1RJYB

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Structural Basis for the Restoration of TCR Recognition of an MHC Allelic Variant by Peptide Secondary Anchor Substitution
pubmed doi rcsb
source organism Mus musculus
total genus 15
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rjyB00
4FQLH 5C86A 5F96L 5I16B 1E4XH 1OD9A 3MRMB 4JFED 4EIGB 3FB8B 4DCQA 5CJ5A 2FIKB 2R0ZH 4IRZH 2G5BB 4AEHL 4HV8B 5H2BA 5C92A 1G9NL 4MNGA 3ISWA 4ERSH 3BHBB 4LQFL 1T6WA 3BYTA 3V6FA 3BP7A 3VFPB 4IIQA 4RGOH 2CRZA 4G9FD 2BP3A 1LEKA 3QXDA 5FKAB 4KMTH 1A47A 5FAAA 4KI1A 2LAAA 3MOBL 5ISZD 4NZJA 5CZXD 3F7VA 1E6OL 5A2IH 3HC0B 4Y1AD 4MZ3A 1JF1A 3O4LA 5FUCC 4TOYL 2BNQB 5L6YH 3C8HA 4KHTL 2CKBA 4EEEA 4Z0XA 2FBJL 3GMLA 3VXPB 1YN7A 2AXFB 1E27A 1CDHA 5A43C 4J4PC 3IDGB 4YK4B 1NFIA 1FLRL 2Y06L 5DD6A 1NCBL 4YK4C 2JK5A 4HF5H 4YX2L 5FDWA 2PW2A 1PX3A 2YA0A 5GS0H 4MSWB 1ZXQA 5KVFH 1EPFA 5DEFB 5F7LB 5I8CB 3DX7A 4JFXA 3G5ZB 3HHRB 2NY6D 4ZPTA 4EN3D 4OZ4A 3VCLB 1RIUH 4HWNA 4HS8H 4XC3L 1AP2A 3EAKA 2I27N 4GMSH 4JQIH 3WUWG 5FOJA 5L88H 4HUXA 4DKFL 4EDWH 3V79C 2XRAH 4BZYA 5IBUG 1JZ2A 1XGRB 2Y5EA 1NUDA 3GIVA 2UZIL 4S0TD 5T1KB 4PJFA 3DMMB 4OIBA 5D5MF 2HFEA 3DMMC 3ILQD 3O6KH 4NPYB 1A7RL 5F7HA 5D7LD 4PG9B 1IZJA 4KGJA 1TXKA 1F02I 2F58H 3KPSD 4PJEB 1NGYA 4WU7A 4JM2B 2WWMC 5F7UA 3LQAC 3P0YH 3H7BB 5EO1A 4LDOB 3WFCL 5ABDE 1VKXB 3RWIB 1BVZA 3G5VA 2X70A 4KI5F 3MV8E 4M5ZH 2PYED 4OF8A 2BHZA 3KYNB 4LKXA 2PW1A 3RUGF 3CMGA 2AJZB 3BX7C 1FH5H 1I7ZB 4PJGB 4IHOB 3BEWB 4XWGH 1ZLSL 1HYSD 2HMID 4XVUD 3BJ91 4UNUA 4U6VH 2GJJA 4U1GB 2XTJB 1XF3A 4PB9H 4U1GC 3V52L 2XTJC 3KXFA 2O61B 1S7TB 4HKJA 3LEVH 1TTGA 4RRPG 3VG0L 1MCPL 1P4LB 1G6RA 2FYYB 2BY1A 3T0VA 3I6GA 4JFPB 4XPTL 5HYJA 3QPQD 3MJ7A 4PLJC 1TNMA 3W2DH 2ARJA 1IGIH 1YZZA 3MBED 1I1FA 3WBDA 3W11C 5JHDD 5HGAA 5CINL 3CH8A 5L2KD 1U91B 3HI6L 3SGKA 3VXUB 2W65B 3EO0A 1PSKL 3HMXH 1UM5H 1YPZF 4ZD3L 2CRYA 4PJ7A 1TVHB 1HXMA 5KSBE 4LHUD 1IGJB 3UCRA 9CGTA 3IS1X 2JKXA 1XAUA 3AM8A 4DOHE 3TA3C 4LGPB 1AD9B 3VWKB 3VWKC 1V3MA 3ZL4L 5DWUH 1JWMA 4OZGB 5C8JA 4JO1L 2ZUVA 3L5JA 2YRLA 4PJ9B 3BIAX 4PJ9C 3BW9A 3MCLH 4X4YB 5IFHL 4BUHA 5IB3B 3HE6A 5ID0A 1I3RB 4YR6A 4DKEL 1F4WH 3WO3B 3BT2L 2GK0A 1E4KC 1G0YR 1SY6L 1EHXA 5IG7A 4CMMB 3BWAA 3JV4B 4X8JA 5BOZG 4UILH 1A6VH 1JYXA 4L9LB 4KRPD 4OF7A 4QOKB 2PR4L 3AY4C 1NDMB 4YHOH 1E0OB 4KHXL 1QNZH 1MF2L 1WCBB 4AENB 2AAVA 3OJDB 5TJWK 5AAWA 3MOAL 3ARDA 1KYOK 4NZUH 5KOMC 2EDJA 4G8EB 4JDZA 3SKNB 5DD5L 2KPNA 3GK8H 2JTDA 4F9PC 3TJHD 2OSLB 3EDKA 4RGNE 3CDGB 3HA0A 4KU1A 8FABB 1XCQB 3I6LD 2N1KA 1NCNA 2ILLA 3ARYA 2HKFH 1PG7W 4JFZH 1U8PA 4Y4HB 4Y4HC 3HG1E 4PRAB 5E1AB 4WU5A 3FQTB 1NFDF 1MFDL 1A6UL 1IBGH 3BZEA 2CKBH 1I9IH 1LNUB 2JELL 3ARWA 3D0VB 3M8OH 1GHFH 1DSFH 5CD5C 1YJDH 2D9QB 3IDXL 1AJ7H 4Z6AT 1S78C 2I25N 1NMBH 3G6AA 4FQQA 5FO8A 2AJXH 3QNZA 2YZ1A 4DGYH 3QEGH 3VGAB 3QFJB 3VGAC 5C3TA 4M1CD 1H3GA 4CVXB 3W0WE 2GJ6A 2L4OA 4NQTA 4NSKB 1F6FB 3VFRB 1Q9WA 3GMOA 2BVTA 4G9DA 4BH8B 2R4RH 4F7EA 1MEXH 1NAKH 5D5MA 2Q76A 5DZLA 1CDGA 3L7EB 1N8ZB 2C1OA 1F3JB 1YECH 1QR1B 1R3KA 5HD8D 4OI9A 3UTSD 5F21B 2P44B 1AFVH 2GY7B 4P3DB 2NR6C 3STLB 1EERB 2GT9A 5GJSL 1MJ8L 1PKQE 2V2WA 4S0SD 1C16A 1RK0A 1SYVA 12E8L 3AB0B 2V17H 2J4WL 3AB0C 3E0GA 4PGJA 2OZ4H 2W92A 1T66C 3QUMH 4HUWB 4OCYH 1FPTH 4UQ2B 2EDYA 1TZGL 5F88B 3LN5A 3U36B 5EG6C 3DRTB 4YWGL 3NH7L 4X6CB 5CUSL 5FHBH 3RUGA 3QCUH 3CLFL 4NQDD 2EH7H 1ZA3B 3TIEB 1W2KT 4BSVB 1LO3L 3SOBL 3PWNA 2F74A 4YDJA 5DRZA 1QHOA 2VIRB 5FV2A 2EEBA 2VISB 5I18L 2YD9A 4IRSD 4JE4B 2YPLE 1KIRA 5F7FA 3HNVL 3K4ZA 2JB5L 4BA8A 3VGHA 1AGDA 4R4FH 3S96B 3H7LA 5ECJE 3VXOA 5GZND 4G8IA 1YPZA 1MREL 3RZCA 4AM0B 2R0WL 5J6GB 1NLBL 4MNGE 1WBZB 3NA9L 4PJIB 5DJ2B 4CRPA 5IJVB 5FK9A 2CGRL 5DLMH 3NZ8B 2NCMA 3IRPX 3KS0H 1R5VB 4JAMA 5GS0C 1BJ1H 4YHPA 4F58L 4R0LB 4R0LC 4XPFL 3U2SB 5CP7B 5EZIL 5GS3A 1L7IH 4YDLB 3ECBA 5DT1H 5DMKB 5JMRA 3IAGC 1MFEL 4PRPA 3GMQA 4IDJH 4ZQKA 1BZ7A 1IEAA 1PQZB 4M7KL 4YPGA 5DK2A 3T3ME 4F57H 2DTML 3QUZA 3KPOB 1KN4L 5IQ7H 5HI5D 4N1CA 3QQ9C 3ZYIA 2D0HA 5GIRB 5E6YA 4RFOL 5I6XB 4EI5B 2P49B 5I6XC 4EI5C 4NC2B 4JFDA 4B7LA 1K8IA 1QLRB 3IDUA 1U3HD 1UJ3A 3NIDF 5LAXA 3MV7A 1QZ1A 2LABA 3PGDA 4QKXB 3WNOA 3Q5TA 1YNTB 2NW2A 4H1LA 3MV01 3U9PL 1LHZA 3DUUB 3ZSTA 5MI0C 3VU2A 4YGVA 3BYYA 4HXAL 4NQSA 3TBSB 1UB6B 4E41A 2WWKT 1I3GL 1VFBB 4HKXB 5ICZB 1OVZA 1BD2B 3FB6A 4ZAKA 4EQ3A 1VEMA 4UT9H 4UTAL 1I9EA 3GBML 4YHNB 1A3RL 1DFBH 4U1JA 4ETYA 1K8DB 2NY0B 4K7PH 2NY0C 4PJFE 4PJ5D 5J57B 4J23A 4X9GA 4MJ5A 1INDH 1R24A 5J1TC 1MOEA 2F53A 4JPVL 3V5KB 3O9WD 4XP1L 1BQHB 1HHIA 4FTVD 3SDXB 2LFGA 2VZSA 2F9BT 1JMXA 2YEZB 4TUKL 4P5TA 3WN5A 1MCNA 2R1YA 5IMMB 1VERA 3QCVH 4HUVA 1NFDA 4LEOB 1QBLH 5DI8A 5I1HL 1MFBH 5K9OB 3R4DA 3GSWA 5KOVC 2RR3A 3BOVA 3EOAA 5JW4Q 4MHHG 3D87B 3EYQD 3F58H 4MA8H 3W9EA 3OKLB 3JWOL 5IB4A 1ZVSA 5T3ZD 1GZQA 3S37X 1CGWA 4LLMB 3MJGX 2H1PH 5L8JB 3PWLA 2X4UA 4XPGL 4P4KA 5GXBB 2Z8WC 2Y07L 3KXFE 3QHFH 4LARL 4KAQL 2V5TA 1MCRA 4XNXL 2HH0H 3VFUB 3ARFD 5D1QB 1FO0H 5D1QC 5ID1A 1GOHA 5FO7B 5IMKA 3TO4D 4AZ8A 5HYJE 1JRHI 3DVFA 3EYOA 4PJDB 2VLJB 4PTTA 5BZDA 4M6OL 3KYOB 4X7EC 2CK2A 2X4PB 4HC1H 2Q20A 1S9VA 1ZVHA 4ZUSB 4PJ7E 5DS8B 4HWBL 3DV6A 2NY2B 3ULUL 2NY2C 5ENWA 3AU1A 5D7SL 4NZRH 3O4OB 1DL7L 3O4OC 1X7QA 1G7HB 4JFEB 1IC4H 4ZUVB 1XF2A 3FOLB 1VGKB 1HIML 4YHZL 3HZVB 4S1DD 1WEJH 5CEZE 1FNGB 1HXYB 3C2AL 3F6IA 3P2TA 1L7TL 3WEXA 5KN5A 3EJYC 1UCTA 3H9HA 5JW3L 1KOAA 2KQNA 4G9FB 3MA7A 4NKDA 4CVZB 3OKYA 2BSSB 5LWYL 1I8LA 3D2UA 3IDJB 5CJBA 4UBDD 5B22A 3CFCL 5ISZB 4S11A 1FFOA 4U6YA 4J8RA 4N8VB 2BZDA 3T0WA 2KH2B 3DUSB 3X3FH 4XPHL 1Q0YH 5HTSA 3BQUD 1OARH 1ZLVK 5KSVA 5CJ8A 5AEAA 3QQ3B 3VRIB 1U93B 1YJDC 3I6KB 1NMAH 3HZMA 1IGCH 3GJFK 5DJAB 1H0DA 1FZKA 5GGVY 4XCEB 2HG5A 4NO0D 5ESAB 5GZOC 2HVJB 4OM1H 4PJBB 3FQRB 5MEPB 1CD1B 4HJGA 3UTTD 3H3PH 1MCEA 4M9PA 2VN7A 1CVRA 2XN9D 1S7XA 4KZDH 1HZHH 1G7QA 2NY6B 2NY6C 4ODTL 5I1CH 2BRQA 4OLVL 1U8QB 3QZWB 3ESVF 4LSTL 2OI9C 4ZO8A 4LLYA 1WGOA 4X0KB 2WINA 4RGMB 3OKMA 1DQQA 4RGMC 3CSYA 4QXUL 3NN8B 4JM4L 2HVKB 4NJAH 3QUMB 4HUMB 3NACH 3OQ3B 5EBMB 1OM3L 1AIFB 2P5EB 3ILQC 3MLSL 5C09D 2DIBA 3STBA 1T83C 5CCKL 2OR9L 1CBVH 1H5BB 4OCWL 3ZKQD 1H5BC 1ZS8A 4HKZB 4NM8L 4I4WA 4GQ9L 2J2ZA 4KDTC 3KPSB 5E70A 4TQEH 2YKLH 3O8XB 4I3RL 4F8TA 3NABL 3U0PB 2VLLB 1P6FA 3O8XC 2RGSA 2NTFA 3LOWA 4M8VA 3UAJD 5IJKA 2GJ6E 2ITDB 2VQ1B 4O2CA 1KGCE 5J6HB 3OL2A 1H8SA 5FF6B 5C0AA 3LS4H 4ORGB 2B4CH 3L3OA 2FO4B 5D5ME 4BH7A 5LG1A 3LN4A 3SDDA 2Z8RA 4H20L 3RL2A 2R9HD 1JFQH 3IXTB 3WJJA 2DQDL 3DO7A 2GFBB 4ONOA 2EIZA 4QRPE 2DN7A 1RZ8B 4ENED 4NDMB 5BVPL 1OGAA 2HMIC 3GSNB 4XVUC 4OCXH 2BVOB 3FN3A 3GSXA 2ESVD 1MIMH 4Z7WB 4TVPD 1BVLA 4HKBB 4KI5E 1SJHA 3OKNB 5SWQA 4NQED 3MBEB 2RHEA 3HPJB 3TBWA 4JQVA 3WKNA 1R0AL 4XCYB 1U58A 1H3PL 1B88A 1A9BB 1IFHH 5C6TH 5JA9A 3GFUA 1FJ1B 4JGUA 2FSEB 4AEEA 3D39D 3OKDB 4RA0C 3QIUB 4PFEA 5D7KD 3QIUC 5DJCA 2A38A 4RMWA 4DW2H 1YY8A 5DMGD 2BVQB 4LHUB 4HMCA 4HGKC 1VCAA 4F2MA 3I3BA 1D7FA 5A3ID 4X5WA 4OLXL 2A9MH 3I3EA 2WP3T 3WKMH 1LEIA 4YFDB 1YPZE 2Y5TB 3QO1A 4QF1A 2Z8VC 3R1GH 5JPNA 1UWXH 1QBML 1EFQA 4GKZB 5HHOA 1CFTA 1Z0MA 1EVUA 5CLTA 3Q1SL 3WHXB 4KDVA 5HYSG 1KCUH 2VABB 2DLHA 5DSCA 3O3DB 1DZBA 2VC2H 3BRDA 2HJLB 1A7OH 1SBSH 3FOMA 2V2XB 3L5HA 4P2QD 4X5XB 1CE6A 3O3EA 4MCYB 1T3FB 4QNPE 1KPUB 3VGFA 2XA8H 3RX7A 4I3SH 3RWFB 4PJ8D 1MY7A 4MHHI 2C1PA 4TRPL 4KQ3L 4U1LB 5IHUL 4XZUA 2VDNH 1AGCA 3RX5A 3DXAA 5AAMA 4KRPB 4JRWA 4U1IB 4KTEH 3HB3D 1EEYB 1ZWIA 3MXWH 1S7WB 1A4JB 3Q6FB 5J3HC 4WTXA 4JFDE 2ZCLL 4P57B 4C56B 2EXWD 1MIEH 3FQXA 5D6DC 1DBKH 3D9AL 5IB1A 5CJXA 1KB9J 4ZPVB 5CZVH 3MV7E 3KPMA 4JO3L 4NO3A 4GRLA 1EGJL 4LASL 4ZMAT 2P24A 4APQB 4APQC 1OP3H 4EOWL 4TTGA 1BFTA 3ZKNC 4M61A 4LCYB 4OD1L 5GRVK 2J12B 3PHSA 5C08A 2R69L 1UENA 4GXUM 4E41E 4PREB 1H3WM 1YC8A 1QFWI 4YXLL 2NY5L 4D2NA 3BDYL 2AV7A 5F8QC 4UI2A 4HWBA 1DEDA 2ZSVA 4DGIL 4Q74A 4N5UA 2PTTA 2FZ3B 3RVVC 4A2MA 5AD0B 2IGFL 3BIKA 1NUGA 3QISA 3QUYD 5C0DB 3VXMA 3L6FB 2A83A 5E5RB 1FO0B 2YPVH 1S7SB 3OV6A 2F53E 1I1CA 2WK2A 2YZ8A 4DGVH 3QUKA 5KW9H 2IC2A 3QDAA 4HULB 4LSSH 1D5ZA 1YEIH 2V7NA 1PW3A 3C87A 5HYEA 4XXDB 3FN9A 4RA3A 2VLRA 2K1MA 4KK6C 1FNAA 1M71A 2EKSA 1MLBB 1TITA 2XACC 2F5AL 3MLXH 2NXYD 1AGBB 5IHBA 3UTSB 5HD8C 2B5IC 1N26A 1QG3A 2BSRA 3S35L 1D5MA 3PABA 5FGBC 1HOCA 1DCLA 1RUML 1PFCA 1TIUA 1X3DA 4YH6A 3MV8D 3QIWA 5FYLL 1O7VA 4PY8I 5IFAL 2FO1A 3DJ9A 3DYMA 4MAYA 4ZSOE 1GPOH 4HIEB 4Q7DA 1TJIH 3DRQB 3OWEA 3O0RL 1QSFA 1LO2L 2LQRA 4C83A 3P9LA 4ODWB 3ILPB 3SJVA 1RU9H 3TVMA 1QQDB 2F15A 3AMLA 4P3CH 4WI2A 2P5WD 2AJUH 1GSMA 5DTFB 3LKOA 1A1MB 4ONHB 4GSDH 3MRBA 1E4WH 4MXQD 3V5DA 5TQ2L 4IRSB 4IRSC 1TNNA 5BW7A 1HHJB 5GS1B 3C5JA 5GS1C 3DNKA 2MCPH 4LSQL 1AI1H 3K8MA 4HCRH 1IGTB 2IANA 4JO2H 2QQLL 4N0FA 1CDYA 1DP0A 3B9KD 1EK3A 5GZNC 5KVDH 4P9HH 5KTEL 4W4OC 4HDIA 5C2UB 4UV4H 2X2YA 2CDEA 4LLVB 3WNNA 1GC1L 1WBXB 1T0NA 3DSNA 4RQQB 5B3JE 1JHLL 3QI9A 1AY1H 2VN4A 4ODBD 2OL3A 1DQJA 4GG6E 4KTYA 1V05A 4E0RB 3REVA 3HZYA 3T1FB 2DQUL 4N8CH 4NJ9L 3HS0A 5DC9B 3ZE2E 4PRDB 5IEHB 1XR8A 1ZTXH 2UVFA 3L3JB 1EJOL 4XH2A 4LVEA 3G9AB 2E6PA 2OM5A 1G7IB 3MLUH 3BKMH 1YY9C 2D03L 2W9EL 5GHWL 4CU6A 5E2WH 5HI5C 4FS0A 2EYTA 5EZJB 4LLDA 2DKUA 3C8DA 4CNIA 1NGQH 2EXYC 5EOQL 2XWJB 5LGJB 5BRZA 3DV4B 4MNQE 1ZT4A 2PCPB 3H3BC 3TBTB 4S1QL 5BMFL 2G9HB 3RGHA 1U3HB 1WLHA 3CX2A 1U3HC 4ZXBB 1CLOL 4ZXBC 5FGRA 5D7JD 4ZUTB 1OB1A 2B4CC 4HQQH 1VENA 2IFFH 1DLHA 2FRGP 3E6FA 3T2QA 3D48R 2FX7H 4P5KB 4K3EL 3V7MA 1XGQB 1I3UA 5EU4A 2DOCA 4RGND 5DUPH 2R8SH 1OSPH 2XG4A 1OP5H 4B7IA 3CFDA 3IU3A 3KPLB 4MD4B 3HAEG 3WNMA 3SCMA 2AK1L 4YHKL 1LE9A 3RDTD 4A2LA 3KYKL 2Z31A 4PJ5B 3BKYL 5E1HB 5C9JB 3HG1D 1RUAH 4FTVB 1YC7A 5EIIA 2DQCH 1BEYL 4WY7H 1G0XA 4NFCA 3MUGB 3W9DB 2VXVL 4NN7B 2X09A 2YPKB 3DX6B 5F1OB 4NN7C 3U82B 1DBML 3KWWB 3P40A 4KKBD 2P7TA 4MD5B 1VSCA 1ETZB 5K9JL 5F8RC 3OXRA 5F9JB 4H88L 1N2RA 2R56L 2HFFB 4K8RD 1GH7A 3U6RA 5DK0A 3HZKB 3BEVB 2EDEA 3CGTA 5DA0B 5F70A 5JUEL 4LOUD 2HFGH 1U8HA 1CD9B 3MRQA 4NN5B 4NN5C 4AT6A 2ORBL 5AUMB 3A6BH 1MCOH 1I4FB 1WSST 5DR5L 4ZYKA 2E8ZA 1XIWD 3VXQB 3MLVH 1LK3L 1DUYB 3MRIA 3ARFB 4XXCC 1LWRA 5IW6B 2J8HA 1WUNT 3TO4B 5EU7C 2X10A 3TO4C 5ALCH 4Y4FA 1XR9B 4WCYL 1ORQB 1U6AL 1OCWL 1G7MA 2XKUA 2ZOLB 3MUHL 1EAPB 5H8DA 4YDKL 1WQVT 2AS5M 4I77L 2I26N 2IBZX 4DK3A 3O2WH 3E3QE 1EGJA 1P4BL 3KHOA 4ONFH 4PRBA 1MAMH 2EYSB 4BZ2L 3FB7A 4LK4A 2L7JA 3SN6N 5M94B 1R5IB 1INQB 2H2SD 3T2PA 4NWUL 3ZT6A 3ZTJH 3HC3L 1GGTA 1HSBB 2ZJSH 4G6AC 5T3XL 5JOFB 2FATH 1K85A 1U8LA 5DHYA 1T5WA 2YPLD 3TT3H 3WHE0 4DN4H 3PWVB 3GUTA 5L2JA 2FEDC 5GGUB 1JGLH 5AZEL 5HGDB 4PS4L 3QEHB 1Q9KB 1HKLH 5T1DH 2Z9TA 5C0IA 2W60B 1MHEA 4I5BB 4NQXB 4FABL 3GHBH 4JRXB 4NBZB 3ZYJA 1IMHC 2UYLA 2Z92B 4XGZA 4QTHB 1LK2B 4Y4KB 4YQXH 4UBDC 4CL7A 4Y4KC 4J6RH 4NNPL 3BUTA 1T22A 4MZ2A 2YBRB 5CJOL 4AMKH 2I9TB 4UTBL 1XF4A 4CJ1A 2A73B 1KELH 3GJEA 4JJ5A 2OTPA 3F7PC 5CSBA 3C9NB 3GKWH 2VXQH 4C4KO 1C12B 1YEHH 3DXAE 1X6NA 5C9KA 1JRHL 2WUCL 4L4TA 5F7EL 4J3WA 1YEKL 2PTVA 3O4LD 3HC4H 5C0JB 1T1XB 5D8JH 2VITA 4NO0B 3S97C 1KXTB 5AZ2L 3VRJB 4QHNA 1VFAA 2NLJB 2R39A 2WQRA 1IM9A 5LXGL 1F8TL 3UTTB 1S7VB 2R29H 2XN9B 3VMOA 4PGCB 2OL3H 2G2RB 5EFIB 3H2WA 5C08E 3ALXA 2QR0A 1P5VA 4XB8A 2OMNA 4RZCA 4QXGH 1E6JL 1B0WA 3S8WA 4FQCL 1JNJA 4JQXC 3EFFB 1EEZB 2CXGA 3OBAA 1GIGL 5FA3B 1A02N 5DZOA 3ULUE 5IFJB 2FHBA 3MRLB 4CUCA 3FT2B 5TDNB 2PXYD 1KJ2B 3T2NL 2O93L 3VXME 4S1RL 3I02A 1MQKL 5DVLA 3TNMB 4QY8B 2CUMA 2FX9H 5JW4R 3OHXA 3ZHKA 3PE9A 1QSEA 1KIUA 1PY4A 4DN3H 5I2IB 4LLQB 2K3TA 1IC5L 1JIBA 4KC3B 4QYOB 1KCSH 3L9RA 3H9SA 5IHZA 2EE9A 5HI4C 3P3YA 1JTPA 1SYSB 2J3SA 3SO3B 2H3NB 3SO3C 3TIDB 3LQZB 4XVJH 2FWOB 4S1SL 2R9HC 2ICWJ 3U0TA 4H0IA 1HEZB 1D5IH 5H35A 2JE8A 1U8NB 3WFEL 4WNQA 3V0VA 3DECA 4O02L 4POYA 1LO0L 1B4RA 4WJ5B 4P9HC 1MJ7L 1KCLA 4PB0H 1MCHA 1YEFL 3AMKA 5DRWB 2ARWA 2YMXH 2D7TH 4XT1C 5DD0H 5DO2C 1CXLA 1FIGL 1RK1B 1JWUA 4PG2C 1QSFE 3KXFD 4K3DH 1RHHA 1KPRA 3NPSB 5C70A 3NPSC 3SJVE 3QQNA 3KLHD 4CAGA 1TVBB 3HE7A 4I48B 3D25A 4TULL 5KZCD 1JNHB 2M2DA 3NFPA 5HYJD 3D39B 5A2JH 3HRZA 5TDOA 3LDBB 3MRFA 5DUBB 3LDBC 5DMGC 5TGBA 1KJVB 1RZGB 3B2UC 2GITA 4Y8AA 1VB9A 2GSGB 4Q2ZB 5FCUH 3U1SH 5A3IC 3CFEB 1G7JA 3V5HB 2IANE 5B38B 5EU3A 1VDGA 2HLAB 3LEXA 2YWZA 5JXAH 5I0DA 5E00B 1MJUH 5MHSE 4KROD 1QBAA 2A74A 4UT7H 4BK4A 4R96A 3GNMH 1RJZB 1ZANL 3MZTA 1U95A 2YR3A 3DI3B 1U8JB 2IBGA 1YN6B 1Q0XL 5CEZD 1ZHNB 5ESVB 1NL0H 1TETH 3HRPA 3S34H 1J11A 3P9MB 2GSIB 4P5MA 4LLUB 4YHLL 1FFPA 3HE6D 3L5WB 5E4EB 2GKIA 2W0LA 4KJWD 5E4EC 5FYJU 1RY7B 4PJ8B 4PJ8C 5FUZH 1MFAL 1S3KH 1DLFH 3MROA 4UOJA 1QLEH 4BK5A 1QLFB 3LKNA 1AD0B 4Z0BL 1A7QL 1Z0NA 5HGBB 2E9JA 1OAUH 4LCWA 1HHKB 2IG2H 4RRPA 3MLZH 4CVUA 1OTUD 4Q58C 5BZWA 1FC1A 5JHLL 3IKKA 4XP4H 3BESR 3SKJH 3A6CH 5IT2H 2NY7L 5BRZE 3FQWA 1A6TA 1FDLL 3SGEH 5EU5B 3N85H 3H9YA 5J9PB 2KUTA 1SEBB 4MA7L 4OSUH 2GY5A 3ARDD 2AGJH 4M4RA 2HRPL 4HZLB 5C6WH 1WK0A 3NAAL 4JN2B 3OXSB 3VXRE 3M1BA 4X7CC 3GSRB 4YHMH 3PIQB 1T20B 5T1LB 3CLEL 3AREA 3BD3A 4TVSa 1CK0H 3SGJA 2W07A 2ZP0T 2UY6A 5BCAA 4GRMA 5MP6H 4O9HH 3CFJB 2MHAA 5DVNA 3KPQA 2IADB 3QUYB 4HS3A 3QUYC 4MCZB 4GAYA 1EMTH 4JZOA 3MJ6A 4RWHA 3OJMB 5ITFB 5K9QG 2DI7A 3KR3L 4QRTA 4X6FB 1UB5A 4A6YH 3RTQC 5ITBH 1X44A 1CL7H 2ED7A 5IQ9B 3S35X 4RBPH 5D71L 3RAJL 1R6VA 4OJFH 5I1LB 1IKFH 2CDFB 2XOTA 4WDIB 3MMEA 1H9VA 4OD3L 2X4OB 3IXAB 2OJZL 4HIXH 4R90H 2VDML 3MLYL 1UH4A 2GJ6D 3D0LB 1KGCD 1RIHH 3MLTA 2DBLL 1TJHH 4G6MH 5EUOE 3DTXB 1F2XK 1CE1L 2RIKA 1W0WB 4PGBB 5B39A 2DWDB 1G7PB 1IT9L 1ZGLB 3MV8B 1IM3A 2H8PB 1A7PH 1AQKL 1EHAA 3WSQH 1F6AA 3EYUL 4YDIL 5JTWA 1LD9B 1P7KB 3D3VB 2WUBL 1VGEH 3QJFB 5E2TH 4JFHE 1JPFB 3T0EA 2ZSWA 2OR7A 1K9TA 1QFWL 3EFDL 5GGTH 1ED3B 1N64H 1R3IH 4KI5D 2VZVA 5CP3A 3ZE0F 3IU4H 3BKCL 3WXWH 4GMTL 4MNHB 3MRGA 1J0KA 4MXQC 2NYYC 4MB4A 4HIHB 3MLPA 2HTLD 2LTQB 4JKPH 2LTQC 3GB7B 5GSVA 5E7FA 1J1XH 2P43B 1YUHB 1Z3GH 1IGYB 2DJUA 5FYKH 4DOHB 4CN6A 3S3JA 4P48A 4OUUB 5I1AA 1BGXH 4MQ7B 4IEFB 2MCG1 4LLWB 2I24N 1RZJL 4XX1E 4BKLB 2ZPKL 1QR4A 1FVDB 3RWHA 4OFVA 3SQOH 3RZCD 5IEKB 3TPKA 5IW1A 1MHCB 4QRQA 4JY5L 3F65A 4KV5E 2ENYA 2OLDA 1BWWA 2Q7YB 3C08L 3MREA 1AO7B 2WIIA 1RZKL 4U1HA 1Q9LA 1RJLB 2YWYA 2H26B 3QH3B 4DK6A 5JZ7C 1I8MB 5EZOH 1CLYH 3TBVB 5IWLA 4EXKA 3FO2B 1MLCB 2DBJA 4PR5B 1JGDA 1I7TA 3DROB 5D6CB 1T04A 5AYUH 1KCVL 4OGYH 4AIZB 43CAA 4L4TE 3GMPB 3FO1B 1BOGB 4OIAA 3QUZD 4M93B 2W38A 4UDTB 1D6VH 4M93C 3HPLA 4ISVA 4KKLD 1ZLUH 3ARXA 2R23A 1EO5A 5FYLE 1JPTH 4EBQL 3MRCA 4X80H 5D93C 1EX0A 5ALBL 5D7JB 5D7JC 5E6IA 1I7UA 1BIIB 3DI2B 3IJYB 5JXEA 4JFDD 1OAKH 4U6XB 1FFQA 3BZFB 4OT1L 3P77B 2VXUH 1FL5B 3MV7D 3BD4A 4P23A 3T4YB 4ODHH 1P7QD 4EI6B 2DL9A 4RGNB 1NSNH 1Z9LA 5HPMB 5I30H 1FE8H 4E41D 1U9KA 2CLZB 1BZ9B 2V2TB 3UROR 3UJJL 3QFDB 4QXTA 4GW1B 4RIRA 3PNWB 4ZAKD 1BQHG 1ACYL 3TEUA 1KIPA 1ZHBA 4F7PB 4BFIB 5BXFB 1EFXA 5J06A 5KAQG 3JUZA 3EYSH 1QSEE 3JTSB 1H3TA 3VH8B 2VZUA 4N8PA 5JDJA 4XBPB 1NGWA 5MEOB 2IQ9H 3DETD 4M5YL 5C0EB 4WO4C 1WFUA 2F53D 1NBVL 4U0RB 3H9SE 4XP6H 2DQTL 4U0RC 5HI3D 5IB2B 3DGGB 4KK5D 4L29B 2BCKA 4F7MB 3PGCB 4QEGA 4OF0A 2A6JA 1I9JH 4P5TD 3W0WB 1MI5A 3QWOA 1YYML 3O81A 3NA4A 4LOUC 2GAZA 4R4BA 5C0BA 3W82A 3S37H 5JORB 2FB4L 5J4MA 3HUJA 1YYLL 2C9AA 3AXLA 3Q6GL 3M17A 4U6HB 5EDXA 5A2FA 4M8QA 1NAMA 5DF0A 2VDQH 4NQCA 3FAXA 1PKQB 1S9XB 3QIBB 2P1YA 3QIBC 3X3GH 4HJ0D 4P4KD 2JJTC 2Z35A 5E2VL 4GAFB 2ICEA 2GTWA 2VDRL 4YDVA 1Y6NR 4ODSL 5JDSA 5I76B 4DZBB 1IGML 4AEHH 2P4AB 3CU1A 3DVGB 3U4EB 4NCC1 3TJEL 2XV6B 1G9NH 4K3JL 5I73B 2FR4B 5I73C 1OAQH 4LQFH 5GGVL 5I9QB 5I9QC 1NEUA 2NY1D 5J56B 3GSUB 3FN0L 3OTTA 4IOFD 3TN0D 2DICA 5IBTL 2YPLB 4KPHL 3SE8L 5HYFA 1LE5B 1GGIL 3C5ZA 3MRNB 1YEEL 1CVSC 3CX5J 1CICB 1HDMB 1CICC 4MS8D 4ELMF 3OG4B 3MOBH 5K9QI 3UYPA 3P4NB 2Z4QA 1TMCB 5CEXB 3FO9A 3A0OA 3VGDA 5DURD 4D9QE 3VMNA 4OI7A 5FKPB 4Q6IA 5H2BB 1JHKL 2FBJH 4L4VE 3VFOA 4N8VG 4U2ZA 3UJTL 2VUOA 2ZUSA 3MGOA 4OB5L 4XI5D 5D72L 1N5AB 3D2UD 3QXDB 1E4XI 2XXMB 5F6HJ 5FYJD 4OAWA 4YIQA 5IGXH 4NZDA 5DJXA 1KBGL 3LS5H 4LCWE 1OAZL 2R1XB 4WHTA 3FT3A 3V8OA 4Z77A 4A6YB 4FRWA 4HFWB 2DLGA 4OF5A 4EKXA 3U7YL 1IAOB 4DKFH 2OK0L 1H8OA 3JWDL 3LY6A 3INUL 1IAII 4G3YL 3UTQA 2DI8A 4OV5A 4LU5L 1NC2D 1WT5A 3NVQA 4M00A 2GJZA 5CBEA 2VDLH 1XH3A 1JZ4A 4FFZL 3FFDB 4JHWL 4ZFOL 1UVQA 1JWSA 1QYGL 3MV9E 3RPKA 2AJ3A 1S8DA 3BZDA 3OR7B 4OZ4B 4HWEL 2R4SL 1TJGH 3RRQA 4K7PY 1AP2B 2A9NL 2HT2D 3VFNA 1FAIL 3HI5L 5I1DB 2PXYB 4Z7QE 2PXYC 3B9EA 3HI1B 5T3XE 5BOPA 2DYPA 2YD8A 5CD3B 3AAZA 1N5YL 2X44D 3BN3B 3MO1B 2F8VA 1JPST 1QUNA 3IJHB 4LNRA 1J5OL 4WFGE 1ZLSH 2BERA 3SDAA 1S9KC 4JREC 1NGZB 2Y36L 4PRHE 5ADPH 2NQCA 4TSBL 4CVWA 1D6EA 4R3SB 1INEL 1F58H 4MWFA 2VL5B 4YHIB 1MVFA 5EO1B 2JJVA 4PV8B 3LHPH 4YBQC 5B4MC 4K23H 3SDDD 3E8UH 4M43L 3HI6H 4BQ6A 3GBNH 4OLYL 5KJRL 3PQYE 4GG8A 4ZD3H 1MRCH 2NX5A 3QHZL 4JY4B 1RPQA 1FVCA 3LKQB 5H94A 3K7UA 1ADQL 4G8GB 1L0QA 4LL9A 1V7MH 1XF3B 2W91A 3KXFB 3WFZA 1QA9A 3TPUA 4FA8A 4HKJB 1J0JA 4HG4K 1S7UA 3NFNA 3O45B 3PHOA 5IV2B 4NWTH 4YFEA 4GW5B 3TT1H 4KVCH 4O58L 2G60L 3UBXB 1G6RB 5KZCB 2BFVH 3V4PL 3I6GB 5KG9B 5HYJB 1B4JH 1K4CB 4PD4J 5IKCB 3V4UL 3QG7H 3KNBB 4F7CB 2VZOA 3MBXH 1W0YT 4OTXL 1XGYH 3LKRA 4ZOEA 1BBJA 3G6JB 2I9LB 4PJ7B 3WFBL 1X5JA 4DKEH 4M7LT 1G9MH 4WENB 3VWJA 5T5FL 5C07B 4BJLA 1M6OB 2ZNWA 4KROB 3D18B 4KROC 3C8KA 1OAXH 1P84J 2GTZA 1NAMH 2V7HA 4P2RB 5DA4A 5KSUA 5BQ7B 2ATPA 1J1OL 1FG2A 4H5SA 2P42B 1EO8L 1N3NA 3KPRA 1U3ZA 1CLZL 5I1EL 1T2JA 4GXVL 5GGQH 1WZ1L 4Y88A 5HDBF 3R0MA 3AVEA 1KENH 1URLA 1B0RA 3RWDB 3DVNB 3HE6B 4KHXH 4ZNEE 4OCMC 2IBBA 4N0UE 1ZEAL 3OF6A 4ELMA 4LPTA 5IR1B 4RSVA 4JHBA 2C26A 1RUQL 2HN7B 5SWZE 5ACZA 1I7RA 2P8MA 4YEFA 4C59B 2QQNH 4GBXD 4HZAA 4GW4B 1DBBH 3DXAD 4FQJL 1ZHKA 1XCTA 3HNTL 1T1WB 5B8CA 5CGYD 3R06A 3MRKB 3OJVC 3F7QA 3T4AA 3F7YA 3H6JA 2R2BA 3EBAA 3HMWL 1MFDH 1W8NA 3ZDZF 1JNNL 3GO1L 3O3AB 2Z0BA 5DEGB 4O2FA 2VXSH 3O41B 1GXEA 3IJSA 1QKZL 4MB3A 4BQCA 3FONA 3PXJA 4JDTH 1OAYL 5C08D 4O4YL 2XFXB 2VQTA 2GIYA 3HCVA 4Z95H 3I9GL 4LPVA 2VDOL 3FTGB 2VNCA 2X4SA 3EIFA 3O6ML 3CK0L 2AJVH 1NCWH 4JPIB 5HYSA 3IFOB 4LSRL 3ULUD 3NGBB 4OKVB 3VE0A 3NGBC 1YDPA 4GKSA 1J1PL 2Q86B 2R2CA 1FNHA 1KIQA 3K2MC 1ZK9A 3QXAB 3VXMD 1Q9OA 1MNUH 4L8CA 1BWMA 3DX9A 5HVHB 5EULV 5HVHC 3A67L 1AKJB 1KULA 4OGAD 4HHAB 1CR9H 1G9NC 2GJ6B 3IKCA 1NBYB 1TZGH 2EDQA 4YWGH 3MQIA 3NH7H 2YUWA 3AGVA 4F7EB 5DJDB 3EJZD 3QUXA 4RMTA 3RWGA 5D5MB 4KY1H 5C0BE 5TF1H 4MDJA 4PRNA 4QRPB 4WI5A 3Q5OA 4LIQL 3BP4B 1C16B 1RK0B 5EBLB 1NCUA 5C0FA 5DDHA 3T65A 3GGWA 1TZIA 3L3IA 3PXHA 4ODXA 3QIWD 3ES6B 3HNVH 4XP5H 2OQJB 2JB5H 1C08A 1AXTL 2ADFH 2OXHA 2FEEI 1QSFD 1UWEH 1KLGA 2W0KA 3RWJA 3JUYA 3SJVD 4FFYL 5I1KL 3SDYL 4NUGL 3PWNB 2HTLC 3KLDA 4WI3A 4WW2F 1GZPA 4YFLF 1J8HE 1CXEA 4XMLH 3TZVB 5EZIH 3TZVC 3MX0A 1KEGL 4M6AA 1OLZA 4KMQA 2VERN 3U79A 1F4XL 3ZE0E 3EUUA 1HILA 5DD3L 5SX4I 2IAND 2YK1H 2IPTH 4OZFH 1UH3A 5MHSD 2APXA 1YPZB 3CC5B 5BV7H 4LCCB 5EZLA 4LCCC 1D9KD 1CFVL 4MQSB 3SBWA 1U8OA 5FK9B 4RFOH 2DM7A 3X13A 1QRNA 1L0YA 3TP4A 4CU8A 3QULA 5CMAA 3T08A 1HSAA 2FNBA 4UOW0 3PJSA 4TNWK 3ECBB 1VPOH 5I8KH 1AGEA 2F54A 2EDKA 1ZLVH 4H8WH 3K8LA 2DM2A 4P9ML 4U49A 2MSPA 5DFWH 4WEBH 4ZQKB 1EDQA 3GRWL 4OQTL 3U9PH 1X5GA 1QP1A 4HXAH 3F12A 1I3GH 1MFCH 1WBYB 4KKLC 1H3XA 4KKAD 2Y4SA 5HY9A 4PJXB 4GAJH 4H1LG 3VFMB 3VFSB 4L8BA 1ADQA 3LH2H 4Z7NF 3GBMH 3FMGL 4NRXA 3PV6B 5KSAB 5KSAC 5BRZD 5LGHH 3WIIH 3ZSSA 1AXSA 3C60C 2CK0L 1DBJL 3CFIC 4JKMA 2HWZL 1UJ3B 1C5BL 2DDQH 1DBAL 5LAXB 4DKDC 1P7QB 3QNYB 5DXWA 4Y89A 3IFPB 3DGCR 5E94A 3MACL 5D7IE 4GAGL 5DYOB 4NQSB 2WMPA 4TUKH 4XPBH 3VXTB 2QSTA 4M1DL 1OPGL 2Y72A 3RPIB 3V6OA 3T1WA 3ZTNH 2BHYA 6CGTA 3LQAL 3UX9B 2PYFB 4ZAKB 5F7NC 3CXDL 1DQDL 1QO3A 4LKCB 3I85A 3THML 5MENA 4Y1AE 5IHLB 2HKHL 1NKRA 2Z31D 1Z6JT 1CLCA 2PO6A 5C0CA 1IC7L 5GGSA 1U92B 3CH1B 3U4BL 1A14L 3KYMB 1S7QA 4KK5C 2HT4D 4ZS7L 1JGEA 2DRUA 4XNXH 2R1YB 1IQDA 2XWBA 2EDTA 4M1GH 1AHWB 2UWEA 1G9MC 1AHWC 1S9YB 3O2VH 2B1AH 4HIJB 4MXWH 1S5HA 5JW4M 3NTCH 3EOAB 4K3HA 4DZ8B 2WBJC 3KLSA 4ZO7A 4UIMB 3AS2A 1ZVSB 4JY6B 5IROA 2CD0A 1ZA6A 2R1WB 1UWGL 3BGAA 2O5YL 2QSCL 1MELA 3PWLB 2LU4A 1ZSDA 2XKNB 5EO0A 3ULUH 4BQ9A 5D7SH 4ZFGL 2B1HH 3TBYA 4ZSOB 5DJZB 4MJ4A 2C4XA 4JFHD 1FYTA 1T0MA 3B43A 3ZYZA 1A6AB 2GK2A 3MLRL 4Y4FD 4KVNL 2EH8L 3TH4T 1MVUA 2VDKL 3GSOA 5BS0E 1J8KA 1GAFH 3FCTB 2DQFA 1VACA 3LCYA 5JW3H 4G5ZL 4UUJB 4KKCD 3TN0B 3BSZL 4XPAL 3TN0C 5F1IA 4J3VA 4G42A 5HVFB 1NDGB 1G1YA 3QP3A 1ONQA 3S36L 4PJGF 4FQ2L 1MWAL 2CDGB 2PUQT 4X4XA 3RHWF 4PBWD 2KL6A 7FABH 1FGNL 4WW2A 2APBA 4LBEA 2BNRB 1BFVL 1NC4B 2YUZA 4XP9H 1HHHA 3CPLA 1UXWB 3H9HB 3I50L 2APWA 3WXVL 5C2BH 4PY7B 2BJML 4HGWA 5DHVA 4ELME 4Z7VE 4GG6B 3JTTB 1I8LC 3S6CA 1J0ZA 3DBXB 1C5DB 4Y19A 4KUZL 4FQHA 4GO6B 1I9RL 3SDCD 1W72L 5L2KE 3QDJB 5CEYB 1FFOB 1BLNB 5KVEL 4U6YB 4YJZL 3SKOA 3QRGL 3V4VH 3ALPA 3JV6A 4E42A 3RA7H 3TM6A 4HJJL 3VD7A 3GMMB 1QBBA 1NBZA 1UQSA 3DSFL 4LSTH 3BO8B 2XI9A 5IVZA 2FLRT 3PHQB 4NGHH 1UXSB 3MCG1 4L4TD 3KPPA 1RZ7L 1F11A 3TYGH 2CPCA 3X11B 4ZTOL 2B20A 3BJLA 4MNQB 4JM4H 5FYLD 1NC2B 1PGRB 2DQGL 1TFHA 3NCJL 2EDXA 5TE6L 3MLSH 1IM9D 1NCAH 3S88L 3WS6A 3DOSA 4YZFF 5I16A 2VR5A 3MRMA 4D3CH 1MCJA 3FB8A 1S7XB 4GQ9H 2FIKA 4P99A 5IVOA 1Y6KR 4NQUA 1CZ8L 3VFGL 2ICWI 4O5LL 4I3RH 2XZQL 3NABH 1OF2B 4HV8A 1J0IA 3SGDI 1C7TA 3BHBA 2X4RA 1EA9C 4NNXB 4LLYB 3WFDL 4NP4H 4NM4H 2C7UB 3OKMB 3RHWK 3VFPA 4R8WH 1UZ8B 4Z8FL 4W70A 1Z9MA 5FKAA 4P0DA 4X9IA 1FC2D 5ETUA 5HHNB 4JKWA 3K1KC 2YS4A 4FQLL 1E4XL 2A6DB 3VFWB 2XQBH 1CFQA 4NRZA 3HC0A 1QSED 2R0ZL 4IRZL 2EDOA 4FXGA 1TPXB 3ROOB 2R2EB 1TPXC 2BNQA 3TFKD 5MERB 5HHVH 4ERSL 3H9SD 3G08B 3VXPA 2AXFA 1JP5A 3U7AA 4GJTB 5D70H 4J4PA 1M7XA 4Z7UE 3IDGA 4YXKH 5IK3B 1SQ2N 3TNNB 4ELKB 2AQ1A 4MSWA 3GRWA 4OQTA 4OZFB 1JJUA 3FHQA 5DEFA 5I8CA 1HKFA 4JO4L 4ZODA 2X1XR 5BV7C 4MGXA 3VCLA 2VXTH 1XMWA 5L6YL 4EXPX 2JB6B 4PYHA 5IBLD 4ZFZB 4LVOB 5D1XD 2E3VA 4LVOC 4RMSA 1BMGA 1ODAA 5SWQB 1N4XH 1A7BA 2E9WA 4LSVH 4LDEB 3ETBF 5DK3A 5T1KA 3DMMA 3HE7D 4H8WC 4JKKA 3Q1SH 1PZ5B 4NPYA 4M48H 5ICXB 3E3QC 4HEME 5GS0L 4PG9A 2XPGA 1OQOA 5KVFL 2G5RA 3GJFB 3L3HB 1BQUA 3C09B 2D9CA 3C09C 2BY0A 4F2MB 4HS8L 4TSAL 3EKCA 4JQIL 2XQYK 3IYLW 3W5MA 4L3EB 1M7IB 4EDWL 1LEIB 1VKXA 1BPVA 3RWIA 1L9NA 1VFOA 4ETQA 3QO1B 1IEHA 5JPNB 4F15B 4EVNB 2OXGA 4F15C 3KYNA 4G8FB 4X6CF 2OTUB 1UADC 1B2WH 2AJZA 1I7ZA 1QRNE 4PJGA 2V6HA 4IHOA 3BEWA 4D9QD 2WV3A 4L4VD 2EDNA 2F54E 3D9AH 4DUXA 1XF5B 2BNUB 4JO3H 1P4LA 2FYYA 3BH8B 5HDBE 4Y5YA 4GBXB 3DIFB 5LJYH 4GBXC 2R69H 4DTGH 4D0CB 4M5ZL 4LCWD 5GJTL 1BF2A 2RBLA 4JRYB 5IM7B 2H2PD 1TVHA 4DGIH 1CGVA 4D0DB 4XWGL 5DJ8B 4U7MA 5MEQB 1G7LB 4PJIF 4U6VL 2W0PA 1IGJA 4EDXB 3CCHB 1DDHA 3LEVL 2HT3D 3TA3A 5DQJB 3RY6C 5A2KH 1AD9A 2R2HB 3QQ4B 1P4IH 4X7FC 4PJ9A 4X4YA 5DGRA 5J12B 32C2B 3V6OE 4UB0H 3HMXL 3MV9D 5J12C 1I3RA 2L7UA 3ZDZE 4OZIB 2ZSVB 3ARED 1JYWA 3ZDYF 1TQCB 5MENE 1OWWA 4P46B 1TQCC 4P46C 4LF3B 3ULUC 1E4KA 1MRDL 3BIKB 1UEYA 1U8KB 3CMOH 4I18B 1MWAA 4I18C 3S35H 3VXMB 5F72S 5C0CE 1CQYA 4XHQA 5JO5A 1HYRC 4XBEL 1QRKA 3B6SB 4CMMA 1PAMA 3JV4A 3QUKB 3UYOD 4OGAC 2DWEB 1WCQA 3ZTJG 4EUPH 3MCLL 4WFGD 3AY4A 4QOKA 1A9EB 1PEWA 1NDMA 3O0RH 1U8MB 4XNYL 1JPSH 3EJZC 1T7ZA 4WVRA 1F4WL 1WCBA 3OJDA 3UPRA 1ND0B 3LB6D 4K2UH 1UM6L 4G8EA 3SKNA 3WE6A 4QGYA 3ULVL 2C3VB 4JEGB 4F9PA 1KJMB 1D5MB 3MNZB 3PABB 1KG0B 1HOCB 2OSLA 2XKSA 4QCIB 1SMOA 1I1AD 3CDGA 4HPOH 3PQYD 4LSQH 3TF7C 1CT8B 4G43B 4UILL 3RVUD 4ZFFB 4JFFB 1A6VL 3SDXF 2EDDA 1FV1B 3D1MC 1QSFB 4Y4HA 4YHOL 1OGTB 3P0VH 1FYTE 3T0ED 5GISH 1X5FA 1OP9A 1ZAGA 4PRAA 5D2LB 5ACMA 3FQTA 4YBHA 5CSGA 4NZUL 1LNUA 2A2QT 3D0VA 1GC1H 1SMAA 4PBVC 4HLZH 4AH2B 4I2XA 1JHLH 2ID5A 5ANMB 2YOCA 3V5DB 1QVOB 3N06B 2IPKB 3QFJA 4JG0H 3QA3B 2DQUH 4QTIH 4LRNH 4LSUH 4NJ9H 2BVPB 3VFRA 2IANB 4BH8A 3EYFB 3ZT5A 1PYWA 1EJOH 1WIOA 2HKFL 1LEGA 4J3XA 1MCWM 4JFZL 3IDNB 2E7LA 2PN5A 1L6XA 4YGAB 3L7EA 1N8ZA 1WC7B 4M7LH 1D9KB 1D9KC 1QR1A 3UDWC 1IBGL 2CKBL 2MQCA 4GRWH 1I9IL 2A6KB 3M8OL 1EHLH 4P3DA 1GHFL 3OAYK 1YJDL 4PJDF 1AJ7L 3MRJB 2OYPA 5BO1L 1CQKA 5EBGA 1HQRB 2IPUG 2JCCF 4DGYL 3QEGL 2C4FT 1DVFB 4ALAH 1DVFC 4HUWA 3OGCB 3MGAA 3P4LA 3PDOB 4Y19E 1CLOH 1FFRA 4UQ2A 2XNAB 4NKIH 3HS0B 5F88A 4NC0B 3U36A 2R4RL 2ZKHH 4X6CA 1MEXL 2EZ0D 5J11B 3WL9B 2ED8A 5J11C 3JSSA 2ARJQ 3B83A 1YECL 3DPBA 3SE3C 5SWZD 3RKDD 3TIEA 1YMHB 5CBAB 4PJAE 1AFVL 4LIQE 1FNFA 3BN9C 4DFIA 5CKAA 5GRWA 2AK1H 2VIRA 2VISA 4YHKH 4QT5B 2V17L 1CGSH 1ZT4B 3MNVA 3UTZA 4TSCH 4OCYL 1FPTL 1NQBA 1KB9K 1P2CB 5H37H 3S96A 2AJSH 1CGXA 5D2NC 5FHBL 2QADB 1OQXA 3QCUL 2QADC 1MCBA 4AM0A 4FFVD 4Y2DD 1WBZA 4PJIA 2MPAH 3SKMB 1JV5A 3KDMB 3VXRB 5IJVA 3WHE1 3X14B 3NZ8A 4JCMA 5E5MB 3E2HB 3VMPA 1CGYA 5K9JH 3E2HC 1RAMA 4R0LA 1CDCA 3VH8G 5DMKA 2XZCH 2Z31B 5GRJH 2Z31C 5ACLA 1OTSD 3RWEB 4R4FL 3WDHA 3BPCB 1PQZA 5C0GB 3W81A 1EFXD 3OX8B 5IVXB 3P4MB 4PJBF 5FUCE 2HT4C 3KPOA 1LP9F 3BP5A 4M4PA 1F4YH 2BNQE 1Y0LB 4PTUB 5GIRA 1YEGL 5JLZB 3H0TA 4MAUL 5DLML 1NLDH 3T0AA 5JQHC 2P47B 1T21B 4C55A 2P8PB 1N2RB 4EI5A 2J8UE 1MI5D 1U6AH 4FQIH 5DK0B 1R3LA 5EUOB 5DT1L 2AQ2A 3PL6D 1QLRA 4Y16B 4IDJL 4Y16C 4XCCL 4KJYB 5C0BD 1P4BH 1YNTA 2JF1A 5INDA 1T03L 4NT6A 3DUUA 4ZYKB 1UA6H 4NHCH 3DYOA 4AIXA 3TBSA 4F57L 1UB6A 1VFBA 4HKXA 5ICZA 5F89B 4NQCD 5IQ7L 1LDPH 4U3XA 5T3XH 2AK4E 3C6SB 1GGUA 4FQXB 5HYQA 1KB5H 4FQXC 1W8OA 2QSVA 4TNVF 1QEWA 3PWPE 4Y4FB 4YHNA 2Q6WB 1OT2A 2Y6SD 2AKRB 4J3SA 3TWCH 1K8DA 5LQBH 4B5EA 1HNGA 3SE9H 3TYFB 3LZFL 4YXHH 1RSFA 3VI4E 3T77B 5F6HI 4JHZA 3X17A 4E5XB 1BQHA 3NZHH 3SDXA 5IMOB 4H0GA 3MXVH 3ZE1F 2YEZA 4LLAA 4HK3J 1DR9A 5IMMA 1J8HD 2NY5C 3HMXA 5EOCJ 1U8LB 3RVTD 4LEOA 2AERT 3C5ZD 4UT9L 2NZ9C 3C6LD 3LSOB 3GUTB 4JG1L 5E8OB 4Q9QH 3LV3A 3TC9A 5FECB 4Z7WF 2N56A 4YEEA 1JUFA 3WLWD 3ARGB 4WI8A 3ARGC 2HJKB 3OKLA 4K7PL 5FO9B 3RI5F 1JHTB 1FN4A 1INDL 3ZKMC 4NO2B 4LLMA 2O5XH 1NCCH 3LD8C 2FH6A 3GMRB 5FM8A 3ZMRA 4XGZB 5E08L 2ENSA 3VD5A 2I5YH 4V1DA 2ED9A 4XMKH 3EDDA 4CADB 3SDCB 3SDCC 3VFUA 3QCVL 5D1QA 5FO7A 5GQBA 1QBLL 4IOSD 1MFBL 4PJDA 2VLJA 3QCTL 1DUZB 3KYOA 3S4SB 4HAFA 5ADOH 1E6JH 2X4PA 3F58L 4MA8L 3VRLF 2JCCA 4FQCH 4LMQE 5J13B 3DWTA 3IS0X 4L4TB 3WD5H 5J13C 4ZUSA 4M6NL 4IMLB 1A6WL 4URTB 1XGPB 4IRJB 4TNVK 2CIIB 2VITB 4IRJC 3QHFL 2BMKB 2DQJH 4EUPB 3EDJA 4L4JA 3T2NH 2BC4B 1CYGA 3K1DA 4QWWD 4ZUVA 1G7HA 4JFEA 4QRRA 1FO0L 1VGKA 3FOLA 3HZVA 3ARUA 1XFPA 1FNGA 1IC5H 4P2QE 4RZCB 2NY4B 5GS2D 2DF3A 2NY4C 4WEMB 1T0PB 4ZO6A 4Q9RH 3GI9H 3P4OB 4CVZA 1SHMA 3PP3H 4YZFE 3IDJA 1BF8A 1P1ZB 1K6QH 4MXVF 4NZRL 2FX8H 5ISZA 1F3DH 2DYPD 1HWHB 3WFEH 4TTDC 3KAAA 4N8VA 1IC4L 3RI5K 1LO0H 5D1ZB 2YN5A 5D1ZC 4KK9C 1WEJL 3DUSA 4YPJA 1TLKA 4CGTA 3QXWA 4NKOB 4HIIB 4H25B 4N90E 1JTOA 3L9RB 1FIGH 1GC1C 3VRIA 2M1KA 1FVEB 4GKNB 4QOKE 3BVNB 1U93A 3SDAD 1QFUL 4M6MH 2MQ3A 5DJAA 5E9DA 3U9UB 5FHAH 4CKVX 2DIJA 3M07A 5ESAA 1OW0C 1A4KB 3U46B 2HVJA 3U0TB 4PJBA 4IBLT 3FQRA 4WHDA 1CD1A 1LP9A 2OR8A 1X5HA 4HSQA 3EDEA 2CKNA 4M7JH 1IJ9A 5DUML 3X3FL 2DQIH 1TVDA 1U8QA 1Q0YL 3UBXG 3QZWA 2J6EH 3S3SA 3UJIH 4GRWB 4N5EC 2RFXB 3SO5A 1JWUB 5D1XB 5D1XC 4OV6F 4X0KA 1NMAL 1IGCL 4X4ZA 1OL0A 4HD9A 3RNKB 2OBGA 5JR1H 3BFOA 2OZ4A 1ZT1B 3NN8A 5EWIL 2HVKA 4XNQB 3QUMA 5EBMA 3HE7B 3RIFF 1AIFA 2P5EA 4K55A 4OM1L 1EXUB 1T83A 3MGTB 4I2XE 3WUWB 3H3PL 1WITA 1H5BA 3CDYA 5TDOB 4KDTA 4KZDL 5BS0D 3KPSA 3QEUB 2AJYH 1KN2L 1BJ8A 2J88H 5I1CL 3O8XA 4R6UA 3U0PA 1BX2B 2VLLA 4JM2C 2VQ1A 3LRGA 1I8IB 5FXCH 5FF6A 4GFTB 1MFAH 4GT7A 4ORGA 3TH3T 4K9EH 3VWJD 1EEUA 3QRFM 2BRRH 1LO4H 2P8LB 4Q9CA 1T89C 3KYAA 2P45B 3MR9B 3CZJA 1SJEA 3IXTA 2GFBA 4JZNB 3EZ8A 1RZ8A 5HYIA 3KPRD 4NDMA 1CBVL 5TH2B 5JHLH 3GSNA 3TCXA 1GGBH 2VH5H 3D85B 4N0YH 4L4VB 4F3FB 2YUXA 4X7DC 3T0DA 4TQEL 2YKLL 4U1KB 2Y1VA 4MJIE 5TE7H 2X40A 1EAJA 2NY3B 2P5WE 3ULSA 4NRYA 2NY3C 3IRZA 3EOYG 1NEZB 4MB5A 3OF6D 2HJFB 1J7VR 2WQ8A 4Z7WA 4LFHG 4MA7H 4HKBA 3SPVB 1PDKA 3LS4L 5E8DL 3OKNA 4X6CE 2B4CL 3HPJA 1NGPH 5C0RL 3EHBC 4XCYA 1A9BA 3V2AR 4DQOL 1N0XH 1JFQL 3G6DL 2FSEA 4X6EA 1C7SA 3CLEH 3OKDA 3QIUA 2BVQA 4OLWH 4OCXL 1A6TB 1B6DA 5J1AA 1TCRB 1MIML 1CFNB 1WZKA 1C5CH 1HCFX 5BJTB 4GS7B 4GS7C 4PP1C 3B8YA 1N59B 2HFTA 1YMME 3BAEH 4PP2B 3WO4B 2Y5TA 4X4MA 1PG7X 3WO4C 3H3KA 3GI8L 5ILTL 1IFHL 3O6FB 3EO1A 5C6TL 2FHFA 3O6FC 1Z9SA 4PJIE 1VESA 3MV9B 3WHXA 4LEXH 4AQ1B 2VABA 4UV7L 1CFSB 4NHUA 3SGEI 3O3DA 1JN6B 3U7WL 4DW2L 4KFZC 4S2SA 2V2XA 4BELD 4I0KA 2DBLH 2A0LD 4MCYA 1T3FA 1BM3L 1KPUA 3RWFA 4I0PB 1FGVH 2A9ML 4I0PC 4ZUWB 1KB5B 4PRIB 4YC2B 4F7TA 4YC2C 2QSQA 4U1LA 1AQKH 1FNSH 5EC1B 4OCNC 2CJUH 5E8EB 1HH6A 2VDPH 3LKPA 3R1GL 4EJ1C 3IF1B 3ZDYE 5KVGH 1FFNB 4RAUB 4L9LC 5B39G 2WUBH 1JL8A 4U1IA 2R15A 1KCUL 1EEYA 4BZ1L 1S7WA 35C8H 1A4JA 4G6KH 5I1IH 1ZHLA 4PRHB 1OOAA 2EO9A 1R3HB 2R0LH 1NCTA 1QHPA 2A1WL 2H9GB 4P57A 5D6DA 4C56A 3ALWA 4PGEB 1GYAA 5CJQL 4ZPVA 2XA8L 3QUXD 3BKCH 3L3DA 4I3SL 3QDGB 4MA3B 3BXNA 1UACH 4APQA 3WJLC 4FZ8L 1I1AB 4LCYA 1I1AC 3PQYB 3IDIB 2VDNL 2UY7A 3RVUC 3VXSA 2ERJB 1SJXA 5A2LH 2ERJC 3MXWL 5IW3A 3I2CL 2FZ3A 4J3TA 5AD0A 3ARZA 4QHLA 2FHCA 4KDWA 5DJ6B 3QWRA 1DBKL 1WIUA 5KS9B 5CZVL 1FO0A 1ZLWH 4BSWB 4D0BB 2I07B 3MRGB 1EHNA 4JY5H 4KJQD 4WFFE 4WUUE 5FYJL 1NH6A 3C08H 1EO7A 4ZTPH 1RZKH 3RU8L 4XXDA 4HC1A 4C4KT 1XZ0A 4MD0B 1MLBA 4M02A 3G5YB 1AGBA 4XVTL 3UTSA 5I1AB 2YPVL 5IW1B 1EUTA 4QRQB 4DGVL 2QQKH 5KW9L 1AE6H 1SM3L 4J7RA 2WLZA 4V1DE 4LSSL 1FL6A 1QRND 4N0UB 4HIEA 4P2OB 1JK8B 5ALBH 3DRQA 4P2OC 3JVGC 3BPLB 4X6DB 3BPLC 2IMNA 2F54D 4ODWA 2HLFC 4WV1B 3ILPA 4WV1C 4N9GA 2VLJE 1QQDA 1T04B 3EYVB 3MLXL 5SWZB 1ROWA 3RBSA 1D5BA 3ULVE 1HHGB 1KLFA 4UINH 5DTFA 1FRGH 4HT1H 2JCCE 5SX5K 1A1MA 5EB9A 4JPWH 4ONHA 2ZWLT 4PBXA 1Q1JH 3Q3GA 2YD4A 2LV4A 5CHNB 1WWAX 3RIAF 1MUJB 3HPLB 2FJFB 4IRSA 1BVKB 1HHJA 5GS1A 3VW3H 3MLWH 1FZMB 3KJ6L 4X99B 3OKOB 4ODUB 1RHFA 4JDVB 1TJIL 2ICWA 4GQPH 2ATKB 4QRRE 4U1SA 3GSNH 4AG4L 4G6FD 4W4OA 1VFUA 1SEQH 3QEQB 3DX8B 4XHJC 4EIZC 4TYUA 4LLVA 4Y2DB 4P3CL 1OSZB 4Y2DC 2AP2A 4M5YH 2AJUL 1F42A 2W9DH 2V5SA 1R3JB 1BIHA 4GSDL 1E4WL 3NCYP 5I66B 3WV0A 2Q7NA 15C8H 4YDLC 5DMIH 4E0RA 3T1FA 1AI1L 1WJ3A 4HCRL 1V3LA 5MEND 2FB4H 4JO2L 1JBJA 3L3JA 1G7IA 3O4LE 4P9HL 4UV4L 5E03A 2PO6D 4OFYA 5C0CD 1JTTA 2BSTB 2DQHH 3GM8A 5TPWH 5GRYA 4OLZH 1AY1L 4PJHB 3BUYB 4J12A 1MRFH 5E9DE 2XWJA 3O2DH 2VDRH 2PCPA 4XWOC 2DIAA 3PL6B 4OZHB 2G9HA 3PL6C 4Z5RA 4ODSH 1U3HA 4ZXBA 4N8CL 2A77L 3UO1H 5C0BB 1IGMH 1LP9E 3IETB 5C0ND 5CZKA 4WUKH 1ZTXL 2QTEA 4K9EC 3WDIA 5HHQB 2BVEA 2EDRA 2XWTB 3MLUL 5GGVH 3BKML 4M8QB 4P5KA 2VKWA 1GOFA 3RVXD 2GI7A 1XGQA 3QDHA 5E2WL 4LCIH 3GIZL 1CG9B 1PJ9A 5FIEA 4F33B 1WIPA 3KPLA 3BRFA 4POZD 1NGQL 2Z35B 2ZUYA 3H8NA 2UV3A 3N9GH 2EDFA 1UJTA 5F44A 5JDSB 1FYTD 3STZA 4C57C 2IEPA 4HQQL 1VA9A 2IFFL 1Q72H 3HNSH 1A6ZB 1J12A 3MUGA 2YPKA 3DX6A 5TDPB 4Q0XH 3UJTH 5EH1A 2QKIB 1J8HB 3RNQB 5HBBA 3KWWA 1T1YB 5DJYB 3ARBD 4OB5H 3V7AG 5D72H 3RVTC 1ETZA 2R8SL 1OSPL 5D9SB 4ORZC 3C6LB 5F9JA 3C6LC 2HFFA 1HI6B 1JGUL 3HZKA 1KBGH 3BEVA 2WLYA 3NIFF 3LVEA 3WLWC 4HK3N 1M7DB 5IMLA 1A64A 1T4KB 1OAZH 3ZE1E 1I1YB 5AUMA 2IH3B 4Q6IB 5DJ0B 3LRHA 3ME0A 2DQCL 3U7YH 4D8PB 2X4TB 1A3QA 4WY7L 5JOPE 1N7ML 3VXQA 1DUYA 1CD8A 4XXCA 1I85C 4HS6B 5IW6A 2Z91B 3W39A 4RFNB 5ESQB 1JYVA 4L1DA 4RFNC 1XR9A 4OAWB 4YIQB 2HTKD 1KXVC 1ORQA 4Y19D 3EGSB 3N1PC 1FP5A 2ZOLA 1EAPA 4P4RB 1UZ6F 2IQAB 5EO9B 3CFKB 4WHTB 1LO5B 5CS7A 5I1JH 2Q1EA 4O00A 4Z77B 3A6BL 1FAKT 2EYSA 4HUKB 2VUYA 1R5IA 2DLTA 5CGMA 2A9NH 1F4AA 2XICA 4BFBD 1KEMH 2YXMA 1HSBA 5JOFA 4GH7B 4MMZC 4DJMA 4QWWC 4QRSB 3UTQB 3WS3A 3S9DB 1UT9A 3PWVA 3VRLE 3B8SA 1V3KA 4X4ME 5GGUA 4ACPA 5HGDA 1ACZA 2EEAA 1Q9KA 1L6ZA 3TCLB 3CFBB 4DVBA 2W60A 5D7IB 1CWVA 3BDXA 2AJ3B 3O2WL 4U1NA 4JRXA 3QB7C 4P3WA 4ONFL 3CUPB 4L8DB 1MAML 2Z92A 3RGVD 4NYLB 3PGFH 4Y4KA 3MA9H 1RI8A 1RIVH 1CN4A 2ZJSL 2DYPB 3AC0A 4KRMB 2YBRA 2QJDA 3AAZB 5CZXC 1NBQA 4Y1AB 2I9TA 4M43H 4QRUB 3TT3L 2A73A 4DN4L 5KJRH 2PTUA 1FSKB 1FSKC 2AABL 1KC5H 1JGLL 4RWYH 3QHZH 3C9NA 4X9FA 1C12A 5T1DL 2JJUA 3SDAB 3SDAC 3NIGF 2OJEB 4MXVE 1H8NA 1JI2A 5KANG 5C0JA 1T1XA 2BNQD 4NO0A 3VG9B 3VRJA 3VG9C 2NLJA 4C56E 4YQXL 1Q8MA 1CI5A 1RZKC 1HE7A 4RMVA 1S7VA 3OAUH 2FJGA 3V4UH 2OMBA 3ZHLA 5EPMB 4PGCA 4AMKL 2P48B 3UC0L 2G2RA 4EN3B 1KELL 4EN3C 4HPYL 5EFIA 1Z5LB 5ELIA 4Z78B 2D3VA 4WRLA 4MDIB 3GKWL 5AWNH 2ADGB 2VXQL 1YEHL 2WIMA 2YUVA 3VXSE 1BAFL 1HH9A 4JQXA 4X98B 5GGRB 3EFFA 3BPNB 3BPNC 4JKLA 5FA3A 4Z76B 2HRLA 2AK4D 1S7UB 1J1OH 5IFJA 4OLUH 3FT2A 5TDNA 3LMJH 5D7LB 4JANB 3TNMA 3PWPD 1CLZH 2K9UA 4QY8A 2R29L 2ITCB 4GXVH 5EA0H 2OL3L 3TV3H 5BS0B 1WZ1H 1M05B 4QHKJ 5I2IA 5T1KD 3DMMD 4LLQA 1RZFH 5C1MB 5EIVA 2X9XA 3CVHH 1T5XA 3L95A 4QXGL 2ADIB 2H3NA 3IVKB 1CF8L 3TIDA 3LQZA 3WIHH 2NZIA 4CW1B 1PY9A 2PYEB 2WWMD 2VZ3A 1BJMA 4OGXH 3QXTA 1E4JA 4TPRL 1UKTA 1HEZA 4HCRA 1U8NA 1HYSC 5K9KB 4BYHA 1FL3B 5DRWA 2H6PA 3LRSB 3FRUB 4ELMB 1KCSL 1RK1A 4Z7VB 4YHYB 4PG2A 4YHYC 1TCMA 1NPUA 3IGAB 3QPQC 1RJYB 3RUGE 3SE4C 2JJWA 2X1QA 2A6IB 3HAEH 3MBEC 3ZZ1A 5JHDB 5L9DH 1MHPH 4XVJL 1F4HA 5L2KB 2P8MB 1TVBA 4I48A 4CN4A 1JNHA 3JWNC 1A1NB 4PLJD 3D39A 3UPCA 1D5IL 3BH9A 1T1ZB 1S9WA 1OAYH 1KT2B 5DUBA 1ZHKB 1XCTB 1KJVA 4DVRH 5B8CB 1RZGA 1EBPA 2BDNH 2YMXL 2GSGA 4Q2ZA 1LMKA 3O6MH 5BVJB 2D7TL 5T3ZH 3CFEA 3V5HA 5B38A 2HLAA 4K3DL 5E8PB 2C3GA 4HUNB 1KPVA 3KJ4B 1RJZA 4UU9A 3KJ4C 4KK8D 1FORH 1U8JA 3TA3D 4F80A 3A67H 1YN6A 4CBPA 4LPWA 1ZHNA 5CILL 5EC2B 5ESVA 3QDMA 2YC1B 4WI6A 3P9MA 2VAAB 4D9RE 2GSIA 4LLUA 3B3IB 2X4SB 3L5WA 4PRPE 4MYWB 5FCUL 1F90H 4PJ8A 1R5WB 4N0RA 3LN9A 2X7LB 2FD6H 5JXAL 5T1MA 4UNVA 1P7HL 4IS6B 4UT7L 1AQDB 2Q8BH 5GPRA 1AD0A 3GNML 5INCA 2ADJB 4KRPC 5HGBA 1V7NH 2GCYB 3DX9B 4UOW1 1HHKA 2YN3A 1NMCB 1J0YA 1NMCC 1LDSA 4V2BA 1NL0L 2XZAH 1AXTH 1TETL 4MJ6B 3S34L 3IKCB 1T2QH 2IAMA 4EQ2A 4N90D 2K7PA 4QOKD 4O51B 3QUXB 1K2DB 5I15H 4KUCF 2OP4H 3TJHC 3PF2A 5J9PA 4Z7UB 5I1KH 1SEBA 5FUZL 1P9MC 1S3KL 4WHYG 1DLFL 4X7SL 4MDJB 2MWCA 1QLEL 3O6LL 4K7FB 4R7DB 4X83A 5GGSY 5JPMB 5HJ3B 1Y18B 1HK6A 2XXCB 1BREA 1VEPA 1OAUL 3OXSA 2IG2L 1XEDA 3GSRA 3MLZL 1KEGH 3PIQA 5T1LA 4Y2OA 4L5FH 4XP4L 5FV1L 4YE4H 3SKJL 3CFJA 1M1SA 1G0DA 4OI8A 2IADA 3QUYA 3UTPE 4MCZA 3JWDC 3N85L 2RAMA 1RJCA 5K93A 4X6FA 3RTQA 4OSUL 5HHXH 1UYWL 1W0VA 4XAWH 2AGJL 2IPUK 4M1CC 4NZTL 5DD1H 1X4XA 5IQ9A 3MRRB 3CDFA 5CD5D 4CMHB 1GZPB 4ZFOB 3V0AC 3L3GB 5I1LA 3CXHK 5FFLA 3UYRH 1NFDE 4WDIA 4JB9H 1S5IL 2X4OA 2RCSH 3IXAA 4YHML 1AC0A 3GEWB 2YD6A 1EIBA 3QFJD 4XBGA 5DRNA 1CK0L 3D0LA 4P9MH 1P84K 5MP6L 2XA3A 2FGWL 3LKSA 2Z93B 2CIKA 2MTPA 3B5GA 3DTXA 3MSPA 4XCNA 2FECI 1EMTL 4PGBA 2NPLX 4WWKD 3MFFB 2DWDA 5EZLB 1QPPA 5ERWB 4J2XA 3MV8A 1S7RB 5I19H 1U8OB 3TH2T 2VRAA 1CL7L 2NR6D 4Y5VB 3GSQB 1AR2A 1KJ2H 1LD9A 4Y5VC 3EO9L 3QULB 1OTTD 4OJFL 3D3VA 2AV1B 3FMGH 4L8SB 4Y5XB 4AEIH 4L8SC 4Y5XC 2N4IA 3QJFA 2ZCKL 4U33A 1JPFA 1T66D 5CIPH 2F54B 1MPAH 4NQDB 1I3VA 4R90L 4MJID 4HH9B 3FB5A 2HWZH 5IB5A 3WLBB 1JE6A 1RIHL 2X42A 1ED3A 2W0FA 2JLLA 5IUSA 1DQMH 1IKNC 4KMLB 1YNKL 4MNHA 1OLLA 4OM0H 3BZ4B 4OQ1A 1U2HA 4KTDL 4HIHA 3NCMA 4HGMA 2OTWB 3WSQL 4WI7A 4HXBH 1A3LL 3GB7A 3WUZA 1J86A 1VGEL 1YUHA 5F9AC 1KTLB 5E2TL 2DD8H 4G6FB 5LBSH 1AXSB 1IGYA 1FZJB 2K7QA 3EOBB 4NNYA 5K33A 4OUUA 3A6OA 3VDBA 4MQ7A 1N64L 3DO3A 4TVPH 2V5MA 1R3IL 4X8XA 1UM4H 4FQ1H 4BKLA 3BKJH 1FVDA 1YMMD 1K4DA 2R0KL 3IU4L 3WXWL 4JRXE 5IEKA 2E7MA 5FGCB 4JZJB 4LPXA 1MHCA 4JZJC 5FYJE 2Q7YA 3QO0B 4UT6L 1AO7A 5GS0D 4JKPL 5HGHA 1RJLA 4UIKH 2H26A 3QH3A 1I8MA 1J1XL 3PWUB 3ZYOA 1ZT7A 3EDFA 3TBVA 4KQ4H 3FO2A 1MLCA 4F8QA 1Z3GL 4FFWD 5FYKL 3DROA 5D6CA 2UZYB 5C0CB 4JR9H 4LHQB 2QSCH 6FABH 1T6VN 1BGXL 2AW2A 4AIZA 1ORSB 3GMPA 1S7QB 3FO1A 4XNMB 4ZFGH 4UDTA 3SQOL 2IFGA 2VKXA 1WTGT 3MJ9H 2BXYA 1IQDB 3CVHB 5F1NB 1QOKA 2OCFD 3MRHB 4HEPG 1A5FL 1QFOA 3MLRH 5IF0A 5EZOL 1BIIA 2EE6A 1CLYL 4U6XA 3GSVA 5TE4H 3BZFA 1FL5A 5F71A 3RVXC 5AYUL 3BSZH 3T4YA 4XPAH 3REWB 4NOBA 3VFTA 4EI6A 4OGYL 4RFEB 1BBDH 1ZSDB 5HPMA 1PBYA 1I8KB 3NIDE 2QBWA 4POZC 4DAGH 3OPZH 4FQ2H 2CLZA 1BZ9A 2KKQA 2V2TA 3LEYL 4NCC2 3KS0J 1JPTL 1IAKB 3X12B 1BJ1J 1A2YB 4GW1A 4X80L 3PNWA 3PP4H 2ZCHH 4TUJB 4WEUD 3K4DA 2DLEA 4F7PA 5BXFA 4BFIA 3O9WB 3O9WC 1MVUB 3HAEB 3JTSA 5HVGB 3VH8A 2NY0D 2VXUL 4XBPA 4WO4A 5C0EA 5HXMA 3DURB 4ODHL 2C5DC 3ARBB 5C0AE 5IB2A 3ARBC 1DE4B 5F1IB 1Q94A 3DGGA 4WFFD 4L29A 5IESH 5I30L 4F7MA 1FE8L 4WUUD 1B0GB 3WFHB 4MVBD 3W0WA 1I9RH 2KZ1B 1W72H 5EBWB 4X4XB 4RBPK 1T7XA 5I17A 3EYQC 4P59H 4R26H 2O5ZH 3QPXH 1UC6A 4PJCF 2LAGB 4HJJH 3DHMA 1G84A 1JZ3A 1OGAE 4H26A 3UZQA 1ZGLM 2Y23A 3EYSL 4U6HA 4KXZI 5E2UH 2YA2A 5HDQH 3GM0A 1RZ7H 1S9XA 2IQ9L 2FJHB 3ARFC 3QIBA 5CSZB 5DHVB 3ZO0A 1F6LL 5I8EB 4ZTOH 3DVIA 1KCRL 4OCRH 2JJTA 5I74B 1DJSA 1JNLH 2DQGH 5I74C 3NCJH 4OD2A 3G6JF 4V1DD 1BQLH 2E7CA 4NO5B 1I9JL 1K5NB 4C58B 2X1OA 5D1QD 5FB8A 5I76A 5DFVD 5E0QA 4DZBA 4U31A 4O5LH 1DQLL 4UDUA 4OIIH 3DVGA 3U4EA 2VLJD 1NBZB 1UQSB 5EORH 3ULVD 2FR4A 3VXNB 4PJAB 2VDQL 3WFDH 5L7XH 1IAIM 1F11B 3GSUA 3CZFB 4JLRB 2DLFL 5B21A 3X3GL 1KLUB 4S1DC 1LE5A 2QEJA 2ZUWA 3BMVA 3MRNA 1CICA 1HDMA 3AS3A 3K2UL 4OCSH 5E8NB 5HHOE 5CEXA 4QRRD 1HNFA 2NNAB 1U42A 4QHMB 5SV3A 5FKPA 3BIBX 1BFOB 3QDME 3RGVB 3RGVC 1U8IB 3EJYD 1WZMA 1OAQL 2X4RB 5FUOH 4XNUH 4OFDA 1IEBA 1A21A 2H32H 2PF6A 2D31B 1VADB 4X7TA 1E28B 1N5AA 4YNYB 4JHAH 5ETUB 1ES0B 3BQUB 3D6GA 3BQUC 4HLZG 4MX7B 1IAIH 3IFNL 1D5XB 1CFQB 4JO4H 4NRZB 3SY0B 2R1XA 3T0BA 4P2CG 1JZ6A 4FXGB 1OHQA 1FZOB 4A6YA 4HFWA 1J0HA 4J3UA 4GUPB 1MAKA 1MHHA 4WW1A 2KBGA 1JZ5A 1IAOA 2X6MA 1U2CA 8CGTA 1DN2A 2J8UB 5E9DD 3FQUB 1HN1A 2VWEC 1ZLUK 3L3KA 5GZOD 5DQDH 1REIA 4LAQH 3NIGE 1IQWH 4IMKC 4J1UB 3G5XB 5HGGS 5IGXL 4AL8H 1IL1A 3FFDA 2EC9U 2GUOB 4IJ3B 4LRIC 3LS5L 1KTDB 4IJ3C 4NKMB 1H15B 3HR5B 3OR7A 2X4QB 3P11H 4CJ0A 2ZG3A 1XGUB 2CQVA 1UKQA 3C5SA 4JFOB 2AK4B 5TFSH 4TSAH 1T2XA 5L8LB 5I1DA 2PXYA 4X6BB 5C09B 3HI1A 1ZKAA 2YA1A 4R2GD 3MJ8B 3HKFA 3MYJB 3PWPB 5CD3A 4JFQB 4FNLH 3RWCB 5CIPB 3MO1A 1UEMA 1X5IA 2P5ED 3IJHA 3UAJC 5GGTA 2VDLL 1ERNA 1RZIA 2XY2A 2H41A 2CXKA 2XPGB 3I84A 2VLRE 1NGZA 1O0VA 3O8XD 2VR9A 2BK8A 1TJGL 4XC1L 4PGDB 2AXGB 4R3SA 5H37G 2X41A 2VL5A 4YHIA 3OAYH 4PGZA 2WZPD 5LKNA 4ENEC 2EYRB 4PV8A 1MQ8A 4ETQB 4NOFA 3H42H 5SV4A 2BOBB 5CKGA 1NEZG 5GJTH 4JY4A 2ESVB 3LKQA 1KSRA 3D3VE 4G8GA 4DWHA 2JJSC 1F13A 4NQEB 3HN3A 3QWQB 5IIEA 2ZOKA 4P2YA 5JOPD 1AH1A 4PJCA 3WYRA 2UZXB 3O45A 1OD7A 5ADPL 5IV2A 2CLVB 1UCBH 1WTLA 1PD6A 4GW5A 5HHPB 1F58L 3UBXA 4G7YL 4TUOB 5KG9A 3NFSH 1K4CA 4Y5YB 3MRDB 4Y5YC 5IKCA 3KNBA 4F7CA 3LHPL 3MZGB 2AEWA 4K8RH 3LIZL 2X4NA 4K23L 3QSKB 3E8UL 4N0CD 4H0HB 1ZMYA 3GBNL 5FOBB 3B2VH 1MRCL 3G6JA 2I9LA 3QIUD 1UFUA 2BOCA 1FNEB 3ZHDA 1YNLH 3CAFA 3GMNA 5C07A 1V7ML 1M6OA 1MRDH 5F7DB 3D18A 3V0WH 4K94H 2E27H 1IILE 4P2RA 1PG7H 1DDHB 5BQ7A 4KK8C 3PG2A 2UUDK 4XAKE 3TA3B 4NWTL 4NC1E 1N6VA 3O11B 3TT1L 4KVCL 4YUEL 1HINH 4XBEH 2BFVL 4OCLC 3ZDXF 1B4JL 4QNPF 3QG7L 3KPNB 2PKDA 3MBXL 5EOTB 2F8XC 1U0QA 4P2QB 5E2JA 1XGYL 4YFLI 2PNDA 2DM4A 4XNYH 3RWDA 4D9LH 3DVNA 1AO7E 1WFOA 2CH8A 5I8OH 4HBCL 3QR2A 1FCGA 2SEBB 1G9ML 5IR1A 3WNPA 1UM6H 4PJXF 3ULVH 4ZDHB 1MWAB 1OAXL 1NAML 2HN7A 5JO5B 2NXZD 3HB3C 2IH1B 5GRUL 4GW4A 1XF1A 2VE6B 4KZEL 3QNXB 5GGQL 5GSRB 2Z8SA 4ODVH 1T1WA 2EXWC 1KENL 3MRKA 4ZUUB 5JIPA 3UPRB 4O2EB 5J3HD 3WE6B 4NQVB 4C56D 5TQ0H 2WANA 1W72B 2YSSB 3O3AA 4HWZB 3F5WB 3WIFA 5DEGA 5SWSA 5JNYB 3O41A 3OR6A 4APQD 2QQNL 3G04B 3ZKND 3ELAT 1KFAL 3TGXA 5E4IA 1MJJB 2XFXA 5ICYA 1XGTB 1DBBL 1C1EH 5CAYB 5DZNA 4U05A 3O3BB 3VXSD 3FTGA 5L0QB 2VOTA 2DQEH 5L0QC 4JPIA 3RVVD 3IFOA 3BP6B 4OKVA 1JGVH 2Q86A 3QWRD 3OB0K 3QXAA 3HUJF 4I2XB 2Q8AH 1J05B 3NMEA 2F19H 5BO1H 1WVZA 1AGFB 2VXSL 1AKJA 1BQSA 1PLGL 2AEPH 3OKKB 3MV11 3MNWB 4HHAA 3U0WH 4JDTL 4R7NB 3FRPA 2NXYB 2NXYC 2CLRB 1NBYA 4Z95L 4L3CB 1PYWB 3OZ9H 1NGXB 1LEGB 5DJDA 4KK6D 4YO0B 1NKOA 4WWKB 1EBAA 2E7LC 4WWKC 2AJVL 1NCWL 4U7KA 5DRXB 5E7BA 3B4NA 4AQOA 5CWSB 3WCYA 4FXKB 2X9YA 3T8XA 4QRPA 3IFLH 4P49A 2DTSA 3BP4A 4EZMA 2J1KA 1MNUL 1OTTC 3MCKB 1WWCA 3RY4A 5EBLA 5HVWA 2QHRH 3GHEH 1RQ5A 3ES6A 2OQJA 4HUUB 4MJIB 1CR9L 1YQVH 2DB8A 4LDLB 2P5WB 1CIDA 1BOYA 2X89A 2H32B 3S5LB 3B9VA 4KY1L 4K71B 3DHJA 4K71C 5SX4H 5TF1L 1KNOB 2AEQH 1FNLA 2VL4A 5GRZA 2KQMA 4JFYB 4LPYA 1ZE3C 1EZVX 3BGMB 4NBXB 4WTWA 3RVWD 4JN1H 3VDAA 3IAPA 3TZVA 5KSBB 3B9KB 3BE1H 3B9KC 3OAZK 4G7VL 3ROLB 3CNKA 5B3JF 4ONGH 3MNVB 4XP5L 3UTZB 3OB8A 4RNRB 2ADFL 4GG6F 3D69B 1UWEL 1HQ4B 2OS7A 4B0MM 1YMMB 3CC5A 2W59A 4LCCA 3ZE2F 2G75A 5IOPB 1YEGH 5I1GL 1KXQE 1JV5B 2FECL 4MAUH 1G6RH 3EOTL 3D5OF 1CS6A 3PWJA 3ARQA 4XMLL 4HX1B 5T33L 1BFSA 4D9RD 5F3BB 4FFWC 4PRPD 4W6WB 1L9MA 2MNUA 4XCCH 4IM8A 2YK1L 4XVSH 2IPTL 1T03H 1Y6MR 1YY9D 4PUBH 3DLQR 5BV7L 2VLKA 3BP5B 1WBYA 1DEEB 4OFYD 5EU6A 3H0TB 4PJXA 1RFDH 1ITCA 3VFMA 3VFSA 3L1OH 3HLAB 3ARRA 4LMQI 2EXYD 4RAVB 5CEZH 2X05A 4JPKL 5A16B 3PV6A 5KSAA 3FO0H 2AEIT 2CUIA 4G80B 3VJ6B 1KJ3H 1VPOL 5I8KL 3C60A 1R3LB 4U0QB 4G6JH 3LZFH 4H8WL 2I60H 1J87A 4ZXBD 4WEBL 4N68A 5F7YC 1P7QA 3QNYA 3IFPA 5INDB 1J9CT 4RGNC 4NT6B 5MI0B 4GLRH 25C8H 5DYOA 3BRGC 3VXTA 3BDBA 1MFCL 3RDTB 4XMPH 3RDTC 3RPIA 4U1MA 5DQ9B 5HYQB 3VGEA 4GAJL 3IT8D