3H42H

Crystal structure of pcsk9 in complex with fab from ldlr competitive antibody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
224
structure length
221
Chain Sequence
EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYISYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYFCARDYDFWSAYYDAFDVWGQGTMVTVSSASTKGPSVFPLAPSSKGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title From the Cover: A proprotein convertase subtilisin/kexin type 9 neutralizing antibody reduces serum cholesterol in mice and nonhuman primates.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 221
sequence length 224
ec nomenclature
pdb deposition date 2009-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h42H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h42H01
2WQ8A 3IJYB 5DUPH 4TSAH 4HUVB 1ROWA 4R4FH 2G5RA 2ZCLL 5IMMB 3ABZA 5GRVK 1QLEL 5DUMH 1DBJH 1XGUB 3VGEA 2ZPKH 5DD3H 1INQA 3VFOB 3WO4B 2NY6D 1H15A 4XNUH 4LSUL 3T04D 1P4BH 3ZT5A 4I18B 4UT7L 3MXWH 1IGCL 2H2PD 4ODWA 2HVJB 4QRUA 5H94A 1A7NL 3QUYD 1MIEH 5T3ZD 12E8L 3OJVC 4XCFL 1F3RB 3A6BH 5FECA 2A6DB 3STZB 1ZHBA 1ERNA 3QSKB 4JFDA 3OKLB 1NAKL 3QEHA 2VN4A 4DKFH 1MWAA 1JHKL 1MJ7H 1X5AA 1ZA3A 2IPTL 3LPWA 3RGHA 3DX7A 1HKLL 5AZ2L 2OTPA 3L9RB 1U3HD 3TA3D 4FQCL 3SKUD 1SQ2N 1F58H 5GGTL 1S7WA 3VWJD 4Q9CA 4L8SC 4P5TA 5FYJU 2DQTL 3K3QA 4LAQH 2QQLL 1V3KA 4NNPH 4NO2A 2KKQA 3T0ED 1EBAA 3WHXA 3DECA 3MLRH 4ZFFA 2FJFB 3ZKSD 1MHPL 3JWOL 4OM0H 1XGYH 1JF6A 1FVEA 2APWA 4Q9BA 5HBBA 1BIIA 1A6UL 5FHAL 3FOMA 1RPQA 1N5AA 3NCMA 3D2UA 4OLWH 1V8HA 2HA1A 1A3RL 4OCLC 3A6CH 3V7MA 3VFWA 2VXQL 4LLMA 5MHSE 1C7TA 3QUXC 5HPOA 4YDVA 3RL2B 4LHUA 4X9BA 4YDKL 5F1NA 1B4JH 1IVLA 4KV5E 2EDEA 1IC4L 4LCCC 1L0QA 3NA4A 4GS7C 1P7KB 4JZOA 4M5YH 4ERSL 2FGWL 3BD5A 5K9OA 2ZCKL 1C8PA 3AXLB 4Y4FD 1CXLA 2CLZB 4XVJH 3KPNB 1FV1A 1MOEA 1ZVSB 3DARA 3GSVB 2CIIB 1KELH 2DBJA 2A1WL 2O5XH 2YK1H 3FQUA 4IDJH 4LCIL 4KVCH 2HTLD 4ODTH 2ZJSH 1T21B 4X6CF 1AIFB 1Q72L 1XAUA 2IALA 2RFXB 1HHHB 4GKSB 1BJ1H 3EYUL 4PRBA 5DD1L 5HGBB 3PQYB 3QXDB 3TWCH 3G9VA 4BH7B 4S10A 4YUEL 4FFWC 4DK3A 2PETA 5BJTB 4DKDC 5EO0A 2VWEC 2YPKB 3UTZA 2F5BH 3GNML 4BFIA 2CGRH 2RCSL 3PQYE 1L9MA 2NW3A 3QWRA 3MA7B 1NEUA 4ELKB 1YNTB 2JIXD 1RZGB 3ORJA 3BZ4B 3EAKA 3A6OA 5DJCA 3X12B 4Z77B 1F6AB 1EHLH 2VXUH 4UDUA 4NO5B 5L2KD 2R0KH 1PG7L 5KVFH 3QISA 5EN2B 3L7EB 1JHLH 3O41A 5I1HL 2P8MB 2RJMA 4JY6A 2CO6B 2VDQH 2P24B 1X5IA 5T3XH 1ACYH 3TJHD 3LRHA 1ZHNB 3OKMB 1FN4A 4Y16B 5TGBA 4GMSL 5EC2A 1OP5K 4JPVH 5IWLA 1FNGB 3AMKA 3WXVL 1MNUH 1X3DA 3GJFB 3GSWB 1INEH 3MCKA 2V9QA 2C26A 3OHXA 3N9GL 5IIEB 4LQFH 4G80B 2V5TA 3GSUA 4M61A 2NTFA 4LLYB 2PXYB 1H8SA 2XZZA 5GHWH 5AWNH 2WK2A 4Y5VB 1O7SA 4PRPB 3CFKA 1K4DA 4ZUVB 4JFDD 3VCLA 4LCYB 3CSYB 4UIKL 5C6WH 5IFJA 2EIZA 5I18L 4AH2B 1M71B 2EDNA 2Z35A 4OIIH 3F5WB 1NGPH 4JM2B 4N8VB 4YAQB 1RZFL 4ODSL 2BVQB 4PRPE 1FZMB 1S7SA 1OTSC 5J11C 4J1UB 4HWZB 3FCTA 1EO7A 1QBLL 1ETZB 3LY6A 5J8OA 2F8VA 5MP6H 3GSRA 3T4AA 2W1NA 2IG2L 4XWOC 4PJAF 3QIUB 3BXNB 2IANA 3KNBA 3Q5TA 2VL4A 2OJZL 3BUTA 1JWMA 2EDDA 2K7PA 1P4LB 1NUFA 3VXMD 5FDWB 1A64A 3RAJL 3UTPD 5HDBE 2QEJA 3V9FA 2BCKA 3WDIA 4M43L 3IYLW 1QLFB 4XX1G 4P48A 4MXVF 4XMLL 3CXHK 1JPSH 1J12A 1FL3A 2DRUA 4YK4C 1WF5A 4LNRA 1MFAL 2X9WA 1P6FA 1A7NH 2YD4A 1QSFA 5GRZA 4LHUD 1J7VR 1F4WH 4I9WE 1F4AA 2EH8H 2JLLA 4MDIB 1WISA 4NZJA 2N7AA 1I7RA 3RZCB 5IMLA 3CLEL 1R5WB 2ADGB 3TFKC 4ODUA 4RAUA 4X4YA 1CTNA 4TULL 3UTTA 4LSVL 2H2SD 3TBVA 3U6RA 4G43A 2VDLL 3QO0B 3JV6A 5CJQH 1CDJA 5AZ2H 5T1KB 3ELAT 4WW1B 2DQJL 3MOBL 5INDA 3ISWA 1YEEL 3P4OA 4H5SA 4FQCH 4J8RA 5TFSL 5IOPB 4X4XB 1A6ZB 4UDTA 4IJ3B 5TQ2L 5JW3H 1SJHA 2NXYC 3VFPB 3VGGA 2DQTH 1ZLSL 4AEEA 4UILH 2CRYA 1RUQL 5GJSL 3T0DA 5CIPH 1ODAA 3I85A 3BP6A 2PYFB 1S9KC 4F3FB 2BY1A 3JWOH 3VWKC 1DLFH 1ZS8B 5FHAH 3O3EA 1JTTA 2NY6B 2ICWI 5JA8B 2MOVA 2RHEA 1NH6A 1A3RH 4K71C 1EA9C 2ZG2A 4P9HH 2KH2B 4IRJC 5CKGA 4M6NL 3QWRD 2QQQA 1Y6MR 2Y1VA 2DTSA 4KROD 4P9ML 5GS1A 1P5UA 3QUYB 4P46B 3D5OF 4RFEA 3VFRA 5F1KC 5I16A 1VKXA 4O2FB 5DRZB 1K3ZA 3FMGL 1MHEB 4OZGB 1K2DB 3GMNB 4PJDB 2FGWH 3CFBB 3DJ9A 5C0IB 4KGLA 2Q20A 2P47B 1I7ZA 4F7MA 4JFXB 4M7LT 5T3ZE 4HUNB 4MJ4A 5ETUA 4JQVA 1RUMH 5HYSA 2FX9H 4OZGE 4WTZG 4LCIH 3IDNB 5IBTL 4PJDE 4R96A 4XNXH 3TA3B 1WWCA 2W65A 1M6OB 1KJVB 1HH9B 1MRFL 3BW9A 2E27L 4LVOB 5DSCA 3FO9B 3AAZA 1ZEAL 5JIPA 2D7NA 1D6EB 3VWJB 5DD1H 4H88L 2GJ6A 4NQCB 4ZDHB 5ITFA 4Z7OF 3LV3B 5DVLA 2P8LB 4X4ME 1EJ6A 2MFNA 4Y5YC 5DDHA 2V7NA 3JUYA 2HLFC 4H8WL 3IF1A 1TCRB 3SDCA 5JQHC 1NCAH 3FQTA 3IGAA 4PGEB 4W6YB 4NQCE 1MCFA 3GM8A 1BZ7A 4K23L 1CLOL 1JZ3A 2RCSH 4HHAA 4P23A 5EUKA 4HSQA 5GISL 3O6FD 4R2GD 2I26N 3O0RL 1HHGB 3WEXB 1PG7H 4S2SB 5JIHA 2X1QA 2HT3C 3VRJB 1A4KA 2YD5A 1FRGL 5I1HH 4KRPD 4L3CA 4OJFL 5T3XD 5KJRH 3OGCB 3IXAA 4ZO6A 3VGHA 4R7NB 5CSBA 1YN7A 3WXVH 1UACH 1CXFA 1PG7W 4R0LA 4QTHA 4UNVA 4M6MH 4P4KA 1SEQH 2X4RA 1YYMH 1RMFH 4NNYB 4L4TA 4JFPB 3PL6C 3N9GH 1A9BB 2N4IA 5EZJA 5L0QB 4AIOA 1QSFD 4XCNB 2FLRT 3VH8G 1LILA 2BK8A 4A2LA 1RY7B 2J6EA 3SOBH 4XNZB 4L1HA 4UIKH 3SGJA 4WUKL 4HWEL 4FMFA 4JPIA 1MUJA 4RMVA 4Q9RL 5E1HB 5HHOD 1T22B 1T7ZA 3UTTD 3VMPA 2AAVA 2BP3A 2IAMC 4KHXH 1VPOL 5SWZA 4F7TA 2LFGA 5F7YC 3MV7A 4F33A 5ESAA 1JK8A 5DA0B 3O3AB 5IVNA 3R1GH 3I75B 1QBLH 4HAFA 4Q0XH 1FL6A 2JIXB 2BSSA 1QG3A 4Y2DC 2IG2H 2VDNL 1FO0A 2NY2D 2GK2A 5IF0A 2A77L 4WIQA 2EE9A 3X13B 5L2KB 4Q6IB 1V7NL 4MMZC 2VZOA 2OJZH 4K9EL 4PGBA 3LVEA 4LGRB 3GJEA 5JQ6H 3T2QA 2DI9A 2BNRA 5D93B 2EXYD 4DWHA 4ONFL 5C8JA 5L2KE 3OR7A 1INQB 3JSSA 1H15B 1G9NL 4M1DL 5C7XL 3GBLA 4XMLH 3MGTA 4HJGA 1OTTC 1CZ8L 3CH8A 5DVMA 4ODWB 3HB3D 3BPNB 4QRUB 5H94B 2JJTA 3RZWA 4MJID 4KQ4L 1RHHA 2JB6A 2X9YA 4IHOB 2XPGB 4FFYH 1ZHBB 3ES6A 4JFDB 2D2OA 1FIEA 3QEHB 2VH5L 1T1XA 2Z31D 2X7LA 4TULH 1MWAB 4LSVH 3IU4H 5EH1A 2LQRA 4WI2A 1TFHA 1ZA3B 2ICEA 2V2XA 3G6AA 1DN2A 3O3UN 5ECJE 3DX7B 4O58L 1YEEH 2A9ML 3GMLA 3QPQC 4JFDE 4LKXA 5F88A 3RPIA 3WXWH 5CSGA 2XXCB 1YEGL 5TFSH 3CU1A 3HAEH 2F5AL 5JR1L 1GAFL 4RMTA 1S7WB 1N4XL 4XTRC 5GRXG 3QNXA 3WFCH 3FAXA 4P5TB 1BM3L 4EZMA 3DUHA 4NO2B 3WHXB 1OLZA 5EUOA 4R7DA 5CILH 2J8UF 3BQUC 4CAGA 1FVEB 3JUZA 4TNWF 1BIIB 2XZQH 1EV2E 2VAAA 2ICWJ 3FOMB 1X4ZA 2J8HA 1N5AB 3BKMH 3D2UB 2YUVA 4GRWH 5C9KA 2DDQH 1EEUA 3ARGA 4P23D 3VRLF 4M6NH 2A6KA 2CXKA 5GJTH 4C56A 5J6GA 3VFWB 3UTPE 4MMXC 4LLMB 1EUTA 1UADC 4YDVB 4LHUB 5F1NB 1B9ZA 4XPTL 1AQKL 3WCYA 3DBXA 5D2LF 5F89A 3DVGA 3ZE0E 5JPNA 3O2DL 4R8WH 5FK9A 3X3GH 4JZOB 3M07A 3H9YA 1KT2A 5K9OB 2X4PA 2YWZA 1EEYA 1S7QA 4HJ0D 4X5XA 1DCLA 4QRPA 5GZOC 1FV1B 1AXSA 1G9ML 3UROR 4LEXH 5J1TC 3FQUB 4G8GA 2BXYA 1C5CL 1FP5A 4O2EA 1QRNA 1HWGB 1MRFH 3DYPA 5FUCC 2YD2A 3EOYG 1MY7A 3WJJA 2E27H 4D3CL 4ZYKA 3LH2L 5ICXA 3ZL4H 1B90A 4ZO8A 2IALB 1TVHA 3QA3A 5CEZE 2E7MA 3HR5A 4H88H 1RULL 4PRBB 3BHBA 2H45A 4KWUA 1KCVL 2XA8H 4LCWA 4NQTA 2N56A 1Z9SA 3FL7A 4H8WH 5CGYC 1KCUH 4JO4L 4U3CA 5HXMA 25C8L 3O6KL 4G8FA 3UTZB 3MRLA 3MV7D 1KJ3L 2YXFA 4BFIB 4JQIL 2VQ1B 2NW3B 3O0RH 4LASH 5DJCB 3BJLA 3WS3A 4AG4L 5KSAC 5D1ZC 2FO4A 4HPYH 2UUDK 4UDUB 1MLBA 3H42L 4KKCC 3NABL 1FRGH 1BF8A 4BFBD 4OJFH 3CFEA 4UIMA 1J88A 3O41B 4HUXA 5IW1A 4JY6B 3SO3C 5FO9A 3OF6A 1FN4B 5TGBB 1I1RA 5EC2B 3FFDA 1UEMA 4KV5F 3MNVA 2OR7A 2ZUYA 3O45A 3QCVH 4OI8A 1LO2L 3Q2CA 1KN4H 5KAQG 3HPJA 3MCKB 3BPOC 3OHXB 1CFQA 4ZNCD 2XQBL 4M61B 2NTFB 4BQ8A 2NZ9C 3HI1A 3MV11 1VEPA 4HWBA 5FA3A 3VXPA 3CFKB 3P0YH 1K4DB 1UC6A 4XI5C 3PWLA 3WIHA 3ARDC 4C83A 3VCLB 4WUKH 4HWEH 5IFJB 4ZFOL 2EIZB 2KZWA 3ZT7A 4Q9RH 4UT9L 5C0BA 4XPHH 2Z35B 3LQMA 1EFQA 1YUHA 2X1PA 1S7SB 5KSUA 3O6FB 3FCTB 3VA6A 1U0QA 4AIZA 1A22B 3ETBF 3RA7L 3AM8C 3VXSD 1CE1L 2V7HA 3QUZA 1TLKA 3T4AB 2A77H 5ABDE 2YN5A 1V7NH 4N90E 2IANB 1RI8A 1RZ7L 3KNBB 4AMKL 1FYTA 2HKHL 3RIFK 1JWMB 2UZIH 2KQNA 4KRPB 3HR6A 2EE2A 1GCFA 2VR5A 1JTOA 2V2WA 5F7DA 2LAGB 4ZO9A 5T1DL 3ILQC 1BZQK 1FVDA 2X5PA 2BCKB 5A2IH 2IANE 5IT2H 1G9NH 3TVMA 4M1DH 5C7XH 4U2YA 4PJEA 1OQOA 2ARJQ 3ARGD 5T3XE 1CZ8H 4TNVK 3JXAA 4C56D 4OD2A 4LNRB 1IFHL 5J1SC 1QSFB 4LNVA 4KQ4H 3MMEB 5LJYH 1JPFA 3W5MA 1FDLL 4XBEH 2V9TA 1HNFA 4JM4L 2XG4A 1I7RB 3DGCR 5IMLB 1I4FA 4ODUB 4RAUB 4X4YB 1QSFE 2FECI 5E2UH 1QZ1A 3RWEA 3UTTB 4AJ0A 3U6RB 3V79C 4G43B 1I1YA 2MWCA 3JV6B 4HQQH 4X7FC 4C54A 4HMCA 5INDB 2Q87A 1QRND 3K2MC 3VDCA 4H5SB 3RKDC 4J8RB 4XCEA 3UTTE 3S88L 4G3YL 1GAFH 4UDTB 2NY2B 3ALXA 1SJHB 1BM3H 2M1KA 3MUZ1 3RWCA 4KK5C 1JIBA 2NY0D 3BP6B 3Q6GL 2F15A 1RU9L 4JM2F 3T3MF 3H3PL 1CDBA 3O3EB 2XFXA 3C08L 3JTSA 1U2CA 2BOCA 1R5IA 1B0RA 2DQFB 3GUTB 4L8SA 3GKWL 4RAVA 3DURB 4U31A 1QFOA 4KRNA 5IB2A 5GS1B 4MJIB 4RFEB 3VFRB 3ZDYF 1AQKH 1PX3A 4M7KH 5I16B 3V4PH 1A6TA 2GCYA 3OKNA 3O2DH 4PY8I 1VKXB 3CSPA 1HYRC 1BWMA 1GSMA 3BYTA 5JDSA 3RDTD 4GRLA 1I7ZB 3SGDH 3LEYL 2ORBL 4F7MB 1YN6A 3OF6D 3NBNA 1CFNA 3S4SG 1G9MH 5ETUB 5HYSB 4K94C 1RZJC 3PDDA 3QUXA 2BNQD 2R4SL 3RUGA 2HRPH 4R96B 4HIJA 1S7XB 4LCCA 3BW9B 1E6OL 5DSCB 3QNYA 3AAZB 2HAZA 3C09C 4DEPC 2GJ6B 4WTZA 5HGHA 1KCVH 5ITFB 1ZT4A 3PP4H 5CD5C 5TPWL 4P2RA 4L4VA 1IC5L 1DANT 3MBED 3SKMB 3EHBD 4JO4H 25C8H 3IF1B 3O6KH 4LLDA 3FQTB 3IGAB 5T5NF 1MJUL 2GJ6E 1WJ3A 1BZ7B 4XT1C 1YEIL 5C0FA 4JQIH 1DFBL 1UWXH 4HHAB 4P23B 4PIRF 5FAAA 2HKFH 3BKCL 5CEZL 4KJPD 2XY2A 5D7SL 5DVOA 3QUZD 3VW3H 2J3SA 1GPOL 1I1AC 3QQNA 3RJQB 4ONGL 5TE4L 2OXHA 2UYLB 4L3CB 1G0XA 4J4PC 1IBGH 5F9DC 5D1XA 2AJYL 3GRWL 4NQXA 3IXAB 1E4XI 4UZGA 3L95A 2Z0BA 1EPFA 1SY6L 4N1EA 5I74C 1YN7B 3KLDA 3TVMD 4R0LB 1HN1A 4QTHB 4U6YA 1X5XA 2YBRA 2NYYD 2FIKA 4P4KB 1CFSA 1WZKA 4L4TB 1FGNL 3SCMC 3L3HA 5EZJB 2XQBH 5ALCL 5CCKH 1TNMA 2MQ0A 1KYOK 2JELL 1MLCA 4I4WA 4L4TE 5DMIL 4O5LL 2PCPA 4UT9H 4JPIB 1MUJB 5CZXC 2ADFH 3VH8A 1U8PA 1JYVA 3TH2T 4OD3L 4RMRA 4FXKA 4F7TB 2K3TA 3MV7B 4F33B 1Z5LA 5ESAB 1RUKL 3QFJD 5HD8D 1JK8B 4OFYA 4MX7A 1I7UA 1FL6B 3LB6C 2BSSB 4M9OA 5GRJL 2BDNL 2AJVL 4CMMA 1G7MA 1FO0B 5J1AA 5IF0B 5SWZE 3MV7E 4F37K 4PB9L 4PGBB 2HKHH 1CD0A 3GJEB 4DAGH 1RURL 3QI9C 2AXFA 2BNRB 2VMFA 5C86A 4N9GA 3TYFB 4BYHA 4X98A 3DSFL 5C8JB 2W59A 4PJ5D 3OR7B 2BNUA 2QADD 3MV8D 2WINA 1YEKL 2D7PA 3RVWD 1V3MA 1LO5A 4JDZA 2ADJA 2P4AB 1OAXL 3MGTB 2BNRE 1S9WA 1R24A 4U1GB 4Z7WA 1J1XH 1RHHB 3GM0A 2JB6B 5AUMA 3JWNC 3WIFA 3D6GA 3THML 2EYTA 1FNFA 3EJYD 3ES6B 3B3IA 4POZD 1MCOH 2YWYA 2UVFA 1T1XB 2QBWA 4GRLD 2X7LB 4NUJA 5BV7B 4NWTL 4QOKA 2V2XB 4Y7MA 2ICEB 3G6AB 1DL7L 3QDGA 15C8L 3EO1A 4LVHB 4MJ5A 1XF2A 4U33A 3GMLB 4LKXB 3RPIB 5E7FA 3WMSA 1D5IL 5IBUG 4JANA 3VXSB 3S88H 4G3YH 3R0MA 4PTUA 2YKLL 3QNXB 5A2LH 2CQVA 1OTUC 4N8CL 4OCRL 3ZE1E 3Q6GH 4S1SL 3L3IA 2NY4C 4AQ1B 1RU9H 5EUOB 4R7DB 4QXGL 2EEBA 4QRSA 3V4VL 4YXLL 1KTRL 4IRZL 4KI1A 2VAAB 4YC2B 5M94B 2AI0H 4NM8L 3WDJA 3ARGB 3ZTNL 3GKWH 4K8RL 3DXAD 4N0YH 5EUOE 2A6KB 4ODXA 2XZAL 3T2OA 1RIVL 1J18A 1PGRB 2D9CA 1T66D 4ZFZA 4C56B 5J6GB 4GW5A 1NAML 1ZLWH 1VFBA 4Y1AD 1CFBA 4PY8J 5ESQA 1QQDA 3VWKA 3MR9A 3TV3L 4FFWD 3DBXB 5F89B 3DVGB 5JPNB 4JY5H 4U1IA 5KW9H 4C56E 2X4PB 4X7CC 5D1XD 5GS2H 1EEYB 1CD9B 1S7QB 5A2KH 2ORBH 4X5XB 3HUJA 1TVBA 3ZT6A 3KPSA 4QRPB 4Z6AT 4IRJA 3S37X 1V3LA 2VDRL 4FABH 4S1DC 2DJSA 1AXSB 3VG0L 5F72S 3MGAA 4O2EB 1X6LA 1QRNB 1DEEA 1ZE3C 3C6LD 4ZYKB 2OQJA 3H9SD 4QRPE 5ICXB 3QA3B 1TVHB 3KDMA 3UYRL 3HR5B 4G8GE 1CCZA 2F19H 4NM4L 3BHBB 1RJZA 1QRNE 3IFNL 5TPWH 4LCWB 3IT8D 3MRRA 4MB4A 3KYKL 5CS7A 3VI3F 4G8FB 1I3GL 2EC9U 5I75B 4MQXD 5AEAA 1YEIH 3MRLB 3SDXF 2DI7A 4LCWE 1A6AA 3O4OC 3BKCH 3V0VA 2MKWA 5F9JA 5T1LA 1CF8L 4U7MA 2PTUA 2F58H 4G6KL 4Z0XA 3WS3B 4Y5YA 1GPOH 2FO4B 2R1YA 4QO1A 4AQOA 1MLBB 3CAFA 1JCKA 3LD8C 4ONGH 3S96A 2JCCA 5SX4H 4GSDL 4UIMB 3CFEB 4Z95L 4TVPL 4HUXB 3I6LD 1RK0A 1U8HA 5IW1B 4XAKD 2AJYH 4QHUA 3GRWH 4ZPTA 4DZ8A 1SY6H 5FO9B 1CN4A 1GOHA 3F58H 3FFDB 3QAZB 3MNVB 3KLSA 2MKLC 1AGDA 2BNQB 3O45B 4G7VH 4XWOD 3QEQD 3HPJB 5L9DL 1JRHL 2AJZA 1CFQB 1QHOA 4ZOEA 2B1HH 1EVUA 3HI1B 2BNQE 3CZFA 5MEQA 5C0CA 2JELH 5BRZA 5DHVA 5FA3B 5LBSH 3VXPB 4PJHA 3DETC 3PWLB 1EHAA 5CLWA 4LARH 4O5LH 1WFTA 2DLEA 3MBEB 2MPAH 2FJHA 5C0BB 1VFMA 2O5ZL 3O8XC 1IAII 2DYPA 4OD3H 1BQUA 1EH9A 3PL6A 4QOKD 1DBAH 3QDGD 4F58L 3ZYIA 3HLAA 2DTML 2Z91B 4MCZA 4OGYL 5KSUB 4GG6F 4JN1H 4JPWH 3RKPA 4C55A 4FQQA 4AIZB 2FNBA 5C0BE 2AJVH 2CO7B 2V7HB 3QUZB 1AJ7L 1IEAA 4JPKH 3BRFA 4ZOCA 2XA3A 4ORZC 2OI9C 3DO3A 4NPYA 5CJXC 2IAMA 1FYTB 5KSBF 1UH3A 3BP4A 1RURH 3EZJB 5EIQA 2V2WB 4TYUA 5F7DB 3QCTL 4EXKA 3LS4H 1BHGA 2B7DT 2B39A 1KB9K 1FVDB 4NCC1 3TVMB 4U2ZA 4X6DA 1FYTE 3F12A 5GSRA 1OAXH 4RMUA 4PJEB 2NXYD 4RWYH 2JK5A 1LO4L 3E3QC 2GITA 4OD2B 5D1QD 5EO9A 1JPFB 2X09A 1HXMA 1WFNA 4PJEE 1T0MA 1FO0L 5C70A 4LSSL 4GAJL 7CGTA 5KTEL 3PDGA 3GIZL 3LKPA 2XRAH 4LHJB 1TZHA 1CFVL 3C9NA 4OGZA 4RGMC 4XX1E 15C8H 1I1YB 1H3UA 1WCQA 1RZ8A 1VSCA 4U6TA 4KJWC 1I8LC 3H7LA 2H3NA 1D5IH 3M1BA 1CGSH 4JVUA 2D9QB 4XCEB 1X6NA 4WI5A 5D5MF 1FZJB 4GFTB 4F2MA 4L1DA 2W0LA 4N8CH 4OFVA 5C0RL 1JZ2A 4OCRH 4L29A 4S1SH 4D0DB 1N3NA 3RL1A 5C0NC 4QXGH 4KY1L 1ADQL 2APTA 4YXLH 3V4VH 4IRZH 1H3XA 4QXWA 2QADB 1CE6A 2IBZX 2XFXB 3KJ4C 4PY7A 3IAPA 1PZ5A 2EIBA 3JTSB 4FTVD 1A7QL 2ZUQC 1QFUH 2BOCB 4X9HA 1R5IB 4Z8FL 3MRIA 5J9PA 4L8SB 4RAVB 1RIVH 5T1LD 1NAMH 2C5DC 3IFOA 3REVA 3VFGL 5IB2B 2W9DL 4EIZC 4YWGL 4WEMB 3TV3H 1CG9A 3BQUA 4QHLA 1A6TB 1KJ2A 2HLFD 3OKNB 3QDJA 3RNQA 3MOAL 5L6YL 5LVEA 3QR2A 4YHIA 4JKLA 1K8DA 4ZXBC 1HXYA 4GRLB 2GIYA 1YEJL 2VDRH 1YN6B 1CFNB 4M4PA 3CH1A 4DN4H 4DOHB 3QUXB 3RUGB 1FH5L 2B2XL 2HT3D 2IEPA 4LCCB 1TXKA 1OAKL 1PEZA 4GS7B 1JZ4A 3QG7L 3QNYB 3S4SA 1CT8A 4HZAA 1GOFA 3RNKA 4DOHE 2E7HA 2WIIA 4WFED 5C0CD 3RUGE 5GGUB 5HGHB 1A1NA 1ZT4B 1XF5A 2VSDA 2MJWA 4P2RB 3U4AA 3TPUB 1CIUA 3PGFH 3ROOB 2Y07H 3KYOA 2VXTL 3CC5B 4LLDB 1I3GH 2DYPD 5FEBA 3PL6D 2CLRA 4KTYA 2VR4A 4M7JL 2YA0A 3AS3A 5C0FB 4YHNA 5E7BA 4P2RE 3RPKA 4L4VE 2C4FU 1CF8H 3QWQB 3HC3H 2Q7NA 3UZQA 2X89A 4GQ9L 4P2QA 1LDSA 3MYJA 1CD1A 2UVEA 2GTZA 1G7HA 3QJHB 4CU7A 3JWDL 3AUVA 4GSDH 5IMOA 1WUNT 2IAMD 2XI9A 4Z95H 4TVPH 3SDYL 4XC3L 5D1XB 2JKXA 4NQXB 3L95B 2QHLA 4JFYA 1UT9A 3RRQA 1J0IA 4XVTL 1L0XA 1MFEL 1LMKA 4U6YB 1XR9A 5KSAA 2VWEE 5D1ZA 2YBRB 3LZFL 2FIKB 1CFSB 1JRHH 3L3HB 1L7TL 3HC4H 5IR1B 3MLVH 4CJ0A 5DRWA 3VXUA 2OMBA 2I5YL 4E0RA 4E9LA 4CKVX 1MREL 3U82B 4UUJA 4Y4HC 3PWNA 4NZTH 3KPRD 3WFDL 4JAMB 1MLCB 1F13A 1U8KA 3WO3B 4I4WB 2EDRA 3ZTJG 3OAUL 2PCPB 2O5ZH 2P5WA 3VH8B 1U8PB 4FXKB 1QHPA 1T3FA 1ZWIA 4RGOL 1Z5LB 3CXHJ 1ZVHA 1AE6H 4FOMA 1WK0A 4MXWL 4MX7B 5B8CC 1I7UB 2WSKA 1ZXQA 4RMSA 4DCQA 1GXEA 3ARFC 1AJ7H 4CMMB 3ARDA 1G7MB 5J1AB 4QKXB 3HTLX 1FG2A 4DVBB 8FABA 3KXFA 3E0GA 4PLNC 2BX5A 4Y8DC 3VD7A 4L9DA 1SMAA 3O6ML 1HSBA 2AXFB 1A7OL 3QCTH 3B2VL 3QPQD 5J11B 4N9GB 4X98B 1JP5A 3U1SL 1NCCL 4TUKH 2BNUB 3AM8A 1NQBA 2WINB 3KLAA 4I2XA 1JI1A 3IU3A 5KVGL 5DK0A 2DQHL 1LO5B 4JDZB 4PFEA 2ADJB 2OL3L 3QEQB 4YZFF 2APBA 3I6LE 2VXSH 3MCG1 1S9WB 1NGWA 3QZWG 5DGRA 1R24B 1T5XA 3LQAL 4FQ2L 4DK6A 1Q9WB 4NKMA 4Z7WB 5DEZA 1IJ9A 3OB8A 3KR3L 5B3JF 1X5FA 1WBXA 5AUMB 3WIFB 1LP9F 3ARVA 3QDJD 1RHFA 2R56L 3QEQE 2XV6B 5E6ZA 4LSSH 4GAJH 1F90H 3EDDA 4JKKA 3TH4T 3B3IB 5KTEH 4Z7WE 4ACPA 4LP4A 4LFHG 1WTLA 3G6JB 4NUJB 4OF5A 4QOKB 3DUSA 3QDGB 2EKJA 3EO1B 1IM3B 2AABL 4MJ5B 5FHBL 1XF2B 1MEXH 1MCLA 3QIWD 5A16A 3BRDA 5AAWA 4JANB 1AKJD 4P4RA 4UT6L 3KPMA 4QOKE 3QDGE 4PTUB 4XMKL 1N2RA 1V05A 3D3VD 1JNNH 2EIEA 1YNKL 3T4YA 1DQLH 3CXDH 3KVQA 3L3IB 4ZPVA 1G6RH 5D72L 5E5MA 4XCCL 4X7TA 2OP4L 4KY1H 4YE4L 4HV8A 1MCJA 4UV4L 3S8WA 3RTQC 1IGML 2WWMC 4QRSB 3QHFL 1AFVL 5F71A 1QFHA 3WFHB 4HFWA 2VRAA 2IBZY 3BSZH 4PJBA 2NY5L 2DKSA 2NXYB 3O3DB 4H1LG 5JW5A 1IQWL 4OCXL 3WNOA 3LS5L 1MFCH 3MRGA 4KUCF 5KG9A 4ZFZB 1OL0A 2X89D 2XN9A 3IVKA 4GW5B 1VFBB 4WUUD 5DQJA 2W9DH 2RIKA 1FCCA 5ESQB 1QQDB 3VWKB 3MR9B 2FB4H 4LDOB 5CGYD 5SWSA 1JWUA 4OZ4B 4U1IB 4HIEA 4V1DD 3B9KD 4HUMB 1W0YT 4PV8A 1YEJH 1OW0C 2LTQC 3HUJB 1TVBB 4K71B 4ZAKD 3KPSB 4IRJB 3L6FA 3F6IA 4F15C 1B88A 4KDTC 3MRJA 4PS4H 3ARBC 1FH5H 5FKPA 3CLFL 3CVHH 4NRZA 3U7AA 4DN3L 1DEEB 1BLNA 2OQJB 3HUJE 3KPSE 4X8JA 3FFCA 1RZKH 3QG7H 5HHVH 5ANMA 5DS8B 3KDMB 1U42A 2WQRA 4Z7UB 4G6AD 1G6RA 1RJZB 3LHPL 1JGDA 5DEGA 1GJIA 2VITB 5JTWA 2F9BT 3J8F7 3MRRB 4IIQA 5DQ9A 4IEFB 2VXTH 4Z7VA 2P8PA 4QGYA 5DRXA 5EBLA 2QSCL 3G6DL 4WHTA 4Z7UE 4FTVB 4ZG1A 3MUJA 4KK6C 4HS8L 3WFEH 1A6AB 2NZ9D 4UMGA 2ZCHL 4WHYG 5T1LB 4GQ9H 4ALAL 4XVSL 4XI5D 4Z0XB 3K4DA 5JOFB 3ARDD 1Z9LA 1MRCL 4Y5YB 2R1YB 3L5XL 5JNYA 4M48L 2P48B 4TVPD 3S96B 2JCCB 3GSOA 3SDYH 5D7LD 4HIXH 2ITDA 4PRDA 1PKQA 1RK0B 1U8HB 2CRZA 3QHTC 3E6FB 4QHUB 5SV4A 4ZPTB 1UM6H 3QDMA 4XVTH 4YHZH 4B7IA 1MFEH 2JCCE 1AGDB 3CVHA 1JE6A 1IILE 3MC0A 1T2JA 4MD4A 3U83A 5KVMC 5JLZA 4MGXA 1I1AA 2F54A 1L7TH 2DQCL 2AJZB 2RGSA 2I5YH 4MHHG 4HCRA 4J4PA 4E5XA 4PP2A 2VQUA 5DK2B 1K4CA 4FN0A 3CZFB 5MEQB 5C0CB 1CGTA 5EU5A 5BRZB 1PYWA 2R0LH 5GIRA 2XOTA 4PJHB 1RSFA 2QQNH 3VXOA 3OAUH 3RVVC 5CUSL 1FFRA 5H2BA 3WBDA 2FJHB 3SPVA 5BMFL 5JOPE 1Q9OA 1R3JA 3MRKA 2DYPB 4NN7B 3SCMA 3PL6B 4TQEL 4WFEE 5C0CE 5BRZE 3MACL 2O5YL 3VRIA 4PJHE 4MCZB 4MXWH 3L5HA 3KJ6L 1ORSA 1H8OA 4FQQB 4YXKH 4OGXH 2AJXL 3IDMA 1CGVA 1IEAB 1VGEL 5E70A 3HS0A 4EN3C 2HRLA 1V5JA 4NPYB 4KKNA 2J2ZA 3BOVA 2IAMB 1BIHA 4UOW1 3BP4B 3O6MH 5TDOA 1A7OH 1R3HA 2EZ0C 1CD8A 2MQCA 3RBGA 3C87A 3D0VA 5ACMA 3U1SH 1NCCH 3RKDD 2WIMA 4GRWF 1HYSD 2BY3A 2A6IA 5DFTA 5KVGH 4X6DB 3IFLL 3F12B 3EOTH 2OL3H 5GSRB 5FGRA 1UENA 2AEPL 3AB0C 2JK5B 1OAZL 4JM2C 5KBNC 2CDFA 2GITB 1M1SA 2EEAA 3KR3H 4JREC 2HJKA 3QI9A 5HYEA 5EO9B 4NZDA 4X6DE 5SWSD 5BS0D 5C08A 1HXMB 2R56H 1T0MB 1CLYL 4P2YA 1I7TA 4XP5L 1ZGLA 4DW2L 2G75A 5L8KB 3LKPB 5CJOH 1TZHB 3C9NB 5F3BA 2EH7L 4DVRL 3GK8L 5T33H 2AABH 1RZ8B 3MV9A 5KZCD 4S11A 3OB0H 1JNLH 1J5OL 2H3NB 3K0WA 3JV4A 3M1BB 4UT6H 1SBSH 4GKZA 4R4NC 4F2MB 2P44B 4GQPH 4XMKH 4I0PC 4IMKC 4A6YA 4WHCA 1KACB 1YPZF 4YFDB 2IPUG 5FYLH 5ERWA 1MIML 4L29B 3EO0A 5D72H 4XCCH 1N3NB 1N5YL 4NT6A 5GQBA 1EGJA 3RL1B 4YE4H 3VFTA 3VXQA 5E94A 2B20A 3QIBD 1NGYA 4UV4H 3NCFB 2CXGA 2BHUA 3QHFH 1WLHA 3ZDZF 1CE6B 4PY7B 3RZCC 1PZ5B 3FO0L 4Z7NF 5IGXH 2F8OA 4OLYL 5J9PB 1IQWH 1YY9C 1EFXA 3LS5H 3WIIL 3IFOB 3REVB 2VLJA 4X6CA 3BKJL 1KCRH 1QPXA 1CG9B 4QHLB 2R0ZH 1MJ8L 2ZUWA 3QDJB 3K4ZA 2P1YA 4GAYA 1FYHB 4WU7A 3RNQB 3U48A 3C5SA 1W2KT 4YHIB 4IJ3C 1K8DB 1E4WH 1XF3A 1AGFA 2HJLA 5J13C 3F7PC 1YEDA 2ED7A 3C2AL 3QDMD 3CH1B 3QDJE 1A7PL 4YGVA 1BGXH 3E6HA 5A3ID 5K59E 1W8NA 4KDWA 5E2JA 1CQKA 1C5DA 1I1AD 3PV7A 3F62A 1AKJB 4PJIB 1AD9A 2YPVL 1IT9L 4PB0H 2AKRA 1Q0YL 4MB3A 4J4PD 3WFBL 3S4SB 1CT8B 3RNKB 2WIIB 1SEBB 3S5LA 2GK0A 1A1NB 3FRUA 4W70A 1XF5B 3FOLA 3QUYC 4LHQB 4HH8A 1KBGL 1LGVA 3KYOB 3UC0L 1FGVL 3OAZH 4EUPG 1P9MC 5HVFB 1BVZA 3G6DH 2CLRB 2P5EA 1MRDL 1YY8B 4YHNB 4NZUH 4AEFA 2W9EH 2ZCHH 4K3DL 3HPLA 2P42B 1J8HA 4M9PA 4UI2A 4P2QB 5FUCE 3ZTJH 1WQVT 3MYJB 1DDHA 4WUUB 5AD0A 1Z3GL 2DLGA 1LVEA 2GTZB 1EK3A 4O4YL 1U3HC 4M48H 3TA3C 4ZUWB 1G7HB 3U4EB 5FYKL 1W0VA 3BPCA 4YX2H 5J12C 5IMOB 1ZGLM 4ENED 4HC1A 2XZCL 1MCRA 4P2QE 3CFJA 3VWJC 4WUUE 4IMLA 3T0EC 3LB6D 4JFYB 1DE4A 1BZ9A 1MCPH 3L3KA 3MROB 4WEBL 5KS9F 4HW6A 1AI1L 1XR9B 2BFVL 3TT1H 3MX0A 4O9HH 1W72H 1OCWL 5IBLD 1CDHA 2DQCH 3I02A 1KSRA 3ARSA 1J1PL 5DRWB 3U4BL 3VXUB 4E0RB 3HCVA 4G6JH 3SO3B 3BDYL 3TO4D 4UU9A 1JGUL 4YLQT 5CFHA 5C08D 1WSST 2VC2L 1JGVL 4PJAA 3PWNB 3D69A 1U8KB 2IC2A 2AK4D 1D6VH 1ZA6A 1JF5A 3VXUE 2X70A 4Q6YA 5IV2B 3BPOB 1X9QA 1T3FB 4Y4FC 1X5KA 4ZTOH 1T1WA 3FQRA 4EXPX 1XIWD 4BUGA 4YHML 4DCQB 3ARDB 2AJXH 3TEUA 2HTLC 1FG2B 1D9KC 3KXFB 1YECL 4KQ3L 4M5ZL 4YHKL 3EUUA 1JZ5A 3NTCL 1HSBB 3ARUA 4U6HA 3W9DB 1BOGA 3X17A 1OB1B 3KLAB 1J8KA 4I2XB 3KXFE 2DN7A 3IFLH 3IU3B 5DK0B 1IC7L 1YQVL 5I8KL 2AEPH 4NP4L 2NTSP 4I5BA 5EZOH 4E42A 1NGWB 1T5XB 3E8UH 5JIKA 5CJXA 1ED3A 4U3XA 4NKMB 3ARQA 5E8DL 2NY4D 4I2XE 5IQ9A 5D70H 1WBXB 2MCPL 5A2FA 4X9FA 2Q7YA 5E8EA 4GW1A 2BY2A 3WL9A 3SKJL 4DVRH 3DUSB 4DUWA 3TBSB 1GGIL 2IH1A 3UXFA 1LD9B 1C1EL 3TJHC 5IFHH 3FB8A 5A16B 1NGXA 2W38A 2Y06L 1R3IH 4P4RB 3HMXH 5J0BA 3KPMB 1QLRA 1N2RB 4JJ5A 3LRSA 3L3DA 5FYLD 3U46A 2ERJC 1MELA 4WV1C 3T4YB 1D5BA 3MFFA 4ZPVB 5E5MB 4X7TB 5IBUB 4GAGL 4HV8B 4ZMAT 1I8LA 4YNYA 2OS7A 5JHDA 1MCIA 4JO2H 3FO0H 4HFWB 3EFDH 4P2OC 2XQYG 1N0XL 3QUMA 4YQXL 1QYGL 4PJBB 1MVFA 5IEKA 4XNMA 1A14L 2DF3A 5JW5B 2XICA 2FCBA 3ARYA 2DIJA 3MRGB 5KG9B 3MJGX 4BSVA 2XN9B 5E1AA 5DQJB 1H3WM 5E99L 3O3BA 1O7VA 2GUOA 5SWSB 2EYRA 4PJBE 5T5NG 2ED9A 1JWUB 4OD1L 1L4IA 4H1LA 4HIEB 2EDYA 2HJFA 4PV8B 2XN9E 1CFTB 3CVIL 1P84J 4F80A 4HMEA 4WHYH 1H5BC 3Q5YA 1D5XA 5DMYA 5SWSE 1A7PH 3L1OL 2LU4A 5ADOH 5IVOA 2J4WH 1MQKL 3MRJB 4O2CB 4QHNA 5KZCB 5H37H 5FKPB 3HRZA 4HLJA 2OCFD 4NRZB 1XEDA 3SHSA 5K9QI 4F9PC 3HMXA 4FQIL 1BLNB 1ZV5A 1UWXK 4X8JB 3FFCB 3WFBH 5IVXB 5ANMB 1BBDH 3LAFA 1BQHG 1GGCL 4ZXBA 3AMLA 3VD9A 1KFAL 1FJ1A 1K85A 3SJVD 1G6RB 1JGDB 5EOQL 3V5KA 5DEGB 4HK3N 4U6VH 1KJ2L 3FFCE 3G6JF 1JPTH 4IIQB 5DQ9B 4NQUA 5ANME 4XPGH 1FGVH 4Z7VB 3EYOA 3OJ2C 2AXJA 5LKNA 1MVUA 2P8PB 2DAVA 5DRXB 5EBLB 1MRDH 4WHTB 3ZKQD 4HD9A 4QNPE 4Q74A 4Z7QF 4GXUN 3SE3C 3C09B 4K3DH 4OIBA 3PDOA 2VUOA 5MEND 3ULUL 4Z7VE 3EGSB 1Z3GH 3BPLC 1NUNB 5DJ2B 5LAXB 5IVZA 4O4YH 4OSUL 3U79A 2VSCA 1WIOA 4OCYL 3K74B 4G7YH 5FYKH 5JNYB 1MAMH 4APQD 3S36X 1PAMA 1IARB 3GSOB 2XZCH 4OLUL 4PRDB 1S9YA 2ITDB 5HHNA 1PKQB 1LK3L 1QPPA 3RWFA 3QDMB 1TQCB 1WEJL 4WEBH 2R8SH 3CVHB 3FB7A 4MD4B 2BFVH 1PKQE 4NOFA 1I1AB 2F54B 5C0JA 4LDEB 1RVFL 5EZIL 3U4BH 3QDME 4E5XB 1TJHL 2MHAA 4PP2B 5F93C 1JGUH 1OGAD 5KANI 2VC2H 1JGVH 1K4CB 2M2DA 4MAYD 1PYWB 5EU5B 5GIRB 5KVEL 5I74B 2D31A 3ZHLA 4KROC 2F54E 4XXDA 5HGDA 5INCA 3T08A 3VXOB 3IDIA 3IETA 5H2BB 4RNRA 4NQEA 3WE6A 5I6XC 3SPVB 4F57H 3BAEH 5E03A 1Q9OB 5FUOL 4OTXL 3MRKB 3SCMB 4JKPL 1W0WA 2OR9L 3G5XB 3LEVL 3VRIB 5JPMA 1U8NA 2IH3A 1ORSB 5KOMC 4DGIH 3PWJA 4LFHD 4HGKC 3L3JA 2AS5M 2Y9RT 3IDMB 4PP1D 4Z7UF 3HS0B 4C59B 5I1GL 1YECH 4YHKH 4M5ZH 5J3HD 3NTCH 3FB6A 1R3HB 3DNKA 5C0GA 3D0VB 5DGQA 5B8CA 1B0GA 3NCBB 1OOAA 1D5MA 3TC9A 5JHDD 1UYWL 2A6IB 3ARFA 1IC7H 1YQVH 4NP4H 1EERB 5IM7A 3BMWA 2Q76A 2CDFB 3MO1A 4OLEA 4ELMF 2MNUA 2HJKB 3QI9B 2E6QA 5C0ND 4DGVL 5HDOA 1P2CA 3O6FC 4R2GC 5C08B 3MRDA 4FHBD 2B4CL 1I7TB 4J7RA 1UM5L 4GMTL 3RP1A 3LMJL 4R97C 1ZGLB 1OWWA 2G75B 2VO5A 3PF2A 4NZRL 2C3GA 2FECL 2J8UA 1MAKA 3OX8A 3SKJH 2J1KA 1J0JA 4ISVA 2DB8A 5C08E 5F3BB 1T6VN 1GGIH 1WBZA 2D03H 3D25A 2Y06H 3JV4B 5F1SA 1F5WA 2UY6A 4GKZB 4AYFA 1CLZH 3AS1A 5ESVA 1ZLWK 4A6YB 2D3VA 3MV9E 4GBXD 1NCNA 5D2LA 3N85L 5ERWB 2Y4SA 4X6BB 1T80A 5KAQF 3UBXG 4NT6B 3VFTB 4F7CA 4GAGH 3WD5L 1IM9A 5E94B 4RMQA 1NGYB 5I8EA 2I9TA 5ILTL 2PKDA 1YMHA 1Q8MA 1WT5C 1N0XH 1QYGH 5F7EL 1H3TA 3PE9A 1Z0NA 1EFXB 3D39A 3H9HB 4I3SL 2WANA 3Q5OA 2HVJA 3BGFC 2VLJB 4X6CB 5E99H 5ENWA 2NY4B 5D96C 3VMOA 1G7QB 2APFA 3RTQA 4OD1H 3ZSSA 4GAYB 4WU7B 2YSSA 3QO1B 1EMTH 3C5SB 2VXVH 1IEBA 4CADA 5DJ6A 1IGJA 4MA3A 3P0VL 1XF3B 1AGFB 2VLJE 4X6CE 4YJZL 2HJLB 1F4XL 3RGVD 1OGTA 3GI8L 4YGVB 2B0SL 5C3TA 2EXYC 2HFGH 3QBTB 4FQIH 4PUBL 1C5DB 4MVBC 4OLZL 5DD0L 2AKRB 4G5ZL 1OW0A 2QSQA 3MUGB 4WFHD 4IOSD 3FRUB 1HZHL 1F4HA 3HB3C 4YDIL 1GIGL 3QB7C 3FOLB 4KDTA 1CXEA 4QCIA 3ARBA 1B3JA 1KLUA 1SJVA 5FYLE 5DI8A 2P5EB 5CBAB 4LSPL 2G60L 2XWTA 2Z31C 3MRFB 2ENSA 2HH0L 2BC4A 3ULUH 3S35X 3HPLB 1FC1A 3I2CH 4PR5A 2IGFL 4XNYL 4EUPA 1DDHB 5AD0B 4R90L 4OSUH 4OCYH 2FJGA 3VMNA 2P5EE 3SDAD 3VGFA 1IGIH 2FATL 1W0VB 1IZKA 3BPCB 4UTBL 3O4LD 4OLUH 5I15L 5EA0H 4EDWL 2B5IC 3CFJB 4WI8A 4FXGA 1GVIA 4IMLB 1E4XL 2H32H 3EYSL 3KPNA 4BZ2H 1DE4B 1RZJL 1GGYA 3JWOC 3NCEB 1WEJH 1MCKA 3CMOH 1BZ9B 4XP4L 3ARFD 3L3KB 4KKAC 4XPAL 4OLVH 2ZOLA 3LD8B 4K55A 3I02B 4AL8L 1RVFH 5EZIH 1P7QD 2XTJD 4P9HC 3HCVB 4P23C 3PNWA 1U8JA 4UU9B 4WJ5A 4PG2C 2DJ4A 2BJML 3D69B 2DL2A 4OM1L 3V6FA 5D71L 3VE0A 1ZA6B 5GRVL 1KB9J 4DKAA 1BD2A 5DJ0A 3K1KC 4OTXH 1QTYT 1JGEA 3V5DB 4PJAE 4M93C 2OR9H 3KWWA 2VOTA 5DXWA 3QNZA 1MPAH 1FE8L 1OSPH 4LPVA 4WI4A 1T1WB 3FQRB 1JL8A 4YPJA 4PJIF 1DQDL 4KMLB 4P0DA 5CP7B 3BZ4A 3OG6B 4H26A 3TIEA 3EJJX 3ULVL 1HIML 2EDJA 1R0AL 4NO5A 4HCRL 2F53D 4MXVE 4LIQL 2P8MA 3IDXL 4U6HB 1IM9D 3U7YL 1BOGB 1UYWH 3B5TA 1TZIA 3BP5A 5BW7C 1KB5A 3HZMA 4NQVA 2QQKL 1A7RL 2X4OB 4I5BB 1YEHL 2OI9B 4EN3A 3GSWA 3D39D 3MLYH 2P43B 1I8IA 2JJSC 1ED3B 1CR9L 4HF5L 3H8NA 4UQ3B 5D2NC 3X3FH 5FIEA 5IQ9B 2KDGA 3RTQD 2FSEA 3GMMA 4I3RL 5IEHA 2WWMD 2B4CH 1UM5H 2IJ0C 3QZWB 1Q9LA 1QUNA 4GW1B 5D6DC 4QEGA 4NZRH 2HMIC 3WL9B 3UPAA 3HNSL 2R29L 3T65A 4MJ2A 4JM2A 3U7WL 2IH1B 43C9B 4J1UA 3GHBH 3FB8B 3RWIA 1NGXB 3T3PF 3NIDF 1FAIH 1AXTL 4D8PB 2AEWA 1QLRB 2R39A 3E3QE 4EI5C 4JJ5B 3LRSB 3L3DB 4RISL 2ID5A 5F9OH 3U46B 3MJ9L 4RGMB 1C5BL 1RUAL 3IRPX 1D5BB 4OCNC 1NDMA 3MFFB 3GBNL 1M4KA 3DV4A 2CSPA 3ARBD 2DLFH 2DMKA 5ILTH 2JJVA 3V6ZA 4GKOA 3U9PL 4YNYB 1UJTA 4NO0D 5JHDB 1DSFL 5F7EH 1VFUA 1NANI 3QUMB 3NA9H 4H25A 4I0PA 5IEKB 4XNMB 1JV5A 4I3SH 5DJAB 2EIDA 4JO1L 3M8OH 5I1AA 2W0KA 4BSVB 4KGJA 4PRAA 5E1AB 5JHDE 4LVHC 1CBVL 3O3BB 2D4DA 1F8TL 2GUOB 4U1HA 4BQCA 4MDIA 1PVHA 4WI9A 4FP8L 3KJ4B 4H1LB 3RZCA 5TF1L 2F8XC 2WP3O 1UM4L 4KK6D 4X7SL 3N50A 5FOJA 4XP6H 1D5XB 35C8L 3P4LA 2VNCA 3QXAA 3GI8H 5CZKA 3UO1H 3UPRA 1U93A 4KUZH 4XH2B 4RA0C 3PHSA 4Z7OE 2W91A 2XNAA 3LEXA 4QHNB 5IKCA 1WIPA 2AVGA 3HRZB 4PUBH 5EU6D 2VUYA 1BMGA 2BY0A 1QP1A 3MLXL 3IRZA 4HJJL 3F7RA 1LEKA 4G5ZH 2CMRL 4ZXBB 1B2WL 1KOAA 3ROLA 1ZKAA 2NY3C 1FJ1B 1GIGH 1KXQE 3V5KB 1FG9C 5K93A 4POUB 4KTEL 1IL1A 4OI7A 4PG9A 1CL7I 1VFOA 1BQHA 5JIIA 2ICWB 3CX5J 4LLVB 4HH9A 4YBLC 2G60H 4ETYA 4D9RD 3ULUD 4CVXA 3S37H 1BF2A 3BH9A 3PDOB 5FDYA 4N0CC 3GGWB 1GC1H 1I9RL 4XNYH 1ITBB 2FHBA 5IK3A 4R90H 4Q7DA 4KAQL 4K2UH 4OQTH 5IVZB 3RVVD 4UTBH 1UEYA 1P9MA 4LPWA 5I15H 4NRYA 4EDWH 1S9YB 3HRPA 5HHNB 3ZLQC 4YFLI 1P5VA 3RWFB 1E4XH 4NBXB 5DC9B 4HFUH 3EYSH 1F4YL 3DX9A 5JW4M 5FYJH 2NY0C 3ECBB 4XP4H 3DRQA 3CDGA 4TUJA 1I9IH 1QBBA 2FD6L 4LRNL 4RGND 1LE9A 1N64L 4XPAH 3FB7B 3VD3A 1U3HA 3TA3A 3MREA 5B3NA 1RUPL 3REWA 1M6OA 4EN3D 4AL8H 2Q8AL 5C0JB 5T5FL 5CINL 1NFDF 2MHAB 2EZ0D 4YIQA 4MQ7A 4K3JL 1KEMH 3T0EA 4WHDA 2D31B 3WJLC 5LXGH 4XXDB 3QQ4B 3PHOA 4GRMA 5D71H 5HGDB 5INCB 3IDIB 3TCXA 3IJHA 1QNZL 3IETB 4RNRB 4NQEB 3WE6B 4GKNA 4WI7A 4F7EA 1IAMA 2OXGA 4PGEA 1FC2D 1X5LA 1IAIL 1W0WB 4WFHE 1QRKA 3RDTC 5JPMB 2EDKA 1FE8H 3CK0L 3WUZA 5CGTA 4NC2B 1U8NB 2IH3B 4DQOL 2WV3A 1DQDH 4MSWA 1FNAA 4NQEE 4OQTA 4BSJA 5IVXF 3ULVH 4OF6A 1R0AH 4OBSA 3VFVA 1JN6A 3T2NL 2DD8L 2LU3A 5FFLA 1VCAA 1X5GA 2DS4A 3IDXH 3DOSA 3FB6B 4JG1L 3INUH 3LKRA 3V52H 4JO3L 1YJDH 4L9LC 4LOUC 1NUDA 3SQOL 1AR2A 4Y4FA 5C0GB 4QLRA 5B8CB 1X7QA 1B0GB 1UWEH 1D5MB 4FNLL 2ITCA 1E4JA 2DQUL 4H8WC 3ARFB 2QQKH 3MBEC 3EHBC 4FFVC 4I0PD 1A7RH 5IM7B 5F9WC 2CKBL 4KHTL 2Q76B 1BOYA 1D9KA 1PZUB 2DQGH 1CR9H 1A02N 3OSKA 1A8JH 4UTAL 1U8OA 4LSRL 3MO1B 4L4JA 1P2CB 3FN0L 4I3RH 5D7JC 4WGVB 3VDBA 3MRDB 4HIHA 5E8NA 4TTGA 2YUZA 4KJPC 4I77L 1I9JL 4NJAH 4XZUA 2V17L 3D87B 1JYWA 5GGQL 1T22A 2J8UB 3HNSH 3OX8B 1NMCC 4ISVB 3U7WH 3MLWL 1WBZB 2X10A 4FQLL 5C2BH 3D25B 2QJDA 4HUWB 1DBML 5HHQA 1A3LL 4XRCA 3LKQA 2J8UE 3TVMC 1AXTH 1KF9B 3OKOA 4D9LH 4KMTL 5EIIA 1IKFL 2NYYC 5L7XL 5ESVB 3NPSB 1RFDL 3LN9A 4ONOA 1NKRA 5D2LB 1RUAH 5J57B 5ISZD 4N0RA 3VRLE 4MWFA 4F7CB 1IM9B 2WUBH 2C4XA 5I8EB 1CICC 2I9TB 4P99A 2HT2C 4OKVA 3WS6C 3ZMRA 1YMHB 1F6LL 1LO0L 1DSFH 5D2LE 3B5HA 3S6CA 4FQ1H 1HNGA 2VLRA 4X5WA 3UBXA 2Z93A 5EOCJ 1CTOA 3LPGA 2CPCA 3D39B 4JO1H 3S3PA 2R9HC 5TQ0L 3FHAA 1Y18A 4WV1A 3U0TA 2XWJA 4XP9L 5A43C 1CBVH 5ENWB 5E4IA 1I3UA 2CK0H 5HD8C 3MUHL 2AP2A 3RTQB 4IHOA 2XPGA 2YSSB 3EDKA 2YA1A 5FUZL 2AK1L 3D39E 4P2OA 1IEBB 4C58B 5DJ6B 3WLWD 4CADB 2FX7L 1UM4H 1IGJB 4MA3B 2ZUSA 3IFPB 4MDJA 3OTTA 1OGTB 1O5DT 5GSVA 5F96H 5I1KL 3HMWH 3SDXA 1G9NC 1T4KA 2QADC 3Q3GB 1LE5A 3RVWC 4HJJH 2IQ9L 2YRPA 3LPFA 5J89A 4M3KB 1H5BA 2LTQB 4Y88A 4JFHD 3ZSTA 3MRQA 1NEZG 4LCUA 4F15B 4KTEH 4UOW0 3VXMA 2ATPA 4QCIB 3ARBB 1SBBA 4NN6C 4TTDD 5DJXA 5F6IC 1NMBL 4KI5D 4ZS7L 4F9PA 1KLUB 1OP5H 5DI8B 3WN5C 3EJYC 4POZC 5EWIL 1T5WA 4GRLC 2XWTB 2YC1A 1LK2B 4M6OL 2BC4B 4KK8D 4PR5B 1WBYA 3O2WL 4JG0L 3T2PA 4EUPB 2RQ8A 1IAOA 2NXZD 2FJGB 3BP7A 1TZGL 4NHUB 4D2NA 3DV6A 4HWUA 3HAEG 4XPFL 3SE3A 2DQIL 3NFSL 4FXGB 4K07A 5FYJD 1F4YH 3RWDA 1WTGT 2VZTA 3C8KA 5JUEL 4EKXA 3CNKA 1S3KH 1UKTA 2BVYA 2FD6H 1N64H 1RUPH 5EU6B 4JFOA 2Q8AH 4GG6A 2ZOLB 1D9KD 1NCWL 3BIAX 2W07A 4PPTA 3NCCB 3TGXA 3GSNL 1MCHA 2FL5A 3PNWB 1U8JB 3I84A 4K3JH 4WJ5B 1T66C 4XPBL 4WW2B 3TESA 1HINL 3BDXA 3V6FB 3MXVL 5CAYB 5KSBA 3VE0B 1U3JA 4HBCL 1ZK9A 1QNZH 2BSTA 5FCUL 3RY6C 1BD2B 5DJ0B 2VAJA 1UXWA 2PR4L 1IAIH 1U2HA 1JGEB 5IUSA 2AJUH 2YD3A 1E6JL 3KWWB 4LPYA 3FQWA 5D1XC 1X44A 5AZEL 3CZJA 3QNZB 1BVKA 5EU4A 3ZE2F 1G9MC 4DQOH 2VQ1A 3SE8L 5DQDL 4JE4B 1EHNA 3NACL 5D8JL 1BD2E 4OFIA 4H26B 4HUUA 2AEQL 3GB7A 3TIEB 4ESKA 4Q9QL 3T2NH 4X4ZA 3QRGL 2DD8H 3SDDA 4AENA 3C6LC 3T77A 5A1AA 5DEFA 4JO3H 1YDPA 5IFAL 1CS6A 1YMMA 1OAUH 3J7HA 1IGYA 1TZIB 2DQUH 3BP5B 2XKNA 5I19L 1KB5B 3DVIA 3HZMB 4NQVB 4RGNB 2VLRD 2ZNWA 2ZKHH 4X6EA 4KHTH 2EICA 5BVPL 4FZEL 4EN3B 1KENH 4S1RH 1I8IB 4N0UA 3OB0K 3LDBC 3KPPA 4MQXC 1AC6A 4UTAH 1BQSA 4LSRH 5D5MA 2BVPA 1WFUA 3GI9L 2FSEB 3GMMB 1AO7D 4POYA 5IEHB 3B43A 4I77H 3FT4A 4P2OD 4NRXA 1Q9LB 1PY4A 3AB0B 4Y89A 3U0WL 3T65B 2DQEL 3MLWH 4UQ2A 5F7UA 5FXCH 2P7TB 1Q0XH 4JREB 3F7VA 1DBMH 3O6FA 3RWIB 2IF7A 3MLZH 1RIHH 2CKNA 4OZIF 2G2RA 3QJFA 2VDPL 1IKFH 1PLGH 3T3ME 4I3GA 5L7XH 5FCSH 2Y36L 2C3HA 4HXBL 1KCLA 2ZCLH 1DLHA 3FQNA 1NDMB 1QLEH 5ICYA 1YEFL 3DV4B 3V6ZB 1AHWC 1HH6A 1LO0H 1Y6KR 3ZDYE 2I24N 4BA8A 4LSUH 3HI6L 1E4KC 2Y72A 4DKEL 5I76A 4H25B 1QKZL 3MRBA 4I0PB 3W82A 3CDCA 1A3QA 1JV5B 4UT7H 2OTWA 1IGCH 3PABB 5JMOC 1PX4A 4M62L 5I1AB 4XP9H 3QXTA 4FRWA 4PRAB 3MMEA 3OV6A 12E8H 5LWYL 5F7FA 4U1HB 4XCFH 3EO9L 3H3BC 2W92A 4WFGD 5ITBL 1WT5A 1NAKH 2FX8L 1H8NA 1JGLL 5JW4Q 5HHOA 1JHKH 1NKOA 3QXAB 3CFDA 2IPTH 4RBPK 2DMCA 1OAYL 3UPRB 1BQLL 3OAZK 1U93B 1HKLH 2EDOA 2XNAB 3LEXB 3V8CA 5IKCB 5B22A 1JUFA 3C5JA 1JBJA 2VZ1A 2V5RA 3HFML 2PW1A 5GS0L 3AFLA 5GGTH 5FV2A 5IESL 1LEKB 2DWDA 1ITCA 4ZOAA 4XVUC 3ROLB 2QQLH 5J13B 4GXVL 2GT9B 2GW5A 3VFSA 2VABA 5D1QC 2APXA 5KOVC 1MHPH 1IL1B 1NMBH 4ZS7H 4IRSA 3MFGB 3TN0D 1A6UH 3OKEA 4PG9B 1BWWA 3WFZA 1XZ0A 1BQHB 4J3VA 5EWIH 4CU6A 2GEEA 4HH9B 2M8XA 1HWHB 1K8IA 4CVXB 4M6OH 2DQFA 3GUTA 3BH9B 3DURA 3O2WH 4JG0H 3ULSA 2VXQH 4MD0B 5IK3B 4YDKH 4MJIA 1NGZA 1C08B 3SDDD 1IC4H 1ZANL 4NRYB 4ERSH 4XPFH 2ZCKH 1F45A 2Z31A 1YMMD 5C71A 3WYRA 1Q1JL 3DX9B 4OZFG 4HG4J 4Y19A 3DRQB 2A1WH 1FFOA 2I27N 3CDGB 4TUJB 1LE9B 1U3HB 3MREB 2YPLA 3REWB 4B41A 1Q72H 2OZ4L 1S7XA 3EYVA 3MJ7A 5HHMD 5J12B 3GSNH 3OQ3B 4WCYL 3EYUH 4YIQB 4MQ7B 5CIPA 3E2HC 4XPBH 4LPCA 3T0EB 1G7LA 3PHOB 4GRMB 4YUEH 1KIPA 3SKMA 5FCUH 3IJHB 3NFNB 4OUUA 4Z0BL 5HHXL 4GKNB 2C1PA 2PO6C 4F7EB 1K5NA 1MF2L 4JFHE 3GNMH 3MLUL 3OZ9L 1HQRA 4BELD 3T0EE 3I6KA 4JKMA 4X9GA 4NO3A 1P7HL 1OM3L 4PG2A 5D8JH 1XGPA 4MSWB 3N06B 4KI5E 2AEQH 1A6WL 4LQ1A 4Q9QH 4K7PL 2NXZB 4QGTA 1KIRA 1UJ3A 1G1CA 3VFVB 5C2UB 1JN6B 4MAUL 3RI5F 5DF0A 3S34L 1LP9A 4JFZL 2ZUUA 2UYLA 4ZS6D 3U30C 3DMMC 3LKRB 5IFAH 1VGKB 4Y4FB 1KPUA 4XWGL 4XBGB 1X7QB 2EECA 4GMSH 1Q94A 4GG8B 3HNTL 4W68A 3P3YA 4G9DA 2ITCB 5I19H 3NCYP 5FGBC 2BRRL 3TNNA 1D9KB 4NN7C 5MERA 5B21A 3P40A 1MCNA 1U8OB 3A67L 5L8JB 2ATKA 5FOBA 4EBQL 3TF7C 2X4TB 4JGJA 4HIHB 5E8NB 2BOBA 4XZUB 5BW7A 5I18H 1NBZA 3RI5K 2DQEH 4M1CD 1RZFH 3CSGA 4ODSH 2JJSA 1G1YA 2AQ1A 4KU1A 3AS0A 3SO5A 5D2NA 3AROA 2D0GA 3QEGL 5CP3H 1U92A 5ACZA 5HHQB 4J6RL 1XR8A 4XRCB 3LKQB 3MRMA 1MCBA 2H1PL 2VDPH 2Z8VC 3OKOB 43CAA 1ZLUK 3V95A 5EIIB 2Y36H 5D6DA 4KRLB 1YC7A 4HXBH 4L3EA 3N1GC 4I13B 5EB9A 3HHRB 3V4UL 4MWFB 2G9HB 2LABA 2YD9A 3TYFA 3RAJH 4QRTA 4IRSD 4OKVB 4JDTL 1JPGA 4BFGA 4M43H 3HI6H 4MVBD 1RZIA 1U36A 1QKZH 3HE6D 2VLRB 1FORL 5FM8A 4X5WB 3UBXB 2Z93B 4EI5A 1XF4A 1IQDA 1KGCD 4MNQA 5E6YA 1MFAH 1UZ6F 1Y18B 2ERJB 2AW2A 4WV1B 3U0TB 1U3ZA 2XWJB 1DANU 5D7IF 3EO9H 4DJMA 5C0AA 2VLRE 4R26L 1TETL 5ITBH 4PD4K 3CLEH 4P2OB 2FX8H 4KDVA 4PJFF 4JCMA 1JGLH 3B6SA 4YDJA 4CDHA 3FQXA 5IHZB 4MDJB 4ODBD 2NMSA 5I1JL 2VDLH 3V5HA 1BQLH 4Y19D 3QP3A 5CP3A 5GSVB 3MOBH 2DQJH 3WDHA 5DMGD 3SDXB 1WICA 1TTUA 5MEOA 2Z8RA 2YPLD 5ELIA 1T4KB 3MLTA 3VXSA 4NCDA 5GS0H 1LE5B 4FFZL 4ZFGL 4X9IA 5IESH 1S7UA 5TQ2H 3VI3E 2UUDH 1ZLSH 1FLRL 3CJJA 1H5BB 1RUQH 3SDXE 5GJSH 3MRQB 4GXVH 1HE7A 4LCUB 4CN6A 3VXMB 2ATPB 1T0NA 4JFFD 4KKAD 5DJXB 5CBEA 4CL7A 2I07A 2CDEB 1NEZA 1T5WB 1WAAF 4S1QL 2YC1B 3VXME 4UBDD 1WBYB 4P9MH 4DFHA 6CGTA 2ENYA 1IAOB 1S78C 3BP7B 4X8XA 5D6CA 3FMGH 3QIWC 4EJ1C 5GPRA 2AV1A 3DV6B 5IHBA 3EJZD 2NY7L 4W81A 6FABL 3C8HA 4XCYA 2FZ3A 5DZNA 5TH2B 3RWDB 5IJKC 3IXTA 3C8KB 1FNSL 1G84A 1IRAY 2H6PA 4WFFD 3BPLB 5IBTH 3SN6N 2ZZUT 1F00I 1QBAA 5F9AC 3T0BA 2J5LB 5C07D 4JFOB 1ZT7B 1GGUA 3HAEA 4GG6B 4TNWK 4YR6A 2OZ4H 2AGJL 1LQSR 3MRPA 4XXCA 4EVNA 2X9XA 4WCYH 3K80A 1ZEAH 4X83A 4WU5A 2BRQA 2FL5B 4NFDA 1SYSA 4PLKC 1IGFL 2Y5TA 2BZDA 4GG6E 2VZUA 5T3ZL 3TLRA 2GY7B 5KSBB 5HHXH 4Z0BH 4J3WA 4UINL 2BSTB 1KLFA 1UXWB 3S36L 1O0VA 5MI0C 3TT3L 5BVJB 3MLUH 3B9KC 4K23H 1CLOH 3FQWB 1PDKA 4BK5A 1BVKB 3KHOA 5EU4B 5FM5M 3EOAB 5GISH 4ZAKC 1OM3H 5KSBE 1T03L 3B5GA 3GIVA 2YEZA 1A6WH 2IPUK 3LIZL 4KUCD 4KROB 1NCDL 3WJLA 1A4JA 4HUUB 3GB7B 5J4MA 4AIXA 3KPQA 2CRMA 3FN3A 4MAUH 3S34H 2HMID 5I6XB 3SDDB 4AENB 4QWWD 1CGWA 4L3ED 1QSZA 3L3OA 4JFZH 4OCWL 4N0FA 3T77B 5DEFB 2EE6A 5F6HI 1F02I 4M1GL 3RDTA 1YDPB 1YMMB 4XWGH 3HNTH 5KANG 4G6AC 1GYAA 1IGYB 2XKNB 4LVEA 5JZ7D 1ND0A 2BNQA 2OTUA 2BRRH 3W11C 4X6EB 1NSNL 4EI5D 3PWUB 1YMME 4MNQD 5HHMB 4N0UB 3KPPB 4EBQH 2VDOL 4NBYB 5D5MB 2BVPB 4L9LA 4PBWD 3O11A 5C0AD 4P5KA 4IOIA 2WW8A 3SEPA 1YPZA 4J3XA 3FT4B 4CN1A 4NRXB 5HHME 4N0UE 3MBEA 3LN4A 3QEUA 3ZZ1A 2R69L 3EKCA 5D5ME 4Y4KD 1VPOH 4UQ2B 4H20L 3PWPD 3K2UL 1P4IL 2X1WL 1G9EA 2Z91A 2JJWA 1X4YA 5E6ID 3F7VB 3GDBA 1DUZA 4R2GB 4J6RH 5D7JA 5DD5L 4ZSOA 2H1PH 2G2RB 3OJDA 3QJFB 2VDNH 5DR5L 3GJFH 4R97B 5I73B 4K9EH 4QTIL 4WW2F 3MYZA 2FGZA 3AVEA 1BX2A 3V4UH 2WUCL 1DLHB 3FQNB 5ICYB 1TITA 3NVQA 4TUOA 2FYYA 5A40E 2VZ3A 2DQDL 4ONFH 3IS1X 1HH6B 1FSKC 2VLKA 1A5FL 3MJ8A 1H3GA 1M7IA 3ULUF 4HXAL 4DGYL 4I8DA 5I76B 3MRBB 4IOFD 2VDKL 2OTWB 2NY3D 5JHLL 1KTLA 4FQJL 3JV5A 1J05B 4LLAA 4MA8L 3MCLL 1CICA 4CJ1A 1J0HA 3WS6A 3OKDA 4R26H 1TETH 3DO7A 4WWID 4PV9A 3BISA 3JZ7A 1KJMA 2OK0L 2VH5H 1IC1A 5L8LB 2R0WL 5HHOB 2FR4A 4N0CD 3ARXA 3CFDB 4NUGL 3QXWA 5F97E 3TBWA 2EDBA 1Z2KA 2A73A 4RRPG 3BGFB 4O58H 1FQ9C 2A9MH 3QFJA 5D96B 3H3KA 1YEGH 1NBVL 4LSQL 5GS0D 1JUFB 3C5JB 1HYSC 2CRIA 1OY3B 2F5AH 5HHOE 4FFZH 2IFGA 3WKML 5JR1H 2PW1B 5H35A 1FZJA 4ONHB 2PTTA 1N4XH 3JTTA 3NIGF 1JFQL 3U0PA 1FLRH 2DWDB 4MS8D 4OZFH 1NJ9A 4P5MA 1RJYA 4D0DA 3VFSB 2VABB 1MJJA 3P4MA 4RQQA 1D7FA 1REIA 5F7WC 1VADA 3RX7A 4IRSB 5C0DA 3UJTL 5C0EA 4PJ5A 3OKEB 1XZ0B 3MV8A 1MSPA 2CR6A 4XBPA 1MWAL 4S1QH 3S97C 1K8IB 5DLML 5KS9A 1HCFX 2OJEA 4O00A 1IE5A 1UZ8A 2UZYB 3OKKA 3ULSB 1D3CA 3DWTA 3BEWB 3QXVA 4MXQD 1XT5A 3NN8A 4V2CB 1NGZB 4XPTH 5JOEA 4NJ9L 1BVLA 4CBPA 4MLSA 1WITA 3WN5A 2NY7H 1KGCE 1VERA 3DI3B 3KAAA 2OR8A 3BJ91 1T04A 2YD1A 2Z31B 4MJIE 4HEPG 2VL5A 1DBJL 3SGKC 1FNSH 1TNNA 1CVSC 5I9QC 5GGRA 4Y19B 1FFOB 1MH5A 1C5CH 5DD3L 1FFNA 3QIBC 1SJEA 4IIQC 4XNUL 2YPLB 4D3CH 4ZUSA 1P4BL 3LH2H 3MQIA 3EYVB 3MJ7B 2RAMA 1GGTA 1UH4A 3KGRA 3QG6A 2B5IB 4OZFA 5HVWA 1IAKA 4Y19E 3M17A 1ZSDA 4LOUD 1S7RA 1RULH 1WC7A 5CIPB 3S35L 2HLAA 4OV5A 1MIEL 5GGUA 2YPLE 1G7LB 3TPUA 3BD4A 1KIPB 3EBAA 3T0WA 4FFVD 4OUUB 3ROOA 3S36H 3CC5A 2C1PB 3TT3H 1K5NB 4U1LA 1KJ3H 3DYMA 5I1LA 1HQRB 3I6KB 2CUMA 4NO3B 3SY0A 3DXAA 5D7JD 1XGPB 5HJ3A 3W5NA 1TQCC 4KJQD 1NCDH 2HG5A 5A3IC 5DVKA 4WWKC 4Y1AA 4AG4H 3O2DA 1KIRB 1UJ3B 3HG1A 3H42H 3RY6A 3QJHA 1F58L 3V7AG 4OCWH 3EFFA 1RZKC 3NABH 4OFPA 1T0PB 3MUY1 1LP9B 5F6HJ 4YZFE 4LAQL 4M93B 4M1GH 4GOSA 2XQYK 4PRHA 3PGDA 3PQYD 1KPUB 1U95A 4JVPA 4YFEA 2VLKD 1Q94B 4PJGF 1CXKA 4OM0L 1XGYL 5B3JE 4G9DB 1NL0L 3I9GL 1LP9E 3RVUD 1NSNH 2W0PA 3TNNB 1LO2H 1DBBL 3C6LA 3CPLA 4OLWL 3H9SA 5MERB 5IR1A 3A6CL 2VDOH 2ATKB 5FOBB 3BVNA 3K8KA 4NYLB 1CICD 2HT2D 2NPLX 4G8EA 1B4JL 4JAMA 1UH2A 2BOBB 1MFBL 5GS3A 1NBZB 2R69H 4M5YL 4B7LA 5B4MC 1NLBL 2KBGA 4KJYA 2V9RA 3FONA 1AP2A 2R9HD 4ENEC 5DJDA 3K2UH 3P73A 4EOWL 4XVJL 5CEYB 3E1F1 5D2NB 3BN9D 2LVCA 3VFNA 1U92B 5DD5H 2YK1L 4UB0L 5ACZB 3RA7H 1TTFA 4IDJL 1XR8B 1OF2A 3MRMB 1CE1H 1U8QB 2ZJSL 43CAB 3O9WC 3DHMA 4CRPA 4DVBA 1RZ7H 2PXYD 5D2NE 5IBLC 4AMKH 4L3EB 3FJTA 5SX5H 5T1DH 2DQDH 5B39G 3TO4C 4KI5F 1ZLVH 4QRTB 1A5FH 3TWCL 1JPGB 3KG5A 1RZIB 3B2UC 4L3EE 2QL1A 4LAJH 3QEQA 3KPOA 3EDFA 5CZVL 2VDKH 3CU7A 3SBWC 4EI5B 1SJXA 1XF4B 1IQDB 4MNQB 3V2AR 1Q9WA 1IFHH 4FQJH 4YBHA 2GAZA 1EHXA 2QR0A 4OQ1A 5J56B 3MCLH 3I3DA 1FDLH 5C0AB 1AHWA 1XIWC 2R2CA 4HAGA 1EHLL 2VXUL 4JM4H 1TVDA 3QIUD 2JF1A 4ZFOA 2R0KL 1WVZA 4OF7A 4DUVA 2OK0H 3LOWA 4LLUA 5KVFL 1E4KA 4MNQE 3B6SB 2Y6SD 4YDJB 2BXZA 2R0WH 4X5LA 3FQXB 5TDNA 5A2JH 3G6JA 3R06A 2A9NL 2KZ1B 3LCYA 5C0AE 2HN7A 3V5HB 5T3XL 1CIDA 3MNZA 3K4AA 1IM3A 5HDQL 4I9WD 2XYCA 5E6IB 5DO2D 5MEOB 4LSQH 3RVXD 3PP3H 3H9ZA 1MNUL 3MLTB 4LGSB 2QSVA 2APVA 4PTTB 1S7UB 1T7VA 4LQFL 4LPUA 5BZWA 3MRCA 1NGQL 3UEZA 5AG9A 3F7QA 4PJ8D 5AWNL 1IKNC 3VXSE 2P45B 1T0NB 3RY5A 3UJTH 1A9EA 3H3PH 5CBEB 3OAYK 3V6OC 3AC0A 2Q86A 3WFHA 2LV4A 2OX5A 2I07B 5HYQA 3C08H 1NEZB 5DLMH 3KS0J 3RBSA 5KSVA 3O3DA 4EI6A 4F7PA 5EU3A 5FGCB 4PJ7F 3ULVF 4P3WA 2NY3B 5KVDL 1DQML 5TJWK 5DURD 1BAFL 1WWBX 3V0WL 5D1QA 5DVNA 1S7VA 3KPTA 2L0DA 2A38A 5MP6L 3HG1D 5D6CB 4U1JA 4OZ4A 2AV1B 1UCBL 5FGCE 3D85A 3GEWB 1QR1A 4YBLB 3QT2A 4PRHD 4XCYB 3LEYH 2FZ3B 4PREA 4HZLA 1CI5A 3JBG7 3IXTB 4NQDA 5D4QA 2H6PB 3AREC 2R4SH 1JVKA 3QRFM 3HAEB 4YR6B 3F7YA 2V5SA 3MRPB 2NY5C 5ICZA 4EVNB 1E6OH 1JPSL 2OBGA 1R3KA 5DS8A 1OAQL 2UZXB 4WU5B 2DLTA 3S35H 1AD0A 4NN5B 4P46D 1SYSB 5IB1A 4I0CC 5AAMA 3UAJC 4Z7UA 1F4WL 2ZSWA 4X99A 2NY0B 2Y5TB 4KZEL 1T2XA 2EH8L 3GMQA 1IC5H 2VITA 3FB5A 3P9MA 4R3SA 1MJUH 4GRWB 1BPVA 5FO7A 1DFBH 1MAJA 4FTVA 4WEUD 1JZ7A 4OZHF 5CJQL 5CEZH 3GIVB 3C5ZC 5D7SH 2YEZB 3HKFA 2QV2A 5HI3D 5JOFA 1A4JB 3KPQB 4FG6C 4JN2A 4GRWE 4MB5A 4ELMA 2FH8A 4G6ML 3NH7L 3OG4B 4WNQA 2PO6A 3L3OB 5TE4H 5JW3L 4N0FB 4NQCD 4UILL 1RJCA 2WP3T 3RDTB 3E6FA 4P3CL 2Z9TA 2UY7A 2AJ3A 3IB4A 2AXGA 2BSED 5E5RB 4HK0A 4RFNC 1DLFL 1NL0H 3I9GH 1LO3L 1ND0B 2OTUB 1OP3K 1F3JA 1T89C 1DBBH 1I3RA 1FGNH 4ZD3L 5ACLA 2JJUA 4P9HL 3VXTA 3S7GA 5ALCH 2G5BA 3DMMA 5CWSA 1PFCA 4L9LB 3O11B 5DK2A 4P5KB 5IW3A 1YYLL 4IOIB 1MFBH 4TOYL 1YPZB 5DMIH 3TJEL 5HYJA 2D7QA 2IBGA 3ZYJA 5FGBA 3LN4B 1NLBH 3QEUB 5F9WB 4APQC 1RIUL 1V3JA 4EOWH 2R15A 3D48R 3UTSA 2WM0A 1YPZE 1RUKH 4YHOL 1RUML 5IMKA 4UB0H 2FX9L 3B8SA 1DUZB 1IMHC 5D7JB 4XB7A 5GRJH 4ZSOB 2BDNH 4XNXL 3OJDB 3H7BA 3VI4F 3ZDZE 5LCVL 4K3GA 4PB9H 1RD6A 4QXUL 4YHLL 1UKSA 4L5FL 3AGVA 1BX2B 4Z7NE 1NMCB 5TDPA 1KV3A 3MODL 3GRWA 1Y6NR 4ZSOE 1SY6A 4TUOB 2FYYB 4U1KA 4GLRI 3DSFH 2J6EL 1PD6A 4ORGA 2VLKB 3DPBA 4MAYC 3MJ8B 1M7IB 1YEKH 2WNGA 1U58A 3LKSA 2E6JA 1NCAL 3VD5A 3DI2B 4E41A 5CZVH 3K7UA 4XVUD 1KTLB 5EOCL 2VLKE 3DSNA 2VZSA 1CICB 5FA4A 3KPRA 3OKDB 3THMH 3DO7B 4OT1L 4PV9B 4YBQD 4BQBA 1KJMB 3D85D 3TYGL 4PP1C 2AJSL 4NWTH 2A9NH 5KJRL 2FR4B 4BSWA 1DL7H 3DHJA 4NQDD 5J3HC 3TBWB 1SVCP 2A73B 3HN3A 4BZ1L 1YZZA 5HDQH 3QFJB 4OCMC 2NY1D 5I17A 3DX8A 1UACL 4JFQA 3WHE1 2D7TL 5JORA 4M6ML 4JHWL 4MD5A 1SEQL 4NC0B 1YYML 1RMFL 4YHYC 3Q48A 5LGJA 5H35B 5C09A 2PTTB 2YKLH 3JTTB 3U0PB 4U1MA 3TPKA 2ARJA 3R0NA 4HKJA 4RRPA 1NGQH 1P69B 3QFJE 2NNAA 1NJ9B 4IBLT 4P5MB 1RJYB 1KCSL 3GMRB 1MJJB 3P4MB 3NZHL 4RQQB 2E8YA 3P30L 3SOBL 1NCTA 1VADB 1J10A 1SVZA 5C0EB 5C0DB 4PJ5B 1CL7L 3MV8B 1KIQA 4XBPB 4NM8H 2OYPA 4KHXL 3ZTNH 3G04A 1FNEA 4K8RH 5BV7L 5KS9B 1J87A 2OJEB 2XZAH 4PJCA 5KVDH 1DQMH 3V0WH 1BAFH 1UZ8B 4KKLD 3OKKB 2V2TA 3R1GL 4PJ5E 4Q0XL 4QHKI 3MV8E 4GH7B 3NN8B 3MLSL 2O61A 4NN6B 1BVLB 4Q2ZA 5F6IB 4CMHC 1UCBH 2PO6D 5KS9E 3OXSB 4P5TD 4P2CG 3WN5B 5GS2D 1I9EA 4PBXA 1T04B 5JQ6L 2X4QA 4GBXC 2DJUA 3MJ6A 2VL5B 4S0SD 5GGRB 3VG0H 3RWGA 1MH5B 4LPXA 1FFNB 1SJEB 4HLZG 1J11A 3D2UD 3QIWA 4ZUSB 1AKJA 4PJIA 3QG6B 3UYRH 1OAQH 4OZFB 3DMMD 1IAKB 3M17B 1ZSDB 1L0YA 1S7RB 1WC7B 4NM4H 2HLAB 4OV5B 1SEBA 5DA4A 3D3VA 4KZEH 3IFNH 5IJKA 3NGBC 4PJ8B 5HYJD 1LWRA 1T83C 3DVFA 4FFYL 3KYKH 4AT6A 1XCQA 3P11L 3IU4L 4U1LB 3UTSD 5I1LB 2ZUTA 1YY8A 5K33A 3BH8B 2R2HA 3QPXL 5CEZD 5ID0A 3SY0B 4BFEA 3DXAB 2GHWB 1NAMA 2NX5A 3WXWL 5HJ3B 3RGVC 5HVHC 32C2A 4G6KH 5DURB 2HG5B 4WUUA 1EO8L 1FZOA 4Y1AB 3C6SA 1FIGL 3NH7H 4G6MH 3HG1B 4RDQF 4ZUWA 3U4EA 3EFFB 1TENA 2GSIA 4MLIA 3WFCL 3DXAE 2PUQT 4V1DA 3B9KA 1X5ZA 3ME0A 4P3CH 4PRHB 1FVCA 3DVNA 4QXTB 3PGDB 4Y1AE 4ZAKA 1U95B 4JGUA 5IW6A 5CILL 3HG1E 1LO3H 3MROA 3H6JA 2XZQL 3TH3T 1SYVB 4E41D 1S7TB 4U1NA 2CH8A 1NDGA 4ZD3H 3BKML 4PRHE 2DDQL 3C6LB 3CPLB 5L9DH 3H9SB 5GJTL 3DYOA 4D0CA 3BVNB 1R3LA 4LU5L 1YYLH 3HZKA 2AV7A 4G8EB 4TOYH 2V6HA 2Z8SA 4U7KA 4QRRA 3TJEH 5HHPA 2XACC 4CNIA 1CYGA 4ZODA 3H9SE 4R8WL 2V5MA 4B50A 3X3GL 3SDAC 5JDJA 4KFZC 4DZBA 4QY8A 3C2SA 2R23A 1RIUH 2PW2A 4M03A 4KJYB 3FONB 1AP2B 5CJBA 4F58H 5IV2A 3LDBB 3P73B 5DJDB 4YHOH 2DTMH 4OGYH 5DRNA 1TDQA 4LEXL 1U9KA 3ET9F 3VFNB 1INDL 3K46A 3TBYA 1OF2B 4GAFB 5C09D 5LCVH 3ZL4L 3RVTC 3ZDXF 4QXUH 1CDIA 4YHLH 4L5FH 3MODH 5D7LA 2XTJC 5FV1L 2QTEA 1TQBC 2XA8L 2HWZL 1AGEA 3W9DA 2FEDC 2J6EH 4HWBL 3BT2L 1YA5A 3RX8A 3RY4A 3WIHL 1KCUL 1OB1A 2E7LC 4EDXA 5J6HA 1NANH 1BFSA 4MHHI 1S5IL 3CFCL 4N90D 3KPOB 5E4EC 4HBQA 4XAKE 2GYSA 1LO4H 2UWEB 1DVFA 5B39A 2C7UA 5EOCH 1ORQA 1VHPA 3QYCA 2VQTA 4LASL 2GAZB 2QR0B 1P53A 1AHWB 4OT1H 4HPYL 1FO0H 4ZFOB 2VR9A 2IAND 2UWEE 3IAQA 4LLUB 3TYGH 3H0TA 4XHJD 2EDWA 2AJSH 3GIZH 3NPSC 5TDNB 3LKNA 1JZ6A 3R06B 1CDYA 1CFVH 1Z9MA 4LSTL 2HN7B 4BZ1H 1J9CT 3ZO0A 3TBSA 5JW4R 3MNZB 1QFWI 1LD9A 5DJYA 1S78D 2D7TH