5IGXH

Crystal structure of nih45-46 fab germline precursor in complex with 426c.tm1deltav1-3 gp120
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
219
structure length
192
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGKYCTARDYYNWDFQHWGQGTLVTVSSASTKGPSVFPLAGCLVKDYFPEPVTVSWNSGALTHTFPAVLQSSGLYSLSSVTYICNVNHKPSNTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 426c.TM1deltaV1-3 gp120
publication title Structural basis for germline antibody recognition of HIV-1 immunogens.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 29
structure length 192
sequence length 219
ec nomenclature
pdb deposition date 2016-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5igxH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5igxH01
1NGYA 4YQXH 1T20B 5DZOA 2IG2L 3C09C 1FV1A 4YFLI 4PJ9B 3EIFA 1GC1C 3RWEA 4MNHB 3DRQB 3KJ4B 1XR9A 3ARFC 1IQWH 1I8LA 4FTVE 3Q2CA 1S7VB 4DQOH 3PWUA 3BUTA 3WXVL 5I8KL 2ICES 1RUPL 3QUZA 4J23A 4X5WB 3MV7E 4FXKB 4RGNB 3ZTNL 5CMAA 1E4KC 2WSKA 2BCKA 4KUZL 5E7BA 2GFBA 3S35H 3MRDA 4NQEB 5FGCE 3DO7B 4OLYL 5DYOB 5HVHC 3LQMA 5HGDA 4GRWF 2I25N 2NY3C 3ARFD 2EKJA 4DKAA 1KIQB 4XBPB 5IB3A 2B5IB 4ZUTB 2CMRH 4NQVA 3MUZ1 3HE7C 3CXHJ 1X5FA 3X3FH 1FZKB 1DBAL 3QFDA 3TF7C 2Q3AA 3SO3C 4DK6A 4PBWD 5FAAA 1UJ3A 5BV7H 5HPOA 5EO0A 2GEEA 4WU5A 12E8H 2CXGA 3Q3GB 1KJ3L 3IT8D 4H0GA 4PUBL 4I18A 3WYRA 1AJ7H 4XMLH 4ZTPH 2EYTA 1UT9A 2IANA 1T0PB 4G7YL 2MOVA 3NZ8B 1MCKA 3TESA 4Y4HD 2Q86B 2VDOL 1RD6A 4TSCL 2BSTB 1HHHB 2PW2B 3HI1B 3CFKA 1T22B 5DS8A 3L7FA 3P4MB 5ICZA 1NEUA 2LU3A 4LCIL 1CFTA 2Z31A 5E8NB 5E00B 1CE6A 4X7FC 2OX5A 4M48L 1T1WA 3LKNB 1LEKA 2FX7H 3OTTA 4GRWB 1TQCC 3BQUB 5IV2B 3MNZA 4F9PC 5CILH 3T0XA 1QLFB 3S88L 2NY4C 1G6RA 1BLNA 4QOKE 1UACL 4G42A 4KUCD 2L7JA 3UTZB 3L6FB 4PPTA 2VZSA 1L7IL 4IS6A 1QSVA 4JO4L 3ELAT 5A2FA 3LS5H 5KSBF 2OJEA 4XVUC 3PWVA 3RJQB 3G5VB 4G80B 5DQJB 1E6OL 5FB8A 4QHNB 3MLXL 3MRQA 4GBXA 2SEBB 4TVPL 4Y5XA 5I1CH 3O3BB 1UZ6E 5L88H 4EUPB 2C3VB 3O11B 2WUCL 4Z78A 1FL6A 3O2DL 5AYUH 2NLJB 4NPYB 4JFEB 1JGLL 5ANMB 3EO9H 3U7YL 5KSUB 2IH3B 3TV3L 1ACYH 3WDIA 3ILPA 4XAKE 1QRNA 1VFMA 1EHLL 3KWWA 2VQ1B 4OV5B 1Y6KR 1Q38A 4WCYH 5CKAA 4MZ2A 1CTOA 1BFVH 4U7SA 4UT6L 1S5HB 3WIFB 1AXSB 1CXFA 3NIDE 3DUUB 3QSKB 1H3PL 4N0YL 2X4RA 2D9QB 1FNEA 1JN6A 5AAWA 4F7EA 4S1SL 3DX7B 1YC7A 3U0TA 2G60L 5J13B 2O5ZL 1EO7A 4WV1C 3PL6C 5MHSD 2X4OB 2APWA 4AH2A 1NGPH 1PY4A 5IBTL 3NCEB 5T33H 4OQTL 1HI6A 5HHQB 4Z5RB 2FBOJ 1T04A 5SWSD 4AT6B 4HPOH 4M61B 3BPLB 4GSDL 5KSBB 4LBEB 4OZFA 3NOIA 1R5VB 5EG6C 4WI3A 1GGYA 4TULL 3RWCB 3DX9A 4PR5A 1BX2A 3ZZ1A 3GHBH 4TTGA 2C7UA 1T21B 3PL6D 3VGBA 2NR6D 5D7KE 2R1XB 4M7LT 1MVUA 2XZQH 1R24A 2E7MA 1QACA 2EO1A 5FV2A 4A2LA 1RZJH 4UMGA 1LWRA 2VDNL 1CXHA 4GAYA 2W9EH 2LABA 2X10A 3F6LA 2MMXA 4F7PA 1RUQH 3MRNB 1I7ZA 4GH7B 4HS6A 3G6DL 3I6LE 5D1XC 5I8EA 3QZWA 3C5ZA 1XFPA 3BSZH 3CC5B 1MCJA 1ADQL 1LD9A 1DN0A 1NBVH 1PKQA 5LJYH 5FHBH 4PY8I 1DQJB 3H9HB 4PB9L 2QHRL 4F9LC 5C2BL 3E6HB 4KRMB 1GZPB 1ZHNA 3D18B 3MLWL 4KROB 2ZCKH 3RVUD 1RUMH 1WZ1L 4OF8A 5MENA 2XFXA 5D6DC 4UU9B 1J5OL 4LNRB 4ZFOL 4R4FL 1P7QD 2BFVL 2J6EL 1XMWA 3IS1X 4AIXA 5GGQH 2ZWLT 1RZGA 3VRIA 5T1LD 3HZMB 2PNDA 4RDQG 1CFVL 5DHYB 5E1HB 1WTGT 4DKEL 5JHLL 2ZCHL 1KJ2L 4ZUSA 4XWOD 4JM2F 4D0DA 3PJSB 1AE6H 2CLRA 3VJ6B 3OKMB 4BH7B 5J0BA 3QQNA 2YWYA 4XXDA 1AKJA 4PRHA 4UQ2A 5KVEL 1B3JA 3REVA 2YBRA 5EPMA 4KRLB 4RIRB 5EZJB 2NY6B 3WE6B 3MX0A 5C09E 3OX8A 1HSAA 1WV7T 4BZ2L 4D0BB 2Y5TB 4KRPB 1SEQH 2AV7A 4JPKL 1L7TL 4X8JB 4Z7WF 3OJDB 5INDB 1I8IA 4W70A 4YZFF 3S3PA 3MBED 2IEPA 2H32B 5F1OB 2O5YL 1J0JA 2DLHA 3QI9A 2HP4A 4MVBC 5L8KB 4PRIA 3GUTA 1INEL 1VEMA 2LVEA 5I1JL 2Q7YA 2A1WH 4K3DH 4OZHE 1NCTA 1B4RA 4R26H 4L4JA 1BFOB 1FG2A 1NLDL 1YEDB 5I73C 2J6EA 4LKXB 4IRJB 4TNVF 5E2VL 3GB7B 4POUB 1ZSDA 5GGRB 1NEZG 1IC4L 4QRPE 35C8H 4OFPA 1Q94B 4NN5B 4ODHL 3HC4H 2CDFB 4RAVB 1KJ2A 1DTUA 4JAMB 4MVBD 2HFGL 3B4NA 3KYKL 4PJBF 3WEXA 1VERA 4JM2B 5B4MC 5ESVA 4Q6YA 1T5WA 3OKEA 5J1SC 1NKOA 2X2YA 1IQWL 1A0QH 3IXAA 2H8PB 4QY8A 4DQOL 4OZGB 4AM0A 1F6AB 1YQ2A 1L6ZA 3TN0B 5IHZB 1G0YR 3WDHA 5HHXH 3OJ2C 2R4SH 4JQVC 4D3CH 5DFVD 3S35L 1A6ZA 1G0XA 2O5XH 5MERA 4Z7WB 5JW4N 1UJTA 1X7QB 1XF3B 3EFDH 1LP9F 4NUGH 3DNKA 2IALA 4G9FD 3QULA 2CKBB 2W38A 2CMRL 4UIMB 4ZSOE 4NKOA 5C71A 4XXCA 2EEBA 2KDGA 1YNLH 3DUHA 3R0MA 3X3FL 4JO2H 2HTKD 3O41B 1TNMA 4HUVB 3W5NA 2FSEB 1J0HA 1GOGA 1NEZA 2A6DA 2BVPA 1BD2E 5BV7L 3AS3A 4HF5H 5GGRY 1HINL 1F5WA 12E8L 3HPLA 1IM9A 4KTDH 4U05A 4PJBB 5L2JB 1AJ7L 1I3RB 4XMLL 3VFOB 3ARWA 4KGLA 4KGJA 4OB5H 2XWTB 3ZTJH 3ZYOA 4GRLB 3B9KB 4O58H 1BJ1H 4OGYH 1T0NA 4BK5A 1IGIH 5IQ7H 2VNCA 5DTFB 5IMLB 1EO8H 3S96A 1CTNA 5IVXE 2DQCH 1U91B 5F89B 3G08A 2YR3A 1DLHB 5JIKA 1TJGL 3DSNA 4H0HB 2UWEA 5E03A 2FX7L 2ICWI 4LSPH 1DANT 4U1MA 1LP9B 4FQQA 1OT1A 4QXTB 1MY5A 3O6MH 5CILL 1GGTA 4O51B 2E5EA 4MB3A 1YDPB 4C58B 3QR2A 5IR1A 2CK0H 5IMKA 2G2RB 4QT5A 3V7MA 3MGTB 3LS5L 5IB5A 3HAEH 1LO3H 1I9JH 5EB9A 1Q72H 4KUCF 4DEPC 4C83B 4HJ0C 1OCWH 4WIQA 4LFHG 5I1CL 5DJDB 4M6NH 4PJFA 1VA9A 4RFEB 5L88L 1E4JA 2XQYG 3P2TA 1OLLA 4JHWH 5AYUL 4GKNB 3EO9L 5JOEA 4PG2A 1ACYL 4PJXE 4NN7C 4U1IA 3VXQB 4UOW1 4MQSB 2ZUTA 5C9JB 1ZK9A 2GJZA 4Z7NE 4L8CA 3O6KH 4WCYL 3UTTE 2QR0B 2F5AH 3KPRA 3W0WB 1BFVL 4GRMA 2G75B 3ORJA 5FF6A 4HS8H 2ED8A 1Y18A 4LOUD 2P24A 3UPAA 2VC2H 4RX4A 3X12B 1ZS8A 3DVIA 1BQLH 4J3TA 1HE7A 5AUMA 2P46B 1A3RH 1WTLA 1DEDA 1NGPL 4KFZC 1BJ8A 3ULSB 5C07B 1V3LA 2GJ6D 5T33L 5DWUH 2CKNA 3FQWA 5JNYA 2FZ3B 4IHOA 1E27B 4HPOL 4LVNB 1QO3B 1NANI 4EIZC 4NRXB 2DYPA 3DURB 3GHBL 5DI8B 1S7TA 5DJCA 1G7IA 4MWFA 5BS0D 1JPST 2EIZA 5GQBA 5F3BA 1B6UA 1K3ZA 4MJID 1ORSA 2XZQL 4CADB 3F65A 1JGDA 4RGNE 1RZJL 1JV5A 4MNQA 4DUXA 2W9EL 4UQ3A 3JWOC 3JVGA 1RUQL 3VDBA 4NQEE 4OZIA 1I85C 3GMQB 4YXKH 3MRMA 1OAZH 1ZVSA 4EJ1C 3VXUB 2ADGB 1CR9L 4NQDD 3ZKXC 2V2WA 4H0IA 2J8UF 1FZOA 1DQTA 3D85D 4XB8A 5FHBL 4I0PC 3KPSD 4OF0A 4RQQA 3VG9C 3I3DA 3PHQB 5DSCB 1BZ9A 3ARQA 3WO3B 2BVOB 2L0DA 2GQHA 3S3SA 1LK3H 2ZCKL 2AEWA 4RFNB 3EYOA 4NCC1 3PG2A 3C8DA 4HIIA 3RBSA 1RUML 1A14H 4K2UH 3OR6A 1QPXA 3QQ9D 2P5ED 1OGAE 3EOTH 4PJEF 5KSAA 1S7UB 3IJSB 5GGQL 2D4FA 1YYMH 3HS0B 4Y19B 1A1MB 3QIUC 5BW7C 3LPFA 1WBXB 2H6PB 3GMNA 1A3LH 2P47B 5F21B 2HT3D 2HWZH 2UYLB 5HGHB 1I8LC 3AS1A 4UB0H 4PRDB 1NMBH 2DKSA 3WFEH 3QUZC 5HTSA 2YD7A 2AJUH 5C0NC 1U3JA 1JP5A 5ITFB 1NMCC 2XNAA 5JW4Q 4H5SA 4HPYH 1SEQL 4ELMA 3DETD 5DVKA 2V17H 4RRPA 3FTGB 2FB4H 1LVEA 2J8UB 2D9CA 5DEZA 3TNMB 1SYVB 3O3DB 4AJ0A 4PJCA 2I60H 5C0FB 5IMMA 2BVQA 4P5TB 3QUZD 4X6DA 5C0ND 2EXWD 3FQNA 3GMPA 3SQOH 3IVKB 2A1WL 1M4KA 1TPXC 4K3DL 4R26L 2WANA 2K1MA 3JXAA 3BVNA 2P8LB 5DJZA 4L8SA 5BZDB 5BRZE 4PJEB 4H1LB 4NNPH 1GL4B 1OQXA 2ESVA 1UJ3C 3K46A 1EERB 35C8L 3HC4L 5I74B 2VE6A 4FFZH 4HSQA 4N68A 4I18C 1P7QB 3U6RB 5HI3D 1KN4L 3HRZB 5I15H 4YDJB 1DN2A 3VXSA 3CFDA 1KTDA 5F3HB 1D5XA 1S7RA 2GUOA 3VXRA 5F9JA 1A0QL 4PJ8D 4HJGA 4YBLC 1RK1A 2GTWA 3BKJH 3CSYA 4NNYA 4O2EB 1Z9MA 1GGCH 4LSRH 1QG3A 3RNQA 4MX7A 1ES0B 4D9RD 1ONQA 1G9NH 3BD4A 5HHXL 1PQZA 2R4SL 2PYED 1TVBB 2Z31C 3GJFA 1IEBA 4D3CL 2PW1A 2O5XL 2VZVA 1N3NB 2W1NA 3KYMA 5C08A 3BP5A 5GRWA 1K2DB 2G5BA 3D5OF 3EFDL 5IESH 5JDJA 4NUGL 4XRCB 1ED3A 3GSXA 4KK6D 1DJSA 4XGZB 4Q9CA 4DUVA 1RVFH 4NO3A 3HG1B 3G5XB 4JPIB 5KZCB 1IARB 3JV0A 1M6OA 1M7DA 3UBXI 1YNLL 3BOVA 5I17B 4PRBB 4QF1B 1WFUA 1I1RA 3MBEB 4JO2L 3MLUH 3N1MC 1OSPH 4WO4B 3BJ91 1MFCL 2FL5A 4GBXC 3CIQA 3L3OA 4NJ9H 4HF5L 3IFPB 4JY5H 4X98B 4Y5XC 3PNWB 2FD6L 3X3GH 2E3VA 4UTBH 3W39A 1Q9OA 4FABH 1OTTD 4KTDL 5T1KA 1MNUH 3WFCH 1ZMYA 5EO1A 4D0CA 5AZEH 4OB5L 3C6LA 2OSLA 5IVZA 2CD0A 3U7WH 4V1DE 1A6AB 2APTA 4U6VH 4O58L 1KUMA 5FECA 4OGYL 3H9YA 5F6IC 1IGIL 2EH7H 3OXSA 5B21A 4GBXD 3KLAB 3P77A 4I48A 2FECI 4XVTH 4XNUH 1EO8L 1EVUA 2FR4A 2E7LA 4X7DC 5BMFH 2VLLA 1FL5B 4OFYA 4ZUWB 2DQCL 4PRAB 3MMEA 4M6MH 3VFRA 1ITBB 3MRLA 5T3ZH 1VGKB 5LGJA 1ZHLA 4LSPL 1NC2A 3L3JA 1QRND 5CIPB 4X6EB 3TIDA 2FJFB 2Q20A 3EZ8A 3O6ML 3F7YB 3OAZH 2A0LC 5KOMC 4MYWB 4BFIA 1CLZH 4ZPVB 1HHIA 1Z9OA 2C5DC 1D9KB 1XF1A 3PV6B 4AEEA 5A1AA 5JQHC 2CK0L 2X4TB 3SE8H 4Y8DC 3HAEG 1U2HA 3L95A 5JIPA 4I0KA 3LRSA 1EAJA 3RX8A 5D2NA 1LO3L 1I9JL 1X5IA 1Q72L 3SCMC 3VCLB 4Z0XA 1OCWL 4S1DD 3F7VB 4M6NL 3U2SA 2J5LB 3K0WA 1GSMA 4JHWL 5F44A 4EI5B 3O4LE 1JPFB 4KWUA 5D7IA 3V5KB 4LU5L 3EYSH 1BBJB 3GIZH 5DRXB 1JPTH 4R8WH 1YY9C 1WAAE 3C5ZC 1AGBA 1ZLWH 1TQBB 2F54B 5FUCE 1WBYB 3ZYIA 1X44A 3O6KL 2FIKB 2F5AL 4RGMC 4MQXC 4HS8L 4KDVA 4EN3D 4YAQA 2WMPA 2NTFA 5F1KC 2ORBH 5IBUB 3ARGB 1NANH 4OLUH 4NT6B 2VC2L 2XG4A 1MY7A 3U4EA 1BQLL 1A3RL 4GMSH 5J6GB 2EDFA 5HGBB 2CXKA 4N9GB 5DWUL 5TE4H 2AKRB 2O61B 5T1MB 3U0PB 2C4XA 2ZSWB 3HAEA 1MREH 2V2XB 3EDEA 5FO7B 1TXKA 1U8PA 2AJZA 1EFXB 4ZOEA 2P7TB 2D7PA 5F72S 1PBYA 3EO1A 5MEND 1HQRB 4N9OB 2OR8A 1F2XK 3KPQA 5B38G 4Z6AT 3QNXB 1QBBA 1A4KB 3V5DB 4PLJD 4JHBA 1DCLA 4Z7WE 4JRYB 2AQ3A 4YXKL 1F4WH 1OAZL 3WIHA 4YZFE 2X1XR 1PYWA 2ZZUT 4FXGB 3FZUC 5ICXB 4HIHA 2AXFA 3W9EB 4KHTH 4X7SH 5DJAA 3AREA 1BVLB 1DBML 1LK3L 3J7HA 4HKBA 2EDKA 1OD9A 2D03H 1RZIB 4JKWA 1A14L 4K2UL 1YMMB 3GGWA 4W68A 3EOTL 4BSWA 4I4WB 1ZANH 4PD4J 1JF1A 3OXRB 2HT2D 4OT1H 5DMYA 4PJBE 5CGYD 5TF0A 5KAQF 5L0QB 1YEKH 5TDNB 3OKNB 3IDXH 5JOFA 4R2GC 3MJ8B 3QI9D 1G7JB 1JHKH 2R2EA 2G9HA 5D71H 1MJ8H 1A3LL 2ARJB 3R06A 3MOBH 5ACZB 1AP2B 3H0TA 3SDCD 2HWZL 2YA2A 3I02B 5B38A 4UB0L 4ZNEA 4WDIB 4XHJC 4YH6A 1NMBL 4POZD 3WFEL 1DR9A 3MRIA 2AJUL 3M8OH 2F19H 4MJIB 3RI5F 1ETZB 4L9LB 4R2GD 4R3SA 2OK0H 1LP9E 3T1FB 4HPYL 1GAFH 3L5XH 2V17L 1LNUA 3CX2A 2FB4L 2R23A 4U1HA 4TUJB 5EU7E 4L3CB 5CBAA 3QEHA 2EE2A 1NGXB 4XHJD 3WDJA 2I60L 4NM8H 3D2UD 1Q9WB 4MAYD 3Q6GH 1JNNH 4XXCC 1A7BA 3HE6B 3QYCA 3MRKA 2Q87A 3KPSB 3ES6A 3QDJD 2UY7A 2QADC 3HC3H 4KKLC 5GRXG 4LVHC 1U93B 4NNPL 3JUYA 1N2RA 5LWYH 1I7TA 3VE0A 3IDIA 1B90A 1XIWD 1FYTA 4F37K 4HS3A 4HXBH 3KXFB 4Q0XH 3SGEI 3ZE2E 5H35B 3KS0J 1G7LA 5DHXB 4FFZL 4U6XB 2ADJB 5BVJA 3GSVB 5I15L 4JY6B 2GCYA 4LF3B 5DMKA 4N0FA 3PWPA 3W0WE 1AXIB 4P4KB 5JORA 5BQ7B 4ZYKB 1CE1H 3SE4A 2W0FA 3BKJL 2GITA 2IBZX 2NX5B 1GGCL 4LSRL 3UYPA 4XI5D 1E6JH 1G9NL 5C1MB 4L3EA 4XHQA 3RWFA 1JWMA 4NHUB 1KN2L 3CVHH 5JW4M 1NJ9A 4QYOB 3DXAD 4DVRH 2CRYA 2HJFB 1CQYA 4NO0B 3FFCD 3CFBB 4ZXBB 5IESL 3FO2A 1TTGA 3EHBD 1DQQA 2HRLA 1UCBH 4G6AD 3MGAA 1G9EA 15C8H 1RVFL 5EOTB 5TDPA 1ZGLP 5AD0A 2YSSB 1BZ7A 1U8KA 1A6PA 3N50A 2YC1B 5HPMA 1AIFB 2ARJQ 5GZOD 3MLUL 5DZLA 2W65A 3HR6A 1OSPL 2XN9B 5BV7C 3VFGH 5HJ3B 4Q6IB 2BNQD 4FQXA 4JDZA 4NJ9L 4JY5L 5E6ID 4HK3J 3O3AA 2FIRT 3X3GL 2VB5A 4UTBL 4RMWA 1VEPA 4R7DB 5LKNA 4FABL 2BRQA 1MNUL 3WFCL 4JFOA 3F7RA 3KPOB 3B9DA 5AZEL 3V6BR 4PG2C 3RWJB 3G6JA 1MH5B 3TA3A 3I6KA 4U6VL 3U36A 1JTOA 5DURD 2DI9A 4LLQB 5CBEA 2EH7L 4PJAA 3QXAB 1WICA 4WEBH 2B39A 3T2PA 3T08A 4XVTL 4XNUL 3IJYB 5BMFL 1NDGA 4F7MB 3MCG1 4LSTH 4M6ML 5I1DA 5E1AA 2QBWA 5T3ZL 3WHXA 2HT4D 1QA9B 1EA9C 1MHHB 4MZ3A 5EN2A 4WY7H 1NUFA 5CZKA 5MHSE 1CLZL 5C0EB 3W9DA 3MUJA 3KPRD 2N7BA 4Y19E 4HWUA 3U4AA 3X13A 2HLAB 5I6XB 5SWSE 1G84A 1WZMA 5SX5K 1DUZA 5MEOA 4PRNB 1UKQA 4XPFH 3UXFA 4QO1A 1JUFB 3HR5B 4NQCB 1C08B 2DKUA 1ZT7B 1M71B 1DDHA 2XT1B 4NN6C 4E0RB 2ZPKH 5EBWB 3RWGB 2ZG1A 1I3VA 3MRJB 4FQ1H 2VQUA 1S9YA 2D0GA 2QEJA 1F58H 3ZDYF 3EYSL 3ZDZF 1KOAA 1FVDA 3GIZL 1JPTL 4R8WL 4PG9B 3OKKA 4Q9QH 3AGVA 1KIRA 3BH9A 3ARDA 2A77H 2YPLD 4HAFA 1CGVA 1RY7B 3ULUD 3O9WD 1FO0B 4P3DA 2ORBL 4XNYL 3GMRA 5GS1B 4MNQD 2R2BB 4OLUL 2J1KA 3FB6A 4KC3B 4M7JH 5GZND 4R97B 5SV4A 2ZOLA 4A6YB 5EU6A 1IKNA 4JVUA 4PJEE 2R1YA 4GMSL 1VKXA 3CH8A 4WEMB 1WWCA 1C5DB 5EFIA 5DRWB 3L3DA 1IKFH 1IEHA 2DQEH 2GTZA 2BOBA 5TE4L 3SEPA 3RTQD 1OSZA 5K9KB 2BNUB 5KSAC 1MREL 4YHMH 3REWA 1RZ8B 3ARXA 3QG6A 2D7TH 4NWTH 5EU4B 4K7FA 2AXGA 4L8BB 4XPGH 4NRYB 3ROLB 2I9TA 4PV9B 3PDOB 2BJMH 2A83B 2YD1A 1RZJC 1JJUA 4FTVA 4X4ZA 4CMHC 1JZ3A 4DGVH 3MV7A 3MYJB 3TO2B 2I07B 5GS0C 5ABDE 2CO6B 4HJJH 3TJHD 2C26A 3KPLB 3UPCA 4HWZA 1F4WL 5IJKA 1MI5B 5I1GH 1OHQA 3VWKC 3NA4A 5F97E 5FFLA 2R4RH 1NBYB 3HG1E 1JHTB 3FL7A 1JYXA 2QLVB 1BVKB 2NYYD 5EH1A 4KHTL 4X7SL 2C3HA 4DCQB 4K94H 3KHQA 4M1CC 4TTDD 2D03L 1CGTA 2YN5A 5F1IA 2VR9A 3PHOB 3DRTA 2WWMC 2AV1A 4L8SC 1JFQH 1ZANL 2KQMA 3IRZA 2D2OA 4OT1L 4P46D 1YEKL 3OAUH 5D7LB 4F8QA 3IDXL 1RQ5A 3VMPA 3AU1B 2BP3A 5F9WB 4KI5D 3VWJA 3RDTD 3FN3A 1ZEAH 1JHKL 5D71L 1MJ8L 1EDQA 3C5JA 1I1FB 4M1CD 3U48A 3MOBL 1QFWM 4UDUB 1JWSB 2EYSB 6CGTA 2ZP0T 4HKZB 1LE5A 2Z91B 2YRZA 2XTJC 4WTZA 4CVWA 3HZVB 4RMUA 2B0SL 4KQ3H 1Y6NR 2F19L 3QO0B 4WUKH 2Z9TA 2OK0L 1I1CA 2GK0A 1GAFL 3L5XL 1FFNB 2MNUA 1UH3A 3BGFC 5I66A 3P9WB 2H26A 3QP3A 3VXSD 3K80A 1IJ9A 5J12C 2XTJD 2DQTH 3NGBC 1EZVX 4QOKA 5F7DB 4PJ5D 4YFEA 4NM8L 1NDMB 3RX5A 1DE4A 3Q6GL 3PXHA 4G6MH 1JNNL 4YNYB 1U8NA 3BPOB 3MRRB 5JMRA 3HC3L 4OD2A 3MJ7B 2DWEB 1W2KT 4ZPTA 5DVMA 1OT2A 4M7KH 5KW9H 5LWYL 4L4TD 4ZFZB 1DP0A 1R3HB 4XCFH 4F15B 4CDGC 4HXBL 2R2HB 5FO9A 1XGRA 1PVHA 3H7LA 3GIVB 4ODBD 4PRPB 2BVUA 4P2RD 2F54E 1P9MA 4JVPA 1IBGH 3C6LC 1D5ZB 3MNVA 3EYUH 4GKSB 3GMMB 5HD8C 3LZFH 4L4VD 1CE1L 3ILQC 4MDJA 3V6ZB 5ISZD 3RY4A 1QR1A 3BZ4A 4WFGD 4WGWB 2VLJD 5ILTH 4HDIA 4WW2F 5JLZA 4N90D 1KTKE 1U92A 3F12A 4FQHB 1E6JL 2E7LC 2NMSA 4KU1A 4PGZA 4XT1C 3CVHL 2WBJB 5T1KD 4ONHB 5DJYB 1BM3H 3SDDA 3CDYA 4DVRL 3C6SA 3TM6A 4UV4L 1I1AB 1U95B 4QRTB 4BUGA 2DJ4A 1UCBL 1YNKH 5HHPA 15C8L 4Y7MA 4R7NA 3VFVB 2QKIB 5K9JH 2GSIA 3PUCA 3VXTA 1QSFD 2VLRD 3GSNB 3TBSB 1UB5A 5E5MB 4XB7A 1XGUA 5D2NC 3BXNA 4WWKA 3VFGL 5CJ5A 5JOPE 3T0ED 4KVCH 1JPGB 1VENA 3PP4H 1F2QA 2FECL 2FLRT 3BMWA 1FL3A 3QDJB 1P1ZB 3I3BA 4KK5C 1HN1A 1UB6B 5FUZH 4OLEA 4YHPB 1T1XA 4M02A 1F11A 3JV5A 1V3MA 5FYJD 3CZJA 4L8DA 3QNZA 4JPWH 1UADC 3U82B 5KVFH 1T3FB 3JUZA 2X70B 4MCZB 4GRWH 5KS9E 1S9VB 3WIIH 4QRRB 4KVNH 4WW2B 3UBXA 4WEBL 3WNMA 1CDJA 1I8KB 3U83A 3BPCA 4X5XB 3CVHA 3VGEA 5ERWA 3VGAC 5JW5B 2A9NH 4LSTL 5JO5B 4WHTA 2WP3O 2FJHA 4QHKJ 2MHAA 3VG0H 1VDGA 1PZ5A 2EIEA 3PGDB 3SKNB 4HV8B 4ORZC 2VDPH 4WY7L 2GIYA 3G5ZB 3K2MC 1X4ZA 2NNAB 1G7HB 4EUPH 3CVIH 1W0VB 3D39D 3STBA 2GJ6E 1J87A 3FFCB 3B9VA 5IMOA 2M2DA 4X4ME 3Q6FA 3GO1H 3KR3L 4XTRD 1RU9H 3IFNH 5DR5H 1N6QH 5K9QG 4P57B 1YEIH 4YHYC 1S9XB 4XP1H 5C0RH 3IDYB 1U8MA 2NZ9C 2VUOA 3VFSB 1JGUH 2DL2A 5DXWA 5FK9B 2BX5A 2ZPKL 2P48B 2WIMA 2Z35A 4YWGH 2FRGP 4MJIE 4QRSA 4U1NB 1M7IA 2BNQB 3QUXD 2BOCB 1MOEA 5IHLB 4FQ1L 1NLBH 4K3EH 1F58L 3TO4D 5C09A 4LCCA 1U8JB 2NXYD 4GFTB 4Q9QL 1T7YA 1XGTA 5DUBB 3LN4B 5GGUA 2VABA 1MJJB 3L5WA 4JGJA 2NZ9D 5F6HJ 2A77L 1YMHA 3O2VH 4GKZB 4NQDE 1CWVA 4B41A 2CR6A 1RV6X 1PZUB 5L2KB 3KPSE 4M7JL 5JIIA 1XGPB 3AREC 4HULB 4Y4FA 1MJ7H 2AP2A 2VOTA 2ENSA 3ZKQD 3KYNB 2LTQC 3IFOB 2DD8H 4OZHA 3KDMA 4I2XB 4R0LB 1S8DA 3ULUF 1NAMB 3BP7B 4LHQB 4LLWB 2GY5A 1IKFL 4OTXH 5EULV 2DQEL 4Y4KA 5BXFB 1W72B 4QRPA 4PP2B 2P5EE 3QXUA 2C3XA 1NFKA 4YHML 1C12A 1HHGA 3VFTA 3FO9B 2D7TL 4NWTL 4ZUVB 3KLHC 3ARED 4XPGL 3C09B 1QLEH 1W0YT 2D7MA 3QH3A 2VXUH 5EO9A 5JDSA 2BJML 2BVYA 4RZCB 1WVZA 1A4JA 3F7PC 2UZIH 2NX5E 2HG5B 1WC7B 5IFAH 4DGVL 1AXTH 3CPLA 3KYOB 5K9OA 5FYKU 5CS7A 3VFUB 5IG7A 5JXEC 1HXMA 4HJJL 4YC2C 1QFUH 4YHNA 5IW1B 5C0IB 5I30H 3DMMD 1AGEA 5DDHA 4N8VB 5FV1L 2XZCH 5I1GL 2WINB 3NCCB 1N5AB 1VFBA 2VISA 3QFJB 5HYQB 5C2UB 1IQDA 1T7ZA 2R4RL 2V5TA 4J4PA 1KTLB 3P0GB 1V8HA 2DAVA 4ZSOA 1NCNA 3HE7B 1REIA 4CMMB 4K94L 2YPLB 4GAGH 2I9LA 2XXCB 3VD9A 2JCCF 2BXYA 3RVXD 3SO3B 1BHGA 1V3KA 1IGMH 2VZOA 3SDXF 2FEDD 4NQXA 1BD2A 5T5NG 4NRZA 4WFFE 1JFQL 3SJVB 3OAYH 1BIIB 5CINH 3OAUL 5SWZD 1TCRB 3PQYB 1ZEAL 3QQ4B 4QCIA 1KLGB 2QSTA 4HZLB 3MRPA 5CD5C 1NL0L 3VD7A 4KI5F 3HUJF 4FFWC 3SE4C 1HCVA 2E9WA 4TSAH 2HMID 4RGOH 2PKDA 3BRGC 3IETA 2H32H 1MCWM 2JE8A 4LPUA 3GBLA 5IVXA 1FNGA 3AVEA 3DX8B 2IQAB 3HPJB 4WUKL 4D9RE 3VRLF 2ADFH 2PYEE 3L3HB 1NCUA 1AQDB 3VXNB 2YS4A 3LB6C 1KCKA 3DI2B 4IDLA 5EBLB 1QVOA 4E9LA 3PWPD 2PXYA 4K07A 3CFIC 4NKQB 4RSVA 2NY4B 4YIQA 2DQTL 4KV5F 1JMZA 3P4OA 1KB5B 5IB2A 4E41B 1JZ5A 4G6ML 2NW2B 2JCCB 4LIQE 2Z92B 3SDXB 2FBJH 3QBTB 3TFKC 1A3QA 1Q9KB 1SVZA 3TZVA 1W0WA 4HFUH 5H94A 2BNRB 1BQHB 4M7KL 5KW9L 4FQXC 4RWHA 3TIEA 4XCFL 4PJIF 3RIAK 3WFHA 3BIKB 3V4PH 1XCTA 3NCMA 3QO1B 3EYQD 2EKSA 5KTEH 3T4YB 8CGTA 3S5LB 3ARYA 3DVGA 4PJXA 5MEQB 3LS4H 1K6QH 4Z77B 2CDEA 1X4YA 4I8DA 3U9PH 1A9EB 4HX1B 3EYUL 3CUPB 5FGSA 3RDTB 5GRYA 3TA3C 3TFKD 3HUJB 3LZFL 3UTTA 4I9WD 3LDBC 1JE6A 2NW3B 3IF1A 1KTRL 4FQXD 1XR8A 4ODTH 5ILTL 3HLAB 5EU5B 2W60B 3S37X 4B53A 1NKRA 3WNLA 2CKBH 5BZWB 3NBNA 1BP3B 4ZO7A 1XGQA 4G8GD 1A7NH 3C60D 4JO3H 3MV8B 1B0RA 1BM3L 1PDKA 4WV1B 1JCKA 3FFDA 1T83C 4RAHA 3TPUB 5B3JF 3OHXA 1YNKL 4ODUB 1SJEA 2MJWA 1A22B 5J06A 5KG9A 1CD8A 1MJUH 5K9JL 4X6CE 1V05A 4P99A 3ARUA 1T20A 3BEWA 1ZHKB 1HDMB 4Z7QF 5IVNA 5I76B 4MNHA 2VXSH 3T0AA 2CR3A 4KVCL 3VFMA 1CU4H 4PJIB 3GMLB 1CGSH 3PP4L 2DQHH 4X5WA 4FXKA 5ESAA 1F97A 3FN0H 3ZDYE 3ZDZE 1F45A 5FUZL 3LN9A 3UROR 4L4TB 1H9VA 1U3HD 5JPMB 5D1XB 4NQEA 3K74B 4HWBH 5DYOA 4JPWL 5KVFL 5E4EC 3VRJA 1R3IH 1KIQA 4XBPA 1HSBB 3WIIL 4KVNL 4P2RB 3ARDC 4BSJA 2GAZA 4NM4H 5JHDD 1EMTH 2EDBA 2P4AB 3HNTH 2Y4SA 8FABA 4JANA 2A9NL 3LEVH 4L4VB 1F00I 2RFXA 1FZKA 3GSQB 3T8XB 4NWUH 3VG0L 3BW9B 4HEME 2Z8VC 3IAPA 1NQBA 1VACA 1IKNC 5IK3B 2M8XA 2IH1B 1LO5A 3O3EA 2VDPL 4PV8B 1OGAA 3ARPA 4HZAA 5MI0C 3RZCA 1CGUA 3LKQA 2PETA 4O4YL 3O8XB 2P5WB 1YNTB 3AB0C 2EDOA 1XF5B 3R8BB 3GO1L 5T3ZD 1RU9L 4ZS6D 2CLVB 3IFNL 5DR5L 4K71B 2VITB 3ZDXF 1F6FB 2Z4QB 1N6QL 2DM4A 1YEIL 1KF9B 3HI1A 4JFXB 4XP1L 5C0RL 1QSFB 3QDMD 4HGKC 4CVZB 3P4MA 3THMH 1M05A 1RMFH 1ZA6A 1JGUL 3B6SB 3O0RH 5IVOA 4AMKH 5GHWH 2JK5B 4HH9A 5E8NA 5E00A 1YY8B 3T0EB 1NLBL 5DGRA 1GIGH 4K3EL 5H37G 1KPRA 3OGCB 2KZWA 3H42H 1OAKH 3BQUA 3CCHB 5IJKC 4Z9KB 1NCWH 3DVNA 1QRKA 5IF0A 4JFDB 3AFLA 3VXMB 3I9GH 3O2VL 5GGSB 5EZLB 3S36X 2DLTA 4IRSD 1S5IH 3O2WH 4JJ5A 3G5VA 4G80A 3RKDD 1MJ7L 4QHNA 4KMTH 1I7RA 2PYFA 1PLGH 2DD8L 1INQA 5BRZA 4OSUH 4OTXL 1RZ7H 2C3VA 3O11A 4N0UE 1VADA 4YBQC 3D3VD 4HAGA 4HIJA 4M1DH 4NPYA 4MNGB 1EHXA 4MJ2A 3X11B 4FG6D 2HVJB 2IH3A 3TH3T 3VWJC 2VQ1A 4XPBH 1QLEL 3D39B 4WHYG 2VXUL 3WJLA 3K4AA 3ARSA 4NC2B 1KJVB 1S5HA 2UZIL 5IW6B 3D69B 2KUTA 5DHVA 5IFAL 5KANI 2FYYB 1AXTL 3FONB 2QV2A 1HQ4B 4X9IA 4CVXA 3UDWA 2WAHA 1QFUL 3AXLA 4FOMA 3MFGB 2X4OA 4S2SA 3S4SG 5IIEB 5I30L 3QUXB 2XZCL 4NNXB 3TO4B 3QWRA 3UP1A 3S97C 3WSQL 5GGSY 2WP3T 1J8KA 2IPUG 2NXYB 3DGGA 4JRXD 1R5VA 1QBLH 3RWCA 1T1ZB 1CG9B 3T77B 3D0LB 1YPZE 3SOBH 4GAGL 2IC2A 2X9WA 4RMTA 3WD5H 3P4NB 1KYOK 1IGML 4HMDA 3P9MB 3QDJE 3QDGD 5ADPH 2W91A 4HG4J 2BMKB 5CINL 1UEYA 2MKLC 4OUUB 4J3VA 5JUEH 3CFJB 2A38A 4Q97A 2ZSVA 3L3IB 2CRMA 1A7QH 5C3LD 1VFAA 3BDBA 1P9MC 4GT7A 4V1DA 3FQUB 4QRRE 1B4JH 4KZEH 4KJPC 1CFSA 4QHLB 4HFWB 2EO9A 3RKPA 3QNYB 5FYJU 1U8QA 4LP5A 5FYKE 1CD1B 1P4LB 3E6HA 4TSAL 4MQ7A 4RGOL 2X4NB 1SY6A 2C4FU 2ITDB 4E5XB 3S4SA 4DJMA 2ADFL 3IFLH 2H9GA 2HAZA 2XACC 3SDDC 3KGRA 1O7VA 5CEYB 3DXAE 4H1LH 1DL7H 3DMMB 3FFCE 1NUDA 3EKCA 3WBDA 5ID0A 3A6BH 3IDMB 3AROA 2NY2D 1CCZA 4K7PY 2D3VA 3TH4T 4AEHH 3FRPG 3ARBB 4LL9A 2B1HH 2XA8H 4FQCH 4M7LH 1ACZA 2F8OA 3PJSA 2FBJL 2VAAA 3VGDA 2V9TA 3LKRB 4WWKC 1RUAH 4HFUL 4NO2A 2BNQE 2AK4B 3O6FD 4RIRA 3V4PL 4MHHG 3O4LA 5EZJA 2Q8AH 5KTEL 4JCLA 1J1OH 4NN7B 2Y5TA 1K6QL 5E94A 5TPWH 3OR7B 1Z9SA 5SWZB 1XZ0A 2KBGA 3U9PL 3L3KB 3OJDA 5INDA 4XPAH 1OPGH 4KKAC 3OJMB 3P11H 4JDTH 4JKMA 3MPCA 2H32A 4YFDB 4F37F 4ODTL 2P45B 2BVTA 3VFNA 3OF6D 3MJGX 1WIUA 2CKBL 3H3PH 4P3CH 3NCFB 4H88H 1A7NL 3ZT5A 5A2LH 4Q2ZB 2WWKO 4U1KB 3T65B 4JO3L 4KKBC 5E5RB 2Y6SC 3FB7A 1YEDA 3I6LD 5AZ2L 4IRJA 3RL1A 3GB7A 1EO5A 1GPOL 1NGQH 5GGRA 1D6EB 3IXTB 4ZDHA 2X4UB 3BZEB 1CLYH 4NO5B 1IAMA 2CDFA 3TJEH 1I1YB 4P2QB 4JAMA 5J8OA 3FRPA 4HC1H 1MJUL 3F5WB 1OAQH 4D8PB 2YD3A 4JM2A 1DQDL 1QR4A 3HB3C 2VDRL 3BH8B 4G5ZH 2VXSL 2VLKD 5E4IA 4K7PX 4YHIB 2OTWB 3KLSA 4U0QB 4W6YB 2YA0A 1CU4L 3PGCA 4HD9A 1CGSL 3QXVA 2DQHL 5HHOB 3FN0L 3RWIB 4DKFH 2XWBB 1A7PH 3PXJA 1QFWH 3C8KB 5HYJB 3S3JA 1UG9A 3CLEH 4KHXH 4HWBL 4Z7WA 3MA7B 4APQA 3BRFA 4LCCC 4LGSB 1KPUB 1R3IL 4PLOB 4X4YA 5CD3A 5CIPH 4XVJH 3ZKXB 4DK3A 1UKTA 2CKBA 4G43A 3HA0A 2EIBA 3MXVH 1AHWB 3JTSB 5IKCA 2BERA 4I0PB 4BUHA 4LEOB 4NM4L 1EMTL 3VG9B 3HNTL 4I13B 5DD3H 2YPLE 3ULUE 4HUVA 5FDWA 2Y25A 4NWUL 3W5MA 1CD0A 4Y4FC 4MNQE 1IM3B 4KTEH 4MD5B 3RIFK 3FAXA 4LLVB 1UVQB 5C09D 1QEWA 4WI7A 3BHBB 5J4MA 2ZUVA 5C0AD 4C54A 3C60B 4Y4KC 2EIDA 2F8XC 5IM7A 5FA3B 3GHEH 4PJBA 5L2JA 4QTHA 2FO1A 3VFOA 3EBAA 1ZHBB 1K5NB 3RWHA 2WUBH 1FNHA 1IGJB 2XWTA 4KDWA 4IMLB 4GRLA 1FH5H 3FQTB 4HGWA 4P9MH 1FV1B 3RWEB 1G9MH 3THML 1RMFL 1XR9B 5IMLA 2VN7A 5EBGA 3O0RL 4AMKL 5FCUH 2JB6B 4Y4KD 4KXZI 3QCUH 4HWBA 4QRPD 3ALWA 1GIGL 1U91A 2IFGA 5CMAB 1OTSC 2BCKB 3QUYB 1NMCB 5EIVA 3QB7C 2OMBA 1LP9A 5DF0A 3RVTD 3H42L 3MRDB 1OAKL 4RA0C 1NCWL 5CCKH 3SPVB 2EDQA 3GSOB 1YDPA 5HGDB 3I9GL 2YUXA 5F7MC 2G2RA 4J4PC 3MGTA 2XG5A 1S5IL 3O2WL 4P2OB 4NQVB 5A2JH 3MRBB 1TPXB 4KMTL 1PLGL 2NTSP 4G7VH 4C83A 5AWNH 1WZKA 2BNRE 3MRFA 3P9LA 4RFEA 1IL1B 3SDAD 3VDCA 4OSUL 1CBVH 4WI5A 1RZ7L 1KLFA 2IPKA 1UJ3B 5EO0B 4WU5B 1IT9H 4M1DL 5DUPH 3RP1A 3VXQA 1I7UB 4I18B 3TYFA 1NGZB 1UQSA 4DTGH 4XPBL 4KI5E 2ZUYA 3HUJE 3GRWH 2QR0A 3W0WA 2OI9B 3K4DA 1HYSD 2G75A 4Y4HA 1JMXA 1PW3A 4YBLB 4OV6F 5DS8B 3TVMD 3L7FB 1BD2D 5ICZB 1FPTH 4OCRH 4OLWH 5DK2A 4DVBA 1NSNH 2EZ0D 4YHKH 3BWUC 2W0PA 3X12A 2Z31B 3H2WA 4JHAH 1HXYA 3Q48A 4HUWB 4X0KA 2ZNXA 2XXMB 1LEKB 3NACH 5EC2B 4MD4B 3ULSA 4KV5E 4X6FA 5GGVH 4UV7H 5J9PA 1BREA 1HOCA 4CN6A 4BZ1H 1QBAA 3MNZB 2FZ3A 5ACMA 1E27A 1CF8H 4CL7A 1T4KA 1G6RB 1BLNB 1QBLL 2AW2A 4G42B 4LARH 1QO3A 4NRXA 4Y16D 1LQSR 4PJ5E 5F9DC 1NMAH 3DURA 1YN6B 5DI8A 2OJEB 3SOBL 3WD5L 4PP1C 4GG6E 4IRSB 4ODVH 5FDYA 2NXZC 3PE9A 4JZOA 5E0QA 3RUGF 1ORQA 4CU8A 4G8FA 3WS3A 4F2MB 3CX5K 4OLXH 1X5LA 5D1QD 3DOSA 3TZVC 5ADPL 5IEHB 4IJ3C 4Y5XB 1ZKAA 2PXYD 4L4TE 5JUEL 4KJWC 4YUEH 2F53D 3GMQA 1A7QL 3BPNC 3D3VB 3ILPB 4MXVE 2ADGA 3V7AE 3GM8A 4PP1D 1PG7X 4P2RE 1B4JL 4KZEL 4XBEH 2F5BH 5F6IB 1OAXH 4EZMA 4ETQA 1FP5A 3PHQA 4L4VE 1JF6A 5EU3B 5ISZE 2CK2A 4WFGE 2VLJE 4KJWD 1T89C 3GSWB 4N90E 1XF2A 5B3JE 1C7SA 1HK6A 5D93B 3IFLL 1FVEB 4DGIH 4QRUA 3MLRL 1A1NB 4AH2B 1JZ6A 1S7UA 1U8IA 2P5WE 1DL7L 3OJVC 3UTTD 4ODWA 4G3YH 3VMOA 4Y19A 4Z7QE 1A1MA 3A6BL 1T04B 1WBXA 3ZT6A 1FLTX 1JPSH 2B1HL 4FQCL 4M7LL 4JRXB 1BJ1J 3DX9B 1QSFE 2VLRE 1JI1A 3KG5A 1X5GA 1MELA 1BX2B 3R4DA 3SCMB 2C7UB 5HGHA 2AJXH 4IDJH 2MCG1 4PRDA 4G6FB 1WLHA 3CXHK 3L5HA 1R24B 3T0EE 1C5CH 4RGNC 1MLBB 4GAYB 1YN7B 1MAJA 1RURH 3H6JA 4F7PB 1J8HD 1J1OL 2OR9H 1RFDH 4HS6B 1GZQB 5I8EB 5TPWL 1OP5K 3C5ZB 4L5FH 3WLWC 2HLFC 5FYJE 2VIRA 4PJ9D 3VXME 1KPVB 1OPGL 1K4CA 2BHYA 2R0WH 4RGMB 4FQIH 4X9GA 4JDTL 3P11L 2RJMA 1SYVA 5IEKA 5CWSA 5C0FA 1PG7W 3KPPA 4OM0H 3MUHL 4PBXA 1INDH 3EDKA 4RGND 3H3PL 4P3CL 1SM3H 1U8HB 3IVKA 1K8DA 4H88L 5TH2B 1CI5A 4PGCA 1Y0LA 4MS8D 3U30C 2YPKA 4MCYB 1GGBH 4NQED 5BZDA 4PJEA 4H1LA 1KXTB 3UTQB 3VFWA 5LVEA 1NGQL 1R5WB 2XFXB 2DMCA 3ULVD 4MNGE 1MCIA 3FCTB 1CLYL 2OS7A 3RZCC 4N1CA 1GJIA 2JJTA 2DN7A 3ZDXE 4HC1L 1RZGB 3T2OA 1P7QA 1OAQL 4PLNC 4RDQF 3CD4A 1X3DA 3D39E 4Q9RH 4EVNA 5T1LA 3J8F7 5F3HA 4G5ZL 2ARWA 3H9ZA 3UZQA 2AQ1A 5B39G 3V0AC 2I27N 4ZUSB 3EDFA 4TVSa 4NBYB 2CLRB 3LIZH 4BFBD 4DUWA 4CJ0A 5DO2C 4TSBH 4DKFL 1A7PL 1FFPA 1AKJB 1QFWL 3FQXA 4UQ2B 3REVB 2Y7QB 5BCAA 3KNBB 3CLEL 4JN1H 1YA5A 3WCYA 4KHXL 5C0GA 4P23B 1Q0XL 5DT1H 2AV7B 2N7AA 2IPTL 4XVJL 4OZ4B 3RGVC 3PIQA 1SBSH 3MXVL 1I8IB 3HG1A 3G5XA 4FFVD 4CVUA 5DD3L 4HIEA 3BO8B 5I17A 4PRBA 1UZ8B 3INUH 2OMNA 2F8VA 4PRIB 3GUTB 3MBEA 4ZG1A 5IFJA 3IS0X 4FS0A 1ZT4A 3M45A 4P4RB 2Q7YB 1JHLH 1Z9LA 3QJFB 1ZLUK 1QSEB 1FG2B 3IFPA 4PY8J 1AGDB 4X98A 4LIQH 3BQUD 3PNWA 1JGVH 1DBJH 2NY1B 1ZSDB 3MLTB 4YXLH 3GHEL 4FQLL 4OCYH 2QL1A 5E8PB 2WUBL 1KJ2B 1E4XH 5B39A 4F7TB 4P9HC 3WEXB 1A6AA 1FH5L 3MACL 4P9ML 5D6CB 2B20A 3LEYH 3KLAA 3WJLC 1G9ML 3OKEB 1KSRA 1F4AA 3IXAB 5I71C 1EJOH 1F90H 4QY8B 5FCUL 2H3NB 3QCUL 1DQLH 4ZUWA 4KQ4H 3RY5A 2HYMA 4OCXH 4JFED 3T1WA 1FO0H 1VGKA 4OFKA 4NBZB 1FRGH 2VYRE 1A6ZB 3QWOA 4X6EA 1QNZH 4A6YH 2VZUA 5CCKL 2VO5A 1P84J 4MDIB 4Z7VE 3D6GA 4RCAA 1T66C 1CIDA 3PV6A 1R0AH 4YHZH 4NKMA 2WWKT 3VXOB 2X4TA 2IJ0C 3RVVD 3QULB 5M94B 2VL5B 2COQA 3NZHH 4NKOB 5CEZD 1UWEH 4HUUB 5I75C 3CFEA 1ZXQA 5AWNL 5CLTA 3VCLA 2QADB 1L4IA 2DQFA 4UBDC 2Q8BL 1WBZA 4OI7A 1CBVL 1NEZB 2A6DB 2BVPB 5KANG 3QWRD 3MV01 1IT9L 5DUPL 3V5KA 3HPLB 1OL0A 4PJFF 5F7WC 2IMNA 5C0AB 1BBJA 3HI5H 5EUKA 5SWZE 3KVQA 1FLRH 3BDXA 4DTGL 2F54A 1WBYA 3GRWL 3JV4A 3MNWA 1RK0A 2C1OA 2NZIA 4X7CC 5JZ7C 2CRIA 3JWDH 2GKIA 2W9DH 4HHAA 1T0NB 3NA9H 4S10A 1FPTL 4OCRL 4OLWL 3MOAH 4NZTH 4OI8A 3OKDA 1NSNL 1C16A 3GBMH 3MGOB 4YHKL 4B7IA 3RNKB 3A67L 4JHAL 2R29H 2FHBA 1TZHB 3G08B 3LQAC 5J6GA 3NACL 5LGHH 1C1EH 4N9GA 4UV7L 5GGVL 4OFVA 3IGAB 4XCYA 4BZ1L 2AKRA 2BSED 4P2QE 5CJ8A 1CF8L 3I85A 5FO7A 3PWPE 3MJ9H 5DVLA 3RY6A 1NCDH 4LARL 4Y5YA 3HHRB 1EFXA 4QT5B 1NMAL 2P7TA 4KROD 2RB8A 3WHE0 4R96A 4EI6B 4ODVL 2MKWA 5DD6B 1HQRA 4OLXL 2YN3A 3OV6A 4PJFB 1A4KA 2ZNWA 4NFCA 1C7TA 3SDAB 4YUEL 4YO0B 3TYGH 3GRWA 2NY6C 1PKOA 1EBAA 3U9UB 4HK0A 1LO2H 1RIUH 6FABH 2GJZB 4NYLB 4MGXA 4XBEL 2F5BL 5KS9A 1OAXL 4GRMB 4KMQA 5D1ZB 4L29B 3MUY1 1MAMH 5FF6B 4I9WE 4QRQB 1BVLA 3DV6B 5FOJA 1Y18B 5IB4A 4YHLH 1I9IH 1RZIA 2A73B 4I3RH 4MA3B 4G8GE 4KRPD 4DGIL 5HHMB 5AUMB 5LAXA 1FNLA 1OY3B 2P44B 4IRJC 4RMQA 3UO1H 3GEWB 3QIWD 3OXRA 5JXAH 5AEAA 5TDNA 4G3YL 3MO1A 3BE1H 4NN5C 4PYHA 1W8OA 2YEZA 2GJ6A 4NZRH 1G7JA 4IHOB 5EUOE 5JR1H 1JPSL 3CDFA 5ESQA 2ICWJ 4X4MA 1UM5H 3W82A 2ARJA 5B22A 1CYGA 1AP2A 4LPYA 3DI3B 2D7OA 4OM1H 1SVCP 1ZA3A 2H2SC 2AJXL 1G7IB 4IDJL 4MWFB 3FJTA 2IF7A 4WWID 2EIZB 4IRJD 1GYAA 1WCBA 4NN6B 4JFFD 2QTEA 1J05A 3AS0A 1C5CL 1P5UA 4MJIA 1JV5B 2HTLC 1ETZA 4L9LA 4X7TB 1RURL 2NY0C 2DTMH 1OVZA 3EYFB 5IROA 1YJDH 2OR9L 1RFDL 3LRGA 3QUMA 3ROOB 3ZSTA 4JM2D 4U31A 4L5FL 4RISH 4APQC 2F53B 4L3CA 3KPMB 2E9BA 5EOQH 2R0WL 3OKYA 2X44D 4FQIL 4ELMF 2V2WB 5ICYA 4OM0L 3RIAF 4NQDA 1INDL 3TN0D 1SM3L 3D85A 3RVWC 1AO7D 3SKMB 1Z0NA 5JHDE 3KPSA 2EC9T 5DJ6A 3GSNH 3VXPB 1AQKH 1GGBL 2OXHA 3EYOB 1U93A 4HIIB 2W0KA 1GOHA 3D0VB 3S35X 3FT2B 3OR6B 1RZFH 3BX7C 1NBZB 3UYOD 1G7PB 2EE3A 3BZFA 4S0TD 5KSAB 1AC6A 2P5EA 4WHCA 1CDUA 4H8WH 1U3YA 4U6XA 2YA1A 3QA3A 4N1HB 2NCMA 2OL3A 3C9NA 2YHGA 4Q9RL 3ULVF 4GRLC 3OKOA 2Q76B 5DUMH 2X5PA 4GXUN 5T3ZE 5BQ7A 3IDUA 4NCDA 1MHPH 5D5ME 1MLCA 2NX5A 3LIZL 5IQ9A 5CJOH 4CMHB 3QDME 2VZ3A 2L7UA 5ID1B 3DARA 5F1NA 5FYKH 2EDLA 3G5YA 2YD8A 4JN1L 5GSRB 2EDDA 1Z6JT 4RWYH 2XNAB 4NO0A 4HH8A 1D5MA 4GRLD 4M8QA 5DT1L 3B9KD 4ELMB 1J8HB 3VWKB 3HZKA 1SBSL 4WUUD 5BOZG 2X40A 5EU7C 2YC1A 2RCSL 4Y2DD 1AIFA 5CP7A 3INUL 4PGDB 1TIUA 2BVQB 4X6DB 4ZFFA 4NSKB 1H3XA 5HJ3A 1JHLL 1MCNA 4LIQL 5DJZB 4L8SB 4JFYA 1DBJL 3ZKMD 2ESVB 4R7DA 3CGTA 4YXLL 1KJMB 1OAUH 3RWDA 4OCYL 3FAWA 4PGEB 3KPOA 3D3VE 2VE6B 2OXGA 2JJSA 1E4XL 1FZJB 4WFHE 4YX2H 1XGYH 5DD5H 3MLYH 3V4UH 2OBGA 5F1SA 1U0QA 2D7NA 3LEYL 3CFDB 1KTDB 1D5XB 3NVQA 1S7RB 5E8OA 3VXRB 5F9JB 3ZKND 1EJOL 1F90L 4Y4HC 4HJGB 4LSSH 2GTWB 4F7MA 4JDVB 3RNQB 1DQLL 4MX7B 4PJ8A 4HKXB 4KQ4L 5F71A 1ONQB 4OCXL 1EIBA 1FO0L 1NFIB 3I2CH 1N6VA 3GJFB 1FRGL 2IAMD 1WITA 2PW1B 1MHHA 2PYEA 4XNZB 1QNZL 4A6YL 4AYFA 1FCGA 3BZDA 2AEPH 5C0EA 1X9QA 3W0WD 1OP3K 1R0AL 4YHZL 1TENA 3GSXB 3NGBB 4QTIH 1HH9B 2PCPA 1W72H 3P4LA 1MSPA 5E9DD 5EBMB 4NO3B 3NZHL 2YD9A 5A3ID 4JRXE 2ZKHH 3RUGE 5KN5B 1M7DB 3JSSA 3TCXA 2C3WA 1UWEL 3ZSSA 1C08A 2Y23A 4RA3A 1ZT7A 4PJGF 4DGYH 1OLZA 4DZBA 4E0RA 2KQNA 4RFOH 5C07D 3L3OB 3ARRA 3MRJA 5F9AC 4C55A 3QDGE 4BFGA 3TCLA 4MB5A 3W39B 3HI5L 3U79A 4DOHB 4PG9A 1FLRL 4LP4A 5EO1B 1TVHA 4D0CB 3PGFH 3C6LB 3U46A 4CN1A 5J11B 5IVZB 2VSDA 3CLFH 3JWDL 4LPXA 2W9DL 4OZFG 5FECB 2FATH 1UENA 2JTDA 3NA9L 3MLSH 4GW5B 4NDMB 1QLRB 5GS1A 1OF2B 3MOAL 4I48B 2R2BA 4NZTL 3GBML 5F93C 4OCWH 3HC0A 2HFEB 3FKUS 2R29L 1DVFB 3G9AB 1C5DA 3ULUH 1ZHLB 3F8UB 5DRWA 1C1EL 5LGHL 3VXUD 1NC2B 4DAGH 4X83A 4EDXB 3TIDB 5K9KA 4FN0A 4BFIB 2EDHA 5FXCH 1HEZB 3MJ9L 3QZWG 1RZ8A 1NCDL 4ONOA 4U3CA 3SGDI 1R3KB 4X6CA 1QYGL 1MFNA 4L9DA 4NRYA 4PJGB 2V7HB 2A83A 5MP6H 5D2NB 4AIOA 2CLZA 3IU3A 4Z0XB 3LH2H 3U2SB 4YLQT 3MYJA 3TO2A 2CSPA 2NR6C 3AMLA 3GSRB 3UJJH 2J2ZA 4WGVB 4Y19D 3TYGL 3KPLA 5D7IB 1DQMH 1CLOH 1LO2L 1RIUL 2IQ9L 3QEGH 4OKVB 6FABL 4UUJA 1AGBB 4N8CH 4AG4H 1NBYA 3QXDA 4X7EC 1ROWA 2DICA 4K9EH 1Q9LB 1MAML 4YAQB 4X80H 2FX9H 4DCQA 2NTFB 4EN3A 2OTPA 1P2CA 1I9IL 2VWEE 2CUHA 3O2DA 4I3RL 2Y36H 1QSEE 3PHOA 3AS2A 3QJHA 2E27H 1TTFA 2DTSA 3UO1L 2HFTA 3MJ9A 3EJZD 4LPTA 1FAKT 1QFPA 3RVUC 5JXAL 2APXA 3B5HA 2MCPH 3OKLB 3BE1L 1CLCA 1FSKB 5I74C 1F8TH 5DC0A 3HAEB 1SEBA 2JJTC 5JR1L 2ADIB 4P5TD 1UM5L 1U8PB 2AJZB 4OM1L 4UDUA 3Q5TA 1R3JB 4GG8B 1N4XH 2Z91A 4Y8AA 4YDKH 3LV3B 2BY3A 2VLKE 1HKFA 5B8CC 1FNSH 4P3WA 3HZVA 4XWOC 3V4VH 2IPUK 2OLDA 4LLDB 4ONFH 4XZUA 1P7KB 4OQTA 1SJHA 5F9OH 1BQSA 3QO0A 2DTML 5EWIH 1YJDL 4ZOCA 1FFNA 4U0RB 2Y1VA 4RISL 1KCVH 2CIKB 2X89D 1UH2A 5I16A 3BN3B 4G6JH 5EOQL 3MXWH 5ALBH 4FZEH 5EIIB 1JNJA 1IGYB 1PYWB 2BK8A 2MPAH 1T5XA 4XP6H 1GHFH 2ED7A 1QSZA 4HIHB 5EORH 3NN8A 3SKJH 3MRRA 4RMVA 3MBEC 1ZVHA 2VXVH 3GSNL 5A16B 1AQKL 4HKBB 2XPGB 4OZGF 3VH8G 4ZFZA 4YPJA 1RZFL 3U1SH 2C1PB 1HH6A 3GGWB 1ADQA 4N0UA 5DQDH 1JF1B 5C0AE 5HGAB 5T1DH 3HG1D 4H8WL 5KZCD 1WGOA 3BT2H 3CXDH 3QIWB 3RAJH 2BRRH 1D5ZA 4H25A 1YC8A 2R2EB 3IKCA 2G9HB 4B7LA 1RHFA 4GKSA 3GMMA 5DUML 3R06B 2VLME 2UVEA 3EDJA 4WO4D 1IAIM 3MRHB 5DJ0B 3QT2A 1MHPL 4JG1H 2DI7A 4JN2B 5CJOL 3SDCA 4FQHA 4MD0A 1A6UH 1R3LA 3Q5YA 4ZFOA 2R9HC 4XC1H 5FYKL 3MRIB 4FNLH 2UVFA 4OF7A 1G6VK 2LVCA 3TT3L 4JFFB 4ONHA 4YC2B 4XVSL 3MZGB 4RWYL 5D72H 4TUOB 3BFOA 1U95A 4QRTA 4YGVB 5DD0H 5DFVC 2R23B 4YQXL 5HDBF 5CBAB 5TQ2H 3NPZB 5IHBA 1A6TB 5AAMA 1XCQA 3GSNA 3CZFA 3QAZC 3TBSA 1T1YB 2BY1A 5E5MA 2R9HD 4NP4H 1PFCA 3CDGA 3PP3K 4GXVH 5CGTA 3D2UA 1YPZA 3VH8A 4YPGB 4MAYA 4WJ5B 1QHPA 1AO7B 5DQ9B 3C08H 2E6PA 4MMZC 3QDJA 2HTKC 4W4NA 2J5LC 3MR9A 1UB6A 1I7TB 3VE0B 3IDIB 2D0HA 4HS3B 3EO0B 1OAUL 4CKVX 1D9KD 1XIWA 4MXQD 2GT9B 2BXZA 2BY2A 2BC4A 4BKLA 4YX2L 3BWAA 5DD5L 2X70A 3MLYL 5BVJB 3V4UL 4MCZA 3RIFF 1G9MC 1JGEB 1S9VA 4NFDA 5DMKB 4QRRA 2PF6A 5FYJH 5JORB 4LSSL 2W0FB 4NC1E 4M6OH 1G1CA 1DFBH 1S7QB 5JO5A 4EI5D 3HTLX 1H3UA 4PLKC 2XA3A 3CDCA 4WW1A 1Q1JH 1I3GH 3GSUB 5DJXA 1ND0A 1MCRA 4L3EB 3I2CL 3RWFB 1JWMB 2X9YA 4I3GA 1YEFH 3PGDA 3OG6B 3SKNA 1NJ9B 4PJHF 2D31B 1HNFA 4HV8A 2NY7H 4NUJA 2F54D 3A0OA 1Z5LB 2AEPL 1EJ6A 2NNAA 5IWLA 4ZTPL 1X5YA 1MIMH 2EDEA 3DXAA 3BYTA 3FO2B 1G7HA 1MCHA 1W0VA 1DQQB 3FFCA 4QTIL 3ZYJA 1FIGH 1W72L 3CU1A 4BQBA 5TDPB 5AD0B 3FB5B 3RY6C 4YDVB 4Y5YC 3ARGD 4PLKD 4WUUB 3IKKA 1U8KB 2ZKHL 4JZNB 5H8DA 4J1UA 3SHSA 3NABH 4OGXH 1EXUA 2AEQH 1YECH 2FHCA 4Y2DB 5EC1B 4N5ED 4DGYL 3JZ7A 3VFSA 4PIRF 4JDZB 4PBVC 4RFOL 3TPKA 4U1NA 2BNQA 2BOCA 4R4ND 3O3AB 1NC4B 3F6IA 3DUSB 1CDGA 1W8NA 5E6IA 4GAFB 2FNBA 1EFXD 2B4CC 2F53E 5DUBA 3PGFL 1UA6H 4G8IB 1MJJA 4N8VG 3TA3B 3I6KB 3CLFL 3WNKA 3U36B 3LDBB 2HVKB 4AEFA 2DLIA 2FATL 5JOPD 5CKGA 4ENED 3MLSL 1J88A 5FKAB 3SGDH 2FWOB 3V0WH 2R15A 4OCWL 1XGPA 1NDGB 4PJ7F 3FOMB 4KJYA 2VDQH 1BF8A 3KYNA 4PJHB 4X6BA 3NIGE 5HYEA 5E1AB 1CT8B 4JRYD 3BP7A 4LOUC 3ULUL 4DAGL 3PWNB 4PP2A 2IAMB 2W59A 4YK4C 1F3DH 1CFBA 1J86A 1DUZB 1P4BH 5E9DB 5MP6L 2HRPH 3FHAA 4IOIB 4RZCA 5MEOB 1EAPA 1YMMD 1BAFH 3EUUA 1WC7A 3LH2L 3KYOA 4YBHA 5DRZB 3VFUA 3UJJL 1E4WH 1RJZA 4L9LC 1S9YB 5IW1A 5C0IA 3U4BH 5IROC 4CN4A 1DQML 1CLOL 4N8VA 1FVDB 1K4DB 3K8KA 3QEGL 1JTTA 2WINA 1N5AA 1J8HE 5E4EB 4Z7OF 4N8CL 5HYQA 4LAQH 4AG4L 3HFMH 1KIRB 4LGPB 3RPIB 3WFZA 4K9EL 1F4YH 3ARDB 5FKPB 1I8MB 4PJ7B 4X80L 2FX9L 2XQBH 4P3DB 1MHEB 5DEGB 2YPLA 3O9WA 5HI4D 2Y36L 2VDMH 5ACLA 5EU6B 2E9IA 2E27L 1JF5A 2R1YB 3MUGA 4MJ5B 1FZMA 1CS6A 1BQHG 5EFIB 5MI0B 3GNMH 3SKOB 3L3DB 3QRGH 3BSZL 2MCPL 5HDOA 5GSVA 3BYYA 1G0DA 3AB0B 3QQ9C 1F8TL 3ULVE 3RTQA 1FHGA 1KLGA 3E6FB 1UWGH 3PWJB 4LVEA 4GS7C 2E6JA 1NBVL 2IADA 4HZLA 4RRPG 3S5LG 3WKMH 3QG6B 3HE6D 4EIGB 1AC0A 1J1XH 1N4XL 4YDKL 3FRUB 5L8JB 1FNSL 2R39A 4Z76A 4PY7B 1S7WB 3V4VL 4GW1A 4U7KA 4ONFL 1EEZB 5ELIA 3KXFD 5J6HA 2HT3C 5F9OL 3MV7B 4V2CB 3MV11 3HPJA 5EWIL 3MJ6A 1GGIH 3L3HA 1S9KC 3LCYA 1AQDA 3VXNA 4PJDF 3LQZB 3TBTB 1KCVL 4HWZB 4OD1H 4WENB 4FZ8H 4G6JL 4P4KD 3MXWL 5ALBL 4FZEL 2MPAL 3DETC 4F58H 4XP6L 1GHFL 3BD5A 2NX5D 1AE6L 5EORL 3ZT7A 5C0JA 3SKJL 1TZIB 2Z92A 4D9LH 4NQSB 2XICA 3DECA 5HVGB 2VXVL 32C2B 4ZAKB 1T2JA 2BNRA 1BQHA 5F1IB 2KH2B 4RNRA 2EXWC 4NO0D 5GJSH 3U1SL 3DRTB 4ZXBD 5TJWK 3BIKA 3QPQD 5D7JD 4GRWE 2AV1B 5DQDL 5T3XD 4FXLA 3KHOA 5T1DL 1A6WH 1OWWA 3S5LA 2YXFA 3BT2L 3CXDL 2IFFH 4YJZL 3RAJL 2BRRL 5DK3A 3VWJB 4P46A 4Z77A 1R6VA 5ADOH 3C5SA 2JJSC 1A9EA 4HX1A 3CUPA 3RDTA 3C5JB 3HUJA 2XN9D 2R0KH 2NW3A 5HI3C 1FCCA 3PABB 3V7AG 3HLAA 4JG1L 2W60A 4NKIH 1LE5B 1A6UL 4WFFD 4XC1L 1N8ZA 4PJ8C 4FNLL 1F13A 4MA1C 2Y9RT 4PJDB 3HI6H 4P5KB 3MCKA 2UZXB 4JFEE 4S1QH 5ANME 2YPVH 5D72L 2GK0B 3TPUA 3E3QE 3MOQA 3LN5A 3KPNA 5DD0L 5I66B 4QWWD 1JRHI 2H26B 4OBSA 4M9PA 5TQ2L 3N06B 2WBKA 2RR3A 1ZHKA 4LKCA 1AR1C 4KK6C 4NP4L 1DE4B 4PJGE 4PJ5A 2BZDA 5I76A 2UZYB 4GG6A 4DKDC 1QP1A 5CEZE 3C08L 4XH2A 4OD2B 1YEHH 4LCUA 4ZPTB 1BVZA 4LMQI 1IGFH 2DJUA 4L4TA 1IC7H 3ZYZA 1T7VA 3V95A 3DYMA 1X5HA 1IFHH 3CH1B 1K9TA 1AR1D 5IB1B 3LKOA 1KNOA 1WWAX 5KSBE 1PSKH 3DHJA 1UWXK 4KRNA 1OTTC 4LQ1A 1HILB 1T0MA 1HSBA 5CJQH 4P2RA 3AAZB 4NQCD 4UILH 4F7CA 1N7MH 3LD8C 5FYJL 4MDJB 4NOBA 4PGBA 1QR1B 3NCJH 3BZ4B 4L4VA 4M6OL 3SE3A 1DFBL 5GS1C 1U92B 3GSQA 5ISZA 1Q1JL 3T8XA 1I3GL 2VLJA 1LO4H 2V5RA 2JB5H 4R97C 1YEFL 2V2TA 2ERJC 1LK2A 2J12B 5IK3A 4ONGH 2IH1A 2NY7L 2DQDH 3SDDB 3K4ZA 3K7UA 3ZTJG 3HN3A 3O8XA 2P5WA 1FIGL 4LQFH 4R7NB 3NCYS 4LVOC 5IQ7L 4BSVA 3NABL 4OGXL 1CVSC 2AEQL 4BFEA 1YECL 1QSFA 2VLRA 2DOCA 3X14A 1XGUB 5C0BB 3BXNB 4WWKB 2CUMA 3QISA 1YY8A 2W07A 1GGUA 2CPCA 1FL3B 3T0EA 3EJYD 4S1DC 2DM7A 5IBLD 2V7NA 5SX5H 1SMAA 3TBVB 3JWDC 4L8DB 1UA6L 4P48A 3MFFA 3V8OA 1SYSB 3VXMA 4AIZB 1GCFA 1A7RH 3Q1SH 2X4SB 5C0CD 3C87A 5HHNA 3V0WL 43CAA 1G6RH 1IAII 2VDQL 3MRGA 4WU7B 1QOKA 5FYLD 4EN3C 5GRUH 3CFCH 1DBAH 1CFNB 2MHAB 4UIKH 1HHKA 1H0DB 2CDGB 1MI5D 1B9ZA 4OZHF 1LEIB 1H3GA 4MNGA 3X11A 2HVJA 4UAOC 2ATKB 5F9WC 2DJSA 2EEDA 3T3MF 3D39A 3G9VA 4G7YH 5A40E 2X09A 4CBPA 1JZ2A 3DBXA 1P4BL 2HRPL 1A1OB 1KJVA 5IW6A 1BAFL 4ZQKA 4G8EA 1U8MB 2FYYA 3D25A 3K8LA 4OCLC 3FONA 3QIBD 1S78D 2Z35B 1E4WL 5D7LD 4QRSB 4JFFE 4GO6B 5IIEA 1J0YA 3QUXA 3MREA 4NNXA 4LCCB 3TO4A 4PLJC 4LAQL 2HJKA 3HFML 3L3GB 5IOPA 2HFFB 1CVRA 2VABB 4LLUA 1F4YL 2F74A 2V9QA 3T0VA 1KFAH 3L5IA 2XQBL 1DBKH 3MLVH 1A9BB 4OZGE 1O5DT 1ZWIA 2N4IA 5GIRA 1B6DA 3V6OE 1AO7E 2VDML 4Y4FB 4R90H 4OZHB 1AD0A 1S8DB 3VI3F 2X4QA 2Y07H 5KJRH 2BMKA 4F15C 1CICB 1XH3B 3BN9D 4NIKB 2A6JA 3CFJA 5EZIH 4Y2OA 1MWAB 3L3IA 1S9WA 1HHGB 4Q7DA 3VFTB 2HT2C 3WKML 1FN4A 5CGYC 5EIQA 2B7DT 3FQUA 3BUYB 3TNNA 1J1XL 5DGQA 5E99H 3TP4A 4HFWA 3QNYA 3QI9C 3QH3B 3ECBB 1WIPA 4KY1H 1CD1A 1A4JB 5I9QB 2YRPA 5BOPA 1ZT1B 2X4NA 5F7LB 1MUJA 3SDCC 1MHCB 3LEXB 5I1AA 4ELKA 3CPLB 4ZOBA 4E5XA 5K9OB 5IG7B 5E8EA 1KIPB 1GGIL 1HXMB 4I5BB 4DN4H 4B50A 4POZC 4UNUA 4PRPD 1CGYA 4X4XA 5HDBE 4NZUH 2LFGA 3FMGH 4OD1L 4Q74A 1YYML 1AGEB 1F4HA 3MV9B 4FZ8L 5CEYA 1RIVH 4Z7VA 1VFBB 2X05A 3DMMA 3LAFA 1MFBH 4MJ6B 1PX4A 4F58L 1NPUA 2IBZY 4OKDA 4YGAB 4WUUE 3ARBA 5D2LF 4R4BB 4V2BA 4ZSOB 3DIFB 4D9LL 1MFDH 4OIAA 4JRWA 2WBJD 3ZLQC 2DLEA 2BHUA 3B5TA 4MAYC 3UTOA 1SBBA 3O45B 3PDGA 3MRCA 3RQ3A 1FYHB 1ERNA 2E8YA 5GJSL 1RJCA 5T5NF 1I1AD 4H8WC 3C2AH 4J7RA 3KAAA 1A6WL 2X4PA 2OYPA 4DFIA 2IFFL 1XIWC 3OR7A 5ADOL 5SWZA 4X9FA 4QCIB 1TETH 2F15A 3L3KA 2EXYD 1IEAA 5FA4A 3MRPB 5BJTA 1KIUA 2R0KL 2MQCA 1JRHH 3SQOL 1AR2A 4NKIL 4XP5H 4JQXA 1H8OA 3G04B 5GGTH 3DLQR 5C2BH 1TJIH 7FABH 3B3IB 4KK8D 5INCA 2WZPD 4PJHE 2MTPA 4LLMB 2OQJB 5IVXB 3HI6L 5ENWA 1KELH 1FNGB 5CZVH 5J3HD 4XI5C 2YPVL 2A74A 3IXTA 4KK9D 3ZE0F 2X4UA 3GFUA 3BZEA 4NO5A 4XMPH 4QRRD 4P2QA 3N85H 5D2LB 2YWZA 1X6NA 5FYKD 3O6LH 5IB2B 3EHBC 4G6AC 3VMNA 5E9DE 3L1OH 1KJ2H 5IW3A 4ODXB 1DANU 2NXZB 2K7QA 3IDYC 5GZOC 1YEHL 1E28B 3TZVB 1W0WB 4IJ3B 1U36A 2XWBA 3V6FA 3C8KA 1IGFL 3NFPB 1K3IA 3WFHB 1TJHH 1IGTA 5C07E 3WO4C 4D9QD 1XCTB 1IFHL 5E6IC 5D7JB 3BPNB 2EKSB 2EC8A 3M17A 3UTSD 4J8RB 3DVGB 1PSKL 3WN5B 4U1LB 2CDEB 1UFUA 5CJQL 3BP6B 1AHWA 3JTSA 4UILL 4KKNA 4I0PA 1N7ML 4LEOA 5FHAH 5JIHA 1EEQA 2L4OA 2OCFD 4PJ7E 1CQKA 3IF1B 2XRAH 3HKFA 4ZO6A 2JIXB 1IAKA 4Y1AB 1LO4L 1KENH 2JB5L 1XGQB 5I1JH 4C56D 1F3RB 4HCRH 5JMOC 1UVQA 2A6KB 1WFOA 4QXUH 4ONGL 4G8GA 1C8PA 1KACB 5CP3H 1N59B 2DQDL 3NH7H 3W11D 3C60A 3FFDB 2FH6A 2XWJA 2PUQT 2HT4C 5GRVL 1YUHA 2H2PD 5TDOA 3VXUE 3OHXB 4LSQH 5GISH 3B2UD 3U7WL 1ZHBA 1K5NA 4LQFL 1AI1H 5F8QC 1MQKH 5EUOA 1IGJA 4ZTOH 5IUSA 2XY1A 3I3EA 5DC4B 5KG9B 1DSFH 3BP4B 3KYKH 5IHUH 5L2KD 4EEEA 3FQTA 5GRVK 1JK8B 3BEWB 3LY6A 4UOJA 4KAQH 4E42B 1P5VA 2P43B 2XZAH 3I84A 3VFMB 2WV3A 2JB6A 4JZJB 4K3JH 1VB9A 5ESAB 1IAIH 4O2CA 3SDYH 3QUYA 4Z7OE 4U4BA 2XKNA 2XYCA 1UEMA 4EXKA 3EFFB 3EOBA 3SPVA 1U3HA 3GSOA 43C9A 3SE8L 3DROB 3VRJB 1B88A 1DLFH 1A7RL 1WSST 1H5BA 3ALPA 3Q1SL 4KI1A 3TT1H 4OLVH 1KLUA 5IT2H 1WFNA 1JTPA 3RHWK 2GAZB 4P2OA 1G6RL 3MRBA 4JANB 8FABB 4YR6A 2RFXB 1KXVC 1QFHA 5JHDA 3U30B 5GRUL 3CFCL 3ULUC 3O9WC 3UZEA 4JREB 4UIKL 1IL1A 1BEYH 1I9EA 2ZOKB 2ICWA 1VACB 3JVGC 5GZNC 1LO5B 1HINH 3O3EB 3QFJD 2NY3D 3DGCR 1OGAB 3RZCB 2J8UE 3LKQB 2X42A 2N1KA 2AJYH 3JTTA 1I7UA 3IJHA 1NGZA 4XCEB 5A2IH 2AEIT 3HE7D 5J57B 1BFTA 3RTQC 2VJXA 3LKSB 1LILA 3CK0H 4EOWH 5TGBB 4M6AA 4Y5VA 1XT5A 4M7ZC 4XNMB 4OAWA 5D5MA 5J1AA 2WIIB 3IDJA 3O81A 1M05B 1ZA6B 3SJVD 3QDMA 2FJGB 2GSGA 4MSWA 2CIIA 4PJDE 4HH9B 3CJJA 1K8IA 3JBG7 5DK0A 4HUWA 5HY9A 3PQYD 4HQQH 2P8MA 3STZA 1FC2D 3VD5A 1TJGH 2WQ8A 5EC2A 1KPRB 3TGXA 3MZTA 4MD4A 1M1SA 4K9EC 3X17A 4XBGA 4GQ9H 4JB9H 5E2JA 3SQBA 3DVNB 3TJHC 4G9DA 3RGVB 5IF0B 2LU4A 4JLRB 4I77H 2LAAA 1IAOB 3DTXB 5I1KH 3JWNC 1KFAL 4NHCH 1DBKL 1YN6A 1MVFA 3MLVL 4JJ5B 3OQ3B 4IRSA 3V9FA 5C3TA 5C0CB 2NYYC 1IC1A 4R90L 4FRWA 1I7RB 2PYFB 4WTZG 2P42B 4TNWK 3HCVA 2CJUH 4F2MA 5IEHA 2Y07L 3FT4A 1INQB 4TTDC 5KJRL 1V7MH 5BRZB 5JW3H 2NY4D 1VADB 1EZVY 5EZIL 4ZNCD 4HIJB 4F3FB 1OARH 2PTTB 5D96C 2FHFA 4E41D 3D3VA 2Z8RA 4XVUD 4P46C 1QQDB 4M1GH 5E99L 1MCPH 3MLZH 3QDAA 4KI5C 1KCLA 3RDTC 1A2YA 2Y5EA 4KY1L 3QEQD 2BNRD 3CNKA 1QPPA 1H15B 4LDLB 1AGCB 5I71B 4ORGA 5EU3A 5DHVB 1ZGLB 1KT2B 3GSWA 1N64H 3T2NH 5FGBA 4X99B 4CVXB 4DN4L 4GMTH 4U6HB 3QIBB 1FVEA 1F3JB 3AXLB 4NZUL 3FMGL 2GI7A 4QHMB 4S2SB 1A1NA 1NCBH 5SX4I 4U6YB 3EYVB 1RIVL 4QXWA 3OWEA 1MFBL 3MROA 2V5SA 3P0VH 3DGGB 2B2XH 1OD7A 1U42A 5FIEA 4JRXA 1U8LA 3RUGA 1MFDL 1WJ3A 3OB0H 3SCMA 1OGTB 5C0BE 5I75B 3MV8D 3M8OL 5L7XH 5IJVA 1FDLH 4DWHA 2XKSA 3OG4B 4LHUB 1MLBA 3C2AL 1J0ZA 3RGHA 1YN7A 3QDGA 2JJUA 4XCNA 4U1SA 1GZQA 1CXIA 2ZSVB 4JKPH 5C8JA 5GS0H 3SGEH 1TETL 4R6UA 2DM3A 5DMGC 1VFAB 1KPVA 3STLB 1RZKH 4V1DB 3WUWG 1CR9H 1WAAF 5DLMH 1GVIA 1JRHL 4O9HH 4OLZH 1CFSB 3O4OC 4XP5L 1U8QB 5GGTL 3IDGB 3ZHLA 5KSVA 1JL8A 1U8HA 1TJIL 3CMGA 4OGZA 4U1GC 7FABL 5TH2A 4MQ7B 3SE3C 1GRWA 3WL9A 2VKXA 1CN4A 2AJ3A 1QHOA 4MCYA 4BH8B 1KELL 5D1XD 3S4SB 5CZVL 2FGWH 4Q0XL 4UNTA 3BD3A 3UTQA 5HYIA 1S7XB 1R5WA 2EDRA 5DMGD 2H9GB 3FCTA 2FEEI 1NH6A 2XI9A 4XMPL 3N85L 4GLRI 3O8XC 3GJEB 1MCOH 1N26A 5ID0B 5FO8B 3O6LL 1IILE 4P5MB 5E2WH 2APVA 1WWWX 3L1OL 4K71C 4Z7UF 3ULVH 1VGEH 1QFOA 5HHVH 4L1HA 5FM5M 5F8RC 3UBXG 2OTUB 1UM4H 2VAAB 4CJ1A 1RIHH 4LLYA 4OCSH 2O93L 1NFDF 4NO2B 2Y7QA 2ICCA 1TJHL 3O8XD 2P5WD 3KNBA 3T0EC 1G7QB 3FB8A 3WKNA 1WIOA 3O4LB 5C0DA 3O6FA 4P23A 2P1YA 3P73B 3QHFH 1NCCH 3GJFH 3WUWA 5E94B 3E8UH 3EGSB 2PO6B 4H20H 4OZ4A 1XZ0B 5GGTA 4F57H 1D5BB 1P69B 4OF6A 3K1KC 5HYSB 5FHAL 2X7LA 4HUXA 1TMCB 2VERN 3H9SD 2XRAL 2J3SA 3BO8A 1UZ8A 3VFNB 1LDPH 3LSOB 1KENL 3HMWH 4P4RA 3OF6A 4OBRA 4HCRL 1L6XA 4JFPB 3QJFA 3IAQA 1QSEA 4QXUL 2A6IA 4P0DA 1AGDA 2MFNA 3FB7B 3IDNA 3VD4A 3NH7L 4O02H 3RL1B 2VDLH 4JRYE 4JFDD 3MLTA 1MAKA 5F96H 3VXMD 4ZDHB 1NGWA 5GISL 4LSQL 3T3ME 5E8PA 1AI1L 2HJLA 1MQKL 4ZTOL 2EDNA 1DSFL 4Z7UB 3T0BA 4F7TA 5IHUL 1A8JH 1KN4H 3VGHA 5D9SB 3FT3B 4FQJH 5D6CA 1H3WM 4KAQL 4LSUH 1EHAA 1Z3GH 4NCC2 1LE9B 3E2HC 3T09A 3N1GC 3EDDA 2ZUQC 1BOGA 4XTRC 7CGTA 2XZAL 5TQ0H 4AQOA 1NFDB 5DA0B 3PGCB 2VLKA 5LQBH 5ITBH 2H3NA 2EEAA 1YMME 4K3JL 4WI4A 1YEGH 1IAIL 3SDYL 4ISVA 4LCYA 2LAGB 4DN3H 2NY0B 4W6WB 4ACPA 5GRZA 3WLBA 3MC0A 3ZE1F 5B4MD 3MV9E 5I1LA 4HG4K 3QUXC 3GBNH 2RBLA 4APQB 5CEXA 4MDIA 5B3NA 3TO4C 4O2FB 1FVCB 1UXWB 4X4YB 3UTSB 1DLFL 3VXOA 5I0ZA 5CD3B 3TT1L 4GW4B 1SHMA 3DX6A 4IIQA 2NXYC 4OLVL 3BIAX 4G43B 5IT2L 1VFUA 2VL5A 4XPFL 2QSQA 5IKCB 4HCRA 4LLAA 3TC9A 3PV7A 4WFED 5CP3A 4HUUA 3VI3E 5FDWB 5KBNC 4LNVA 1BEYL 1MFCH 1LGVA 2W92A 1QEWB 5J7CC 3RU8H 4JVWA 4C56B 4GAJH 3FHQA 4PREA 3I6GA 5DRNB 2FD6H 5CEZH 5C0AA 2AJYL 5IM7B 5K33A 4O5LH 4WI2A 5I8CA 4QTHB 2HKFH 5F7NC 1VSCA 3RWHB 3NPSC 3ZE2F 3BKYH 3CK0L 2EH8H 4EOWL 5ALCH 2ZG2A 4XNQA 5FGRA 4JY4B 4KPHH 4HGWB 5D70H 1N6UA 2ITCB 3AY4A 4KKCC 1U8OA 5HBBA 1D6VH 4UDTA 3MGOA 2J8OA 1FJ1B 4OGAC 3QCTH 3RNKA 4NOFA 1TZHA 4HQQL 3KXFE 3B8YA 2R69H 4CNIB 3IGAA 2Q3ZA 5E7FA 2MQ0A 4GQ9L 4JB9L 2Z8WC 5D2LE 4I77L 4KKCD 3DMMC 1B0WA 2C3GA 5I1KL 4NHCL 5K59F 4OGAD 3CU7A 5CJXA 3ARFB 2FO4B 1I4FA 3ARBC 4HK3N 4EI6A 1PEZA 5DD6A 3NIFF 4IOFC 2GW5A 2CJUL 3V0VB 1EFQA 3MRFB 3P9LB 3VA2C 3H7BA 1JWUA 2CUIA 1V7ML 5JW3L 4R9HA 2IPKB 1B0GB 2UV3A 3RVXC 4QHUA 3SDAA 4YO0A 5FOBA 3NAAH 5HVHB 1SJXA 4EKXA 1OARL 2FEDC 3T4AA 3CMOH 3QQ3A 2EYRA 5T3XE 4LU5H 3QUKA 3F58H 2XOTA 2NY3B 3U9UA 4H26B 3ARBD 4M3JA 2VDKH 3MTRA 3TYFB 5SX4H 1UQSB 2XQYK 2YD6A 4M1GL 4NYLA 1MCPL 3MLZL 4CAGA 1MF2H 4IOFD 5SWQB 2QQQA 4HIXH 4HJ0D 2Y06H 5D1ZA 4L29A 3WIHH