3H42H

Crystal structure of pcsk9 in complex with fab from ldlr competitive antibody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
224
structure length
221
Chain Sequence
b'EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYISYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYFCARDYDFWSAYYDAFDVWGQGTMVTVSSASTKGPSVFPLAPSSKGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
molecule tags Hydrolase/immune system
source organism Homo sapiens
publication title From the Cover: A proprotein convertase subtilisin/kexin type 9 neutralizing antibody reduces serum cholesterol in mice and nonhuman primates.
pubmed doi rcsb
total genus 51
structure length 221
sequence length 224
ec nomenclature
pdb deposition date 2009-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h42H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h42H01
2WK2A 4ISVB 2F5AL 4PJCF 1P9MC 3FO0H 4L29A 4KI1A 4E41D 1AI1H 35C8H 5FYKD 3Q1SL 1U3HB 4ZPVB 4JFYB 3P9LB 1YEEH 4YDIL 5I9QB 2GAZB 3RRQA 4MYWB 1JBJA 5JQ6L 5L9DH 4NGHH 4NRXA 3CSYA 2AQ2A 2VDQH 1NL0H 4HHAB 3HZYB 5F7EH 2F53E 5D7LE 4FFVC 5SWZA 1NGPL 2QR0B 3FT3B 4FFWC 2ICWI 4F8TA 4LLVB 5DUPH 1VB9A 4LLMA 4XCYA 5J8OA 1ROWA 1DQLH 1LEIB 5HI4C 5IBTL 1UA6H 3C5ZA 4QXUH 1D9KB 3HMXA 4HAFA 4JDZB 3HZMA 3HC3H 3DYOA 4W6XB 4K7FA 4M5ZH 4WCYL 3C9NB 1TJHH 3IDNB 5IG7B 1BBDH 2EDHA 4ODUB 1ZEAL 4WWKB 4U1NA 3VWJA 3QHZL 3WJJC 2NX5D 1SY6A 5BOPA 1U8IB 5J3HD 2E27L 2XZAH 4HF5L 2NYYD 3BDXA 3LPGA 4RX4A 1UYWL 1KCRH 2HFFA 4JM2D 1DSFL 4JFED 4H0HB 4N0RA 3GM8A 2G75A 2X4PA 4I3RL 5TQ0H 3C5ZB 4LASH 3Q3GB 2NW3B 4JY4B 4PGCB 1IL1B 3MV8E 3GSNA 4XGZA 1FFOB 5KSBF 5CSZA 4YBLB 1YMHB 3D9AH 1MAKA 3VWJB 5IB5A 1EEZB 3L3JB 1INQA 4KV5E 2DTMH 5CUSL 4JN1L 4RWHA 2FDBP 1JWUA 2WW8A 4X7DC 1TZIB 5CS7A 3EDKA 4XP9L 3IRPX 1Z0NA 2VDKL 3FT2B 1TZGH 5DYOB 4L8CA 3PHQB 3QG7H 5DJ2B 3BH8B 3I6GB 3TCXA 4Q9CA 2NY2C 4Z5RA 3FTGA 1N64L 4ONFH 2MKWA 3LEXA 1BIIB 2AJYH 1SBSH 3ESVF 5ICZB 3LKSB 2OSLA 1CS6A 2EIBA 5LQBL 3HI1A 2ZCKH 1PYWB 4YZFF 1AGCB 4ZYKB 3WNNA 3ARSA 4LL9A 5L0QB 3RTQB 5ID0A 1MCQA 1D5BA 3RWJA 1KIPA 2FRGP 1ZHNA 4KZDH 1HWHB 3V0WL 1IGJB 1BBJA 4DK3A 3CD4A 1TNMA 3BH8A 3I6GA 5T33H 3QDJB 1CR9H 4LLQB 3RWIB 3MRNB 3SDYH 1UM6H 5IJKC 1H3UA 4R4FL 2QJDA 4KI5D 2WANA 3LPFA 1JNLL 2UY6A 4WHDA 4R7DA 3P73B 4LCCC 4LVHB 1QFWL 4Y4HD 3T4YA 3WN5A 4EKXA 2DQTH 5IT2L 1AR1D 3E3QE 4OLXH 2NXZC 2KQMA 1ULVA 2EYRB 4E41E 3IB4A 2Q86A 3D3VA 5JDSB 4G6KL 5GS2D 3MRIB 5EO1B 4CN4A 4AM0B 4PJGE 1INQB 4KMTH 3X3FH 4X6CF 2M1KA 4X6EA 1ADQA 1T1YB 2IADA 4LNVA 5I76B 3NBNA 3QYCA 3B5GA 5DJZB 3QEGH 1H3PL 3VD3A 5HYSA 3QIWD 1DE4B 4G6ML 1HWGB 1UEMA 4Y4HC 5ESQB 3KDMB 2VUOA 1LD9B 1RJYA 4K8RH 2A9NL 2VLJD 3KNBA 1T2QL 4NQCB 5GIRB 2NXZD 4F7PA 1HQRA 5MEOA 1E6OL 3TZVB 3OMZA 5T1LA 1RMFL 3GJFB 2ZSWA 3PWJA 2AJ3B 3P4MB 4ODUA 3DVNA 3VWKD 2VLKD 2ESVB 3I9GH 1TITA 1Y0LA 4NZRL 3U0PB 4MNGB 1TQBC 3RNKA 2H32B 1NSNL 1V3MA 1K2DA 2OJZH 4K3DH 3WO4B 3VFRA 5I1IL 3DX7B 4RAHA 1JZ4A 3SJVB 2F58L 3GB7B 4MDJA 4ONGL 4MAUH 5D2LB 2BCKA 1NFIB 5ISZA 3KG5A 1A1NA 3T2PA 2DAVA 4IBLT 3RZWA 4JM4H 4NT6A 2YC1A 2I60H 5D71H 4TVPD 43CAA 1HYSD 3AFLA 4KRMB 3U7YH 3HZVA 4Y4FA 1QVOB 4QHNB 4FZEL 3F12A 3GK8L 3CFKA 1U8QA 2HLFD 1KENH 1OARL 4MQXC 2C4FT 2VLRD 3GI8H 2OZ4L 2LABA 4RFOH 1OW0C 2V5RA 3B9KA 3MGTA 3V6OA 4UTBL 3RZCB 1XR9B 5L9DL 1A8JH 1MY7A 2X9YA 4NRYB 2DLFH 1MNUH 4YNYB 1CN4A 3SHSA 4FQHB 2EIZB 3WCYA 3G5VA 3PWLA 5DUBB 3TT3L 1GZQB 1IC7H 1K4DB 2IWGA 2B1HL 1G7MA 3K81A 4UZGA 1D5ZB 3E8UH 5IHUH 3V52H 4KQ3H 3V9FA 1OAZH 1NMCB 2YXFA 4CVZB 1EHNA 4JZOA 4H5SB 3DROB 3LHPH 3IFOB 1F8TH 5L2KD 2DYPB 4QXUL 1XZ0A 3DETD 2B2XL 1WVZA 3HCVB 3HNTH 2IBZY 2EE3A 3CFBA 3H9HA 5L0QC 2NX5B 5GJSL 5IR1A 1ZEAH 3GMNB 1I1FB 2A6IB 2DQIH 5EU7C 4X7SL 3LS4H 4MXWL 4MDJB 4JN2A 1AY1L 2F9BT 3BJ91 3QEQD 1H8SA 1DN2A 3KJ6H 3O11A 4JO3L 1YN7B 2VXVL 1JZ3A 1UWGH 1NLDH 2Z92A 4RAVB 4M7LL 1RIHH 1V05A 4QRTA 5IB1B 4S1RH 2HMID 1N8ZA 1RY7B 5E2UL 2WIIB 4AJ0A 2H3NA 3L3HA 3PABB 4N5EC 5TPWL 5A16A 3NA9H 4EUPH 1SM3L 3J8F7 2YOCA 4LEXH 3PDGA 4TVSa 4FP8L 1OB1B 3K1KC 2ITCA 4HBQA 3DRTA 3MRQB 2OTWA 4G6JH 4H8WC 4LP4A 2R4SH 4NRYA 3ULVH 4LCWE 3RY4A 4Z7WA 1SEBB 3VD7A 3U30B 3SKOA 2Q76A 4J8RB 1T21A 1L7TL 2O5XH 1SJHA 5GIRA 4F7PB 3GKWH 1HXYB 5FIEA 1PKQE 3VE0B 4JHWL 5J06A 4P57A 1BM3H 5C0CA 2VMFA 4JO1L 1RZIB 5FYKL 1H0DA 3O6LH 4NQSA 1A7NH 2A6JA 4KK9C 3QUZD 4QRSA 2E5EA 4Y5YC 5IIEA 3DX7A 1SMOA 1YYLL 4Q9BA 3MXVL 5CJXC 4Z7WB 5HHPB 1S3KH 4JREC 3V5DB 2APFA 5J11B 4V1DB 5D6DC 1HZHL 3QIBA 3BGMB 4P9HC 1KJ3L 5T1KA 1EJ6A 5FHAL 1I1AC 5EIQA 4PR5A 2R2BA 1DBKL 1S9WB 4WTWA 4F9PC 3AAZB 5DD5L 4P2OB 4RMRA 4PJIE 2Y5TA 5IB1A 4PJEA 5IFJA 1PYWA 3ARRA 3HE6D 1WITA 4LPXA 4M4PA 3DXAE 1NGWB 2FX7L 4YZFE 2A6KB 3MNVB 4XPBH 1D5BB 2JIXD 4F9LA 2F5BH 5TJWK 3UJIH 4PPTA 5HSFA 1TQCC 4PG9B 2IPKA 4NBXB 4KU1A 3W2DH 4JFDE 1BFTA 1MF2H 4WWKD 5I66B 4KMTL 4OGZA 2BVPA 3M45A 3ZTJH 3MLYH 5E2VH 4HDIB 5DR5L 1EFXA 1MRFL 4PJBF 3RVTD 1JZ7A 3GHBH 3RUGE 3HE6C 5FHBL 5KSUA 1N6QH 4HIIA 4R0LC 5CSGA 1IEBB 5EO9A 3BKYH 3VFPA 1E6OH 4AT6A 1CDIA 2IANA 3PWNB 1N2RB 3QAZB 3SKMA 3MRFB 1JWSB 4ZMAT 4WDIA 4CN1A 2OJZL 4Y16D 3MV8A 4ZFZB 1P9MA 4M6NL 4RGOL 4U3XA 2I9LA 5C0RL 2AGJH 1CXLA 2DQHH 1OWWA 3KNBB 1C08B 4POZC 5DRWA 1UKTA 3TZVA 2ICWB 4CVXA 1P7QD 5SX4I 1VGEL 5DJXB 4LEOA 5JUEH 2OTUB 4AT6B 5DA0B 2QHLA 4YDVA 2V2TB 5EZJA 4F7CA 3P2TA 1MH5B 2R0KL 4AH2B 3GK8H 5HHMB 3S88H 1ZT4B 1KENL 3RWCB 4NQDE 4P2YA 3SDCB 4NQUA 1HH9A 1XMWA 3SJVA 4LSPL 5IVZB 4UTBH 4XXCA 3LN4A 4OCWH 3TO2A 4X99B 4ELME 3MOAL 2BOCB 4H8WL 4RFNB 1BQHA 5C8JA 3A67L 1ONQA 4QRUB 1Z3GL 2YD6A 1CL7H 3NCJL 3FQTB 1UXSA 3K3QA 2DDQL 2COQA 4N90E 1IAOB 2BNQD 5E5UB 1RAMA 4P2QA 3QEHB 3IRZA 4KK5D 4GW4A 4Q0XH 3MROA 4TSCH 1Z5LB 5DEFB 3UTTD 4KWUA 5J57B 2DJSA 4POYA 2DI7A 2CQVA 4MJ6B 5D7IE 3T04D 5INDB 3KLHC 3NACH 4U6HB 3VRLE 1NCAL 4DN3L 5MEQB 1T4KA 3C8DA 1UM4L 1F6AB 5E6IC 1YEHL 3H3BC 3LSOA 3DYMA 4C57C 1I4FB 4NSKB 3WUWA 3D85B 4L4TD 2GK0A 5DTFB 4U4BA 3X13A 4M9PA 2H1PL 3MNWB 1SYSB 2DQJL 4Q74A 4V2CB 3GBML 4PJ8C 2Z91A 1XIWC 4U1LB 1YEFL 1CK0L 3U6RA 4HH8A 1A6AA 3O9WA 4LSTL 1KN2L 4WW2C 1A4KA 1T3FB 4PYHA 4XPGL 3BD3A 4F57H 4YAQB 4M7KL 4KROC 3V7AG 1MCBA 2DQGL 4R26H 3PL6D 3BPLC 4AIZA 3QUYC 2KH2B 3QAZC 5KG9B 1WGOA 4G7YL 1T4KB 3DVFA 2IH1A 2JB6A 3V0VB 1DQJA 5KOVC 5EUKB 3M1BA 2AI0H 4AEIL 1T66C 3OG6B 2YPLB 4HK0A 3C09B 3FN0L 4J12A 2CIIA 1SYSA 3V7AE 3I02A 2H8PB 2Q3AA 5TE7L 3N50A 4NN7B 1CLOH 2AJUH 4P2QB 2X5PA 2J5LB 3TBVB 3V6FA 1WFOA 4M7JH 5DJAB 3QUYD 2A38A 3KPNA 4L4VE 3HE7C 5CJOL 4ONHA 1A7NL 4JEGB 3RIFK 1QEWB 4EIGB 4B53A 1ZAGA 3TEUA 1HH6B 1WTGT 4JZNA 5L8JB 3ULUD 2YPLA 3CVHL 1MRDL 3LKRB 5FKPB 1OAXL 2UVFA 4DVBB 4HIJA 1JMZA 1RZ7L 2N7BA 2EEDA 3WLBA 3W39A 2YZ8A 3GKZA 5LGHL 2P8MB 4OBRA 3BSZH 2Z91B 3MV11 3U6RB 5CGMA 5KSBE 2FJFA 2N7AA 3I2CH 5E2WH 3UTSE 1CDYA 1IAIL 2DKSA 4D9RE 1IGCL 5IVZA 1QBBA 2WQ8A 3KPRD 3N85L 1JNNL 2QQKH 1DEEB 3EZJB 2EDFA 5D96B 1QR1B 4KJWC 2X4TB 5BRZB 3ARYA 4UTAL 2GK2A 1GSMA 4ZS6D 4QGTA 5FKAA 1RZ8A 4PRIE 3ROOB 4J4PA 4OI9A 2YA2A 3WFDH 2Z31B 3RWEA 1UXSB 4XP6L 1T83C 2X4PB 1I9JH 5F7MC 1HINL 5H2BB 5I2IB 3PWUA 1Q1JH 3DSFL 4LOUC 4QOKA 1FGVL 3TYGL 4NQEB 1LO5B 3LN9A 1Z5LA 5C9KA 4M43H 5INCA 1TCMA 1NMAH 4YXHH 1J0KA 1N7MH 3QIUC 4NQVA 3T0EE 3LQAH 3VWJC 1EEZA 3L3JA 4CU8A 1OAYL 2JLLA 3IDGA 4LSVL 1HILB 2G9HB 1CF8L 1Q9OA 5ICXB 5BVJA 1VDGA 3NN8B 1INEL 4I48B 2FZ3A 4OIIL 2BVQB 4B7LA 4H25A 1R3JB 4NO3A 1G7IB 2Q7YB 2AXFA 1VGKB 5CZKA 4HUVB 4ETQB 3DO7A 3VXSE 3WFEL 1DLFH 5EBLB 1HCVA 3KLDA 5HHNB 1FRGL 2KBGA 2VYRE 4L29B 1QRNB 2IPTH 3B83A 2VXTH 1GGYA 1RZJH 4LBEA 2H41A 5DK0A 2GAZA 2P24A 3UEZA 5E9DD 5HHMD 1WZKA 2BVOA 1R24B 1AGFB 3BQUA 4QRPB 5DHYB 2E6PA 1KJVB 3DGGB 3KHOA 3JUZA 3IXAB 4PJ5D 5C1MB 3MA9H 3RWJB 2VISA 1AQDA 2RIKA 3QUZB 3ARXA 3B43A 4PB9H 3WS3A 3HC0A 4ZAKB 4FQJH 2YD5A 3L5JA 3IFLH 1RZ8B 3GIZH 4N8PA 3VXRD 4ZO9A 2YKLL 3EDFA 4MXQD 5EBLA 2FEDC 3U2SA 1WFUA 4NOFA 3GNMH 4WU5A 3TN0D 3TYFB 1YMMA 4H26A 3D18A 4Z8FH 1D5XA 1BZ7B 5IUSA 3WXWL 4JPVL 1JPFA 1X5IA 3P4NB 4P4KB 3DARA 2VKXA 1NC4D 2ZG2A 5IJVB 1HCFX 4LPWA 4HEPG 4JQIL 2J8UE 4RRPG 1G9EA 4XX1G 5GGVL 3C2AH 3LB6C 4HKBA 2B4CC 4WUUE 1D9KC 4EDWL 4KTDH 2AEPL 1IAII 5DEGA 3A6BH 1FGNH 4MSWA 4PREB 1HHIA 3BH9A 5FF6A 2YK1L 4RIRB 1T2JA 4GXUN 3TN0C 5J6GA 4N0UB 2DWDA 1RQ5A 4Z9KB 1U58A 1A6PA 2JB5H 2VN4A 3UP1A 4DCQB 3FB8B 2BOBB 5DJ8B 4M6ML 3LCYA 1KTLA 1AGEB 3EOTL 4H1LH 5IVNA 4JFEB 3GUTB 5DDHB 2VITA 4NHUA 2FSEA 5C71A 4RAUA 3AXLA 1DLHA 3T0EC 2FD6L 1N5AB 1A14H 1P7HL 4W68A 5GZOD 4HXAL 4F15C 5HI4D 3NPZB 5I6XC 4EBQH 3PL6B 1UJ3B 5ESVA 2X89A 4JVWA 5C09B 5J0BA 3FFCE 4FXLA 1M6OA 4HZLB 4G7YH 1KT2B 5F7WC 2EDXA 4PLOB 3MCLH 1AO7B 2DWDB 2QEJA 1KPUB 5F3HB 4YEEA 3B9DA 2ZOKB 5T5FH 2FECL 5FM4A 3H9YA 3DMMC 3QDAA 3FN0H 3P40A 1L0XA 1HSBA 1XT5A 1U8JA 4XAWL 3MJ6A 5HGAB 3RL1A 4JRYB 2R0ZL 1NFKA 4XP5L 1NC2D 5J7CC 3QDJE 3CSYB 5C07A 1J12A 4NCC2 4JFFE 1FNSL 3HZYA 3P30H 4M1CC 4ERSH 1H15B 5D93C 5C09A 3HI5L 4EN3A 3HPLA 5ALBL 4OGAC 1Q9WA 5E8DH 1DZBA 5CINL 3RTQD 3DV4A 1T6WA 3CVHH 3LQZA 5GRZA 5MERA 2R39A 3FB8A 4OI8A 3LMJH 2XZCH 5E1AA 3V5HA 5IGXL 4K71C 4LVNB 3LKPA 3VXSA 3TH4T 3QPQD 2J88L 3HUJB 1FC2D 3IDNA 5IG7A 2AJZA 3C2SA 1HHKA 4OFPA 3C6SB 4NWUH 3QNXB 1LE5A 2XACC 1I8KB 3QXTA 4WEUD 4KJYA 3I2CL 3TBSA 1IT9H 3QEQA 4Q9RH 2X7LB 4A6YL 2LVCA 4YDKL 2ZKHH 4LVHC 4PJIB 1X5FA 4JJ5A 3JV5A 3QQ4A 2P4AB 4CBPA 3OKEA 5FFLA 1R6VA 4Z5RB 2ZUSA 4MA1B 4LNRA 4HT1L 5E7BA 5FYJD 1BQHG 4EI5C 2PUQT 4TSBH 5DMGC 5EOCL 2XG5A 2HP4A 4JKKA 3QZWA 4U1IA 3AMLA 4DKFL 3V5HB 3WFDL 1MFCH 3KR3L 4OD1L 5IW1A 2YD8A 1Q0YL 5DJCA 3QCVH 1HHKB 4DQOL 3O3DB 4Z0XA 3TYGH 1D7FA 1NCUA 7CGTA 1E27B 4YEFA 4M61B 4ZUTA 3VA2C 5GS2H 3VFRB 4UQ2A 4PJ7A 3TIEB 3DVGA 3N0PB 3VXNA 4K23L 3J7HA 1F11A 5BV7B 3GDBA 1GC1H 3HAEB 1JPSL 3MREB 3UTSA 4F80A 3UZEA 3VFGH 4RZCB 2EDBA 4PJ9C 3MPCA 1VFAB 3F8UB 2YUVA 2Q8AH 4R2GD 3CLFL 1KXTB 5HHVL 5JW4R 2IG2L 3JWOH 4JFEA 3SJVD 1VADB 1U93B 4J3WA 2BMKA 4OD3L 4U1GC 1QRND 5CMAB 4Z77A 1T2XA 3QIWC 3VRJA 5EU3A 4RDQF 2X4QA 4LGRB 2C3HA 4X6FB 5ESAA 5F89B 2OS7A 4APQB 3FQUB 1FV1B 2EC9T 2ATPB 2QSTA 3EFDL 5T1KD 2KL6A 1BFSA 2X7LA 2C3WA 3QUYB 1ED3A 2YBRA 4ZAKD 4EI5A 1CE1L 4PBWD 1G9NC 2J6EH 5DQJB 4YHOL 3BIKB 3MRNA 1UKQA 3STZB 1ZV5A 3PIQA 1I9EA 1GXEA 3MLXH 1PKQA 5DD0L 4JDVB 4HIHB 4HC1A 1HKLL 2A74B 3DVNB 3WO3B 4JKLA 3L1OL 1QLFB 3OWEA 4I18C 5KVMC 3O4LD 1AGFA 2H32A 1B6UA 3L3DB 3FO1A 4PJHB 5JXED 3FJTA 2W91A 3WKMH 5GRYA 4NNPL 1ETZA 5MEPB 2A6KA 5LWYH 3KXFB 4Z0BL 5E9DA 4NBZB 2MOVA 2FX8L 5J9PB 3V4VH 4KKLD 4WFFE 4Z7UE 2VXSL 5CJXA 2DYPD 5E4EC 4ELMA 4JFFA 3KPRE 1AJ7L 1QLRA 2C1OA 3BHBA 3WN5C 2EXWD 1CD9B 3BN9C 1MCWW 1VFOA 5AD0A 4OAWA 4HH9B 3OKDB 4U1GB 4BZ1H 1C5DA 1TJGH 3A6BL 4JZJB 4UOJA 4EN3C 3BW9B 1MHCA 1OTTC 5JTWA 3F12B 4L3EB 5EFIB 4N9GA 3E3QC 4LHUA 4BFGA 1F4HA 1U0QA 3MLTB 1WWWX 3DGCR 3O6MH 1Y6MR 4G8GD 1G1YA 1UZ6E 1P6FA 1O5DT 4X6FA 35C8L 1JN6A 4KKBC 3TLRA 4BZ2H 4MB3A 7FABH 1GGTA 1A7OL 2EXWC 2CKBL 4HCRH 4PJFA 5FO9A 1B90A 5GS0H 1EDQA 3BWAA 2FEEL 4PYGA 2D0FA 1I1AB 5IROA 4KHTH 3MJ9A 2RAMA 1NLBL 3V4UH 5D7JD 1DBBL 4OLZH 1S7UA 1MJJA 2VXQL 4U6XB 3IFOA 4DTGL 2FIKB 4XNXH 3TJHD 3O45A 5I1KH 2YS4A 1I8MA 4HS6A 3C9NA 1PG7X 4LEOB 1XF5A 2FSEB 2NLJB 4FTVE 1A6UH 4Y1AB 2MPAL 1JHLL 1IGYA 3UAJC 2GEEA 3UCRA 1WEJL 4FS0A 2HFFB 3WBDA 5FGSA 4XVJH 4GRWH 3BKMH 4KUZL 2P5WD 3VRLF 2L0DA 4ORGA 3R06B 4P9MH 1H3XA 4ZS6C 1J1PH 2VLKE 2BOCA 3HI5H 2R23B 5DZLA 5HYIA 3BRDA 5JOPE 1F4YL 4LHUG 4JFZH 4M03A 2F53D 1U93A 2GCYA 3CLEL 1QSEE 5CSZB 3NIFE 1F2XK 2AXGB 1LHZA 4ACPA 2ATKA 5C0BB 2GITA 5DJ0A 1UXWB 2MWCA 4P2RE 1XCQB 3EDDA 1DP0A 4L4TE 3VDAA 1U92B 4GG6E 4GFTB 3ZYOA 4Y4FD 4E5XB 2D7QA 3QI9D 4MA7H 1GGIL 5FYJL 1JFQH 5GPRA 5F6IC 1OAQH 1XGUA 4CUCA 5DJDA 4RGND 3QHTC 1T03L 3ES6B 1S9XA 4UT9H 4QEGA 2R1WA 4N8VG 3V8CA 4ESKA 4POUB 4GKOA 4GW5B 4P9HL 1N59B 4I3SH 5E2JA 3C5SB 5TE4L 3NAAL 3HI6L 5EOTB 2EE9A 1KG0B 4I5BB 4PJ8A 4BJLA 4U6XA 3U4EB 2DI8A 3KPSB 4YIQA 2WIIA 3HR5A 4Y4FC 2W9EL 3L3DA 5B3NA 5I17A 1RU9L 3KR3H 2FO1A 2AEWA 3UTQB 3B9KB 1C5BL 2BZDA 4EI6A 3FB5A 4N8VB 3UPRA 2GHWB 5D7JA 4Y4KB 4WRLA 5B39G 5JLZB 4FN0A 5ELIA 1G7HA 1F5WA 5GGSB 3REVA 4OZIE 4XXCC 3ZL4L 1G9MH 4XVTH 1F4WH 4LLMB 3K80A 4X4ZA 3OB0K 3SKOB 2R1XA 4Y16A 1JPTH 4X4YA 4QTIH 3CVIH 3HFMH 1NANI 2V7NB 1I85C 3KPSA 3BGAA 3GMPB 4J6RH 2FX9L 4YDVB 2IALB 3DWTA 4P23B 2AV7A 4FFZH 4M1DL 5HY9B 3SDDA 1O7VA 2WINA 4G8GE 3MBEB 3TBVA 5EUOA 4QO1A 3X14A 2UWEE 3TIEA 2OCFD 3SGEH 1QSED 1MCFA 4ZPTB 1DCLA 5BCAA 5DVKA 1X5AA 1AD0A 1GIGL 1U8HB 3KPOA 4GAGL 1CICB 2AEQL 1UQSA 2R1WB 1YJDC 1J8HA 2HVKB 4K2UL 1WIOA 4XMKL 3EYVA 2K3TA 4NN5C 5FOBB 1EGJH 1FSKB 2BNRE 5JW4Q 4LSUH 3UDWA 2J6EL 5ID1A 3INUL 2C1PA 5E5RB 3QEUB 3IAQA 1KFAL 3FRUB 1JGDA 1KLUA 4HUWA 5ADOL 1N0XH 1N0LA 5I17B 4LFHD 4M6OH 4XTRC 1I8LA 4FXGA 1R5VB 1RMFH 1A3LL 5DC0A 4DZBA 3UO1H 3WDHA 1GGCH 2DIJA 5D7SL 5E8PA 2AJSH 1WCBA 2NY3D 1ORSB 1A4JA 4YWGH 3EFFB 5HDQH 4Z95L 5MHSD 5FOBA 3MMEB 1IBGL 2D7TH 2F74A 5ICZA 1I8IA 4YGAB 4RISH 4GUPB 3P9LA 1AIFB 1B4RA 5FB8B 3S36L 4M48L 3EOYG 2V5YA 4ZYKA 5IHLB 5LXGL 4OQTL 1FBIL 1XR8B 5AZEH 3EOAB 3QJHA 1FLRH 1UCBL 3ZSSA 1I9IL 4HUXB 2D3VA 5DXWA 4EDXB 2HJKA 3HNSH 5AWNH 4ZFGH 1G7QA 1QKZH 3HG1B 5KSAD 4NKIH 5AAWA 3IKCA 3ZKND 4FQHA 3ARGC 5HYSG 1DN0A 1JI2A 3O3UN 3P4OA 1Q9OB 3IDUA 5ICXA 4ODXA 5TFSH 4U0QB 1QA9B 5KVEL 4PV8A 5J3HC 3ZDZE 5B39B 1CLYL 1ONQB 3QULA 5ISZB 1FNGB 2D0GA 4CL7A 4KK5C 4MD0B 1WBZB 1R3JA 1Z9OA 4PRBB 5K59F 2ZCLL 3ZZ1A 4RMWA 2YPKA 4ETQA 3EHBC 4Y2DB 3LKNA 3BT2L 5LGJB 2ZUYA 1ORQA 4HMDA 3KLHD 4F9PA 1RZIA 5I1KL 4KQ3L 4MQ7B 4GKSB 4N8VA 4GQPH 1MH5A 4U6VL 5IR1B 4WW2A 2KPNA 3MRCA 3IU3B 3OX8A 4DEPB 1AQKH 1BLNB 3MJGX 2EDYA 4ONHB 4GRWF 4HKXA 3TO4C 3VXQB 5DS8A 1XIWD 3BZ4A 5C9JA 1S7VB 5CGYC 3OJDB 1T0PB 3OXRA 4LMQE 4IDJH 2X4SA 5T1KB 3TA3D 5E6IA 3WL9B 4ALAH 4AMKL 1J1PL 1QSFE 2E6QA 3ZDXF 2BNQE 4PJIF 4KRPC 4OJFL 2GJJA 3BPNB 3P4MA 3WD5H 1U3HC 4R97B 4JFZL 3BN3B 1X4YA 1ZLUK 4U7KA 3EIFA 3QO0B 2DJ4A 5K9JL 5J6HA 4XP4L 4FNLL 3GIVA 3DMMA 3GMLB 3O4LE 5DJ2A 1SJXA 2H32H 5GRJH 4PLKD 15C8H 4IJ3C 4PRPB 1BIHA 3MLZL 3UJJL 3MRLB 4M02A 1QA9A 5DRXA 4XP1L 3KPLB 3SE3A 1V5JA 4HKJA 2R15A 4NO2B 5DQ9A 5GRVK 1XEDA 2V2WA 1YNKH 1K5NA 1EA9C 5MENA 3LN5A 1Z9LA 5DSCA 4RX4D 3OPZH 3I3DA 1AD9A 5HYJA 1CD8A 1DDHA 1W72B 4PIRF 4HWUA 1ZLWK 4NQEA 2PCPB 2PR4L 3SEPA 1MFDL 2ITDA 1RU9H 1DLHB 2NZ9D 4G9FB 2OTWB 3W5NA 2FJGA 3RU8H 3VI3F 3STLB 1ZGLM 3L3IB 2FLRT 1NAKH 4IS6B 4ZD3H 1RUQL 2N1KA 4MX7A 1ODAA 3H3PL 2C7UB 3O2WH 1B9ZA 4H1LG 4KZDL 5LKNA 1T1XA 4HWEH 4HCRA 3MRKB 3AAZA 3H9SD 4O51A 3OJMB 2IANE 3ARZA 1CR9L 2OJEB 3RFZC 4YHML 2QBWA 1U8OB 4I9WD 3IFPA 4O00A 1W72A 3VGFA 3AREA 3QO1B 5J11C 3BEWB 5E99H 3MRRB 4LAJH 1P5VA 2CDGB 1WAAE 4L4VA 2FX9H 5L6YH 2DD8L 4NQCD 1NBQA 3JVGA 1S9VA 1T04A 4FFZL 4OCYL 4QRSB 5FECA 5KAQG 2G60L 3MQIA 1QTYT 4JN2B 2C3VA 1RHHB 3QUZA 2R8SH 3BFOA 1T1XB 4H88L 4G8IB 3ZE1E 4U33A 4JPKH 2UZIL 4DK6A 1YEJH 1YPZA 2H6PA 2ENYA 1QYGL 4XRCA 4U7SA 3FO2B 1JF1A 1MRFH 3UZVB 1TFHA 3VXMD 3HS0A 5C0FA 3NFNA 1J7VR 5MERB 5EZLB 3BEVB 2W0FB 3Q1SH 3UTSD 3MODH 5INCB 3CFDB 4F9LC 1NCCL 4WW2B 3DX9B 3W0WB 1J10A 1NGPH 2IFGA 3BKYL 1VACA 3VGBA 3LDBC 1XGQB 4M6OL 1FFPB 1PG7W 3MV8D 4LRNL 3E2HB 4PJBA 1EJOL 1RZKC 2AXJA 3VGEA 3I6LE 4YE4H 2PXYB 1YEKL 2W60B 3C09C 1AHWA 4Q2ZB 2AVGA 2W65B 3C6LC 3D39D 5ITFA 5I1IH 4J2XA 3G04A 2ED7A 2R2HA 5DEGB 5BS0D 3FQNB 3ABZA 1TJHL 1W0VA 3DUSB 1F13A 5I8EB 1B2WH 4PJGF 5IBUB 5IP4A 3EJJX 1X5GA 1G6RA 2DM3A 2K7QA 2NMSA 4DW2L 4HJJL 3PWNA 4OFYA 3PNWA 1KCRL 1OWRM 3O9WB 5LXGH 5CP7A 3QHZH 4XXDA 2BHZA 2X42A 1OCWL 5CHNA 3MTRA 3VDBA 2XZAL 4HF5H 1M7XA 4P48A 4LLUB 4ZUSA 5JPNA 3WS3B 4ZFZA 1KJMA 2Z35A 3P11H 4DAGL 3QXUA 1U6AL 3JUYA 3SO3C 3CMOL 1KCKA 1X5XA 4JR9H 3KWWA 4U1MA 2X1PA 2HRLA 2B7DT 4KI5F 3TNNA 3BD4A 5AEAA 4MWFB 3TT3H 3RA7L 4U3CA 5TQ0L 5JOEA 5T3ZL 2V7HB 4G7VL 4QWWC 2P5EA 2Z31D 4D0BB 3BEVA 4NQDB 3BT2H 4HW6A 3NMEA 3QG7L 4NJAH 4KRNA 5JHDA 2B2XH 5E95B 2GFBB 1W8OA 4N5ED 1R3LA 3ZMRA 4WUUB 2O5YL 4M62H 4AG4L 4QHLA 3MYJA 2P42B 3QI9A 1WBZA 1IC4H 3VXRE 3U4BH 1CFBA 1DVFA 4EOWH 4Z7OE 2MHAB 1TMCB 2R4RH 2DIAA 2GK0B 1Y18A 3MJ7B 3NACL 1T89A 4R4ND 1S7XA 2VIRA 3H0TA 3ZHLA 1NBYB 2ZCKL 2MKLC 1NGQH 3BIAX 3BYTA 5F6HJ 3JTSB 4IDJL 1S7RA 3NZ8B 1U8OA 3EYOB 1CIDA 3HAEH 4E0RB 4D0BA 1UG9A 4KZEH 1SBSL 1MUJA 3WEXB 5DD6B 5LQBH 2I24N 4M7LH 3EOBA 5TE6H 1LO0L 1G1CA 4OLWL 3VG0L 4EUPB 2GW5A 4PJXE 1SM3H 3QDGB 4LK4A 1DQQB 4PY7A 4WJ5A 4ZTOL 5E9DB 2OX5A 1KTDB 4GQ9H 1A9EB 4J8RA 1M7IB 1G9MC 1S7VA 3AU1A 5L2KA 4QCIA 3V0WH 2GT9A 1QR1A 5F1NA 5FKAB 3MLZH 5TDOA 4U2YA 1ZHLA 4Z78A 5J6GB 4XP1H 3FCTA 4G6KH 2WP3O 2P5WA 4P5TC 4C55A 2PXYC 5JOFA 4X8JA 2DQTL 1YZZA 4RDQG 4FQXB 1P7QA 3WIFA 4NWTH 1E4XL 4FG6C 4KMQA 4D8PA 1R24A 5H35A 5FDWB 2BHYA 1WC7A 4O58H 4Z0XB 1AHWC 3D25A 4JDTL 4JO1H 2OTPA 1AFVH 4Q9QL 5EZOH 4AEHL 1A1OA 2VQ1A 4L9DA 1C8PA 1F2QA 2FL5B 3VGGA 2MFNA 2BNQA 4G6MH 2P49B 1N6UA 3U79A 4HMCA 4AEFA 3L5WA 3TF7C 2A9NH 4HWEL 5JOFB 4FG6D 1IFHH 3LPWA 3TYFA 4JRYE 5B8CA 3QEQE 4JQXA 2MSPA 5F6HI 3PJSA 5ISZD 1FL3A 5SWSA 1MHPH 1CGXA 2PETA 1UADC 4PGZA 4X6CB 2CDEA 3NZHL 2IAMD 4XNQB 1LILA 4MGXA 1JMXA 4MZ2A 3EYSL 1B3JA 3KYOB 3OAUH 4G5ZH 3W0WE 1KJVA 2AJVH 2P8PB 3DGGA 4FXKA 4LU5L 5DMGD 5C3LD 1RV6X 4ZXBB 4K3DL 5C09E 3LAFA 5MENE 4O5LH 3DV6B 1FNEB 2EIDA 1HXMA 5TF1H 5JDJA 1ZE3C 1KV3A 4JFHE 3D1MC 3TWCL 2DRUA 4K7PY 5A2LH 3MLUL 2LAGB 2J12B 4P3DA 4UNVA 1U41A 1RUPL 1MHEB 2R8SL 1MJ8H 5D72H 3IT8D 2I60L 5EO9B 5B8CB 1CQKA 5JIKA 2RBLA 3F7RA 3W5MA 4POZD 1WISA 5FHBH 4IM8A 5ENWB 5FDWA 3MRPA 5E56A 4JFQB 2JK5B 4XNYL 3GJFK 2B1HH 1A1OB 3DECA 4QHMB 5I8CB 1JGVH 3RQ3A 5IHUL 4DKEL 4OB5H 1WBXB 4AQOA 1J05B 1FFNB 1MCIA 2B0SH 4L9LC 1BX2B 4LDLB 3I02B 3UTPE 3Q3GA 3MNZA 4GMSL 3EJZD 2OTUA 3HNTL 4X4ME 3EHBD 1LEKB 4R0LB 3K74B 4ODWB 4O4YL 4NPYB 4HIEB 2RCSH 4JM2F 3GBLA 4P2QE 5DD6A 5FO8A 5IMKB 1KTLB 3PV7A 1LK2A 5DJAA 4IRJA 2GJZB 5HXMA 2BXZA 4DW2H 5DHYA 3MLWH 4XNQA 1MIEL 2Y6SC 4XNMA 3WV0A 4JY5H 1UC6A 4MHHI 2J7LA 1YEGL 2E7MA 3KJ6L 4QHMA 2ADGB 4HQQH 2X1OA 3ARWA 3GSQB 4DOHE 2CR3A 3W81A 2VTFA 5KJRH 2AK4E 3V79C 4KY1H 1MLCB 4IOIB 1G7IA 4X9HA 4LLWB 5JXEC 4YHPA 4OCMC 1IAIM 4X4YB 3QRGH 4NO0A 3L3OA 1T1ZB 1U3HA 4ZPVA 3A67H 3FKUS 2JF1A 1XF2B 5K33A 1V7MH 2FBJL 3D5OF 1FG9C 3WJLC 1TIUA 1H3VA 5ID0B 1IILE 2ZNWA 1I8KA 4U1JB 3RNKB 4MJ6A 1I9RH 3GGWB 4O2EA 5AAMA 4A6YA 4K9EL 2DL9A 3KPTA 3DOSA 5J89A 3EGSB 2R4SL 3GKWL 1S9KC 4M6AA 3HC4H 4MSWB 3O8XC 4GRWE 1EAPA 4U1MB 3F65A 4DN3H 3B4NA 1S7TB 1KXQE 5M95B 4KI5E 5E8EA 3IXTB 5IF0B 2JIXA 3Q6FA 3QCUH 4I0PD 2AEPH 2WLYA 1FIEA 3SE4C 2EYRA 5EO0B 2OK0H 1BJ8A 2VDPL 3MACH 3HI1B 4O9HL 4QYOA 4W4NA 3S6CA 3EDEA 5FYKH 4XC3H 3MRHA 3U7WL 1E27A 3K8LA 4YAQA 1KYOJ 1HZHH 2ADIB 3QUXC 4MCZB 3RVVD 3BISA 4Z7UA 5DJYB 1RIVH 2Y07H 3IDYC 3EJYD 1HNFA 1LP9F 2FD6H 3SO5A 2EC8A 2BP3A 3S3PA 4WFGD 4ZTOH 4D0CB 1KT2A 1NGZB 1VEPA 4LHQB 4D2NA 3MJ7A 4GQ9L 4M7KH 1VGKA 3B6SB 3A6CL 1QBLH 2D4DA 4JFHD 1MLCA 1ZLVH 4GRMB 1A0QH 3UAJD 5C08E 2BY0A 5FGCE 3L95B 4P46D 1RK0A 3UYRL 1JGUL 1LGVA 2F5BL 3UJIL 1KG0A 4I5BA 1YMHA 2JJTC 5I18H 1KEML 2BVOB 4QGYA 4M7LT 4ZFOA 2Q8BL 1KIQB 2FX7H 2HG5B 4UU9B 4O58L 2V5MA 4HX1B 2WP3T 2EICA 1NMBH 1CD0A 3LQAC 1KJ2H 5JXAH 1WBXA 2NY6B 4ZG1A 5D7LD 1CE6A 3QISA 3B6SA 3MJ8A 3QUMH 1IE5A 1QFUL 4JHAL 5DR5H 3S4SG 3D2UD 2R1XB 2PO6D 4IRJC 3W39B 4KJWD 4QOKE 3PDOB 2B5IC 1IKFL 5E8DL 4HUUA 4WFFD 3U0WL 4Y4KC 3GSNB 3LKNB 5JO5A 4J3XA 4N1CA 4QYOB 1F3JA 1MHPL 2C5DC 3MV7B 3U9UA 1PEWA 1FZOA 2YPLE 2ADIA 2D9QB 3H8NA 5BMFH 1CXFA 3CXHK 1LO2L 1QQDB 1WWCA 4ZXBD 4WI5A 3VXUA 2CH8A 5BQ7A 3WNKA 2X9XA 2AJVL 1IAIH 2XXMB 3MRGB 4ZPTA 5IV2B 4C56E 1BFVL 1AXIB 3X17A 4IIQA 2QADD 3RDTA 2A0LC 3WIIH 1T21B 3NTCH 4PJCE 3TZVD 3ARFD 1KLGA 2W1NA 3IJSB 3T77B 5I1JL 4K7FB 4HT1H 4QTHB 3TV3H 3KYMB 5L2JB 1FO0B 5EOCH 2WLZA 5EU6B 1BFOA 2WUBH 5IEHA 1OW0A 1CICD 2PN5A 1FORL 1Q1JL 4JY6A 3MOAH 4LRIC 3KXFA 1I3GH 4WW1B 4G43B 3DXAD 3O3AA 3CZJA 2I9TA 1Z3GH 1I85A 1KBGH 4V1DE 3SN6N 4L4VD 4PJ7F 1OAYH 3GSVA 4MD5A 4PV9B 4LDEB 2EEBA 3VCLA 2CLVA 2CLRB 1N4XL 3OKDA 5IQ9B 1P2CB 4JANB 2V7NA 4PBVC 4K23H 2DLHA 2Q6WB 3ET9F 1TETL 3JTTB 4TSCL 4XCEB 1ZANH 1FIGH 4WW2F 3ISWA 2BX5A 4NKDB 3VRJB 4AL8L 1EBAA 3VW3H 5F7LB 2RCSL 2A73B 1FV1A 3JWOL 2ED8A 1FE8H 3L7EB 1OLZA 1BMGA 4HJGA 2XFXA 5EPMA 2BSRB 3JV6B 3LKQB 1R3HA 3KGRA 5BZWB 4UQ2B 2VRAA 4NKMB 5EC2A 2A83B 2B4CH 5HYSB 3CNKA 4NQCE 2Q1EA 1S5HA 1W0WA 5J56B 1CK0H 4MHHG 5KZCD 4XTRD 5KVDH 2BNUA 3MUGB 5DK2B 1KPVA 2WBJC 4NUGL 4OZFB 3CK0L 3W9EA 3QRGL 1I7UB 2IQAA 4NZDA 1FCCA 1ORQB 4ZUVB 3KVQA 1J11A 1UZ8A 1YEFH 2DQGH 2IALA 4U0RC 5MI0B 4D9LH 1V7ML 4MQ7A 3THMH 4DZBB 2AV1B 4FZ8L 3B5TA 2ZOLA 1QRKA 2AI0L 1KB9K 3HPJA 4GLRH 5TQ2L 2O26U 1QFWI 2UUDH 3WKML 5HHXL 4DGIL 1RFDL 1ED3B 3MRDB 3O41A 3FHQA 3GJEA 2BFVL 3CSGA 1UWXH 3HB3C 4HSQA 4AEIH 3HR6A 2VLKB 5HGBA 4JREB 4OZHA 4P5TD 5FUZH 4YIQB 1SMAA 3EO0B 1Q8MA 1OGAE 1QPXA 1UZ8B 3QCUL 1QSFB 3CFBB 3VXSD 3KJ4B 2VAJA 4JCMA 2N4IA 4PS4L 3SO3B 1BP3B 2MCPH 4JFOB 1DVFC 1IAKB 3MACL 3RTQA 4BQCA 1RZFL 3GSUB 3T0XA 3VXTA 2IQ9L 4GKZA 1XR9A 1PLGL 3OR7B 4KDTC 4OD2A 1LDPH 1OAKL 4EQ2A 4OCLC 3Q6GH 4F3FA 1ZHNB 4LSRH 2HH0L 1H3GA 1A7BA 5E08H 1J8KA 1OF2B 1A3QA 4XBEH 3GMOA 5EBWB 3MFFB 2YRLA 2W59A 5I15L 1NDMB 3ES6A 7FABL 4ONOA 5EC1A 4L8SA 4LVNC 4HAGA 5C7XH 3U36B 3RPIA 1OLLA 2WQRA 5DRNA 1LVEA 1VKXB 3L3HB 2H3NB 1W0VB 3PABA 2VLRB 4XNUH 1RZ7H 2IBZX 4PJEE 3VI4F 1JRHH 3OKOA 4P2CG 3RTQC 3HE7A 3N85H 4P4KC 2NR6C 4P5MB 3QSKB 3T4AB 4XNXL 3N1GC 1WCQA 2NX5A 2VLRE 1I75A 3QNYB 3BPCB 1OVZA 2MPAH 2VUYA 3HRPA 1GL4B 3BP4A 3E6FB 3SDAC 4NT6B 3BIBX 3P30L 3TN0B 3QULB 1J5OH 2PTTB 1XGPB 5IBUG 4N0CD 4ERSL 4S2SA 5IKCB 3BKML 1HN1A 5D4QA 2GJ6E 5E1AB 5KSVA 3KPMB 5ALBH 2QQNL 2XTJE 3C08L 1VCAA 3GMMB 3ZYZA 4MA8L 1I8MB 3OGOE 4EI5D 1KCVL 4MJIB 3RWFA 4PLKC 1UGNA 4JKPH 4KHXL 3LEYL 1HK6A 5JPMB 4MS8C 1OB1A 4BH8A 4FABL 3ZKXC 1SHMA 3JV6A 4I18A 4I0CC 2OM5A 4GKZB 4M5YH 4MNQB 3QIBB 1ZT1B 3OR6B 3MCG1 4OZ4A 3FQWB 1BAFH 3JV4A 5K9QI 2BCKB 3NGBC 4B7IA 2O61B 3MCKA 3DHJA 1ZLWH 4PR5B 1NEZA 4NQEE 4JQVC 2LFGA 4M3JA 4G8IA 5SX4H 1SY6L 3GSXB 1WIPA 1MCHA 4MB5A 3NTCL 4LSQH 3WFEH 1L0QA 4E0RA 3HCVA 3FRUA 3MNVA 1MI5A 1UVQB 4S10A 1OPGL 3QZWG 2A6JB 2MMXA 1FZJA 3RWCA 4BFIB 2W9LA 3HPJB 5INDA 4MNQA 5C0AD 1LE9A 4I77H 4PGBB 5TDPB 2I5YL 3GSNL 3SQBA 2C7UA 3UTSB 1I7RA 4PLNC 25C8H 1IKNA 2HJLA 1GVIA 1BGXL 1CFQA 4HLJA 1FL6B 1P1ZB 3SKJL 1CZ8H 4HIXH 3GJFA 4MJIE 5EOTA 5ACMA 1N4XH 3KPMA 3FO9B 2Y5TB 3T09A 5IEHB 2ZG3A 2LTQB 1JPTL 4WFHD 3OB0H 1TETH 4WHYH 1I1RA 1AD9B 2Q8AL 3T8XA 3TA3A 4DN4H 5HYJB 2HLFC 2YD3A 2FJFB 5A1AA 1QFHA 4JPVH 2HFGL 3VDCA 1P4LA 3UPRB 2BVYA 4Y2OA 3T3ME 4OIAA 3D3VD 1FE8L 5IMLA 4HV8B 1A1NB 3WIHH 5SV4A 1U95A 4UQ3A 5DQJA 2MCG1 4XWOC 2FH6A 2E8ZA 3BAEH 3VXMA 4L4JA 4YQXL 3EFDH 2WMPA 1FZKA 4B0MM 5I1CL 4GRWB 2VH5L 4P5KA 4G80B 1KJ2A 1QHOA 4I9WE 4I3GA 3TJEL 4K9EC 1NUGA 3BN9D 1T1WB 4HXAH 3PWVA 4U1LA 3T4AA 1WFTA 3ALXA 3DX9A 3LVEA 4LGSB 1QUNA 4EBQL 3S4SB 3GBNL 4EN3D 1H5BC 1PJ9A 4LKCA 3T0VA 4JPIA 1KTKE 4JGJA 4XMPL 4OCRH 4X5WB 5AYUH 3UMTA 2GY7B 3WUZA 3OJ2C 3O6KL 5LWYL 4Y88A 2I9LB 5HHOD 1W0WB 2HKHH 3B2VL 12E8H 2EZ0C 3CPLB 2R2EA 4N1EA 4NYLB 4L4TB 1K9TA 1YPZB 4TOYH 5GRWA 3BUYB 4P46C 5KS9E 3HC3L 1WBYB 4ODTL 4M5ZL 2G2RA 4WCYH 3JTSA 4YBLC 2GJ6D 5B8CC 1MCDA 5D7JC 5CBEB 3AY4C 3MRBA 4RISL 4KPHH 3IU4L 3MA7B 1NC2A 4GBXD 1YY8B 1DEDA 1ITCA 4RMTA 3OKNB 3VFMB 5HD8D 3CZFB 1M71A 2UYLB 4ZFFA 3GSRA 5E8PB 1FLRL 1IC5H 3WS6A 5AWNL 4ZFGL 4JE4B 4XMLL 4KUCD 2W60A 4PRBA 3ORJA 2CKBH 4HCRL 2XZCL 5GJTH 5IGXH 2BSED 4UAOB 5F1NB 4Y1AE 3FN9A 5CCKL 3BUYA 2ZG1A 5CJBA 1RUKH 3PWUB 4QHKJ 3U0PA 1HSAB 4P4RB 3TPKA 3RVXC 1U91A 1VERA 3T2OA 4KK8C 3ZE2F 3Q5YA 4P2OC 3ZLQC 1JK8B 1MCOL 1NCDH 3SGDH 3GSUA 4HUXA 2YN3A 3QXAA 4R4NC 5DWUL 2FHCA 5FGCB 2FH8A 5DS8B 5ABDE 1LO4L 3L3IA 5B4MD 4YDKH 3TESA 1UM5H 4ONFL 3OXSA 4OCXH 5D9SA 1RZJC 2ZJSL 4N0UE 2MHAA 3RGVB 2BNQB 4OZFH 4XRCB 2CIIB 4KUZH 2XNAA 1QVOA 4MXVE 4RMVA 5C0CB 4X9IA 5F9OL 1NBZB 5ICYB 3HE6B 3LKOB 1FVCB 3G6DL 2ERJC 4N9OB 3M8OH 3BEWA 3DVIA 3PV6A 2K9UA 1Q0YH 43C9B 5IBLD 3DBXA 3WJLA 1HH9B 2KZWA 4XH2A 2CRIA 1N5AA 4D9QD 4JKPL 1FL5A 3X12A 5JHDB 4PJBB 3LEYH 4PB0L 1JPSH 3ARFA 3UTTE 3O0RL 5L7XL 3VH8B 4FABH 3KPQB 4OZGA 5FA4A 2QKIA 1JFQL 4FNLH 5C9JB 5FEBA 1ZLSH 3QJFA 2XZZA 5DGQA 5GRJL 4TUJB 3RVTC 1T03H 4LVOC 3ECBB 4ZQKB 4JRWA 3NIDF 1QSEA 3G5ZB 5FM8A 3I3BA 4WIQA 4LLYB 4GW4B 3B5HA 1C1EL 5F8RC 4G9DB 2V2XA 1OGAD 4PJCB 3F58L 1BQUA 4LAQH 4G9FA 3SGEI 5HGHB 3QIUB 5JLZA 2W9EH 1OPGH 3BKCL 4XPAH 3GIVB 4OZGB 4PJAF 3UROR 1A3RL 3K2MC 1MAML 4EZMA 3FOMB 3MLXL 1F3DH 4PRHE 5AZ2L 4YHLH 1I8LC 2Z8RA 3PDDA 5AG8A 3ULVC 3H9SA 1LMKA 25C8L 4N68A 1F4WL 2P5WE 1S7SB 4JKWA 4AZ8A 3SGJC 1D5MA 4Z0BH 3QDGE 3E6HA 2D31A 3CC5A 2DM2A 4RBPH 4YDLB 3KS0H 3V6OC 2VXSH 3KYOA 3EYFB 4KFZC 3HUJA 5FCUL 3RDTC 3QIUA 1R3LB 4GAJL 8CGTA 4PJHF 1HILA 1EO7A 1V3KA 3TO4B 4FFVD 3QT2A 1CFSB 3STLA 1XGRB 5EU4B 3BPOC 3ULVD 1TJGL 4KVCL 5F9WC 2V17H 1C08A 3OJDA 3PHOB 5F1IB 2F53B 5EH1A 3MR9A 5DURB 4P2RA 1IEHA 3BAEL 1JF1B 2NY3C 5I1CH 5BXFB 3T0WA 1U91B 4RQQA 4OCSL 5LAXA 4XMKH 2UZIH 5CKAA 3I84A 3RL1B 1U36A 2OZ4H 2DQFA 3P0GB 2E7HA 1GHFL 2IH3B 3BOVA 4PGEA 1FFQA 2YD2A 3MRPB 5F9DC 4JVUA 4JG1L 4FQXD 1CLZL 1YEDB 2YN5A 2VLLA 2B1AH 5FECB 1KB5H 1RJCA 4YX2L 3MGOA 5F7YC 4I2XE 3EFFA 1INDH 1U95B 2X09A 3ARUA 5DUPL 2XKUA 5BVJB 1A7OH 5AYUL 4XHJD 4LIQH 3E8UL 1KLFA 2XQBH 4P5KB 1Y6KR 5KSAC 1AGDB 3OV6A 1CXEA 4HLZH 1MRCH 5E6ID 3HG1D 4NQED 3MV9E 3V4UL 1W0YT 3LIZH 1ZOXA 2RR3A 2VXQH 3ZT5A 5CJ5A 5IF0A 5SX5K 1BVKA 2R9HD 4PGCA 4DVRL 1M7DB 2D7TL 4L8DA 4QTHA 3UYPA 4HUMB 4G8FA 1KB9J 3MBEC 3KYKL 2V9RA 3MLRL 1IM3A 4M48H 1UYWH 1F97A 5DVLA 4TVPL 2ESVD 2JJSA 4X5WA 5CEXA 1B6DA 4LCUA 5HVFB 3U46B 4LLUA 4ODBD 5JPNB 1N3NB 5C70A 4MNHB 3O6FD 1O0VA 4FQIL 4MLSA 5TH2A 5B38G 3KPSE 1UJ3C 3PL6C 3AU1B 1UENA 2EH7L 3MZTA 1IC5L 3FFDA 4HWNA 3QZWB 2BY3A 5IQ9A 3P11L 4DAGH 1CLYH 1UACH 3AREB 3QO1A 5CSBA 5JZ7D 1HI6A 4Y19B 1Z9MA 5J1AA 4X8JB 1D5XB 4P2QD 3VU2A 3CLEH 3MA7A 2NY7H 2ZCLH 3PGDB 1QO3A 2XWJB 1NGXB 4GLRI 5E5MA 1ZGLB 3NIFF 1J9CT 4Z6AT 1TJIL 3O9WC 2PYFB 5FO7B 4K8RC 2WBJA 1R3IH 4ODHL 3ULVF 2O5XL 5DMKA 1E6JH 4YHYB 5TE4H 2APXA 3WL9A 3BO8B 4YHYC 3VXOA 4JHWH 5AD0B 5JZ7C 2D2OA 3D3VE 2O5YH 3FHAA 1BM3L 4PD4K 2ZJSH 1T7WA 1UEYA 5IW6B 3NFNB 5IQ7L 4HKZB 2CKBB 4L5FL 4UNTA 4PJXB 3WEXA 1KPVB 4LBEB 4WUKH 3ZE1F 1AGEA 2NY0C 1XF2A 3MRMB 3EYFA 3BQUB 2CDEB 4K8RD 4Z7NE 3CDGB 4JCLA 5JDSA 2JK5A 3G6DH 4JG0H 5J12B 1H15A 4A6YB 1YUHB 3ZDYE 3IDIB 5BQ7B 4OFKA 3FOLA 4OLWH 5GGUA 2FZ3B 3VG0H 1J05A 3LRHA 2GUOA 4XCFL 3BZFB 3ZL4H 1A5FH 3WUWG 4HWZA 4XVTL 3IF1B 4OZIF 2CMRH 3S5LB 1FO0H 2JJVA 5DQ9B 1KEGL 3U2SB 4P3DB 3WNLA 1KC5H 1ZHBB 4QTIL 2VDML 2X1WL 1FYTA 4J1UA 3WIFB 5DVMA 2ZUUA 4PJEF 5CMAA 3S96B 1H5BA 4JO2H 5IMMB 4LOUD 3HMWH 5GHWH 5A43C 1C1EH 3RP1A 1N5YL 1GCFA 1A47A 3QIUD 1IGYB 1F90L 3MLYL 2PYEE 3VGHA 1AXSA 1GAFL 5HJ3A 4YGVA 5DD1L 2FHBA 4ZOEA 2YUZA 1AR2A 3LS5H 4LSUL 1CGVA 5HHQB 3LSOB 3BKCH 5EA0L 1AFVL 3ROOA 4J7RA 5I75C 5E94A 4F2MA 3SOBL 3QCTH 3U4AA 2NY0B 1GGBL 3H3PH 3QXDA 5LJYH 5F9JB 5I8OL 5FYKU 3INUH 3TM6A 2JTDA 3F7VA 3GRWA 4PGDB 1D6EA 2YUXA 3QPXL 3V5KA 1IFHL 1U8IA 4YHMH 3MUHL 1MSPA 2XY2A 1HHGB 5C2BL 3D25B 1ZGLP 1QPPA 5EN2B 3MGTB 1O7SA 2CRZA 2APWA 2J5LC 4GAJH 1T7XA 1HXMB 3D0LB 3IDIA 4JHBA 3GSQA 3MBXH 2EZ0D 1CE6B 4GG8A 4ENED 2QSVA 3SDXB 3TT1H 2G60H 2YRPA 1GPOH 1UJTA 2YPVL 5GGTA 1JF6A 1S7SA 5C0AA 3SY0B 3O45B 3DETC 3T0DA 1OARH 4MVBC 3F7VB 5HPMB 3GZKA 2R0KH 3WMSA 2FEDD 4PJFE 3GI8L 4N9GB 3WLWD 5BZDB 1KIRA 4OCNC 4YC2B 2AS5M 1CXIA 4YFEA 4NKIL 4S0SD 3V5KB 4P46B 3DNKA 2Z4QA 1UH3A 5GS1B 1LNUA 2NY1B 3RVUD 4JY6B 4U1NB 1U8LA 5AZEL 3RZCD 2YSSB 3I75B 5JPMA 5D6DA 1A9EA 1P4BH 2CDFA 4JG1H 3VXUD 4H8WH 4ZXBA 1QKZL 2B1AL 4HWBA 3T65A 3DVGB 1A2YA 1RZKH 4GSDL 4WV1B 1EVTC 3AUVA 3FTGB 1FFNA 3T08A 1JWMB 1S7WA 1X5YA 3BMVA 3OQ3B 3LHPL 3RDTB 4YE4L 4GBXA 4NQCA 3QIBC 3I50L 1FC1A 5D1QA 3MLVH 5T3ZD 1PBYA 2GITB 4R96B 1PG7H 1JPFB 2AP2A 3SDCC 3K7UA 3U9PH 4N0YL 1IQWH 2A1WH 2VN7A 3GMRB 4MCZA 4IRSA 3FOLB 1A9BA 3WFCL 3O6FB 5CWSA 3MJ8B 2WM0A 3TIDA 3ZKQD 5F1KC 4OJFH 1PZ5A 1S5HB 4IOIA 5EBWA 3KLSA 1NAML 1YJDL 1FH5H 5H2BA 4MJ5A 4BSJA 4JAMA 4RFEB 1WAAA 3NA9L 1MI5E 2EXYC 1XF3A 1NGYA 1BECA 1I3RB 1M7DA 4JR9L 2UZXB 2VITB 4XVSL 5DGRA 4X98A 3NCFB 4F57L 3H9SE 3BDBA 4KXZH 1KIQA 4IRSB 5E6ZA 1UM6L 1H8NA 1WWBX 5EU6D 5FO9B 4YGVB 4O2CA 1IRAY 5K9JH 4P99A 4KAQH 4S1SH 5E4EB 1L7TH 4TUOA 5EWIL 5IV2A 4NJAL 4CADA 2HJFB 3KDMA 3QQ9C 1C5CL 1E4WL 3QUXB 3BDYH 4U1KB 3EYUH 2X05A 3AM8C 1YNKL 3EYQC 3ILQD 1RJLA 5TE7H 1YQVH 1G7JB 5JMOC 4FMFA 4Y19E 3RI5K 3O4LB 3HC4L 3BZEB 3FRPA 3LDBB 3MO1B 5L8LB 5EOQL 5EU7E 5D7KD 1FYTD 3OKKB 4JFDA 2X4QB 2XWJA 5LCVH 4ZUVA 1K2DB 3ARTA 1BF8A 3MXVH 4HZAA 2CJUL 5SWQB 1ZWIB 4KZEL 2PXYD 4WWKC 1LO3H 3FZUC 1MFDH 3IDXH 4O9HH 3ARDC 5T3ZE 4I13B 4YC2C 3T2QA 3K46A 1OHQA 5I1LA 1NUFA 1FNAA 4KJPD 3KPOB 4NC0B 3P4OB 3FQXA 5BVPL 1JPGA 2NR6D 1RJYB 3RPIB 2JCCA 3ULUH 1CD1A 3MXWH 1MCSA 3VD4A 4L4TA 2CKBA 5C6TH 5DT1H 2YZ1A 1U8QB 1I3RA 3TPUA 4DUVA 3RAJH 5GISH 1ZXQA 1VFBA 4OLUL 4Y5YB 2A73A 1HOCB 1U92A 1P7KA 5C0IA 3ZSTA 1IGCH 4MAYC 1R5VA 3CDYA 1EPFA 3MYZA 1MCJA 2ZNXA 3BPCA 5SWZB 2J2ZA 3IVKA 3FL7A 3Q48A 3NFPA 1ZLVK 2FO4A 4CRPA 1FLTX 4JDTH 3FQRA 3QG6B 4XNZC 4XP6H 1OP5K 3S5LA 2BSTA 4R7DB 2AQ3A 3RNQB 3LS5L 1T0MA 4PGJA 5MHSE 3VFSA 4PJDA 1IGFH 3PDOA 3QDMB 4J1UB 2ENSA 5A40E 4MA3B 4OZFA 4RFOL 1AH1A 2D03L 4KDWA 1XZ0B 4Y8AA 4MAYD 1HHHB 1A6WH 5H94B 4YK4B 4QHUB 3RVWD 2V2TA 2DLFL 4YXLL 1TTGA 4GG6B 1GRWA 3L5XL 4LSVH 4AH2A 5HYJE 1NCCH 4Y19D 1TPXC 3VXRA 1J0IA 4I18B 3U0WH 4PJ7B 3QNZB 5IB4B 4JQXC 5C2BH 1TDQA 1UH4A 4TNWK 4LRNH 1OAZL 3H9ZA 1LD9A 1GZQA 1MVUB 1YEKH 3G9AB 4JAMB 4RFEA 1PY4A 1L9MA 2BY1A 5HVHC 4HJJH 3AB0B 1MCPH 1SJVA 4XPTH 1RZGA 1REIA 3TT1L 1GPOL 1A7RL 1I8IB 2XPGB 4FQQA 2X6MA 4QHUA 5EFIA 1SEQH 4R3SB 1F58L 5IHZB 4Z7VB 5B3JF 4X7CC 1HYRC 4GO6B 5KTEH 1A21A 3SDDC 3PGFL 1SYVA 4RCAA 1EMTH 5E7FA 4FTVA 2IPKB 3O3AB 4NZTH 5BJTA 4PB9L 4Y4KA 2A6IA 1JUFB 1NLDL 2BNRB 1DN0B 2FO4B 5AUMB 2DIBA 4KKLC 2YKLH 1S78D 1JV5A 2R29L 2C9AA 1NCBL 3EYVB 4OQ1A 4GSDH 2R2EB 4LHJB 1EHLH 2FIRT 3G6AB 4S11A 3K2UL 2NW3A 3X3GH 1C12B 5FYLL 1QBML 3IJSA 2ZSVB 3V7MA 4WO4B 5T1LB 3BP7A 2Z4QB 5GS1A 4PJFF 3T8XB 1FO0A 4ZFOB 5IM7A 4L8BA 3SE3C 1MCKA 2V5SA 3ULSB 4XT1C 3BE1L 4LKXA 5BZWA 1YN6A 3UBXI 1JF5A 1S78C 2PO6A 5J12C 2IF7A 5H37G 1MIEH 3AS1A 1FYHB 9CGTA 1T66D 1JV5B 1PX3A 3IDJA 4MQXD 5DMJB 3WFCH 2Q20A 4ZSOE 2Q87A 2PTVA 3T4YB 3B3IA 3ILPA 1FFRA 1T1ZA 2YUWA 4PRIB 4NO5B 1HXYA 5E00B 5TE6L 1K5NB 3TH2T 4Y2DD 1IEAB 3ZO0A 2VR4A 3O8XD 2XPGA 4KY1L 4QY8B 2NY0D 4S0TD 3TJHC 3KXFE 4S1QL 5C0BA 1A14L 5EZJB 2AKRB 2W0LA 4UINL 3C5ZD 1E4XI 1ZT4A 5C0GA 5IFHH 4YBQC 2NY2B 5ISZE 1U2HA 5A2KH 3VRIA 1ZT1A 3OR6A 1SQ2N 2FWOB 4HBCH 1GOFA 1X6LA 3FRPG 3MCLL 1KB5A 2O61A 2ED9A 4NN6C 1FNGA 2ZCHH 4MB4A 3C8KB 3S97C 3ROLA 3R0MA 1S9YA 3RVVC 2W65A 3OHXA 5TQ2H 2PTTA 1DBJH 1NGYB 2FIKA 1WBYA 1V3LA 3VFWA 3C5SA 1HNGA 3FQTA 1YQVL 5DZOA 5C0AE 1OT2A 4Q9QH 3BP7B 4HPYL 5EOQH 2VXUH 1XR8A 5FA3A 4DWHA 3IU3A 3MLSH 3OX8B 4MNGE 2OK0L 5C0DA 1XF1A 4GJTB 2ZP0T 3QHFH 3GMNA 3QUYA 2HMIC 4HC1L 1DEEA 4RGNB 4G9FE 2IQ9H 1PGRB 4ZS7H 4R8WH 3U36A 2HH0H 3VXPB 2NY5H 1NEZB 4UBDD 4L3AA 4HWBH 3WDJA 1PX4A 5HI5C 3LMJL 5DJXA 3RX7A 5FK9B 2AK4D 2APTA 2HFEB 3G5XA 2NNAA 1B0GB 3QDJD 3HE7B 5C7XL 2J1KA 3N1PC 3BKJH 4LLYA 5KSAB 5ERWA 4ZO7A 2CDGA 5IVOA 4O5LL 2V2XB 4G9DA 5C0RH 4EVNA 1VACB 3AS0A 2YRZA 1QG3A 1GJIA 2YXMA 1IGJA 4Y4KD 4PRPE 4G5ZL 1PEZA 4QXGL 3MLUH 3E0GA 2Q8BH 2KKQA 1RD6A 2W0KA 3H3KA 1U8NA 5T3XH 2UWEB 1AD0B 1U8HA 3TBYB 1I9JL 1CGTA 5E8NB 1S9WA 3ROLB 5T1MA 1KJ2L 3QUZC 2V9TA 1FZMA 1CBVL 2VZVA 2H6PB 4N1HB 3S88L 2BRRL 4GRLB 3NH7H 4PJEB 1BQLH 4IHOB 2UZYB 1AO7D 2OMBA 4I8DA 2BDNH 3WLWC 5TGBB 3RY6A 4HUWB 2PF6A 3S4SA 4ZNCD 3TZVC 3SKNA 43C9A 5JHDE 4X83A 1CGSH 1QQDA 3IETA 4MA8H 1NGXA 1ZGLA 1CL7I 5DJZA 1BEYL 1UT9A 5J6HB 3NFPB 3REVB 1QD0A 1RK1A 5HDBF 3NCJH 2A9MH 1GC1L 3LN4B 5IMLB 2XN9B 4RRPA 5K9OA 3NPSC 2J8HA 4QOKD 4BM7A 3G04B 5E00A 3H42H 2W0PA 1URLA 1CDGA 2IG2H 4IHOA 4LQFH 4Q6IC 1PSKH 4TSAL 4GMSH 1FNFA 4P23A 1MPAL 2FR4B 4OZHE 1SY6H 1DUZA 5D7IA 3STBA 3DRTB 3MRQA 3B9KC 3GHEH 2OXGA 5IB4A 3TVMA 3MLWL 4W4OC 4XNZB 2Y5EA 4XH2B 4CN6A 2CK0H 4OFYD 4XZUB 2LU4A 4IDLA 3ZT7A 2DTSA 1CG9B 4QRRB 4TQEH 1XCTB 1BZ9B 4HQQL 1V3JA 4U0RB 2DQJH 4EQ3A 2PW2B 2PYED 2EKJA 3FFCB 1L4IA 1RULL 3GSNH 3L7FA 1HKLH 1S7RB 1Z6JT 3P9MA 3BWUC 2OR9L 1CDBA 5D1ZD 3REWB 2LU7A 1D5MB 2EKSA 4WNQA 4HLZG 5JW5B 2DM7A 4NKOA 1I1YA 4CDHA 3VFNB 3ZT6A 4R26L 1A6AB 4NQDA 5GZOC 1ZANL 2F54D 3GRWH 4XPHL 1J1OH 2Y25A 3WYRA 1HH6A 1A7PL 5F96L 1XCTA 2PXYA 1G7LB 3BX7C 1S9XB 3Q5OA 2EYSA 1K6QL 2VDNH 3NN8A 4ELMF 2NW2A 3DV6A 5JHDD 5TH2B 3ILQC 1OGTA 1UH2A 4JFDD 2X44D 1MCWM 5TDOB 4GUPA 3LRGA 3T2NL 4F2MB 3HZKB 1IAOA 4OF7A 3TBTB 2ERJB 2EDLA 1PW3A 4I2XA 3HLAA 5C0JA 4MMZC 4TPRH 2WNGA 5FGRA 4B41A 3O2VL 4WI4A 4R2GB 3DUUB 4YPGA 4TVPE 3O4OC 3DI2B 2ITDB 3TJEH 1MCEA 1XGYH 2XKNA 4GAFB 3G6JA 4M1CD 1BF2A 2NY2D 1QLEL 3MGOB 3MUJA 3KPQA 5KVGL 2UY7A 4ODSH 1GOGA 5LGKA 2WV3A 4PRNB 5JIPA 2NPLX 5JQHC 5I8CA 1OGTB 4A2MA 4NP4L 4Y16B 1T89C 2XYCA 3GSXA 1UKSA 4G42A 4BFBD 3QQ3B 5SWZE 2B8OT 4HIJB 5E2WL 1R5WA 1A6UL 4XP5H 4U49A 3UYRH 4JRYD 1FN4B 2CRYA 2H26A 1P7QB 1VFUA 2DQFB 3VXME 1MJUH 1NC2B 2B20A 5HGHA 5GGQL 3OR7A 3WNOA 2FEEI 3VI3E 4XC1H 5CD5C 3QUML 2FJGB 4KJYB 2BVEA 2BVPB 1YUHA 5LBSL 3T65B 4FQCL 4HC1H 1LDPL 1OAKH 3HRZA 1FL6A 1KXVC 1P1ZA 4HK0B 4G8GA 3S36X 1IKFH 5I75B 1BHGA 1FGVH 2ICEA 4OZGF 4PJAB 3QJFB 2H8PA 2R56L 5BV7C 1QFPA 3TNMA 1KPRA 1U58B 2CUIA 3LQAL 1HSAA 4HIIB 3O9WD 4P4RA 4DUXA 4YXKH 1ZHBA 4V1DD 3SE9L 5J1SC 2H26B 3RVWC 3VD9A 4JRXB 5DK0B 4GRLC 3SGKC 3FAWA 1GGIH 3WNMA 3T0EA 2E7BA 4AENB 5DJCB 3FMGH 4QXTB 2W9DH 4N0FB 4GH7B 2E9WA 2D4FA 1BFVH 4LPTA 1B4JL 3GGWA 4O2EB 4NUJA 2IPUK 1T5WA 2NZ9C 4PLJD 4PRPA 5DMKB 3GSRB 1LO2H 4GMTL 2VABA 3N9GH 5D9SB 1EV2E 3MYJB 5EZIL 5FKPA 5B38B 4XCCH 4I3SL 2XNAB 3CU1A 2DS4A 3W11D 1JHKL 1RZJL 1Y18B 4CW1B 4OD1H 4OSUL 1AGBA 2X2YA 2BVUA 4GRLD 4OGXL 4OCXL 4MNQD 1XIWA 2OQJB 5CBAB 2XZQH 3QXDB 5ECJE 4DQOH 1UB6A 1A1MB 4UB0H 1KSRA 3OKYA 1NC4A 2BRRH 5FUCC 1BQLL 4IRJB 2CUHA 3MZGB 3CFDA 3O3BB 1AR1C 4X98B 1KBGL 2WUBL 4CMMB 5J4MA 4RGNE 3ARFB 3WNPA 8FABB 1K8DB 3IFLL 3MV9D 4G6AD 1DQQA 4LHUD 3P9WB 2CIKB 2XICA 2DB8A 1I3GL 5I16B 4HUKB 3CDCA 2VWEE 1M7IA 5KANI 1KCUH 3BMWA 5CAYB 3CUPA 2AQ1A 5KN5B 1ITBB 4RIRA 5FUOL 5E6YA 4LLWA 4U05A 1VHPA 4QNPF 5EU5A 3V4PL 5C0AB 2P5ED 3DUSA 1BVKB 3G08A 4YR6B 1NCWL 4J23A 3MO1A 5IB3B 1YMMB 4KC3B 3MRBB 4KKCC 4L4VB 4EXKA 4LSQL 5KS9F 1IGIL 4APQD 2GTZA 4EDWH 1OP5H 4F8QA 1FGNL 2HT2C 2BRQA 5I73C 3B9EA 4U3HA 3FOMA 2VQTA 4U6HA 2CO6B 4XWGH 3QI9B 1ADQH 3GMQB 3RGHA 2D7MA 2X4SB 3LH2L 2ADFH 1R5IA 3C60C 3GO1H 4PJ5A 3FQXB 3W82A 5CIPB 1PKOA 1ZA3A 1JE6A 2DWEB 4ZQKA 4D9LL 3IFNL 5AZ2H 4F7TB 4K3EL 4RGMB 5C07D 5D6CB 1DUZB 5EUOF 4J4PD 2OR9H 3IJHA 3V6FB 2FBOJ 4DKAA 4LCCA 1B0RA 3F5WB 1HKFA 2M2DA 2NY4D 2AK4B 1FPTH 3QWQB 2AJSL 1VESA 1IM9A 2M26A 1EFXD 4D9RD 3ZE2E 4YFDB 4H0GA 4ZUTB 4K94H 1J1OL 1J0JA 5T5FL 2OR8A 4BZ1L 1Q9WB 1DQJB 1Q72L 4QRUA 3FQNA 1KJ2B 1ZVSA 3AM8A 3OAZK 4R9HA 3RVUC 2R0ZH 1KPUA 1NBZA 1MREL 1NBYA 4U6YA 3RBSA 1T1WA 4PS4H 5LVEA 5I8KL 4YQXH 3PG2A 5KANG 3T0EB 5H35B 1EVUA 1TQCB 3CDFA 3P4NA 2DBJA 3Q6GL 3RKPA 4W6WB 3O2VH 2NTSP 4PJXF 1AO7E 3CFJB 2VO5A 5GS0L 4NM4H 4XB7A 1QEWA 2EDOA 4R6UA 1CFSA 3GBNH 1PLGH 5BRZA 1CI5A 1YDPB 3CPLA 1P4IL 1NLBH 1CLZH 4OLYH 5FV2A 5KVGH 5E08L 2HJFA 2XOTA 4YHNB 4DTGH 4UBDC 3O6KH 2J88H 5CP3H 5BW7A 2YMXH 4QXWA 5DC4B 1OD9A 1ZA3B 5SWSB 4KJQD 4IRSC 3JWNC 4MNQE 4U6VH 1MRCL 4RAUB 2YA1A 2ATKB 5KSBB 3LIZL 5ANMA 1YMMD 3NIDE 5ADPH 1ZS8A 3QFJE 5GS3A 3B8SA 5I1DB 5GGQH 1FHGA 4KK8D 1E4KC 4QHLB 5FCSH 4HJGB 4EUPG 1DVFB 4JJ5B 3DX6B 4UDUA 4DKFH 3CSBA 4PY8J 1QLRB 4OFDA 5F3HA 3PUCA 4E42A 3WD5L 3S98A 3RHWK 4YHIA 5KAQF 1CXHA 5CZVH 4FQ1H 5IK3A 1GZPA 5GJTL 4FQPA 3ZTNL 3ZTJG 2QQNH 5JHLL 2F8VA 1HOCA 4EUPA 1UACL 5K9KB 1ZS8B 3UTQA 4KQ4L 4PRAA 1OAQL 4C56A 1BAFL 1VPOH 1ZT7A 4O2CB 5CEXB 4WW1A 3QBTB 2C4FU 2NY7L 2JCCF 5EIVA 2IADB 4LCYA 4LKXB 3UTOA 5I76A 4QRQA 1G6RL 3HPLB 1B4JH 3S9DB 4M5YL 4EI5B 5HHVH 4KRPB 4M7ZB 4PRDB 4G8EB 5DWUH 2Z8WC 3HI6H 4I0PA 4JFPA 2E7LA 4OZGE 2Q6WA 2F19L 3B9VA 5BS0A 4ZUUA 2WIMA 1MI5D 1ACYL 1KTRL 3DI3B 4C83A 4JFDB 2QQLL 1JI1A 4P46A 3RX8A 4WEBH 4OGXH 4QY8A 2PR4H 4QXTA 2EE6A 3B9KD 2NQCA 4XCNA 1T20A 2X4OA 3TBSB 3HN3A 5GGRY 1ZLUH 3M8OL 1C7SA 4TULL 1YYML 2HVJB 5C0NC 4LIQE 5E70A 3D6GA 3FT2A 5GGRA 3TCLB 5E2TH 3BZFA 5I73B 3GB7A 3QFJA 2X4UB 4I0PB 1EUTA 2DBLL 3L1OH 3BQUC 3TNNB 5EBMB 3VCLB 1A22B 2R23A 4NO0D 1B88A 2H45A 5EC1B 2BNUB 5D1ZC 1MLBB 2P5EB 1Q9KA 4HGMA 2X9WA 2VDLL 3NABH 3GUTA 4O02L 4P0DA 3O3DA 4KTEH 2DD8H 3VJ6B 5C0IB 1V7NH 3RI5F 3EUUA 4M61A 5DEZA 3RY6C 1EEYA 4QT5B 1YQ2A 5BRZE 2EH8H 4HFUH 4MMXC 1R3HB 1X5HA 4JPWL 4K2UH 4JPKL 1XAUA 1U3ZA 1ORSA 2B5IB 1CFVH 1MFAH 4Y16C 3QUKA 5C08B 3DRQB 3FAXA 1MOEA 3OF6D 3EZ8A 4G6FB 4YBHA 1P84J 4X6DA 3BXNA 4LVEA 1IL1A 4JZJA 3CMGA 5F7KC 1U8JB 3L3OB 5DF0A 5D1ZA 4MCYA 4H5SA 4BZ2L 4XMPH 3ARBC 5JW3L 3IFNH 4GKNA 4OCRL 2Y7QB 1AXTL 3NCMA 1QACA 1OTUD 4D3CH 3SDAA 3QJHB 1RJZB 4H20H 4U1HB 1EJOH 5I9QC 1MHHB 4F3FB 2Y6SD 3UX9B 3RGVD 4RWYL 5DLML 4Z95H 5L2KB 5D2LA 2PO6B 3CJJA 3QXWA 1TVBA 5I1EL 4P2RB 4ODTH 5DZNA 1XFPA 4X6CE 3B2VH 4KVCH 5E8NA 3L95A 4UV7L 2GQHA 3RWDA 3WKNA 4BKLA 3KAAA 4OQTH 1JHLH 1DUYA 5T1DH 2JIXB 1A6TA 3Q6FB 2VR9A 5BZDA 1QLFA 4QRTB 3S35L 1MREH 4F15B 2ZSWB 5I8KH 4K3GA 2N56A 2HTKC 2X4RB 5MEPA 1S8DA 1RJZA 2IPUG 1S7QA 1CFTB 3WHXA 4XMLH 3BUTA 5C0GB 1GHFH 4OV6F 4PP2B 5KVEH 4NNXB 3U83A 5D7LA 3NCYS 3TBWA 2DQEL 3CMOH 4KDTA 3JV0A 3KLAA 4CADB 1EEQA 4OAWB 5D8JL 5FF6B 3P77B 5A2FA 1N26A 4YX2H 4NJ9H 4GBXB 3WSQH 1SJHB 5T3ZH 3FB7A 43CAB 1M4KA 1NCDL 1NBVH 3BXNB 5H37H 3CFCL 2C1PB 3CH1A 3JTTA 3BESR 4Y5YA 2ARJB 4AYFA 4L8BB 3VXSB 1IGTA 1JYXA 1SVZA 1S8DB 3ZKXB 4WV1C 3DXAB 4WI6A 1LO4H 2I26N 1JGLL 4LF3A 4HHAA 1OSPH 4BQ9A 4NFBA 1KIPB 4M62L 4AG4H 5F8QC 3OB8A 4OZ4B 1IC4L 2PYEA 4UIMB 4HG4K 3U9PL 3MOBL 4L3CB 4ALAL 5E94B 5CILL 5F9OH 1X5ZA 5D1XB 4S2SB 5IKCA 1WFNA 1C5BH 3ZKSD 1WAAF 1HHHA 4DZ8B 5FYJU 2ARJA 5F7NC 2V2WB 1OAUL 5DJ6B 3MLPA 5DFWH 2W38A 2PNDA 1UVQA 5CZVL 1CT8A 4HULB 5JHLH 1DBAH 5EN2A 3UPCA 1FZJB 4BFIA 4G3YH 4IRZL 4Z7UB 3U9UB 1JN6B 2ATPA 1TCRA 3UYOD 2OI9B 3SCMB 2QHRL 4G6AC 3VFOA 3RKDC 4V2BA 1ZSDB 3LV3A 1DFBH 1SEBA 1WJ3A 1MWAH 3DX8A 3JWDH 1AE6H 3ALPA 3R06A 4PV9A 3HE7D 3O0RH 5L7XH 3DRQA 4ODXB 1G6RH 2HVKA 3JV4B 4XP9H 1EFXB 1F45A 2BSTB 2VQUA 4WY7L 4X0KA 3CFEA 4NRZA 1LEKA 4P59L 3VE0A 2DMKA 1KLGB 4WWID 1XH3A 5CJQH 4HS8L 1ND0B 2A77L 3WFHA 4MJID 1YEIL 2NLJA 3CDGA 1Y0LB 4YJZL 4BQ8A 1QSFA 4PRAB 2R0WL 3SDDB 3I75A 5EDXA 4X7FC 2ID5A 4U1SB 1ZVHA 1IAKA 1YC8A 3ARBA 1MCLA 3ESUF 3CFIC 3O2WL 3CU7A 4X6BA 3F7YA 3O2DL 5JIHA 4PJDE 1I1CA 2GSGB 3C60D 3JWDC 1LO3L 3NCCB 4X0KB 2IMNA 1JZ5A 5I71B 1N0XL 3SDXE 4UOW1 4NO0B 4UUJA 4GOSA 4F33A 5KVFH 1KCLA 4BZYA 1A5FL 4HMEA 3UO1L 5ILTL 5BVPH 3PWVB 2HYMA 2VE6A 3L3GA 2AXGA 2BVTA 3ULUL 4HUNB 2ZPKH 2YD4A 3VG9C 4EI6B 4LU5H 4OUOA 1HIMH 3QO0A 4YHZL 5GRVL 5IFAH 1V7NL 4YK4C 1IBGH 5T3XE 4J3UA 4H88H 3HAEA 3MREA 1FVEA 4LLQA 3S36H 4NQXB 2A6DA 1MQ8A 3B3IB 2QTEA 3ILPB 4JKMA 4CMHC 5F21B 3HRZB 3M17A 4JY4A 1C5DB 1XF3B 5GQBA 2R2BB 4Z7VF 1CD1B 3G6AA 3MODL 1WQVT 1NDGA 4OF6A 1HHJB 3SKMB 4HXBL 5HY9A 4GT7A 4R90L 4Y89A 1RIUL 5DURD 3VXTB 4UI2A 5JR1L 4EVNB 4LIQL 2J4WL 3MV8B 3F7QA 3QPXH 1II4E 1AKJA 1F00I 1NSNH 1KB5L 3IDMB 5HDBE 3BWAB 2OL3H 1MFNA 5DLMH 3QG6A 3O41B 3IJYB 1J87A 3KXFD 4MD0A 3BZEA 1WZ1L 4QHNA 2GI7A 4MAUL 1S5IH 4P3WA 5JIIA 3MLRH 4KJQC 5GZND 2GYSA 3VFVB 1ZTXL 2G2RB 1I3UA 4F7CB 5D71L 2WBJD 5T1DL 4M8QA 5EBGA 3Q5TA 3G5YB 4OTXH 1OCWH 1A4KB 4CU7A 3ARQA 3QIBD 1GH7A 1F58H 3G6JB 5E1HB 3TC9A 2XA3A 4XHQA 2E27H 1MFEH 4PGBA 5TDPA 1TVBB 3LD8C 4YFLI 3CVHA 2DQEH 3V0VA 1XGPA 2AABL 4NZTL 4PTTB 1J1XL 1JCKA 3WFZA 4TUKH 2E7CA 2EH7H 3TFKD 4G7VH 1C12A 1AIFA 1RZKL 3PXHA 5FK9A 1JNHA 4P5TB 1MIMH 1WK0A 3WFHB 1KGCD 1FSKC 1CDCA 2GCYB 2R29H 1W8NA 4XP4H 3LKOA 4MJIA 3RWFB 1QP1A 4FOMA 4M8QB 2FR4A 4DGVL 3C5JB 5I71C 1Q94B 1I1AD 3QQNA 2YPLD 3NCBB 3DBXB 3AY4A 4IOFD 3D9AL 3MLVL 1OL0A 4K9EH 3IVKB 2FHFA 2MQCA 5CWSB 1FJ1B 2VZ1A 2HWZL 4D9QE 3U0TA 2YWYA 5I74B 3MRDA 2BNRA 1R3IL 3TFKC 3F62A 1TZGL 1L0YA 3BE1H 3VFSB 2DQIL 4FHBD 4NO5A 3NCYP 5CILH 2XN9D 2VNCA 1KOAA 1MCNA 2ADJB 1JNJA 2QSCH 3S34H 3GMMA 1FH5L 2P5WB 5CBEA 3DUUA 4W81A 2CGRL 3HNVL 4PJCA 5BO1L 4JRXA 4JFOA 5EORH 4H1LA 4LCCB 4S1RL 5E2UH 2XY1A 4MZ3A 4UMGA 5A3IC 1RIVL 2Y07L 2XTJB 3BJLA 4WDIB 2PCPA 2HN7B 1L7IH 5ITBL 4D0DA 2H2SC 4WGWB 3QRFM 3MX0A 4G3YL 4IRZH 5CEZH 3GMOB 3C8KA 2A6DB 5EUKA 5DQDL 2JCCE 1SVCP 1GYAA 2WWKO 1A0QL 2NW2B 3BQUD 2QKIB 4NFCA 6FABL 3HZVB 4Y4FB 5EWIH 4N90D 3RWGB 3LKSA 3SDYL 1AGDA 3Q2CA 3BDYL 2CMRL 1E4XH 1KEMH 1KYOK 2GKIA 5A3ID 1F90H 2R2CA 1DQTA 1U8KA 5CJQL 4U6TA 5EU6E 2A77H 4PRHA 3UTPD 1IVLA 3SKNB 3TA3C 3VMOA 4JO2L 2VR5A 3QNYA 2D9CA 3S5LG 3SDCA 4HJ0D 3O8XA 1FFPA 3HMWL 2CXGA 2DM4A 4LLDB 3DX8B 1N5YH 5F7DA 1GAFH 1K4DA 2QQQA 3PHOA 1KGCE 4DGYH 5IB2A 1CGWA 1JPGB 3EW3B 1H3PH 4WTXA 2VLJB 3T0AA 1CFQB 2Y06L 3P9MB 4IOSD 5C0BE 1KPRB 4YUEL 5ID1B 5SWZD 1NCTA 1KJ3H 2E8YA 4CAGA 2ARWA 4LVOB 2ADJA 4NDMA 5I8OH 5DD3H 1R3KB 4PLJC 4TYUA 5DD5H 1OTUC 5HVHB 1JK8A 1FAKT 1WICA 4NZRH 2HAZA 3VFTA 2ZPKL 4OLUH 3MBXL 2GTZB 3RGVC 1CFNB 2UV3A 1G7LA 4YHZH 3DSNA 2YEZB 4ZUSB 3QR2A 3V5DA 2VABB 4W4OA 2EDEA 4Z76A 3WIIL 1B2WL 1QSVA 1MJ8L 5F97E 1U8PB 3GSWA 2EDKA 4QXGH 3NCEB 3BO8A 3K1DA 3QDMA 1FZKB 3FFCA 3SDXF 4ZSOA 3MNWA 1E28A 5T3XL 5TGBA 4WEMB 5ICYA 3U7YL 3FO0L 4MNGA 2D0HA 1JJUA 1AI1L 3OTTA 1FORH 1KN4H 2HTKD 4R2GC 3L6FB 1LK2B 4LFHG 1JYNA 3ULUE 1WC7B 1EXUA 1JPST 4R90H 2AK4A