5IGXH

Crystal structure of nih45-46 fab germline precursor in complex with 426c.tm1deltav1-3 gp120
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
219
structure length
192
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGKYCTARDYYNWDFQHWGQGTLVTVSSASTKGPSVFPLAGCLVKDYFPEPVTVSWNSGALTHTFPAVLQSSGLYSLSSVTYICNVNHKPSNTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 426c.TM1deltaV1-3 gp120
publication title Structural basis for germline antibody recognition of HIV-1 immunogens.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 29
structure length 192
sequence length 219
ec nomenclature
pdb deposition date 2016-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5igxH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5igxH01
5D7SL 4JFED 4XP9H 4NNYB 2PO6C 5CD5D 2AXJA 4LQFL 2WBWB 3OKOA 1UXWB 3O81A 5IVZA 4NHCL 3T0BA 1LWRA 3H8NA 5A3ID 5CJQH 5E6IA 4JFXA 1NANI 1KJMB 1R3LA 3C2AH 2VXQL 4QHNA 4MDJA 3DRTA 5ENWB 3VRIA 5HHQA 4KKAD 4UI2A 5DEGA 2HLFD 5BRZA 3NN8A 1TJHH 4JY4B 5DQJA 2H2SD 1F5WA 4Y1AB 4FQLL 4QKXB 4PG9B 1IC7H 1FSKC 1AGDA 5BCAA 3MCKA 4PJEA 4YZFF 2CMRL 3I75A 1FVCA 3S88H 3MV7E 2ZZUT 4GLRI 5I1CH 5JHDA 3QRFM 1TETH 4Q7DA 1CGYA 2EE9A 4XMLL 1U91B 3QUXB 4JPIB 4E41B 2AXGB 3EO9L 2PYEB 5ICZB 3FN0H 5HTSA 4GKZB 2FSEB 1KTLB 1Z9SA 2JCCA 3HZYA 5KSAA 1JGDB 5IROC 4NKIL 4HSQA 3UAJC 2DYPA 5DMKB 4ZS7H 1AIFA 2XT1B 2DQDH 2CQVA 3HI6L 1NKRA 5EOCJ 4PBXA 4WU5A 1ZT1B 2OJZL 3ES6B 2Y36H 1NSNL 2VXUL 2W0FA 4BZ2L 1JGLL 1T22B 4FTVA 4XCYB 3EHBC 3OG4B 4I5BA 1J0IA 2AJ3B 1CBVH 1LE9B 4ZUTB 4X6CF 2FHBA 1KCRH 1PQZA 4MQ7B 3WIHH 1JYVA 3MCLH 4GUPB 7FABL 2I60H 5IVXA 5F7FA 4OD1H 5K9QI 2ZCLL 2D0FA 1EXUB 3UJTL 1E27A 2FEEI 5IR1A 4MNGE 2A1WL 4JFDA 3VGDA 3UTSA 1JNLH 3ROLA 2Z31A 3C08L 1WCBB 3CPLA 3F6IA 1EFXD 4YPGB 4FQPA 1JRHL 3LRSA 5GSVB 3BYTA 1WAAF 4PJDA 4U1IB 5CZKA 1S7WB 3C09C 4XCEA 3CXDH 1JPSL 1PW3A 2LVCA 1F4WL 1IC5L 3U6RB 1MCBA 3SE8L 2AAVA 4OLVL 3IETB 2VERN 4HKBB 4QRPA 5JXAH 4HKXB 2I07A 1X3DA 3MLRL 3QWOA 4K07A 2Z9TA 2CRZA 3KPMA 1NGQL 2P8MA 3DRQA 3REVA 3S4SG 2IAMC 4LLUB 1MCOH 1RIUL 3KPRE 3EO0B 4DKFH 1U8HB 3H9SE 1OPGL 4ERSL 3VGHA 3HAEG 2XICA 3VFVA 2E8ZA 2J88L 4ZTPH 5HSFA 3L3OA 3A6CH 4PRAA 2LTQB 2XQBL 2X1WL 3B9KB 3BDYH 5FHAH 1E4WH 2BVOA 4N8VG 1GC1L 5HXMA 4GSDH 4YC2C 5E00B 1PZ5B 2Q8BL 4I4WB 3K4ZA 2UWEF 1T1XB 2CK2A 4WUKH 4X7CC 5JXEC 3MRIB 3ZE2E 1UKQA 3LQAC 3MV8E 3DV4B 3BZFA 2I5YH 1CDHA 1YC8A 5CEZL 4W6YB 3WEXA 3G6DL 2VLKB 2VLRA 3GSRB 1BM3H 3P4MB 3V4PH 2DJUA 3D3VB 4JFFE 5DC9B 3V8OA 1JNNH 1J1OH 1Y6NR 3E6FB 3QDGA 4G7YL 4I3SH 1U8NB 4LHJB 3QI9A 5LCVH 5C2BL 5CUSH 3FB8B 5J0BA 3FT4A 1LHZA 3HG1D 2WZPD 5CKGA 2BFVH 4N9GA 5FYLD 4Z7UB 4P9HH 4IS6A 1FLRL 2DD8L 3NFNA 1S7TB 1Q1JH 4DN3L 1OTTC 4NO2B 1HI6A 4PRBB 4Y4KB 4JHAH 4FA8A 5EDXA 2B2XL 3CUPA 1NAMH 2HFEA 1G7MB 1X7QA 2Y4SA 4OM0L 3HC0A 4OGYL 3H0TB 3N9GL 4PP1D 4X6BB 4XCFL 3B6SB 4L8SB 3D87B 3OKDA 4KKCC 5JMRA 1PFCA 1T7VA 5GRZA 5KW9L 3BPLB 1FAIL 4NFDA 1TVHA 3CVHL 1A4KB 1RJLA 3UJIH 1F6AB 3MBED 4PLKC 2VO5A 4JKPL 2P44B 1RIVH 1NMCC 3S96A 2HP4A 3MLTB 1KSRA 4IIQA 4PJBA 1FLTX 3SDCC 2K1MA 3S3JA 5I74C 3ZT6A 4MMXC 4YHMH 1YEFL 2F58H 5C0DB 4IDLA 1T04B 1FV1A 3MREB 2A6KA 3CFEA 3VWKD 4ZG1A 1OSPH 1KJ2A 3GHBH 4KK6C 3DJ9A 4PJFA 3O3BB 2E5EA 1BEYH 1ZTXL 2IG2H 3QCVH 4H20H 5HHME 1U3JA 4XX1G 5I19H 5JZ7D 3FFCD 2Z35A 1T7ZA 5E2WL 5KN5A 2XN9A 2CKBH 4P5MB 2E6PA 3BN3B 2J6EH 1OVZA 1I1AC 1F58L 2VYRE 1NUFA 2FX9H 4NHUB 3CGTA 2XY1A 2YUWA 2HKFH 1NCCH 5EOCL 1YJDL 1T1ZB 4ELKA 4EOWH 3QXTA 3P9WB 3P30L 2AJXH 5IB1B 2YD7A 1AC6A 4F33B 5GGSA 3T65B 4MA3A 3DMMC 5EOTB 2X9XA 5HGGS 5DUMH 4ALAL 4EI6B 3PQYA 3DO3A 3QZWG 4JGUA 4JRXD 3IAGC 1G0XA 4ZUVA 2XWJA 1L6ZA 3KPLA 1JK8B 2I9LA 4QTHB 4F7PA 4TNWK 1KN4L 2IALA 5HYJA 3CIQA 3W5MA 5KVGH 3O2VH 1BWWA 3C5ZA 3P11L 3E2HB 1FZJB 3RU8L 1PZUB 5AZEL 1V3KA 3D0LA 1JHTA 1T83C 4PTUB 4PJGA 5DRZA 2VZVA 4K7PL 4MD4B 2DJ4A 4UILL 3BISA 1BQSA 4QT5A 2V5RA 4WRLA 3FONB 3LN4B 2C3HA 9CGTA 4OCXH 3VFNB 1EFQA 1K4CB 4F58H 4F3FA 1UVQB 3CMOH 2JJTC 3FFDB 3WNLA 3I9GL 1GGYA 4IDJH 3VXRB 4NNPH 1ED3A 1D6EB 5EU6B 2DI9A 3B2UD 2RHEA 4NO5A 1IZKA 1CZ8H 4WHTB 1DUYB 2VH5H 1ACYL 1YEHL 3LVEA 1GRWA 1U8LA 1VDGA 2GYSA 4TTDC 5FCUH 3GZKA 2F74A 4EN3A 1TVBB 2QADB 4OAWB 1BJ1H 2PW1A 3CFJA 1Z2KA 4I0PD 3FCTB 1WEJH 1KBGH 4G3YL 3MV11 2WMPA 3GDBA 2OS7A 3EZJB 4C57C 5F7HA 5HD8C 4GBXD 1G9ML 1FO0B 3DBXA 3PGFL 5IJVA 5I66A 5AD0B 5IMLB 1ORQB 4OV5B 1Z9LA 4K9EL 1XGYL 1QFUH 3SDAA 5TGBA 4FQ2H 3OR7A 1JPGB 1PAMA 5B38G 3RI5K 1KIUA 1UYWH 5KSBF 3U46B 2NY5L 3UBXG 2F8OA 3OXRB 4FQIL 4JDZB 4HFUL 4WWKD 4QWWC 4XCCL 3ZKSD 4LK4A 3SJVE 2CIIB 3IT8D 1CE6A 4NKQB 3QIUB 1BQHA 4LPXA 4KXZI 3O45B 1Q9OB 3O6MH 2D4FA 2FLRT 4RX4A 5DD3L 3MRRA 2R2HB 1RU9L 5E8PB 3P0VL 4PRNA 4F8QA 2UZIH 2WIIB 3ZSTA 4FQCL 1YPZA 4FG6D 2XKNA 4FQHA 1V5JA 1KJMA 2P5ED 4FFWC 3M07A 5C0AA 3QUZD 3O0RL 4FQXD 2E3VA 3JWOC 5EUKB 8FABB 4AY0A 1B9ZA 5EORH 1VACB 3MV9D 5ESVB 2P46B 5BV7H 4ZAKC 4XNYH 2B5IC 5CINH 1NCBH 5GS1A 2DJSA 3C60D 4XAKD 4PG9A 1N0LA 3CFBB 1MRFH 3ROOA 1WZ1L 4JHBA 2VQ1B 1M05B 3DSFH 3BUYA 3SDXE 1BD2E 4NQED 5E2TH 1RMFL 3OTTA 3FQXA 4JKMA 5DS8B 4LMQI 4KDTA 1YMME 2FR4B 3RWEA 2J5LB 2HTKD 5F1NB 2CR6A 1DBKH 3GK8H 3H9HB 1QRNA 4GRWF 3EYOB 2Q20A 1N59B 4HIJA 1TXKA 4U49A 1D5XB 4KK5D 4NSKA 4FXGA 4ODUB 4YDLC 4M6NL 2IPKB 5D2NB 3LH2H 4PJEF 4K8RL 1CGUA 4HK0B 1EPFA 2HFFA 2AEPH 1G7QA 4P2QA 2YPLD 4OZIE 2OTUA 5ISZE 1KNOA 4HAFA 5D9SB 1D6VL 1CLCA 4HJJL 4DOHE 1HQ4A 4OZHE 4LVNB 4ODSH 4P46D 3CDYA 3WFBL 4GKNA 4TPRL 1JZ8A 1WIPA 5AYUH 2C1OA 1HH9A 2NY1D 5BMFH 4NCDA 4UV7H 1IRAY 1T22A 3W9DB 4A2LA 2W9DH 3ZE0E 1F4XH 1K4DA 2IFFL 3MRHA 2B4CH 2F9BT 2EIZB 3EUUA 3RVVC 2V2WA 1AY1L 5IJKC 2W92A 2ITCB 4H88L 2JK5B 3HPLB 4P2RA 4X9FA 5I1IL 3ARGD 2QQNL 2FD6H 4WW1B 1S78D 4F9LC 5IB2B 4OJFL 3O8XD 3I6GB 2D03H 2XTJE 3CSPA 1OF2B 2UUDK 3MROB 1KGCD 1DQMH 1S7WA 2GJ6E 4YHYC 3P9MA 3PL6C 2L7JA 3RTQD 3J8F7 4NP4L 3IETA 3GEWB 3RUGA 2A6IA 1FN4B 4C83A 5L88H 3U7WH 4D8PB 2L0DA 4L4TA 4NWTL 3IJSB 3RX8A 4PREA 4BH8B 3LB6C 2DIAA 2BOBB 4U6XA 3N0PB 1C12A 5KVMC 5FUZH 1BIIA 1T66D 4JZJB 4PS4L 5KZCD 4NQCA 1U8HA 4APQD 3FQTB 1M1SA 3PHOB 4PJDF 4JVUA 1KPRB 1BMGA 4XTRD 4HPOL 4ISVB 2NY4B 4ODXA 4WTWA 4U2YA 4DTGH 3AY4A 3SKJH 5J56B 4NQDB 4YDJA 3EDDA 2R0ZH 4L1DA 4U1NB 4DW2H 5F89B 4G6ML 4BZ1L 1CGXA 1TPXC 4LLQB 5LGHL 5E00A 5C0IB 3NFPA 4P2OC 3VWJD 2X4PA 2FH6A 4NPYB 4AJ0A 5JMOC 2AV1B 3SGJA 1I3VA 4L3CA 5F96H 3FOLA 3KXFD 4TUJA 5AUMB 5C0BB 1N7MH 1D5MB 5JNYB 3TBWA 4TQEL 3KPOB 1U8NA 3QFJE 4MDIB 3U9UA 1RK0B 1IM3B 1WITA 3MGOB 4Q0XH 1MJ7H 3BPNB 4NKOA 1T1WA 3K74B 1C7TA 2A0LC 3RVTD 2X4SB 4JFPA 4Y4KA 1S7UA 3VH8G 3DETC 4XVSH 5D7LA 4LLWB 1FNEA 1XFPA 4X7SL 3B6SA 5DJDA 5J1SC 1CLYH 4HHAA 1HHJB 4NNXB 1F97A 3MV7B 1CD1B 5EO9B 1A4KA 3MGAA 3O4LA 4ODHL 1EHNA 3MNZA 1F6AA 4ODWB 2EDDA 2R23B 3B5TA 2C1PA 3GSQB 3MX0A 4ETQB 1KELL 3MLTA 3BT2H 4LMQE 4KI5D 3G08A 4TULL 1I8MB 1Z9MA 3VRJA 4Q6IB 2ZSVA 1QBML 4YHKL 1YEKL 1DBAL 2NY3D 4PJHF 3GIVA 3SGEI 1L6XA 3MREA 4R2GC 5FB8B 4HGMA 1D9KC 2YKLL 5AG8A 2NYYC 1J7VR 5FYKH 3WN5A 2DMCA 4P9HC 5DVKA 5KVEH 3W0WA 1LGVA 1XF5A 3O6KH 5DJXB 4Z0BH 3G5VB 3IDJA 1JTOA 3LN9A 1FZOA 1D7FA 2OLDA 1A02N 1M7DB 1E4KC 4WTXA 4PLNC 3EDKA 5CWSA 2Q1EA 5KAQG 3DNKA 3AMLA 4AM0B 4PJFF 5ELIA 3MUJA 2XXCB 1J0KA 5DLML 1PG7W 4HGKC 2LAAA 4U31A 1LNUA 1OL0A 3WD5L 3BN9D 5DJZA 4HWEL 1P4IH 4WENB 1B0WA 1IFHH 1QLRB 4N1EA 2YR3A 5C0NC 2X7LB 3Q2CA 3QUML 3WIFB 5BZDB 4KAQH 4XB7A 3SE9H 4QTHA 4ONFH 4WDIB 5CZXC 5HBBA 2NW3A 3L3IB 2AP2A 1NC2D 2JELH 4YWGL 1KXTB 3QPQC 4N0YH 4MZ2A 3FZUC 2WBJA 4NFCA 3QDME 2XZCL 4M8QA 1PYWB 3HZVB 4MD4A 1PLGL 3BIAX 5F3BB 1QHOA 3MODH 2Y06H 3MYZA 5T3XH 2EYSB 2LE9A 2B0SH 4P5TB 1SEBB 5BS0A 1K3IA 5FECA 5DURD 5LXGH 1WGOA 3AU1B 1VA9A 2VMFA 4XNUL 4Z7WA 8CGTA 3T0EC 4C56D 2V7HB 1SMAA 4KTEL 4GH7B 1G84A 2VR4A 5IB4B 4PV9A 3GNMH 3MV8B 4PJGF 3WFCH 5JW5A 1QSVA 1LD9B 5GGVL 5DHXB 1UJ3A 1J1PH 4AG4H 4S1DD 3O3EB 3GKWH 4YEEA 4HPYL 2PO6A 4XBGB 3UC0H 2Q6WB 3HC3H 4QNPE 3SO3B 5D7JC 2D7TL 2PUQT 1VEOA 3FCTA 5DEFB 3RIAK 3EDEA 4CW1B 1BZ9A 4TOYL 5GJTH 2GSIB 3DX8A 1JBJA 4JM2F 1XR8B 3GRWA 5HVHB 3OKNA 2NX5A 2QEJA 3QEUB 5IMLA 1ORQA 4AIZB 2B1AL 1FVDB 4K3JH 1D3CA 3RX5A 1A7RL 2MFNA 4U0RB 5JLZB 3QUXC 3TNMB 2DDQL 1SYVA 3GGWB 4P3DA 4WI9A 4MX7A 2R2EA 3GSWA 4HUUA 3DROA 4LU5H 5ALCL 2R9HC 3MRMA 5A3IC 3LQMA 4JY6B 1LILA 4AEHL 1DL7L 5TQ0H 4PGEB 4JFHD 4PJ9B 3ULVE 4PJAE 3SKUD 3G9VA 5ADPL 2ARJB 1KLUA 4BM7A 5EBWB 4L4JA 3BP4B 3O45A 1CGSH 2R2HA 3KYNB 3MQIA 2GITA 2UY7A 1OP3K 3Q3GA 4Z76A 1NDGA 5J1AA 2QSVA 2QQQA 4M5YL 2E27H 1YEIL 4HD9A 5AWNH 5F88A 5GSRA 2FX7H 2R4SL 2MHAA 2BVPB 5TE7H 3ZL4H 1VFAB 1U2HA 4KY1L 4RZCB 4S1QL 1VCAA 5D8JL 5HHMB 3CFBA 4HIHA 4EI5C 4D3CL 1VFOA 2VQ1A 4EVNB 1YEEL 1I7UB 3A67H 4PUBL 1ZHKB 3KYMB 5FYJU 3GMLB 4H1LB 2DIBA 4OLXH 3QA3B 2EDBA 4G8EB 3A6OA 2R0WL 3ARDD 3HR5A 4JKLA 3BRGC 1N59A 3QNXB 1YDPA 3FO9B 4I48A 5CSZB 3AREC 3RA7H 4R0LB 3IKCA 5B8CC 3K8KA 1ETZB 1FGVH 3CFKB 5ADOL 1IGYA 2ARWA 3CZFB 5T1MB 4RA0C 2O61B 5IBUB 1A1OB 5SWZA 5E24E 1AHWB 1IAMA 2VWEE 5KG9B 1S9XA 2COQA 2A9NL 3KLDA 1LK3H 2BJML 4WEBL 1MHPL 1XGTB 3MRNB 2WANA 5I1EL 5K9OB 1FNAA 1JV5A 5DQ9B 4OGXH 5F3HA 5BV7C 3JTSA 1MI5A 2X5PA 3CH1B 5EBGA 1NCAL 1A9BA 1AD9A 2VR5A 1E6OL 3AAZA 3H42H 4BK5A 3BW9A 1INEL 4GRLD 1QVOA 3P4LA 1YEDA 5LG1A 2XA8H 4JRWA 3HPLA 3PF2A 4G6KH 4OB5L 3T4YA 2W59A 2VXSL 5CD3B 4U6VH 2V5SA 1OF2A 4Y2DB 4M4PA 2W9LA 1FYHB 4K3DL 4OKDA 4CUCA 2VITA 3THMH 5IKCB 4X6FA 2DBLH 2VLJE 2VDLH 4MAYC 4BH8A 5IEKA 3QG6B 1U8PB 5HGBB 4OSUH 4O00A 4XNXH 3E8UH 4TVPL 1A4JA 1MH5B 3QAZB 4XC1L 3GUTB 3O2DH 4L8SC 4X5XB 4F7CB 4MA7H 3WV0A 2WUBH 3OX8B 4KRPC 5I0DA 3BPLC 4JPWH 3QHTC 1G7IA 2YN3A 3NIGE 5LJYH 1WBZA 3UTTE 3RUGF 5E2JA 4OM1H 1XF4B 4WU7B 2OX5A 4JEGB 2WWMC 4L1HA 4WO4D 4P9ML 1MCSA 2YUVA 3OKEA 5EWIL 4EDWL 4N8VA 2B4CC 2P8LA 5IW1B 1S7SB 3LV3B 3VFTB 3KLAA 1UKSA 12E8L 2AV1A 2EDHA 2VZTA 4K55A 4X6DB 2DL9A 5DRNA 5MP6L 2WP3T 3HNTL 3B5HA 1CFVL 4EQ2A 1JN6B 1AXIB 4G8GE 4P23C 5DJ6A 1KACB 3SDCA 1ZWIA 4XPGH 4ZODA 1VGKA 4OZFH 5L2KD 1RK0A 5I1KL 3QUYD 1VGEL 1B88A 3C2SA 1S7RA 5HHOE 5FK9A 1IQDA 2BVQA 4UTAL 1SY6L 2LV4A 3EYFB 5KVDH 5L9DH 4MVBC 5CEZE 3R8QA 1ZE3C 2GJJA 4ZXBD 1B2WH 1YN6B 3LMJH 1DQQB 5C6WH 5EU4B 5H94A 4J2XA 1TFHA 4TUOB 1UM4H 1GHFL 2D7QA 1RV6X 5HPMB 1Y6KR 3PWVB 4M4RA 5ETUB 3HLAB 4X5LA 5A40E 5EIQA 1MF2H 4Z7UF 3SDXB 5INDB 5C9JB 1BD2B 1VEMA 1NQBA 3MZGB 2X4TA 5E8EB 1T20A 4WUUA 5C9KA 2F8VA 4ZD3L 2IWGA 2F53D 1C5CL 2GJZB 3VWKC 4HS6B 1EAPB 3RI5F 5IFHH 2QBWA 1GGIL 1ADQH 4TSCH 3VXPA 1W2KT 1ZEAH 3L5IA 1SVZA 4PB0H 4JREC 5JZ7C 3E2HC 3PGCB 2VUYA 4DKAA 3DMMA 4D0BA 3FO2B 1KPUB 2OL3A 5D71H 3RL2A 4OZIB 3GJFB 5ISZB 1KCVH 2A77L 5CEYA 5IV2A 4PJIA 3V0WH 4DOHB 3WFDL 5E9DA 3UTZB 2M8XA 3RWFA 4LLYB 4MJIB 1F2QA 2NY2C 5TFSH 4DN4H 1NFIB 1S7XB 2OXHA 1T83A 2F54E 1DUZA 3GBNH 3LPFA 4N90E 2EICA 4HIXH 2J2ZA 1GAFH 1KENH 1FP5A 1FBIH 3C6LD 4BFIA 3EYUL 4AM0A 2JB5L 4RISH 4HJGB 3FO0L 4KUCF 1CXIA 5DA4A 4U05A 5IMOA 5JIIA 4HS3B 4U1MA 1FFRA 4ODVH 4F9PC 4ZUUA 5ID1A 5CJQL 1CFSB 3VFRB 2GJ6B 3AC0A 1ZS8A 3C2AL 5L6YH 2AEQH 1Y18B 2X7LA 2LFGA 3WXVL 4PJ8B 5CSBA 5ABDE 4JN1H 3QZWA 1DLHA 3FQUB 4BQ8A 2OYPA 4NUGH 1HHHA 2ESVB 1AO7A 3VXMB 2R0LH 3FRUA 2XG5A 1XCTB 3G6AB 3ARSA 3K3QA 5TE6L 2DAVA 4H1LH 2YWYA 1J0JA 5IHZB 5LAXA 1BIHA 5I1JL 5FGCE 4LSUH 2XZQL 1UZ8B 1ZT4A 3NCJL 1AGFA 4M7ZB 4HIIB 5FKPA 1Z5LA 1CFTB 3LEVH 3X13A 3PXJA 1S9YA 1QQDB 1W72H 2H1PH 3ZLQC 3EDFA 1K8DB 1QLEH 2HMIC 5IB4A 3D6GA 1BGXH 4YHLL 1G6RH 3RKDD 1URLA 2FBJL 3TVMB 5B39G 3EAKA 3UO1L 4XP4L 3BZ4A 3F12B 4L9LB 3W5NA 4X98A 2GQHA 4CDGC 1XF3B 3I3EA 5I8KH 4ELME 4PBVC 3TO4B 5J6HA 5F9OH 3LQZB 4M61A 2ERJB 5CIPH 2R1YB 2FO4B 5ESQB 4Z7WF 5C0RH 2OI9B 2MPAL 3AXLB 2CDFA 1HKLH 4WV1B 1XR8A 4YHOL 5IT2L 4S2SB 1KCRL 4CVWA 3DI3B 4YH6A 5AG9A 1ND0B 1J8KA 4M1GL 4N0FA 4ZAKA 2FLBT 3D39A 1F3DH 5JLZA 1A22B 5IBLC 3H3PH 1V05A 4CBPA 3GGWA 5SWSA 2FJHB 2NXYC 5C07E 3H6JA 2IPUG 1Y6MR 1KJ2L 3IDXH 3K0WA 1NGWB 1MRCH 4FG6C 5AEAA 3QUZC 4HG4K 4G6AD 2ARJA 2EYTA 3FN3A 3QEQD 4XI5C 2Q86B 5DSCB 5EIIA 4J6RL 5E6ZA 2AJSH 1IGFH 2CPCA 3AM8C 4R90L 3FB5B 4LSDA 2I9TB 5J06A 2QQLH 4HF5H 1H15B 2Y9RT 5MERB 3RY4A 1WFNA 1JGUL 4JDVA 4L3EE 5K33A 4FXLA 4LSSL 4MXWH 4HFWB 3OHXB 3GJFK 2IH3B 4BA8A 4YQXH 5E6ID 2BVPA 2EDXA 1AR1C 4N0RA 3PV6B 1BX2B 4HKJA 2PXYA 2UY6A 3MLXH 4RZCA 1LO0H 1EFXB 4XMKH 2YS4A 5I6XB 4WUKL 1WC7A 3L6FB 1I7UA 1I8KB 2FECL 3AUVA 5EPMB 4HXAH 5FO9B 1ZHKA 1BM3L 3V4PL 4LHUG 4LLMB 4RRPG 3WO3B 1C1EL 2W60A 2W1NA 4S0SD 4F80A 4PRHA 5IVOA 5LCVL 4P46C 5CUSL 4F9LA 3JUZA 3VJ6A 1GCFA 3V5DB 1ZA6B 4UIMA 5EU5A 5A16A 4B7LA 2HH0H 3MNWB 1IAIM 4P9HL 4H25B 3ECBB 4PRIE 4HDIA 3PL6A 1MUJB 3IJHA 5FEBA 3JTTB 4BSVB 4N0CC 4PGJA 1YEJH 4U7MA 5I76B 1N5AA 5DD6A 4MWFB 3IU3A 5HVWA 3KPSA 5EIVA 5KS9E 4EIGB 1QD0A 3KYAA 1NAML 2X70A 1DQLL 5HGDB 2WIMA 5F8RC 2Q7YB 3V95A 3F58H 3UYPA 3O4OC 3S36X 3ARGC 2AK4E 5KOMC 5D5ME 5HHVL 3QDMB 3BO8A 1Q9LB 3O8XC 2AJZB 5JUEL 2M1KA 3U83A 3V7MA 1BQUA 5I73B 4XNZB 2XTLA 4Q74A 1CGVA 4JR9L 3FO1A 4KKBD 2ZUQC 4FTVD 2J8UA 4P2CG 2L7UA 4PTTA 3MJ6A 15C8L 3HG1B 3PP4H 4PJ7B 1HINH 4P2OA 2FATH 2ZUYA 2ZKHH 4F7TB 1T66C 4HWBH 3X3FL 1QZ1A 5DJCB 4L4VA 4P4KD 4XTRC 4LQ1A 5I1LB 4TTGA 2WP3O 1UWGH 1OSPL 2Z31D 3GHBL 2DLFL 2G5BA 3TO2A 3CNKA 4Z7NF 4MNQA 1LEKB 5F71A 3ZDZF 1CICA 3WFEL 5GPRA 1C5DA 3BQUD 2WM0A 3L7EA 1EBPA 4MAUL 5I19L 3IXTA 3T09A 3GUTA 5E8DL 4FQQB 4LFHD 3MBEB 1UQSB 1PG7H 5EZLB 3D2UA 1A6UL 2J6EL 2OR9L 3PABB 1DVFD 1NUDA 1P2CB 4YIQB 5IOPB 3JWNC 4KJWC 5T33L 3PXHA 1CTOA 1T5WB 4YEFA 1G7PA 3P4NB 3VMNA 1MCKA 1MPAL 1NCCL 3L5HA 4JRYE 2AK1L 2V5MA 1MFBL 2ZUXA 1S7SA 4QRUA 3VFTA 1CL7H 1NMAH 5GGVY 2VL5A 3GIZH 1JVKA 1EGJA 2UZYB 1TTGA 4PJAB 2BVEA 1ZHNB 4H5SB 1GH7A 4JO3H 4UBDD 3KAAA 1IZJA 3FB7B 4YZFE 2K9UA 3OBAA 1IEBA 3VFOB 4Q9RH 4Z5RB 5C09A 3O2VL 2YN5A 5ALBL 1NCWL 2GAZA 1QSED 3ARBC 4JVWA 5J4MA 1RZIA 3U4EB 5F21B 5DTFB 3DX7A 4OZFG 3ULUF 4HCRL 3HFMH 2ICES 4D2NA 1JGVH 4HEME 3RVUD 5E0QA 1A6AB 4F58L 1YN6A 2VC2H 1BLNB 1DN0B 2EH8H 3CMOL 1WCQA 3JWDC 4NYLB 2OQJA 3R06B 5D6CB 3VH8A 5I9QC 4KI5C 5DJ2A 3SKMA 3QPXH 3RIAF 3BD5A 1CIUA 3OGCA 2H8PB 3GMMB 3TIEA 5TDPB 2IGFH 5FA3B 1NAKL 1ZVSA 4X8JA 1MAJA 1QBLH 4XH2B 3VFUA 4BUHA 1E4KA 1J5OH 3C6SA 3QBTB 4ONGL 4ZTOL 2KPNA 4YHIB 5CSGA 3VMPA 1ZLSL 4Z0XA 1I7RB 1QHPA 3PWPE 1X5JA 2H26A 4M7JH 4K23L 4X6CE 4XB8A 4YR6A 3PNWB 2OR8A 1K6QH 4OLZH 4HMCA 3TCLA 5L7XL 3NACL 3IGAB 2N56A 3MJ7B 5DDHA 4IBLT 3BVNB 1IEHA 4MCYB 1KJ3L 5FO7B 1DQDH 4W68A 3MXWL 3GJFA 1NCUA 1F3RB 2YD3A 1X5FA 2NQCA 1MQ8A 4FQJL 4PR5A 2DLIA 3SGDI 1IM9A 5DJ0A 3MLUL 1WAAE 4J4PC 5EBLB 3HMXL 4MJIA 4KK8C 3P9LB 4WWID 3FMGL 1VADA 2BNRA 1AE6L 4I0CC 1A6ZA 5MI0B 2C3GA 4LLVB 2X4NB 4FZEH 4X6EA 5FA4B 3BN9C 2OTWB 1ITBB 3CU1A 3D25A 3EOTH 4UQ3A 2B1HH 4PJXA 5EU3A 5SX4I 3MRKA 3IVKA 3T3PF 1GIGH 3O11A 5T1DH 5JA8B 4I0PB 2CKBA 3OKMB 3T0EA 4JO2H 3O9WC 2Z93A 4HT1L 4DZBA 5DFTA 1CT8B 4GBXB 2BDNL 4L5FH 3ME0A 2YEZA 1CDGA 4UB0H 5HI5C 1U2CA 1FC1A 3G04B 3X11B 5LWYH 2UWEE 4QHLB 2YD1A 5DMIH 4JO4H 1JPTH 1OGAD 3QDJE 1RVFL 1NCBL 2A9MH 1LEIA 2W65B 3OF6D 1OAZL 3TYFB 2XACC 4WWKB 43CAA 5HYJD 2DF3A 5I8OH 2Q8AH 3C5ZD 4H1LG 4I3RL 3UTTB 4PJ9C 4JFEA 5MEND 3GK8L 4PGBB 4OF8A 4HUWB 5D96C 5F1IB 3QQ9C 4X80H 1G9NL 3BPOB 5DRWB 4NM8H 1T3FA 1N8ZB 3OJMB 5GIRB 4WW2C 1D5BB 4WFHD 2GY5A 2X89D 3IDIA 3S8WA 2P5EB 2YD2A 5F9JA 1C7SA 2AEPL 3DUSA 3U48A 3B5GA 4Z7VB 5DVLA 4PV8A 1SEQL 4IRZH 2Y1VA 4FABH 3MV9B 1BQLH 5H2BB 3PWUB 4L9LA 1RIHH 1JTTA 4ODSL 2AJYH 2V7NB 1NLBH 2J7LA 2O5YH 3V5HA 4TSBH 3DURB 3CCHA 1TNNA 3C60B 3V5KB 1RZ8B 4W6WB 4H0GA 1JNHB 4IJ3B 5F9WB 4NC0B 4UV7L 5I8EB 2R1WB 4YBQC 4DZ8A 5HHOB 2DM7A 5ESAB 3RAJH 43C9B 2D2OA 1MWAB 1UG9A 2W9DL 2ZJSL 4EN3D 4UUJB 1DFBH 2BVUA 1LQSR 4JHWH 4NQEB 1Q0YL 4G9FE 4GKSB 3MRCA 3I6KB 3EJZC 1FORL 3HNVL 1LP9A 3QJFB 3UZQA 3WUWB 1JYNA 2FD6L 5C0FB 4CMMA 4EI5A 2NLJB 4WHCA 2D03L 4ESKA 1KULA 3HZKA 5DD1H 2FJGA 1NGZA 4GAYB 3LKPB 1IC4L 3WL9A 2D7MA 4YHZH 4KVNH 3RWIB 1IT9H 5IUSA 2HT3C 4JM4L 4GG6A 3AREA 4R26H 2C3XA 3STLB 3I50L 4RFNB 4M3JA 5B8CA 1LK2B 1KCUL 3SCMD 4JB9H 5JIKA 3TYGH 3HC4H 1N3NB 4PJ5E 4DTGL 2SEBA 3SKJL 5GS0D 2CLRB 2ZNXA 3LS4H 1DQJB 1IKFL 3R4DA 2R0ZL 2XZAL 3U2SA 5IFJB 2G2RB 3HUJA 4DW2L 1NMBH 3RVXC 2A6DB 3MMEA 1NBYA 3KG5A 5T3ZL 1OGTB 3DWTA 3DGGB 5FYJE 3ULVH 1YQVH 2DM2A 2F54B 4OZGA 3JBG7 4M93C 3SY0B 4OCSH 3CVIL 4NGHH 4LCCB 1I8KA 1FJ1B 3RTQB 2D0HA 4AQOA 4KQ4H 3IAPA 2X1PA 3NFSL 1XIWB 5D1ZD 2Z8WC 4GXVH 3BYYA 1IMHC 3L7FB 4OLUH 2CJUL 2FYYA 2W0KA 1P7HL 1ZANL 4NBYB 4L8BA 4LEOB 4D0DA 1JPFB 4ZDHB 4L8CB 1CG9A 5C0CD 4QLRA 3MNWA 3BAEH 1T2QL 5KZCB 5D7SH 3MNVB 3WNNA 3SGEH 4H25A 5F7DA 4APQB 1T80A 3P40A 1QRND 4BSVA 2IAND 4KWUA 4ZUWB 3G6JA 2AV7B 4NHCH 4MAYA 2DWEB 4MXVF 4GRLC 5HGDA 5JIPA 5K9KA 1FYTD 4M00A 4XNQB 5IESL 1DZBA 1T4KA 2VXQH 4M9OA 4YXKL 4JKKA 1HSBA 1QSFE 4P2QD 1Q9LA 3VWJB 4DFIA 3MC0A 3TBYB 2O5ZH 1SJEB 4BFBD 2XFXA 5D1XB 5DYOB 5FGCB 5HGAB 4FQLH 1RK1A 1T0NA 4FFYL 3C8KB 1EUTA 1B0GB 4CADB 5EC1A 2CMRH 4Y5VB 3DYOA 3GRWL 5T5NF 1FO0L 3S35H 4Y19D 4RGNE 1CK0L 4OFKA 4PD4J 1IE5A 3EO9H 1EVUA 3OJDB 5KSBE 2FIKA 4NO0D 2GTZB 5DQDL 4P23A 2HN7A 4MNHA 5DJAB 4LCWD 4LVHB 5CEXB 4M3KB 4EUPB 1MAKA 3REWA 2ICWA 2VDNL 3QEHA 3RPIA 3L3GB 3IDYC 3B9AA 3HI6H 1UH2A 2BP3A 4CVUA 1RY7B 3WLBB 4EDXA 3W39A 4KROB 1UQSA 5D1QC 4G7VL 3V6OE 4XMPH 2RB8A 1NSNH 2VXUH 4BZ2H 3RL1A 1JGLH 5IOPA 5DD0L 4OQTH 3PP3H 4LLDB 1Q9WA 2EZ0C 2BHZA 4G42B 2MTPA 1MCCA 3QUYC 4TVPE 4YNYB 1U8OA 2ZCLH 2NY3B 4DGVL 3UJTH 3W9EA 1QFWL 2IPUK 5AZ2L 2A1WH 2VXTL 3VWKA 3SDDB 3C08H 4E42B 1R5IB 3WJJC 5F7UA 1WWWX 3QEGL 1JPSH 3GI9H 3M1BB 5GGUA 1F4WH 1IC5H 3SE8H 4OLVH 1E4XI 4UV4L 3V6ZA 3MLRH 2BXZA 5BRZE 3FFCA 4YO0A 1MFAL 1NGQH 3BKCL 4LAQL 4GRWE 2H3NA 2ADGB 3EOYG 3S36L 4KJYA 1MRDL 3MFFB 4X6DF 3H9ZA 1A1MB 1A6AA 1NBVL 1WWAX 3STZB 1RIUH 1BLNA 2VTFA 4YDVB 4PJEE 3R06A 2JKXA 3MUGB 3BZEA 5JHDE 4ERSH 3MRPB 2J88H 3QJHA 5KBNC 3UYRL 2XQBH 2OZ4L 3B9VA 3JSSA 4XH2A 3WFCL 1DEEB 2XTJC 1LMKA 4AG4L 4N8CL 1GC1H 1B0RA 1CFQA 3GKWL 4JRXA 5HYSB 2Q8BH 3WDHA 3HC3L 4LRIC 5KSVA 3T4AB 1K5NB 3O4LD 5CEZH 3LDBC 1JRHI 4F9PA 3GMOA 1HXYA 4PRIB 1X6NA 4ZUSB 4Y2OA 2YD9A 1NL0L 5C2BH 1P7KB 4OF5A 4P5KB 2FWOA 1I3RB 4IHOB 3TT3L 2YHGA 5ICYA 2J12B 2VAAA 2VQUA 5D7IB 5DZLA 5JDJA 2E8YA 1FLRH 2DD8H 5DURB 1B4JH 4DN3H 4XXDB 5GGSY 4G8FB 2ED9A 2P5WA 5D5MB 2FBOJ 1R3HB 3KPNB 3F5WB 2B2XH 1CWVA 2KZWA 4LU5L 5AAWA 4U1SB 3VFSB 5C08E 4NOFA 2X4NA 4KJQC 1JF1A 2C3VA 1JYXA 3FAXA 4OGYH 3N9GH 1U93B 4XCFH 4MD5A 4JFDE 2XWBB 1SYSA 4TNVK 3UTSE 3TVMC 3OMZA 4XRCA 5KW9H 3L3HB 3O6FB 4K3EH 3JVGC 4LRNL 2VDRL 4Y4HB 1FL6A 5DD5L 3T1FB 3NMEA 2A83B 3CVHH 4PJDE 4DKEH 1JTPA 4Z9KB 4WI8A 2WQRA 4QRPE 4JDTL 1MFEL 2ERJC 4GBXA 3VXOB 5GGRA 4YHNA 3P2TA 2OK0L 1MCPL 4OKVA 4TSAL 4OF0A 2O5XL 3VFWB 3KLHD 5AWNL 5D7KE 2FX7L 1YEFH 5HI4D 3RNQB 3E3QE 3ULUL 4Y89A 3DVGA 1CU4H 4ZS6D 3G5XB 4WI4A 5CGTA 1VFBA 1JI2A 2W65A 4KV5F 3IS0X 1XF1A 3TA3C 3OB0H 2CGRL 5MEPB 4LSTL 3A67L 2ZPKL 2FEDD 2NW2A 2ZOLB 1U3HC 3LKNA 2AJVL 2WBJD 1H8OA 4OLXL 4QXGH 2DWDB 2GK0B 3MOBL 4A6YB 4QRSA 5E2WH 3F7QA 1JMZA 4BH7A 2VLRE 2VB5A 3T77A 1MHHB 1F58H 2QR0B 5BS0D 3QDGE 1KC5L 1OAYL 3QUZA 2CK0L 4Z7VA 4FQXA 5EOCH 3R1GH 4IOIA 1CDBA 3P30H 3PWUA 5CILL 1VENA 2V7NA 3AM8A 4F8TA 3E6HA 3V5KA 3MRBB 4ALAH 4RQQB 1OTUD 3U4AA 3VCLA 4GW1B 3G9AB 2RFXB 2PO6D 2DI8A 4LCUB 1KN4H 5B22A 1NUNB 4NQEA 1GXEA 3MRGA 4Z77B 1JGEB 1UFUA 3P11H 3H42L 4ZPVB 3RU8H 3ARFB 3CFIC 5AZEH 1OP5H 3CAFA 1ONQB 4PGDB 3SPVB 2ZG3A 4UILH 4PJHE 4G6KL 4D9RD 5C0FA 2NLJA 4JFOA 3X14B 1BFOA 4XBPB 2X4QA 5BJTB 1Z6JT 2AQ1A 3KPPA 3I9GH 4G80B 3TZVC 2E9WA 1CI5A 1NC4D 1T6VN 3GJEA 2YPLA 4NUJA 5GQBA 4X4XB 1PX3A 3CLFL 5EZOL 2D31A 4MQXD 2DBLL 3GMNA 3PWPB 4P46A 1ACYH 5IHLB 3NIFF 3CX5K 2D3VA 1KUMA 3ARYA 3D85B 5J12B 5DMYA 4UINL 4PJFE 4XWGL 3L1OL 1N3NA 1FNGB 4OFYD 4JPWL 4OGZA 5DVNA 3C5JA 1HWHB 3OXSB 4G3YH 4OM1L 2GTWA 4I77L 1TZGL 3TNNB 1FPTL 1G9MH 2G2RA 4QO1A 5FXCH 3BP7B 1HHIA 1T2JA 3PGFH 5BO1L 4HBQA 3ARGA 5EFIA 4ZSOA 2XN9E 1I8LC 3DGGA 2HG5B 3O8XA 4K9EH 1XGYH 3L3KA 4IRSD 5CZVL 3GSXB 4FZ8H 4BQ6A 3QO0B 3P77A 4LCCA 2X10A 3EDJA 4I2XB 3VXSA 5E4IA 5H35B 3EHBD 2CLZA 2XOTA 4FQIH 3MRJA 4XPGL 4G5ZH 4HFUH 1CN4A 4XCCH 2EIDA 3QNZA 4V1DD 2FJFB 2CSPA 1YUHA 1JZ2A 2XG4A 4Y4FB 1KIPB 1NGYA 3W81A 3PQYE 4OZGF 4Y16D 4DAGL 2OJEB 2HJFA 1HDMA 3QIWC 1U6AH 2CIKA 1KXVC 4DEPB 5DD3H 4ZUWA 1WV7T 1RU9H 4KKBC 3EJYC 3MFGB 4UNVA 3P0VH 3LMJL 1A7NL 5DHYA 4FQCH 1EA9C 4PJGE 3RZCC 5EUOB 4WO4B 3EOAA 1TZIA 4Z95H 1GZPB 3NCMA 2ZNWA 3D48R 4RFOL 3HI1B 3VWJA 5E4EC 3ARWA 2X4UA 1M7IB 4BSWA 1PX4A 1IARB 3KXFA 4E0RB 2IAMD 2DQFA 2VXVL 3OAZH 3BZDA 4R7DA 2Y07L 3C8KA 5CBEB 3ULVC 2VISB 5DZNA 3K2UL 2V5YA 1LVEA 1WICA 5L2KB 1A1NB 4TSCL 1RMFH 1MI5D 2V2TA 3DYPA 35C8L 3VD5A 4M43L 3BQUC 2NCMA 2PN5A 5JQ6L 1U8IB 4NCC1 1W0VB 2JJUA 1X5KA 5D71L 3PHQA 1UGNA 4ZXBB 1KCVL 1G1CA 1T5XB 4O2FA 4YXHL 4M6NH 3V0WL 4AENB 5JXED 1KIQA 3WE6B 4K8RH 3OJVC 1XAUA 3SO5A 2MQ0A 3ARBA 5TFSL 2R2BB 1JWUB 4PJ7F 1T0MB 4U6TA 1D6VH 2EDWA 2XPGA 3MJ9L 4HJJH 4NO3A 5FO8A 3LSOB 4TPRH 3JV4A 2PNDA 4G9FB 1MLCB 1KENL 2P45B 4HG4J 1AP2A 2F53B 3WNMA 4FQ1L 1EMTH 5DHVB 3GMQB 1OTTD 4LKXA 1FG2B 2GCYB 2C4XA 2BCKB 2IFFH 1L7IL 3FOMB 2HFGL 2H9GA 2ICCA 2M2DA 1XGQA 4YDKL 4J23A 4KQ3L 3GBLA 3U0TA 2QKIA 3N50A 2AEQL 2QQNH 4PY7B 4B50A 4KKCD 4OJFH 5C1MB 4R96A 3UMTA 5ERWB 4JN1L 1KTKE 1A14L 3Q5OA 1N2RA 1U41A 1I8IA 1MVUA 4RMUA 2VWEC 4NP4H 1YN7B 2R0LL 5C0AE 4ZFOA 3QUKB 4OFIA 3HRPA 5KSUA 1DDHA 4NWTH 4Z78B 3HE7B 3TBSB 1H5BC 3UXFA 1N6QL 3H9SA 5EULV 4NN5B 5MHSD 5BXFB 4OZFA 2I27N 1AD0B 2BHYA 2KKQA 3RY6C 2D9QB 4RFEB 3C6LB 4HZAA 4J4PA 2L4OA 2Y72A 4PS4H 4W4OC 2G60L 4LEXH 5TDOA 3RWHB 2HLAA 4WFGD 1U8QB 1JP5A 2VR9A 4PLOB 4HPOH 3IKKA 4FRWA 2H1PL 3ALPA 4NC2B 4J8RB 5J11C 5E5MA 4E41E 2ITDA 3O3AA 3BI9X 1ZHBB 2PYEE 1T21B 3JV5A 4BZ1H 3VXQB 3BRFA 5LGHH 1JFQH 1TCMA 1GOHA 5JOFA 2PKDA 2A6JA 4R4ND 3MLYL 4JFFA 5IQ9A 2XRAL 3NPZB 5EH1A 5TH2A 2DRUA 2CDGB 3O9WA 1NC2A 4RDQF 1SBBA 5F9OL 1I1AD 4O5LL 1RD6A 1I1RA 4CNIB 4HWNA 4MJ5A 4TQEH 1HKLL 2C5DC 4ZUSA 5DFVC 4RCAA 1KF9B 5BVJA 1FE8L 1B6DA 1NDMA 1ADQA 4KHXL 3UZEA 1VKXA 2E9JA 1BVLB 1G7JB 2QSQA 1I7ZB 3PDDA 5EN2A 1SJHB 1ZGLA 1XF2B 3DMMD 3WUWG 3MYJB 2CRIA 3SN6N 1A6TA 4Y5YB 1R3HA 4C56A 3SBWC 4POZD 2NTFA 4LSVL 1HSAB 3WLWD 2VZ3A 4FXKA 1MRCL 4U1KB 1ZLUH 2NY6C 3V0VA 4XBEL 4P2RE 4L29A 1U93A 2VJXA 3S35X 4X7SH 3DSNA 3L95B 1OARL 3ZMRA 1FZMB 1X5HA 2I25N 5GGTL 2AJSL 1EEZA 1IGFL 2YA0A 4QHUA 1LEGA 4ODHH 4RGNB 4WW2A 4HF5L 1GC1C 3OAYH 3KPQA 3O3UN 1KELH 3RUGE 1F6LL 1ZKAA 4L4TE 3SDYL 5I16B 4TULH 3EBAA 5KSBB 1AFVH 1DANU 1V7NH 5D2LB 2GUOB 1QBMH 3TPUB 3U9PH 1HHKA 2Y5TA 1YEKH 4XZUB 1E0OB 5IF0B 4NQCE 1DBAH 4U1HB 4KMTH 3RGVD 2DQJL 3NZ8A 3WFHA 1NFDB 1RJZB 5I75B 3VE0A 3LKOA 2YKLH 2WLZA 4XMKL 5HHNB 5DWUH 4BJLA 5DVMA 4P48A 5BZWA 5JPMA 1S5HB 4QOKB 3AB0C 1AO7D 3GO1L 1FNHA 2DQEL 5FGBC 2ZOLA 1KJVA 2DKSA 3EFDL 3MOAL 1NJ9B 1TLKA 5GRYA 4ZFFA 1I7TA 4ZQKB 1J12A 1TMCB 4O58L 1F3JA 3MGTA 4MD0A 2VLKE 2IADB 3TLRA 5E1HB 3D3VE 2YD4A 4AIOA 4RFNC 3NGBB 4ZO6A 4HH9A 5DLMH 3OKOB 5IVZB 1A3QA 1J9CT 4Z7UE 5E6IB 4JFXB 2HT2C 4JZOA 4HWEH 5EBMA 1H3PL 1R3LB 4QHNB 4MDJB 3DRTB 5HHQB 3VRIB 3LEYL 2DQUH 3W11C 3QUMH 5DEGB 5A2JH 5BRZB 3NN8B 3D69A 5M94B 3KR3L 2GT9A 4LCUA 5DQJB 4UOW1 5F97E 3QG7L 5TDNA 2NY0B 5D7LE 3HMWH 4I9WD 1ZHLA 1JGEA 1EERB 1QRKA 2X9YA 4Z77A 5CIPA 4IOFD 4Z7VF 4YWGH 1J05A 2VRAA 1MJ8L 1AGDB 2G75A 4PJEB 2E7LC 5IWLC 4JE4B 1GYAA 2P1YA 1XGPA 3UYOD 1PLGH 1FVCB 4N8PA 3ARDA 5JHDB 1A6PA 1NGPL 4Q9BA 3RPKA 3ZHDA 4YAQA 4XBPA 4DK3A 3D39D 4JGMA 4J1UA 5HGHA 1P1ZB 3WHE1 3QIBC 4XNUH 1IAII 5SWSD 2MJWA 5EG6C 3H3KA 2JCCB 3HZYB 4FFVD 5KSAB 1TTUA 4KTEH 1WSST 3B3IA 1FGNL 1M4KA 5DMJB 5M95B 5GGVH 2DYPB 1AIFB 1K2DA 3EO1A 3IFNL 3GMRA 3QXDA 5GS2H 2NXZD 4HPYH 4U1GB 1QR4A 4L3AA 2B20A 3CX2A 3W0WE 3BDXA 4RBPK 3U36A 5D1ZC 4FTVB 5HHPA 1ZVHA 2IQAA 4GRLA 3BKML 1PSKL 4I5BB 3L3DA 1AGBA 1U3ZA 3MRDA 1PQZB 2B1AH 1IL1A 4OIIL 3OKLA 5IVXB 5F7KC 1FL3A 5FKAB 1E27B 3A6BL 5IR1B 1RULL 3DVNA 4UT9L 2DDQH 4P4KB 4OLWL 1OW0A 4D9QD 3UTSB 2Z31B 2DQTL 3CLEL 3CPLB 5ALCH 4ZNEA 2VDKL 3LRSB 3QRGL 4PJDB 2JIXA 4I8DA 4LVHC 4AEHH 4Q9RL 1QFOA 1DL7H 4XCEB 5FDYA 4QRPB 5EZIH 3HR6A 5ADPH 2ADJA 5DF0A 2I07B 3OZ9L 2OJEA 3MRLA 3QWOB 3RRQA 3KPMB 4JY5L 1HH6B 4GAJH 4GG8B 3DRQB 3J7HA 3REVB 4PPTA 2VC2L 3DUUA 3U1SH 2Q3ZA 2LU4A 3PL6D 5C0EA 2KBGA 3HCVA 5JDSA 1GZPA 2VLMD 4QRRD 3VFVB 4UTBL 1YEIH 3IRZA 3L3OB 4PRAB 3KPSD 3ARPA 5EO0A 2R4SH 1JUFB 4OQ1A 3LB6D 5C86A 1MCNA 2FB4L 4NN7C 1G9MC 2BVOB 2HJKA 1RZJH 3R0MA 4E0RA 4S1QH 1B90A 5D8JH 3RDTD 5EU6E 1YYLH 4Z7WE 5HYSG 3MJGX 3PUCA 1YMMA 1LO3L 4K9EC 4D3CH 2X44D 3FRPG 2FZ3B 1YEEH 3SEPA 4F2MA 5L2KA 3BZFB 4UDTA 5I17A 4PUBH 3QHZL 1OSZA 3QUYA 2VLRB 1QSEB 5CJBA 4OLZL 3ZDXF 4U6HA 4LPUA 2NY5C 2A73A 3QDGB 1ZMYA 4EEEA 5SX5K 3QI9B 2OTPA 3T0WA 1KPVA 2R0WH 4NQSA 3FT4B 4TNVF 4N9GB 1T5XA 4P2OD 3WJJA 5J1TC 4AENA 4HWBA 1OAQL 4IS6B 3ZHLA 3NFNB 4DVRL 4OD2A 4OZHA 4GRMA 1NGXA 2NX5E 1AKJD 3NIDF 2RJMA 1HI6B 5ADOH 1MLBA 2QTEA 3LPWA 2KZ1B 3CUPB 5FM5O 2C4FU 1F6FB 5CP7A 3T2NL 2XA3A 1MCQA 2HFEB 1X7QB 2UYLA 3HC0B 4MNQD 2A9NH 2BJMH 4WEBH 1MHPH 4MA1B 2QSCL 3ALWA 2DLGA 2A0LD 4XPFH 1TVHB 4M1CC 5T1DL 5JA9A 2GCYA 1RJLB 1CDUA 2R0KL 5DJ8A 1NCAH 3D2UD 1JWSA 1OCWL 1E6OH 3DETD 4ORGA 3S96B 1INEH 1YMHA 4IIQB 1INDL 2CO6B 4PJBB 3S37X 3D9AH 3T04D 4OB5H 1FNFA 5ERWA 1OD9A 5EA0L 3X12A 3WHE0 4DGYL 1CGTA 1R24A 4KI5F 1CXKA 3DXAD 3DUHA 4K3DH 2XNAA 2AJUL 1UH3A 2A6KB 3ZKMD 3TIDA 3CFEB 3SQOH 1HEZA 4NN6C 1C5BL 1WBYA 4JJ5A 1HZHH 4K8RC 3LD8C 5I18L 4TVPH 4ZO8A 3C6LA 4RWHA 1GGTA 2Z35B 4DVBA 4M62L 1FNSL 3GSNA 5KN5B 2XN9B 4R2GD 4HUVB 4NM8L 1D9KD 5FM8A 1VESA 2UZXB 3DTXA 4R97C 2D7PA 1Q0XH 2Z91A 4WFEE 5GXBB 3VXUD 1ZHBA 3IDGA 2FO1A 3STBA 1B6UA 5JHLL 4PRPD 2R1XA 3CDGA 4IRZL 4ELKB 1FH5L 1JF5A 5EWIH 4EDWH 4FABL 3B8YA 3CMGA 4JLRA 3JVGA 5D2NE 2AEWA 5GGSB 1OGAB 3NCYP 12E8H 4MA3B 3BOVA 3CXHJ 2O5YL 3KWWA 3QFJA 1R3KA 4GRWH 4TSBL 5E99L 4JQXC 4QHMA 5MP6H 3S98A 2EDYA 4LSRL 3HNTH 3X3GL 3VDAA 3PQYB 1NEUA 4CNIA 2XWJB 3KPLB 2I9LB 3VRLF 4F7PB 5SWZE 3D18A 2IALB 2XI9A 1DFBL 4GXUM 4XPTL 5HYJB 4YE4H 5I1KH 3C5ZB 1VGEH 4WIQA 4D0CA 1I7ZA 1JHTB 4QTIL 1K85A 4PJGB 5DRZB 1SY6H 1PY9A 5FYLL 1SJHA 3L3JA 4NRZA 1AXTH 4G6JH 3VGEA 1GOFA 5FHBL 1WWCA 3TA3A 1U8JA 5HJ3A 5CZXD 4Z7NE 5HYQA 2CH8A 1J8HD 5D70H 4RMVA 1GHFH 3ZDZE 2YXFA 1ED3B 1U3HA 2H32H 4PGCA 2MCPL 2EDNA 3DX6B 4NO5B 2DKUA 4O2EA 5D7IF 2LVEA 5IEHB 4RGMB 2VQTA 5T1LD 5SWQA 2Q87A 4CGTA 1U8LB 4NDMA 2AS5M 5CGYC 4KZDL 5F93C 3HNSL 2F74B 4EN3B 5I16A 3KVQA 4FMFA 4M6MH 4WI3A 5BOPA 3TYGL 1GGIH 3CFJB 2FEDC 1BWMA 1CD0A 5L8JB 5ITBL 2EE3A 2HT4D 3WIIL 1Q9KA 5IF0A 1ZGLM 3ARFC 3DBXB 4UAOB 5IJVB 4LGPB 1OTSC 4WCYL 1YQVL 4WW2F 2A77H 3SDAB 4NQDE 3DIFA 5TGBB 3WFDH 4JO1H 5D7JD 1S5HA 3OKYA 2H6PA 4UIKH 2R4RL 4GS7B 4Y1AD 3KJ4C 3QEQA 3O6LL 4MHHG 4X4ZA 2APVA 3QXAA 3ULUE 2ENSA 4BELD 5DK0A 1S7QA 3DLQR 5DK2A 2CRMA 3O41A 3ARXA 3G5ZA 4FN0A 5C0BE 1CE6B 3RBSA 3TZVA 3UZVB 1BQHB 3EYUH 3QUXD 3VG9B 2JB5H 2KQMA 2PYED 5F6IB 3FO0H 1QLFB 1AQKL 3MRRB 1ZLVH 4PRNB 1J10A 2R9HD 1V3MA 1YPZB 3WSQL 4F15C 2XKNB 4FQHB 1A6WL 3VGBA 3I02B 3EGSA 3T0AA 4POYA 5C0AB 2CR3A 3VGFA 4HV8A 3WXVH 3BGMA 1Z3GH 2O5ZL 3VFPA 5C6PB 1CD8A 4UT6L 4X7EC 2ZOKA 5GS1B 1EAJA 1CE1L 3MACH 4RNRA 3UBXI 3ROOB 5TE6H 2ED8A 1Q94A 4MQXC 3WO4B 5I1JH 3BUYB 1ULVA 2DQGL 3MTRA 1VFMA 3KJ6L 3S35L 4N5ED 2YRLA 3FQXB 5IM7A 2XZQH 3GMPA 3NCJH 2PTUA 4WUUE 3SKNA 5GZNC 3RWEB 2EKSA 3KYOA 3I2CL 3HZMA 1QRNB 3ET9F 2XWTA 1FL5A 1A9EA 1P1ZA 2A2QT 4HIJB 4EI5D 1F8TH 4NSKB 4FXGB 4YX2L 4K7FA 4HX1A 2BY0A 1ES0A 4YHLH 3EYSH 5I1AA 2FBJH 2HFFB 2IEPA 2P7TA 1G7QB 4P2QB 3UO1H 4XP4H 2OTUB 4RWYL 2AABL 4QRQA 5DJYB 4ZOAA 3BXNA 1KNOB 1R5WA 4TRPL 3T3PE 1HQ4B 4IRSC 5E9DE 3H7BA 4GKNB 4KRLB 2C1OB 3ARED 1HH9B 4MB4A 4XMPL 1DLFL 5MEQA 2MPAH 3VXTA 3RZCA 4OQTL 4YHOH 1OAXL 3BSZL 5IT2H 2BSSA 1K4DB 2J1KA 2ADIA 3MRHB 3LEXA 2YK1L 5D6DC 4I18C 1LDPH 1ZV5A 3D5OF 2V2WB 4M1GH 4Y16C 3CJJA 5FKAA 4NZUL 4P2RB 4P4KA 2XIDA 4Q9QL 3LHPL 2PW2A 4KH2A 4LCWB 3PDGA 4NRYA 1KJ2H 1PJ9A 4YK4B 2CDEA 2VL4A 3P9MB 3GI9L 1I1YA 4LIQE 2Z4QB 3PWLB 3BQUA 3RUGB 2JJSC 2A6IB 4C83B 4L4TB 1EEYA 4J6RH 4PREB 1HH6A 2PTTA 4OV6F 1YEGL 3IB4A 4GG8A 4U6XB 2KH2B 1DANT 4LASL 4X4MA 3WDIA 1C12B 4R90H 1DVFA 1BIIB 3VGAC 5CFHA 3BP6A 1X5LA 1JGUH 2HA1A 3GHEL 4NQCB 2BSRA 5FDWA 3ZKXC 4HUMB 4ODXB 2YPKA 4LSSH 1QNZL 3AROA 1EHLL 5CMAA 1AQDA 1HOCA 1I1FA 4MAYD 2APWA 4YDJB 1JUFA 1DP0A 4DGIL 5E8NA 3WS6A 1UENA 3NABH 1UXSA 3NFPB 2JJVA 3WKNA 2YC1A 1MEXL 2FZ3A 2X4PB 4OCNC 4KRPD 1MWAL 1H0DA 4M7LT 4L3CB 3SGKC 3T8XA 5EUOF 5DC4B 3FOLB 4TUJB 3QNYB 1QSEA 4HQQL 3TBWB 4WEMB 1C1EH 5LVEA 2X1XR 3RIFK 4AT6A 2WWMD 1R3IL 3U9UB 4XCNA 1JZ7A 4NKOB 1T1WB 2AQ2A 5C70A 4CU8A 1B4JL 2YSSA 4NZTH 4XXCC 4EJ1C 2F5BL 2AQ3A 1U42A 5JW4M 4JFPB 1O7VA 1S7UB 4OD3L 4P23D 1MCLA 3C5SA 1WBXA 1H5BA 1DQLH 5D7LB 1FNEB 4V2BA 4X5WA 5DJDB 4QXUL 4QCIA 1U8KA 4NKMA 5HHVH 5LQBH 2CRYA 4HHAB 4W4OA 5IB5B 3V8CA 5JW3L 1I85C 4K3EL 5JUEH 3F65A 2DL2A 4KHTL 4EBQH 5I15H 1SM3L 5IW6B 4DKEL 4MVBD 3RWJA 3O4LB 3MNZB 3CX5J 5EOQH 3U82B 5ITFB 1KCKA 4JR9H 2ZCHL 2C1PB 3VFGL 5IB3A 5IG7A 1NBQA 4LSPL 2FECI 3IDNA 5GHWL 3G08B 1MJUH 3I6LE 5GZOC 15C8H 4G6FB 3VRJB 2ZSVB 3X3FH 1BOGA 1FRGL 3H7LA 1CU4L 3V7AE 3GIVB 5T3ZD 2HJLA 2D0GA 1MY7A 4Y5YC 2DLFH 3WN5B 1Z0MA 1A6VL 1WK0A 2XQYG 4NC1E 5JOPD 1MCJA 2EH7L 3W0WB 1XF5B 3WFEH 1A0QL 1RHHA 1I75A 3VI3F 3IDJB 1ZK9A 4MAUH 1L0QA 4R4NC 4QXGL 3MBXL 2YD5A 2E7CA 1FZOB 5E8DH 1DCLA 4DUXA 1RUQL 4ONHA 4W81A 4Y5XC 1TQCC 5J7CC 4HUVA 3SBWA 1TQBB 2EDLA 1A6UH 2OR9H 5CWSB 4NZRH 3WCYA 4MXVE 3S5LG 5T33H 1YNTB 1X5GA 4PRHE 2NY2D 4LF3A 1MPAH 3VXRD 4JPKL 3R1GL 1LNUB 2AK1H 1J1XH 4G8GA 1MFBH 3KGRA 3QDAA 1OGAA 3WBDA 5DJZB 1ZLWK 5HPOA 1HHGA 4BKLB 4RSVA 3OF6A 2R39A 3B43A 5CBAA 2ZUSA 1YY8A 3IU4H 2BXYA 4POZC 3WLWC 1OAUL 3OB8A 2NW3B 3O2WL 2QADD 5ALBH 3HRZA 1NCWH 2WBJB 3V6OC 5MENA 4M8QB 1NCTA 3CH8A 2FX8L 4HCRH 4S11A 5J13C 2IFGA 3GSVA 2X89A 3NPSC 4LARL 2RCSL 2LU7A 5BS0B 5LKNA 5FECB 5B4MC 5FGBA 3VDBA 2P5WD 4PB9L 4Z7WB 4WY7H 5HYEA 5K59F 1QO3A 3DX6A 2DMBA 3ZYOA 3MLVL 4JCMA 4X7DC 4I13B 1NAKH 4K71B 5FYKD 4PV9B 4P57A 5IEHA 5JW5B 2BY3A 3S37L 2X09A 3RGVC 4MLIA 2BRRL 1UJ3B 3HI5H 4L4VE 4AL8L 3QQ3A 2QLVB 4ONGH 4CJ0A 1V3LA 4ZTOH 1F4AA 2PO6B 1ZLSH 3U30C 2ZUTA 3QIUD 2EE6A 2EYRA 3HN3A 3CVHA 4K23H 4AH2A 1CYGA 1MIEH 1BZ9B 2NY0C 3RZWA 2HMID 5L7XH 3NACH 3DX8B 3MZTA 2VE6A 1LO2L 4M8VA 3L9RB 1KJ3H 1WFUA 3MJ8A 2NX5B 3OKNB 4AEIL 3NZHH 3MXWH 4FQJH 2C4FT 1MNUL 2NZ9C 4FZ8L 3MLUH 3HMXH 1OY3B 1SYVB 2FNBA 3FMGH 4P3DB 5E94A 1FSKB 5D2LF 4MX7B 3N85L 2R2EB 1OWRM 2E7LA 5IWLA 4KZEL 3DI2B 1AE6H 3GSWB 2O93L 1ZVYA 3DROB 4HUUB 4WHDA 5TF0A 3MRMB 4XPBH 4JFQA 4U2ZA 3SE3C 5FCSH 4LLAA 4G5ZL 4OGAD 5CP3H 5TF1L 5TQ2L 1NFDF 4X6DE 1L7TH 2AI0H 4AK1A 1KLUB 4R4FL 5IQ7L 4MMZC 5L0QC 5DUPL 5IBLD 3SCMA 4XT1C 1ORSB 1U6AL 3NA4A 1OLZA 3QH3A 3QIBA 1QLFA 2YOCA 1ZSDA 4RMQA 5C09E 1S9VA 2NXYD 4HT1H 4IOFC 5T3XD 3F6LA 2VLLA 3PIQA 5I1HL 5GRUL 1QEWA 2GITB 1P4LA 2BDNH 3Q3GB 3I02A 4Z76B 1NDGB 3FL7A 4Z95L 5J1AB 3AS1A 3L5XH 5A2IH 4XI5D 1AGEA 5F88B 5GSRB 4OCYL 3I84A 2DLEA 3S6CA 2MHAB 3OPZL 1RVFH 1JL8A 3ILPA 2BNQD 2MMXA 3NCBB 5D1ZA 4HIHB 1OAZH 2FL5A 1PKQB 1XZ0A 4FFVC 5C6TL 4URTB 2F8XC 1CFNA 4MJ4A 2UV3A 2JTDA 2E9BA 4X7TA 3K80A 5C0CA 1HNFA 2Y7QB 4I3RH 2NXZC 3ARQA 1BFVL 4WTZA 1AR1D 1G0YR 4XPHL 2IANA 3ORJA 3HR5B 4OZ4B 1G9NH 3BIKA 1YDPB 4I48B 1MVFA 4UDUA 3IKCB 1CR9H 4JFYA 3C09B 2W38A 1FYTA 3BGFC 1QYGL 3AS2A 5D93C 3E3QC 4ELMA 4NKDA 5DT1L 5JO5A 2DMKA 1SEQH 2HWZL 5DJYA 1IGYB 3H2WA 1BBJA 4ENEC 2W0LA 5SWZB 3B9DA 4WFFE 1BF8A 1S9XB 4MJIE 4J3OC 2IAMB 1KLGA 1X44A 1UKTA 2BNRE 1K9TA 2JCCF 4ZYKA 4NRXA 1EMTL 3GSOA 3KNBA 4RAHA 1JV5B 2ZJSH 3PWJA 2P49B 4N0CD 5F72S 5F3HB 3B8SA 5JW4Q 3JTSB 4Y19A 1Q0YH 1MI5B 1A9BB 1AD9B 4GW4A 3QCUL 3AAZB 2GSGB 5C07A 3BW9B 1QVOB 3B2VL 1LE5A 1YEDB 1FORH 3HNVH 2V9QA 1FC2D 1L4IA 3MUHL 4NO0A 4KV5E 4YC2B 5A1AA 1NEZG 4OCLC 3T0EE 4LCWA 3T4YB 4K94L 1XEDA 1RZFH 3IF1A 3UTPE 1G0DA 4CRPA 5EC2B 1KCLA 2VIRA 2VITB 2Z4QA 4UNTA 3PWLA 32C2A 3BRDA 3VXSD 4JFZH 4Y88A 3FQRA 1IC4H 1OB1A 1H3TA 4X6FB 5IVXF 4LHUD 5IEKB 1D5IL 1MJJA 4JM4H 2N7AA 2XV6B 4L3EA 3UTQA 2ESVE 4A6YL 4KKLC 5LGJA 4RAVA 3VXME 2JJWA 3I50H 3RDTC 1A4JB 3C87A 3S4SB 1I9JL 1KCUH 4LEXL 5E56A 2ENYA 3BP5A 5GS3A 4UU9A 3V6FA 1YNLL 5HY9A 3OKKA 2YZ1A 1G7IB 3HAEB 3ULSA 1WBZB 3ZT5A 3INUL 1IKFH 4JFEE 2MNUA 2XZAH 4JANA 4RMSA 5F7EL 5DGQA 5IIEA 1P53A 1JFQL 5T3ZH 3Q6GH 4QRTA 1KT2B 3OKEB 2IMNA 4N8VB 2QV2A 3BJLA 2BVTA 2P8LB 1K3ZA 1DE4B 3CVIH 5E03A 3KLAB 3FRPA 5FOJA 3CZJA 3MV7D 4G8IA 5DRNB 5E5UB 3QNYA 1NMCB 3NFSH 4GJTB 4KJWD 5DJ6B 2YUXA 1WFTA 2CJUH 2ICWI 4RGOL 3SDCB 3IYLW 1ZANH 1ZWIB 4HIEA 1KV3A 1VGKB 5I74B 3F7VA 1TJIH 3PDOA 1BJMA 1MHCB 1S7RB 5IMMA 4U1JA 5IVNA 3HE6C 4HK3J 1IQDB 2BVQB 1T2QH 3EYQC 5FK9B 5KS9A 3U7YH 4YFDB 5J6GA 4X9GA 1ROWA 5CJ5A 2AK4A 3EFFA 3QXVA 2UUDH 4X0KA 1I3UA 5H94B 4CMHC 1F4YL 5IESH 3NIFE 1XR9A 3ARBD 4YXKH 2N4IA 4LPVA 4O2CA 4GQPH 3B9EA 1EUUA 5IB5A 3VA2C 4AEFA 3HTLX 5IW6A 4N0UB 3GFUA 4IMLA 1ZA3B 1FZKA 3KHQA 1I1AB 2X4TB 3Q1SH 1T20B 5F6HI 4WUUB 5ITFA 4YHPA 3ZKMC 4FFYH 2VSDA 4G9DA 3GRWH 1FO0H 1AFVL 1V7NL 3VXPB 5ICXA 1CK0H 5DO2D 3U9PL 5CJXA 4M03A 3DMMB 4KMTL 3FAWA 4D0BB 3TN0C 2OL3B 3RL2B 4OBRA 5DQDH 4ODTL 5CEYB 2VABA 4PJIB 5IV2B 5DWUL 4S10A 2YPVL 5E9DB 1MELA 1TCRA 3RWFB 2EXWC 3MPCA 4PJBF 4F7MA 2DOCA 2VDNH 3TEUA 4QYOA 4OZGE 4CVXA 1DUZB 2P47B 3KPRD 5GRVK 1TIUA 3F7RA 1UACL 1UWXK 3H9SD 4JM2C 1WLHA 2F5AH 2VDOL 4G7VH 3LAFA 4ORZC 4H26B 1NLDL 5D72H 2YD6A 1HQRA 4BFIB 4YGAB 4J4PD 5DD0H 2H41A 3MRFB 4NJ9H 4P5TD 4R8WH 1YNTA 4KK8D 4ODBD 4IRJC 4OT1L 2C3WA 5IMOB 2P8PA 4U1MB 4M9PA 2ZG2A 4ZUUB 3M17A 5ID1B 1MFNA 1MFDL 1RURL 2ATPB 4DGVH 1ZS8B 2MQCA 1QFWH 3MV8D 4BKLA 2E7BA 5AZ2H 1KB5B 2DQUL 2VXTH 3TGXA 4JFFD 2ADFL 1A47A 1J86A 3QZWB 1DLHB 3QEGH 1HHHB 1AO7B 1NBZA 3HMWL 3O9WD 5LBSL 2FHCA 4D9LL 3FRUB 4UV4H 1G9EA 1FFPA 3TBTA 5I71B 5C8JA 2IC2A 5H37H 5LAXB 1MFAH 3BKCH 4LAQH 5GGRY 5HI5D 5JW4R 2VDQH 3S36H 2X6MA 1MRDH 1ZT4B 1AGFB 1NBVH 5FKPB 4B53A 1Z5LB 3X13B 1P7QA 4GMTH 1RZGA 1S9YB 4HUXB 1E6JL 1A7QL 3VG9C 1S8DA 3HG1E 4PJ7E 3JV6A 3UPAA 5EB9A 3GM8A 5FYLE 3UYRH 2HT4C 3BESR 2OZ4H 1TVDA 3QFDA 1QFPA 4X6CA 4GOSA 4YDIL 4JG1L 4N8CH 3BZ4B 2WINA 4PJ9D 1IGML 4X98B 4NJAH 1NCNA 3CC5A 3QQ9D 4HLJA 5SV3A 4FP8L 1XGUA 2GKIA 5J6HB 3RX7A 4M61B 3ETBF 1KEML 5GS1C 4PD4K 2CDFB 1CIDA 1F13A 1Z0NA 3HHRB 3L9RA 1NL0H 3IXAA 4LPTA 1J0YA 4YUEL 1KXQE 3TT3H 1II4E 1IAKA 4KTDH 1BVZA 4N0FB 4ZAKB 5BVPL 3D39B 4KDTC 4GW5A 1NC4A 1RUPL 2GK2A 3GI8L 4RIRA 3VW3L 2IQ9L 5B38B 1IGIL 2FH8A 4YBQD 3IDMA 5SWSB 4S1RL 2YRZA 1BAFH 5HHMD 3ARVA 3BUTA 5KANG 5EU7E 2EIBA 2FGZA 4U33A 5EZIL 4JKWA 1EBAA 2EYTB 3EJZD 1IAOA 1RZKL 4LRNH 5DD5H 2VDRH 1ORSA 5EIIB 1GGCL 2WLYA 4GAJL 5L8KB 2QHRL 4OFYA 3WJLC 1RJCA 4YDLB 5FYJL 2CXKA 4JDTH 1MFEH 5IHUH 5IROA 3U1SL 4EZMA 3FFCE 2OK0H 1MCPH 4JDVB 4NM4H 3QDJA 2ID5A 4H0IA 1UB6B 4I0KA 4TSAH 4N5EC 3QQNA 1AGCA 3BPCA 2O5XH 3BJ91 3LKSA 3RIFF 4N5UA 5GGQL 4IRSA 1V3JA 1GGUA 3ZTNL 1CGWA 3CD4A 4QF1A 2HT3D 3ULUH 4HKJB 2PXYB 5IFAH 1RZJL 1H8SA 1INQA 1YYLL 1QSZA 3QUMA 1OOAA 1PKQA 4WJ5A 2CGRH 2WK2A 1WC7B 1YPZF 1P6AB 4LSTH 3ZE1F 2Y25A 2ZPKH 4V1DA 5D6DA 4I18A 2AJVH 4MA8L 2Y7QA 4Y16A 4JRXE 4DUVA 4QY8A 2W60B 2A74A 4PRHB 3MOBH 3RVXD 3VJ6B 4IEFB 4OZ4A 2CUMA 4UIMB 5EU5B 3PGDA 5A16B 4F57L 3HS0A 5HYFA 2GY7B 1VSCA 4HDIB 3PL6B 3IJHB 4LBEA 1KC5H 2CUIA 4Y2DD 1OAYH 2CK0H 1N5AB 5DD6B 2JJSA 3IU3B 1R5VA 3KPSB 2ED7A 2X70B 5CILH 3BEVA 2LTQC 4KMLB 4C58B 1JZ6A 2IAMA 1KG0A 3B9KC 4ZNCD 5A43C 3BO8B 1SQ2N 4XVUC 4XPFL 3FO1B 4PY8I 4H0HB 2GSGA 2J8UB 1MQKL 1OP3H 1TPXB 4PTTB 3D9AL 3IFPA 1T7XA 3BE1H 2Y23A 4WNQA 2DLTA 4P2OB 1WT5C 5JXEA 3T3MF 1N5YL 2P4AB 3SGKA 4L4VB 5EC2A 3O3DA 1P6FA 4RAUA 3OL2A 3AS3A 4JZNA 1G9NC 3SJVD 3SQOL 3CLFH 5EZOH 5E7BA 1QP1A 4Y4KC 1DSFL 2G5BB 3TO2B 2JIXD 4NQTA 1HZHL 4MNQB 3QQ4A 4WI2A 5HVFB 2Z8RA 3HPJA 1CICB 1NH6A 4PJ5A 4XP5H 2ATKA 4EKXA 1C5DB 3L7EB 4LDEB 2DTSA 2EEDA 4HC1L 3S4SA 3IXTB 2IPTL 4XXCA 4UINH 4XWGH 3L1OH 3D2UB 4JN2A 4YPJA 3BGAA 1Q0XL 1JI1A 3HAEA 2CLVB 2PF6A 4XWOD 5DK3A 2X05A 4I77H 1TZGH 4K3GA 4HWZA 1FPTH 3VXNA 2OBGA 5BO1H 3P73B 3RWDA 1G7PB 4LIQH 2ZP0T 1KT2A 1SJXA 1I85A 2WAHA 5E2UL 5CZVH 1DE4A 4QRUB 1U8MA 2VL5B 1S3KL 5D1QD 3WS3A 2P5EE 1MCIA 1BD2D 4Z7VE 2R56L 4F7EB 1X5YA 1QR1A 1IQWL 1YMMD 1UM5H 3MLWL 3MV9E 4QHKJ 3DO7A 2EZ0D 4BQ9A 4E5XA 1IEBB 4HJ0C 3RNKA 5C09B 4YE4L 2GAZB 4XAKE 2BNUA 1MHCA 3FT2A 1RZIB 5INCA 4DAGH 2IH1B 4N1HB 2BC4A 3DX7B 3FQNA 1KEGL 2LABA 1AXTL 1BHGA 1CDCA 1R3JA 2NY7H 5DMGC 4GQ9L 4G6JL 4RMRA 4NQEE 2QJDA 4GAGL 1IGCL 4Q58C 1QSFA 1A7NH 5ISZD 2OQJB 2QQKL 3VH8B 5E1AA 5DJ2B 3SKMB 5D70L 4PRPB 4R7NA 3OGCB 3TIEB 1KTRL 4P3CH 4RFOH 4OIAA 5BQ7A 1ZVSB 4X8JB 4N0UA 1U92A 4Y5XA 3VFUB 1ZA3A 3C6SB 1I1AA 5EZJA 2VXVH 2YPLE 4U6YA 2Y07H 1J11A 4GFTB 4MCZB 4Z0XB 5I2IA 3K2UH 2JE8A 3X17A 2H26B 4M6ML 5LGKA 1KFAL 2CKNA 1V8HA 4YR6B 3CK0L 3L5WA 2RBLA 35C8H 4LL9A 1NANH 3OV6A 4M43H 3TCLB 5DDHB 5JQ6H 2XTJD 3V52L 1EO8L 2GJ6D 3F7YA 4NIKB 1I9RL 5A2KH 4QEGA 4FOMA 4PRDA 5JORA 5ID0A 4YXHH 3LKQA 4PR5B 1KCSL 1IM9B 4JO1L 5DJ0B 5FIEA 4PJ8D 5D4QA 2JB6A 2E6JA 4UIKL 3V4UL 5EO1B 3PJSA 1VFUA 1VADB 3IAQA 2BNRB 4GLRH 1A6ZB 3MJ9H 1KGCE 4X6EB 1E28A 1AJ7L 5CHNA 1EEQA 3D25B 4UQ3B 4H26A 3RKPA 4PJXB 5EU3B 2JJTA 2ICEA 3LOWA 3MRKB 3IVKB 4FQ1H 3MRFA 4LKCA 3O11B 3S5LA 5K93A 2DQHL 3R0NA 2CKBB 5HDBF 3T0EB 1L7IH 2QADC 2HFGH 2Z93B 4JJHA 4DZBB 4UNUA 4KJQD 2ATPA 3RGVA 4YDKH 2YEZB 4KQ3H 4M02A 1KB5A 4F37K 3TVMD 4HH8A 1Z3GL 3RWCA 1A14H 4R3SB 5D7JB 3NBNA 1NFKA 3QFJD 1DJSA 1LEIB 3MACL 5IBTL 4LCIL 3TO4D 1ODAA 2N1KA 3ZDXE 1BVKA 1FVEA 4Z7QF 5IGXL 3ZKNC 2R29L 1CCZA 43CAB 2V17H 2VDML 4P4RB 1N6QH 3PWNA 3VU2A 2BOCA 3KXFE 5DFWH 5H37G 4XGZA 4JFEB 4HUNB 2G60H 1SY6A 2MKLC 3QIUC 3E1F1 3NIDE 4HUXA 5GRJL 3T0XA 4X4YB 1T3FB 2Z8SA 3TA3D 3C9NA 1F8TL 3G5YA 3SE3A 3IDIB 3D0VB 3T2QA 1E4XL 3EYSL 5TE4L 5F9JB 3DUSB 2H32A 1U3HD 4PV8B 3DHMA 4MSWA 3MLYH 4UQ2A 2XRAH 1S5IH 3NH7L 5ANMA 1KIRA 5I30H 3V5HB 1FFNA 1M6OA 3CCHB 1UWEL 4DZ8B 4O5LH 1OAKH 5DRXB 3CU7A 2QL1A 5JOEA 4GO6B 1M71A 3RHWK 4OGAC 1FE8H 4U1LB 4KHXH 3C8HA 3HB3D 4NT6B 1LDPL 2BHUA 2CD0A 3MRCB 2Z0BA 2EC9U 1PKOA 3ARUA 5C08A 1LP9B 1CF8L 1QACA 2J5LC 2VZUA 4KI5E 5C0GA 5B38A 4Z7OF 4HAGA 1RPQA 5KVFH 4CMMB 4EI5B 5FUCC 3ZSSA 5T1KD 2X4OA 3HZKB 4ZFZA 4LSVH 3UBXA 2XXMB 4C4KT 2FJGB 1BZ7A 5D2NC 3U0WL 1NGZB 4HS8L 4XBEH 3WL9B 3Q6FA 1KB9K 1OARH 1GPOH 4WGVB 5GGTH 4M6OL 2HVJA 4GG6B 3AREB 1YA5A 2E9IA 4LVNC 2AGJL 3SKOA 3MXVL 5FOBA 5B8CB 3VFMA 3TZVD 4TN9A 3FT3B 3SDYH 1RI8A 5B3JF 5DZOA 4G43A 1UB6A 4M7LH 2SEBB 1B4RA 3H3BC 3V6BR 4KRMB 3U2SB 3LN5A 3HUJB 2DQJH 4H8WH 3U0PA 3MMEB 1NBYB 1EGJH 2GFBA 2X4RA 3NABL 4HGWA 4N9OB 2WUCL 5HDLA 4LP5A 1C08A 4OZGB 1RJYB 3QDMD 3VRLE 5BV7B 4JPVL 1UB5A 3GO1H 2DQEH 2DTMH 2Q76A 3EFDH 5IJKA 1TNMA 3MOAH 2FYYB 1FQ9C 3CDCA 1SHMA 1LO4L 4L8BB 4D0DB 4O58H 4LNRA 3VA6A 3BWAA 3AMKA 1CG9B 3DYMA 5F7DB 4NZTL 4JZJC 3QWRA 1GZQA 4QRRA 2DN7A 1ZT7A 3G6JB 2NY4C 4MAYB 5D7IE 2BY2A 2OMNA 1TZHA 3WXWL 5K9KB 1FFOA 1H3PH 4Y8AA 3BKYH 1T4KB 3RDTA 3LEYH 1HSBB 5LQBL 3K4DA 3CSGA 2AW2A 4C56E 3C8DA 4Q2ZA 3MLZH 3KR3H 3QIWD 4EBQL 5I15L 5J8OA 4KRPB 3RGHA 1U58A 3QG7H 3QO1A 1VPOH 2XFXB 5J89A 3ULUC 3GB7B 5EOQL 4MXQC 4PJHA 1X5IA 2BSED 1RK1B 3EJYD 1T0NB 1I9IH 1MJ8H 4FMKA 4TYUA 5L2JB 4JAMA 5EC1B 3RZCD 1MJUL 2KUTA 2W0PA 2GW5A 1Q72L 1EO7A 3WIHA 4M7KL 3EOBA 1NGPH 3GJFH 1NEZA 3LZFL 3IJYA 1MREL 1X4XA 2ORBL 3BPNC 4KPHL 1KN2L 1AKJA 4NZJA 4OFPA 3BHBA 2FIKB 4PJCB 4P23B 2HN7B 4MS8C 4MNHB 3ULVD 1IGJA 3DV6A 5MEOA 4HZLA 3REWB 1FGNH 1P5UA 1N64L 2ICWB 1BJ8A 3QEHB 1JZ3A 3P0YH 3IFNH 3RPIB 3TV3H 3HE6A 4Y8DC 3CDFA 4YGVA 1Y0LA 1NKOA 4PBWD 5GRXG 4BK4A 4EDXB 3W39B 4X9HA 4ZOCA 4JFHE 3FTGA 4OUUA 3RL1B 2CLVA 4NZRL 5GS0L 3BKMH 1PSKH 4DJMA 1YNKL 1Q9WB 3P73A 2NTSP 5F9DC 4XHQA 4OIIH 2EEBA 4WI5A 3K7UA 1J1XL 1U8OB 3RVWC 3MR9A 3A6BH 3DXAA 4Q6IC 1RULH 3W9EB 3QULA 4UT9H 4NZDA 4OLWH 3VG0L 3VWKB 2V6HA 4F7EA 4P59L 2DQTH 3CLEH 3IU4L 1MAML 2VDKH 1X4ZA 1GSMA 3QRGH 2HRLA 3QISA 4GXUN 5GGUB 5I1GL 2P24A 2M26A 5ACZA 1CS6A 4DQOL 3FB6A 3V6ZB 4JREB 1WJ3A 2IH1A 3OZ9H 1C16A 3FFCB 1OT1A 2HVKA 4YO0B 1HXMA 3TN0A 4JY5H 1FNLA 1S7VA 3ARZA 2H3NB 4KJYB 5HYIA 1GGBL 1D9KA 5JPNA 4XHJD 1HKFA 3VXUA 2F19L 1WZKA 2VZ1A 3BZEB 2NY2B 4PRPA 2W9EL 4WY7L 4UTBH 3QJHB 1W0WA 5DO2C 1IEAA 1NAMA 4J3SA 3M45A 4JM2A 4LSQH 1P9MC 5E8OB 4CJ1A 2FB4H 5K9JL 3JV0A 3HI5L 4X99A 4KXZH 1B0RB 1CFQB 2ZSWA 2NR6C 4JRXB 5I8CA 1CL7I 1LO3H 1XH3A 4MCZA 4IRJA 5KSVB 4QXTA 2V2XB 4WI6A 1MIEL 3QHZH 3TM6A 3MRQA 3GMOB 1HXYB 4MJ6A 1L9MA 5I71C 5CJOH 2FWOB 1VEPA 3NZHL 3L5JA 25C8H 5ICYB 2B7DT 2VAAB 2H2PC 1ZOXA 1HYSD 1OAQH 4DFHA 3TJEL 1DBML 1FAKT 2VLJD 4DVRH 1J8HA 4P5TC 5EO1A 2P5WB 4K2UL 2BSTA 3T2NH 4CVZB 5DFVD 4XPBL 4XPAL 5T1LA 1F00I 1JF1B 2C3VB 2DS4A 5C71A 2MOVA 1FDLL 1L7TL 2AI0L 2RQ8A 4I2XE 4MD5B 4HKZB 1SYSB 3BH9A 2QSCH 2YBRA 4XRCB 4PJIF 2YMXL 4ZNEE 3UTTD 1FL6B 5J57B 4NNYA 3SO3C 1U0QA 2R0KH 2J6EA 3D1MC 1OCWH 1UXWA 4A2MA 4PG2C 5GGRB 4YHNB 3V7AG 1INDH 2EDFA 1EJ6A 2NY6D 4OKVB 4Y7MA 3ZDYF 5HVHC 3L5XL 5ENWA 2GEEA 5EA0H 4R3SA 5D7JA 4G8GD 2BVYA 4DGYH 3DVGB 4JY4A 4X83A 2E7MA 5EUOE 1VFBB 4U0RC 2AJUH 4Y1AA 5HHOD 1C5BH 2X41A 4P4RA 4NQUA 3TBVB 4ZPTB 2NW2B 5CEZD 4OIBA 3LKNB 2MWCA 4O02L 1EVTC 5I18H 1YYML 2X42A 1U91A 3QUXA 4JPIA 1IBGL 4E41A 1QKZL 2AXGA 4M62H 2PYEA 4HCRA 4QRSB 5K9QG 1FNSH 4X9BA 5ICZA 4X4YA 4GKZA 5L2KE 1X5AA 2NXYB 2FSEA 1KTLA 4BH7B 4LOUC 1KLFA 5GISH 1CR9L 3T77B 1Q38A 3D0VA 1JGDA 5JHLH 4C4KO 3QUZB 4FQXB 3T08A 5DMKA 5J3HC 5B39B 1FH5H 4IOIB 2EDRA 5IBUG 4YJZL 1F45A 5T5NG 3QHFH 3WJLA 3E6HB