 5AWNL 2JKXA 1U3HC 4Y5YC 4V2BA 1A4JA 1NGQH 1FRGL 1U36A 4X5WA 4I0PB 1OLZA 4XNXH 3VXSE 4TOYL 1OM3H 5ISZD 5E00A 1AGCA 4YHKL 5C07B 2YSSB 5F6HI 3N1PC 4U6YA 1HSAB 4JFHE 2ITDB 2MPAH 4O00A 4WU5B 3U79A 4A2LA 5JHDD 2DWDA 5GS2H 4L8CB 4JDVB 1F4WH 5IVZA 4UZGA 2BC4B 4P9ML 3B6SA 4X4XB 2BOBA 3QWRA 3NH7H 2EC8A 5C08D 3RZWA 5FK9B 3SN6N 1N5AA 2VISA 4J4PD 3BMWA 5DVMA 4K7PH 43C9B 3HPLA 4TSCL 1FCGA 4M5YL 5I1GH 3P9WB 1IAIH 2FX7H 2VITB 5B4MD 5HHOD 3IDNA 1MCOL 4F7MA 4HUNB 5GGUB 2MTPA 5LGHL 3NZ8A 3RKPA 2OJEA 2XQBH 4X6BB 1OL0A 1LEKA 2W1NA 4NDMB 4Y16C 3E6FB 3UC0L 3QEGH 5FGBC 3JTTB 3SCMD 4EI5A 3D18B 3KXFE 1MLBA 3ORJA 1C7SA 3OXRB 4JY6A 1DQDL 4PRNB 2HJKB 4PJHA 3GJFA 4GG6A 3P9MA 1D5MB 4TULL 4QOKB 1CFQB 1PG7W 3CXDL 4UTAL 5GGVL 3LSOA 5LWYH 2EIBA 1DVFC 3VXPB 4Z95H 1WT5A 4HKJB 2W07A 1I1RA 3OAZK 2BOCA 4HIIB 1KJVA 1KTKE 1F4AA 3VXTA 3O6MH 3X12A 3I3EA 1ZT1A 4JO4L 4WO4D 2CKNA 2WK2A 4GKNA 4OV5A 1DBKH 5I1KH 4JO3H 4OZFH 3WO3B 4WIQA 3MXWH 4G8IA 4YO0A 5GSRA 4Z95L 3VGAB 2V7HA 1GVIA 5DWUL 4W70A 3T0DA 1TFHA 3K0WA 3U36B 1WT5C 3U0TA 5ID0A 3QZWA 1YUHA 4POZC 1BEYL 5ACZA 3LMJL 5T5NF 3GSXA 5CEZH 5E2VL 5E08H 2NY4B 1JI2A 2MCPH 2WLYA 1I3GH 1OW0C 5D7IA 1W72H 4JANA 5T3ZD 4MJIB 1XCQA 4FHBD 4RAVA 1QP1A 1OAYH 4KJYA 4U1MB 4HGWB 1X4YA 5MP6H 2XN9E 3CFJB 1OCWL 5C09D 1NMBL 1NEUA 3PDOB 2G9HB 4HV8B 5LQBL 2B0SL 3QRFM 3HA0A 1BJ8A 1NCDL 2PN5A 5EO9A 2VXSH 5FGCE 1QRKA 2EH7L 2N4IA 3MR9A 1RZ7L 4KJWD 5DR5H 3MV9D 3WFCH 4UV4H 4F33A 4TUJA 2EC9U 3RVUC 3TCLB 3BUYB 5T1KA 1TIUA 4LLQA 3V6OE 4E5XB 3X17A 5HHME 3SGEH 3EIFA 2EO1A 1MQKH 4PJFE 5HGHB 3BRDA 1FYTE 2XWJB 3K8MA 3DRQA 1Q9LB 2D9QB 2C4XA 4NPYA 1MUJA 3MA7B 1BZ9B 1UM6H 4PJ5E 1XGUA 4XI5D 5JOPE 4HG4K 1J5OH 2EDOA 2P5EB 2RHEA 5SWSD 2ZKHH 3B9KA 3OJMB 4LLMB 3TO4A 1KUMA 1T21B 5FGRA 1ZXQA 3RGVB 5I75C 5HHOA 3SGJA 3VW3H 6CGTA 4WHCA 1NUDA 1A9EB 4XNXL 4OGZA 2NY1B 1CVSC 2AJ3A 4K3JL 4RMVA 5DT1H 5E99L 1UCTA 2B5IC 2BOBB 4N8CL 4UQ2A 4GXVL 3DVFA 4MNGB 1G7MA 2XTJB 2X4RA 2VQ1A 4NZUH 4UNVA 3KPQA 2FECI 1NBVL 3W9DA 5E5MA 4BSWA 4OAWA 3O6FC 2HRLA 1R3JA 3E0GA 4XX1G 4OM0L 3PXHA 1V3LA 3S3PA 4WU7B 3X3FH 4QF1A 1OP5H 1KJ3H 4I0KA 3LN5B 2I07B 1IQDA 3SKMB 3ARGC 2F58L 3O3AB 5F44A 4UTBL 2J4WL 3VRIB 4M93C 1MF2L 1LO2H 2ZSWB 3MJ7B 3AREA 4PTUB 1I3RB 5IQ7L 4ONFL 5FUOL 3PV6A 4W6WB 5FUOH 1CD1A 3JUZA 5T3XL 1S7RB 3AGVA 5I19L 3ZKNC 1Z5LB 5CBAB 5KSBF 4HPYL 3PWVB 5DSCB 1IGFH 2R1YA 4S1QL 5DEGB 2ED7A 3AREC 5D7LD 4FG6C 4KTDL 1RU9L 3SDAD 4BQCA 4IRJB 2I25N 4HKXA 4RCAA 3U4BL 1QO3A 4JN2B 5DEZA 2J6EH 4M8QA 1SVZA 2DS4A 4RWYH 5JOEA 5EORH 4CUCA 1NMAH 1CYGA 3OKDB 2XY1A 3MFGB 4XNUH 2APWA 4U7SA 1K5NB 3VXMB 2PYEA 5F3HB 2IJ0C 5GGSA 4L8BA 3S4SG 1CE1L 4KKCC 5T33H 1NLBL 5ACZB 3NTCH 5HY9A 4YHPA 4QGYA 4TUJB 5E24E 3HAEG 3SGEI 4J8RA 3MRJB 4JO2H 4U3XA 3ROLB 3TIEB 5FYKH 5FUCE 3KNBB 4OCRH 3L3DA 2FATL 3VCLB 2NNAB 4F58H 5TDOB 3WYRA 3RBSA 4F3FA 5I6XC 2D4FA 4LFHD 3L95B 1DQQB 1YMMD 3W2DH 1HYSC 3CMOL 1D5BA 3DX8A 1F2XK 3WEXB 1NGYB 5BO1H 1Y18B 4ZUUB 3R8QA 2IH1B 4M1GH 4MQSB 4LAJH 1QQDA 4GS7B 12E8H 5D1ZB 1F4XL 1ROWA 2HJFB 5JW5A 2W65A 5DZNA 4JG1H 1FL3A 5FYKL 2LTQC 4GUPA 5ICXA 3RL1A 4LHUG 3B9KD 2QHRL 3ZKXB 3G6JB 4KI5F 3BN9D 4KI5D 3O45A 3MV9E 4M1DL 2YBRB 3BW9A 1CE1H 1HHHB 3D18A 1MF2H 4PGDA 4M6MH 1DVFB 4GQ9H 5DRNB 4X4YB 3HPJB 5C0CE 2X1XR 4XNUL 5JPMB 3ZE2E 1NFDE 4G9FD 1MI5E 1U8HB 4QHUA 1J05A 3IDMB 3DXAA 3QNXB 3RJQB 1J10A 4UAOC 1RZJH 1Z2KA 5DMGC 5E2VH 3BUYA 4P5TD 5T1KB 3IRZA 5E08L 3W0WD 5EO1B 1LQSR 2DBLL 2R9HD 5JR1L 3EDFA 3BEWA 5TJWK 3ARGB 1MI5A 4MD5B 2UZIL 4JFHD 4O2CB 3IJSA 4FQCH 1G7HA 4MXVF 4JO3L 3L3OB 4Z7VA 1ULVA 1CT8B 5ISZA 5GISH 1N6VA 1PLGL 2VTFA 5JIIA 2CXGA 2Z0BA 3AXLA 4EUPA 3T09A 4AH2A 4X6CA 3IETA 3PDGA 1JV5B 2R8SL 1FJ1A 1OARH 3MOBH 4TVPD 3N9GH 4U1IB 1LP9F 3C87A 4LLDB 4POYA 2ICWA 5HVFB 1MIEL 4JFEB 4PREB 5IHBA 4KZDH 1V7MH 4M6OH 4UV7L 3MZTA 2P7TB 1QR1A 1G9NC 1NBZA 3CFKB 1QSFE 1UQSB 1N7ML 3Q3GA 3IXTB 2ZSVB 3V6FB 1OPGH 4WO4A 1MWAL 3KPRB 3BDXA 4H1LG 1LO3H 3BP6A 2EYSA 1MJ8H 5LG1A 3IAGC 4ZFOL 4MJ2A 5C07D 2VH5H 1MQKL 4NJ9L 5E5MB 4BSWB 4LASH 3VFGH 4KH2A 1WWWX 2VAAA 1A6AB 1YNLH 3UBXA 1UH4A 4JO2L 1RZ7H 3WFEH 5MEOA 1A0QH 3Q6GH 4FOMA 4XPHL 4K3JH 4FABH 4JRXA 4KI5C 4FMFA 3C9NA 5A40E 3HLAA 4AIZA 1CICB 3MRHB 1X6NA 2ZCHH 1YNLL 3V7AE 4X5WB 2ZSWA 1FVDB 1QUNA 3BPCA 1CZ8L 1IKFH 1EUUA 2AXGB 1N64H 2XWJA 2XFXA 4X6DA 3QUYD 1AQDA 1RURH 4JQXA 1OTUD 1I3GL 1IM3A 4ORGA 1Z0NA 3RI5F 2PYFA 3NZHL 1FC1A 1P53A 5KVMC 3P4NA 4UT7H 3TH2T 2DDQH 4N0CC 3IRPX 4Y4HA 2M8XA 2AV7B 4HS3B 5CD3B 5CP3A 4W4NA 3FRUB 3ARSA 4HT1L 3EO9L 2AEIT 1BQSA 4APQB 3O3DB 3JWOL 1U92B 1WV7T 1P1ZB 2ENSA 4XNYL 5ITBL 1OWRM 4LF3B 2H26A 1JNLH 3V8OA 3BWAB 2UZIH 2NZ9D 3JWNC 3QO1A 3W9DB 1QSFB 3LIZH 4PJEA 5EOTB 5FYKU 1MREH 2YZ8A 3EYOB 3L3KA 1T5WA 4ELMA 2C7UA 3B83A 5J12B 3TM6A 3K80A 5DS8B 4GFTB 5FA3B 3TZVB 1I7RA 1NGXB 3F7YB 4GMSH 4UAOB 1S9XB 2AJYH 5DD6A 1BVLB 4BK5A 5J1AB 5E8EA 3GMPB 5GGVY 3R0MA 1I4FA 1YC8A 3L3JA 1U93A 1AIFB 1DANU 4ZXBA 3G9VA 2DJ4A 4EUPB 1DBKL 4P99A 3DI2B 4HZLB 4PR5A 1P4BH 5E99H 4U1LA 2V2WA 5CKGA 1N2RA 1OSZB 3LB6D 3QG7H 4X6FA 4DEPB 1QPPA 4HDIA 1NANI 3UTSA 5GIRA 4XTRC 1SY6H 4XTRD 3WUWA 1X5ZA 5A2KH 5F7NC 3T0ED 4P3WA 4Q6IC 1DJSA 5IF0A 5ACLA 1FO0H 3U36A 4Z7WE 5C0AA 1IZKA 2HWZL 3D3VE 3LVEA 3QUMB 2PYEB 2E7BA 2KKQA 4LRIA 1WWCA 3SDAB 4Q9RH 4NZTL 5C0BD 2AABL 3MV7E 5B3JF 3IDMA 4HJ0D 4Z7VF 2AK4E 2BSED 1KIPA 3LZFL 4UV4L 5DI8A 3RZCD 1CGWA 4Z7WA 4P4KC 1MVUB 1VEOA 1JTTA 3GM0A 4X6CF 3IGAB 5H94B 1T1WA 3B4NA 3V95A 5E94B 2CK0L 1CE6B 1RZFH 2BVOB 3QUZA 1NFIA 1YYLH 1NJ9B 2F8OA 3IFOA 5E8NA 3WSQH 1CFQA 3QUXA 2FX7L 2NZ9C 3GMNB 2AI0H 4J3XA 5D6CB 4TVSa 5GGRA 2JE8A 1A6ZA 4ODTH 1C5CL 1F58L 3VDBA 2P5WA 4GRWF 4JPKH 4AIXA 5E6IC 3MNWA 2EDJA 1DL7H 1I3UA 3ARTA 2BVPA 3UYOD 3MJ7A 3U7WH 5L6YL 4KY1H 4M00A 3GHBH 4YEEA 5ENWA 1PQZB 2BOCB 1MNUH 2VAJA 3GRWL 4E0RA 3QUXC 3HFMH 2EXWD 4XWOD 4CW1A 5ESAA 3UPCA 3PV7A 2VYRE 3CUPB 3EOTH 5EN2B 1F45A 1Q9KB 5I1KL 3U46A 1XF3B 3RVXC 1FNSH 4DKAA 2J2ZA 5E6ZA 3K2MC 3OR7B 3C5ZA 1J88A 1EGJA 1XF5B 5DEGA 1UVQB 2D7PA 4J3SA 1A6AA 4L8DB 1N5AB 5I74B 1G9EA 1Y6NR 3P77B 5IKCA 3RWHB 3NIGE 4JAMB 2VLKA 1U42A 4WFGE 4JFQA 3OZ9H 3O9WC 5GGQH 1F3DH 4J23A 5C2BH 1OP9A 1BOGB 3TZVA 4D9QE 4ENEC 1KJ3L 4LPWA 5JQHC 1BP3B 4WEMB 4WV1A 1JK8B 2F8VA 4ONGL 3WKML 5BV7C 4K2UL 1AD9A 1N8ZA 3T0XA 5D4QA 1VB9A 2BHYA 4YLQT 3MRBA 3DX6A 3LN4A 5SWQB 2HFEA 5D7KD 2NX5A 3FO1B 3WS6C 2RFXA 4B53A 3V6ZB 5D72L 5FM5O 5ICZB 2IADB 4XP4H 5AG9A 3TF7C 3JXAA 3TVMD 3QDMA 5D5MA 4G6JH 3KYMA 3MRQB 3I6GB 3EDEA 4WNQA 4ZUVB 1FO0B 1ZLSL 3TGXA 3GZKA 1KCRH 3MUZ1 3GJFH 4IDJH 2ED8A 1L7IH 1JWUB 1QSEE 3FL7A 3LQZB 3WS6A 1HSAA 4P2CG 5FYJH 5BOZG 3QHFL 1T2JA 2YD4A 3V4VL 5ILTL 5JDSA 5IVOA 1T3FB 4JFFD 3VDCA 1T21A 3WN5A 4L9LA 3K4AA 1KCLA 4R4NC 1A9EA 4LVOB 4L29B 1NC4B 1PZUB 3DBXB 2R4SL 1WBXA 1WLHA 1AP2B 3GB7B 5F71A 1W72A 1CTNA 2NY3D 4U31A 3RP1A 5SWSE 2UY6A 3DRTA 3EJJX 3OB0K 1CF8L 4PJ5D 4FQQB 5MERA 2HT2C 3SDDB 4DN4L 3SPVB 3WN5C 4FQXD 4LVEA 1O0VA 3QJFA 1NCDH 1G6RL 1TQBC 1YZZA 1FL5B 4ZYKA 2O93L 3N85H 1WAAE 3HPJA 1FYTD 3QXTA 2BVEA 5F3BB 2C4FU 5CP3H 1OCWH 1X5IA 3PHOA 3T3ME 4QHNB 5IEKA 3PP3K 4EDWH 4KTYA 5DUML 1DQTA 4MNQA 3RDTB 1Q72L 4YGAB 5C09B 2FH8A 4U4BA 2MHAA 4XCEA 3STZA 3GM8A 1PD6A 1U8QA 4HV8A 4KUZL 1YYMH 1LHZA 3L5IA 3L95A 3AU1B 1VDGA 4IRSA 5C71A 4KDWA 1GGTA 1MHEA 4ZO6A 4NT6A 3P73B 3LSOB 4ERSH 2NXYB 2FCBA 4RA3A 5D6CA 5GGRB 2GCYB 3MLXH 3DX9B 2I9LA 3VXUB 1S7XB 1JFQH 3IF1B 1CDCA 2DB8A 5GJTH 3TC9A 4OT1H 1U8OB 2OTUB 5HHOE 1ZT1B 4JZJC 5FDYA 3V6FA 2VJXA 1YY9D 4OBRA 1MCSA 2GK2A 3AS0A 3CFKA 4UTBH 4EJ1C 2C7UB 3O4OB 2AJXL 4ZSOB 1MCWW 2BRRL 1FL6B 5C08E 1F13A 4U0QB 4NRYA 1TJHH 5GS1A 3LPFA 3UP1A 4JPWH 1D6EB 1AGFB 1QFHA 2B7DT 3DX6B 3DSNA 3KPMA 5DJDB 5IGXL 1UH3A 4QRUB 4DUXA 3KPSB 4RSVA 2X2YA 5FO7B 4JQVC 2D7MA 3NIDF 3NCJH 5CJQH 1E28B 2O5ZH 3UC0H 3RTQC 2HVKA 4G8GA 4HIJB 2I60H 3TPKA 4MAUH 3VRJA 5C3LD 2DM4A 3QDAA 3PQYD 3O4LD 5FB8A 4JVPA 4MDIA 3EZ8A 3KG5A 2F54A 1ACYL 3CFIC 3TFKD 4JPIB 4J2XA 4WJ5B 5DVNA 1JRHI 2E7LC 3ZKND 1BPVA 4GW4A 4FFVD 2FX8L 4HH9A 5MHSD 3BGMB 1YEEH 4LPVA 3HUJB 3WJLA 3T77A 3HE7A 5DA0B 1G9MC 5IESH 5E5UB 4FZ8L 4X6CE 5FOBB 3IVKA 4GG8B 5BJTB 5TPWH 3SGJC 4JVWA 3QCTH 2NY2B 3JUYA 3PWUB 3BVNB 1U3HA 5CMAB 5EZOL 5GRZA 1K4DA 3B8YA 1XGRA 4MAYB 5ANMB 1MRCH 4ZQKA 3VFSA 5GGUA 2QQKL 1S7SA 1FRGH 3QQ4A 4M7JL 3DSFH 5SWZD 1OAQL 3WBDA 3QUXB 3EYOA 1HHIA 2QADD 4TSAL 4UOW1 3REWA 5DD6B 4RWHA 2VR4A 3MJ8A 1FNGA 1UZ8B 1WFUA 4PJBA 2X4NB 4PGBB 2DQTL 1BZ9A 1S7WB 2VZUA 3INUL 2Z93A 2IPKB 4RAUA 3HC3L 4P9HH 2H41A 1BEYH 3KHOA 1AGEA 1J11A 1KEML 2ESVB 5IT2L 3AXLB 1S8DA 3HR6A 1UJ3A 3NGBB 2C3GA 5J7CC 2IGFH 3VXRE 5C0EB 3D39B 3HB3D 2EE3A 1X44A 5D6DA 5DQJB 5HGHA 5C0CD 4FQLL 1INDH 1BD2E 3MLZL 5DEFA 1ZE3C 3NVQA 5EU7C 5IM7A 1JUFA 4KXZH 5BCAA 1J0HA 1AGEB 4HUXA 3FO0L 3MGOA 2ID5A 3BVNA 1HKFA 2AK4B 3VG0L 1EDQA 4QTIL 2D31B 2CLRA 3E8UL 1MAMH 1VACB 2WUCL 4CAGA 1BD2A 3WXVL 1FZOB 3LKQA 3HC4L 2ENYA 4UTAH 4MA7H 1P84J 5K9QG 2HRPH 4NQEB 4IMLA 3GSXB 1ORSB 2X70A 3E3QE 1ETZB 3FZUC 2H6PA 1NBYB 2OP4H 5E6IB 2VDOL 2ZPKH 4WFEE 2ITDA 3NA4A 1AH1A 3LS5H 3VD3A 3BUTA 1ZGLP 3CDFA 1F4YL 4YDVB 1BBDL 3GGWB 3GMRA 5IV2B 2P24A 1T22B 1M6OB 2Z92A 5ADPH 2FIKB 3K81A 3BP7B 3LEXA 5IB5A 4NQEA 3RVTD 1N5YH 1A7QL 1QLFB 4BK4A 3TO4B 3EJYD 3W0WE 2DQCL 2Q6WB 4GKSA 1HN1A 4LLWB 3MRNA 3RY6C 3CDGA 4NQCD 1WVZA 3MOAL 1FG2B 4KDTC 4ZUTA 4R7DB 3X3GH 1P2CB 4KV5E 4JRYA 1IC7L 4MD5A 2VWEC 3GSOB 5ID1A 4NFBA 1LO5B 5CWSA 1Q0XH 4FFZL 4XPFL 3QDMD 4M48L 4PJGE 1WWBX 1EHNA 2Z8RA 5EU3B 4LPXA 3PHQA 3FQNA 4MDIB 1GOGA 3DYMA 3PWUA 3GJEA 4WHTA 5TE6L 4JN1H 1JWMB 5CBEA 2D7QA 5HYIA 4CU7A 1UKSA 4TQEH 1N26A 1JJUA 1JTOA 3MJ9H 4ZQKB 5D2NC 1UZ6F 3WV0A 3MCKA 1JYWA 2EECA 3TIDB 3BOVA 5E2UL 4Q2ZB 1QRNA 3RWEA 4XAWL 5L0QC 3CIQA 1DQJA 1WICA 2AQ1A 4FFYL 5FM4A 3C5JA 2O61B 5F21B 2CDFA 1N8ZB 1SJEA 4TQEL 5HPMB 1T1WB 3CNKA 5EIVA 5TPWL 1R24B 3GEWB 2JJUA 2NTFA 4GRLC 4OFYD 5I1IL 4CNIB 3ULUC 3O6LH 1DFBL 1AXIB 2BNUA 4HK0B 5B8CA 2B4CC 1RUML 3ILPA 2P43B 3DLQR 3IDGA 1Z3GH 3P9LA 3R4DA 1EERB 5IFHL 2EKSB 5F97E 4M6AA 4YPJA 1FE8H 2FEDC 5DXWA 3VXUD 5INCA 4Y5XC 3UO1L 2VZSA 4N0FB 5C0JA 2DIAA 4Y5YB 4H20L 2CDFB 2OR9H 3TCXA 5JPNB 4OUUA 3WE6B 3O6KH 4MMXC 3T77B 1VFUA 5CUSL 2ADIB 1I1FB 4KXZI 1YMHA 1ZANH 4PJBE 4XPAL 3SE8H 2ADGA 3FTGA 5HDBE 4HHAA 3F5WB 2CXKA 1S3KH 1WC7A 4IBLT 1HXYA 4EN3D 4Y5XA 3MV7A 2ZUYA 1ZHBB 3KLAB 1U8LB 3V6BR 4TPRH 2IQAA 3H3KA 2BNQE 1W0VB 3LCYA 2A73B 3RDTC 4YHPB 2WANA 3KPNA 1VFAB 4PS4H 1X7QB 5HI3C 5FGSA 3WFHA 2QJDA 3LOWA 4HPOL 1B0WA 2AXHA 3RZCC 2JIXA 1NGXA 3T0VA 1A3LH 4V1DD 4XP1L 4C56E 4YJZL 3S98A 3OKDA 1G7PB 2HTLC 4PYHA 3I85A 2HLAA 4DVRL 5AAWA 5HGDB 3LKSB 5TQ0L 1HQRB 3KPSD 5D93B 4LDOB 1F11B 2R0LH 2V2XA 3CDGB 4P59H 4Z9KB 5D7LB 1KT2B 1QTYT 3MJ9L 4XZUA 4XP9H 1PKQB 5BS0B 4Z0XA 1VFMA 4ZFOB 1LILA 3ARBC 4HAGA 4WI7A 5E2WH 4MJIE 5BRZD 1AO7E 3GGWA 2HFFA 1KLFA 1A3RH 1CFSA 5DLMH 5JOFA 2F54E 3INUH 4KJPC 4LIQH 3GI8L 3OKLB 4M03A 2VXUL 1OGTB 5EBWA 4NC0B 1JWSB 1QACA 1TTGA 1NUGA 2J6EA 4YIQA 1TVBB 5I1HL 4L3EA 5D71L 3UYRL 3MJ6A 2CRIA 2A73A 3DXAE 4JAMA 4NHUA 3F7QA 5C0NC 2XTJE 1NBZB 1SBSL 2A6KB 2VLMD 4OKDA 2K7QA 1AY1H 2XZQL 5T1MB 1HHJB 3HN3A 1XCTB 5TQ0H 4EUPH 2XKSA 2VSDA 3ESVF 4NGHL 3GSWA 3VCLA 4HXAH 1H3GA 5BV7H 3GKWH 2NY5C 1A4KB 3FQTA 4P2RA 1IAOB 4NHCH 4P5KA 3VI3E 3RY5A 4JFXA 4L3EB 4X4ZA 4RNRB 4PJIE 1RHHA 1WCBB 2DMCA 5BXFA 3A6OA 1IAKA 3DYPA 4P23D 5DK0B 1IGYA 4XRCB 4DZBA 4G6FB 3O11A 3H6JA 4ZAKC 2HVJA 3BPLC 3VGBA 3ZSSA 4QRPD 4ZFOA 2WNGA 1P4LA 4OI8A 5T1MA 5D2LA 4A6YL 4LDLB 2HYMA 1ZSDA 2A9ML 4P2RE 5FYJL 4DW2L 2HVKB 1P4IL 3ZTNH 4ODSL 7FABH 4N0CD 4K9EH 3MNZB 3KYMB 4NFDA 2YPKB 4YEFA 4N9GA 3BD4A 4ZXBC 5C9JA 1XGUB 3BWUC 1A6VL 2BJMH 4YNYB 1OTUC 3GO1H 4U6VH 1K6QH 2DLGA 4E42A 1WTGT 4RZCA 5J13C 1RUKH 2ARJA 2PTTA 2FHCA 2UY7A 5FV1L 4K9EC 1QBML 4PP1D 4CW1B 2G2RA 1E6OL 3WFBH 1CQYA 3VXOB 5C0IB 2H8PA 4JRXD 4WHYG 3IDIA 5IFHH 1BOGA 4MA1C 1UXWB 4JR9L 1E4XH 3OR7A 3K2UH 5T5FH 3TWCL 3MLPA 3QDJD 1RUMH 1J0IA 1O5DT 4YE4H 1GSMA 3HC4H 4HGWA 5H2BA 4KDVA 5T1DL 4YAQB 4DKEL 3L5JA 3UTPE 4Z77A 1GGIH 2X89D 4L8DA 3U0PB 4EDXA 2HLAB 4NFCA 1QD0A 3KPMB 1NCCL 1YN7A 3C5SA 4I77H 1D5BB 3UBXB 2XA8L 3KPSE 1HHGA 4X6FB 3LEYH 3KLHD 3MX0A 1A1MB 5GS2D 4E41E 4QOKD 1MHPL 1FNSL 1HEZB 3KPNB 5C0DB 1E4JA 1WGOA 3QUZC 3DX7A 2BSRB 3P40A 3BQUC 3DMMA 2J8UB 2HLFD 4V1DE 4PRBA 1RIHL 2DQDH 1QFWL 4YDIL 4QXUH 5IF0B 3RL1B 2BZDA 4UT6H 5H37G 4YO0B 5GSRB 4R4ND 5LKNA 4MCYB 4MZ2A 4K7FA 4NQEE 1L9NA 2A77H 5D70L 4Y5XB 4DGVL 5ID0B 3I2CH 3DX9A 4EVNB 2RAMA 4RA0C 1F58H 3TBTB 2WMPA 5I76B 5T1LA 2YRZA 1TETL 1R5VA 1KIPB 3X11B 2JK5A 2H8PB 4OI7A 1GZPB 4FQPA 1QFOA 5D7JC 5LJYH 1QO3B 3MV7D 3H3PH 3I3BA 4WFGD 3ZTJG 5CAYB 4RGNE 3F7VB 4M5ZH 2CJUL 4OD2B 5CCKH 1A7QH 4GOSA 1CD8A 1VACA 4FABL 3FOMB 3RY4A 3VE0A 3NPSB 4L1DA 5I1AA 4UU9A 5L2KE 4MJID 5J1AA 4S2SB 4X6BA 1M4KA 5EZOH 4KHXL 3GMNA 5DUBA 1GZQA 2YK1L 5KTEH 1ZVSA 5L88H 1XR9B 2AABH 2BNRE 4G8GE 3T04D 4WTZG 3CSYA 4L4JA 1FYHB 5JHDE 2VXTH 5DJ0A 5IESL 1AGFA 5EZIL 2BVQA 3R06A 2GFBB 3I50H 5HYFA 1TJHL 1FO0L 4I0PD 5T3XD 2WBKA 3FFCE 1JHKH 2PXYC 2BMKB 4PP1C 3BP4B 2DI9A 1JGVH 1P7KB 2Q20A 3TA3C 3TNMB 5HYQB 4OFYA 3KDMA 4UINL 5DGQA 1U91B 2Q3AA 2CLZB 4QHNA 4Y4HC 5F7EH 4XH2B 2VUOA 3CFCL 4HS8H 1OARL 4LNRB 3MV8E 3QULA 1AHWA 1NANH 4CADB 4J6RH 2XN9D 5E8DH 4LHJB 3FFCA 1OD9A 3GO1L 4PRPD 1FVEA 1N0XL 4OZHA 4P4RB 5D2NB 4OM1H 2E7HA 1U58B 4OF5A 5IHLB 3OKNB 3TA3A 1ACZA 4LPCA 4NCC1 4ODSH 5FFLA 3MQIA 4OKVB 4NSKA 2EKJA 4KJQD 4NO5B 1FVCB 2OR8A 4LHUD 4MNHB 4WENB 3NIFF 1KEMH 4BELD 5BVJB 4P5MA 4YQXL 5EZJB 4YHML 1TQCC 4DFHA 1U8IA 4TVPH 5EUOB 3ME0A 1X4ZA 3C08L 3MRHA 4MX7A 1JN6B 4AEHL 2HFEB 3PNWB 3OZ9L 2VLJE 1KIQB 1T5XA 3IDJA 4ODHH 5TQ2H 4Q6IB 4PV8B 1DLFL 1FIGH 3A6BH 3UZEA 4UUJB 5HYEA 4LSQH 4M1DH 4PRAB 1CICA 1GOHA 5HPOA 2HTKC 1MRCL 1NUFA 4HW6A 1II4E 3SKOB 4OF8A 4JFYB 4PJ9A 1CT8A 1WZKA 3SDAC 5KBNC 3C60A 1EAPA 5F3BA 3MLVH 1YEDA 2CDGA 3BPLB 1MNUL 3F6IA 5DD3L 4K23H 5JW4R 1NDGB 4RMUA 1IILE 5DD1L 5DMIL 2HFGH 2UWEE 3QEQA 2ESVA 3U7WL 5L6YH 3K1DA 1VSCA 5FCSH 3FAXA 3F58H 5ETUB 3D25A 4DK3A 3LQMA 4IOFD 4P23A 1ERNA 1T04B 3LN9A 1JI1A 5MENA 2Q8AH 3TV3H 2Z31D 2XACC 3F65A 5INDB 3U7YH 5AYUH 3BD3A 4PJHE 5JORA 2QL1A 1FLTX 4ZAKB 1RZFL 1B0GB 2JB5H 2KQMA 4YPGB 3OGOE 3RX8A 5ALBH 2EYSB 2VDRL 1A9BA 3VI3F 2X44D 3PP3H 1ZT4B 1AQKH 4KROC 2QQNH 5T3ZL 1NLBH 2VLLB 3QDGD 4FXKA 4S0TD 5GRUL 5ALCH 4R4BB 4HWBH 4N1CA 3DGGB 1F42A 2Y23A 1YEHL 1H15A 1YNTB 1KPRA 5DJAB 4NUJB 4Y4KD 3ALPA 1KSRA 3QIUD 4YBQD 4HIXH 1JPTL 2WP3T 5J6HA 3FB6B 4MAYD 2P8LA 2OBGA 4ELMF 2WIMA 1LP9E 2DLTA 4PV9B 2OXGA 1GOFA 5ENWB 4M1CC 4CBPA 4NP4L 1ZVHA 3P9LB 3OSKA 4NNXA 4HPYH 1A6WL 4JM2F 4HWBA 1U8NA 2VZOA 2VDNH 4O2EB 3FO0H 1LE5A 3ZE1E 5LCVL 5TFSH 5B38B 5AD0A 4D9RD 1C7TA 4MNQE 5IWLC 4KMTL 5D2LE 2OS7A 4RGOL 5BW7A 5FO9B 4HAFA 4PJ8A 3U1SH 2XQYG 1KXVC 3QUYA 1BQLL 1T7XA 3BH8A 3CFBB 5C0AE 1RIUH 2CR6A 1YECH 2Z31A 4G9FE 4BUHA 3ZKQD 2HMID 1JNNH 3AC0A 3S88H 2XWTB 1S9YB 2DN7A 3IJHB 3QXVA 2XI9A 5TH2B 3D39D 2YPVL 4ODVL 2PYEE 3WO4B 1QRNE 2K1MA 3OXSB 3I84A 1JPGB 3ULUL 3M8OL 5BW7C 4PRPB 1HZHL 1ZVSB 2VR9A 3KJ6H 4J3WA 3QG6B 3TBSA 1U8OA 1EHLL 4XHJD 2CKBL 2XKUA 4TUOA 5C2BL 4AEEA 2FR4A 3MLRL 2RIKA 3MV8D 3B5HA 2YMXL 5HHNB 1ZA3A 1H3TA 4PJ9D 1X5JA 4GXVH 5AG8A 1OGAB 4P46C 2XY2A 4M7JH 4OZHF 3RTQB 4JFFA 3OXSA 2Y07L 3L3IB 5E56A 3CSGA 5TE7L 4ZXBB 4PRPA 1CF8H 2GUOA 3OF6D 5IK3A 1ZLUH 2XKNB 3VFOB 4XBPA 3JV5A 4YXKH 4JGUA 4KJQC 5TE6H 1MFNA 3HFML 1NC4D 5IB1B 4U3CA 2Q6WA 2FD6H 3MZGB 1BM3L 1UB6B 1KJMB 2NXZC 4YDJA 1SMAA 5FO9A 3HE6A 4HEME 2HFTA 4LHQB 2LFGA 5LBSH 4NQSA 5HYSB 3VWJB 2P5EE 4DGYH 1A7PH 4X4ME 1SVCP 5DMYA 5EOQL 1JIBA 3BYYA 1MI5D 4GKNB 3RWJA 4F58L 4K71B 4L4VB 3MRKA 3EOBA 4RIRA 4I3SL 5EPMA 2CDGB 3SDDA 1F3DJ 3MRLA 3QNYB 4DEPC 4UMGA 3QG7L 2FEEL 1PG7X 4BFGA 1C12B 1NFDA 2F5AH 5KSAB 5DYOA 4F7PB 3QO1B 2I60L 3FQWB 2VO5A 1E4XI 3SBWA 3ULUD 3CX5J 4U1HB 5I2IB 3SDDD 2ERJC 3VXPA 3I02A 4LQ1A 3N1QC 4JM2C 3HS0B 1TZIA 3HLAB 4OTXH 5SWSB 4AIZB 2P4AB 1X4XA 4JDTL 4XPTH 4D9QD 3MRIA 5IVXE 3SKOA 3LKQB 4G5ZL 35C8H 3FQXB 1ZHNB 3GBLA 4OF6A 2NMSA 3UJIH 1IJ9A 4X7SL 43CAA 4IRSC 1YEDB 3RX7A 3WXVH 5JW3L 4LGRB 4X7TA 2FECL 2XN9B 3KPOA 1IM3B 4P4KB 5CHNB 5DVOA 2EIZB 3H9SB 3ARUA 4HBQA 2ZP0T 5KN5B 5I1CH 4QXWA 3GFUA 4NKOA 4EXPX 4OZGF 3QFJB 3DV4A 2AQ3A 4AMKL 3TYFB 1S7VB 3KS0H 3QFDA 5FKPA 3RVTC 3KYNA 1BGXL 1G1CA 3NCCB 4JZJA 4HT1H 4RIRB 2ITCA 3R1GH 1ED3B 3MCG1 2W9DH 4I4WB 5IB4B 3RY6A 3ABZA 3V0VA 3PGDA 4CVXA 3KPOB 4AZ8A 5T1LD 1U3HB 3UTQB 5KSUB 5GGVH 2QSVA 4OUOA 3SE9L 1UEYA 1JRHH 3F7PC 1KCSL 2X9WA 3G6DH 5KG9A 3T0WA 4KUZH 1HYSD 4H25B 3GHEH 1IGTA 1LE9B 3HUJA 1KIQA 3CK0H 1G0XA 3D6GA 1LGVA 1IKFL 4ODBD 4PV8A 4KFZC 4GJTB 3OF6A 1KCUH 2K7PA 4OFPA 3WSQL 3L5HA 1A4JB 4TSAH 3FO9A 3HTLX 3EYQC 5DQ9A 5K59E 4Y16B 3S3JA 4PBWD 4ZO7A 4NKDB 4PJFA 3MRFA 2F53B 1G7LA 2N1KA 4PJ8D 4ZUUA 4BUGA 2XKNA 3VFOA 2YPLE 1T1YA 2Q8BL 1ZOXA 2BVQB 5DJ0B 4R90H 4YUEH 1RY7B 4NQXA 1QA9B 1MWAA 5KSVA 1CFNA 2C1OA 4Q9RL 2WBJC 1YNKL 5D1XB 1NEZA 4HS6B 5BV7B 1Z6JT 2NNAA 4DJMA 1OLLA 5MEPB 4R2GC 3NCYP 2P8MB 5LBSL 4PJHF 2BY0A 3BHBB 2IPTH 3LEVL 5EH1A 1SQ2N 5C09E 3MLUH 1JMXA 5F93C 4F33B 2XTJD 1AO7A 2ZG3A 3FT2A 1T1ZA 2R23B 4L4TD 5EC2B 1EGJH 3OHXA 1OM3L 1OQXA 5EIIA 1F3JB 4PRHD 5TE7H 4JFEA 4L3AA 4MCZB 3UTZB 4X5XA 3NFSL 5E4IA 3MA7A 1KIRB 2W92A 4S10A 3GSNH 2XWBA 3ZHDA 2B5IB 4FNLL 2O5XH 1H0DB 3ARGA 4MX7B 4Z7VE 2QADC 4NJ9H 3VH8G 3L5XL 3M1BA 5CILH 4G6AC 4KI1A 1T7ZA 5I8KH 5H2BB 5C3TA 3MR9B 1KBGL 2R2HB 1KNOA 1J05B 4XBPB 2J5LC 3GMQA 4BH7A 2D0FA 4EQ2A 4KZDL 1W0WA 3CVHA 2P42B 4XPGH 5MEPA 3P2TA 4I9WE 4U1NB 3TPUB 1BFOA 1J86A 5IMOB 3TBWA 3BI9X 4PB9L 3UJTL 2Z4QA 2IBZX 4MSWB 4UT9L 5D6DC 4KRPD 1BQLH 2CDEA 3EFDL 4O5LL 4PJCB 5DURD 4JHBA 4KJPD 2CRZA 4R6UA 4GXUM 4X8XA 4M3KB 3ARYA 4LNRA 4M61B 1CLYH 4HSQA 1A14H 2X1OA 2GKIA 2APXA 5C0BA 4PB9H 2FL5A 5DHYA 1FFOA 1I8KB 3ARBA 4GRMB 5JXED 3IJYA 3VG9C 1CDGA 1NGZB 1F4XH 2FB4H 3QI9D 4NYLB 4YXHL 1JYVA 3U9UB 3Q6FA 7CGTA 4BQ9A 1ZLWK 1LE9A 3HZMB 2G2RB 4POUB 5I8KL 5C86A 4OZFA 3V6OC 1U6AL 4M7LH 4HCRL 3DRTB 3V2AR 1Q0YH 3CU1A 1Q72H 1AGBA 5J06A 4CN1A 5CJ8A 3FO9B 3A0OA 5JLZB 4R4BA 1TTUA 4XCFH 5KSAC 4HWBL 1TZHA 4YHOL 5GS1B 3QXDA 3FB5B 4QF1B 4AQOA 3AMKA 2F74A 3ES6A 4QYOA 2YRPA 4Y19A 4F7EB 5I73B 1A6TA 3L5WA 2QHRH 1OAUL 4U1GB 4NUGH 3O4OC 4DQOL 4TNWK 3DOSA 2NY0C 3JV6B 1XEDA 3QDMB 4OD1H 3DV4B 2DQIL 4HS3A 4UNTA 4JGMA 3FQUA 3KS0J 3LS4L 1YEJH 1MCNA 2PW1A 3B6SB 3O3EA 1DQML 4G42A 5C92A 2XFXB 5D7IF 2GSGB 4QWWD 4PRPE 4NQCB 4U1JA 5L9DL 1OPGL 1OGTA 4WFED 2ITCB 1EO8H 3HUJF 5SX4H 4I1NB 4JFED 1T6VN 3MBEA 2V5MA 3DURB 2AXJA 3I6LE 2R1YB 3LY6A 1YEJL 2NY5H 2X6MA 2GJJA 1YDPA 1T7YA 3IDNB 4NYLA 4CGTA 2BNQA 4Z7UB 5DJ8B 3KXFD 4IRJA 1DANT 2WINB 3MOBL 3JV4B 4PRIA 5D1XA 1U8HA 2C3WA 4P4RA 4QHUB 5D2NA 2J12B 5L2KB 2LTQB 1M7DB 4WFFD 4MJIA 4G6JL 3FQWA 1E27A 4A2MA 1VHPA 3V79C 3OMZA 1CFSB 3QEQE 3H9HA 4P46B 5I8EA 2ESVD 5HGBA 4NM8L 5I66B 4LKCA 1DEEB 3P0VH 5DDHB 4Z7OF 1I1AB 2DIBA 3P0YL 4ODHL 5TQ2L 4OLVH 5KOMC 5EU6E 3P77A 5IKCB 3OR6B 2A83A 1KB5H 3PQYB 1DUZB 1EHLH 3GSUA 1WCQA 1NBYA 3CGTA 4LSSH 2VL5A 2DQJL 1S7TA 1T20A 3MODH 4MVBD 4PJXE 3O9WD 1Z9LA 2W9EL 4JHAL 3CCHA 5KN5A 2ZNWA 3IKCB 1T83A 1MHHA 3VWJC 2OSLA 4D0CA 4HKJA 1X5HA 4PREA 1JNNL 3P0YH 1DBML 5D1QD 3BZ4A 3DIFA 3RUGF 1JHTB 5L2JB 2GUOB 5DMKB 3BAEL 3P11H 1RIVL 2ZZUT 4NQED 3OKLA 1BVKB 4JE4B 4UQ3A 2P5WB 4X5LA 1RK1A 1LK2A 3CFDA 3BIKA 2JJVA 5EC1B 1RD6A 3I6LD 1XIWC 1FO0A 1V05A 5EIIB 1U91A 1PKQA 1LD9A 5DI8B 3GRWH 1IAII 4MWFB 1JGVL 1H3XA 4HMDA 4N8VG 4FQ1L 2Q76A 4YHIB 3IGAA 4OKVA 2BSSB 3FB7B 35C8L 4MS8C 1SY6A 4Y2DA 3CVIL 3D1MC 1DL7L 2ARJQ 4UILH 5EZIH 4KAQL 4I48A 5EPMB 2OJEB 3HNVL 4ODTL 4LL9A 4PGZA 2DAVA 2R29L 4LVHC 3LS4H 1BD2D 3NACL 3DHJA 3O8XB 4RFEB 4X9FA 1FFNA 3RPKA 5J0BA 1JZ6A 3BGFB 4AEFA 3I02B 4U1HA 2APVA 4NHUB 4YC2B 4QXGH 3TCLA 1KEGL 4JHWL 5DRXB 2AEQH 3PQYE 2I5YL 4N0FA 5IMOA 5C0JB 3GMMB 2FHFA 3VW3L 3HR5B 2UWEB 3ZYOA 1KULA 4LOUD 1H3PH 3CSYB 4FZEH 1BQUA 4FMKA 4L4TE 2A77L 1TENA 2Y7QB 3WUZA 4JPIA 4L4TB 4NQUA 4FQIL 5ESVB 2CKBA 5FHAH 1BM3H 1E6JH 2EC9T 4G9FB 4XB7A 5GQBA 1V5JA 1R5WA 2Q1EA 4HDIB 4GUPB 2G5BA 1T5WB 4G8IB 4C54A 4P2RD 4WWID 2I24N 4OZGB 5C0IA 1A5FL 3WFCL 5F89A 4NQDE 5T3XH 4N0YL 3UTZA 4JVUA 3RI5K 2E9BA 4BFIA 4Z8FL 3CZFA 2XA8H 2V7HB 2IMMA 3JWDC 2ATPA 4X8JA 3BGAA 2DKMA 5CBEB 5TH2A 3SE3A 1LO2L 1A2YA 3PGFH 3BZFB 4P4KD 4PJDB 2VRAA 3B5TA 3EHBD 1C08B 3BDYL 1NCBH 4L3CB 3DV6B 3TT3L 5JW3H 1VFAA 4ZS6C 3SY0B 3DMMD 1SJEB 3RNQB 4X7SH 3SDXF 5T5FL 3VFPA 2FJHB 3JWDH 2DQJH 3N1FC 2AJSH 4BFIB 3G6DL 4NRYB 3OXRA 4RDQF 4Y19D 5KVGH 1PZ5B 1FH5L 1NAMB 1REIA 2NY6D 3T3MF 1E6OH 3EO0A 3VXME 4FQHB 3NABL 5E00B 1BAFL 1T2XA 4OLEA 4WI8A 4CVUA 3G5YB 1XGPB 1YMMB 1CDIA 4OZ4B 3C2AH 4KRMB 4Q6IA 1K6QL 4X0KB 5IB3A 5KJRL 1A6VH 1NKRA 2BJML 4D3CL 4JPVL 4LP5A 3RWFB 5M7QA 4LSDA 1I7TB 1RUAH 1ZTXH 4KRPB 1LO5A 5CWSB 1A22B 3D39A 3E3QC 1JGDB 1T80A 2P46B 4C83B 3WL9A 1OB1A 1FHGA 1CDJA 2YRLA 4HUXB 5C0GA 4FQIH 2EIEA 1WISA 2O5YL 4QRQB 5GHWH 2CQVA 3G6JF 3G9AB 4YIQB 5L9DH 3D2UD 5IG7B 1P7QB 1H3PL 3DVNB 5CP7A 3HCVB 4OTXL 3ZDYE 4W4OA 3BXNB 4ZS6D 4MNQB 4P3CL 1JP5A 1U8JB 3T1FB 4AM0B 5KTEL 1DDHB 4XHQA 4RBPH 5DK0A 2AEQL 1G7MB 5CSGA 3ULSB 1KV3A 4KKBC 5HHVH 2OZ4A 4MQ7B 4GBXB 2H6PB 5E6IA 4UIMA 2AERT 4QHKI 5I9QB 2F5BH 1DUYB 2HKFL 4HLZG 4LAQL 2CJUH 3WKNA 2LAGB 2ADFH 1NCUA 5BQ7A 4JFFB 3G04A 4TSBH 5D7JB 2EDLA 1RJZB 4X9IA 1UWXH 4OAWB 2JJSC 4QRSB 4Z7VB 4APQD 2PW1B 2DWEA 3MMEA 3LKSA 4LNVA 3C8HA 3VFTA 3LKPA 3WNMA 1JYXA 15C8L 3ILQD 2FJGB 3V5DB 4DTGL 1ZK9A 3UPRB 4U2ZA 1X9QA 1I7TA 2NQCA 4TYUA 3SE4C 3QFJA 4F8QA 2YN3A 3GSOA 5ID1B 2AKRB 3R06B 2ICWB 4PJ5B 1TJGL 1HILB 3F7RA 1QFWH 5D7JA 5KS9A 4QHLA 3MRGB 1CGTA 4Z18A 3SDYH 2V5SA 5CINH 1HWHB 3MXWL 4WJ5A 4PRDB 1SEQL 1L6XA 3RGVA 5DJCB 2WBWB 3FONA 5HHPA 2ICWJ 4LPYA 2Q7NA 3RHWK 3PL6B 1WFNA 3BAEH 1IC4L 4GH7B 2BVUA 3KAAA 3ARDC 5IEHB 1YY8B 1R5IA 4FQCL 1JF1A 5KSBB 1IFHL 3VD4A 2A83B 1LEKB 5K9QI 4M9OA 4R97B 3VRLE 1N6QL 2Z31B 4GBXA 1U0QA 1TCMA 4YHNB 3O9WB 2JCCB 3KJ4C 5F1IA 3VFUA 2V2TB 1P84K 5EU5A 3SO3C 2F53E 3S37L 5DJZB 1DP0A 3O8XC 5E2TH 4C58B 4JY4B 4M3JA 1CCZA 2AEWA 5HDLA 4L4VE 3P30H 3B2UD 2BSRA 3FHQA 1U8IB 4QHKJ 1EBPA 3HI6H 4WI9A 1U8NB 5AZEL 1BIIB 4XNZB 1BECA 1K8DA 4NZUL 4FRWA 4PB0H 3WUWG 4OIIH 4V1DA 3P3YA 3GUTA 3CLFL 4LLVB 4NUJA 2BXYA 1QSEB 3CX2A 4YHNA 4QO1A 2R0ZH 1F90L 1QRND 5HGAB 3RNQA 1N0XH 2CKBB 4RGOH 5DGRA 2FNBA 4ISVB 4JFDE 1BWWA 3JV0A 4ZTPL 2GSGA 5HJ3B 1PEWA 3X12B 4PG9A 5EOCL 1KCVH 3EJZD 4MWFA 3EO0B 5F96H 4MJ6A 1SMOA 1PX3A 5D7SL 2Z8VC 1A7PL 2H2SD 4JFDA 1ZT4A 2FZ3B 4QCIB 3GKZA 1GL4B 4LCUB 4QRRD 1I8MB 1NAML 4ZUWB 1FSKC 3RPIA 1T0NA 3HI5H 4OLUH 2I9LB 1JPTH 5DD1H 5DMIH 2FR4B 3IDYB 3IDIB 4G7VH 4LVOC 1H8NA 3REWB 5I17B 3U48A 5E8OA 5F88A 5I8OH 4H88L 5AZ2H 4OD1L 2R9HC 5EA0H 5EU5B 3OPZH 1RULL 4G80B 3G5ZA 3HZVB 3PJSA 1IC5L 1MY5A 4F7CB 5DUBB 5KSBE 4U33A 2ZJSH 3HMXH 1K4DB 3TIDA 3DETC 2UZXB 1BIIA 5E2UH 1I1YB 3D2UB 3V7AG 3FFDA 1CXHA 3MTRA 5FGBA 3B9DA 2M26A 4LLVA 3S36L 2CO7B 4N8PA 3V9FA 2RCSL 2OTWB 1KPUB 2HVJB 2ADJB 1S7TB 1JZ3A 4G3YL 1LO0L 4ESKA 3ZKMD 3MLYH 1W72L 3F58L 1XR8B 3EYSH 3QXUA 3T4AA 4J1UA 3ULUH 4YHMH 1PEZA 4G9FA 2DF3A 4FFZH 4NRXA 1PAMA 5CZKA 4HBCL 1ZWIB 1IC7H 2ZUVA 2BX5A 3S9DB 4O4YL 2XRAL 4LARH 1K4CB 1PX4A 1RJZA 1MJJB 4RMRA 4F7MB 4Z7UF 4XC3L 1CFNB 3H8NA 3MRNB 3MOAH 4WU5A 4LSRL 3KPPB 4P48A 2H3NA 1NBQA 2VDQH 4PY7A 4PJAA 3BQUB 5DQJA 4KRPC 4O51A 3KPLA 3KPRD 1DCLA 1NLDH 4HJGB 4M43H 3AMLA 5D5MF 3A6CH 4EBQL 5F8QC 2AJ3B 3LKRB 4LSUL 2PCPA 3L7EB 1A6UL 3FN9A 4DAGH 4O9HH 5I8EB 2FHBA 1S78C 4BSVB 4GMTL 2B1HH 2Z92B 3DO7A 1ND0A 3MRDA 2OMNA 2IBGA 4NNYB 4ORZC 5DO2D 1YN6B 3JWOC 1FFNB 3KJ4B 5I15L 2EH8H 3PHOB 4YAQA 2VN7A 4L8BB 4G5ZH 4RFEA 2P5WD 3RAJL 4Y1AE 2W0PA 2F74B 4Q0XL 3PABB 4U6HB 1ODAA 1CVRA 4EUPG 5KS9F 1CR9L 3MSPA 3QXDB 1ETZA 5CJBA 3FO1A 3H0TA 3VG0H 4ELME 2CK2A 1NMCB 4HQQL 3T2NH 1CI5A 2E7LA 2V17L 1MFDH 5JXEC 2BMKA 3K4DA 5CIPH 4FNLH 3MGAA 5EU6A 4KTEH 5IBUB 5D5MB 4OCNC 1OTTD 4H8WL 1WJ3A 2AEPL 1AQKL 1ZWIA 3SE8L 1I1CA 4I18A 4ZFZB 2ZUQC 4XCCH 1M05B 5H8DA 2DQFB 4XNMB 1BF2A 4CN4A 1L7TH 1M7XA 3BKYH 5EFIB 4R96B 3ZKXC 1P7HL 3GSNB 1JPSH 3BX7C 1H8OA 3ARBD 5JXEA 1QA9A 2G5RA 2Q3ZA 3HE7D 1WIPA 2IPTL 1VKXA 4K3DH 4KHTH 4DGYL 4HK3J 3AREB 3ISWA 5FCUH 2IADA 1NGZA 4G9DB 1DZBA 5BVJA 4MXVE 5IVXB 1UACL 3JTSA 2UV3A 1FSKB 1CFVL 2VR5A 4FFWD 4YR6A 2JJTC 2WBJD 4NO5A 2FD6L 2Q87A 5I16B 1RVFL 2XXCB 4HHAB 4DGIL 4NNYA 3LRSB 4JJ5B 5T3XE 1DLHA 3QEHB 3B9AA 4LKCB 4PLKC 1A2YB 1GGBH 4KKAD 4X9GA 3P4MA 4MQ7A 3C6SB 4OCXH 3ZHLA 1RMFH 2HKHL 2K9UA 4X8JB 1AD9B 3MBXH 3DSFL 4NRZB 2OX5A 3DV6A 2D03L 4WHYH 3Q6FB 3WJLC 2D03H 4MAYC 5DUPH 2X4TA 3AVEA 2WQRA 4LSQL 4K8RH 3PWPE 4I77L 5MEOB 4JZOB 5AWNH 4LP4A 1N4XH 1IGJA 2NXYC 2VDML 4UQ2B 5D71H 3S3SA 3UYRH 4JN1L 5LGJB 5I1HH 5FDWB 3FKUS 1RFDL 5E9DE 4B41A 1N59A 4R0LB 4Y4FD 1EX0A 1KELH 1E4KC 4LCCA 4PPTA 3SHSA 1O7SA 5L8LB 1A1NA 5HTSA 1YJDL 1JRHL 1IGIH 3QWOA 1D5MA 1JWUA 2VXVH 1CLCA 2BRQA 1G1YA 3O4LB 3H2WA 2WM0A 3BKYL 3S88L 3MA9H 4ZO8A 1LEGB 3BGMA 5IJKA 4U1NA 4U1IA 2ADJA 5I18H 4U7MA 5JPNA 5HGGS 1EAJA 1OP3H 1E4KA 5FAAA 3RU8H 5IEHA 5IW1A 1FYTA 4L8SC 3OG4B 2VZTA 5E8DL 5K9OA 5FOBA 4G8FA 3TBSB 2MNUA 3ARFD 2MWCA 2V17H 4YXLH 2HTLD 3MV7B 1MHCA 1JPGA 4PGCA 4QOKE 5CKAA 1LO4H 3QCUH 2WV3A 4NP4H 4XVUC 2DQUH 2G60L 4PJ7A 3S35L 1F3JA 2GTWA 4U0RB 5FYKE 5FA4B 4Z7WB 2KL6A 3JBG7 4D0DA 3KPSA 3NCFB 5JHLL 2V9RA 1QRNB 3ULUF 2DTMH 4WFHE 3DARA 3GBML 4YXLL 1ZEAH 2VDLH 4XP5L 5ITFA 3QEGL 2EE2A 3VFMA 1DUZA 3NBNA 3BFOA 3KVQA 4F2MA 5DTFA 5HJ3A 5GRVK 3VH8A 1IAKB 3GSRB 3DIFB 1BJMA 1EEQA 4I8DA 3MLXL 1AI1H 1MH5A 2ZUQB 1KJMA 4MJ6B 4YDJB 3VFNA 5B38A 3H3PL 3UPRA 6FABH 4UQ3B 1W0WB 3WFDH 2YD5A 2NX5D 5EO0B 2XRAH 4AG4H 5J1TC 3UO1H 4PJGB 5F6IB 2A9MH 5SX5H 1FP5A 1KN2L 1A02N 4L5FL 4M62H 4WGVB 5DD0L 4LIQL 5F9WB 2NZIA 4KK8D 5A16A 1IMHC 1CDUA 4PLJC 2QSTA 5ICYB 1T0PB 5C7XH 5C0RH 3P4OB 2GIYA 2J8UF 3MBEC 4XNQA 5A2JH 1IGCH 4ZMAT 4B5EA 1X5GA 4KDTA 4FQ2H 4OGXL 1QVOB 5HHMD 2PTTB 4JB9L 4R2GB 1ZT7A 5SX5K 4K8RC 4U6XB 4PGEB 4XNZC 2YUXA 3PXJA 4NWUH 4JFZL 3VXOA 1TXKA 1G6RH 1EEUA 1EFQA 3UYPA 4YBHA 3SGDH 3T0EB 1MWAB 5KSVB 3UTPD 1NCCH 1OSPL 1M71A 2XNAB 1FZMA 2X4QB 4FQ2L 4OF3A 3UTTB 4IRZL 4AENB 4O02L 3LEXB 4NO0D 5JIKA 1RK0B 4I5BB 1ZLUK 1NAMA 4QRTA 2C1PA 1BMGA 3WJJA 5JUEL 4TVPL 4AT6B 1CDYA 4XBEL 5DD0H 3BN9C 4OF7A 4U1KA 3B9KC 3T2OA 3B5GA 4HMEA 5B4MC 1A7BA 2YUWA 4TNWF 1TNNA 3UTSB 2NY7H 1HSBA 4WNQB 2V7NB 1VPOL 2COQA 4XMPH 3BKJH 1MPAH 1DBJH 2LAAA 3LKRA 1SJVA 4GRWE 1NCAL 5GJSL 5ESVA 4Y1AA 3A67L 5C0GB 3K74B 1RUQL 3C5ZB 4KQ3H 4OF0A 3KWWB 3QHZL 3LS5L 3QZWG 5I8CB 1CGVA 5IMKA 1YDPB 1OP3K 4LLDA 4NO3B 5DQ9B 2R0KL 3HI6L 4NSKB 1FVCA 1LDSA 4FXKB 3HCVA 2HT4D 1MIML 1KFAH 1YPZB 2D3VA 2BDNH 3DO3A 2X1WL 4HIXL 1DDHA 2ICCA 3WS3A 4HKZA 4D0BB 4E9LA 3BWAA 5I1IH 4ZO9A 43CAB 1F6LL 1YEGL 3GI9H 3L9RA 3SOBL 1IFHH 1PZ5A 3D2UA 3TJHD 1G9MH 1I9RL 2RBLA 1CIUA 3GSRA 3ZDXF 1OHQA 1AGDA 1FZJA 1OF2A 3JVGC 4KK6C 3QIBB 1BIHA 1C5BH 2GFBA 3ARED 2PYED 3IU4H 1E0OB 4LVNC 4PJXA 4GT7A 1FL3B 1Q9LA 4GAFB 1L0YA 1XFPA 2LU4A 3DHMA 5F8RC 4H1LA 2HT3C 4DCQA 3MRRA 5F6IC 1YYML 2E6JA 5I74C 5EZLA 1T89A 5F9WC 2KZWA 3MLSL 3EOBB 1PJ9A 1T7WA 5E2WL 1MCPL 2RB8A 3JSSA 2OTPA 3MLVL 1KENL 4K3HA 1EFXB 3VXRB 2W0KA 3SDCD 4UIKL 3SGDI 1XH3A 1GPOL 3QG6A 4LCWD 2PR4L 5EWIL 1G9ML 5EZJA 3CCHB 1DQLH 1DLFH 2J8UE 4L3EE 4TUKH 4PJIB 5I1DA 1F4YH 2L7JA 4XNQB 1S78D 4F3FB 4X7FC 1N59B 4PJBF 3BZFA 5JQ6H 2DQGH 3WEXA 1C1EL 5KOVC 2YEZA 3TLRA 4V1DB 5DS8A 3KYKH 3BIKB 1UB6A 2O5YH 3GDBA 1C5DB 2BP3A 2ZG2A 5K59F 1NPUA 1CE6A 3F7YA 2G5BB 5E1AB 5HYSA 5F96L 4PJIA 3X3GL 4IDJL 2X5PA 1SY6L 2OQJB 3MROA 2EDKA 5EZLB 4MZ3A 1Q94B 2DTSA 5DK2B 3TFKC 4LCWA 4U0RC 3FB7A 2R0WL 1GAFL 4LKXB 3MLZH 3V0VB 4ZD3H 2FYYB 5IMLB 3QXWA 2H26B 5FKAB 1VGKA 2VDPL 4YFLF 5KS9E 4Z7QE 3NCJL 4PUBH 1XMWA 3BH8B 4Y7MA 4ONHB 3BKCL 3WN5B 4X9HA 2W59A 1WBXB 2DKUA 4FTVB 4Q6YA 3QCVL 1KLUB 4XVTH 1F4HA 3EYQD 3QDGB 2IF7A 3S5LG 2VLKE 1A9BB 1NSNH 3HMWL 1FL5A 5B38G 1P6FA 1ZHNA 1NCBL 1A8JH 3V5HA 4NKDA 3ETBF 4NQVA 1OSPH 3O3BB 1N4XL 2VLRA 3V5KA 1A21A 5HI3D 2UYLA 1FZJB 4RFNB 1XGTB 4M43L 3JV6A 3LN5A 5IBTL 2NX5B 1A7NH 3D25B 5C09A 2NW3B 4KVCL 2Y6SC 4FQLH 5MENE 3OKEA 4UIKH 5JW5B 4L8SB 2B8OT 4KUCD 3MA9L 4HWNA 2IBZY 2IFFL 3C60B 4UDTA 4DGIH 1EEYB 4PJAE 3ZE1F 3IS0X 2QV2A 2AXFB 2J5LB 4Y2OA 4MLSA 3ZHKA 5C7XL 4HC1H 3V5KB 4AIOA 3B9KB 4P9HL 3CZFB 4LMQI 4LFHG 5SX4I 1YEEL 3TESA 4CADA 3MRQA 4U49A 3BQUA 5GRWA 5KVEL 2YOCA 3QQNA 4DOHE 1G7JB 5L2KA 1QKZH 5DMJB 4Z76B 1T2QH 5B22A 2IPUG 2VDMH 3GSUB 1KLUA 5IW6B 3ZL4L 5IM7B 2DL2A 3FOLA 1MFBL 5I0ZA 1BJ1J 4XCCL 4IRSD 5ESAB 3H3BC 1I1AA 1BD2B 3O8XD 1B0GA 3P4MB 5MI0B 1H3UA 1OAXH 5D1QC 2CLRB 2FDBP 3MRMA 3LKNB 3NIDE 3MRPA 4GAGH 3LZFH 4AQ1B 2VLRB 4GRLD 3CFJA 3D3VA 4OZIF 5CGTA 3OAUH 5JIPA 1SM3L 4LGPB 2BY2A 2MCG1 5IGXH 1FZKA 2PW2B 1MCEA 3HC0A 1TZIB 2A74A 1YEFH 3FFCB 5F7HA 3U4AA 1IE5A 4Z0XB 5J11C 1CGXA 3VDAA 3ZE0F 2X4NA 2OZ4L 3X13A 2DMKA 1E28A 1TQBB 3QI9B 3WNPA 3QEUA 1D5ZB 1TCRA 2WUCH 5IROC 5EB9A 4F37F 3MNZA 3VA2C 3O3EB 1EJ6A 1QBMH 3OKYA 4RRPG 3WD5L 5EN2A 2H32A 5EULV 1TDQA 4B0MM 4I18B 3QUXD 4PD4J 1MCFA 2Z8WC 5GGSY 5GGTH 5CEXA 1QFWM 5GJTL 4NKOB 5IB1A 5FKAA 1T1ZB 4Q97A 1LEIB 4KPHH 4WUKH 1INDL 1I8LA 4JM4H 2Y9RT 2VDQL 3RKDC 2W65B 5J1SC 3T0AA 3NPZB 3TJEL 1HI6A 2Z91B 1QFPA 1UWEH 3QRGL 3PWLB 4JKMA 4FTVA 3V0AC 4JHAH 3M17A 1FDLH 3WIHL 5DFVD 2AJSL 1YUHB 1L9MA 3FT3A 2ZCKH 3MJGX 2BVOA 1MCHA 2FZ3A 4F7TB 2ICWI 3T3PF 4CU6A 1DFBH 2YKLH 1P5UA 4JHZA 4NWTL 5D9SA 1F8TL 5IJVA 2HH0L 1LNUB 3ULVD 3QNXA 2JCCF 4ONHA 4YX2H 1S9VA 1J8HE 3FN3A 2OI9C 4Z7OE 5GS0C 1HHGB 3FZUD 4IMKC 4MNHA 5HHNA 4PY8J 4P2QE 2UVFA 2XPGB 4MDJA 1X5XA 1EVTC 3L3DB 1JZ2A 2UWEA 2AJUL 1Q1JH 2DICA 2F53A 4EKXA 4LCCB 1WZ1H 3QO0B 3ILPB 4ERSL 2PTVA 1GGCH 5FB8B 3CUPA 2WSKA 3DUSB 1B3JA 4UBDD 1E6JL 4WCYH 4KK9C 1QSED 3NZHH 3QB7C 4M1GL 2VERN 3C09B 2DRUA 3WHXB 3TEUA 5DK3A 4HIIA 1V8HA 1A1MA 3VA6A 4X4XA 1OGAD 4WWKC 1U3ZA 2JK5B 1GH7A 3RVVD 3FHAA 4Y4FC 3D0LA 1H15B 1YNTA 3O4LE 3O3DA 4RGMB 1L7TL 3H9YA 2I5YH 1GC1C 3PGDB 3MRGA 1UXWA 5I16A 2X9XA 1VESA 4XPHH 3HMXL 3KWWA 5EUKA 4URTB 2R0ZL 3BIAX 2FJFB 4X7TB 1GCFA 4MCZA 4CJ1A 1JL8A 5E9DB 4ZPTA 1ZEAL 1T6WA 5I8OL 3WNKA 1FV1B 4P3CH 4KKAC 1XCQB 4H26B 2E7CA 2VDOH 2ZPKL 4G7VL 5TGBB 4LVNB 4S0SD 2I27N 2YR3A 5SWSA 2PKDA 1ND0B 2H45A 1B6DA 3S35H 2A0LC 5HYJD 1N7MH 4ZODA 1RU9H 1QBAA 4PJFB 5J11B 4NT6B 4GMTH 4JRXE 2GTZA 2Z31C 3E8UH 4S11A 3CJJA 2YPKA 4JQVA 1A7OL 4FFWC 1CLZL 5GJSH 3RL2A 3FO2B 1S3KL 4NQDB 2ILLA 3VI4E 1NGPL 3P4NB 5KJRH 1JZ8A 3P11L 3LB6C 1MCBA 4L8CA 1T04A 4ONFH 3ARDA 2PTUA 3EFDH 3C8DA 5KANG 5KZCB 1FN4A 4P3DA 3VWKA 3TN0A 1X3DA 1W72B 1D5ZA 1TCRB 3T1FA 4AM0A 4BSVA 1IQWL 1DE4A 2MFNA 2WIIB 3OL2A 4H20H 4XPGL 5C0BB 5C8JA 1M7DA 2EYTB 1KTLB 3DVIA 2CLVA 4H5SB 4TTDD 4CVXB 1E27B 1T0MB 5L0QB 3GHBL 3SPVA 3P30L 3RL2B 2AK4A 1WK0A 3NGBC 5KVGL 3WO4C 2D31A 4ETYA 1VKXB 4ONGH 3QUYC 4OCLC 2XQYK 5C1MB 2NLJB 4Y19E 5F7YC 1K2DA 2A6KA 3H0TB 4H26A 3V5HB 1HDMA 2FBOJ 4AEIL 4DVBA 4OCWL 2CUHA 1IKNC 4JJHA 1PG7H 1VA9A 2XNAA 3IXAB 4K8RL 4LEXL 5HVWA 5DD5H 4MQTB 3T65A 1RHHB 1OT2A 4MA8H 1S9WB 1WITA 1G7PA 1YQVL 2BY1A 2E9JA 1AR1D 3GMLB 2LE9A 3OX8A 1IC5H 3QFJE 4OZ4A 4MHHI 5EUOA 4XH2A 1G7HB 2WP3O 5F7DA 3VH8B 4OGXH 4AT6A 2XZCL 4GAJH 3MC0A 5IMMA 1GIGH 4QCIA 1LDPL 1W2KT 3H9SA 4KROB 5J6GB 4X7CC 2R2BA 4ODWB 3W0WA 1JV5A 1ZGLM 5DK2A 3ULVE 1EMTH 4JO1H 4RMQA 5T1LB 2HG5A 1I1FA 2OQJA 2FLBT 3K4ZA 3V4VH 4JFQB 3QQ9D 1JPSL 4NM4H 3F62A 2ZG1A 4CKVX 1PY9A 4JM2A 3QUMA 2JELH 1U3YA 4LLAA 1U8KA 3HE6C 3KPRA 4JHWH 3VE0B 2VXSL 4JPVH 1KJ2L 1PVHA 4MVBC 3X14A 3HNSH 5BS0E 5IB2B 2EXYD 3QHTC 3MREA 3KR3H 5MP6L 1UM4H 3CLEL 3ARVA 1W0VA 4XP5H 3TPUA 5C0CB 1HK6A 5CEZE 3BN3B 3E2HC 4LASL 5I30L 5DJZA 3D85D 3HR5A 3LKOB 3CVIH 4FQXC 3T4YB 3QWRD 4Y16A 5C0BE 2EZ0C 4MMZC 5D1XD 4YXHH 3TP4A 4LCIL 1HXMB 4OZHE 2BNQD 1G0DA 1YMMA 2UUDH 5EO9B 2R56H 1MREL 3D3VD 4F57L 4XZUB 2BCKA 3EGSA 3HAEA 3N9GL 3QWQB 4O58L 3ROOB 4D94A 1I9JH 2V2XB 3RWIA 5DZLA 3D87B 5E6YA 3T0EE 3T0BA 1JNHB 4PLJD 4XGZA 4RGNB 1PLGH 3IAQA 4OLZL 1U2HA 5MENB 4BZ2H 2APBA 4QHLB 1AJ7L 2FGZA 3QUKA 4APQA 1BX2B 4QLRA 5J9PA 3F5WA 3BQUD 1FG2A 1L4IA 3EGSB 3HAEB 1T0NB 2VXVL 1UC6A 1M7IB 5FYLD 4QRRA 4WWKB 4TN9A 3O2VL 1D6EA 3VGHA 1INEH 4P0DA 2BERA 3KLHC 4JPKL 2BSSA 1CDBA 4WW1A 2HJLB 4APQC 1KB9K 3BYTA 3NCBB 4HLZH 2C1OB 4UU9B 5KSAD 4FTVE 4EDWL 1TVHA 3NA9L 3NFNB 3IU3B 3MRPB 5JW4Q 1MHCB 4P2OD 2Q7YA 4PGCB 2O5XL 4PRAA 3GJEB 3PGFL 4WHTB 1AR1C 1EHXA 3ARFA 4Q9QL 1KPVB 5DUPL 1FFQA 3N85L 4EOWH 2CH8A 2ZJSL 4I18C 3ARDD 4ENED 4PG2A 1J0YA 3BE1L 4N0RA 3Q2CA 4ISVA 2YA1A 3M07A 3C5JB 5K9JL 1NFKA 3FN0H 1NDGA 4XCEB 3ZYIA 5JA8B 1YC7A 3SO3B 3UAJD 1UXSA 3UBXI 4K94H 2R4SH 1MHHB 5A2IH 3SCMA 3VGGA 3WDIA 1P4LB 3L7FB 3O3UN 3ARFC 3ZZ1A 4IRSB 2G75B 1LP9B 32C2A 3THMH 5FM8A 1KOAA 3HPLB 4WI5A 2B2XH 3HRZA 4LSTH 3EUUA 5D93C 4E41A 4R8WL 4GRLB 4C4KO 2XZCH 4GAJL 5JOFB 4JM2B 5HDBF 1ZLWH 2BNRB 1DBAH 4W6XB 4Z7UA 1QLEL 2DWDB 4OD3L 4OCMC 4J4PA 3SJVD 3HNTH 3DBXA 5A1AA 1ORSA 4JGJA 2FGWL 1QR4A 2OL3L 2AEPH 3W0WB 2A6IA 1FFPB 4XP4L 4PTTA 4J3VA 4LCYA 1KXTB 1J8HD 4Y4KA 3GSQA 1DBMH 2EEDA 2P5EA 1KPRB 5DJAA 1JNJA 4AENA 3DNKA 3AM8C 4I48B 3NAAH 4Z7UE 2NY6C 4Y1AB 3BZEA 2C26A 3IJSB 4KVNH 2R29H 1CR9H 1QFUH 2DJSA 4J3TA 2GSIB 2A0LD 3QDGA 4JPWL 1IAOA 5FXCH 4YHLH 3QUML 3UXFA 2YSSA 3LKPB 3BP5B 4IJ3B 4CL7A 4FQ1H 1IGYB 4XRCA 4DZBB 2DWEB 3MMEB 4F7EA 3FT4A 3HHRB 4JDZA 1MFAL 4R7DA 4S1QH 3RZCA 1UJ3C 3AM8A 3ET9F 3TT1L 2OSLB 4D0CB 4EBQH 32C2B 1D6VH 4YBLB 1KTDA 1VERA 5IOPB 2DQFA 3AU1A 1MJJA 4RGMC 4LLMA 1OVZA 4QRTB 1JFQL 3TO2A 1WEJH 5BVPH 5GISL 2FWOB 3QDJB 4R7NB 5ERWB 4B7LA 3R8BB 3IVKB 2IH3A 4HUUA 4TVPE 5D2LB 3UJTH 5D7LA 1KTLA 4PJCF 1YMME 2Z9TA 1ZT7B 4LCWE 1U58A 1TZGH 5KAQF 1MFAH 3QXAB 5KSAA 1R5VB 3X11A 1WBYA 1SJXA 4XMKL 2VLKB 2DL9A 4XBGA 2XA3A 1UQSA 4NJAL 2PCPB 2AS5M 2E5EA 3Q5YA 3OAYH 4LEOA 2FIRT 3K46A 4OZIB 3DO7B 3O41B 5ITFB 5CD5C 1ZHBA 3KLAA 1WIUA 1FFOB 4KK5C 4N1HB 5CZXD 4MD0B 4HK0A 5B8CB 1FV1A 1ZLVK 1KEGH 4LK4A 5D9SB 3EAKA 1UA6H 4JZOA 4PJDE 4YDLC 4RFOH 1Q8MA 3NTCL 3HNSL 4IOSD 2FX9H 1QSVA 5F7MC 3EOYG 3OAYK 1X7QA 2XOTA 3QIBC 4DOHB 2EYRB 3VJ6B 3EHBC 3SJVE 3MGTA 2BVYA 2QR0B 4Z5RB 3R0NA 3S5LA 1WTLA 1L0XA 4LSTL 4HCRH 4OQTA 1FGVL 1TTFA 3T8XA 5HYQA 3PDOA 3THML 2E9IA 3QULB 4DN3H 3SJVA 1LEGA 5D7SH 5E1HB 3OJ2C 3VD5A 2FB4L 2GCYA 3C2SA 1UEMA 4GQPH 1UH2A 1QLRB 3GK8L 4XVSH 3FN0L 4HKBB 4LOUC 4F9PA 2LQRA 1ZTXL 4PLNC 4HEPG 5D7IB 4H1LB 4HIHA 4E41D 2AJUH 4I9WD 2FEDD 2GTWB 1KIRA 1ADQH 1P6AB 3E6HA 2B0SH 3MNVB 3IDUA 5CMAA 5I17A 3NMEA 2HTKD 1U8PA 4NO0B 3VG9B 4OFVA 2ARWA 1Z9MA 4OIIL 5C0AB 2X4PB 2XZAL 5F1KC 2HH0H 4P57A 5GS0D 2MQCA 1OAYL 3G5XB 4JM2D 3NCMA 3DUUB 3VD7A 2RJMA 1T22A 5L2KD 2IPUK 5AUMB 3D3VB