1RJYB

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
b'MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Structural Basis for the Restoration of TCR Recognition of an MHC Allelic Variant by Peptide Secondary Anchor Substitution
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 15
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rjyB00
4HWZB 1ZVHA 3MLSL 4Z18A 2JIXD 2NY2B 2ADGA 3PABB 1YY8B 2QADB 1G7MB 5I8OH 4XCEA 1MRDH 4LOUC 1OCWH 5KANI 3KJ4B 2VOTA 1I7TB 3EHBD 4X9BA 4BH7A 4JM2F 1KLGB 2YD9A 1BIIA 3HMWL 5H35B 3M17B 4KROB 4Y4KB 3UTQB 4XPBL 4X5WA 1C8PA 3DRQB 4MCZA 1ZVSB 4PD4J 5GRVL 5D7LE 5MENB 5KTEL 1I3GL 4C58B 1V7ML 1JYXA 4APQB 1FORH 2B4CH 1J8HB 1OQOA 1UYWL 3BKYH 3G5ZA 1P5UA 3ABZA 4TVPE 2X4UB 5HY9A 1ZT4B 1B9ZA 3IJYA 3Q5OA 1WK0A 3HUJE 3TM6A 1JNLL 1RJYA 3O45B 1NUFA 4WW1B 3F12A 2VLKB 3ARGB 2YD1A 4OLVL 1FYTB 4IDJL 2UYLA 3QUZA 1AXIB 4IS6A 5HYFA 4NO0B 1F90L 1T1WA 3MRBB 5F88A 5I15L 3BKCL 4RWYL 4E41D 1SM3L 1A7BA 4YE4L 3BRFA 5C6PB 4PG2C 1JHKL 3L5WB 4H8WL 3WO4C 1WTGT 4U6HA 5CBAA 4OZGA 3UJIL 1L0XA 3UPRB 4LSUL 4F2MA 3TO4C 4M8QB 1UXWA 1J05A 2DICA 4OUOA 3OTTA 2YKLL 1NMBL 1BQHB 1X5XA 3L3JA 3T4YA 1T03H 3FQWA 5CIPH 4Z7UB 1ZHKB 1CS6A 4GRWH 5E9DE 4BQ8A 5AZEL 5F3HB 3SGEI 5DTFB 4XPGH 1BJ1H 2IQ9L 4YNYB 1IGML 1KC5L 4U1MB 5BRZA 4HLZG 3QUZC 5LKNA 4PRPB 1T5XB 4ZFFA 3L3DB 5SWSD 1EIBA 1Z0NA 3RKDC 4R96A 4U1SB 3VU2A 4WWKD 3V0WL 1BP3B 2WIMA 1DDHB 32C2B 4LNRA 3RWHB 1DANT 2YPLD 4BJLA 2GY7B 2DLGA 3FO0H 5C0FA 4LFHD 3QUYD 2W9EH 4PJHF 2EEAA 3GNMH 3GHBH 1LE9B 5DUMH 3OGCB 1MWAA 1H3VA 5L2KE 1NAML 2CRYA 3HZVA 1F11A 1T0NB 1WBYB 4KUZL 3U0PA 3QDHA 4PR5B 3T0VA 4RX4D 3MRPA 5I1CH 4YHYC 1ZA6A 4YHOL 4KHXL 4AEEA 1BHGA 4PB9H 1Q8MA 2D4DA 4FZEL 4MVBD 4PP2B 3FFDB 2GCYB 1VDGA 4JAMA 1KPUB 1ORSB 7FABH 3AREB 1MAJA 1YN6A 1E4XL 3IJHB 4X6EB 3WKML 1RUAH 3CFJA 4S11A 2XY2A 4Z78A 3HE7B 5JNYB 3RVXD 5KS9A 4XVTH 4Z7OE 1J9CT 2X9XA 2R2EA 4YHML 4LSDA 1EDQA 3NN8A 3RZCB 4OFYA 1QFUH 2HLFC 2DAVA 1JNNH 5EZJA 1BEYL 1ZLUK 4N9OB 2BC4B 4F3FB 5LVEA 5F44A 4XRCB 1Q9OB 1W0VA 1XCQB 1YJDH 3IKKA 3BDYH 5B39A 1GGIH 1KELH 1QPXA 2AEQH 5BS0E 1Q1JL 4G9FA 5BQ7B 2Z35B 2XZCH 4G8IA 3U1SH 5GGSY 3D85A 1INQA 4U6TA 2R2BB 2XTJD 2FX7L 3FJTA 4OQTL 3K2UH 1Q9KA 2AABL 3RZWA 2WINA 2BMKA 1TETH 3V52L 5HHNB 4JJ5A 2YZ8A 3VFWB 1CXKA 4U6VH 4JQIL 5T3ZE 4LAQH 4F7CB 1KTKE 1MJ7L 1NDMB 2HT4D 4YGVB 4F9LC 4DW2L 3MV8B 2Z92B 3AU1A 2HT2C 2VABB 1UADC 4HF5H 1MLCB 3MRIA 4PJ7A 2PETA 4HPOH 3T2NH 1SEQL 5J6GA 3GSWA 4P3CL 4UBDD 4KK6D 1I8LA 3BW9A 2Z91A 3OPZH 1WQVT 2I26N 2CDEA 4TTDD 4WCYH 1EEQA 3ZYJA 3LOWA 2HTKD 1NCAH 2VLRA 2P5WA 2A6KA 4N1EA 1E6OH 2BOBB 1E6JH 1HCFX 4P2RA 3RVUC 1G1CA 4XH2B 1MJ8L 4LHUG 2NTFB 3L3HA 5ACLA 2NX5A 5H37H 3FOLB 4JFDB 1CL7L 3BAEH 1RZKH 1Y18A 4NUJA 4LPYA 4ZPTA 1PY4A 2E7MA 4XCFH 3CDYA 1RJZA 1CE1L 1SHMA 3IDMA 4FQLH 4KKLC 1FG2A 4EN3D 4OF3A 5TE6L 1K2DA 4QRRD 3HNVH 3FTGA 3MRGB 5BVJA 2P43B 3J8F7 1WZKA 1CFBA 2E9JA 2IFFL 3H8NA 3FQUA 3BT2H 1NC2D 1PEZA 3GMNA 3UEZA 1GHFL 1KJ2H 3FQXA 4DGVL 1JF1B 3U0WL 4YBQD 4AIOA 4GLRH 3HAEA 1SY6A 3OWEA 3MJ8A 4HS8L 4JFFA 5GRWA 4DGIL 1MFDH 4L9LB 3KLHD 3X3FL 2DQTL 4FFYH 3HZYB 4FXGA 4PJXE 4U0RC 5ESVB 5IFAL 3UYRH 4LDEB 4DVBA 1YNTA 5GGVL 5C0JA 4PJEB 1EH9A 3IF1A 5EZIH 1DBKL 3L3OA 1T7ZA 3BJLA 4UV7H 5KN5A 1XF3A 3ARPA 3LB6D 2AV1A 3MLXH 3WV0A 1UVQB 1ONQA 4MDIA 3OKLA 4P3WA 3IAPA 2RFXA 4WU7A 4E0RB 2VC2H 4LL9A 5B4MC 1I9IH 1TVDA 1N64H 5DD1H 7CGTA 1A9EB 2BSRB 1MHCA 4RMTA 4N0FB 5D1ZA 4UDTB 1BD2E 1IC5H 1MY7A 1CBVH 3Q1SL 1UM4H 3W11D 1S7WB 4FMKA 2A83B 4U3HA 1GC1L 4Y8AA 1U95A 1G7LB 3LKPA 1BFVL 4Y2DB 4Y19B 4TOYL 5MP6L 1OD7A 2X2YA 4HH9A 3MREA 2FWOA 5TPWL 4PJ5D 1K8IB 3S36X 2KZ1B 2F54B 4UAOC 2AKRB 2P8LB 1RUKL 2RCSL 2UZIL 3FMGH 4W81A 3VFTA 1AR1D 5EC1B 3K8LA 1JTTA 1Y0LB 2PW1A 3S35L 3T4AA 4OLZL 4FFZH 3ZTNH 4GSDH 5T5NF 1CGUA 1FFPB 3UBXG 1OTSD 2ADIA 1D5BB 1LK3L 4ZFOB 5IVXA 1UA6L 2EKSB 1IEBA 1QLRB 4XI5C 5D1ZC 5C0NC 2ATKA 3EYQD 3AMKA 4KVNL 3WSQH 4TSAH 4TUJA 3I6LD 4OB5H 3ARDD 4KAQH 5F6HJ 4OZIB 1T66D 1BWWA 4PLKC 5CEZH 4K8RL 1S9KC 5D8JL 1HHHB 1W0WB 3DECA 2Q87A 4P2OD 3CVIH 2VDQL 4KJPD 2FIKA 1XZ0B 3A67L 3HI5H 4S1QL 3TJEH 1YEGH 1KFAH 1TFHA 1G7PA 5FF6A 3HG1A 5DHVA 1QLEH 4X0KA 2GIYA 5GRJL 5A2LH 4YXKL 1FG9C 3ULUC 1MCKA 5E5UB 3V5KB 4HWEH 4FQQB 4A6YH 5JPNB 2R4SH 4PLOB 3FO1B 3IAGC 1RFDL 3QXTA 4P9MH 1ZWIB 4F57L 2NY3B 4KGJA 2GUOB 1N0XH 3KR3H 1DUYB 4C56E 1G9ML 5MEOB 1ZMYA 1J5OH 1RURH 2OJZH 5I30H 4L8CA 1KACB 3DHJA 4I13B 1N59A 1MRFH 1P7QA 2OR8A 3MROA 1JZ6A 2EKJA 3HC3H 4R2GB 3ROOB 2DQGH 3P73B 5GGUB 2A2QT 2A38A 4YHZH 4QXGH 4FFWD 5IHUL 1J8KA 1AGDB 2W07A 1LEKB 5TDNB 1YQVH 5C0AB 4KTYA 4Z77B 4JRXD 2EDDA 4JFXB 3U46A 2XWTB 2WP3O 2DQFA 1LO3H 1KEML 3KYKH 4JPVH 5F7EL 2CSPA 1GAFH 1BGXH 2Z93A 3FQTB 3NIDF 4QRTA 2PYFA 1FSKC 3I6KA 5DDHA 3OJVC 1A6AA 5DEFA 1UACL 43CAA 5H94B 2NY0B 1PG7W 35C8L 5D7LA 4OLYH 1OW0C 1Q0XH 2YPVH 5E95B 3ARTA 2HT3C 1AHWA 3EFDH 3IFNH 3DO7B 3GM8A 3D25B 4G43A 4PB0H 4K3HA 4JFZL 1LP9E 5BJTB 2QBWA 5GRVK 1FNSL 3HNTH 2ICWJ 4ZXBA 5T1KB 3REVA 4NHUB 3PDGA 4JFYB 5IMKB 1KEGH 3D39D 2VDKH 4JKLA 4M93C 2OI9C 2ARWA 4ZDHB 4P46C 1DP0A 3GM0A 4AM0B 1QACA 3HFML 5I2IA 5ADOH 2ZSWB 3HS0A 3ZKSD 4OZFH 4OZHE 4XPAL 5EZLA 4YUEL 2IALB 4LEOB 5GS0H 4U1LA 3QDJB 5JA8B 4LPXA 4ZTOL 5FEBA 3S3SA 4LHUB 2DLTA 2Q86B 3U7AA 3VD5A 3BVNA 5I1AB 1KB5B 1JNHB 3DUHA 4YO0A 1M7XA 4QTHA 4HKZA 1FV1B 1EJOH 4U0QB 4M9PA 1MHEA 3OX8B 3A6CL 2YSSA 4XVJL 4XCNB 4YFEA 3IDNB 1IM9D 4U1NB 5IG7A 2G9HA 2W60A 3OR7B 3WEXB 2EXWC 4ZXBC 3G6DH 6FABL 4ZS6D 4XXCA 2VDNL 1MCBA 3F7VB 1X5JA 3MOBH 4FG6C 3WE6B 1QBLH 1EEZA 1P4LA 4Y1AE 5IROA 3AXLB 1QFWH 2C3XA 1TCMA 5BO1L 4QXTB 1HE7A 3ARRA 3U9PL 2H2PD 3P4NB 4UQ2A 5EORH 4XPFL 3KPOA 2OL3B 1JGUH 3MLYL 3DX8A 4G80A 4H1LH 2HVJA 5ERWA 3VFOA 2C5DC 1MCRA 4LQFH 3PL6A 1CLOL 2B0SL 4G6FD 4MA8L 4EUPA 4ETQA 2APBA 5E08L 4JY4B 4ZO9A 3MV9E 3VXMD 2PYEE 4HK3J 4I48A 4O02L 5F7DA 4CMHB 1XF4B 4K3DH 4HWBA 5SX5K 4XXCC 1UWEL 1EFXA 3TBSA 2BSSA 1DFBH 1YNLL 4PJBE 5HVFB 2F53D 5B8CB 5IROC 4PRHB 4HJGA 3TBYB 3KPSB 1LDPH 1HYSC 4K9EL 3NZHL 2Q76B 5IB1B 4KQ3H 3QFJD 3G04A 1A4JB 3HZKA 5GGRY 5IP4A 3DGCR 3QDGD 4GMSH 5DR5H 3DSNA 1KF9B 4QOKE 5HHOE 2N7BA 4JY5L 3CH1A 2CR3A 3QI9C 2DBJA 2O61A 3JTSB 3HRPA 4J1UA 1P7QD 3MRKB 1BZ7A 1F5WA 3LKOB 3UBXB 4HCRH 1MF2H 4KKBD 4AIZB 5IFJA 3VJ6B 1CD9B 2DI8A 3P9LA 1QBBA 3DGGA 1PZUB 5L0QC 5D7JD 2OTUB 3BKMH 5IMLB 3GMOB 5F7MC 4ZAKB 2B1HH 2IG2L 5EBWB 3MACL 1A4KA 4LASL 1BPVA 1M71B 2OZ4L 3MRCA 4K94C 3SDCA 2R29H 3G5YA 2Y06H 2NZ9D 1JWUB 1NBVH 4LLQA 2CIIA 3DIFB 4AT6A 4XNXL 5ID0B 1NGZB 1GSMA 2APVA 4M6NL 3PWPE 4YAQB 3LEXB 2OSLB 5CGYC 5DHYB 1ITCA 4FQPA 3VA2C 4OKVA 2BNQB 1HXMB 1C08A 2F58H 1ZSDB 4QRPB 4KK9D 3VH8A 3CZFA 3B5HA 3MLSH 5J89A 3QCUL 3MLTB 1OAXH 1T4KA 4YC2C 4IMKC 1N5AB 4TRPL 4ZODA 5IQ9A 1CICB 3RX8A 2D03L 3OAZK 1N3NB 3GI9L 4BZ2H 5IM7A 4GQ9H 4EOWL 1KCRH 1JTOA 4MMXC 4OF0A 1I8MB 5EULV 1N5YL 5JLZB 3WO3B 3QWRA 4OTXL 2MFNA 3SDCC 5D7KE 1NLBL 1RZJL 4XPBH 1A0QH 4ZUWA 1T6VN 3BIKB 4LGPB 5L8JB 1QYGH 3H3PL 4UU9A 4ORGB 4LRIA 2G5BB 4DN4L 1G9NL 2HP4A 5IIEB 1TLKA 5CCKH 1V7MH 2AK4B 4NRYA 2BVUA 3QUMH 3MV01 3U30B 4XXDA 1UYWH 1BOGB 4BSVB 2X4RB 2YPKB 5ALBH 3BQUC 3AC0A 1JNLH 3QNYA 4IRJB 3IDGA 4H0IA 2X7LA 3D2UD 3P2TA 2EECA 2MHAA 1UENA 5I76A 2EDLA 3BOVA 2ENSA 4OLVH 5HI4C 4HUKB 3FKUS 3MCKB 5J13B 1F90H 1AGEA 4LSQL 1PSKL 1OM3H 3BKCH 4RWYH 4DOHB 2GSIA 2MMXA 2R56L 4YE4H 1HN1A 1LD9A 2JELL 1JHKH 1BVLA 4H8WH 5ANME 2Y7QB 5I73B 5IHLB 5LJYH 2PCPB 5FM5M 1TJHL 5BV7H 3R1GL 4J8RA 5MEQB 1I7ZB 1IGCL 4LSUH 4KUCF 2NY5C 3VI4F 4DK6A 3RNQB 5JOFB 2AV7B 4NZUH 1KN4L 4WGWB 4PJXA 3EYFB 3SGJC 1XMWA 3LPWA 1QVOA 1K4CB 4D9QE 1NMBH 4XNQB 1QEWA 4DKDC 2AXJA 4X4XA 5H37G 5DJ6B 3OG4B 1ZHBB 2ICWB 3SDAC 3VGDA 3O3DB 1EEYB 2ILLA 3WIHH 2ERJB 4K7PL 1PDKA 4X4YA 3VFUA 1KC5H 3IFLL 1EFXD 1U58B 4NWTL 1PYWB 2R0LL 4HIIA 1MCWM 3NVQA 4LF3B 2WWMC 5JA9A 4U6XB 5FYLE 3O0RL 1C12A 2A73A 3BP5B 1FZOB 4ODSL 1BD2A 4P5TA 3SE4A 3C9NA 4DKAA 3QXVA 4PRDB 1RMFL 2F5AL 4N5ED 3JTTB 4LVNC 2KBGA 3GJFB 5HD8D 4LLMB 5K9QI 2NLJA 4NFBA 4CRPA 1FYHB 2IEPA 4YJZL 4WTWA 3WLBB 3E0GA 4WUUA 5TE7H 4D0CA 3ORJA 3OKOB 4KK8D 4M7LH 1OP3K 5E56A 5DRXA 1AD9B 4Y5YB 1NAMH 1CLYH 1EXUA 4PRID 1S5HA 1F4AA 4JPIA 5J7CC 1X4ZA 3QRGL 3GBMH 1NL0L 4NO0D 4WI3A 5CIPB 3VRIB 4YHOH 3MZGB 3TGXA 4FZEH 4ODWB 3NA9L 1YDPA 4M48L 5DRZB 3NIGE 4U7KA 3PWVA 4KDVA 1NCTA 4GRLB 5DFTA 5EU4A 3LAFA 4GKNB 1PX3A 5IR1A 2VITA 4YEEA 1SBSL 2YWZA 1JV5A 3CPLB 3O2WL 4K55A 4YHMH 4NQCB 4NKOA 1GGYA 3VD4A 3ZMRA 3RPKA 5EA0H 5DC4B 5ITFB 3HI6L 2X4OB 2IAMB 1BEYH 3HI1B 2GITB 2KDGA 4F15B 4PFEA 3LKQB 4H25B 5LGHH 1BZ9B 1I3RB 2APFA 1OGTA 1Q0YL 2P24B 4QNPF 3QHZH 4ZFGL 3KDMB 1ZTXL 1R3HA 4OM0L 4C56A 1CLZH 1JHTB 3OV6A 5IFHL 1C7TA 3FFCE 4ZUSA 5D7IB 1IQWL 3CLFH 4YHKL 2D7TL 3GMLB 3LPGA 4M1CD 5T3XD 4HZAA 4KXZI 5DC9B 4J12A 5F6IB 5DZOA 3LDBC 5T1LD 3U7WH 1IC4L 3QWOB 4PY7A 4L8SB 1LK2A 1KN2L 3OXSA 1G7QA 1U36A 3V52H 1K4DB 5JO5A 5DUPL 4O58L 3OJ2C 5C8JA 4X7FC 4K71C 1MWAL 4ZS7L 4JRXE 3W2DL 4DKFH 1X4XA 1FZMA 4LCIL 3OAZH 4UZGA 1K5NB 1MJ7H 2QQNH 5C0EA 4CN6A 4DW2H 1JK8A 4DEPC 1WITA 3CDGB 2C3VB 1Q94B 4HUXB 5DMKA 4K7FA 4ZQKB 4X6DE 4OAWB 1SEQH 4RZCB 4P3CH 4F8TA 1JZ5A 4I9WD 1XF2B 2WM0A 4G7YH 4JFOA 1JN6B 1PVHA 4DN3L 3D9AH 3Q3GB 3VXNA 5FUCE 3S35X 1LP9A 3PQYD 3DV6A 3H3KA 2EDNA 1BWMA 1MCWW 5GISH 2AXFA 1AD0A 3ULVD 3FRUA 1D5ZA 1UKQA 4H5SA 1SEBB 2A9ML 5J3HD 3LD8B 4L4VE 3D39E 5CEYB 4ELKB 4LSVH 1LGVA 3RZCD 1CL7H 5F1SA 1A2YA 3O6FB 4NQDB 4PV8B 4OIIH 4MQ7A 1T1YB 4NPYB 4NQTA 2ZCLH 3MRNA 3QO0B 1R5WB 1MJUL 4DGVH 3GI8L 5HHQA 3WHXA 3SO3B 3JWDC 2VLLA 5ISZE 4O00A 4XP4L 2DKUA 4PJGB 2N56A 4V2BA 4X7DC 5ESQB 4FQXB 5FA3A 1BF8A 4HUUA 3UTZB 3EZ8A 3RWIA 4C55A 4D9RE 3WFBH 4NUGL 1FJ1B 3MR9B 4Q6IA 4CVWA 2FEDC 4PJIE 2HAZA 4JZJB 5FK9B 3WFHA 1DL7H 1XGYL 1NCWL 1RHHA 4OCRL 1N2RA 4PGEB 1V7NL 1YECL 3H9SB 4Y1AA 3SKNB 4OZFG 5FYJD 1C7SA 1R5VB 4TN9A 2EC9U 4I3RH 2DQDH 1YEKL 5DD0L 5FKPA 4LP5A 3DHMA 4KJQD 5DJYA 2VN4A 2DI7A 1KUMA 1PY9A 3VWJA 4NYLB 2N1KA 2WK2A 4NQVA 2EDYA 5E4IA 3WJJA 5I17A 1LEGA 3F5WB 3KPTA 1WTLA 4KI5F 4PRNB 3MYZA 4KFZC 2FZ3A 2DYPD 3SDDD 5HGAB 4OIAA 4P3DB 3MV9A 2VDPH 3NPZB 4GKSB 1BQLL 5FYKE 1JGEB 1SYVA 3QIUB 1OP3H 1FPTL 4Q6IC 5C70A 5EBMB 1BFVH 2E7CA 3P4MB 5DJCB 1FGNH 3T0EE 4BQCA 5DA4A 5C7XL 5E00B 3ARSA 4PGCA 4NZJA 4CAGA 2UZIH 1RUKH 5BZDA 2R9HC 3LN9A 5C09B 1D9KA 1FNGB 4HMEA 4XAKE 5EO9B 5GGTA 3SOBL 2F15A 4OLZH 3DMMB 4EI6A 5KSBE 4HV8B 3U9UB 3ZKXB 4H1LG 3VWJC 2H8PA 1UA6H 4U7SA 2XN9B 4I4WB 4OGYH 4OZGF 3QDGE 2WUBH 3O2DA 4QOKA 5HHOA 5ALCL 4MA7L 4JFEB 2V7HA 5DJAB 2VN7A 5CS7A 4BZ1L 3C6LA 1IC1A 1OB1B 2JCCE 3STLB 3WKNA 3C60D 1KXQE 5HYJB 3THML 1H8OA 3LSOB 4ODUB 3S4SA 1FIGL 3G6JB 3A67H 4S1QH 1AKJD 3LS4H 3S96A 4OZ4B 4OF6A 5E6IB 3SKOB 4YXKH 4MXWL 4JVPA 2J8UB 5JZ7D 1M6OB 4OFKA 3U36B 4ACPA 4L29A 4OGZA 4H88H 1D9KC 3I50L 3MLVH 2Y5EA 2ICEA 3L9RA 5KVEH 4F7MB 1RFDH 1BBJA 3T0WA 4F57H 4F58L 3FHAA 1G9MH 4MVBC 2ED7A 1NMCC 4BQBA 1KJMB 2GJZB 4PJ9A 5FO8A 2HVKB 1DBAL 1S7UB 1U8MB 4F80A 4P23B 5GS1C 4G5ZH 5IEHB 3GEWB 1R24A 3OZ9H 4E5XA 3GSUB 4HZLB 4LEXL 2KQMA 5IB4B 2LQRA 5D9SA 3QEUA 3MX0A 2ADFL 4FMFA 4F37F 2AI0L 1QNZL 3AS0A 5E8EA 3B2VL 5DK0B 4NNPL 5HGBA 4NM8H 4YDVB 1KEMH 3ULUL 2XQBL 3IAQA 4RGMB 4HAGA 5LWYL 3B43A 4U1IB 5JOPD 1Z6JT 2B5IC 1UXSB 2AQ1A 3DXAD 3BXNA 4LLVB 4LSTL 1CU4L 4R4FH 1T1ZB 2QKIA 3ARQA 5K59E 4OV6F 4TUOA 3ULSA 1JFQH 4JFZH 1FL5A 4MAYD 2PXYB 3I75B 4ZFZB 5KS9F 5BXFA 1BJ8A 4P4KD 5D2NE 5DJ0B 5DJXA 2ZUUA 3B9KA 3O4OB 2DQEL 5BVPL 2E3VA 1TVBA 4LLYA 2Y5TA 2ITCB 3NPSC 4CJ0A 5KZCD 2OS7A 2FYYB 3SEPA 1CDGA 1EAPB 3OKDB 1S9WA 3B9EA 4DUXA 1C16A 4LCCC 4XPAH 4DKEH 5DD3H 1F58H 1MVUA 3ROLA 3FQRA 1QBAA 4ZTOH 3N50A 1U8IA 4M7ZC 2QLVB 4XVUD 1OT1A 5JQHC 4TTDC 2XA3A 5CLWA 2Y9RT 2CO7B 2DLIA 5KSAB 5IOPB 5HVWA 3DBXA 5EIQA 1HSBB 3ECBB 4RGOL 2WLYA 3IU4L 4KMQA 3RWEA 2AEPH 4MDJB 2HWZH 2NXZC 3MMEA 3A6CH 4FXKA 1FQ9C 4FQHA 4Y4HB 4HEME 6FABH 3VGAB 3B9KC 2VDNH 3UTTD 3UAJD 1OGAB 3ZDXE 5CJXC 3TIDA 1XR8A 3EYVA 2P5EA 4N5UA 5IGXL 4RMRA 3E6FA 1HH9A 4EN3C 5C08A 1FLRH 3KS0J 5E1AA 5IB5B 4JDVB 4J3TA 4ONFH 4EIGB 5BO1H 3OKEB 2VL5B 1U42A 3U9PH 1QSFA 3P11L 4LARL 1FL3B 4PJ7F 1OAYL 2QR0A 5LGKA 4DCQB 1WFOA 3IVKB 3LQZB 4NRXB 3MRQA 3SCMB 3QUXA 3P4OA 4WNQA 5EUOA 3IXTA 1ACZA 4Z7WB 4IIQA 2HH0L 1ACYL 1EO8L 5MENE 2ZJSL 4HEPG 5DYOA 2DQJH 4C83A 5GHWH 1IARB 1D5MB 1H3TA 2ZP0T 1WV7T 2X89D 5DQ9A 4TVPL 1J8HE 2A0LC 4O02H 3C6LD 1I9RH 4GBXA 3JV4A 5D93C 2CH8A 3WFEL 1IAIL 4CVXB 3TH3T 1ADQL 3JV6A 2VLKE 1O0VA 4PJFB 4L4JA 1FYTE 1Z0MA 3S34L 3DX9B 3PWJB 4YGAB 1HIMH 5C0GB 4NQEB 5DD6A 3MJ9L 2RHEA 3MJGX 4ODXA 1NGPH 3X11B 4MAUH 4K9EH 2VR5A 4MJIB 4GXUM 1DQLL 4LHUD 4I2XA 5I1LB 5DQJA 4RAHA 4ZUUB 3QUXC 1VSCA 2CKBH 2C3WA 4IIQC 3CZJA 4QT5B 2BNRB 2NY6B 4JY5H 1N0LA 4PJ9D 1MCDA 4LSPH 5JXED 3ILQD 2CRIA 4HKXB 3OSKA 5FUZH 5E2TL 4WJ5B 2ZUVA 1OSZA 4OM1L 3GMQB 3D0VA 4UIMA 3DO3A 4POZD 4B5EA 3QXDA 5DVOA 3UTSA 4QXUL 4Z7UE 3TZVD 1IGFH 3CSYB 3RL1B 3L5HA 4M5YL 1YMMD 4QGYA 3AS3A 2PO6B 2DN7A 3FCTA 3BP6A 5AD0B 3HC0A 1NAKL 3RI5K 4N8VA 4PRPE 3NTCL 4LK4A 4S2SB 3QPXL 3FONA 3DRTA 4S1DD 3FFCA 3B6SA 5EOCH 1HHJB 1CG9A 2WLZA 4PJDA 5K93A 1VA9A 1DE4B 3EYQC 3RWFB 3BUYA 4P9HC 4K7PX 5HI5D 1FFOA 1YEIL 3VWKB 2VDLL 4X5XB 1CT8A 5TGBA 1ES0A 1YEJH 4WTZG 5HTSA 5F7HA 2BVOB 4H0HB 3NZ8B 5D1QB 1UZ8B 5DUBA 4DTGH 3KYNB 4Q6YA 4KJPC 3UROR 12E8H 1VEMA 4ELMB 5ADPL 3HC4H 1VADB 1Z5LA 1SYSA 2OMNA 4R7NA 3ESVF 3RNKA 5I8CB 3RDTB 2DTML 1T89A 1KPVA 4OGXL 3ULUF 4F37K 3JV0A 4TRPH 2BOCA 3NCJL 1MCLA 1YUHA 5C0BB 1VESA 2UY6A 3GMRB 4YFLF 3CMOH 4UT6H 4EOWH 2MPAL 4Y7MA 3F6IA 3TO2A 5IVXF 3KPLA 4X6CB 4MQXC 1N5YH 3SPVA 5BMFL 4I9WE 4MMZC 5HJ3A 3KLAA 5IB3A 1EA9C 1RZJH 5AUMA 3MFFA 4AZ8A 2VXUL 1A21A 5E1HB 3RBSA 2GYSA 4OCMC 5FM4A 3WN5C 1JJUA 2DL2A 4DN4H 2APXA 2NW2A 4AENA 1G7JA 4ZG1A 5F7UA 5HGDB 1JWMB 5JUEL 2C3GA 1RIVL 4L4VA 1S8DA 3GBLA 4ZUVB 4UDUA 5JMOC 3MO1A 3WNOA 1PD6A 1OARL 2HJKB 1T89C 4JHWL 3KYOB 5D1XD 1RULH 2GT9B 2HFGL 2IPTL 5GGRA 2O5YL 2ZSVA 1F3JA 4DAGL 3PHOB 4UAOB 5EO1A 3S37H 2DDQH 4YQXH 4LLWB 5ISZA 1TZIB 4YR6B 2V2WA 2E27L 1QSFD 1TJHH 4IHOB 1IGCH 1QBML 3MSPA 3EDFA 5EC2A 5FUCC 4JB9L 4RIRA 4AEFA 4C57C 1KN4H 4NQSB 2ED9A 3DOSA 4JPWL 5JW5A 1CGXA 2V5SA 3DROB 2AJ3A 2VKXA 1XGQB 4U1JA 4PJIA 4R9HA 5E94A 3MBEB 5T3ZL 4P2CG 3QDMB 3D18A 1MI5D 4WI2A 3WFDL 2AJZB 2VTFA 1HHGA 3HE6A 1JPST 3UJTL 3MV8E 3P0VL 4RA3A 4NN5C 2R0LH 2ORBL 3OGOE 5CMAB 1B3JA 2X44D 4HULB 1NKRA 3MJ7A 2ATPA 3C8DA 1HEZA 4AG4H 1HOCB 3OL2A 3VXSA 3LN5A 1WT5C 3EJZD 3L7FB 5LAXA 4IRSB 4F7EB 1YY9D 2XG5A 2GEEA 1RMFH 4Q9RL 1X5KA 3MLZH 1WFTA 1B4RA 1JTPA 1XCTB 3QCVL 4NZDA 1VACA 1XF1A 4FTVD 2HFEA 5E2UL 2IPKA 3HCVB 1NJ9A 4DUVA 2VQ1A 1MEXH 4XHQA 2PNDA 2AQ3A 3KLSA 4RAVA 4XP1L 3OG6B 4JFDE 1NGXA 1C1EH 3GJEB 5HSFA 3HE6C 1KCUH 2IH3A 5HYSA 4YHLH 3K80A 3QRGH 5KSUB 3ILPB 1I8IA 3IDIA 1NCCL 3VGBA 4NO5B 4G42B 4JG0L 3PHQB 5GGVY 1KLUA 3NA9H 4M48H 3ZKMD 1DQQB 5F9DC 2WBJB 1WZ1L 2F74A 2B1AH 3AY4C 4S0TD 2JCCA 1DANU 3RUGB 4RFEA 1HHKB 4LKCB 1GOFA 2E6PA 3CMGA 4PRBA 1SBSH 2X41A 3NABL 2H32A 5F7NC 3RWJB 1E28B 2E7HA 2OTWB 2VO5A 3ZYOA 1FVDA 3T0EC 4XNYH 4PJEE 3V0VA 1AIFA 3HI6H 5HHVH 1U8NA 3NFNA 3WHE0 4B53A 4OUUA 4XGZB 1U3HA 3PNWA 2WIIA 2LAAA 1Q0YH 4XBGA 2I9TA 4P46B 4PV9B 3QIBA 1A6VH 3RA7H 1DBBL 2Z8RA 3VFNB 5HGHB 1ZTXH 5DRWA 4OM0H 3MQIA 4JLRA 2CXKA 4HC1A 3V6FA 1U8JA 4YHKH 1IEAB 3T65B 1RK1A 3LZFH 4CU6A 1OLLA 3IU3B 4YHPB 4KK5D 2HKHH 4QEGA 2WNGA 4UB0H 4WW2B 1DR9A 2V17L 4CW1B 2D9CA 1NFKA 1NGYB 1G7HB 4OD1H 5FGBA 1P1ZB 5ID1A 1MWAH 3ZT5A 2CDFB 3BH8B 3OJMB 1U92B 2Z31B 4HUWB 4O2FA 1U0QA 5JQ6H 2CGRH 4DZBA 5D7JC 5B38A 2IGFH 3HUJB 4PLJC 1UB5B 1LNUB 1A7PH 4JRYD 3BZEB 1U3HC 4NO3A 3TT1L 1TPXC 3WLWD 3PWLB 3P77B 5D6DA 2XWBB 4G6AD 3IDUA 1QRNB 4OKDA 1MH5B 4GQPH 5I8EA 1DCLA 3DVGA 3JWOC 3GRWL 3W0WB 4YHNB 5CP7A 2NZ9C 1VGEH 1R3LA 2V5TA 3RGHA 4NWUL 2A9NH 4G8FB 5C0IB 3KYMB 4RNRB 3OR6A 2NY4D 1BVKA 2J6EA 2Z9TA 3BFOA 4DN3H 1D7FA 3OKYA 4CVZA 3BH9B 5IVZA 1FNLA 3ARFB 5F9WC 1WCQA 3UO1H 3QO1A 4Z7OF 5D2NA 1JHLH 1E4KC 5HBBA 1FFQA 1SMAA 2YD4A 3IDXL 1A1NA 3BPCA 4O2EB 4WTXA 4WFFE 1X5YA 1YEDA 1A3RL 2Y07L 4HT1H 4ODVL 4UT7L 1JWSB 1SVZA 2ZNWA 2DD8L 1CFQB 3TBVB 4WEBL 1CGWA 5MEPB 4HGWA 2EIZA 1J18A 1N7ML 1I8KB 3PIQB 4PJCB 4V1DA 3A6BL 1CFVL 1I3UA 4Y2OA 4ZPVA 4QRSA 1RJCA 1RVFL 3V6BR 3Q6GL 2Q8BH 4F7TB 5C2BH 4WU5A 4KRPD 1MNUH 3PE9A 3O81A 3RTQC 3QEQB 5IHBA 5D2NC 4YHIB 1QZ1A 1S9YB 3CFDB 3K7UA 1F8TH 3FAWA 4N0CD 3MRHA 1YY8A 3N1FC 1CQYA 4HG4K 1X5FA 1YECH 1N6QL 1CXIA 1ERNA 3JZ7A 3BO8B 1YEKH 5L2JB 1DVFA 2AK1L 3TNNB 5GGQL 2RAMA 3CX5K 5JR1H 1KLGA 5H35A 3M17A 4Y4KA 1YEEH 3K0WA 3UTQA 2C4FT 3G6AA 3LRSB 3VGHA 3JWDL 3DRQA 3RGVC 1FVEB 4IBLT 5C0CB 4APQA 1E4XI 2FL5A 2NNAA 4DQOL 1BM3L 1J8HA 4RGNB 5IBLC 2VZ1A 5IJKC 1ZT4A 1IRAY 2MCPH 1QSEB 4YDLC 4NKDA 2VLKA 2NY2C 1CGVA 3ARGA 1MOEA 2VXVL 2QADC 1FYTA 1A6UL 2LFGA 3H0TB 4HXAL 4OBSA 1OY3B 2GJJA 3HR5B 2EO1A 2XQYK 3SOBH 1QKZL 3KJ4C 1T83A 5CJBA 3MLUH 4RMQA 3QDJE 3L5WA 1EBAA 4HHAB 3VXRB 3NACL 4KROC 4OLUL 3KG5A 2NCMA 3UPRA 2NXYB 3HAEH 1SY6H 2XXMB 4IRZL 3B5TA 4NZTL 4XPHL 2JF1A 3NBNA 1NBZB 4M8QA 3LMJL 1IAOB 4MA7H 5HD8C 2WQRA 3NCEB 1LO4L 2ZKHH 1TJIL 3EGSB 4PJXF 1EV2E 4APQC 3IT8D 1BQHA 4Y5VC 3THMH 1CDHA 1GVIA 2BZDA 3NFPB 4Z7UA 2HKFL 1ZHKA 3MCLH 1EHAA 3ARGC 5DTFA 2FX8H 5BOPA 5FDYA 4YNYA 1YMME 5SWZB 2FHBA 2HTLD 3OQ3B 3KWWA 5HDLA 3VXPB 4MQSB 2W38A 4PRPA 5C07B 1EK3A 4BQ9A 4R97B 1XFPA 4D94A 4B50A 3L3DA 1T83C 2G60H 4DWHA 4WHCA 1VKXB 1DDHA 3CFIC 32C2A 5C9JB 2VXSH 3QSKB 4ODTL 1DBAH 3DI3B 4JM2A 2AXGB 4JN1L 1JGLL 4MJ6B 3L3GB 3GB7B 2Z8SA 5HPOA 1LE9A 4L3EB 2I07B 3OGCA 3H9HB 3CAFA 2AI0H 1VFMA 1QNZH 5L7XL 3STZB 3IXAB 5ESAB 1CL7I 1T0NA 3ULUH 2E9WA 4PR5A 1U8KB 5K9KA 4JO4L 4PRHE 4NBYB 5GGTL 3SDAB 1UCTA 5LWYH 2VE6B 2O93L 1JYVA 2CLVA 1FZJA 3GSQB 4LSTH 3FFDA 1CU4H 2GCYA 3BPNB 3R06B 2NY1B 1ORSA 2BHYA 3AREA 2J5LC 4QHMB 4V1DD 4DFIA 3IJHA 4Z5RB 4X6EA 5D5ME 1JPFB 2GJ6B 2CUHA 4CKVX 3HE7A 1BZQK 3S88H 2D7OA 5EU6D 2BVEA 3EZJB 1D6VL 4BH8B 4N1HB 1AP2B 4WV1B 1ND0B 1GZQB 2DQEH 3S5LB 1PEWA 5DHVH 3B9VA 2BC4A 3LHPL 3TN0A 2RQ8A 1OAUH 3U7YL 1Q9OA 1XCQA 4Z8FH 5ITBL 5JHDD 5FO7A 4CVUA 3MXWH 4R0LA 1CE6B 1P4BH 5BQ7A 4PUBL 2Z35A 2P49B 1I7RB 4ZNCD 4LFHG 1DVFD 2CXGA 5F6HI 2R2BA 4I0PD 5SV4A 4HX1B 3OKNB 2P8PA 2FR4B 1BX2B 1KXTB 2X5PA 5EOTB 3MOQA 3IU4H 5GSVA 1OT2A 3HE7C 4GAGH 1C5DB 4OI7A 5HHNA 1GZPB 4MJ5B 2B2XL 2BNQE 3D3VB 4LVHB 3VFWA 2QQKH 2FHCA 1EO5A 4QRPE 3MNZB 4EI5B 3RZCC 2P44B 1MIMH 1VPOH 4F7CA 3EBAA 1MCPL 3KXFA 5CEZD 4YGVA 8FABB 3MV8A 3QWQB 1CIUA 1MSPA 2Z92A 3SKMB 5IGXH 2PF6A 1UJ3B 4BFIB 5FUOH 1TVHB 3TV3L 2FCBA 2Q6WB 1K3IA 4FP8H 1MLCA 3T09A 3UDWA 2R0KL 3P11H 5A2KH 5DVKA 3RU8H 1OTUC 1OAYH 5HHMB 1IAMA 1XIWB 5H2BB 1YYLL 2X1QA 4Y16D 2FGWL 1ACYH 1U8HB 1HI6B 1JYNA 4I3SH 1LP9F 4G8EB 2YC1B 3FO2B 1A3LL 3LDBB 1NFIB 1I1AD 3MV7D 3SE9H 2NTFA 3L5JA 1FNFA 3RFZC 1IL1A 3FOLA 4JFDA 4XP9H 1FE8H 2VISB 5FCSH 1JGDB 4KJQC 4BM7A 3MRGA 1BFOB 3C2SA 4QO1A 2BCKA 2VLJA 5IMMB 4XMLL 3UDWC 2X70B 3GO1L 1L6ZA 2E6JA 4DOHE 1JF1A 4MNQB 3O9WB 2GHWB 2RGSA 4PGDA 4Y5XB 1PBYA 4P5KA 4K7PY 4PPTA 2FATL 4OCYH 1WLHA 4NKIL 4U1KB 4PJAB 3IGAB 3S97C 5ESVA 5DURD 4JM2D 3TVMB 4GUPB 5E2TH 5F1OB 4GW1B 2IFGA 1KULA 5D7SL 3O3EB 4KGLA 4QXUH 5FB8A 1UCBH 4M5YH 3SN6N 4YWGL 2ESVD 1SMOA 2JIXB 3MXVL 1F3RB 4E0RA 3IRPX 4RFOH 3B2UC 3SGEH 5FYLL 3VE0A 4DGYH 3OMZA 2DB8A 2J8HA 1A9EA 2BSRA 1KYOJ 5TFSL 3BI9X 4N0FA 5TDPB 4UDTA 3F58L 1YEIH 3SCMD 2VDLH 2MOVA 3I9GL 5EUKA 4ZO7A 3WXWH 2A83A 2K9UA 4L9LC 4EUPH 5GS0D 1KT2A 5IKCB 4JO3H 1G7LA 1GOGA 1MFCL 4Y2DA 2YMXL 5ADPH 4Y19A 5I1JL 1ZANH 4HWBH 3MLRL 2JJTC 1Q38A 5I19L 2F54A 4OGXH 2AKRA 2P8LA 3LH2L 5DVMA 5EC1A 2DM4A 2IAND 4X6FB 4JM4L 1Y0LA 1F6AB 4HFWB 3TN0D 1FFPA 3F7RA 2HMID 1RV6X 1D5BA 4ZFOA 2EKSA 1V3JA 4K94H 4PTUA 1MQKH 4OZHB 5BMFH 4MJ2A 2YRPA 4L8BA 4E41B 1I7UB 3E3QE 2VXUH 2DM7A 5KVFH 4OZIA 4XMPL 3ISWA 3TEUA 4LDOB 1HHHA 1W0WA 3HNSH 3KNBA 4O2CB 3W9DA 3EYUL 4O9HL 3GK8L 1XZ0A 1RIVH 4XNUL 4Y2DC 3UZQA 4G8GD 1F2XK 1A7RH 4NQCE 1ZHNA 4NQXB 4EVNB 1X5IA 2XWJB 1M05B 5IQ7H 2DIAA 5KW9L 4JHWH 4U33A 5KBNC 4MSWB 2QHRH 4HMDA 1L7IH 4PJ8D 2IPTH 3V5KA 4FQQA 2G2RA 2O5YH 3QIWD 4U05A 3ZDYE 5JPNA 1FRGL 2BERA 4Y4FA 3BRDA 4DAGH 2KUTA 2JK5B 1PFCA 2C7UB 5MEOA 3BESR 1REIA 1NBQA 4PRAB 5D7IE 1BAFH 3ARBD 3NMEA 3QQ4B 1NBYB 5SWSB 1GGTA 5FOJA 1NUGA 2MNUA 4UV4L 3WNLA 4WWKB 3P73A 5GGUA 2X09A 3QXAA 4AL8L 1KGCE 3F7PC 4PG9B 5F7FA 2YPLB 4P4KC 5TDNA 4LMQI 5C0AA 3LQAH 4Z77A 2H26B 3QUYB 4JFXA 2XWTA 1KNOB 4PTTB 3WFDH 4MXQD 2RBLA 4MLSA 4JCLA 4LMQE 4PLNC 5B39G 3UJTH 1A22B 3FQTA 3P0VH 1UH2A 2EXYD 4ONHB 2ORBH 3AAZB 4PJBB 2NY3C 3KVQA 4JEGB 1T21B 5H94A 2L7UA 4U2YA 3D6GA 1VCAA 4JDZB 3G9AB 4JFHD 3PV7A 2R4RL 3QCTH 5DFVD 4FQ1L 1WCBB 4LIQL 1KXVC 2NY5H 3D25A 4R2GC 3SJVD 5BJTA 4JFQB 4HIHB 4MNGE 5T1KA 3O3BA 4NHUA 5IMKA 3OF6D 4ZDHA 4TSCH 4AM0A 4XP1H 4LHJB 3VRJB 5T33L 3GBNL 4XP5L 1MUJB 2DQHL 2EZ0D 4NQDE 5B3JE 4LEOA 2CKNA 3P0YL 1KV3A 2VMFA 3QDJA 1VERA 3A6OA 1NCCH 5T5FL 4LCWD 3VCLB 1UM5L 4RMWA 2NY0C 2Q86A 2YN5A 2Z4QB 1ED3B 5EIVA 5EO0B 2VKWA 1IAIM 4PJGE 3IFPB 3K46A 5I1DA 2HG5A 3OX8A 3U4BL 5D70L 2V2TA 2XTJB 4KI1A 4XCNA 3IDNA 4U1NA 3OR7A 4OQTA 3WEXA 1J0JA 5KSVA 5ICXB 1QQDB 4MCZB 3GUTB 5I1HH 5JXAL 4HXBL 3WE6A 3H9SE 4KKAD 2BDNL 1AI1L 3D87B 4D0DA 4KKCC 1O7VA 1CI5A 4NZRL 3G5ZB 4QXTA 3RIAF 1RZGB 3IFOB 3VXUD 1FBIL 4Q0XL 3P4NA 1RJYB 1DBBH 2N4IA 3BEVB 5EDXA 3HAEG 3L6FA 5DWUL 1AE6L 4GMTL 3Q6FB 2BVPA 1WF5A 3MA7B 3D48R 4OD3L 3ZTJG 5EUOF 2UV3A 4IS6B 1S7XB 5CINL 4M5ZL 5F88B 3QJHB 4OF7A 5FYKL 4NC2B 1NLDL 3GKWL 4FNLL 4RMUA 2AGJL 4GRMB 1P53A 4MHHG 3NCMA 3HRZB 2H6PB 2XTLA 4OT1L 1XF4A 1V8HA 4POZC 3TZVC 4M03A 1EGJL 1S7VB 4NT6B 1J05B 3WDHA 1KBGL 3G08A 5B8CA 1GPOH 4PRHA 3MC0A 3TT1H 3KPSA 4LPVA 4WFGE 3EOTL 3T4YB 5IBTH 3FQWB 1M7IA 3WYRA 5F71A 5IB1A 1ZT1B 1X6NA 1A4JA 4WHTB 3GRWH 4QRRB 5KVGL 4Y4FD 2XN9E 3CX2A 4JKKA 5C71A 4NWUH 1GGCL 3NIGF 5BRZB 2W65B 1NC2B 3LS5L 2R8SL 4JFEE 1J1OH 5KJRH 4S1SL 5ANMB 2VDRL 4ZFFB 2AJVH 1WWBX 3LKOA 4QHLB 1U8LB 1ZHLB 4CMHC 5HYJE 3EDJA 2UY7A 3GMPB 4D9LL 2YA2A 25C8H 3G6JE 3VJ6A 1EZVX 1B2WL 3ZDZE 4UT7H 1KOAA 2DD8H 2Y25A 5IMLA 2I9LB 2J8UE 3GMOA 2EDBA 5B8CC 4ZAKA 2D9QB 2FO1A 3K8KA 6CGTA 2VLME 3QHFL 1GGUA 5DLML 5LBSL 3TBTB 3P9MB 4IDLA 1FAIL 4CGTA 2VR4A 1M71A 2OP4H 3BSZL 3CJJA 3JWOL 1JPSL 3A6BH 4GXUN 2WBKA 1L9NA 1JWUA 5CSGA 3AROA 3DIFA 1NGZA 4XWGL 1UZ6E 2FJHB 1MJJA 3LEXA 2OSLA 5I16B 3Q6GH 4OSUL 5DHYA 5JW4R 4FQCH 4WFED 1ZA6B 1ZLVK 2YUXA 1HXMA 2ZOKB 3OAUL 1ZSDA 4QRPA 2ZUWA 1UB6B 2YEZA 3BGFB 3MLTA 3ZHDA 3IDJB 3ZE2E 4K23H 1N5AA 5IWLC 3EOBB 1CICA 4IOFC 3CFJB 2CMRH 5J1TC 3TCLA 4PJ5B 4ZAKC 1N3NA 4X6DF 3UZVB 3VRLF 3EO9H 3EYSH 2FEEL 4GKZB 4X9FA 1HILB 1I8MA 5JLZA 1RUQH 4I77L 3X17A 4JANB 1NFDB 2JE8A 3FZUD 2J88H 1J0HA 3TA3D 3IRZA 4EKXA 5I1GL 2J6EL 3QJFB 2G5BA 3UC0H 5AWNL 4QHNA 5IIEA 3O8XD 1Z3GH 3K8MA 2AK4A 5A3ID 1TXKA 1JRHL 1BOGA 4BSVA 3ARDB 2X4RA 3BMVA 2YPKA 4N0YH 5C6WH 1INQB 4IRJA 4C4KT 4P2OB 4ESKA 1EX0A 4KTDH 1ZGLB 2Q8AL 3QEGL 1I1YB 3MCKA 3WIFB 2N7AA 4GAJH 3CFEB 4XCYB 1D5XA 2X4QB 4GXVL 4NRZB 2OYPA 4JJ5B 2UUDH 1FL6B 1QKZH 4X7TA 1A6WH 4J23A 5DK3A 5F3BA 3VXOB 5KANG 3TPKA 3TYFA 2Y7QA 3EJZC 2PCPA 1INEL 4R4ND 5MEQA 1I7ZA 1YY9C 4NZTH 3TNMB 1QUNA 3LMJH 4FFVD 4JO2L 3RNQA 2OR9H 2AV7A 3EYFA 2IQAB 1YN7B 2YRLA 4PJ7B 1K4CA 3U30C 3ZE1F 3GSWB 4XNQA 4PJIF 3QEQD 5DJ6A 4KJWC 1TENA 3ZKND 2XQYG 3RVWC 1OAKH 2ICWA 1WAAE 4IRJC 2CDEB 4K8RC 3VDBA 4UNVA 1EEYA 1RIHL 1T80A 2E5EA 3H7BB 2EDEA 1OGAE 4JDTH 3SDXB 4JRXB 5ACMA 1MRCH 5J13C 3DARA 1PYWA 5GJTL 2NR6D 4XZUB 4LF3A 1Q72L 2OX5A 4P2QD 4U6XA 3I6GB 3L3HB 4N0UB 2NX5B 1CGSL 3BP5A 1GYAA 1FZOA 1D5IL 3RIAK 1N6UA 1XGPB 5K33A 5I73C 2O5ZL 4ZPTB 3QFDA 4PRDA 4O4YH 1DBJL 1PKQA 4M7KL 3ZKMC 1RJZB 3IDMB 2ZUQB 4R26L 2A6JA 4Z7WE 3JTTA 4LGSB 3V5HB 3GJFA 5CD5C 1HNFA 1A7NL 1IC7L 2XZZA 4LLMA 3RJDA 5CILL 2VSCA 3WLBA 2VZTA 3QBTB 1LEIB 3OKOA 4KRLB 4M6OL 4N0RA 3HAEB 1ODAA 3MJ8B 1F00I 1MFNA 2FJGA 1NCUA 2HLAA 5L7XH 1AD9A 4Y5YA 3M8OL 2ERJC 3BHBB 1FZKB 4PJFE 4G6KL 3D39B 4JO4H 4NQEE 5KSBF 4WI8A 5GGTH 1RIUH 3VRIA 5JW3L 5E8DH 1CGTA 1H15B 1MHPH 1QLFA 4MJIE 4YDKL 4RCAA 4X7CC 4M4RA 1MFAH 5ABDE 3L3OB 4ODWA 3WD5L 4FZ8H 4JQXA 5DRZA 2AV1B 3O2DH 3MCG1 2R69H 3OKLB 5D71H 2ZG3A 2JCCF 4GKNA 5FHBL 2RFXB 4WU7B 1B0RB 3DYOA 2BJML 2JLLA 4K3GA 5DK2B 3CPLA 5K9JH 1B4JL 1D3CA 2YS4A 4G8GE 3RKPA 4M62H 4TQEL 4E42A 1IM3B 3KPRD 5ITFA 4U2ZA 2IAMA 5HI3D 5J4MA 3FAXA 3HI1A 1IM9B 4KY1L 2GITA 2XA8L 4Y5YC 2Y36L 3LKQA 2XRAL 5IB2B 4H25A 3BN9C 3MRRB 1AQDB 1I3RA 2E8YA 3C5ZD 1U95B 5IW3A 2DM2A 2P24A 3C2AL 1WVZA 3VXQB 5GS2H 4QTIL 1KTLB 2PW2B 4LSSL 1FO0L 1U8QB 5FIEA 3U2SB 2FO4B 3VMPA 4DJMA 3E3QC 4JQXC 1Y6KR 4WIQA 2CLZA 1T2QL 1U93B 4HK0B 1SJXA 3DV4B 4GRLC 3QWOA 2ARJA 3TFKC 4L8SA 5DO2C 1BJMA 1AY1L 2ADIB 1DBML 3VD9A 1K4DA 3O4LD 1IEBB 2B2XH 5A16B 2L0DA 4G6FB 5IMOB 5GQBA 2ATKB 1F3DJ 3VXMB 2R0ZH 3TWCL 1A7QL 2IAMC 1INDL 4F15C 1MCPH 3GSNB 2DBLL 2BY0A 3CDGA 2C3VA 4TNVF 1EHXA 3LKNA 4BUGA 5C0BE 4HUXA 5I66B 2CK0H 5TF1H 3TYGL 5DMIL 4EIZC 2PTVA 4OAWA 1DQMH 5DRNB 1IGIL 2GTWB 2F53B 4OCNC 4RZCA 2DQCL 4X6CE 4A2LA 4L4TD 5I0DA 4HD9A 2KPNA 1XF2A 5K59F 1S5IL 1JN6A 4WHYG 3BGAA 2DJ4A 3QFJB 5TDOB 3QDGB 4L8SC 1SEBA 3ZL4L 2X4NB 2DQUL 4XTRD 1GCFA 1P7QB 4JG1L 4HDIB 4N0CC 5A43C 3TF7C 3ARZA 1G1YA 3UTPD 4BSWA 4K3JL 2ICES 4PV8A 1J1PL 1UQSB 2E9IA 4NPYA 4WY7H 4AQOA 4MB3A 2EE6A 5I18L 2NPLX 3MLPA 5D7JB 3QO0A 4XMLH 1R5WA 1CXLA 4MD4B 3U46B 2O5XH 1X5GA 2V5RA 4M6AA 4PJGA 1YJDC 2Z93B 4FQXA 2OZ4A 5HPMB 1P4IL 2FATH 4R4BB 2IPUK 3UTZA 5HHXL 4NKIH 3O3AB 1X44A 2YA0A 1FJ1A 3MR9A 1ZLSH 2NQCA 5GRYA 1P69B 1R3IL 1S3KH 4NSKB 2PR4L 3LD8C 4N90D 2DOCA 3ZHLA 4JZJA 5FK9A 1AXTL 1F4YL 4CU8A 4J4PA 5EG6C 4PGEA 1AHWB 3ZDXF 3WNNA 2QTEA 4G43B 1R5VA 5A40E 4NIKB 1VHPA 3O6FC 4YWGH 4MX7A 3OKKB 3LY6A 4YFLI 2D31B 3PUCA 5E2WH 2BVYA 5FYLH 1CZ8L 4LRNH 3LV3A 1K9TA 2IBZX 1FCCA 3F5WA 4M43H 5HHMD 3SO3C 3B9AA 2D0HA 4PRNA 3F58H 4NJ9L 4FQXC 1UWGH 5HGAA 3SDYL 4U1LB 1T0MB 5AYUL 4GKSA 4N8CL 1JGEA 3QIUA 4Q58C 3WNMA 1MFCH 3PWUB 3QG7L 1ZS8A 2YMXH 5DJCA 2J4WH 4TYUA 1UJTA 1PZ5A 4KJYB 4KUCD 4J4PC 2BY1A 4Q2ZB 4QY8A 2XICA 2XV6B 1D6EB 2OCFD 5ECJE 1JGVL 4RSVA 2JJSC 4YX2L 5IVNA 3LH2H 2NYYD 3CFCL 5C09A 1FNGA 5EO9A 5INCB 3D2UB 1T20B 1RJLA 2W60B 3IS0X 1J0ZA 1A6TB 3V4PL 2QL1A 3C08H 2Q1EA 2XN9A 5GJSL 4I4WA 4XB7A 1TTUA 5EN2B 1B6UA 2Y23A 4P9HH 4IOSD 3CCHB 2XKSA 4JFEA 2VAAA 5DJAA 3VW3H 5CJ5A 5LXGL 4XMPH 1OB1A 4X80L 3STLA 3KPOB 1VGKA 3LSOA 4ODUA 1WC7B 2AJSL 4R8WL 3GK8H 5GZNC 4G80B 1LO5B 3G6JA 2BVQB 4L5FH 1L7TH 4Z7UF 1G9NC 4I1NB 4D3CL 4OZ4A 5IUSA 1NANI 3SKOA 3GHEL 4NOBA 4ETQB 2J8UA 3BP4A 3WCYA 1BVZA 1PQZB 1M6OA 1DQDL 4DVRH 3DMMC 4F7MA 1DSFH 3ZKXC 1YQ2A 4PYGA 5FGRA 2MKWA 1EFXB 1EMTL 3C6SB 1AFVH 4G6JL 4F33B 5B22A 1KJMA 2GJZA 4TSBL 5EWIL 2HVKA 4WO4D 1WWAX 4GAYB 1RU9H 1U8MA 2CO6B 2B7DT 3EJYD 4PG2A 4HJGB 4UV4H 5FYKU 5IEHA 1F2QA 5DD5L 1BFSA 2X4SB 4AL8H 3GSUA 4HZLA 5IB4A 5SWQB 3K3QA 4KXZH 3LEYL 3TO4A 4ZYKB 3O2VL 4HJJL 3L5XL 4X7SH 5L88L 3CXDL 1IAII 5DK0A 1WFNA 4U3XA 4M3JA 5E6IC 4YDVA 1BBDH 1FHGA 4NKQB 1YYMH 3CH1B 2O61B 4Y5VB 4J1UB 3MODL 3BGMA 4GS7B 43C9A 5EOQL 4RISH 2FHFA 4KV5E 3H42L 3IS1X 2AJYH 2Y6SC 5IK3B 4ZFOL 2IBBA 1RHFA 4PRIB 1JP5A 1KJ3H 1QRNE 1UXSA 5J0BA 4TNVK 1AQKH 4LLVA 5DMGD 1CK0L 3W0WE 3P9LB 1T1ZA 3VXTB 3CUPB 2YUVA 2V9RA 4FQ1H 1MCOH 1JF6A 4P23C 1PG7H 1T6WA 1FDLL 1JYWA 2OBGA 4D8PB 3MRCB 4KZEL 4I0KA 2VDML 4L8DB 3VFPA 2W9DH 1R5IB 1P7HL 2UVFA 3IETA 2DLFL 5FOBA 4F7PB 3EDEA 5DJDB 2ITCA 3NAAL 4B0MM 2FYYA 3MGOB 5T33H 4XP5H 4P4RB 3OKDA 4RGMC 2VXTH 4OKVB 1C08B 5KOMC 1EBPA 4BFBD 2UWEA 3B9DA 3CZFB 4G9DB 4JN2B 4WFHE 1YMHA 3JWNC 4PJCE 5D6CB 4D0BB 5T1DL 2XZAL 1V05A 3MA9L 4Y16C 2IF7A 1H8SA 1OSPL 3V4UH 1FO0B 4AY0A 5IOPA 5KSAA 1HSBA 3ECBA 5IM7B 5D96B 1YC8A 4HKJB 3KLDA 5CJOL 4NHCL 4W6WB 5HVHB 2PXYC 3FB6B 2IBGA 5D70H 1BECA 5T1LB 3QEQE 2J5LB 4Y4HA 1WAAA 4M00A 4XWOD 3GSXA 4XC3H 3O4OC 4UU9B 2ZUXA 4NKMB 3MRJB 1WWWX 3OAYK 2EICA 1OGAA 3C8HA 1ZE3C 4NP4L 5CWSB 3V7MA 5IB5A 4XXDB 4JDVA 4X5LA 3OKEA 2VL5A 3MUGB 1GOHA 4M61A 4Q0XH 2RJMA 3QNYB 2FB4H 3Q5TA 3PGCA 3UJJL 4DCQA 3IVKA 2MHAB 4NRXA 4XVSH 2CDGA 2HRPL 3RX5A 3MZTA 4Z7WA 5D72L 5C0CE 5DMYA 4LOUD 5KSAC 1AGEB 1AO7D 5C3LD 3HMXL 1D5MA 5FYKH 15C8L 4FNLH 1LD9B 4RGNE 4ERSL 3HPJA 3FRPA 3KGRA 4M02A 4ONGL 4Y4HC 3PQYB 1QSEE 4J8RB 4CVXA 3VGAC 3DPBA 5FDWB 3W5NA 3B3IA 4UTBL 1EGJH 4PJFA 5GSRB 1SJHB 1EZVY 2D4FA 2K7QA 5C0GA 4NQEA 5FECB 1UWXH 3F8UB 2X1PA 4M1GL 3UYOD 4MS8C 4P59H 4MJIA 3RP1A 3O41A 3DVIA 4F9LA 5DJ8A 2VJXA 3VXRE 4WRLA 3V6OE 5KVGH 1KIQB 1HYRC 5I1LA 4UILL 3SCMC 4EXPX 1GGCH 3KPMA 1KB5L 4Y0GA 2BNRA 4M3KB 1X4YA 3ZT7A 2DWEB 4HIIB 2EDFA 5E24E 4S1SH 5IT2L 2VDRH 2XFXA 4EDWH 4HKXA 2XZQL 2ZCHL 4WJ5A 3GMQA 1WFUA 2H32H 2CR6A 5CUSH 2EDKA 3ALPA 4PJEF 3TO4D 4KI5D 5E03A 3CSYA 3O6MH 5F1KC 4KZDL 1MQ8A 1MLBB 2NLJB 2PO6A 2AW2A 5SWZE 3FB7B 5AD0A 1F4WH 1ORQA 5C07E 2MTPA 5EBLB 5CBEA 4D0CB 5JHLL 4S2SA 3I3EA 4NNXB 2MQ3A 1A8JH 1FAIH 2CD0A 3WXVL 3R4DA 2OL3L 3JWOH 1JPSH 4HC1H 5DRXB 1ZGLM 2BRRL 5F96L 3VWKA 3GMMA 4CMMB 1EXUB 2EYTA 3QUZD 3CXHJ 4JPIB 1CD1B 2NY6C 2BVOA 1UEMA 4XBEL 3CGTA 1UZ8A 4XX1E 2EDWA 1XGUB 4OSUH 3S4SG 1I1CA 2GFBB 3LEVL 5CZXC 3RKDD 4ELMA 2DYPB 3SDDB 4L3EE 5SV3A 4UQ3A 4BYHA 1YDPB 1NC4A 5I8CA 5I1EL 5JMRA 2AJXL 4JGUA 1YPZA 2VITB 2PO6C 1TQBB 2FRGP 1MAKA 1JV5B 3QZWA 4FQIL 5ACZB 4LLDB 1A14L 1CXHA 5I75B 4I77H 3EYOB 4YFDB 5TE4H 3VWKC 5BRZD 1GIGL 5I1GH 4OZIF 2J6EH 5BW7A 4JKWA 5ENWB 5AWNH 1KG0B 5D1QC 1JWMA 2GJ6E 4L1DA 5HGDA 3T2OA 1G7IA 3HLAA 4QWWC 1NMAH 3W81A 2XYCA 3NCYP 3C60B 2HJKA 4PGZA 3RDTC 4MXQC 4AIXA 2GTZB 3TT3L 5GRXG 2GT9A 4PY7B 5AAMA 1LK2B 5F93C 2I5YH 1AKJB 1G7QB 2V5MA 4QHUB 1GJIA 2EXYC 4J3SA 3T77A 1QO3B 4FQJH 4HW6A 3PHOA 3RRQA 2V7NA 2ZCKL 2HLFD 4LLWA 2K1MA 2VR9A 3HR6A 4LGRB 1S7RB 4XCCL 5C0EB 4IHOA 1H3UA 2EE9A 5E99L 4YLQT 1CR9L 4Z7VB 2C4FU 3QAZB 3VMOA 5BW7C 5FV2A 1QR1B 2APWA 2BHZA 1YNKL 4NQSA 1UM6L 2AJUH 1KPRB 4QXWA 4JHBA 1XGQA 2Q3AA 3OAYH 3BD5A 2C1OB 3D3VE 4N90E 3MBEA 3QDMA 1EHLH 2BFVL 4OI9A 4M7LT 1P84J 2EDHA 3DSFH 1RIHH 1N4XH 1EVUA 2JJUA 2AJZA 3KHQA 4XPTH 3REWA 4NN7B 2A77L 4GG6B 2EDTA 2FIRT 3E8UL 1AD0B 3FRUB 5I1IL 4YPGB 5GJTH 4KVCH 1Q72H 1X5HA 5LQBL 3PWNB 2FH8A 1CGSH 4OFYD 5HHME 1D5IH 4RRPG 2HA1A 3L7FA 2XACC 3VFGL 1GGBL 4IRSA 3HZMB 4M7KH 5FHAL 2QQLL 3DXAB 1B88A 1A7NH 1IC7H 2HT2D 1XCTA 5MHSE 3MRNB 4YXLH 2V6HA 4TPRL 4G9FD 1UKSA 3VG0L 1IGTB 1KENL 4ZUTB 4M6OH 2AEWA 3LIZH 2JB5H 3FT3B 3O6KH 3HCVA 3MBEC 3D85D 3X14B 4MAYB 1FN4B 4P4KB 4NDMB 3GJEA 1KB9K 2EEDA 1ZLUH 4HKBB 3V6ZA 2WUCL 1LO2L 2MQ0A 1HZHL 5KSUA 3ILPA 1W72L 1NCDH 3RVUD 5KZCB 4G42A 5I8OL 1RHHB 3PHQA 4X99A 4MNQE 1AR2A 2LABA 3QNZB 3QA3B 4IRSC 2M26A 3ELAT 1OCWL 2WBJA 4KKLD 4IOIB 5IJVB 5FKPB 5DJYB 3HPLB 3RUGA 5CGMA 1P9MC 2P42B 4PJAE 5DT1L 1OW0A 4NQVB 4PY8I 2BY3A 5K9QG 3PP3K 3RWJA 4PD4K 5AYQA 2OTWA 4NJAH 3HN3A 1JCKA 2FZ3B 5HYQB 1RK0B 2ITDA 3BEWB 2QEJA 4KY1H 1FORL 3WFCL 2XA8H 1BIHA 2Y36H 4KTEH 2XRAH 1NC4D 2VLRD 3BKYL 2P5WD 3UTTB 5J6HB 5E6YA 4P46A 4PV9A 5HGHA 4P2RD 4KPHH 4LSSH 3WMSA 5I71B 4J3WA 1DLFH 2NX5D 1IEAA 2X4PA 3QISA 3BISA 3T65A 2EDOA 5DSCA 4R90L 5BZDB 2WBJC 3EO0A 4RAUB 4ZO6A 4EI6B 4WW2A 5B4MD 2WMPA 4CW1A 2D0FA 1MIEH 1CDBA 1DBMH 3NGBB 2AS5M 3T0AA 1P1ZA 3BZ4A 3S36H 4FQ2L 4JFFD 3E2HB 3BH8A 3I3BA 2Z31A 4HUWA 4HPYH 3QT2A 3TWCH 1A7QH 1K6QH 3HUJA 3C6LB 1UB5A 1LNUA 4OLXL 3BZEA 5KAQG 4N8VG 1YC7A 5JPMB 1ADQA 3PWLA 3S4SB 3TPUB 3P77A 5LCVH 3TYGH 2XWBA 5DMIH 2DQIH 1QRNA 3MRLB 4KHTL 1MH5A 3W0WA 1IGIH 4WVRA 1C5BL 5J9PA 4G8FA 4HUVB 3MJ9A 1WICA 5C0IA 3KYMA 4RNRA 5FA4A 1NCNA 1S5IH 4E41E 3CVHB 4GAFB 3FHQA 4HMCA 1IVLA 1JI1A 2IH1B 4EBQL 4WW2C 1RUML 4ODHH 2ZOLB 5IEKB 1OAQH 4XI5D 3ZL4H 3OKMA 4PJ9B 2DQUH 5FO8B 3U6RB 5D1ZD 4HJ0C 5C0ND 1UKTA 4JG1H 1T3FB 2Z31C 3K81A 2XNAA 4I5BB 3I2CL 1U8PB 1JWSA 4X4ZA 2ADJA 4PLKD 1CFQA 2CUIA 2W9EL 4R7DB 3TBVA 4LPUA 3GNML 4E5XB 3GHBL 5E9DA 4OF8A 1UEYA 3TZVB 5DUML 5MEPA 5D9SB 3QQ3B 2FLRT 4Z7QE 1I8KA 1YMMB 4S1RL 1X5AA 4PJCA 3PDDA 1DZBA 5J1AA 4G3YH 3TA3C 2IBZY 1S9VB 3ULUD 2R2CA 5SWSE 4KKNA 5AZ2H 1BJ1J 1P4IH 4XNZC 4F7TA 5A3IC 3ARFC 3RAJH 3ZSSA 2YPLE 3DETC 3LN4B 4MD5B 3WHE1 5E70A 1RUPH 4YHIA 4PBWD 3QI9A 3CFDA 7FABL 1AXTH 3ARXA 1J1XH 2YZ1A 4TUOB 2VQUA 3AUVA 2YK1L 1DN0A 1KLFA 5L2KA 4XVTL 2A6IB 4B7IA 5L2JA 1FNHA 4LCYB 3TNNA 2E7BA 1SQ2N 4TNWF 1B90A 2IPUG 5F70A 1QFUL 3RWCA 1JNNL 3ES6B 3IDYB 4BZYA 4R4NC 3LRSA 4LLYB 2Y5TB 3HG1D 2ED8A 1FVEA 5C0CA 1YJDL 2VH5H 4NJ9H 1XF5A 3U4EB 1KELL 2AEQL 3V2AR 3C5JB 5EIIA 4N8CH 4IJ3B 3K1KC 3FB5B 2VXQL 3U1SL 1QSEA 1OQXA 4CBPA 5D5MB 4M6ML 1N8ZB 2XKUA 4YIQB 4IMLA 3K2UL 3JV5A 4OD2B 2HT3D 3NIFE 4XB8A 2L7JA 3H0TA 1JGVH 1TETL 3RWEB 5JW4Q 3CFCH 3MMEB 4OCSH 2NR6C 4FXKB 4XMKL 5D1XB 4IMKA 1QR4A 4LAQL 4HHAA 4KMLB 3VXRA 3T8XB 4WDIB 1DUZB 3V6OA 1SJEB 4OFDA 3CDCA 4G6ML 2EYSB 2HFFA 1PX4A 1NBZA 5LG1A 1S78C 1LVEA 5BS0A 1IAOA 5D2LB 5C08B 3PP3H 4HF5L 1QSFB 4FABL 1N6VA 1T1XB 4HPOL 3T2NL 4RGNC 3L3KB 2QR0B 2XTJE 5JW4N 2BRQA 3OPZL 4R8WH 2ZNXA 1W0YT 4KDWA 3NFPA 3NH7H 5EUOB 4Q9QH 5D7LD 4KI5E 4L3AA 2M8XA 1G6RB 2X9YA 4J3OC 1NCAL 1G9EA 1HNGA 5HYSG 5SWZA 1IQDB 1FVCA 3BQUA 2BXYA 3BYYA 1E6JL 1DQDH 1AJ7L 5C07A 1RAMA 5F9JA 4I18B 1VB9A 1MI5B 1MCJA 5EZOL 2EXWD 4ZXBD 3EFFA 3JV4B 4N9GB 3S8WA 2W0LA 5IVOA 5DJZB 2E6QA 1IZJA 3JV6B 3BAEL 4G6JH 3V6OC 4RQQB 5C9JA 4XCFL 2NXYC 4FG6D 4YDJA 1OWRM 3HNVL 4DZ8B 2WANA 2AXGA 4MJ6A 5DS8B 3L3GA 3GB7A 3HMWH 5EU5A 1IKNC 4RFNB 1KJ2L 1WZLA 3VI3E 4GH7B 2I07A 2LU4A 2DF3A 3FL7A 3H9HA 4I2XB 4JREB 4BKLA 3ET9F 4XP6L 1I3GH 5KTEH 3SGJA 4URTB 4S0SD 1CTNA 5L88H 1MFDL 3QULB 3STZA 3IXAA 5ESAA 3T1WA 1FGVL 4U6YA 3H9ZA 5MERB 4FFYL 4FTVB 3MODH 2QSCL 1T0PB 5EOQH 3SDAA 3UYRL 4R97C 2VE6A 2YBRB 3H42H 3D0VB 3QXDB 5EZIL 4IDJH 5E9DD 2VZOA 3GSQA 4UV7L 4ALAL 2CLRB 1CK0H 4QRRE 1OP5K 1LE5B 2X10A 3R06A 3MLXL 4MZ2A 1U8OB 4TUKL 1W72B 3BE1L 5I15H 5BRZE 1SM3H 4Z5RA 2VC2L 1JPFA 1I9IL 1FDLH 5DEGB 2NW3A 3FONB 1HYSD 3UJIH 1EJ6A 1CG9B 4BH8A 4PJDB 2VDMH 1IC5L 4WV1A 3BUYB 1ND0A 1GZQA 1UM4L 5HDQL 3S5LA 5B38G 2VZVA 4OCLC 1CT8B 2YKLH 3PL6D 3QB7C 3NAAH 2IADB 5EPMA 3QI9D 4NFDA 4OGAC 4OBRA 3ZDYF 4X9IA 4Z7NE 1FFRA 4NCC1 2VYRE 1I85C 1Z5LB 5DI8B 1KCKA 4P5MB 1CE6A 2FSEB 5AZEH 5L2KD 2H1PL 2VNCA 5D7IF 3RNKB 2IQ9H 3U0TB 1IGMH 2YA1A 2GK0A 1QP1A 1KPVB 2XZAH 3MA9H 3BPNC 3FMGL 4OV5B 3SGKA 4HX1A 3IYLW 3OKNA 2NY1C 3D0LB 2FR4A 4GSDL 1EUUA 1OSPH 5F1NB 2H2SC 5E6ZA 5EOTA 3V0WH 1C5DA 1GZPA 4MJ5A 3KPLB 5GZOC 4PGBB 4BFEA 4WV1C 4EI5A 1Q9WB 1F4XL 4KAQL 5CEZL 5SX5H 1YA5A 2UVEA 1OF2B 3SKMA 5CGYD 4RA0C 1UJ3A 4C54A 2VB5A 5I6XB 2OXHA 5KS9E 1TVHA 3AMLA 4PJ5E 1S8DB 2Q6WA 2D7MA 3HI5L 4EJ1C 3TJEL 1YEGL 2XG4A 1KFAL 4JRYB 5HGGS 3WUWG 1P6AB 4Z6AT 4KUZH 1XIWA 5H2BA 1HQRB 1NDGA 3UJJH 4TNWK 1NFDE 3T3PE 2HRPH 3SGKC 4HWEL 1AXSB 2H3NB 2ZSVB 4GRWB 1HI6A 2PTTB 4Z76A 4KHXH 3RHWF 3GRWA 1E4WL 3FOMB 4P9ML 2YC1A 5BS0D 1N0XL 2NY4B 3BD3A 3KR3L 5EO1B 1QTYT 3WJLC 3NCCB 3CFBA 2CUMA 2OJZL 5I30L 5C3TA 1NFIA 3I6LE 4LVHC 4BQ6A 1O7SA 1MRFL 3SDCD 1L9MA 4ONGH 1E4XH 3X13B 4EI5C 3WKMH 2AXHA 1DLHA 1RD6A 4UTBH 1XGRB 2DI9A 4KMTL 3NCFB 5B3JF 1UJ3C 4PREA 1BFOA 1YQVL 5E0QA 5IMMA 2X70A 4UT9L 3EDKA 1ETZA 1LO3L 4MNQA 3O9WA 1TTFA 1QFOA 1XIWC 4UILH 1BGXL 1CFNB 4PJGF 1KB5H 5HI4D 5ELIA 1Q1JH 1G84A 4U1KA 4PJAA 2YD2A 3IGAA 5IT2H 2GY5A 3FO9A 3DX7A 3MJ7B 3WDJA 4HS3A 2ATPB 3AM8A 4PJ7E 9CGTA 1HEZB 1I1FB 4GUPA 4X6BB 2FX7H 4OQTH 4OLYL 3QWRD 3VXSB 4GW1A 1LILA 2AABH 2YPVL 3O3EA 4KRPB 4HUMB 4N8PA 3EFDL 2BSED 3IFNL 5DZNA 1ZGLP 3ARYA 3QQ9C 4LBEB 2IMNA 2LAGB 2VLRE 4GG8A 1A9BA 3SDXE 4JQIH 1Z9MA 5JIKA 1KEGL 2VDKL 1BF2A 1IFHL 2IPKB 3MUJA 1NJ9B 1H9VA 2MQCA 4QRQA 4RAVB 4N0UE 2NX5E 2OL3H 5TDPA 5CD3B 3O9WC 5K9OA 1NGXB 3MRMB 5GPRA 5M7QA 3CDFA 5C0DB 4U4BA 4Y5XC 3C87A 5HYSB 3NOIA 4XBEH 3IDIB 5IKCA 1MCEA 2WWMD 3W39B 3AM8C 3LEVH 3TVMC 3GJFK 3VFSB 3SO5A 4LIQE 1TZHB 1BREA 4LSRL 4Q9BA 3O6LL 3GSOA 5I1EH 1EJOL 4AQ1B 1JPTL 4LVOB 4MNGB 3OBAA 2Z8WC 3FN0L 3OJDA 2Q7NA 4PRBB 1MJ8H 4HFWA 3G6DL 1GH7A 4NGHL 1BLNB 1LDSA 4CADA 2ZUYA 1A7OL 3BZFB 2QQQA 3MOBL 4OZHA 1A14H 1CE1H 1QBLL 4U31A 5TE6H 4OUUB 1I7UA 3WS6A 3EHBC 1QFWL 1H3XA 2IFFH 1GIGH 4F9PC 1KIRA 1GHFH 1UFUA 3U0WH 4O2CA 3RVVD 5DRWB 4HS8H 1P7KB 4JLRB 1JGUL 3AVEA 3C09B 3V6FB 1FFNB 3B8SA 3G6JF 4DGIH 1BD2D 4P5TD 4NQXA 4LQFL 1RI8A 2FX9L 3X3FH 2DQTH 5ICYB 1M05A 3ZDZF 2C9AA 4L9DA 2J8UF 3TT3H 3U82B 5IFAH 5KG9B 3TIEB 5GGVH 3ZYZA 1E27B 3MUY1 4WUUD 5CZVL 1DBKH 5ID1B 1FIEA 4H0GA 4MB5A 5DMGC 1DFBL 4PRAA 1NQBA 3DVFA 2ZCKH 5IW1B 5GGSA 4DZBB 3JUYA 3QQ4A 4XCCH 1NBYA 5SWSA 1AGBB 3WS6C 1UZ6F 4JRWA 2FECL 4QCIB 2XOTA 1V3LA 4PG9A 2YPLA 3DVGB 5IVXE 1QSZA 3Q1SH 4GMSL 3QUYA 5LGJB 2PYEA 4FHBD 3MGAA 3VXME 3ZE2F 1KJ2B 1KNOA 3RIFF 4PTTA 1GC1H 3DUSB 3W82A 4K3EL 5E5RB 2FDBP 4CVZB 3N0PB 3E8UH 4TOYH 1AGCA 5MP6H 1F45A 4HCRL 4NCC2 1JF5A 4ONHA 3MRFB 3EW3B 5TPWH 3AAZA 4PJBA 1W2KT 1T21A 4RX4A 2RCSH 2F53E 3I02B 4JDZA 3BRGC 4JVWA 3BKML 1QRKA 4LHQB 3R8QA 4JE4B 3S35H 3VFGH 1WCBA 5DVLA 1J88A 4AYFA 4WWKC 1LK3H 3QEHB 5FKAA 1NGWB 3QFJE 4MNHA 2EE2A 1KTRL 4JFQA 3HTLX 3LCYA 4HIHA 4TPRH 4C56D 4KVNH 2R29L 4ORZC 4V1DB 4XWOC 5GS1A 4ZPVB 4QRSB 3RHWK 3WUWB 1H0DA 3QUYC 3L7EA 3L5IA 4K8RH 5D8JH 5EU6B 1PW3A 3SQOL 4J3VA 3VRJA 2ZUTA 4RMSA 2VDQH 1MUJA 4LLAA 4WU5B 1WBZB 3N1QC 2JB6B 2QSVA 2F58L 1DTUA 2WUCH 1HZHH 5J12B 3RI5F 3NA4A 5GRJH 1U3YA 2UWEF 1MHHA 1OAXL 3VCLA 3KPPA 1QFHA 3MRHB 5JHDB 4UINL 2Z4QA 3EUUA 1ED3A 4OIBA 5EO0A 4BZ2L 3IFPA 1DVFB 4GQ9L 3J7HA 1KCRL 1B0GB 4I0PB 5DT1H 2J3SA 3BWUC 3G6AB 1A0QL 1QQDA 5ICXA 3PWPA 1WAAF 4WI6A 3GUTA 5IF0B 2KH2B 2X4TA 1QYGL 3RVXC 3FT4B 4OQ1A 5ICZA 3QH3B 3C5SB 5CCKL 5IHUH 2FL5B 2NNAB 3WFCH 3QUML 4ZTPL 4X7EC 1RZGA 3IFOA 5ALBL 1T04B 2YD5A 1CFSB 2FEDD 2FEEI 3BEVA 3NFSL 4AJ0A 4NKDB 5F7EH 4G7VL 3Q6FA 4LCCA 3MA7A 3N1MC 5F7YC 4Q97A 5ILTL 1S7XA 4Z7WF 4R90H 3CC5B 3BP7B 1OM3L 2AP2A 3GJFH 3QJHA 1UACH 3G5VA 4GRMA 35C8H 4Y16B 2XTJC 3HRZA 1JRHI 2H6PA 3P4LA 5BV7L 4A6YB 2EDRA 3TJHD 4FQ2H 2BP3A 4KI5C 5JTWA 2IMMA 1S7VA 4NT6A 2W1NA 4NZUL 2WQ8A 2X42A 4PJFF 2EH8L 1I1AB 1FNSH 3MV7B 4OLXH 4JR9L 3RL2A 5E7FA 1MFEL 3WUZA 5FO9B 5CJXA 2HT4C 1RZ8B 1ZT1A 2R0WL 3HFMH 4KHTH 5EU7E 4EN3A 2A74B 4WHTA 4QRRA 1CWVA 3O11B 3WIHL 1C5BH 3RWGB 4NFCA 1OHQA 3ZE0E 2R2HB 4JQVA 2W65A 4Y1AD 1NC2A 4YUEH 4F8QA 1U2HA 3KWWB 2R9HD 4UBDC 4KK6C 5ANMA 1S7TA 5DJ2B 3WNKA 4OFVA 4EBQH 1RUMH 4QHLA 1U8LA 1ZHLA 3VWJD 2BVTA 3GMPA 2HTKC 1ZT7B 5DURB 1M1SA 4JM2B 3I2CH 4LNVA 4XVJH 2I9LA 3MV9D 2P8MB 2PYED 3RY5A 3CIQA 4XNMA 5TE7L 5TH2B 4M7LL 2G75B 3TBTA 3P9MA 3QHTC 4K07A 2ESVB 4S1RH 5L9DL 3CLEL 1CLYL 1T7YA 5EFIB 3BPOC 4JQVC 1G0YR 5K9KB 3GBML 5E8NB 2FJHA 4XPFH 4WUKL 4YBQC 5F9AC 5I16A 1D9KD 3MLYH 2GK2A 1Z2KA 5CEXA 2ZOKA 4L3CB 4ELMF 2CLVB 1FZJB 4OZFB 1TQCB 1UB6A 1CLOH 3KLHC 2B0SH 4MA8H 3UPCA 5E08H 2Y72A 4QOKD 5HHOD 3IDJA 4A2MA 5F7WC 4IM8A 3EOBA 3K4DA 1YPZF 2YK1H 4PJ5A 4JZNA 3RIFK 1UWEH 3TH4T 4GKZA 1HHIB 3DNKA 1HILA 3IJSB 1YNLH 3LB6C 5EA0L 5CFHA 2IANB 4X6CF 4PRIE 4JANA 4HIJB 1NFDA 1S9XB 1KCSL 3TN0B 1OVZA 5DMJB 5LGHL 3QJFA 3MYJB 3NZHH 4MZ3A 3RWDA 3QHZL 4O5LL 5FO7B 5TF0A 3R0MA 1CLZL 5GS2D 3AS1A 4R0LB 4MD0B 4WI4A 3CLFL 1MFBL 3W11C 3ARDA 4H20L 4WI7A 2VXQH 2EYRA 2OM5A 3BGFC 3MPCA 1XH3B 4M6MH 4P2OA 2P8PB 3U7WL 1ZGLA 1J0KA 3PWPD 4H26B 4G8GB 4LKXB 4H1LB 1I1YA 5GSVB 3WIFA 3CFEA 4XCYA 2X4QA 5HDOA 4NRZA 4GKOA 1FL6A 4XMKH 5FGCB 3T3ME 4DKFL 3VXOA 4PJ8B 1AR1C 3ALWA 3QIWB 4PJHB 1P2CB 2QQNL 5T5NG 3FQNB 3KXFB 4G6MH 2IG2H 1OTSC 3MACH 3TNMA 4LASH 2OZ4H 2IQAA 1MVFA 1YN7A 3ARBB 3BKJL 4FABH 5T3XE 4MA3B 3ARDC 1T66C 3DTXB 3MNWB 4XNXH 5D7KD 3WN5A 4G7YL 3DYPA 4M6NH 1NSNL 3D9AL 4P2OC 3H7BA 5JDSB 5GISL 2R1XB 3SDXA 2C1PB 4JRXA 3V7AG 2NXZD 1AJ7H 3GSRA 3W5MA 3QDAA 4XZUA 3QCUH 5EZOH 3I6GA 2O26U 4LSVL 4N0UA 1A1MB 1IL1B 3B9KD 1XGPA 2D03H 3QUKB 4X6DA 4UIKL 3ZHKA 2ZPKL 4OIIL 1MELA 3GI9H 1JPGB 3V5HA 1R0AL 1UG9A 2BCKB 2ZCLL 5FV1L 2VLJB 4OTXH 1IGJB 1LEIA 2HN7A 1EVTC 1NLBH 5EU3B 3QPQD 2OTPA 1R3JB 1I8LC 1VFAA 3SJVB 3H3PH 3SY0B 4PGDB 4XP6H 3PQYE 1G9NH 4HIEB 4JKMA 4P5KB 4FFWC 3ULVE 1S7QB 3BHBA 1FZKA 1FGVH 3RQ3A 3D39A 4ZD3L 3WFBL 1WIPA 4D9QD 2F8VA 2QSCH 4HBQA 5EBGA 3CFKB 2A0LD 1CD8A 4GW4A 5E2VL 1H15A 1VFBB 1DL7L 3DI2B 4XC1L 5DGRA 5FAAA 4HLJA 4O51B 4ALAH 5CLTA 5FB8B 4NN6B 3MNVB 3MRDA 4LSQH 1PSKH 4I3RL 2DQDL 3BE1H 4TUKH 2ZUQC 2P5ED 5T1MA 2R56H 4LCWB 5C08D 1A6ZA 1T7XA 1VENA 2GAZA 2JELH 2CRZA 3RUGF 1B0RA 3VE0B 5DK2A 1WT5A 2DMCA 5FYLD 2R1YB 3T1FA 3R1GH 4AK1A 1HK6A 2D3VA 1HXYB 1IM3A 1KIPA 1OTTD 5HDQH 3QUXD 5J06A 5EUKB 1IM9A 2VDPL 5BZWA 5IB2A 3MRRA 1AQDA 1KT2B 3T0XA 1JBJA 1BMGA 4WUUE 3VXQA 3VG9B 1FGNL 1KTLA 2PW2A 3VDCA 1U8QA 5FYJE 4K7PH 4GBXD 4R3SB 1Z9OA 2H1PH 3U2SA 3QUMB 2FO4A 3IFLH 5CAYB 3VXUB 5JORB 3TBWA 4NWTH 3F7YA 4HAFA 1U93A 4HK0A 3DV4A 2L4OA 3O0RH 3PXHA 4WW2F 3DWTA 4ODSH 1QA9B 3Q2CA 5F89B 5A16A 4OGYL 4PTUB 5IMOA 2A6DA 2WUBL 3AY4A 2F5AH 5AG8A 4L8BB 4HFUL 3VXMA 1AH1A 1F42A 1J0IA 1F4XH 1CDIA 5HHPB 2IWGA 2XPGB 3HUJF 5E8OB 4ZS6C 3GSNA 5BV7B 3KNBB 3W9DB 3T0EA 4KV5F 2E7LA 3SKUD 5I66A 1EGJA 2E8ZA 3EDDA 1T7VA 1DEEB 2YRZA 1ZHNB 2GTWA 2F53A 3LS4L 3N1GC 5DRNA 2WSKA 3UTSD 5ETUA 5CKGA 5KSBA 2ZWLT 2H2PC 1NL0H 1CF8L 1DQJB 4H88L 3QFJA 2G2RB 2VZ3A 3MLVL