1RJYB

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Structural Basis for the Restoration of TCR Recognition of an MHC Allelic Variant by Peptide Secondary Anchor Substitution
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 15
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rjyB00
1I1FA 1RZ8A 5DVMA 4IOSD 4JFOB 4V2CB 3ZKXC 5BMFH 5C71A 2EXWD 1NMCC 15C8H 4BQ6A 5DEFB 5KVDL 4AMKL 3O6KH 1DQLL 3NGBB 3QUXB 5K9JH 1T6WA 4HH8A 1GZPB 3KG5A 4GRMB 4PJFA 1P69B 4YDIL 3MRCA 3HE6A 1XF1A 1V7MH 4IDJL 2VL4A 2BVTA 1BIHA 5TQ0L 4LSVH 3EIFA 4QRSA 5HJ3B 4QYOA 3BYYA 2X1QA 5FGBA 4RAVA 4TNVF 2NY5H 4MA3A 5T1KA 4LU5L 1SM3L 4I9WD 3OJ2C 3SO3B 3LRHA 4PRNA 4KRPC 4HCRL 4PJFF 3LH2L 4UT7L 1IAMA 1OAXH 2RQ8A 2E8YA 2V7HB 2JK5A 2QQNH 4JPKL 5IHUH 2AEQH 2O93L 2E3VA 4IOIA 1YDPB 2G60L 4XCEB 2ITCA 5IVZB 5CP7A 3DX7A 4XNUL 3WXVL 5I73C 2J6EL 3C8HA 3PJSA 4X6CB 1EUUA 1SJVA 2C3GA 4BQ8A 2VXTH 1NFDB 1A1MA 2ARJQ 4GOSA 3TCXA 3DO7B 4W6YB 2A6KB 5BZWB 5JDSA 3WNLA 5C0AB 1FG9C 3O45B 4UV7H 2OLDA 1SYVA 5EIIA 3ARXA 1Z0NA 1IGTB 4AMKH 2ICES 1DQLH 3VMPA 1MCPH 2NY2D 1P5VA 4JFFB 1DL7L 4DW2H 2C3VB 5HHOB 2HFEB 2KZWA 4WV1A 5DRNA 2F58L 4EOWL 4YDIH 4OZHE 4RGNB 3X11B 5GS0L 3Q5OA 1MAJA 3I75B 4IDJH 3BZ4B 1AGDB 5E94B 1INEL 4ZFOA 5TQ0H 3N1GC 2V2WA 3P4OA 1LHZA 3K1DA 5FB8A 1OGTB 1SM3H 1UXSA 4MWFA 5IFJB 5IROA 4IRJD 2EO9A 3U9UB 4NQXA 5DRWA 2OJZL 3LH2H 1MRFL 1S7VA 4UT7H 5C08D 3ARED 5CEZL 4Y4HB 4JPKH 4X6BB 3D0VB 2J8UE 1MAML 2Z8VC 4OCYL 5I1LA 2G60H 1J0ZA 2DB8A 3OKNA 1QSEE 3GBML 4K9EL 5MEOB 3WXVH 2J6EH 4Z7NE 4KTYA 5F7UA 4DKFL 4TPRL 4HW6A 3BZFA 1NJ9B 1HXMA 4IOFD 4P23D 2B5IB 4ZS7L 1DL7H 3NIDF 2CRZA 2F58H 2R2HA 2B2XH 5EU5A 1A3RL 4NOBA 1X5LA 3PGDA 5DQDL 5GS0H 4NRZB 1MFEL 1CE1H 4TYUA 1INEH 5DVOA 4K2UH 5BRZD 3TWCL 5BVJB 4FFYH 1ZSDB 5LQBH 3RGVB 3CSPA 4JVUA 4V1DA 2BVPB 4L9LB 2XWTA 1KB9K 2OJZH 2EYRB 3QUZC 2EDJA 5GRUL 2AXGA 5CEZH 3C09B 2VLJA 4L3CB 1RV6X 3KPSD 3FCTA 2XQBL 4OCYH 3HMXL 4X7TB 5C9JA 4EN3A 2XTJE 1HQRA 1FFNA 3RFZC 1QUNA 3GBMH 1K2DB 1CE6B 3VJ6A 5BQ7B 4DKFH 4F33B 1JYWA 3HPLA 3EOBA 4TPRH 5GS1A 4UDUB 2QQQA 1LEGB 5J6HB 4JFXA 2LFGA 4KZDL 1PVHA 5CSGA 2EXYC 3I6GA 1OM3L 4ZS7H 4NKOA 2DD8L 4A6YB 4G80A 3RJDA 4MLSA 1PY4A 4J7RA 1FFPA 3CH1A 5C0DB 1A6VL 1SMOA 3MUY1 4APQD 4WW1A 3TYGL 3U83A 1DE4B 3KR3L 1Z0MA 3QDGE 4NCC2 5DQDH 2L7JA 5ICYA 1WIUA 35C8L 1JV5A 4O2EB 5EZLB 3RL1B 1J0KA 2M26A 3TVMA 4UQ2A 3MMEA 2CIIA 1RI8A 1SY6H 4YX2L 1S9WB 1T1YA 2GJ6E 2ZJSL 2Q7YA 4IJ3B 3VE0B 2UZXB 4U1HB 3JV0A 1H0DB 3DIFB 4P3DB 4UV4L 2EICA 5IW6B 5C2UB 3ZYIA 3BAEL 4YXHL 5BS0B 2IFGA 2XZAL 4HK3N 4U1JA 4E5XA 2YS4A 2XKNB 2XQBH 3IFPA 4WU5B 3NA4A 2EH7H 1BQHG 5C0BE 1I1FB 1RZ8B 1Z9LA 4R26H 4PG9A 3GKZA 3LKSA 4Y5YC 3E6HB 3K4ZA 3LN4A 4R4NC 4KZDH 4PJ7E 3WJLA 4PJFB 4PBWD 3KDMA 3CLFL 4UU9A 3STZA 5D8JL 3MRCB 2QV2A 4GJTB 3HE6B 2NXYD 4UILH 4GSDL 2XA8L 3I3DA 5I8EA 3TYGH 4QRSB 4OKVA 4H1LA 4MA3B 35C8H 1EEQA 5T1KB 2L7UA 2V7NB 4R6UA 3OBAA 1G9NH 2Z31D 3S6CA 3PWVA 2OSLA 3HLAA 3PG2A 4X5XB 5EOCJ 3TIEA 4JFED 2ZJSH 2XFXA 5GRVK 2P1YA 4B5EA 4Y0GA 2JKXA 3IJHA 3BESR 4UV4H 4XZUB 2ITCB 2DQEL 5CP7B 4YXHH 1OTTC 3MGAA 3PJSB 3VRLF 3E1F1 4RZCA 4PJIA 3TPUA 1NDGA 2NY1B 3O4LE 2Q1EA 1IQWL 5JHDE 4G6AC 1A1MB 4JEGB 3Q6GL 3QDME 3UBXI 5JDSB 4KJPD 2R2BA 1S7WA 5EIIB 5IMLA 2VLRA 5GGUA 3VGAB 3X3GL 2BK8A 5EUOA 2WWKO 4GBXC 5MENE 4S10A 5GGTL 1KCUH 1CD8A 5CLWA 4WV1B 4PJIF 1P4IL 5DRNB 2YA2A 3CLFH 4I4WA 1V3JA 4MJIA 4NZJA 2VDRL 5D8JH 5F7YC 1FBIH 1XCQA 3C8DA 4N8VG 1MJUL 3MLTB 3QEQD 4GSDH 2XA8H 2V2WB 3P4OB 1I85C 1ZA6A 4P5KA 3RHWF 3V6ZA 3NCCB 4NQSA 5EUOF 1RURL 2DLHA 4ETQB 3C6LD 4NQXB 5DRWB 1YJDH 1S7VB 4J3WA 3V4PH 5L8JB 1OQOA 5JHLL 3H9HA 2EE9A 4N0FA 1DQJA 5A3ID 1AY1L 1T1XA 1J11A 1QNZL 2HTLC 5I1LB 2QR0A 4TUKL 3ALWA 3OKNB 2DQEH 3B3IA 2R1WA 5D1ZD 1Q72L 3PWUA 4TUOA 3LPFA 3BKYL 4MA1B 4JKLA 5ERWA 2WBJA 4L4JA 4S0SD 3DROB 3DGGB 3Q6GH 2H1PL 3BZFB 1HXMB 4PJBA 4JFPA 1OL0A 3RX8A 2BY0A 2MQ0A 3JV4A 3EAKA 4JRYB 4YPGA 4CVXA 4Y5XC 3X3GH 4I2XE 1NBQA 2FWOA 4KH2A 1L6ZA 4YIQA 5GGTH 1T03L 1X5JA 2DLTA 1P4IH 2BVEA 4H25A 3HI5L 4YNYB 2VDRH 3OTTA 5EU5B 3PGDB 4JZOA 3KPPA 1JPFA 1NBVH 2EEAA 4PJBF 3T1FA 1KBGL 1MJUH 5CZXD 3B6SA 3MBEC 1Y6MR 1QSFD 2BDNL 4FQXD 3G5VA 2XWJA 3BVNA 3D3VA 3P73A 1QPXA 1RURH 4MB3A 2DI7A 4V1DB 5GRWA 2EDBA 5C0EA 4LPTA 4OGAD 2XA3A 2IH3B 2AXGB 1RZKC 2ZG2A 5JHLH 2LQRA 2VLJB 4QWWC 5I1CH 1QNZH 1XR9A 4IMLB 3FCTB 5C9JB 4TUKH 4EN3B 5DTFA 1HQRB 1FFNB 3MLUL 2BMKA 3BKYH 3BDXA 3FQRA 2R2CA 4D9RE 2VAAB 5LBSL 3HPLB 5C07D 5GS1B 5HHPB 1QRND 4Y16D 5JW3L 5D7IA 3QUYA 4PP2B 3BUYA 3VD4A 1CGWA 4HK0A 3I6GB 3EJYD 4NKOB 2FBJL 3LD8C 1EXUB 4OGXL 2CXGA 2HLAB 1U8MA 1MPAL 2LV4A 1T03H 1FFPB 5FGRA 4NBYB 3REVA 2V5YA 4DOHB 3D39A 4XRCA 3PV7A 5FV1L 1RUPH 4R2GB 5ICYB 5D7IF 3VMOA 3U0WL 4HUVA 1KBGH 1TNNA 1G9MC 2F9BT 3DXAE 3LN5A 4ZYKA 4K7FB 2BDNH 1I9EA 3B9AA 2Q3ZA 1GH7A 4MDJA 3HNTL 3MMEB 4PJXE 2OI9C 2E9IA 4HHAA 1T1YB 4M7LT 2YBRA 2Q7YB 3BT2L 1UJ3A 5LGHL 4TTGA 3GJFA 2I5YL 1C5CL 2XN9E 3ZKNC 1NFIA 1Z6JT 4E5XB 1KTRL 4L1HA 3IFPB 2Q7NA 3MLUH 3IDXL 1IAIM 2AEPL 2NY6C 3IB4A 4OZ4B 3VXQA 2Z4QB 3L5IA 3RDTC 4PG9B 2VLLA 1JTPA 4ENEC 3LKSB 1E4XL 5LBSH 4ISVA 5HI3D 3FO1A 3PGFL 2EC9U 2NY0B 5JW3H 5CJBA 3F58L 4L4VE 5J7CC 4GAGL 4QHKI 5GS2H 5JIIA 3KDMB 2R4SL 2W9DL 2FBJH 3NH7L 4UU9B 4OGXH 5EC2A 3PHSA 4BKLA 4U1SA 2EDYA 4P2RD 1MPAH 4M1CD 3ARFD 3TFKC 3T4YA 5I8EB 4OKVB 4H1LB 3RWCB 1FV1B 1B4RA 5J3HD 4ZAKB 5BOPA 4U1GC 3U0WH 2ESVA 5KSAA 3MRHA 3ROLA 3U7YL 3PWVB 3ARZA 3HLAB 4RGOL 3TIEB 3HNTH 1QYGL 2XFXB 3BT2H 1C5CH 2APFA 3RRQA 1EAPB 1A6WH 3NCYS 4GUPB 1SYSA 1BD2D 1MIEL 3FRUB 4GRWB 2XXCB 4WWKC 1NDGB 1W0WB 2VISA 2XNAA 3C5ZD 2EDNA 2NZ9C 4F7PA 4UIMB 3QDJA 1MH5A 2VDLL 4ZD3L 3MYZA 4KJQC 2NY3D 1QSVA 1RU9L 2R2BB 1S7WB 2VLRB 5GGUB 4HJGB 3PGFH 2PXYB 5EUOB 5T3ZL 1OOAA 1JWUA 4GAGH 4MJ6A 1F8TL 4POUB 5D7KE 2R4SH 2W9DH 2YR3A 3S35L 3NH7H 1U91A 3BIAX 4DUWA 4IS6A 4XCFH 1LO0L 2O5ZL 4DZBA 1XCQB 4MAYA 1OP3K 4R4FL 3EYFB 1ZA6B 4P5KB 5C0RH 1LEIA 1IL1A 3V6ZB 1YNKL 2HKHL 5F3BB 4NN5C 2R1XA 1F6AA 1J12A 5FEBA 2YRPA 3HFML 3U7YH 1RJYA 3ZKMD 3SKOA 3QFJB 5HVFB 3RTQC 4RGOH 4HUMB 5INCA 2CUMA 2BSRA 1T1ZA 3C87A 2V2TA 1QYGH 4UAOC 4HG4J 2VAJA 1T1XB 3VXUD 5ACMA 5BVPL 3U30C 2R1WB 3PWUB 4TUOB 1MIEH 4YK4B 1MRDL 4RFOL 3WHXA 5HYJD 3D25A 3SE4C 1L9NA 5ERWB 3WMSA 2XKSA 2X1XR 2VDLH 4KDWA 4ZD3H 5T3ZE 2AQ2A 2HG5A 4JGJA 4PJBB 4JFPB 2FH8A 3RIAK 1RU9H 4JG1H 3JV4B 4JKKA 2PO6C 4YPGB 4Q9BA 3V6OE 4CVXB 4OCLC 2GFBB 2FWOB 5T3ZH 1AP2A 3T0EA 1KTDA 12E8L 1UG9A 2VSCA 1F8TH 4NQCE 1GOHA 4H25B 1WCBA 3ZDXF 5HD8C 4YR6A 1LO0H 4JZOB 5EU7E 1JPFB 1S7UA 1S7SB 2HWZL 3T1FB 5AAWA 5C09A 4NZUL 3B6SB 4R4FH 3G5VB 3BVNB 3D3VB 3P73B 1YNKH 2AERT 2HKHH 5ABDE 3DBXA 5DJCA 2XICA 2DYPD 2WK2A 5C0EB 5KTEL 1NCDL 2XV6B 2EDLA 4M6OL 2IQAB 2FYYA 2UZIL 1I8LA 2YD5A 2E5EA 2AJXL 1XR9B 5DTFB 2W60B 4EDWL 2X1WL 5IW3A 5K9OA 2BMKB 1TPXB 1T7WA 3FQRB 1INQA 1MRDH 4RFOH 3E0GA 2C7UA 2FHBA 4HAFA 1JZ4A 3LDBB 3ZT7A 3UX9B 1TQBC 1XF3B 3G9VA 5D7IB 2X4RA 1M71A 5DK2B 3QUYB 4PJGE 4OF5A 1X5ZA 3BUYB 3M45A 4P46C 3LV3A 1ORQA 3MRFA 1VFBA 5F9WB 3B5TA 4KDVA 4R7NA 2OX5A 4NN7B 4Y1AE 2QQKL 3RVTD 4OCWH 1U8MB 12E8H 4N8PA 4LHUG 1PKQB 1GC1L 3F7YA 1MREL 4OIAA 2IAND 1FNGA 2OTUA 3D39B 2YEZA 4XRCB 1J5OH 5DJ8A 2BNQD 4JZJA 4WFGE 3S5LA 4HUVB 5IIEA 2HRPL 4NZUH 4UT9L 2E6QA 4ZYKB 1R3JA 1TQCC 3QR2A 4K3JH 3DRQB 2NPLX 3H9SE 3BGFC 1IAKA 3ARBC 3GNML 3L5WA 2APTA 5TE4H 2IAMB 2YRZA 3WIHL 5IVNA 3LPGA 2ZOKA 1UJ3B 2W1NA 5KTEH 1NCDH 2BJMH 3GJFB 5GGVL 1MCHA 5IVXA 4M6OH 4NRXA 5C6PB 4X6CE 3L3KA 2HMIC 3PIQA 1EMTH 1NFIB 1W72B 1LE5A 3PWNA 2AJXH 3B43A 3FO0L 1NFDE 1WBXB 3QIUC 4YBQC 2CXKA 1YYML 3MRPB 4EDWH 2DQIL 2D31A 3VXQB 5IMMA 3QUKB 1CICC 5J11C 2VLLB 3RWJA 1DQQA 1MJJA 4OF3A 3I6LD 1NFKA 3FO1B 3E2HC 3NIFF 4B41A 4JFFE 5IVXF 4OB5L 3S36H 2FB4L 32C2A 1Q9WA 4PJ5A 4PLNC 4Y4FA 3H9ZA 5CKAA 5KVMC 1OSPL 4RGNE 1GGIL 1KXVC 4I9WE 2QQKH 3GSXA 4BKLB 5CD3A 1DQTA 1EFXA 4I0PD 2P5ED 4JANA 1XIWC 5TDOB 1RD6A 1GC1H 1FL3A 4G6ML 1MREH 1X5AA 3RVUC 1MCRA 2OBGA 3HUJA 2QADB 1RFDL 5D5MA 2NY4B 5I71C 3IDMB 2ESVB 2DI8A 2HRPH 2X1PA 5KSAB 3ROLB 3VWJD 3SOBL 5KSBF 1YEJH 1UACL 5FM5O 1PKOA 4MA8L 1SMAA 2AABH 2RFXA 3GMMA 3GNMH 4HFWA 1IMHC 3UC0L 5GGVH 1ZANL 3HUJF 2OTWA 3L1OL 5D5MF 5IOPA 5TJWK 3FO0H 3MCG1 5IEHB 3UCRA 2VISB 2XNAB 5GS0C 4QHLA 4QRQA 4F7PB 1N8ZB 2CLRA 4IMKA 1YYMH 3QDJB 4UB0L 1MH5B 4UNUA 4JM2D 1FAIH 2DQIH 1G9EA 2Y07L 4NWTL 1ZHKA 5LGJA 5HVWA 4RMUA 1R24B 5EB9A 4JKMA 1LNUA 4WHCA 4Y5VC 5FO7A 2ORBL 1A6PA 4OB5H 4UTBL 5C7XH 1JWUB 4MJ6B 1OP3H 1OY3B 3EW3B 1AD9B 3O3UN 3RNKB 3V95A 3OAUH 4NKDA 1U91B 3QRGL 4A6YL 4WEBL 3AMKA 5CHNA 2YA1A 5FUZL 3PABA 4MAYB 5DZLA 4G6MH 4JB9L 4K9EC 2DJ4A 3VXOA 4WI4A 1RFDH 1JGUH 1IL1B 3QAZB 7FABL 1LEIB 2Y6SC 5DD3L 4FQQB 4YXLL 1T2JA 4LCWA 2XTJC 3SOBH 1OVZA 1RJYB 4R90L 3SKOB 3KS0H 1NGQL 1UACH 2BZDA 4UUJA 2J2ZA 4X6FA 3AS2A 4MA8H 1IQDA 4B0MM 4X8JA 2O61A 4MNQD 1T1ZB 2V2TB 2E7LC 3IAQA 3W11D 2OCFD 5MHSD 4R8WL 1Z3GL 3L1OH 4JN2A 4TULL 5ISZA 3VD3A 5ANMB 1KTLA 3QHZL 4UB0H 1NCNA 2HG5B 1KTKE 3PP4L 3EGSA 4ZODA 4ZUTA 5DK3A 2D9QB 2IH1B 1ONQA 4KRLB 2ORBH 4U1LB 1EJ6A 1HNGA 2ZKHL 5DD6A 1U8OA 4NZTL 1KTDB 4EIGB 1F4XL 4UTBH 2HVJA 5IM7A 3ZDZE 3CIQA 3I02A 3P4MA 1WCBB 2N7AA 5DRXA 4YR6B 4XPBL 3QRGH 4A6YH 1S7UB 2VTFA 4XMLH 4LVOB 1JL8A 5MI0B 4BSWA 1WJ3A 1DEEA 4JB9H 2W0PA 4I3SL 3O2VH 1UA6L 2VZTA 2X4TA 7FABH 1Q1JL 5KZCB 5EU6D 3DBXB 5DD3H 5DJCB 1FCGA 4YXLH 3LQAL 3BKCL 1WWAX 1NGQH 1VADB 4WU7A 5BS0E 2FYYB 3MRLA 1Y0LB 4KI5D 4PB9L 1XGTA 4PRID 2X05A 4N0YL 4LDLB 5I9QC 5DEZA 1Z3GH 3Q3GA 1BFOB 1DVFB 3WUWA 3HI1A 2IFFH 1INQB 4GG8A 2IG2H 4XAWH 1C7TA 3ELAT 1T7YA 2C7UB 5IB2A 3WEXA 4JFYA 3QNXB 1QSZA 5KAQF 2X4RB 1M71B 4G6FD 3R8BB 5LAXA 4PJFE 3SDXF 3LV3B 1ORQB 3KPTA 1T04A 3MRFB 1VFBB 4R7NB 3CLEL 2P8PA 5J89A 2AJVH 1I1AC 1CQKA 1FYTD 1S3KL 3F7YB 2RHEA 4UOW0 1LO2L 1FNGB 4XPBH 3UJTL 5DJ8B 4JZJB 2ADIA 1UKQA 3S5LB 3BIBX 3S88L 2YUWA 5IIEB 1CTNA 2VLKA 3R4DA 1E4KC 1R3JB 4AEHL 4PRHB 3BJ91 2P8MA 1X4YA 1IAKB 3T77A 2E8ZA 3L5WB 4FFZL 3BP5B 2YHGA 5CBEA 3LQAH 3BKCH 2IMNA 1IBGH 2GIYA 3FOMA 2ZOKB 4O9HH 7CGTA 5IVXB 2H9GA 4NRXB 3L3KB 3PIQB 2VDOL 1LE5B 1KCRL 3OAYK 4PB9H 3PWNB 4ONHA 5FGCB 8CGTA 5HTSA 4N0YH 4P9HL 4ELMA 3QPQD 4WFFD 4S1SL 5C92A 2CDEA 3FO2A 2D31B 1TETH 4TSAH 4Z7VF 1TTFA 1S9XB 3FQXA 5IB5A 3RWJB 1DQQB 1MJJB 2KL6A 2N4IA 1NKOA 3VGDA 5T5FL 4C56D 4FQLL 3ZYJA 1OQXA 3ZE1F 32C2B 1Q9WB 2JJUA 4PJ5B 5KSBB 1U42A 3WNNA 1T89A 4G43B 5L0QC 4ELMF 4RA3A 5CD3B 3GSXB 1N3NA 1EFXB 5IBUB 4JANB 1G84A 1NBYA 2GTWA 4KTEL 1MCOL 1FL3B 1S3KH 4JN1H 2VZOA 1LO2H 2I26N 4G8GD 5D5MB 3UJTH 1QHPA 4X4MA 3S88H 4OKDA 3VWKD 3KLSA 2DIJA 4NM4L 4AEHH 4EBQL 1DQDL 1UJTA 2RFXB 5H8DA 3GMMB 4MGXA 4FFZH 4HFWB 2CR3A 1NCUA 1OD7A 4HWEH 1T2QL 3SCMD 4DTGL 3RY6C 3GMOA 5DFWH 1K3IA 2CK0H 4Z7WA 1FYHB 3UO1L 5GISL 4GXVL 1IARB 1DANT 3NIDE 1Q9OB 2VDOH 3CK0L 5IOPB 4QTHA 1DN0A 1KCRH 3SJVA 4PP1D 4KROC 4P9HH 4QHLB 4MD4B 1BX2A 2CLRB 3K7UA 4RA0C 3AU1A 4S1SH 5E7FA 5LXGH 1ZHKB 4OUUA 1JWMA 4BUGA 1LDSA 4JRYE 2AJ3A 1H5BC 5FO7B 5T5FH 3SO5A 4FQLH 3NCYP 4Z7WF 3UTTD 3SDDD 1FG2B 4OGZA 4G8IB 2P42B 1UXWA 4P5MB 3VG9B 1XR8A 4KKNA 2WLYA 5FM8A 1KELH 4N90D 5C0CA 3PABB 1D9KC 4KTEH 1MCOH 4N1HB 2QHRL 3CPLA 5DI8A 5HDQL 1ZVSA 4OQTA 5E03A 3VXOB 5CAYB 3MRIA 3MUGA 4V1DE 2V2XB 1FE8H 3T0DA 1AHWA 5AWNL 2FD6L 4NM4H 4UUJB 4LP5A 4X6FB 4EBQH 1IQDB 1DQDH 5J0BA 4P5TB 2VLJE 3LS5L 2O61B 5SV4A 1CZ8L 5T3XD 1FGVL 1T2QH 4DTGH 1KUMA 5FAAA 5C0ND 4GW1A 4XTRD 3UO1H 4GXVH 3ARQA 1JGVH 1BFSA 3CK0H 5FKPA 2ZUYA 4ODXB 3TA3C 5ISZB 1HHJA 5CMAA 4ZS6D 1AGCA 3K46A 4U2YA 1KTLB 3GMRA 3TYFB 4OV6F 1EK3A 4FQ2H 4MMZC 3SPVA 3EGSB 3WDJA 5L2JB 3CFJA 1ONQB 5E1AB 4JVWA 5GRJH 4X8XA 4PRDA 5DD6B 1U8OB 2M1KA 1QSFE 4Z95H 4CADA 4WRLA 4PUBH 3VCLA 2NYYD 2VXSL 3P4MB 3I02B 4DOHE 3RY4A 1G6RH 4XAKE 5F7DA 3UAJC 3NFSL 5JIHA 1DEEB 4N0CC 5HDQH 4ZXBB 3PGCA 1F4YH 5IG7B 2DOCA 2FLRT 1J8HD 2A0LD 5DUML 2FD6H 4WU7B 1W0YT 2GAZB 4QXUL 3QIBC 4JFDA 5DHVB 3MRLB 5JQ6H 1CZ8H 3SDXB 4P4KD 5SWZD 5TFSH 3BZEA 1XGTB 1QRNE 5ELIA 2IALA 1AO7B 3Q3GB 3HI1B 1OD9A 1S8DA 3SKMA 1FZKA 4OZGA 3QJFA 5LCVH 3S96A 3LS4L 5IB2B 3WEXB 1T7XA 1H3PL 2CUHA 4LSDA 3MOQA 5GJSH 3VA6A 4NP4H 4YBLB 3BKML 3SE9L 3REWA 4FG6C 3GUTB 3QUZA 3S7GA 1K6QL 2IBBA 4F58L 4XVSL 1A3QA 3I3EA 2P8PB 3G5ZA 4LCYA 4P2OC 2WWMD 4J3UA 3ZHLA 5F8RC 1WBZA 4OZGF 1XF2A 1L0XA 3WO3B 4TQEL 3VRLE 4HMDA 1VFMA 2VSDA 1MCWW 3EJJX 4QHUB 2ADIB 3NFSH 2VLKB 3QXTA 5D1XA 1KCVL 4X9HA 2E6PA 1K4CA 2G9HA 1MCNA 3CX5K 3GB7A 4Z7VB 3U7AA 2MQCA 3OAYH 1MCIA 3T77B 4F2MA 3BUTA 1UADC 5CBEB 2P43B 1A6ZA 1QR1A 5DUMH 2KDGA 43CAA 4QXUH 2H9GB 3V7AG 4FA8A 5J06A 2ZUQB 4GRWE 4ZFGH 1NC2A 2JIXA 3QG7L 1U93A 4UBDC 4ELMB 3B5GA 1FO0A 3TV3L 1WC7B 2CDEB 3FO2B 1EVUA 5DMGC 4GRWH 4X99A 3FQXB 5IB5B 1TENA 2VLRE 4JQVC 3LS4H 4FS0A 4OF6A 1H3PH 5L6YL 1FC2D 5EUOE 4XVJL 3UPAA 4GKNA 4PJAE 4POZD 4Y19A 4D0CA 3BKMH 3SE9H 3SE8H 4AY0A 4ONGL 1K6QH 1BF8A 2PTTA 1XGYL 2C3XA 1Z9SA 1YMMD 2NX5A 4HH9B 4F58H 4XI5C 4XVSH 1B4JL 3ARGA 4LVNB 5SWQA 4KK8D 3RVXD 3L3JA 3SDCD 2GSGA 1NBYB 1KPRB 2GTWB 4HUWB 3QP3A 2AEWA 2PETA 4TQEH 3ULSA 3IT8D 3ZKXB 4MB5A 4FQHA 2H8PB 4Z0BL 5I1IH 4Y5YA 3QO0A 3F7QA 5AAMA 3QFJE 4NDMA 1KCVH 5B39A 3CFEA 2PF6A 4URTB 1B9ZA 2IPKA 1FDLL 3FFDA 1YEIL 1KULA 3AY4A 1FFQA 4JY5L 3GMQB 3BISA 4JQXC 4P2YA 3NVQA 4CMMA 4HBQA 3VW3L 3BIKA 2FEEL 4QTHB 3GMPA 3JWOL 3WDHA 5EIVA 1XF5A 1FORH 4HKXA 3V6OC 4QRRA 3PWPD 4GS7B 1BX2B 3PHQA 4C4KO 3TV3H 4PJBE 2NLJB 1JWMB 4KWUA 4LLQA 4J4PC 5I1GL 5DJYA 5EU7C 5L6YH 4PD4K 4XVJH 2E7MA 3N50A 4UIKL 3E6FB 4XH2A 1ZT7B 4F15B 4ONGH 5EZJA 5I73B 1XGYH 1MCQA 2X89A 1UXWB 3TZVA 1XR8B 4Y4KA 2GW5A 5C0CB 4YGAB 4L3ED 1AGFA 1IKFH 1CDUA 2VZVA 2VUOA 3CPLB 3IGAA 5DI8B 4DEPC 1ZVSB 3RZCC 5CIPA 1JZ7A 3T65A 3WO4B 4Z0BH 4YEFA 3VXTA 3MUGB 1URLA 5BZDB 1AHWB 5F9OL 3AMLA 1IKNA 2C1PA 1FNEA 1NCAL 1FDLH 5SV3A 1YEIH 4RNRA 4U7KA 4JY5H 4GRLD 1GPOL 1S7QB 3F62A 4KHTL 4N8CL 3NGBC 2YD8A 3QUXC 3SDAD 4GW1B 2WINB 3OR6A 1EUTA 3VW3H 1I85A 1U3HD 1Z2KA 5FKPB 1W72L 3JWOH 2WIMA 5CMAB 1AGCB 5CGMA 3ZE0F 4QF1A 1CXIA 5D7IE 2HT4C 3V9FA 2IC2A 2MPAL 1Y18B 3SPVB 1I9JH 1UB6A 1P2CA 5H2BA 1QFHA 3HC4H 1ACYL 3CFJB 2ICEA 2GI7A 4PRDB 3MZTA 4UIKH 4WFHD 4EI6A 1CCZA 4CADB 1PKQE 1P84J 4YHKL 3MGOB 2YD4A 5J9PA 3DI2B 3D39E 4CW1B 4HGKC 1LK2B 4Z7OF 1N0LA 5F7DB 3H7BA 1S78C 4M1GL 2GCYB 1UZ6F 4LHQB 2EIDA 3PGCB 4EVNA 5IBTL 3U4EA 3QHFL 2RIKA 4H20L 4Y5XA 3W5NA 4GW4A 3H3PL 5F9OH 1JPTL 4NKIL 1R3LA 3TEUA 1NCAH 1TCMA 2FEEI 4AIZA 2XY1A 4JFDB 5B4MD 1F00I 4MA7H 4UNVA 3BZEB 1GPOH 1VENA 2IALB 3QBTB 3R1GL 1T7ZA 5I76B 4LASH 4RFNB 3DMMD 3MBEA 5T1LA 1GC1C 1S8DB 5CJQL 1EEYA 1W72H 1FZKB 4OZGB 3QJFB 3SKMB 4RGNC 3S96B 5I30L 4KC3B 1KJ2A 2WZPD 4YWGH 4LAJH 2MPAH 4FFVD 2DKUA 2CJUL 3REWB 2IANE 1KIQA 3JUYA 2MKWA 4LCYB 3TVMD 4YHKH 1I7UA 2ADFH 2VDQL 3RBSA 5L88L 2OP4L 1WBZB 3X17A 5GGSA 4Y4HC 4M7LL 1EHLL 2ESVE 1E4JA 2MFNA 3O2DA 4LSQL 4M1GH 1YPZF 5D1XB 2AK4A 1S9VA 5F9JB 1JNHB 5K59E 1K4CB 2G9HB 1NPUA 4M61A 3UYRL 1B0GB 1YN6A 5IBTH 4H20H 4U0QB 3ZL4L 3ARRA 3KPOA 3H3PH 1JPTH 2Z8WC 4NKIH 3RWDA 2G2RA 3IJSA 5KVGL 43CAB 1YEGL 2BVOA 5FV2A 3TN0B 5BXFA 4ODTH 2QHLA 2JIXB 4XBGA 3QXVA 3F7VB 4JE4B 4NQDD 3RJQB 1U93B 3HR5A 4HPYL 4M9PA 3IETA 1FO0B 4I0CC 1PDKA 4X99B 1YY8A 5I30H 4OZFH 3X12A 3LKQA 5F72S 4IRJC 1BBJA 4LPYA 5DA0B 4GKNB 4D0CB 4Y19B 2CJUH 4KUCF 3VI4F 5I1DB 2YPKA 4K3DL 2PTTB 5HHMD 2DICA 4KKAC 1J05B 4BUHA 3RGVC 1MFBH 3L3HA 3KXFB 3ARGB 4EJ1C 5SWQB 4L9LC 3KHOA 2VDQH 2GSGB 2OP4H 1AJ7H 3RDTA 4MQ7A 3C09C 2DQCL 3ME0A 3ULSB 3EYUL 4YHNB 3JTTA 2OXGA 1EHLH 1EAJA 1LQSR 4FQHB 1KPUA 4LSQH 1BZQK 3QO0B 3VFGL 4IOFC 5E7BA 5B39B 3MODH 3KVQA 4P23C 3CFEB 5DHYB 4BK5A 1CLOL 2IPKB 3FFDB 3EYVA 3BHBA 3ZL4H 3O8XA 5EZOL 5E5UB 3GRWH 4ZSOE 1J1OH 2FZ3A 3UJJL 4RMTA 2ICWI 4OM0H 5AYQA 4LFHD 5KVGH 1YEGH 4CMMB 5HSFA 4YBHA 5L2KD 1TDQA 5ANME 3GSUA 1V5JA 1EJOL 1XF5B 4HPYH 3ZDXE 4P2QA 2X9XA 1ADQA 4H1LG 3U46A 3W0WD 3T2OA 2HVKA 4UQ3A 4MJID 2PUQT 4LLQB 5D7JA 5CGYC 1OAUH 4OLXL 5FUOH 5DJYB 5JZ7D 4HKZA 5IR1B 3KYNA 3OSKA 3UTPD 4XH2B 5J1TC 3TM6A 4XHJD 5EZJB 4K3DH 2OR7A 5TDNA 1FNSL 4YHYB 1BFVH 4PGZA 3TZVB 4H5SA 5ALCH 4Y4KB 4A2MA 2BNRD 3DO3A 1FGNL 1CYGA 3IGAB 4MNQE 4GAJL 2DQCH 5SX4H 1LWRA 2D4DA 4QY8A 4HXAL 5CIPB 3G9AB 3KYOB 3QUMA 1BQHA 3VXTB 2Q20A 3VFGH 4OLWL 5MHSE 5CJOL 2C1PB 4O5LL 3VRJB 1CLOH 2GT9B 4CU7A 4FQ1L 2YKLL 4QNPE 1ZGLA 4RNRB 3P77A 2WBJD 5EZOH 2XZQL 2W0FA 3UJJH 1AR1C 1F4HA 2YXFA 4PJ9B 4LKCA 3OXSA 3OR6B 3STBA 3KLHD 5JW4M 1EJOH 1CGXA 5KVFL 5D9SA 1JNNL 4M7ZB 3VXMA 1JUFA 2HRLA 2DN7A 1AKJA 5EORL 3MACL 4YHLL 1K9TA 3T2PA 3RTQA 5FGBC 1UB6B 4Z18A 1OW0C 1FRGH 5H2BB 4OLXH 1H3GA 5F3HA 5TE6L 1N0XL 1AGBA 3GGWA 2ICEB 3LQAC 3W5MA 4N68A 4EI6B 5J9PB 1MWAA 1ULVA 1DP0A 5SX4I 4YHOH 1EEUA 2WQ8A 1NKRA 4EXKA 2FCBA 4PJ8A 2R2EA 3H7BB 3ZTNL 3CFBA 3VGGA 4DZ8B 3RWEA 3P30L 1FGNH 1ZA3A 4PRHE 1MCWM 5ITFA 4GAJH 3TCLA 2A9NL 4Z0XB 2IPUK 4PJEF 5D96B 4EUPA 4EVNB 3JZ7A 2NY1C 3U4EB 3DX9B 2IBZX 4Y5XB 1RZIA 2PCPB 3X14A 3PL6B 5CJOH 3DSFH 4AH2A 5J8OA 5IVXE 1RK0B 4AIZB 2R4RL 4FQ1H 2YKLH 4ZUVA 4XP1L 5FGCE 4YHPA 4N5UA 3VGAC 4AK1A 2XZQH 2XTLA 4OF0A 4ORGA 4KVCL 1GGCL 3MBEB 4WV1C 1G7MA 3HG1D 5FHBL 1KB5L 1QPPA 3FAWA 2OMNA 1JNNH 3MLSL 1UYWL 4YO0A 2BVUA 2WWKT 1KJ2B 5K9KA 4YHLH 2Z91A 5I2IA 4PJ5E 3WKNA 5KSBE 1YPZB 4PS4H 4E42A 1KIQB 5TE6H 3N9GL 1N0XH 1YMHA 4OLZL 1WLHA 5CJXA 1EZVY 3G08A 4LKXA 4I0KA 5CD5C 2YSSB 3IVKA 4WFEE 5CJ5A 4N0UA 2NR6D 4ODUB 5D5ME 3F5WA 4DQOL 1EDQA 3KJ6H 4GKZA 4P9ML 2DBLL 3P30H 4L29B 2A9NH 4P46A 1C7SA 4M61B 3TNNA 4PJCA 4MA1C 5MP6H 1YN6B 4AIXA 4L8DA 1RHFA 5KVEH 1OSZB 3KPOB 4H0GA 2I9TA 2P48B 4ALAH 3RWDB 5HGHA 2BVYA 2G2RB 4D3CH 2AJYL 3O3BA 2R4RH 5BXFB 4KMLB 1KLGA 2YD9A 5D1QB 2H2SD 4U3HA 4XBGB 5D4QA 3PQYA 4C56E 4P3WA 2IGFL 3I6KA 4HS3A 1BEYL 1OP5H 4KVCH 3VXSA 1X3DA 1GGCH 2AW2A 3V4VH 4PJCF 5EDXA 3FO9A 2AJUL 5E6ID 5F7MC 3U79A 1KB5H 1DJSA 3ARBA 3U7WL 2OI9B 3LKQB 3MLSH 1UYWH 1BBJB 3BKJL 2D0GA 3U1SL 5TPWH 1GZQB 4YHZH 2YPKB 3BWAA 1O7SA 3V0VB 3HZMA 5J1SC 5J1AA 4ODBD 3N9GH 2ZSWB 2QEJA 3BPCB 4OLZH 3WLWD 4CVWA 3DVFA 4DGYL 3L3HB 2RCSL 3JBG7 3QIUA 4FZ8L 1YEKL 5D72H 5IESL 3KPNA 5KJRL 2W38A 4K94H 1CICA 2BY3A 4MQ7B 4D94A 1INDH 3JTTB 4MX7A 5F1IB 4EN3C 3RWHA 3JWDL 4P9MH 2C3WA 2DBLH 2H6PA 4L8CA 3ZDYF 2ZCLL 2F54A 4KQ4L 3U4AA 5T3XL 5LWYL 1UM6L 1RZ7L 3O8XB 5GS1C 5C6TH 1UWGH 1P7HL 5GIRA 3MRJA 4PY8I 2FZ3B 3LKRA 2BY1A 2V17L 4PJHF 1XIWA 2AJYH 4U3CA 4CVUA 2J6EA 2VC2L 2WUCL 2IGFH 3UTTE 2J8UA 1BEYH 1AD0A 1XCTA 3U46B 3RU8H 1I7ZA 2HVKB 4LK4A 3ULVD 1QSEA 2AK1L 1PEZA 1PJ9A 4PR5A 4UMGA 2DF3A 3WNMA 1E6JL 5D7JB 3WE6A 1EHAA 3U7WH 4R2GC 2OK0L 5FDWA 4N90E 4HKZB 2IF7A 3ARDA 4XP6L 3ZTJG 1NANH 5F1NA 3PWLA 3ZT6A 4DGYH 5F70A 3UJIL 4GG6A 2RCSH 1FZJA 2A73A 5KJRH 4OZFG 1P4LB 4Z7NF 3L3DA 5FUCE 1GRWA 3ZKQD 3U0TA 3OHXA 2CDFB 3EO0A 4QY8B 3MJ7B 1NCBL 5E5RB 4PBVC 1VHPA 4Y5VA 4AEEA 1IAIL 3JWDH 4W4OA 2ZNWA 3SKNB 4CMHC 2UWEF 4JO2H 4K8RL 3ZZ1A 3TJEL 1ZGLB 4PY7B 4N5ED 5T3XH 3SDXE 2PW2B 5LWYH 4GG6F 1RZ7H 1YEFL 2BSTA 2NY0C 3K8MA 4O02L 2A9ML 4LIQE 1IEBA 1AO7E 2A6IA 5DJ6A 4LGSB 5I8CB 3H0TA 3MA9L 1J1XH 3OXSB 4RRPG 5E2JA 3TO4B 2CUIA 2VC2H 4FQPA 3FB6A 4HIEA 3T0ED 1OAYL 1JUFB 3PUCA 5DMKB 1NANI 4UDTA 1G7IA 1DBJL 3RTQB 4FXLA 2BC4A 1E6JH 4TNWK 3OXRA 1U8NB 4ZAKC 1GOFA 2ITDA 2OK0H 4PJEB 1AGBB 3LB6D 5ALBL 2E7LA 5C09D 5EULV 3P0VL 4J6RH 1NC4A 4XP6H 1MWAB 2VNCA 3G5XB 1UVQA 3FTGB 3UJIH 4PJ8B 2R2EB 3CFBB 3HA0A 4WUUD 1HEZA 5T1MA 1ZK9A 1X5FA 5ITFB 1ZA3B 1I3RA 2AP2A 1NUGA 4Z7VE 4QRTA 3FONA 4EUPB 4MS8D 1SY6A 1QFPA 1IAIH 1RZIB 1YECH 3X14B 3S37L 1DBBL 1HH6A 3K74B 2Q8AH 1A9BA 1F6LL 4AH2B 3IDNA 1KSRA 1PSKH 3TJEH 3ZE1E 4Q58C 3O6FD 4O2CB 2MHAA 4YHPB 1YEFH 2VKXA 4O02H 2PXYC 2A9MH 4ELME 4PLKD 3CDCA 3O6LL 4FQJL 3HAEH 3IU4L 3OF6D 1G7MB 3U36A 3MV01 3Q2CA 4X0KA 1WWBX 4YO0B 5I74B 1BGXL 4TUJA 1MY5A 5IHZA 5C0BA 4E42B 4HT1H 3EZJB 3UBXA 5JORA 3L7FA 3VRIB 2ADGA 3MXWL 3G08B 4LKXB 3P0VH 3IVKB 4MJ4A 4PJ7A 2WSKA 3DV6A 4S1QL 5LG1A 4N0UB 4PYHA 2MOVA 3F5WB 2P8LB 3NACH 1IAII 2GJZA 5GJTL 1D5BA 4DVRL 4UZGA 4D0BA 1TQBB 5F6HJ 1GHFL 2NY3C 1N59A 1R5IB 3MNZA 5DUBA 5FO9B 1HI6A 4YK4C 3O3AA 4LOUC 5EFIA 1MFDL 3TNNB 4P59L 4PJCB 4XWGL 5T33L 4L8DB 4CUCA 2I9TB 1DBBH 3DUSA 4XCNA 5HGHB 2H3NA 4MQTB 3O3BB 3MR9A 4UOJA 1KLGB 1OGAA 5CCKL 3PQYB 1QD0A 3GZKA 4HWNA 3UDWC 3FQTA 4ZNEE 1IGFL 4HS3B 4JFQA 3WV0A 3O6LH 3VXSB 3HS0A 4TSCH 5C3TA 4Y4FD 4LGRB 1N5AA 4U7SA 4CU6A 1YMME 1CS6A 3S5LG 4L3AA 3FO9B 3MNWB 2AXHA 3ARBB 5F89A 3DYPA 3O4LA 5JHDA 1BGXH 3MJ8A 3HE7D 5DDHA 5DURD 1ZLWK 3V52L 3QDMA 4NT6A 4F7TA 4LSUL 4BQCA 3BWAB 1NAMB 3TT3L 4NQEA 3HZMB 5J1AB 1F3DJ 1U95B 4KFZC 5FHAL 2E7CA 3F6IA 1D5MB 3WCYA 1S7TA 3KPNB 4PJHB 4YFDB 4OCSL 2GTZA 4RMRA 3OKOA 4MX7B 2KUTA 4MJ2A 5GJTH 4DVRH 4JG0L 5DJZA 3RWHB 5JQHC 4BK4A 4PGEA 1DEDA 2H6PB 3VFOA 1TPXC 4L8CB 1MFDH 3FB5A 2Y4SA 2F54B 4P59H 5T33H 2PTVA 3PWPE 3C5SA 3V79C 3LDBC 5GIRB 3MRJB 3B9DA 5DF0A 2D7NA 3LKRB 3D0LA 3QUYC 4AL8L 1XIWB 4M62H 5E95B 3MO1A 1IM9A 2DQJH 3QWQB 4XC1L 5IBUG 4CDGC 1KIPA 4U6VL 4LHUA 4NN7C 2W65A 3EYOA 4IRZL 5C1MB 1IGFH 3FOLA 1AD0B 1XCTB 3IU3A 1I7ZB 1T0PB 3QPXL 5CZKA 5E0QA 1QSEB 5DRZA 3RVVD 1TTGA 3RHWK 3MCLH 4PR5B 1RMFH 1RQ5A 1YC8A 4IRSB 5FA3A 3RY6A 3ARDB 5GGTA 1UFUA 4LSUH 5D7LD 2UY7A 1HILA 4XB8A 3TT3H 3PWLB 2UWEB 4R3SA 1MFNA 2AI0L 5FHAH 2IAMC 5JIKA 3HB3D 4GG6B 1NH6A 1FZJB 2A73B 3V8CA 3L3DB 4OCSH 5CEXA 3U0TB 3FRPG 1CT8B 5T5NF 1H5BA 4JG0H 4G7YL 4F57L 2EDTA 1NCWL 4I3GA 4JFDE 3QZWB 1WK0A 3O9WD 5TDPB 2FO1A 5I75B 3AS3A 3FB8B 1TZIA 1IEBB 1U3JA 2A6IB 4AL8H 2GJJA 3SQBA 2HKFH 1D9KA 4XC1H 4D2NA 1MI5B 1TJIL 4U6VH 2FDBP 1JWSA 4JO4L 3SE3C 2NXZB 4IRZH 3C60A 4PRPD 4WFHE 2UV3A 1GIGL 3BGMB 2XTJB 3QPXH 4HJ0D 5AZEH 2QADC 2BC4B 3BN3B 3OXRB 1RJCA 1L7IL 2ITDB 3D9AL 5E8EA 4JJ5A 1RIVL 1QFUH 5KSAC 2VXQH 3ZSTA 1NC4B 1IE5A 1GVIA 4GT7A 1UVQB 3BN9D 3MRBA 2AI0H 1FQ9C 3ORJA 4LLYA 3TA3A 1AGEB 4IM8A 4KMTL 1ODAA 3UTSD 5T1MB 2X7LA 1I3RB 1GGBL 1E0OB 4QRTB 3T2NL 2YN5A 4AENB 2DMCA 4F57H 1CQYA 1LO4L 3M8OL 1AI1H 2AV1A 1HH6B 1NGZA 1A9BB 1I4FA 1LMKA 2XQYK 4WNQA 3IDNB 3C6SB 4MCZA 1MQKL 4PJXA 2MHAB 3MLXL 3GO1L 4MNHB 1WBYA 4JKPH 2YPVL 1Q9LA 1QACA 4FOMA 4XGZA 1UM5L 1MCFA 3U36B 1TJIH 4HUXB 5FYLL 3SY0A 4EI5A 2DQUL 4X0KB 3LCYA 1GIGH 4Y19E 3MJ6A 1I7TB 4MAYC 5HPOA 2R29L 1D5XA 4HJJH 2AJSL 5IHZB 1AR2A 4PJXF 1SJEA 3QAZC 1K8DA 3T3MF 3UBXB 3L7FB 1L7IH 3D9AH 2VZ3A 4YLQT 3KXFE 1RIVH 5KAQG 2ADGB 3UTSB 4WO4D 3GSNL 1J18A 4LVEA 2K1MA 4TOYL 3BWUC 3NZHH 3DV6B 4KMTH 4YQXL 4M3KB 2GJZB 1D5BB 1XF4B 2XWBA 5ICZB 1P5UA 4JM2C 3GSRA 4ZFFA 1JE6A 2GSIB 3MNZB 5DUBB 3MUJA 5E4EC 5HY9A 3DX8A 4FXGA 1HI6B 1NCTA 2BFVH 1XH3A 2ED7A 3O3AB 3T2NH 1W2KT 4X6DF 3ALXA 4NPYB 5JUEL 1C16A 1LO4H 3M8OH 2HJLB 1FAKT 1DANU 3DUSB 4P2OA 3V5KB 3BQUD 2H3NB 2LVCA 3MV9D 4G5ZH 3MR9B 3LQZA 5D7SL 2BSSB 1MQKH 4RIRA 5GQBA 1HKLH 1OGAB 4TVPE 3MLXH 1JNLL 3GO1H 5FYLE 3UPCA 3FQTB 4JFQB 4ERSL 2I07B 3GM0A 2R9HD 3HS0B 4RCAA 1ZLWH 2VIRA 3KPRD 1N5AB 1JMZA 1UM5H 5JOPD 1RAMA 2CDGA 5FYLH 4H0HB 3RY5A 3BRGC 5F89B 1UC6A 3FFCB 3O4LB 4JDZB 3MJ8B 4LVOC 5MI0C 5DJ2A 3OG4B 2R29H 3TJHC 3QDMB 2AJSH 1AXSA 2VUYA 4NQEB 2W07A 4JFHE 5ETUA 3FQWA 5EN2A 3GSNH 1U92A 5TF0A 4TOYH 5E1HB 4ONFL 2XPGB 2GTZB 3OKOB 4JQVA 4YQXH 4X7EC 5DJZB 1CL7L 4M7KL 4M8VA 4PGEB 1DVFC 4WHTA 4P57A 3VFOB 5L2KE 3LY6A 4D8PB 3FB5B 3SJVD 4XPGL 1UKTA 4G9FA 3C5SB 3W0WE 5I1KH 4E0RB 4M1DL 4KRPD 1VEMA 5HPMA 4OJFL 5D7SH 3IRZA 3MO1B 2VQTA 4JQIL 1IM9B 3E8UL 4RAUA 2APBA 5ACZA 3EYOB 4Z7OE 4ERSH 3FOLB 4PB0H 2GHWB 3PV6B 1UZ6E 5DRZB 4MMXC 3AFLA 2O5YL 4MQXC 5A16B 2BNRE 4FQCL 5FA3B 5C8JA 1NEZG 1HKFA 1FHGA 3UPRA 1HILB 1I3GL 2PYEA 1CD1B 1ZT1A 2WP3O 4R3SB 1KG0A 4NUGL 5FA4A 3AB0B 3SBWA 1A1NA 2I9LA 5BCAA 1J87A 4RMSA 5AEAA 4WVRA 1MHHB 3HCVB 4ONFH 3JXAA 5EO1A 1VFUA 5E8PA 4NFBA 1A4JA 2P44B 1CL7H 2MQ3A 4M7KH 2Q76A 1R3KA 3QEHA 1IT9H 5EBGA 4QRPD 5DQ9A 3AAZA 1ZLVK 3JVGC 3QXAA 1S5IL 3GKWL 4JLRA 1Q0XH 1TZIB 2VABA 4M1DH 4OJFH 1D9KB 3Q0HA 4JQIH 3RZCA 3E8UH 4K7PX 1JWSB 3C60B 3QFDA 4HMCA 3D85B 1YPZE 3C08L 5JA9A 2PN5A 3CSBA 2O5YH 5E8EB 1FNHA 5DEFA 2P45B 2R8SL 5J13C 3DOSA 1JGEB 4NOFA 1T4KA 1GZPA 4PJGA 4GRMA 4GAYA 1I3GH 4NQVA 1PFCA 4NUGH 1FFRA 3Q48A 1OTUC 4LLYB 1CL7I 1ZT4A 4QHMA 3A6CL 4Y1AA 1JK8A 1A47A 5IWLA 4WHYG 4KKCC 5HJ3A 1GJIA 2AVGA 3O3DB 2DQTL 3IXTA 3H2WA 4DK6A 4PJGF 5JMRA 1ZVHA 1NGZB 2AV1B 1I4FB 4WNQB 2R0LL 4XWOD 4YE4L 4MCZB 1T1WB 3HG1E 3WXWH 3H9SA 2V7HA 2JJSC 4PJXB 5JNYA 3BYTA 1DFBL 1S5IH 3KHQA 4RQQB 3GKWH 3QI9A 1WBYB 5A2IH 3M17A 4B50A 3QUZD 1B88A 4R4BA 3N85L 3VXRD 1JNJA 4X6CA 4BFGA 2Q3AA 1A6UL 1A1OB 2CRIA 2JB6A 3CFDB 5D93C 1U8KB 3VG9C 3SY0B 4EI5B 1NFDA 3GBNL 3DO7A 2A6KA 1D5XB 4G8FB 5TE7L 3C08H 3IKKA 1SJEB 4FHBD 1K8DB 1MF2L 4X5WA 5T1DL 3QDAA 4H88L 3NABL 3Q6FA 4P49A 4X6DB 1G6VK 3PP3K 1I8KA 2P5WD 2C3VA 4X6CF 3VXNB 4P5TC 1NFDF 3ZMRA 4QOKD 3X11A 4NQTA 3AS1A 4F7MA 3GSRB 3BZ4A 3WNOA 2BCKA 1OAKH 5HY9B 3DX8B 4FXGB 1NC2D 1XH3B 3OX8A 1OGTA 2DWDA 1FVEB 5CKGA 2CD0A 2DQTH 5D71L 1C16B 4HS6B 3EHBC 2VOTA 5GZNC 1LO3L 4P2OB 2R0LH 1PG7L 5FYJD 3LQZB 3RNQA 1DFBH 3MA7A 3D0VA 4YC2C 1JZ8A 3MV11 1A7PL 1DTUA 2EKSA 2XOTA 1VCAA 2VIRB 3I3BA 5MEOA 4K3EL 2NX5D 4Z8FL 4FP8L 5SWSD 3AS0A 2BOBA 4OI7A 2RB8A 2EDOA 4FQIL 3GBNH 3EOTL 5DJ2B 4PV8B 1CBVH 4WW2A 4ZXBC 4HQQH 1FIEA 1MF2H 2EIZA 4JY6A 5T1DH 2I25N 4H88H 3NABH 3H3KA 3LAFA 4R4ND 5ETUB 5EN2B 5C0NC 4FN0A 4JAMA 1MWAL 1U92B 4CL7A 4FTVD 1ITCA 2EE3A 2EYTA 5F7LB 2FBOJ 4KKLC 4ZS6C 4O00A 1KXQE 3EDKA 4U1IA 4ZUWA 4IRJA 4O4YH 5HHXH 5EG6C 4WW2F 1IM3A 5C08A 3MOBH 4WUKL 4XPAL 3HZKA 4NO0D 3AREA 4G9FB 4QRRD 3RGVA 5D71H 3NCEB 4NWUL 3U2SA 1LO3H 2ZPKL 3AM8C 4YBLC 3DWTA 5IB4A 4WJ5B 2FJHA 4RAUB 1KGCD 4EDXA 5ACZB 3C2SA 4L3CA 5E8NB 4S1RL 4DN4L 4X7TA 1A7PH 3ULVH 2A74B 1ZE3C 4MVBD 4P23A 4K3EH 2GEEA 4Z8FH 4FP8H 1OTTD 1U3YA 2WBWB 3J7HA 5B39G 5E9DD 4PJEE 2DDQH 4G6AD 4FQIH 2Y7QA 5C8JB 4KAQL 3RIAF 4FXKA 3UPRB 4K8RC 2PYEB 4X7SL 1ZT1B 5FCUH 1KG0B 3LEYL 5FA4B 3EJZD 4GH7B 3QULA 1A1NB 4A6YA 4GBXD 3V4UL 1V7ML 3CFKA 1PX3A 3K4DA 5FYKL 5BRZA 4LSVL 1BJ1H 5EO1B 2ZUQC 5E8PB 4Q9CA 3GI9H 1A4JB 1QLEL 1R3KB 3QEHB 3RL1A 1KYOJ 1X7QB 2VR9A 4WUKH 4XPAH 3I2CH 4OLVH 2QQNL 1FLRL 3IXAB 3KPSA 3QXAB 4NWUH 2AEQL 5IHUL 4JLRB 2VABB 3KPLB 2ZPKH 4G6JL 3VE0A 1NLBL 1H0DA 3ZDZF 3DIFA 4E9LA 2YMXH 2FECL 4HEME 3CU1A 5B38A 5IW6A 4MXWL 5BS0A 2HTLD 4LVNC 4S1RH 4DN4H 5CINH 4WDIB 1VEOA 4ZQKA 3QFDB 5IUSA 1AXTL 5E8DL 4X6EA 4ESKA 1T21B 2FL5A 4LF3A 1BLNA 4UV7L 3K81A 3ULUD 1I1YA 1KT2A 4XMPH 4JRXD 3E6HA 4OFYD 4KAQH 4LQ1A 5INDA 1MCPL 1FIGL 5IB1A 3S4SB 1T4KB 5FYKE 4XNXL 4APQA 4DW2L 4PJGB 1NAML 1T66D 4GAYB 2DQGL 4N0UE 4HV8A 4X7SH 2ILLA 4E41D 4NQVB 3LEYH 5JOEA 1BQUA 5GGVY 4YHML 1ZT4B 3V4UH 4QHMB 4Y1AB 1IGJA 1JK8B 2YUXA 5FYKH 3T3PF 4NC1E 3UROR 4PJCE 2PYFA 1Q94A 1T80A 4MD0B 1OW0A 1QLEH 3IXTB 1VERA 2V7NA 4GS7C 3NN8A 3MV7D 4MNGA 4F8QA 4HIJA 5T1LD 1BQLL 1H15B 2EDXA 4UINH 1X6LA 1JPSH 4X5XA 3H9SB 1SEBA 3PQYE 5JNYB 1FLRH 3QI9B 1RZGA 5DGQA 2X4NA 4U1NB 4U4BA 4G6JH 2JJWA 1NLBH 3SDCC 4C4KT 1ACZA 3M17B 3VXSE 4XZUA 5TH2B 4QCIB 1TJHH 4F15C 3B8YA 4R4BB 3JWNC 3K3QA 4MXWH 1CDBA 2JB6B 1HYSC 2PTUA 1BF2A 3PP3H 3A6OA 1AXTH 3OKKA 4HLJA 5E8DH 3ZDYE 4X5WB 4U1MA 4QKXB 3WO4C 2G5RA 4KJWC 3Q6FB 4XB7A 3S34L 1AHWC 1QA9A 1FIGH 2AK4D 4GFTB 1I8KB 4XNXH 4PJHE 1NAMH 3I50L 2DQGH 3MFGB 1RZJC 4Z9KB 3QISA 2B2XL 4YHMH 4HZAA 4JZNB 3HI6L 2JCCF 1F11B 4F7MB 1CE1L 1KENL 2BCKB 3MLTA 4K2UL 1HWHB 2F54E 4AJ0A 3OX8B 1H3TA 4FFYL 4JFEA 1QLRA 1S9YA 2DWDB 5LQBL 1EA9C 2ZCKL 4L8BA 2FECI 4ETQA 2CK2A 5KANI 1X4XA 1BQLH 3J8F7 1FP5A 4LCCA 3RNQB 4PBXA 4XBPA 4HPOL 2J7LA 4WGVB 1TCRA 3TBTA 3MA7B 3QYCA 1EO5A 1B2WL 4WCYL 1P7QD 2EKSB 1HOCA 4M7JL 2ARJA 3ZKND 3QCVH 2BOBB 3DROA 2NY2B 2NY6D 3DGGA 4AZ8A 2O5XH 3RDTD 5ILTL 4WW2B 4YDKL 1BFTA 2UWEE 4S2SB 4ENED 4JY6B 2EIZB 4JRYA 4GMSH 4GRLC 4GG6E 3BP6B 3S34H 2BHUA 4XP5L 4JAMB 3I50H 3WD5L 4TRPH 2EYTB 3WFHA 2AGJH 2EECA 4YNYA 5A2LH 3HI6H 4U1IB 4ZUWB 3F6LA 4IRJB 3S9DB 5FYKU 5C70A 2DQHL 3C6LA 4CNIA 1KENH 3QG6B 1PGRB 3DJ9A 4RFNC 3TFKD 1IM3B 5GSVB 5C08B 4D9QD 3MV8D 3HZKB 3AREB 1IEHA 1T0NB 1QBAA 2YPLD 5CEZE 1BAFH 1SY6L 4YFLI 4P2QD 2VKWA 4Z7QF 2ZCKH 3U2SB 2R39A 6FABH 1IC5H 2OMBA 5IB4B 2IH3A 4HPOH 1MI5E 2FJHB 3IDYB 3WHE1 4EDXB 3N1PC 3IS1X 1B2WH 4IMLA 4WCYH 5DJXA 4JDTH 1MRCL 4M7JH 2EH7L 4J1UB 3CDFA 3R0NA 4P23B 1J7VR 4R26L 3UZQA 4WWKD 1X44A 2NZ9D 2VAAA 2L4OA 1VACB 3GSQA 5HHPA 5D6CB 2Y7QB 2FX7L 4OQ1A 4KJQD 5D1XC 4PP2A 2ZSVA 5ILTH 3GSOB 4FXKB 4YDKH 5B4MC 3L5HA 3G04B 3QIWD 4HK3J 2Y06H 1V8HA 3QQ3A 1EXUA 3CJJA 3QULB 2HLAA 2HT2C 4PFEA 1L9MA 4XP5H 3CFKB 1QSFA 4UILL 4FQXA 3WD5H 5BRZB 3TN0C 4ZPTA 3ZE2E 1IRAY 2VZUA 4U6XB 1JMXA 1VKXA 1TVHA 2IEPA 2VWEE 3I84A 3QA3B 2DQHH 5A40E 1FLTX 1KFAH 1PYWB 3ILQC 4FFVC 3GFUA 4L5FL 4K7FA 1G9NL 1P7KB 1M6OA 2F53D 1QRKA 1DSFL 2QJDA 2Q6WA 4UNTA 5HYFA 4BH7A 5EU4B 3KPSB 3Q5TA 3VXMD 1TITA 4NO3A 1AKJD 5E56A 4GKOA 3QNYA 3NFNA 5B38B 4QO1A 1CGYA 5DXWA 4JKWA 3LVEA 2QLVB 4AEIL 3KYKL 5C07A 3ARGC 1QRNA 4ZQKB 5DMIH 1MRCH 1DDHB 4WI5A 4OZ4A 4X6EB 2Z4QA 5CILH 2Q86B 1EX0A 2FL5B 1BLNB 4LF3B 3RGHA 5HDLA 1I1YB 1KT2B 1T83A 1B6DA 3WLBA 3UTSE 3B9KD 2FX7H 5INDB 5I8OL 1KNOB 5DA4A 5F7EL 1BJMA 1XGRB 5IB1B 4APQB 1KCUL 4HLZG 2XKUA 1MIML 4HV8B 5LJYH 5DZNA 2PO6D 2M8XA 3AY4C 1QO3B 1FBIL 4LPWA 1IGJB 1KB9J 2NMSA 4HIIA 2OM5A 2Y9RT 4DKAA 2H32B 4Q2ZA 4H26B 5HD8D 2PYFB 3RWCA 1Q94B 1FV1A 4LSSL 3TLRA 4D9LL 4ZAKA 1W8OA 3NN8B 4MNGB 4L5FH 4HIJB 1YJDL 2G5BA 4MLIA 1DSFH 3V4PL 2WAHA 5I8KH 1OGAE 1SEBB 2F5BL 1RZGB 4HEPG 2X4NB 2HJKA 1BM3L 4KRMB 1N2RB 1EAPA 1AQDA 4GUPA 1UKSA 3FRUA 1V3KA 4AEIH 3KYKH 4YHYC 4PJDE 3TZVC 1W0WA 3FFCE 1JHLL 3F12A 4Y4KC 4UIMA 4LPUA 4EUPG 2JCCB 3FN3A 3OKKB 3FQNA 3L3IA 1NGWA 3SN6N 3VG0H 3LSOB 1MQ8A 3BE1L 4NQEE 1CFNA 4QT5A 4U6YB 4U1MB 2JB5L 1MCLA 4HJGA 5HYIA 4P2RA 2PXYA 2NXYB 5I8OH 1CGTA 1QA9B 5F7EH 4PJAA 5KW9L 3IDJB 1IKNC 1F13A 4P46D 4GRWF 5EA0L 1MIMH 4QHKJ 5K9QI 2LAGB 4RSVA 1AIFA 3ARVA 5DO2C 2CQVA 1FH5H 3O3EA 4BFIA 3QWRD 1NBVL 1EIBA 1A4KA 3MV9E 4PJ9C 2Z31B 1IGYA 3TC9A 1PEWA 5HVGB 3B2VL 3EYFA 4JFEB 4LSSH 1QLRB 1S9YB 4D9LH 5F3BA 4N9GB 4PJAF 4M7ZC 4L8BB 4BZYA 1JF6A 3KPRE 3QFJA 4LCCB 1DCLA 1BD2A 2WQRA 3TBSA 4XBPB 1JP5A 4TTDC 1TCRB 2F5BH 3TBTB 3CVIL 4L9DA 5I1CL 1BM3H 1F4WL 3TNMA 1A7BA 1HOCB 2JE8A 3INUL 1YEDA 3FQUA 2ARJB 2HMID 1U8HA 5ID1A 1HSAB 1G7QA 1JHLH 3QIUD 2HH0L 1A9EA 1A5FL 4PGJA 1IFHL 4MHHI 5MERB 1CICD 3BE1H 5D96C 2JB5H 2EYSA 3RZWA 5KANG 1F4AA 2GFBA 3UDWA 3PL6C 5KW9H 3QEQB 5EA0H 3WFHB 3S35X 1CDGA 1WIPA 1RUPL 1S7SA 4TN9A 3C6LB 4CNIB 3RVUD 4KQ3L 4UT6H 3B2VH 2FO4A 2DTML 3HMWH 1HHIA 1PY9A 1CGSH 5CZVL 5D1ZB 1NBZA 4JM4L 2IQAA 5HYJA 3CVIH 1IZKA 2GK0A 3GJEB 4IIQA 4C54A 1F4WH 5TF1H 5DJXB 1IGML 2E9BA 2W60A 3CU7A 3INUH 2ZUTA 4QXTA 3VI3E 1T3FA 1U41A 1KPVA 3DHMA 4OI9A 4F3FA 3DPBA 4DGIH 2HH0H 4YZFF 1A5FH 3GSQB 1IFHH 1C08A 1XF3A 1WGOA 3C2AH 4XVTH 1CU4L 5DK2A 2EDDA 2ZSVB 1F2QA 4W68A 3QQ3B 1G6RB 5IK3B 1ND0B 3UYOD 1UWEH 4I1NB 2EZ0C 3BMVA 3MRMA 1QSFB 3KNBA 1PKQA 4FQXB 4I48B 4JGUA 5JXAL 4ZPTB 4K71C 4Z7UA 5D1QC 3BFOA 1VKXB 1TVHB 2ZUUA 1EHXA 5GRVL 3LKNA 1ZEAL 3CDYA 2J1KA 1OPGH 4KQ3H 1M6OB 1CIDA 2DQDL 2FSEA 3DRQA 2Q6WB 2DTMH 5HBBA 2Y6SD 4BH7B 3T3ME 3IS0X 4MCYA 2IAMA 3EOYG 4NO3B 4NKMB 4XNZB 5DD0L 5CZVH 1BHGA 4JHAL 5L8KB 3QNYB 3NFNB 4Z7UF 5JXEC 4KY1H 4JM4H 3NBNA 1J86A 1A6WL 4Z78B 1W72A 5C07B 1WBXA 2DLIA 2M2DA 3EDDA 5IFHH 3BP4A 1ES0A 1QRNB 2F15A 4Y16B 2ZUXA 1IGMH 3MRPA 4C55A 3UTOA 5BV7B 4CMHB 3QUKA 4Q0XL 1J0YA 2DL9A 1TVBA 5IKCB 4D0DA 1D5ZA 4X6DE 3QZWG 3WLBB 3X13B 1KV3A 1KLUA 1CU4H 5A1AA 2J12B 2P7TA 3WS6C 5EBMA 1ZAGA 2IANA 3QDGD 2H2SC 4HC1H 3VFUB 2D7MA 2DLFL 3O8XC 1N6QL 3IDIA 2PR4L 4XCFL 3SE3A 3P11L 4ACPA 2F74A 4KKBD 2K9UA 5DC0A 4HIIB 5TDOA 1W0VA 5JXAH 4Q2ZB 1U36A 1RUKL 4OT1L 4BZ2H 5C0RL 1IGIL 1CGVA 4AEFA 2GJ6D 1ZEAH 3IDMA 3MRQB 1WWCA 2DKMA 4L4TD 4EEEA 3CAFA 2G5BB 2DQDH 1J0JA 5D7JC 5HI4C 5GRYA 5CGTA 1YYLL 5JW5A 5DD0H 2HJKB 5FF6A 3JUZA 4JHAH 3T04D 3V5HB 3WL9A 4R97B 3KLAA 1AQDB 2ICWA 3CFCL 5E2UL 2Z0BA 5IEHA 4OZFA 1MCJA 4WIQA 3F12B 1N8ZA 1S7RB 1ZKAA 5IQ9B 2CKBL 3FQNB 1NGWB 3L3IB 5E24E 1MCSA 5K59F 4Q0XH 1R24A 3RQ3A 1CFNB 4JG1L 3SGEH 4QT5B 2VJXA 1PZUB 3MLVL 1CLYL 5ID0A 4I0PA 4P2RB 2A83B 1WCQA 3EFFB 5I6XC 1FL6A 3ARFB 4PJAB 1GGTA 4NC2B 2C4FT 2V9RA 3BI9X 1KN4H 1AD9A 4HWBL 3RNKA 3KWWB 4WENB 1AIFB 4ZO9A 2ZZUT 2DLFH 3LOWA 1V7NL 3O3EB 4BFIB 1N6QH 2PR4H 3P11H 4RRPA 4L4TB 5GHWL 1A4KB 1I1AD 1FCCA 5EOTB 1IGYB 1RUKH 3TO4C 4JHWL 4OT1H 1WTLA 4YH6A 4G9FE 2F8XC 1IGIH 5LKNA 5IJVA 4FQQA 3GRWA 3UBXG 5FYJH 1WICA 1N64H 2X10A 1BD2B 3TBSB 1JHKH 2V5RA 4S1DC 1UGNA 4M00A 3C5ZB 3FT4A 5JHDD 2JELL 4OCXL 1YYLH 3B2UC 2WMPA 4KV5F 4OLYL 4ZSOA 4JM2A 3TNMB 2OL3B 2NY3B 1OWWA 1YEDB 3FQUB 2HFFA 3SGEI 3CFCH 5I1AB 1MHEA 1U8HB 5ID1B 5E2UH 1G7QB 8FABA 5ANMA 4PJ8C 1A9EB 5MEND 4RISL 2CKBH 2DM4A 4FTVE 3G6DL 4LRIC 1DUZA 2PYEE 1H3WM 3HZVB 3KGRA 1JZ6A 2IH1A 2EYSB 2A38A 1CLYH 1QBBA 3MLVH 4EZMA 5C2BL 4JM2F 4U1LA 2EDRA 4OCWL 1VFAA 3BXNA 1A6AB 4HWBH 1FZOB 4ODSL 3ZKSD 3FN0L 2D7PA 2X40A 1V7NH 5KBNC 4XPTH 1J5OL 3IAPA 5GHWH 5FKAA 1F5WA 2EIEA 4DKDC 4R0LA 4F7CB 1GL4B 4JHWH 1KGCE 4K3JL 4MNQA 2FO4B 1QQDA 4LHUD 3HRZB 4NNYA 3LB6C 4ZOAA 1HHIB 4Q9RL 2BHYA 3VXUB 4MHHG 5TE4L 5I74C 4P0DA 5KG9A 1VADA 2BJML 1NBZB 2UVFA 5FOBA 3NIGF 4KPHH 1Y0LA 5DSCA 1EMTL 3RX7A 3HZYB 5HYJB 2JELH 4OLEA 4OCXH 5BJTA 2GK0B 5CJXC 4IIQB 4OLYH 4Y2DD 4P4RB 5I1EL 1C5DB 4QXTB 1BFOA 1DVFA 1T3FB 3BRFA 1KPVB 4WI6A 4OM1L 3ULUL 4F3FB 4KROD 4JR9L 2NY5C 3QNXA 4RISH 1C08B 1WZLA 3G6DH 4U31A 3S36L 4NC1C 1IGCL 4QNPF 3M07A 1U8PA 5C2BH 3AXLA 3EDFA 3CX2A 2PW1A 4U0RB 1KJ3H 2X4UB 3MRMB 4LDOB 3KNBB 1VB9A 3QT2A 4ODSH 1WFUA 2FJGB 4Z7UB 3FN0H 2DYPB 2FGWH 3LKNB 5HGGS 3T0VA 3KS0J 1YEJL 1OT2A 4PRHA 1JRHL 2FSEB 5T5NG 1MELA 2AABL 4Q9RH 3BEWB 1JHTA 3BP5A 4MCYB 3N1FC 3QQ9D 1F02I 5F21B 1GSMA 3EFDH 3IJYA 3CUPA 4CJ0A 3ULUE 3MJ9L 3FT2A 4JRXE 1I7RA 3BP4B 1ES0B 5C0FA 2DRUA 2GK2A 2X9WA 5I1EH 4LP4A 1FAIL 5DWUH 4XC3L 4OM1H 3ULUH 1S9XA 1TVBB 3TA3D 4D0DB 4JR9H 1D5ZB 2DMBA 3JVGA 1AH1A 1X5HA 1KLUB 1HIML 1U8JA 3VFWA 2SEBB 3W39B 1FYTA 5C7XL 2ATPB 2P7TB 1IGCH 3CVHL 5EBMB 1SHMA 5KSBA 2IANB 2Z8SA 1BBDH 3OAUL 4Y8DC 3SGDH 3VGHA 2JJVA 2ZCHH 4G43A 4TSBH 2BNQB 3IDIB 3VH8A 2EDQA 4NZDA 2F74B 3CMOL 3DTXA 3DXAD 4MSWA 1W0VB 3LPWA 3VFPA 5F71A 3D48R 5B3JF 5F6IB 1JGUL 3DYOA 3UAJD 4N0CD 1QFWM 1SVCP 2XN9D 1JRHH 3DVGA 3WS3A 2B4CL 4IRSC 1B3JA 5JW5B 3BP7A 5FF6B 3ARDC 3NZ8B 1RZKH 3WL9B 3QIBD 3KLAB 2FX8L 1KC5L 2ICWB 1Q9OA 1I9IL 4HUKB 3MJ9H 3SQOH 1YY9C 1ZS8A 3A67H 1HINL 4K55A 4OZFB 1KB5A 3RWIA 3B4NA 3O4OC 5E99L 3JSSA 4MD4A 4C56A 1XEDA 4CN1A 4L4VD 3RIFK 3FRPA 1R0AL 1NSNL 3SGDI 4XC3H 1EERB 1A7NH 3O2DH 2CSPA 4IEFB 2H2PD 2JJSA 1CGUA 5ID0B 5JOFA 4I0PB 2P5EB 3VFSA 1HIMH 5I19L 4W4OC 1FL6B 1UH3A 3CVHH 2AXFB 1P9MA 3EUUA 1F42A 1FG2A 3LIZH 5IP4A 4G8IA 3V6FA 2OXHA 5I75C 2P47B 3DNKA 5HDBF 4P5MA 2BX5A 1OTSC 3CMOH 4OCNC 2OZ4L 3VWJB 4XMLL 1IILE 1NLDL 3CDGB 1JRHI 3RVVC 5C08E 1D6EA 2B0SL 5DD5H 1QHOA 4YEEA 4QTIL 4M5YL 3O2VL 1RHHB 1Z5LB 1AC0A 3PDOA 2NXZC 4QLRA 4BSJA 2V2XA 5IJVB 4XPFH 3SCMA 5I0ZA 4J3XA 5DFVC 1YNLH 4P5TA 3RA7H 4DFHA 3FT4B 2B4CH 3QO1A 3K1KC 1PLGL 4ZSOB 3DLQR 2BY2A 4JM2B 4XT1C 3CZFB 2FX8H 2HFFB 1KC5H 5E4EB 1MHEB 2IFFL 5ADOL 1I9IH 1UZ8B 3I85A 4ODXA 4XAWL 2IG2L 4UBDD 1HINH 2GYSA 8FABB 4S11A 3HNSL 5E99H 3WFBH 4RX4D 3UTTA 3PHOB 3SDDA 3TGXA 4X4YB 1R0AH 1BPVA 1NSNH 3TYFA 5DMGD 5D7KD 4JFZL 1DUZB 3U9PL 2Z35A 3P0YL 1NEUA 5L2JA 3MRDA 5E1AA 3OGCA 2VWEC 4PG2A 4CRPA 5I19H 1SBSL 3FAXA 4X4XB 1VFAB 2ZUVA 2AJVL 5BRZE 3BXNB 3K4AA 2DIAA 3GSWA 3MV8E 2ERJC 1BMGA 4LLUA 2YPLE 1I1RA 4XI5D 1X5GA 2OZ4H 1NLDH 1BP3B 3BD5A 4LBEA 5FKAB 4ZUSA 1XFPA 2B0SH 4JPVH 3QXDB 4NCDA 4R0LB 4QTIH 4M5YH 4ZXBA 4NFCA 4MNQB 5IG7A 1ADQH 1QQDB 2CLZB 2IBGA 3NCBB 3KPSE 4NNYB 1WZ1L 3CXDL 1IBGL 3NPSC 2B20A 5KG9B 2GAZA 4OUOA 4HKBA 3G6AB 4O9HL 3IYLW 5FOBB 5DHVA 5DSCB 1HNFA 4PYGA 3THML 3SDXA 1PLGH 5BJTB 2LE9A 3ILPA 5EO9A 3ZHKA 3MOAL 1SVZA 1YEHL 1P4BL 1AO7A 4RFEA 1N6VA 1TETL 4TSAL 3T3PE 2NCMA 5ADOH 3LMJL 5D2LA 1G7LA 5ADPL 1MUJA 2Z93B 3HNSH 3WFDH 1ZHNA 1A14H 5E2WL 3AM8A 1HK6A 1R5WB 4NQCD 3GUTA 1G9NC 4JFZH 3U9PH 4KTDL 3SGJC 3P0YH 3RVWC 1JYXA 2R56H 4J4PD 1U8PB 3AXLB 2EEBA 3ABZA 1E4WL 3TBWB 1SBSH 4MD5B 2PW1B 4ZFZB 1OB1B 5DS8A 5D2LF 4I18C 1C1EL 4JN1L 5HGBA 5EU6B 2VO5A 3BDYL 1KXTB 4QHUA 1OAQL 4MQSB 1J8HA 3D2UD 4MNGE 3O11A 5I0DA 1HQ4B 2H32H 1WSST 3RZCD 4OZIE 4Z7VA 1J9CT 4P4KA 1WZ1H 3CXDH 5SWZA 4PRIB 1JHTB 1EV2E 4XNMA 1P1ZA 4HWEL 3ZLQC 3MLYL 3IJYB 2CK0L 3CUPB 2E7BA 4OTXL 3THMH 4BM7A 3FT2B 1I7RB 1BOGA 3MOAH 1YEHH 5C0FB 1P4BH 4M6NL 3QUXD 1NGPL 3DHJA 2JCCE 4G6FB 3DETD 1OAZH 1N5YL 1WC7A 1AXIB 5LXGL 2KKQA 2BOCB 5FO8A 3LMJH 5ADPH 3OL2A 4XVUC 2Q8BL 5E2WH 2V5TA 1LVEA 1U8JB 4LSTL 3VFWB 1FYTB 4ZOBA 1YJDC 2ZP0T 4KTDH 2VZ1A 1IC7L 4KHXL 4HH9A 3PF2A 1EPFA 4QGTA 4NC0B 3VH8B 2FJFB 1E4WH 1WUNT 5D2NA 2MMXA 3DTXB 1KELL 4MSWB 2QL1A 5F93C 1KPRA 4HUWA 3VFPB 4J3TA 4BZ1L 4H8WL 1C1EH 4K7PH 4JFEE 4BFEA 5GZOC 3BDYH 3PXHA 4QGYA 1OAQH 2DIBA 2H8PA 5J57B 4DVBA 2ZUSA 1FE8L 1S78D 4HKJA 3X3FH 1CXLA 5J13B 3FJTA 1ETZB 1R6VA 3RP1A 1X5IA 3DVGB 2ATKB 1NEZA 5I17A 3S4SG 3WS3B 4FNLH 3PXJA 3GMQA 1YNTA 3BP7B 1Z9MA 3D69A 3MLYH 1O5DT 5C0AD 3O0RL 3E3QE 4OTXH 1JGVL 4I77L 4KDTA 5FFLA 3AB0C 1ZS8B 2I60L 1KB5B 4HF5L 4L1DA 4M6NH 3RWIB 4C56B 1NGPH 4JFFD 3S3SA 1N5YH 2ED8A 1MCCA 4ZNEA 5HHOD 1JF5A 1HE7A 2NLJA 4FQ2L 1YMMA 4RGND 2WP3T 3V8OA 3LHPH 2Q8BH 1L0YA 5JOFB 5GRJL 3MQIA 4Z7QE 3VFSB 4LSTH 3SDCA 3E6FA 3QEQE 1ZT7A 3T0AA 4Z95L 4PUBL 3MC0A 3V6FB 1IC7H 4KHXH 4G8GB 4JO3H 2HT3D 1G6RL 1F3JA 1IC4L 5D93B 5CEYA 4DJMA 1LD9B 1LDPL 1HH9B 3OR7A 5ICXA 3VWKB 1A2YA 1D6EB 1J88A 2YD1A 4H8WH 4BZ1H 1DQML 4Y4HD 1F4YL 3NAAL 5F9DC 3PDOB 2VRAA 3C60C 4Q9QL 4ETYA 5FGSA 3SCMB 1WF5A 5BZDA 1NQBA 5KVDH 5JQ6L 3QO1B 5TFSL 2DJSA 3GMNA 3PWPA 2UZYB 1S7QA 5F1OB 1ZVYA 1A7RL 3O0RH 3BOVA 2VR4A 4DFIA 3QH3A 2WINA 1AE6L 4I77H 1QLFA 4Q6IB 5LCVL 2I60H 5AYUL 2NQCA 4HF5H 1XGQA 4XNQB 4PV9A 5GJSL 3UTTB 3SDDB 1KJMA 4NP4L 4ZDHA 4J23A 5BV7L 1Y18A 2Z35B 4LU5H 5C3LD 1J0IA 3C9NB 5ITBL 3MRDB 3OGCB 1XGPA 4YC2B 2FIKA 4HCRH 4L3EA 3MGOA 3GSWB 1KCKA 4KKAD 4LLUB 1DBML 4NCC1 3RGVD 1G7HA 1IC4H 4CW1A 5F97E 1LDPH 1LK2A 4NIKB 4JREB 2FGZA 3FHAA 4XNUH 4LBEB 4M48L 4NUJA 4ZUSB 2GCYA 3C8KA 1DQMH 5BW7A 3NAAH 3P9LA 3OPZL 4EI5C 3L5XL 4GRLA 4Q9QH 5HYEA 1UWXK 2X4OA 3SDAA 1IVLA 3EOAB 2E9JA 4HKBB 3MYJB 3UMTA 4M93C 1U3HA 3O41A 5J4MA 1J1PL 5C07E 4ZFGL 5HYSB 3RPKA 4O2FA 1WQVT 3ILPB 5EO9B 1WEJL 3L95B 5SX5K 4KUZL 5I76A 1A7RH 4X5LA 4RFEB 1JGLL 3BPOB 4EOWH 5LVEA 1AE6H 4ZOCA 2IPTL 5D2LB 1G7LB 1MUJB 5AYUH 3MLPA 2FHCA 1CI5A 3TBVB 1PAMA 1ZHNB 3RKDC 4I5BA 4JHBA 4KGLA 5KS9A 5BV7H 4XWOC 3SE8L 2D7TL 2D7OA 4TNWF 5HI5C 5CGYD 4N9OB 5ITBH 1RSFA 3RI5F 1WT5C 1CXHA 4RWHA 1MRFH 2VERN 5DS8B 1DBMH 4I13B 5HGBB 1KIRA 1MAMH 1TVDA 4IHOA 1WFNA 5KS9F 1JGDA 2E6JA 5I1IL 1J8HB 3BH8A 3O11B 2KPNA 2J88L 4K9EH 4M48H 3MRKB 1NAKL 4OBRA 4MJ5B 5BS0D 5F9JA 1JNHA 1I1CA 3OPZH 3OJVC 1B0GA 4P4KB 5SWZB 3L5XH 3IRPX 3MNVA 3L5JA 1P1ZB 4XNMB 2Y1VA 3DMMA 4AQ1B 2C1OB 2XY2A 3TN0A 3HAEB 1J1PH 3F7VA 1U0QA 1FORL 1SEQL 1WEJH 1BOGB 1AR1D 1WVZA 2OL3L 4KUZH 5CBAA 1DLHA 2EC8A 1JGLH 4JDVA 4NHUA 1DN2A 4KK9C 2R1YB 1A3RH 2IPTH 5FO8B 1MFEH 4JO1L 4EIZC 3RPIA 4OLUL 5ESAA 2JTDA 3HE6D 4P2RE 1DBKL 2K3TA 4WI3A 4MXQC 4LLWA 3TWCH 5F8QC 5I1DA 2D7TH 5E4IA 1J05A 2HLFC 5B38G 5T1KD 3KXFA 4L4TE 5D2NB 4MXVF 1JPGB 3NFPA 1C5BL 5GRUH 4KK6C 5GRZA 4YPJA 1IKFL 5CLTA 3QNZB 1T0MA 5F1SA 4YHNA 3HMXH 4CGTA 4DVBB 4HKJB 2J88H 1NAKH 5DHYA 1BD2E 3SDYL 2NY1D 4NQDA 1NEZB 4XMKL 5I17B 4X98A 1YNTB 3D69B 3T0WA 4H0IA 1G0YR 1OM3H 2Z8RA 2DD8H 4XPHL 5DLML 2UYLA 3SBWC 1TMCB 1SEQH 4M5ZL 2FEDD 1CDHA 3T08A 2OL3H 1A6VH 2FRGP 2F8VA 3KR3H 4G3YL 4QYOB 2J5LC 4F37K 1CVSC 4RAVB 1YMMB 4LPCA 4JO1H 4CN4A 2CLVA 4OLUH 1I9JL 5CWSA 2AV7A 3HC4L 3RKPA 1DBKH 2YZ8A 4PRNB 5IR1A 3FZUC 3SDCB 4AYFA 1NGXA 3A6BL 3GSNA 1BVKA 4YX2H 3CX5J 2JK5B 1F3JB 4IOIB 5CEYB 5I1HL 3OR7B 5CD5D 3D6GA 4R96A 1C5BH 5EC1A 3BAEH 4MVBC 3DX7B 4Y2OA 1U3ZA 5ICXB 1A2YB 2XZAH 3I9GL 3QDHA 1LO5A 3VXUE 1A8JH 3KYOA 4Y88A 4YZFE 4U3XA 1LE9A 3VRJA 1FVDA 4C59B 2GT9A 1SYVB 5L2KA 3SDYH 5HYJE 4XMKH 3EJZC 1TZGL 5DZOA 4J3SA 3GMNB 3PWPB 4MA7L 3W0WA 4LLMA 2ICWJ 4PJ9A 4FABL 4LASL 3QH3B 4XPHH 5DLMH 1QLFB 4JRYD 2HTKC 5K33A 5JPNA 4M5ZH 4XP9L 1XGQB 5BOZG 4ZFOB 1CLZL 4PV9B 1KJMB 3ECBA 5IWLC 3DURA 4ZDHB 4G3YH 4CVZA 4YWGL 1MLCA 5FB8B 4YDLB 3JTSA 2J8OA 2VZSA 3VFTA 3W82A 1UXSB 4MWFB 2MNUA 1XGPB 2FIKB 2BXZA 2BNRA 3A6BH 3P9WB 4L3EB 4HIHA 2AS5M 2ADFL 4NGHL 5EOCL 4Z7UE 1A7OL 1G7HB 2VDPL 5I1HH 4V1DD 3QI9C 4HX1A 4RGMB 2FX9L 1UWXH 4PRAA 4X9GA 4NUJB 1JBJA 4DZ8A 1R3IL 3C8KB 2VLJD 3I9GH 1IQWH 2EXWC 4Z0XA 3ULUC 3P9LB 2N1KA 3DX9A 4GRLB 5CS7A 4EN3D 3H8NA 5SX5H 2PCPA 2X4OB 1M7DA 3PL6A 3SDAB 2CKNA 1T66C 1RK0A 2V5SA 1U3HB 3O41B 3QWOA 4ODTL 1TZGH 4O2FB 4PD4J 2X6MA 2YD7A 4FABH 4GQ9L 2R2HB 5DFTA 3BPNB 3GDBA 4XP9H 1CLZH 4I5BB 4PPTA 2NZIA 5KS9B 3VU2A 5KSUA 1YPZA 4QEGA 2BNQE 4R2GD 4XAKD 1MFBL 1BWWA 1XZ0A 2Y5EA 5JLZA 2XWTB 3V7MA 1Y6KR 4X7CC 3SEPA 2YSSA 4NGHH 5EOCH 1AJ7L 3JV5A 1OCWL 4ODUA 1AY1H 1A7OH 2VDPH 1EFQA 1KIRB 2HYMA 4IHOB 2CO6B 2Y23A 4L8SA 1JGDB