1Z0MA

The glycogen-binding domain of the amp-activated protein kinase beta1 subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
87
structure length
87
Chain Sequence
ARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-AMP-activated protein kinase, beta-1 subunit
publication title Structural Basis for Glycogen Recognition by AMP-Activated Protein Kinase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Sugar binding protein
total genus 16
structure length 87
sequence length 87
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16561 AMPK1_CBM Glycogen recognition site of AMP-activated protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z0mA00
1R3IL 3X3GL 5SX4H 3N1FC 5JLZA 2NY7L 4HF5L 1QHOA 4WFEE 4ZFOL 2VMFA 1U3HB 4U1IA 4ZOCA 5K93A 1Z2KA 4X7FC 2DM7A 1RUPL 1RU9H 2QEJA 2SEBA 3MODL 3JV6A 3ZYZA 3EUUA 2D7QA 2W60B 3CH1B 5C8JA 3Q5YA 3EYSL 3BW9B 4UMGA 1N4XH 3PWJB 3ULVF 1T21A 4Y5VB 3UXFA 1S7UB 1UH2A 1BIIB 4CNIB 2EDLA 5B4MD 2GIYA 3KJ6L 4FNLL 1PX4A 2WK2A 4OD3H 4MA7L 1I4FA 3RNKB 3S3SA 5FUCE 3HUJF 5C09B 1ZGLM 5DD0L 1DDHB 1WBZA 1HQRB 1GGCL 1RJLB 4L3AA 4WJ5A 2I07A 1YY9D 3O3BB 1X5IA 2QQQA 5HHNA 3EYVB 3UC0L 3ARBB 4HEPG 1HIMH 3T0EA 3UPAA 2F53E 4KDTA 4KKLC 4F58L 3VJ6B 1VEOA 2XI9A 4S10A 4Z7VB 4DGVH 4POUB 4K3EL 2CLZB 2YKLH 4UINH 1IFHH 4P4KC 3FJTA 2B2XL 1OF2B 1OWWA 5IJKC 3QEUA 5DMGD 1INEL 3MLZL 4WVRA 1GL4B 2I25N 4NCC2 4PPTA 4XNUL 2EE2A 3HZVA 4N0FB 5HI4C 4KVNL 2R0WH 3VD9A 1EAPA 4ZUTB 1JGVH 2X9WA 3OXRB 5HHOD 2ADJB 3T4YA 5DGQA 5E94A 4QHLB 2HTLD 1CG9B 3ULSA 1FSKC 5KVFL 3QUYA 1OARH 3KPQB 1G7MA 5EBLB 1D5ZB 5F7HA 4PP1D 2QHLA 3L3KA 4HXBL 4JRXA 4DK6A 4HT1L 1Q1JH 2HFFA 4WFGD 4F7EA 4XBEL 2FX7H 1K85A 2DLEA 1RK1B 3UCRA 2X1OA 4UT7H 1LD9A 1Z0NA 3QNXA 5C92A 1AXTL 4HFWB 2BXYA 5B3JF 2Z4QA 1HKLL 2YD7A 3I3DA 1GPOH 2OL3H 1T04B 1KF9B 5FKPB 4Z95L 3M17B 2IBGA 3G08A 1A7QH 3PHQA 1NKRA 3LQZB 4KQ4L 4R7NB 5T3XH 2J8UF 4R4BA 1K4DB 4LEXL 3LHPL 4KK5D 4LP5A 4E0RA 4WUUD 2Z35A 3OKNB 5JW4Q 2VUYA 5F1KC 4XCCL 4YHYB 3QA3A 1AHWA 2GJ6D 4D9LH 1VA9A 1T2JA 2EIZA 1Q72H 3STZA 4U31A 2VLMD 4LAQH 1AKJD 1R0AH 2G9HB 3HZKA 3LKPA 3GMPB 5EN2A 3VXSE 1BD2D 4NHUA 3GSQA 4XC1H 4HPYH 5J12B 3V5HB 1PJ9A 4DW2H 1FFNA 1YEKL 3QI9B 4L3CB 2VITA 3U83A 2FIKA 3T0AA 1A4KA 3HG1D 3GSUA 3UTTE 1FBIL 4OLZL 2UUDK 4JKWA 4HS6B 1R3LB 2YMXL 2VDLL 3U6RA 1J1OL 4ZDHA 1I3VA 3TC9A 1FVEA 2OZ4A 1CZ8L 1YQVL 4GG6F 4M6NH 5C08A 1BGXL 4WIQA 4AQ1B 3LRGA 3DV6A 3FOMB 3HAEA 3GHBH 3TA3B 1YQ2A 2FYYB 4K3DH 2E7LA 5DEGB 5B38A 4HKXB 1A9BA 1IC7H 1MWAB 5AZEL 2FHFA 1QQDA 1TJIH 2G5BA 1N2RA 2VLKB 4CADB 1II4E 2MWCA 5GSVA 3DHMA 1QSFD 3I02B 3D2UD 3L5WA 4FQJL 1I8LC 2ICES 1T1WA 4LSPL 1I7ZA 5IBLD 5IB5B 1MIEH 3O6FC 3QIUA 3RKDD 1BHGA 2EDOA 3IKKA 4N5ED 2VDPH 5HDBE 3AREC 3BPLC 4Y8AA 5DK3A 3MBEB 3IJSA 3V0VA 4GBXD 1UWEH 2Z8SA 3BIBX 3F7YA 3EOAB 2FO4A 3H9SD 3LAFA 4HMEA 5H35A 2BJML 3TO4C 1W0WA 3OKEB 1QNZL 4XCFL 5ELIA 3H42H 4JKPL 3DVGB 2OP4L 1OGTA 3RUGB 5D7IE 1K4CA 1NSNL 4MAUL 3FFDB 4MX7B 2X2YA 2AXHA 4EJ1C 3LDBC 3DXAE 2PO6A 4PJXB 1A3LL 4N90D 2IG2H 3BKMH 5INDB 5MERA 1D6VH 4PJ5D 4JB9H 3ES6A 4NQEB 5D7LE 5I1KH 2CRIA 1RPQA 4R26L 3PV7A 3HZYA 3WIFA 1A7OH 2QSCL 5EG6C 4D8PA 3HCVA 3MTRA 3PWLB 2C3GA 2K1MA 3JTTB 5DA0B 3NCMA 3NH7L 1FNEA 1NAML 3O6ML 2VWEE 2A1WH 2P8PB 2HKHH 4BQ9A 3BDBA 4PJBA 5I71C 4OJFL 4O58L 1KXQE 4WFFD 3E2HB 2QADC 4QNPF 4TVPE 1FPTH 4KV5E 4POZD 1UVQA 3MNVB 2FWOA 5EC2A 1CK0H 2DD8H 2EEAA 2YA0A 1Y0LB 3VXRD 2BY0A 3OB0H 4PJEA 4KVCL 2FBJL 1A6UL 5F7LB 2IAMC 1QFWM 5CJ8A 3S5LB 1ZK9A 5AUMB 3L3HB 3UBXG 5HPMB 1CBVH 2Z8WC 2BY3A 4MCYB 4C56E 5KS9B 1A3RH 2D2OA 1IGFL 3B9KA 3CDFA 2W0FB 4WTZA 3R0NA 2A74A 3D39D 3QZWA 3K4AA 3L7EA 1NGQL 2XZQH 4RGNE 3EFFA 5HY9B 1Q0XL 3FO2B 2H3NA 3SDDB 1FGVH 2C3VA 5L2JB 1EK3A 3AS2A 4LCWD 5DFVC 5CFHA 2GY7B 4PGEB 3U4EB 4AIOA 5E24E 1BF2A 5LGHL 3LKOB 4R0LA 4UILH 2R1WB 3I6GA 1O0VA 2DTML 7CGTA 4XNZC 2EYRB 5DWUL 2ADFL 4FQXA 3X13B 4OLVL 4PY8I 4NRZB 3M45A 1ZA3B 1AGCB 1SYVB 3MXWH 5DSCA 3TBVB 4WV1A 2PYFA 3OKDA 4JM2D 1Z3GH 2UUDH 3X14A 1JNHB 1JYWA 4LDEB 5BVPH 3BIAX 2LABA 1I9IL 4JGMA 4XPHL 5KSBE 5FKAA 3W2DL 5KSAA 4YK4C 2ZWLT 3SJVA 3G9AB 1MJJB 1IEHA 2C3WA 4Y1AA 3ROLA 2Z92A 1TCMA 5HHQA 1AE6L 2VDML 4M7JH 3KPSE 4XCEA 4Q97A 4DEPC 2NY5L 1G7JA 3T0DA 2PTTA 5JLZB 4PJXF 3GMQA 5IVXB 3H6JA 4O51A 1YYMH 3PGCA 4U1IB 3FHAA 1WK0A 1QO3A 3VWKB 1INQA 3MUGB 4OZFA 2I60L 1IT9L 4PJHE 5C8JB 1HXMB 1JHKL 3C2AL 2CIIB 2XTJD 2EDHA 4HG4J 3HI1A 4IMLB 1D5MA 1T21B 5JIHA 4ONHB 4KI5D 3VXNA 3R06A 2DLFH 4NO5B 2BFVH 4DTGL 1UCBL 4JREC 3I6KB 1N0LA 4H25A 5GS0H 1WBZB 5FF6B 1N6VA 3SDCA 2ZCKL 3EO0A 1U0QA 3L6FA 5HHNB 4DN3H 4DWHA 3T0EB 5L88H 3NBNA 2YRLA 4JRYB 5SX5K 5CBEB 5EO0B 4A6YA 4PBXA 2FECL 1EHLH 2FJFA 1GGYA 1IKNC 2BP3A 3JXAA 3GKWH 3MRJA 5KS9F 4O02L 3QEUB 2AK4A 1MJUH 3FT3A 4ZQKB 2VO5A 4OM0H 5H94A 3Q0HA 1F3DH 3HZVB 3W11C 5EOCH 4XNMB 4ENED 1KB5A 4RFEB 1EAPB 3WIIH 3CFIC 5L9DH 1RHHB 3U4BH 4QGTA 1D5BA 3T4YB 5F1NA 4TSCH 1EMTL 5CD3A 5BQ7A 3ULSB 3ULVC 5LG1A 2GJJA 3QUYB 4BQ6A 3QYCA 1G7MB 1EERB 1N59A 3P4OB 4JRXB 3P0YH 3SBWA 2HFFB 3HI6H 3EYUH 4F7EB 4Y8DC 2VXUL 1XIWA 4GAFB 4N0YH 4WENB 1Q9WA 2J5LC 1LD9B 5I1IL 3QNXB 4OCYH 5BZWB 1UH4A 5DC9B 4UB0H 1ZXQA 3QI9D 4DKFH 3IDIA 1R3HA 2HFEA 2YUZA 4N8VG 1IJ9A 5CIPH 4HIEA 5SWZE 3QAZB 5F44A 2EKSB 5INCB 3G08B 8FABB 4GKSA 1FIGH 1EFXA 4R4BB 4UT6H 4E0RB 1VADA 1KIUA 3BGMA 3EZ8A 1I1AA 3CXDH 3QA3B 3V7AE 3WIHL 1RUKH 5M94B 5DMKA 2EIZB 1CGSL 3VD4A 5DD3H 3RIFF 1OD7A 2BCKA 3IS1X 1G0YR 3SOBL 1YA5A 4Z7NF 2JJTC 5EN2B 2IPUK 1DL7H 1MI5E 2PTUA 4NHUB 2OK0L 5D6CB 2XOTA 5J0BA 1U8LA 1QFUH 1WF5A 4ODUA 1FFNB 4GFTB 5DLML 1FDLL 3X3FL 4YAQA 5JUEH 1DBAH 3RHWF 1CS6A 3MBED 3QUZC 4TUOA 2FIKB 3TPUA 4DGIH 1N6QL 3WNNA 3P77B 5KVEH 5I1LB 3U6RB 1GIGH 3AUVA 4ZDHB 1HINH 4WW2B 1FVEB 1UT9A 4Y5YA 5SV3A 3MGOB 1ES0A 1UKQA 2XZCH 3KXFE 4CVWA 1UJTA 3J7HA 5B21A 1UCTA 3HB3C 1U8IB 1K8DB 3HLAA 2IPKA 1AKJA 1A9BB 1CR9L 2YXFA 3RBGA 4M61A 4LF3B 2H32H 1A2YA 1QQDB 5CEXB 3GBML 3U36A 1N2RB 3F7QA 5IHZA 1MCPL 3OSKA 4MDIA 1I8MA 1TCRA 3L5WB 3O8XB 4LASL 1U3HC 1T1WB 4Y0GA 1I7ZB 3KYMA 1RZJH 2Y36H 4EDXA 1WZKA 4K71B 1BM3H 3KHQA 3HG1A 1T20B 5D72H 5CKAA 1BOYA 3B2VL 2GFBA 1I75A 5ID1A 4D9QE 2NY0D 3ZKSD 1GRWA 3V0VB 2DOCA 5ITBH 2VSDA 3F7YB 1F90H 2PCPA 1DVFC 5A2FA 1F3DJ 1A9EB 1NCAL 2VDQH 3B9AA 1T83C 1ODAA 3KPLB 3B4NA 1W0WB 2Z9TA 1YECL 5DO2D 1ZGLP 1J5OH 5E2WL 2Y25A 4XPTH 2O93L 5E9DA 1K4CB 3QEQA 5CZKA 5IROA 2VLRB 5HI5C 2UZYB 2A9ML 4LHQB 1X7QA 4I3RH 1FL6B 3DX6A 5FM5O 5C2BH 4YDKH 2UYLB 3LEXB 1MHCA 5KVDL 5HD8C 4GKOA 3QQ9D 5FB8B 3ES6B 3ULUL 3DO7A 4MGXA 1ZVSA 1AJ7L 1FAKT 4N9GA 4U6TA 1HIML 1CTNA 5JW4N 3QJFA 3QRGH 5I8KL 4OIBA 3H9SA 1FFRA 3HCVB 4HXAH 3RX5A 5DJYA 3WDHA 3WFHA 3MRMB 3VFNB 2YKLL 4Z7OF 2IF7A 4N9OB 5I0ZA 5KOMC 4HCRL 2A0LC 4DFHA 2V17L 3AB0B 5AYQA 4LPWA 2YD5A 1BOGB 2JIXA 4KK6D 5TF1H 2OTPA 1UVQB 2Y1VA 3OV6A 1D9KC 2EC9U 4J3XA 4YX2L 4AK1A 5JHLL 1SY6H 2HFTA 2ORBH 2G75A 4PJ5A 4NKDA 3MACL 2CR3A 4G6KH 5CBAA 1W0VB 4I18A 4Z0XA 1RZ8A 3BPNB 1RUAL 3RWGA 4EUPA 5JQHC 2A74B 3IAQA 1OB1A 3EAKA 1DQLL 1AY1L 1JFQH 3BZEA 2AJUL 1K5NB 1MPAH 4MD5A 3TO2A 2DIAA 1VGEH 3MOBL 2MCPL 1BJ8A 5TGBB 1C5BL 1U58A 3G9VA 3V6FA 4WU7A 5D1ZD 3RY5A 4YHYC 4ISVB 1EEYA 4XPBL 3RVVC 3VWKD 4N0UB 4R0LB 3VXRA 4JANB 4U33A 1A7QL 3PWVA 4OF8A 4HUVA 4JPKH 3KYKH 2R8SL 1AR2A 2AJYL 4FQXB 5JR1L 3MMEA 1EBAA 4HLZH 4WV1B 2WWMD 4EN3B 2ADIA 5J12C 5C0GB 4G6FB 4LNRB 3DVNA 4MMXC 3X14B 1B0WA 3GRWA 4L4VE 1A0QH 2AEIT 5JW3H 4P3DA 3D39A 4BKLA 2Y07L 3MRNB 5BV7H 3UTQA 1OD9A 2NY1C 5DR5L 2ERJB 2R29L 3ARXA 2DJSA 4LLWA 5F7WC 5KSAB 2UZXB 4IOFD 1EUUA 2EDWA 3D69A 5DGRA 35C8L 3K2UH 3H9HA 4Y1AB 3ROLB 4XC1L 3T65A 2AK1H 1EV2E 2VN4A 5HHQB 3FB5A 2ARJA 3CZJA 4JRYD 4LCWA 4EI5A 1NBZA 4Y4KD 5A16A 1AGFB 2PTTB 4MNQD 5JHDB 2Y06L 3WNOA 3GMQB 4O51B 3G5XB 2AXGB 4ZODA 4Q7DA 4AL8L 1OAZL 1INQB 4OZFB 2NXZD 4PUBH 4YGAB 4OFIA 3MGAA 3C5JB 4J4PC 5TH2A 1NFDA 4YHMH 2R23A 4YBQC 2F74A 3HI1B 3C09C 1D5MB 4ELMA 5DK0A 4JM2A 2X4QA 3GO1L 2GQHA 3MV7E 2BSED 3SGEI 5B39G 4D94A 4MA1B 3VXNB 4KKBD 4PBVC 4LSTH 1DLHA 5F88B 3OB8A 3R06B 3D0LA 5EZIH 4PJBF 5DQ9A 2NY2D 3HFMH 4TQEL 2VAAA 5C0RH 4H25B 2KH2B 5F96L 3EO0B 1BZ7B 3U0WL 2HN7A 5F3HA 2BNRB 4UOW1 3LS4H 2WMPA 4MCZB 5FGCE 4PJEF 1F8TL 4K9EH 4U1MB 2Q6WA 2AEQL 2VDPL 3FQUA 3DX9B 2A83A 3RY6A 1FFQA 2FJFB 4OI9A 4X83A 4NZRL 3LRSA 4KUZH 4IMKA 4IRJD 5IKCA 3JWNC 2AK4B 1QBLH 3OAYH 4NYLA 1DQQB 1YMME 2BRRL 3QJHA 5H94B 2EIDA 3UZVB 1N26A 2JJUA 4PG9B 4GRWB 1KB5B 5F89B 5HGAA 1JBJA 1NMAH 4NNXA 4YHIB 1GCFA 2BVEA 3CH8A 4ZUWA 2UZIH 1D5BB 3EJZC 5F1NB 3UTZA 3O3AB 3SE4A 5BQ7B 5I8CA 3BEWA 1VEMA 3BKML 2GJZA 4XAKD 5JNYA 5K9JL 2VXQH 1WWCA 4PGZA 1IAIM 2R56L 5GZOD 4U3CA 1XIWB 1P6AB 5F9AC 1OP3H 1IGCL 1RMFL 1VGKB 4Z8FL 4OZIA 2D4FA 5BRZD 3ECBA 3FO0H 3P9LB 4LSUH 2CIKA 1RY7B 4BM7A 1UACL 5E4IA 1OCWL 2P49B 1D6EA 5I1EL 2Q8BL 4PJCE 1YEFH 3AAZA 2EDYA 4XT1C 3PQYB 1EFXB 3HZMA 5FUOH 1KJVA 1G7PB 1OGAD 3REVA 1KIRA 2DI8A 1VADB 3BN9C 1CLYH 1MHHA 4AIXA 3D25A 3MJ7A 4Q74A 3ROOB 3RU8L 3BGMB 2HFGH 2FLRT 1I1AB 1CLCA 5CILL 1NC4A 5GGSY 5DMKB 3QHFH 1JHLL 3TYGH 3D48R 2AJXL 3N1MC 4U1SA 3EOTL 4LCIH 3RDTD 4AEEA 4P2RE 4RZCA 1L9NA 1JUFB 3UTSA 3A6BH 1U8LB 2YBRA 1CICA 5IEHA 4ODUB 4YAQB 5L2KD 1F4AA 2CLVB 4KXZI 4TUOB 3TPUB 4H5SA 3OXSA 5I8EA 2I9TA 4FQIL 1RZ7H 2R0ZH 3QUKB 3S6CA 2PKDA 4MNGA 3WUWA 4G5ZH 3G6DL 5FO8A 1DZBA 3FMGH 5I18H 1SEQL 1QRNA 2ZCHL 4Y5YB 2VZVA 1ES0B 3CCHA 1LE5A 1BBJA 1UWXH 3N1QC 3TN0A 43C9A 5DJ6A 5I6XC 2EXWC 3HLAB 1VFMA 1DCLA 1OM3H 2V2XA 5ENWA 3U0TB 3Q3GA 1A2YB 2OMNA 2XWTA 5I1GL 3U36B 3ULVL 5IHZB 4MDIB 1KCSH 2Z93A 4NIKB 5BS0A 1Q94B 1HYSC 1TCRB 5D1XD 4GRWF 2ARWA 3WXVH 3KYMB 3LKSA 3HC0A 4TNWK 3AC0A 1HILB 2ATKA 4GQPH 5DUBA 1OWRM 4NJAH 3QPXL 3VXMB 3GIVA 1NEZB 2GFBB 2BNQE 4CVXA 3OKYA 2ESVE 3EOBA 4W68A 1FE8H 4K8RH 4MJIA 5E8NB 3BP7A 1JRHH 1R3JB 5F9WC 5JW4M 1NGWB 1S7WB 4RWYL 3QHTC 4NO0D 2C4FT 2ZKHL 4PB9H 2NY4D 5GRUL 3VW3L 4MXWH 4PGBA 2OTWA 5E9DB 5FCUL 3KR3L 4GUPA 3QEQB 4YDIH 2FR4A 2OJZH 3T0EC 1DQJB 1NFIA 1X7QB 3D6GA 4HIJB 4KDTC 3VG0H 1HEZA 2DLFL 4G42B 4HPOH 1B88A 1BVZA 3LB6D 2X4RA 5E99H 5TPWH 3TNNA 4QRPE 1U8HB 1UA6H 3A67L 4DZBB 1A5FH 2K7PA 1MFDL 1ZVSB 2WUCL 2IPTL 4Y19E 2JJVA 1UC6A 5FYLE 3K7UA 4M00A 4LPCA 1QR1A 1FNSL 1I1RA 2WWKT 3KHOA 3WFHB 3O4OB 5T3ZH 1G1YA 2YD9A 1JZ4A 3VRLF 2NR6C 4HGKC 5I1HL 5D2LE 3RTQD 3MLSH 1ORQB 2BOBA 5E00A 5CP7A 5IFHL 4YZFF 1TZHA 3QUYC 5EBWA 3L3IA 2JIXB 4X8XA 3C5SA 4RBPK 3PP4L 4AEIL 1HHHA 4JY6A 4XP5L 2AJVL 4NQUA 3BSZL 3U4BL 5ADOL 3W39A 3VDAA 5HYQB 1JTPA 1B2WL 1G9NC 2QR0A 4PGCA 4I18B 5DJDA 1J12A 3RWGB 1VSCA 3U7YH 3OHXB 1OB1B 2CDGA 3BZEB 4QY8A 2XACC 3NCJH 2B8OT 2AERT 4APQD 1CWVA 2O5XH 3TO2B 3S3JA 1YNTA 5ESAA 5FYLH 4CDGC 3SE3A 3V6FB 1U58B 2RCSL 5IF0B 1AHWC 1KEGL 3S37X 4JFEE 5GPRA 4H0HB 3GNMH 5L7XL 2DQGH 4S1QH 1KJ2H 4HUVB 5DQDH 3OJ2C 1TVBA 4P4RA 5KAQG 4EQ2A 4BK4A 5ILTL 5LCVH 3WO3B 3IGAA 4R7DB 5ALCH 4NM8L 1UWGH 2LU3A 2Q3AA 1KCUL 4X7CC 4KRMB 3DVNB 2F58H 5J4MA 2F8XC 3QT2A 5ISZE 4P3DB 3DWTA 1WT5A 3UTTA 4ZO6A 1KYOJ 2F19H 4LLWB 4PRHD 1EJOH 1JWMA 2IH1A 5IVZA 1WLHA 2ADGB 3OKMB 1LO0H 3MR9A 3MUZ1 4TULL 4GXUN 3H2WA 3VE0A 2ARJB 5IVNA 4EI5B 5D1ZA 2P5EE 5A16B 4NKIH 1MLCA 1DBAL 2YR3A 4JO4H 5DD6A 1HK6A 3BZDA 3ZKMC 4P3CH 1NAKL 5DHYB 5FHAH 3ZKNC 4QTHA 3ZE0F 4E41E 5AZ2L 5FFLA 2D03H 1IBGH 4KMTL 4L5FL 1NFDB 1HINL 1BJ1H 1MSPA 2F74B 3NACH 5F7DA 5DK0B 2VKXA 2FCBA 3BGFB 5BO1L 1WVZA 5ESVB 3V52H 1EVTC 2YN5A 4M6OL 3QIUC 1Z5LA 3D3VE 4X98B 2H8PA 2NZ9C 3K3QA 5EB9A 2VAAB 3QDGD 4BZ2H 3IXTA 3BDYL 1PYWA 4GLRI 1ACZA 4M43H 1J8HA 4MYWB 3P0GB 2F5AL 2VLLA 2DMBA 1RZJL 1A8JH 3DV4B 2WBJB 5D5ME 1I8KA 1LO5A 2Q6WB 2YPLE 5ADPL 3O6KL 3FQUB 1FC2D 4HW6A 1JGDA 1GXEA 3GMOA 1ZA6A 2CDFB 1KUMA 3EDFA 2JJSA 3QCTH 1B3JA 2X41A 5IKCB 2DQUH 4NYLB 2X70B 1K8IA 2PO6C 3L1OL 1JV5B 4PRAA 1NUNB 2FSEA 2EDRA 4JFDE 4JPWL 4PLKD 4NNXB 4LVHB 2NNAA 3WNKA 4PP2B 3UTZB 2AS5M 2OS7A 5I8CB 1OTTD 3CFJB 4I3RL 1DN2A 3EGSB 5DRXB 3BEWB 1QSZA 4Y4FB 3O2VH 1E4JA 3GSXB 3HMXH 1T66C 1U36A 2MQCA 1IEAA 3TP4A 3RVUD 3FN3A 5J13B 4KZDL 1LO2H 4M62L 5DD5L 4ONGH 3QHZL 4RBPH 1EO8H 5E6IB 2ZG3A 1NCWH 2R9HC 2ZUWA 3TH4T 2CIKB 3OZ9H 4ZAKD 1K6QH 3OAZK 1D6EB 4P2OA 4M48L 3B9VA 3EW3B 1NANI 1VPOH 2BZDA 4JDZA 3MO1A 3PDGA 2X4OA 1SQ2N 4PTTB 2O5YH 1KIRB 5J89A 3CFKA 5HGHA 2VZTA 3B9KC 4TRPH 1Z9MA 3UBXA 5HHME 1TJHL 2F5BL 5F1OB 4JG0L 3VXUD 2ORBL 2YEZA 1NC4B 3PV6A 5AAWA 3E3QC 3QG6A 1T7ZA 3NABH 3CMOH 4L4TE 2DJUA 4Q2ZA 3SE8H 2DBLH 4HBCL 1RZKH 1NFDF 1TPXB 2ICWJ 4YHOH 4Q9RH 5BRZA 4ELMF 4RZCB 4JM2F 4HWBA 4JFZL 3RWDB 3UTSB 2FJHB 3JWOC 3MREA 3IDYB 5GS1B 3RWCB 2YBRB 1CICB 5CZVL 1A1OB 4ZSOA 4C57C 4WI9A 1S9XB 4ERSL 1NDMA 2H2PC 4FQXC 3V0AC 1R5VB 2KQNA 1P4IL 4WV1C 1G6RA 3WUWB 1BJ1J 2V7NA 3ARZA 4ODHH 4HWZA 3C87A 1KSRA 5IFJB 4BZ1L 4EQ3A 1QRNB 5KSBA 3BH9B 4NHCH 3CCHB 1NLDL 1WBYA 4OIAA 1DEDA 4KGJA 1BBJB 1TNNA 1W72L 3TN0B 2OTUB 5KSAC 4IOSD 1TENA 5GGTH 2IH3A 1ZAGA 2IANE 3KPSA 1NCUA 4F9LA 3RDTA 1WBXA 1X5KA 3Q3GB 4NUGL 2V5YA 2B5IB 1Q9KA 2XWTB 4KROC 2VXVH 5BS0B 4KAQH 4KI5F 3WFDL 1QR4A 2J1KA 3O4LD 3HC0B 5E8EB 4QXUH 2ATKB 1LE9B 5DUBB 5IHLB 5F7YC 3GIVB 4G6JL 4YHLH 2VLJE 2CMRH 1M7DA 3WDIA 2W0LA 3EOBB 2VL4A 3PL6D 5C0BD 3VFSA 2YC1A 4MJIB 4LARH 4OM1H 3HKFA 3VXTA 1XFPA 2YK1H 4MA1C 4JO3H 1E4XH 5DUPH 2NXYD 2P7TB 2E9JA 3WO4C 1SJEA 4P5TD 4YXLH 2J8OA 1QPPA 4QOKA 4OZIF 1JNNH 3SDCC 3PGFL 1GH7A 4GUPB 1PKQE 3RVTC 2FR4B 2F53B 5ETUB 1KN4L 5GHWL 3L3JB 1NFIB 5EZIL 1HEZB 3S3PA 5L8LB 4U1LA 4TNVK 5HYSB 4O5LL 4O9HL 4OQTH 3WFZA 3KPOA 5IEKA 5C7XL 4OD1L 5C0RL 3W82A 5SWSE 4E9LA 4HWEH 2IFFL 3F58H 2PW1A 1ND0A 4ELKA 4MB4A 5T33H 5T1KB 1QR1B 1X4XA 2E7CA 4XVUD 3L3DA 4AT6B 1A4JA 1HHJA 4JDVB 2XN9E 4X4ME 4XGZB 3W0WE 5KSVB 4NRXB 4XCYB 4ZNEE 3RL2B 1FN4B 3NAAH 4ZD3H 1QLFA 2AQ3A 5E00B 1KJ3H 5DT1L 5BOPA 4ZFOA 3V4PH 3ULVE 4NC0B 4OLWL 1A47A 3L3IB 3MRLB 2X1WL 1MFNA 3S4SA 2VABA 1I9JH 1NLBL 4UUJA 5EU4A 2HT4D 3VA6A 1IL1A 1HHHB 3SBWC 4JY6B 1QACA 1RULH 4GG8B 3DYPA 3W39B 4XH2A 3HUJE 3OAZH 2A9NH 1NDGA 5CUSL 1ZLVH 4PRPD 5I2IA 3HC4H 3MYZA 5DMGC 4FFZL 4QF1A 3QCVH 4PGCB 2F9BT 1K2DA 3DIFA 3WFEH 2GK2A 3U9UA 5FDYA 4F80A 2CDGB 4N8VA 3C8DA 3KPRA 3QDME 1SMOA 3RTQA 3E6HA 4K3HA 2HTLC 2CR6A 1YNTB 2HLAA 4RFNB 5ESAB 3WLBB 5HYFA 1KPVA 2X05A 1I1AC 1S3KL 5E4EB 2WAHA 3EDKA 4AG4L 5H2BA 3QB7C 1RURL 4L3ED 1TVBB 4P4RB 1QSED 1S5HA 1CLYL 3T3PE 1SEBB 1BQSA 3IGAB 2HFGL 1KLGA 3QQNA 4L8BB 2DYPB 2C1PA 2Q76A 2VR5A 3E6FA 3ARTA 4IOIA 3EDDA 3MZGB 3TYGL 1ZS8A 3UTTB 4DFIA 4Y5XB 1CN4A 3M1BA 4CMHC 2C7UA 5I1CH 4APQA 1LHZA 3IYLW 3MR9B 5JPMB 5B3JE 2RGSA 4LOUD 2OCFD 3VDBA 3VE0B 3HNVH 1KELH 4LHUG 2MQ3A 4Y5YC 4MQXD 1BEYL 3SKOA 4HUWA 5DD6B 4XP6H 3ARVA 3E1F1 4YE4L 2AXFA 2CKBL 1I1FA 4JY5L 4RAUA 3UBXI 1YEEL 3VWJB 4EKXA 4QTHB 4YDLC 4OCXL 1CD9B 5IV2A 4XPFH 1GOHA 4H26B 2J8UE 3F7VA 1JPGB 4ZO7A 4KK8D 5KTEL 5F7DB 3BUTA 3SCMD 3BXNA 4OAWA 3EO1A 4I13B 2MKWA 1N8ZA 1B4JH 2F54E 4S2SA 5LXGL 3RP1A 5CHNA 1AO7E 3VFRA 1GOFA 1ZKAA 4PRHA 5JORA 2ZUSA 2H8PB 3PABA 1DSFL 1WGOA 4G8FB 3J8F7 4RMVA 4S1RL 1QA9A 1H3WM 1MFAL 7FABH 4GS7C 5GRJL 5MEND 1A7RL 4RA3A 4BK5A 1MAMH 3LEYH 4HUXA 1AP2B 5FXCH 1I8KB 1LO5B 1J1XL 3FQWA 1JGDB 3U1SH 3MQIA 4ZYKA 1PZ5A 2WUBL 5D7IB 1RHFA 5F71A 4BJLA 1RZIA 3SEPA 3TJHD 5EU6E 5JPNA 5IROC 3QDJD 1EEQA 3DXAB 5LWYL 4IM8A 1MREH 3O11A 3BGAA 5GGRB 4GG6E 2AGJH 3QUMB 2NLJA 1LEIA 4PRAB 5IESL 2FSEB 3LS5L 1BQHB 3CFBA 5D7LB 5AWNH 3WHE0 5IB3A 3RKDC 1NCBL 4HKBA 4X99A 1HN1A 2NNAB 1GGTA 1I7UA 2O61B 4FTVD 3SN6N 1W8OA 4ALAH 4HUUA 2XY2A 2R0KH 3SO3C 4BH8A 4QTIH 2BMKA 5TE4H 1JL8A 2DL2A 1IEAB 4UNUA 3WYRA 2D0GA 2AJ3B 2EYTA 32C2A 5K9KB 1WAAA 2WWKO 5DJ0A 3BYYA 2NY3B 3VFOA 3RI5F 1PKOA 4LRIA 4EIGB 4X8JB 2GEEA 1ULVA 2X40A 2APVA 3MNZA 4LSQL 2OZ4L 1U93B 4P2OB 3DSFL 2VN7A 3EDJA 2J6EA 4M7ZC 1AGBA 4UQ3A 4C56B 5JQ6L 3DGCR 4I18C 5MEQA 4UV4L 4YWGH 4X80H 3U7WL 3VG9C 1KPUA 5HGHB 5KW9H 4JZJA 5F9DC 4ZO9A 5F9JA 2DQIH 4XTRC 5IGXH 3C6LB 3D18B 4RGNB 2FZ3A 5I30L 2Q20A 4WHTA 1JI1A 4QHKI 4B0MM 2ZNWA 5C0CE 4WFED 4Q2ZB 3U7AA 4YXKH 1I9EA 2GTZA 2XPGA 4POZC 3MGTB 4PR5A 4MA8H 1P2CB 4ZAKA 2AQ2A 3LN4A 4ZSOB 5F72S 5E2UH 1D3CA 3BE1L 4HJ0D 5KG9B 1NDMB 2O5XL 1JMZA 3PDDA 4HMCA 3WV0A 3GK8L 4QNPE 1G6RB 3A6OA 4GRLA 1NAMA 2R2HB 4HWZB 4WCYL 4OGXL 5F7KC 1CGXA 1J8KA 5CP3A 5KSBB 4YGVB 1U91B 2KUTA 1C08A 5C0JA 1NC2A 3V4UL 4V1DE 1WCQA 3S37L 1QBBA 5DMYA 4C4KO 4XNYL 2IH3B 4QKXB 5F7EL 5HDQH 3KPSB 2P8LA 3BKYH 5E1AB 1IILE 1WBXB 4EI5C 1JF1A 2F58L 5HGDA 1Q9KB 4IRZH 1ACYL 5GJTH 5T3XD 1JN6B 3DUSA 3MLXH 2L7UA 5HHPB 4RMWA 3NZ8B 3T4AA 4PJHB 5T5FH 4NQCE 1ZHBB 1CGVA 3FQXA 3GSNA 5T1KD 1JHTA 1QFWH 2D7MA 2XICA 4ZG1A 4JM2C 1M7DB 3CFCH 3MV7A 4KY1L 4S1SH 2BVTA 2BVQB 3TWCH 2YC1B 1FGNH 3VXTB 1EAJA 4P3CL 4G80A 3ZKQD 1SJEB 3T2OA 1IBGL 2ZZUT 2W65B 5B39A 3AS0A 1RFDL 4QOKB 3PNWA 2W91A 5LQBH 4LGPB 1UENA 2C3HA 4PJ9A 4HEME 5D71L 15C8H 3IDNA 3MCLH 4LRNL 4U1LB 4W70A 3NPSC 5DVNA 4PG2A 3KPOB 3RY6C 2B39A 3RI5K 2NPLX 2QHRL 2HT2D 1A6VL 1VB9A 4NN7C 4NQDA 4GLRH 4IMKC 4ZUSA 2XTJC 4HLZG 1KB9K 1YEDA 3JV4A 4KPHH 3NIDF 3VFVA 4LSSL 4PJXE 4KI5C 2FGWL 5HVHB 4XZUA 5T1MB 1CGUA 3L3DB 4U7MA 2EDEA 4NQEE 3VFUB 5C07D 2P46B 1MWAH 4FFVC 1QLFB 3SE4C 3ARFB 1OL0A 2BRQA 4ZFOB 2I26N 5DFTA 4TPRH 3S4SB 2VABB 2VKWA 1G7LA 1VKXA 2X4UA 3CXHJ 5CCKL 3VXSD 2ZCLL 4H1LH 5LGJB 4PJ8D 5EZJA 4QT5A 4XH2B 8CGTA 1IGTB 3DX8A 4XAWH 1MRDL 3P4MB 3QEHB 2DYPD 5I2IB 3FONA 1RZFH 5I73B 2XTLA 1J10A 3MLRH 1M05A 4LVNB 3TT1H 3HMXL 1K2DB 4HDIA 4GQ9H 3FAWA 3DIFB 5SWZB 5EBMA 5KSBF 3U9UB 1FO0H 4ENEC 4YDVA 3BKCH 2HMID 1LO2L 2R69H 3IB4A 4NKOA 3OG4B 4EEEA 3KPRB 2GTWA 3UROR 5CZXD 3RRQA 2BDNH 5TQ0L 5DXWA 2HLAB 4I0KA 3OZ9L 4CU8A 1EGJL 2IBZY 4HJJH 5IBTH 4KTDL 4P99A 3VWJD 3CDCA 1OPGH 3M8OL 1MF2H 4YEEA 3C6SB 5FM8A 2O5YL 2WBKA 4Z7WE 5CGYD 4PRPA 5DA4A 1M7IA 1S7QA 1S5HB 3MROA 4JFFA 2Q8AH 1MI5B 1NGPL 3QPQD 2A77H 5GGUA 4XPAH 5DURB 2AV1A 2C1PB 1CICC 3X12A 1S8DA 2LTQC 1DUYA 4LSVL 3OQ3B 1FG2B 4JFHD 1ZS8B 4KQ3H 4CVZA 3M1BB 4A6YL 2ZG1A 4YHOL 4PJGA 1DBJH 4HV8B 1TXKA 4YHZH 2QKIA 5E08H 5EZOL 1AFVL 3DTXA 3TN0C 3RA7H 4X6BA 4QRRE 3PGDA 4HUWB 4P9HC 3OL2A 1BIHA 3CVIL 3RQ3A 1ONQA 2AXFB 2FATL 3IDUA 4RMRA 4BQCA 2XZZA 5GRVK 4L3EA 5FK9A 5IV2B 3DXAD 3GI8H 1QSEA 4PJDE 2E6JA 2H1PL 2VNCA 3F7VB 4YUEL 1JPTH 1AIFB 1J0YA 4DQOH 5F3BA 2ENSA 3BXNB 4OAWB 3EO1B 4D9RE 1EIBA 4OCLC 3CDGA 1S7XB 4X9BA 5MEPB 3IJHA 3ZSTA 1SBSL 2EEBA 3CAFA 5ABDE 5JORB 3CZFA 3BVNA 3BZFA 4Z7NE 2H9GA 1Z9SA 1TTGA 4D2NA 3L7FA 3QNYB 4HUXB 5FUCC 3EJYD 4TVPD 2E27L 2VDRL 3A6CL 5E2VL 2APFA 2OQJA 1T7VA 2FNBA 3FQWB 1FZOB 4ZYKB 1PZ5B 3ZT5A 1RZIB 3O6LH 3VDCA 4OGAC 1AQKL 2FRGP 3GFUA 4OM1L 2QL1A 3ZTNL 2C26A 2V9RA 3T0EE 2IALA 4FRWA 3SCMA 3O11B 4OSUL 4QRPA 2NLJB 2BSSA 1LEIB 2EIBA 5IMMA 5E8OA 5IB3B 4X99B 4FXKA 4LKCB 4Y19A 5I0DA 1NCCH 3F5WB 2H6PA 1WZ1L 2NY0C 4HUUB 4EBQL 3QQ4A 3EKCA 4ODSL 3OJDA 4BH8B 1GHFH 5DK2A 5DZOA 3ZE1F 5LKNA 1U8JA 3MLUL 43CAA 4OQTL 3VH8A 5D2LA 4XMKH 4TUJA 1L7TL 2R2CA 4JHWH 3D0VB 5E0QA 2AABH 4MWFA 1AI1H 1B9ZA 2K7QA 4GXVL 5TQ2L 4XB8A 2CSPA 4B41A 3VFOB 2HRPH 4Z5RB 3Q6FA 4ODTH 2EE9A 4OTXL 4P2QA 4JZNB 3QDJA 3QG7L 2ITCA 3VCLA 2JE8A 3RJQB 3MNZB 4F7PA 1HSAA 2Y5TA 4CAGA 5MHSE 1YC7A 3QWQB 3MXVH 4LCUA 1A1MA 2ZPKH 3PG2A 5CD5D 1AGBB 4UQ3B 1FNLA 3HR6A 4RGOL 3VRIB 4FTVA 4K2UL 1X6NA 5I1JL 4HAFA 4G8EA 4U1KA 1CQYA 3FRPG 5F6IC 2P43B 3K4ZA 4YHKL 4F3FA 2FX9H 1B4RA 2BC4B 2YPVH 2ED9A 1Q9LB 2ATPA 2G60H 1RV6X 2FZ3B 5I9QC 4WHTB 4JZOB 3H3PH 1MUJA 4PYGA 5J6GB 1UEYA 2FEDD 3SDYL 4RFNC 1F4YL 4DKEL 5E03A 1X3DA 3MLYL 3SE3C 1KN2H 2COQA 3WFEL 1DE4A 1A02N 4PLJC 4PR5B 4R97C 4J8RA 1LK3L 3DGGB 5E4EC 4UV7L 3IT8D 1S9YA 3LN4B 4M93B 4Z7OE 4LHUD 1JGEB 1WEJL 1N5YH 3EJJX 5GGVY 1M7XA 3VRJA 1OTSC 2ICEB 4X9IA 5CJXC 1OQXA 3TIDA 4GRLB 1RIUH 1NAMB 5BW7A 4HIHA 1JWUA 1CE1L 3MJ9H 3GHEL 4JFYB 1GSMA 4HCRA 4XC3L 1WT5C 2OMBA 3TBSA 1C08B 4Z6AT 1NC2B 4FOMA 4HIXH 5EORH 3WD5H 4JHZA 4GRMB 5A40E 2P8LB 5HYIA 1MY7A 1G9NH 4I3GA 1PDKA 1YN6A 2IQ9H 5D1ZC 5HGDB 4M6MH 4HHAA 1F4XH 2V2WA 5C08E 1P84K 4JFOA 3T1FA 3QUXB 3T4AB 3ZL4H 2Z31A 4G9FE 5J8OA 3U9PL 2BVOB 4NO2B 1FORH 2B1HL 5IUSA 5CEYA 2FECI 3RAJL 1JHTB 4N1CA 1DQML 3OTTA 1OAXL 1LQSR 2Q86B 4LBEB 2ZNXA 3MV7B 3QNZA 4HGWA 2JK5B 4BSWA 1YJDH 4MS8C 1S78C 3C60D 4G80B 5BMFH 5C0ND 1WAAF 4IOFC 2OL3A 4ZO8A 2Q1EA 2VE6A 3O2WH 4ZXBD 4MSWB 4WNQA 4GKNA 5C0AD 3CSYB 3PHSA 4BSJA 4Z9KB 2CXGA 4YO0B 4LMQI 4WO4D 4PJ9B 3H7BA 5E5MB 4O00A 2QQLH 3EO9H 4BA8A 3GBNL 3MUHL 1XGUA 3NFSH 3MRGB 2I9LA 3IU4H 2EDNA 1LO3L 3CUPA 4XCNA 1BFOB 2R15A 4NQDB 2JJSC 5JOFA 4NP4H 1YMMB 1YEDB 3IFLH 3JV4B 5DJ8B 5DS8A 1MAML 2N56A 3VFVB 1IGYA 3ARGA 4X6FA 3FOLA 4U3HA 5CJQL 4KKBC 4XZUB 1IRAY 5ECJE 3LKQA 4TUKH 1NCTA 3MA9L 3GJFB 5FA4B 3IFOB 2NY2C 3IF1A 4K3JH 5E95B 4IJ3B 2EZ0D 4HX1B 2E6PA 2WBWB 3GSVA 2D7TH 1LDPH 4GMSH 1HXYB 2VZOA 1G7LB 5GXBB 2X4UB 2X1QA 4PJBE 3DJ9A 2CH8A 2NY3C 5IK3A 2R2BA 1BBDH 3RVXD 2XQBL 3VGAB 4IRJC 4U6YA 4HDIB 2JTDA 1ADQH 1KCLA 3IJYB 4G7VL 1ZEAL 2IAMA 1TQCB 3BISA 4PJEE 4P2OC 5C70A 3CVHL 3VGHA 4WHYH 2GTWB 5C07A 4QEGA 1JTOA 2XZAL 3KXFD 3HE7B 3UJTL 3BWAB 3RBSA 2C3XA 1BX2B 1G9MC 2C1OA 1IM9D 4KWUA 4PY8J 3TT3H 4XBPB 3HNTL 4RGNC 4XX1E 4O2CA 1KNOA 5J11B 4KRPB 5D7JD 3E3QE 2W07A 2MMXA 3ZT6A 5E5UB 5ACZA 2JB5H 2E7HA 1RZGB 4P2RB 4X80L 1MHEA 5J1TC 1S7QB 1G0XA 4JFFB 5AAMA 2KKQA 5GGUB 1KBGH 4UQ2B 5L0QB 2AV1B 1FRGL 4ODBD 2JELH 3S35L 1QHPA 3X12B 1DUYB 2W9EL 4AMKL 1R5WA 1TDQA 4KKAD 4CVZB 4MLIA 4JFXB 4W6YB 4P23D 2E3VA 3RGVA 5GGVH 3FO9A 4O2EA 4PB0H 5EA0H 1KJMA 4KJWD 2QKIB 3MV9D 3DETD 4K94H 5SX4I 3RNQB 1N0XL 3BQUD 1DBKL 3MLWH 5EFIA 2GUOA 5IP4A 4J6RL 1EO5A 2IANA 1ONQB 3SJVE 2BVYA 1V7MH 5CSZA 3UTOA 1LEKA 4Z76A 4F9LC 1IAIH 3RDTC 4B7IA 1C5CL 1T1XA 2YD4A 1VHPA 2VXTL 4Y4HA 3N85L 4PJ7E 1WZMA 5CSGA 2NW2A 4MHHI 4OB5L 3CDGB 4TOYL 4BH7B 1TNMA 3TCLA 2X4TB 1IKFH 4XRCB 1UGNA 2ESVB 3BZFB 4F37F 1AH1A 2WSKA 5J9PB 5IIEA 3STLA 3OF6D 2ENYA 4I77H 4NZTH 3TVMD 3JWOH 3RX8A 1XZ0A 1T0PB 4KJQD 1E6JH 4P57B 4F15B 2IQAA 4B7LA 2OQJB 1J0JA 1AXSB 1RUQL 1INDL 2CLRB 4D0CB 4HFUH 3HE6A 1ZANH 5FIEA 2YRZA 2IALB 1OSPL 3QSKB 3B83A 4QRPB 3TBWB 2BSSB 4LLQA 1HSBA 1XGPB 4CN4A 5E8OB 5TE6L 4Y19B 3IDXL 1TTFA 5C3LD 2VXSH 1N5AA 3WXWH 1VACA 2AK4E 4YXHL 3QQ4B 3MNWA 4DAGL 4OF7A 4JFQA 4L1HA 15C8L 3GI9L 4P46D 3AU1A 3LIZH 2YD3A 1U8JB 2NW3A 2YUWA 3VH8B 1P4BH 3LZFH 5D2LB 4JJ5B 2X4PB 3H3KA 5E8DL 1FSKB 1ZTXH 1GC1H 1T22A 4L9DA 5J56B 5L6YH 3Q6FB 2GI7A 1QKZL 1CE6A 2FIRT 5FUZH 1HDMA 5EU3A 4NRYA 2PW2A 1XR9A 2R1XA 3LB6C 1S7TA 4LCUB 1A1MB 2ICWB 4L4VD 4PJGF 1N64H 3ZDZF 1HOCA 4P5KB 4WFHD 4LVNC 4U1KB 4X5XA 5DVLA 3TBTB 2DKSA 3RWHA 5FYJH 4XPGH 4Z77B 3JBG7 1MCBA 4PTUA 1A7NH 3PJSA 4QGYA 4J3OC 2ATPB 4K7PL 2APTA 4HC1H 3RTQC 3G5VB 4LSDA 4M1CD 5HHOE 3AROA 1MUJB 4ORGA 4ZOBA 4MAYD 5KVGL 4S11A 4WU5A 3TT1L 2DKMA 4GQ9L 3MRCA 1DE4B 3IDJB 1FO0L 1DBML 2V9QA 1HNFA 4D3CH 5ICYB 4S0TD 1X4ZA 4L8CB 1TVHA 3I50L 4GRWH 1KB5H 1YNKH 4RQQA 3VRLE 3O0RH 1NKOA 3MV01 1HE7A 3RFZC 3R4DA 3I3EA 4NWTH 2VAJA 2CJUH 5IB1A 4YZFE 3QWOA 1TMCB 3FT2A 5E2TH 3KPNB 3TIDB 4LSRL 2VL5A 4HIHB 1JWUB 2A2QT 1OPGL 5TDPA 1QLEH 1L0YA 1MF2L 3SQOL 4U1NA 5C6WH 3IFPA 3LPFA 3TBSB 4FFYL 3NCCB 3WBDA 3I84A 4APQC 2FH6A 5C0IB 2A77L 1L6ZA 5DJZB 3QFDA 2MCG1 5FDWA 4M8VA 4Y2DD 4XMPH 4N8PA 1IAKA 2H2SD 5ITFA 3BJ91 4UBDD 2J4WH 1SM3H 4HHAB 4L29B 2GJ6E 4TSBH 3T1FB 4E41B 2AEPH 3RPIA 1UZ6F 2Z31B 3QXDA 5IMOB 4NJ9L 4GW1B 1OOAA 2VLME 2GT9A 4OKDA 3VGFA 5IWLA 5E08L 1BD2E 5HDOA 1SJVA 3ARQA 3QNZB 4HGWB 3TJEH 3V5DB 3BP6A 4F7TA 4BSWB 5LGKA 3O6FB 5D2LF 3GSWA 3QEGH 4JVPA 3DMMD 3HG1E 3AREB 1OAYH 5CIPA 4FZEH 1WZLA 4X4XA 3B5TA 1BVLB 3AFLA 4WNQB 3SDAD 2CRZA 4GKNB 4PD4K 4XWOD 3QIBD 4PJFA 4DGYL 1I7TA 3H7BB 3TO4B 5HYJD 1SHMA 1QYGH 1HWGB 1Z0MA 4ZTPL 1NL0H 2I5YH 2I9LB 4JPVH 1PG7X 4XCNB 5HHXH 5K9QG 3NFNB 1ZLUK 4NM4L 5E9DE 2YD6A 3QEQE 1DP0A 3O41B 4YHNA 5DS8B 3ARGB 4N8CL 4NGHL 4JFDB 4X6FB 2PF6A 3FOLB 5DEFA 3R0MA 2HRLA 4IRSD 3WDJA 4OF5A 1OQOA 3TV3H 3C60A 3LKQB 3ZE0E 1VFAB 1KIPA 1D7FA 4UAOC 4ZXBA 5KJRL 2O5ZL 4ZS6D 4MA3A 2Y4SA 4GMTH 4GW4B 4HK0A 3GSVB 3H9SE 4WO4A 2A6JA 3ULUF 5IQ7H 4RFOL 4QXWA 3B6SA 1N3NA 3BUYA 5I71B 5DI8B 4OKVA 4LIQL 3CFDA 4K8RD 2X4NB 4XP9H 2R2BB 2QADB 4XVSH 3LD8C 1JPFB 2BXZA 4LRIC 3OJMB 1BWMA 4TSAL 1XT5A 2VISA 1RJYA 5JXAL 2J88L 4NNPL 5CINL 5TDNA 5T1LA 1HHGA 3GEWB 2JKXA 1T0MA 3O9WA 2IAMB 3DOSA 1F58L 4N90E 4OCWL 2H32A 4X7TA 4PJ5E 1MAJA 4PLKC 5MP6L 3REWA 1OP9A 3AVEA 4JN2A 1LK2B 1OTTC 3NMEA 4M5ZH 4FQLH 4IDLA 4G7YL 4JG1L 4JZJC 1X6LA 2CGRL 1V7NL 4PY7B 1UM5H 3MXVL 4PRNA 2EH8L 4IDJH 2ZPKL 1RUML 4O2CB 1KNOB 4L4TB 3QQ3A 3K1KC 2G2RA 1A14H 4FZ8H 2XG4A 1U9KA 1FQ9C 1ED3A 5T3ZD 2G5RA 3FB7A 1DN0A 2E9IA 1XGRB 4ZAKC 4KMQA 3O45A 4NZUL 3VXRE 2BNQD 4CW1A 4UTAH 4U0RC 3UAJC 1D5XA 3TBYA 2GAZB 1ZVYA 1R5WB 3LOWA 3JUZA 4EI6A 2VJXA 1KCVH 4OCRH 1X5FA 4PRBA 3RGVB 2HKFH 4GRLC 1T6VN 4TVSa 4JGUA 1KJMB 1AC6A 3SY0A 1U8QA 1E4WH 1S9WB 3D39E 5EFIB 2GUOB 4V1DA 4YK4B 5EIIA 4I48B 4WTXA 5D7JA 1LO4H 2DQHH 3HR5A 4OF3A 2IANB 5DVKA 1WCBA 2Q3ZA 3FT4A 5CSZB 2MPAL 4KKLD 1G7QA 1FLRL 4U6XA 4Z76B 3JVGA 3PIQB 1LVEA 1T1XB 4LCWE 4M1DH 2X89D 2CDEA 1XCTA 4ODXA 1IZJA 4P4KD 4QWWC 3GIZL 5D2NA 2VDOL 4U3XA 2YHGA 3NCFB 2XKSA 4UDUB 4KKCC 5FYLD 4LQFH 1L0XA 3QISA 2MHAB 4N0RA 5I1AA 2VLJB 5T1DH 2ZUQC 5HI4D 2A6IA 2B1AH 2PR4H 2QQNH 1NFDE 5GRVL 1C16B 3D85A 2DQJH 4ELME 1CDBA 5ALBH 3STLB 1F4WL 3ZL4L 4Y16A 1ORSA 1HH9B 5TFSL 1NGXA 4PLNC 2DM2A 2PYEA 5BVJA 4OD2A 3LEVL 2IQAB 2YWYA 3PWNA 3JWDC 4DOHE 4JFPA 3NVQA 2IGFL 1PKQB 4U6VH 5FECA 2PXYA 4D0BA 3HE6B 2AKRB 4OGZA 4P59H 1G9ML 3GRWH 2NTFA 1FNGA 2D0HA 5I74C 3I75B 1RIHH 4LLQB 4U6HA 4PG2C 3O2WL 3BPCA 5FOBA 5SWSB 1SYSA 12E8L 5I1DA 4WRLA 1OW0A 2DI9A 4H20L 4ONFL 3ZTJH 2XTJE 3GMLB 5I17B 1W72A 3MBXL 3MNWB 4G6ML 4U1GB 3OKLA 1YY8B 5DUMH 3S7GA 3OF6A 4KI5E 2NXYC 2W38A 3MRQA 2XN9B 1GGBH 4K7PY 4HQQL 1YEGH 3IDGA 5EPMB 3IU4L 3C5ZD 4UOW0 2NY5C 5ANMA 1J1PH 3S96A 4JFED 4IJ3C 1N7MH 1TJGH 2QTEA 1T22B 3D9AH 3VD3A 4FABL 3CD4A 2XRAL 3P30L 3S34H 3GMNA 3JV5A 5ID0B 1HDMB 1YEIL 5EU3B 4MZ3A 4NRYB 3BH8A 3BD5A 4EVNA 1F4HA 1S7TB 3HUJB 3JSSA 2R0LH 2J5LB 2AAVA 1DTUA 2XYCA 4XMLH 2RIKA 4YFEA 4N1HB 4OZIE 1EX0A 1S7SA 5ISZD 4QHNB 5GZND 1HOCB 2HP4A 1DQDH 1TVDA 2DBJA 4R4FH 4MXQC 2FEEI 5DHVA 2ZOKA 1MAKA 1C12A 4OLUH 3RWJA 1U8OA 2GK0A 4XVUC 3QDMB 1TETL 5EOQL 25C8L 5DMIL 3T2NL 2P5ED 4YH6A 1CVRA 5GGQH 1VERA 2OJEA 4ORGB 4HKJB 2FD6H 5EUOA 1HHKB 4UNTA 3DROA 4PS4H 3MRCB 1ADQL 4I4WA 5I8OH 4X0KA 4H0IA 4E41D 5DJXB 3F12B 2HT4C 3NFPA 4RX4A 3C08L 5E7BA 5LVEA 5J11C 3WFBH 5CEZE 5HHVL 3LH2L 4Z7WA 2DLIA 1QOKA 4PV9A 4G8GA 5IB1B 1JZ8A 2WNGA 3BESR 3QWOB 4NQSB 4FQQA 2VL5B 3D3VD 3UTSE 5AD0A 1J0IA 1QUNA 5ACMA 4FXGA 5IB2A 4QRTA 1FVCA 4U1NB 1AD0A 5ICZA 5K33A 1KCRH 1CDYA 1FYTD 4HUMB 1ZLWH 3WFCH 4NKQB 4JN1L 3MUJA 3KNBB 1OHQA 3DSNA 4WWKD 4XNXH 3W9DA 3V8CA 5FDWB 4MNGE 4MAYA 3TO4D 4EDWL 3UYRH 4OZGA 1MIMH 2EIEA 4S1DD 5FYKU 1RJZA 2YPLD 4GAJL 3UDWA 1CLOH 4RIRA 1IAKB 1BFSA 5ITFB 5JO5B 4PRID 1U8PB 1CFQA 2EDDA 4KRLB 3OR7A 3FB8A 3I9GH 1UKSA 1CFNB 4AEHL 3PWPA 2DDQH 4ZUVA 3SDXA 1NPUA 1XGYH 3QXDB 4PJDA 2ZP0T 5FOJA 3FQTB 3HI5L 5IHUL 3MYJA 2GT9B 1MJ8L 1CLZH 4PREA 1I1YB 3WSQL 4XBGA 2OYPA 1JZ3A 1YDPB 5BS0E 1T2QL 2F54B 3ILPA 3KAAA 3BP6B 4K07A 1DANT 4F7TB 4M5YH 1AO7B 5CEZH 1BQUA 4LCCA 3O3DB 5CIPB 4TTGA 3L5XL 5JW5B 4X4XB 1KC5L 3ESVF 3TCXA 3B5GA 4LOUC 2VB5A 4LPVA 1DVFB 4Y2DA 4MJIE 1U3JA 2XA8L 4XWGH 1UM4L 4MQXC 4LQ1A 2QADD 5IR1A 1I3GH 4F15C 4XI5D 5J6HB 3UJJH 2UVFA 4FXLA 1MHPL 1P5VA 5EU6B 1FYHB 4KRNA 3W9EA 4RNRB 3LKNB 4YNYA 4OIIH 1YNLL 1JI2A 1JTTA 4GG6B 3SCMC 4LKXA 1K3IA 5DEFB 5IVOA 2DQFA 1MCRA 2P5WA 3E8UL 3VFGL 3OGCA 5HHMD 1GAFL 4PLOB 1KIPB 3GM8A 4HFUL 1E0OB 3AS1A 5J1SC 4MA3B 4BUGA 4ETYA 3DBXB 4YQXH 3HC3L 4JVWA 4L1DA 3QIBA 4R8WH 3HPJB 4HK0B 4MJ6A 2CKBA 2A6JB 2QBWA 1Z9LA 4ODVL 1N3NB 1B0GA 3QIWA 4YDJA 1CIUA 1X5LA 3S5LG 5TDOB 3T3PF 3QXAA 3P0VH 1AQDB 1YPZA 4FQCH 4CGTA 2W0KA 3DURA 4RAVB 1IARB 1V5JA 1OP5K 3PDOA 4U1JB 3N1PC 2Q7YA 4FP8H 5TDNB 5K59E 1D9KB 1BVKB 1WIPA 5FYKL 3LKRB 1HHGB 2P8MA 2EH7H 1L7IH 4KZEH 1KENL 3V7MA 2B4CH 1UXWA 1P7QA 3EYFA 3G6AA 2DQEH 4X7TB 2QLVB 4LU5H 5EWIH 3UO1L 3REWB 3OB0K 4UIKH 5KZCB 2HWZL 3P4LA 2ZG2A 1JGUL 3GM0A 4XNQA 5IJVA 3FN0H 1J9CT 2NX5D 3EOYG 3O3EA 1IQDA 1MFCH 4G43A 5GGRY 3PWUA 4UTBL 4PRNB 1C5DA 1JPSL 3FRPA 4R2GC 4NZJA 2RQ8A 5C0CB 3QQ3B 4FMKA 1RK0B 1SMAA 4WGWB 5D7SH 3TZVD 3CLEH 3V0WL 2BNUA 4BFIB 4O2FB 4U7KA 1ED3B 3ARDD 4JQIL 5IW6A 3FB7B 3KPPA 5LAXA 2VYRE 4X6CE 3ULUC 4CW1B 1TZGH 5E6ZA 3CPLA 2D31A 1D5XB 4KHXL 4QO1A 3IU3A 3TIEA 1ZWIA 1F11A 3L3OA 4V2CB 1UB6A 4PRBB 4Z7UA 2IADA 1OAUH 4NFCA 5BW7C 1QVOB 4PJFF 3QXWA 2HH0L 4FQ2H 4OUOA 1U8QB 4LIQE 2NY1B 4WWID 4I3SH 4NUJB 3ELAT 3TNMA 5D96C 3WKML 5AG8A 5I16A 4V1DB 3K74B 3WCYA 2NYYC 3HR5B 4J12A 3FT4B 4M4RA 1G7QB 1U95B 4U6XB 3NCBB 5EO9A 2R4SL 3ZHLA 3ARUA 4XP1L 3QWRD 2CDEB 1H5BA 2NY6C 2Y9RT 4ODXB 5D2NB 1A6AA 5SWSD 4RCAA 3GB7A 3O2DH 4G9FA 1KGCE 5E1HB 2Z31C 4I0CC 4NQCB 3RZCD 1FH5L 4HJ0C 5I1AB 4M8QA 2Y6SD 4G8IB 3W11D 3C09B 3NZHL 5CGMA 3DRTA 3D85B 2FB4L 3T0BA 3W0WD 4MVBC 3QFJD 2FX8L 4GSDH 5JDSA 2B0SH 3RL1B 4Y16B 1ORSB 4KI1A 2KDGA 3Q6GL 4OD2B 4H88L 4NDMA 2J6EL 3PWNB 5CJOH 4JFPB 1KFAH 1ZHKB 4F9PA 5FECB 3IETA 1J8HE 2PXYB 2X89A 5HSFA 4K23H 2ED8A 4U1HB 2NTFB 5D1QA 4FZEL 2AI0L 2Y72A 3BPCB 1SYSB 5I1DB 3F65A 4NKMB 3EYOA 1JGLL 3MC0A 4OUUB 4XVJH 5GGSA 1A6WH 3THML 3FFCA 1W72B 4NPYB 3OKLB 3ARGC 2VZSA 3CX5J 1NL0L 4WHCA 3IDGB 2NCMA 4L8DB 4LCYA 1AD9B 1MFEL 3HPLA 5EH1A 1HZHL 2YD8A 4O4YL 4R3SA 3S96B 4WY7H 5C86A 3I6LD 2JCCA 1T3FA 2AJSH 1MCFA 3MRDA 1PG7L 2P24A 1VEPA 2YSSA 4MQ7A 1H3TA 1QP1A 4GW5A 5DQJB 1IM3B 1CFVH 5CJ5A 1OP5H 2W0PA 1ZE3C 3CU1A 3OPZH 3P4NA 3BT2L 3BEVB 1GVIA 1KLUA 2X44D 4RRPA 2E6QA 2WIMA 4G3YL 1S7SB 4QRSA 1NGZA 1T7WA 1DFBH 3SO5A 5IOPA 1NBVL 3MOAL 3QUZD 4G6AD 5IQ7L 1GYAA 4JO1H 5DHVB 1KEML 6FABL 4JCMA 2BHUA 1S5IH 2D7NA 1A6TA 1QBML 1U8OB 5DYOA 1EO7A 3KWWA 4HKZA 3UJIH 1IGJB 3BD3A 3IS0X 5IQ9A 3C5ZA 4LNVA 3HNSL 3NCYS 4JO2H 3IXAA 5IMLA 3ARYA 2OJEB 5EUKA 3GSNL 4FG6D 5EUOB 1KPRA 2HYMA 3GMMA 1FFOA 1J05A 2Z0BA 5TE7L 3DROB 3HB3D 1EXUA 1ZLSL 3B9DA 1XH3A 3NIDE 1MLBA 2N7AA 1LNUA 4LFHG 5I66A 3LQAL 3QUMH 1RVFH 1F2XK 3MV8A 4Q9QH 4XAKE 3TFKD 5KANG 4FN0A 4Z7WB 4PV9B 1FZKA 4OFDA 4G8GB 4QCIA 1U3HD 5FO9A 2F54D 3F7RA 3JWDL 5KOVC 2D7PA 5BRZE 2DQDL 2HTKD 4X5WA 3BP5A 4FQQB 3V8OA 1HHIA 4IDJL 3AMKA 5F6HJ 5CS7A 4ZSOE 1A64A 2HMIC 1A14L 1XF3A 4RISH 1QSVA 4NWUL 1DVFD 4JM4L 3RGVC 1PLGL 3T2QA 1MFBL 5CZXC 3RVWC 3W9DB 4D0DA 1IC5L 4TVPH 1YN7A 1X5JA 5HVGB 1OGAE 2A6DA 2GCYA 4UT9H 2L7JA 3OKOA 5C09D 4UTAL 4RIRB 1I9RH 4QRRB 1EEZB 1CFQB 5DRNA 1AGDA 3FB8B 3CU7A 1GGIH 1UYWL 2RJMA 5I6XB 3HMWH 1JWSB 4DZ8A 3PWPB 3ZYIA 1MRCH 4ZUVB 1UM6H 4JR9H 3SDXB 3ARBD 5SWQA 4LPXA 1W0YT 5HI5D 4PJDB 1PQZB 1DLFH 3HMXA 5CGYC 3GKZA 3MYJB 4UNVA 5HD8D 4PJ7A 4Y4HC 4I0PA 4PREB 3QP3A 4XBGB 4Z0BH 1SJHA 5B8CA 1JRHI 3S36H 2SEBB 3JV6B 1LP9E 4R90H 1FYTA 3LV3A 1NCDL 1DUZA 4OCSL 4WHYG 2W1NA 1EGJA 3U79A 2WLZA 4WWKA 4IS6A 1Q0YL 2BVPA 2BOCA 4HWBH 2ID5A 5F9WB 4PRIA 1I4FB 3UMTA 2XFXA 4WEBH 4KMLB 4NQXA 4QOKE 3WHXA 1R24A 1D9KD 3KYNA 1F02I 4WJ5B 2I07B 5I19H 4P9MH 2XWJA 3V6ZA 4A2MA 3MRRA 4YNYB 1PY4A 1CXLA 3HE6C 5B22A 3SKNA 3ZHKA 1FLTX 3FQRA 4LKXB 1CDIA 1D5IH 2DQFB 5IT2H 1WTLA 1QFPA 4N1EA 4PJAE 1MCEA 5EUOF 5C6TL 4F57H 3CC5A 3H8NA 4U1GC 2X9YA 2ARJQ 2CKNA 5F9OH 1MEXH 1M6OA 1T5XA 1I85A 2X5PA 3BO8A 5GJSL 1YYLH 1E6OH 2CKBB 5CWSA 3VXPA 1A7BA 4GJTB 4DCQA 3EJYC 3BKJH 1FJ1A 4FQ1H 3NA9L 3QIWB 4YDJB 4Z7WF 5E94B 3H0TA 2B7DT 3VMOA 2OR8A 2VERN 3QXAB 3X11A 2ZUTA 1MVUA 2M2DA 2W9DL 1L6XA 2VDKH 4ZFFA 1YPZB 1MCQA 2VC2H 5D93C 1J87A 3PDOB 3L3KB 2CK0H 1FFPA 2QQKL 5GGTA 2P8MB 1A7PH 1UXWB 1F6AA 1IC4H 1P7QB 3G6AB 1J1PL 1DBBL 1N7ML 4AIZA 3D9AL 1IQWH 3KDMA 2Z4QB 4NN6B 4Q0XL 4OZGF 2PNDA 2HLFC 3BAEH 5IJVB 4QXGH 1PAMA 4H8WH 2M8XA 1IQDB 4EOWH 3WE6A 3PWUB 2A38A 1REIA 5HHOA 4XMLL 3PHQB 3SDXF 3SKJH 1C1EL 3KPRE 4PJDF 5JA9A 1MCIA 2WINA 4HS8H 2Z35B 5FO7A 4I2XA 3FCTA 3TA3D 1AHWB 5L8KB 1MNUH 3KPPB 4NQCD 1UEMA 4OGYH 1V3JA 1OAKH 3ZE1E 1MCNA 5GS0C 3NIFF 5A2KH 1JYNA 3STZB 1JYVA 5IFAL 3QDAA 4YBQD 2VLKD 4OZHA 3IU3B 3TIEB 3MLVL 1MCJA 1ZWIB 4WTWA 1F11B 3CMGA 3HZKB 3L3OB 2RFXA 3LKPB 1R3IH 3X3GH 3GSQB 4Z7UB 5I75C 2NY7H 4HF5H 4LGRB 4LPYA 4FHBD 4JDTL 4OQTA 2GSIA 1S7RA 1RUPH 2VITB 2NX5A 4JQVA 3MODH 2R4RH 3PXHA 1A4KB 3GSUB 3TNMB 4JAMA 5I16B 2FH8A 3R1GL 1FV1A 1KACB 1CD8A 4OZFG 2D0FA 3TZVA 4WUUA 4ZFGL 3KJ6H 4FNLH 5EO9B 1ZT7A 5FYKE 2YXMA 4F33A 3QCUL 4P2CG 3GDBA 5C08B 4MA7H 2GJ6A 3DV6B 1A6AB 4LLYA 3HAEB 3TESA 4G9FB 1OAQL 2D7OA 5DD0H 4WEUD 1GGCH 5B38B 1BWWA 4RDQG 4M8QB 4KHTL 3IFNL 2XG5A 1V3MA 3UC0H 2G5BB 1BD2A 4CN6A 5GSVB 5IWLC 1CLOL 4F58H 4ETQA 3DRTB 4NQED 3IRZA 4K3EH 2HA1A 1KOAA 3P11L 5JDSB 4ZTOL 1X44A 1MCWW 2B2XH 3QIUB 1EVUA 1Z9OA 4BFGA 4UZGA 3OAUL 4AYFA 1INEH 3MLZH 4PRHE 3IJSB 1FZJA 3DLQR 3WLWC 1YPZF 1T5WA 1CLZL 4XNUH 2FO4B 4ZOAA 3IETB 5H35B 1RU9L 3QWRA 1JIBA 1XF5A 2EO1A 5D1QB 1N4XL 1ZGLA 3RZCA 4M7LT 1OGTB 5BCAA 3UPCA 2UY7A 1HH6A 1ZT4A 4HXBH 1QSFA 4HT1H 3D2UA 3FFCB 4OD3L 2H26A 2PO6B 4AM0A 3EBAA 4XBEH 3QFJA 5MERB 1XR8A 3OAYK 4LDLB 4QYOA 3C60C 1AXTH 5DTFA 1BFVH 2RHEA 4LCYB 3U46A 4ESKA 5C0NC 3HPLB 2E8YA 3E0GA 2MSPA 5JZ7C 1HKLH 2BSTA 1B0RA 4ZXBC 3HZYB 3WIFB 4GBXA 3QDGE 1T3FB 4D8PB 4Z95H 4UIMA 1ZV5A 4DGVL 1ZHNA 4NBYB 1FNEB 4WO4C 1CFTA 2YSSB 4MQ7B 4UINL 3SDDD 1QRKA 1IFHL 4GW5B 4PJBB 4KQ4H 5EZLA 2Z8VC 1WAAE 4LEXH 2OI9C 3LHPH 3D87B 1UZ8A 4Z7UF 1NGZB 1WSST 4XCCH 3KLSA 4H0GA 5IOPB 2FWOB 2R0WL 5EC2B 1OP3K 2DM3A 2CO7B 3NGBC 1JGVL 4PJEB 3O9WC 5HGBA 1A6TB 3K8MA 4HKZB 3KWWB 4P5MA 4DUWA 1OARL 5EIQA 5CAYB 1BFTA 1R5IA 5IMLB 4LL9A 3RX7A 1JZ2A 1RZJC 4X4ZA 3GGWA 5EUKB 2XKUA 3B9KB 1KPRB 1YEKH 1FFOB 1J05B 1TZIA 2HJKA 1Q1JL 1XH3B 2B4CL 1E27A 1HWHB 1LNUB 2FX7L 3QZWB 1BMGA 4UT7L 3L7EB 1FBIH 4X6DA 5I66B 3MV8B 3EFFB 2VDLH 2DQTH 1J1OH 2H3NB 2C3VB 1GPOL 1XF4A 1FZKB 1HYSD 4Y2OA 2OL3L 4QCIB 9CGTA 5FO9B 1CZ8H 1YQVH 3NN8A 1FZMA 1BGXH 5T5NF 3VXQA 3BP5B 3I6GB 4TTDC 4OF6A 3U82B 4LLDA 5T3XL 1KXTB 1XF3B 3CLEL 1NBYA 5D8JH 2EECA 5AZEH 4I8DA 2OSLA 5DSCB 4WEMB 2PYFB 3OKDB 4D0DB 1J7VR 3V6OA 4FQJH 2GCYB 2A6DB 4LSPH 4D9LL 3OKOB 1Q72L 4EXKA 4Q6IA 4LAQL 5DRNB 1R0AL 5FKAB 3SJVB 4DZ8B 5D7JC 5SWQB 3T0ED 1UWXK 2Z92B 4HPYL 1GOGA 4XCEB 4DW2L 2D9QB 4WI4A 1NEZG 3JVGC 1G7JB 4KROB 4FQ2L 2BJMH 4PJ7B 1U42A 3H3BC 5D2NC 3CVHA 1SJHB 4I3SL 4RA0C 3PGCB 1E4XI 1QO3B 4JKPH 4Y5VA 4HH8A 2OP4H 1S7UA 4CNIA 3LV3B 1DUZB 1NSNH 4MAUH 5DJCA 2JCCF 4M6NL 1KYOK 3ARSA 2DMKA 1A3LH 1E28A 2NR6D 3GHBL 3DETC 4K3DL 1DDHA 2V5TA 3WO4B 1HQRA 4Y16C 1IC7L 2XFXB 3QUYD 4R26H 4NQXB 2BY2A 1TJIL 3EYVA 5DJ2A 3ARBA 3SDCB 4JRXD 1JF6A 1HNGA 5MHSD 1R24B 3KYNB 2QSCH 3V2AR 1SVCP 3CK0H 2HT3C 2V5RA 3L6FB 4Z7VA 2XWJB 3V6ZB 3ORJA 1EZVY 3EYQD 1NAMH 2PXYC 3MRRB 3O6MH 2B0SL 4OV6F 3SKNB 1MIEL 1CF8H 3FQRB 3L95A 1X5HA 4OJFH 1OF2A 5CP3H 4O58H 4A6YB 1J18A 4TNWF 1KLFA 3F8UB 2CUHA 5CJOL 1UWEL 1V3KA 3MRJB 1OW0C 4NQDE 1PEZA 3FT3B 5KSUA 4JKKA 3CC5B 1QLRA 2FBJH 1A6UH 5C0BE 4OI7A 2ICCA 1F3RB 4QHLA 3VXPB 3KS0J 3H42L 5CWSB 4CKVX 3KPQA 1FJ1B 5EBLA 2CUMA 1D5ZA 5CD3B 3H0TB 3X11B 1IGFH 3VMNA 5BV7C 4ZFFB 3OX8A 1J0HA 3MCKA 2IG2L 1FAIH 1N59B 1BREA 1D6VL 1DEEA 5GS2H 1P9MA 1RK1A 1FFPB 4JB9L 4C59B 1NGQH 1UH3A 5I1KL 4M9PA 1F6AB 1Q9WB 4LFHD 1URLA 1A7OL 4WY7L 4NOFA 2GYSA 1T04A 4JY4A 3IDIB 1R3HB 5LGHH 2HFEB 4XB7A 2DTMH 2A1WL 5DWUH 2FJGA 2HKHL 3L3GA 4HIEB 3VGBA 1CFVL 3LQZA 4R7NA 3WE6B 2AXJA 5F21B 3HA0A 1K4DA 4OLVH 3G6JA 4GKSB 1KCKA 3B2UD 4WGVB 3OKNA 5HHOB 1FPTL 4XHQA 5K9QI 1ITCA 1CK0L 2DD8L 2WINB 5FO7B 3ZKMD 2MNUA 4JO1L 1P69B 4PJ7F 5E2JA 3B8YA 4JLRA 4XPHH 3ZKND 4IBLT 4U05A 1KTDA 3W2DH 3VI3F 3SGDH 1CBVL 4YBLB 3GMPA 5IMKA 3GJFH 2BCKB 1A3RL 1AE6H 2VDMH 3O8XD 1ZMYA 2NY5H 2RFXB 4PRPE 3QI9A 4JFFE 1T89A 3HTLX 1EHAA 3JUYA 3ZTJG 3QIUD 2GSIB 1S7RB 2XZQL 4HS6A 1J0KA 2NZ9D 5DC4B 2I60H 1IT9H 1FGVL 4HBQA 4CMHB 1JHKH 3C2AH 3UPRA 2BERA 3W5MA 4LMQE 2XT1B 3EHBD 4PJGE 2Q87A 4MAYC 5A3ID 4WUUB 4JPIA 3ZDZE 4UILL 3UDWC 1S9KC 3TA3A 4C83A 2P42B 2VZ3A 4F33B 3KYOA 5DEGA 3LN5A 1CXFA 2GJ6B 1MWAA 1UCBH 1ZHLA 3MXWL 2AQ1A 2BVUA 4YDLB 2VLRD 2IPKB 1AKJB 2ZCKH 1HCFX 4M61B 4TVPL 3I02A 4L3EE 1Z3GL 1QSEE 4AEFA 3GUTA 1BD2B 5BVPL 1I8MB 4GT7A 4H1LA 3IAGC 2V2TA 2WW8A 3WMSA 4X9GA 4A2LA 3MBEA 1MQKH 4JR9L 4EDXB 3HG1B 2RR3A 1J11A 4O02H 4M7JL 5ID1B 4LCCC 1F00I 2I24N 4CU7A 3FL7A 1FZJB 1T66D 1FO0A 4GS7B 3DRQA 2PCPB 3OKEA 1YYML 4BFBD 1BF8A 4Y2DC 4LK4A 3WS3A 3I2CH 1XF5B 4UBDC 4R90L 3RUGA 2R9HD 1P4LA 3FFDA 1ZGLB 4CVUA 4HIIA 5INDA 3VI4F 1HH6B 1QSFB 3DX6B 2GY5A 3TGXA 3D2UB 2BFVL 2H26B 4AM0B 4XHJD 2DI7A 1MHCB 2VXUH 5GS0L 5CGTA 1U8KA 3DO7B 4DK3A 1UZ6E 2X1PA 3B9KD 3U46B 3DHJA 4QLRA 1AR1D 3JTTA 4N9GB 4DN3L 4GBXB 3QJFB 5L88L 2VDNH 4CUCA 1CT8A 3SO3B 5A43C 4XWOC 4Z7QF 4UIMB 3H9SB 1H3XA 3QIBC 2DICA 5DJYB 1EHLL 4JRWA 4OZHF 3GKWL 1MH5A 3QIWC 2Z8RA 1MJUL 4KUCD 4OM0L 4F57L 2LE9A 5EOCL 4P2QE 3QDJE 3S5LA 3P40A 2H2PD 4FQXD 3WIHH 3L3HA 3WIIL 5HPMA 5L9DL 1CGSH 5C9JA 4EN3D 4PJ5B 2G75B 4TSCL 4M7ZB 4NKDB 4P5MB 4G6FD 3SOBH 3WJJA 5J06A 5E6YA 2W0FA 5CBAB 1R5IB 4NN6C 2OK0H 3VG9B 4FTVE 4Z0XB 1RZ8B 4J3VA 3P0YL 5KSAD 2HJKB 5DLMH 3X3FH 5HY9A 4EUPB 2OR9H 3FO2A 3HI6L 3EYUL 1E27B 4N0YL 3SDDA 4Y1AD 2FLBT 1N6QH 1UB5A 5L2JA 4OCYL 4MD5B 4UB0L 1KT2A 3UZQA 4DKFL 5JHDD 4I1NB 3B5HA 4KTYA 1XF4B 3R8QA 3TH3T 2PN5A 2EYRA 4QXGL 4WU7B 3NN8B 1EEYB 3WUWG 4X6CA 3VXRB 2GHWB 1ZA3A 3ULUE 1AGCA 1SYVA 3PWVB 3TBVA 1FIGL 1CR9H 4LLDB 1T7YA 4UT6L 3MMEB 1QFOA 2OSLB 5DHXB 3GBMH 2FEEL 5CJXA 5BXFA 1MCLA 1MCPH 2ADIB 3CXDL 3LN9A 1O7SA 4LASH 1NFKA 4OGYL 3RIAK 1OAKL 1RUKL 3TYFA 4C4KT 1MJJA 3D39B 4BKLB 3UTQB 5DD3L 4Q6IB 3SE9H 2X1XR 3B2VH 4KK9C 4M7LH 3D69B 3RVTD 2BNRD 5FYJD 3H9HB 1DL7L 3T65B 3FB5B 5IVXA 2VH5H 4LCWB 1QFUL 1NBZB 1QFWI 2Z91A 1NCAH 3OJVC 5JUEL 3BD4A 3VWKA 3MUGA 1H5BC 2R4RL 4DGIL 4AY0A 3CVHB 1HXMA 1IC1A 1YECH 3ABZA 2CIIA 5E2WH 2E7MA 1ERNA 3WN5A 2AK4D 5KVEL 4IMLA 1GIGL 1FCCA 4ONHA 5GS3A 5TH2B 1M4KA 5DJCB 4PBWD 2R23B 2A9MH 4ELMB 3QXUA 5JOPD 4JM2B 2XZCL 2X4QB 4NO5A 1AGEA 1E28B 5ICXA 5KVDH 1RD6A 1DLHB 2ILLA 3I6KA 3ULUH 3D0LB 4X4YA 5FF6A 2HG5A 4J7RA 5DQ9B 2E9BA 1AJ7H 2PUQT 5HYSG 2IBBA 4DOHB 1OLLA 4W4NA 5DJ2B 1K3ZA 3S88H 4PJIE 2YD1A 2R1YA 5J3HC 5I8KH 4JRYA 3RGHA 2HN7B 1VCAA 5HJ3A 5CBEA 4Y4KA 5F3HB 4BELD 5EO0A 4F9PC 1V05A 5EBGA 4MNQA 1XIWD 1ZSDA 3QO0A 2Y36L 2EDBA 1BM3L 3U30C 5D1QC 3L95B 5T3XE 5D72L 5B3NA 4NFDA 4HCRH 3NPSB 2V17H 2A83B 4NBZB 4ZQKA 1JVKA 4HK3J 3U48A 4UDTA 5ITBL 4NN7B 3LRSB 1IGIH 5D7KE 2XTJB 1F90L 2A6KA 4XNMA 5KSUB 4RFEA 2VDQL 3QJHB 4CL7A 3P9WB 4YX2H 1F97A 1QLRB 1RHHA 4YEFA 5JHLH 3PQYD 1EFXD 4BSVA 5HGAB 1J5OL 4OV5A 4XXCA 4X6DF 2WIIA 3MACH 4XPTL 4ZUWB 3MJ9A 1X5XA 1I1AD 3DARA 3P4OA 5GQBA 1RUAH 1NH6A 3OX8B 3MCKB 4YDKL 5C2BL 1DEEB 1DQLH 1AY1H 1FP5A 2GJZB 5JNYB 5BZWA 2AJUH 4TNVF 4HWUA 1BFVL 1P5UA 3RPKA 3MOBH 1QZ1A 5F8QC 5EU7C 2MCPH 4OZIB 2EDTA 3QRGL 4MMZC 1C5BH 3ECBB 4IRJA 4JY4B 4XPBH 4HXAL 2EKSA 5INCA 4B5EA 1ZLVK 8FABA 3VFTA 2FJGB 3L3GB 2UV3A 2R8SH 2AJYH 5JR1H 3KLDA 3AAZB 3CJJA 3G6JB 1FCGA 3C5ZC 3BI9X 5DEZA 3HZMB 5C07E 5TF1L 3BYTA 1KJVB 3REVB 3BRGC 1VFOA 1MHHB 3D25B 3MJ7B 1SY6L 2Y07H 4JLRB 5DR5H 2R29H 1KTDB 2DF3A 3RWIA 4WUKH 4G6KL 35C8H 3B43A 1R6VA 4U1SB 5D6CA 5IMKB 3NCEB 4MQSB 1E4KA 2FDBP 5GZNC 3L5IA 2Y06H 3BP4A 3VXMD 5IEHB 2LTQB 1JFQL 3ILQC 3P77A 4AL8H 1OAZH 1MPAL 2DQTL 5I1LA 4X9HA 2YOCA 1AC0A 1VGEL 4H5SB 3OXSB 5I8EB 3UPRB 2I9TB 4WW2A 1QBAA 4MNGB 3MGOA 1FNAA 3HRZA 1OGAA 3GO1H 1MVFA 5FO8B 4JPIB 4Z7VF 3VXOA 4C83B 1U8IA 1K8DA 1LE5B 4JPKL 3KYOB 3KYKL 43C9B 3LN5B 1B90A 1ZHLB 5DJ6B 4LF3A 5D8JL 5E9DD 3QEQD 4TQEH 5H37G 5CEXA 4YFLI 5F96H 2OXGA 2F15A 3U0WH 2V2XB 3O8XA 5ENWB 3ZKXB 3GUTB 1WQVT 3EFDH 1A0QL 4F7MA 1C7SA 5JW3L 4I0PC 5BV7L 2Z93B 1F8TH 4H1LB 1T20A 5B8CC 2AEQH 2V2TB 5JTWA 2FGZA 3LKSB 1LP9A 5L2KA 2EXYC 4LLAA 2IJ0C 4Q6YA 3K2UL 4JFHE 4NZRH 2AK1L 4AJ0A 5IBUG 3MLTA 4J23A 3FAXA 1ADQA 1A9EA 4CVXB 4WWKC 2BRRH 3HRPA 4BYHA 1FO0B 1F2QA 3KPLA 4S1DC 1PSKH 3DRQB 3IKCA 3BP7B 3WS3B 4PUBL 3ZDXF 2KZWA 4OI8A 1P4LB 3HHRB 1ZOXA 1UADC 2JIXD 4G9DA 4YHML 2AP2A 2VLRA 1BQHG 1FL6A 4PGBB 2OTWB 4Q58C 4HIIB 2UYLA 3LEXA 1A22B 4KDVA 2ZUXA 3PE9A 4LSTL 1BPVA 5FB8A 5K9JH 5D1XA 3TM6A 1RZKC 2R56H 4M03A 2X4RB 3TNNB 3HFML 1IGCH 1RMFH 4Z8FH 1GZPA 3G6JF 1U8KB 3BJLA 3GSOA 4CJ1A 1AXIB 4OZ4A 4PJAA 3CK0L 1UXSA 1UACH 2NY0B 3MRMA 4XTRD 1OCWH 1R3KA 3VFNA 3LS4L 5JIIA 1P6FA 4K9EL 1CT8B 5I1EH 5B4MC 1CF8L 1I85C 1TIUA 2Q8BH 1UKTA 3SKUD 2NMSA 3F6IA 1QPXA 4J3SA 3DI3B 4KUZL 4NO0A 1BOGA 1MH5B 1WC7A 2BOBB 4XI5C 4OFVA 5CP7B 1QBLL 1TZHB 2DAVA 3RU8H 1YY9C 4W6XB 5EBWB 2WV3A 3JZ7A 3C5SB 1CTOA 5CILH 1NMAL 1CDUA 1JHLH 2AJXH 2UZIL 1W0VA 4WI5A 5C9JB 5C3TA 3EOTH 2QR0B 4TN9A 5DJDB 3PUCA 1T1ZA 1FAIL 1VENA 4HLJA 5F6IB 5J57B 5FEBA 5EULV 2VXQL 1K5NA 1UB5B 2H41A 4FQIH 5I9QB 4QY8B 5TGBA 4EI5D 1ROWA 3FO0L 4LSUL 1KT2B 4ISVA 3G6DH 3T3MF 5FCSH 4RAHA 4N0UA 3CXHK 1SEQH 4JANA 4LPUA 2C9AA 2ZCHH 3MZTA 4PP1C 4R97B 4X6CB 1YEFL 1W2KT 5KBNC 4P2YA 4YBLC 4EN3A 1BECA 5FUOL 2MJWA 3UZEA 1LGVA 5C0GA 2MKLC 1CD1A 4LNRA 2CO6B 3UTPE 5I1GH 5BXFB 3ULVH 3MRNA 3TYFB 4JQVC 3QHFL 4F8TA 2VSCA 1DR9A 4POYA 3QPXH 3RUGF 1G6VK 4LCIL 2W9LA 5FGBA 1JWMB 2IH1B 5IVZB 4F2MA 3LSOA 1AGFA 4JHBA 3TZVC 5JHDA 4KK5C 2DJ4A 2WBJD 3A6BL 4L8SA 3UP1A 3G5XA 2BK8A 2AXGA 3ARDC 4YC2C 3CSGA 5D1ZB 1P7KA 2Z91B 3JTSA 1MLCB 4C54A 3C5JA 4RWYH 1RZ7L 3WN5B 2R0ZL 5EIVA 2ZKHH 5GRUH 3VW3H 4G5ZL 5FCUH 3KR3H 4ZPTA 3FMGL 5I18L 1T6WA 2NQCA 5F88A 2ZUVA 1AGEB 5EC1A 5ICXB 3G5ZA 3S8WA 4FFVD 3A67H 4X4YB 2DLGA 5KANI 2HG5B 1BZ7A