2AJUL

Cyrstal structure of cocaine catalytic antibody 7a1 fab'
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
216
structure length
216
Chain Sequence
DIVITQDELSNPVTSGESVSISCRSSRSLLYKDGRTYLNWFLQRPGQSPQLLIYLMSTRASGVSDRFSGSGSGTDFTLEISRVKAEDVGVYYCQQFVEYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY 7A1 FAB'
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajuL01
3ARGA 5HI3C 2X7LB 3BEWA 3OSKA 2AK1L 4E5XA 3HN3A 4JFOA 2XTLA 4R7DA 2FYYA 5BO1H 1FZOA 3PHSA 2VH5L 3HE6D 4NP4L 3P4OB 1FVDA 1T4KB 3EOAB 1CLCA 4LPUA 1RZKH 1XF2B 4PJBB 2FH6A 5F44A 1KCSH 3VG9B 5E08H 2VZVA 2YD8A 5CINH 4FQLH 4LFHD 3V5DB 3ARUA 2ARJA 3NFSH 4PR5A 3TO4D 1N59A 3ARDC 3HZKA 2QADC 2C4FU 1KCRH 1ACYL 3U4EB 4WW1A 5E03A 1KJ2B 5ECJE 3K46A 1F4WL 4LVEA 5AUMB 3RA7H 5DURB 3AS0A 1WIOA 3FO0L 1DBMH 3FN0H 1CDUA 5GGSY 1RJZA 5DFWH 1VFUA 3DRQB 4KKAC 5CJ8A 3PHQA 3L5XL 3QIWB 3WO4C 1KPUA 4RBPK 5AYQA 1LNUB 2FJGB 2XZQL 2LQRA 5SX4I 4UILL 1NMCB 3IDNB 4GKSB 3TN0B 5T33L 1I8LC 1UKTA 4HWUA 4KMTL 2HMID 4ALAL 2GK2A 4OM1L 4EDWH 1AD0B 5DJZB 3KPOB 3BKYL 4NQSA 1AE6H 1XF3B 3CNKA 3ZLQC 4M7KL 4XP4H 1UQSB 1JE6A 5FYJD 3QWOA 3VFOA 5HI4D 2A83A 1MFAH 1P2CA 3RDTB 4TVPL 5GHWH 5GGVY 1DLFL 5LXGH 4PJEA 5E4EB 4PRNA 4H0GA 2CSPA 4F9PA 1A9EB 3FO9A 1GGCL 1LO2L 4LIQE 1EX0A 5K9QI 2WWKT 3WS3A 1UVQA 3FCTA 2F5BL 3K2UH 3G5YB 1CVSC 3HE6B 2NY2B 4ZTOL 4XCYB 5J6GA 3GMMB 5F7UA 4ORZC 1WBXB 3O4LE 1RUMH 4YXHL 2BOCB 5HY9A 2J8UA 2X4UB 2QSCL 1D5ZB 1R3JB 4MGXA 4HG4K 3O4OC 3D48R 3MRNB 2CXGA 5CEXA 1IGIH 1KFAL 2DQUH 3MYJA 2XWJA 1PD6A 4E41D 4F57H 1JYNA 4NBZB 4X0KB 3G5XB 4RMQA 3TH3T 3KS0H 1QKZH 3E3QC 4FZEH 3IFOA 5IFHH 3U9PL 1UB6B 4NSKA 1OAKL 1BF8A 1QQDA 2HKFH 4EDXB 3MV7E 3P4LA 3N06B 1CE6B 4WUKH 1KTDA 3GBLA 5DJAB 2OTWA 1MVFA 1ED3A 2XWTA 3VXPA 1XR8B 3WIHH 2DL9A 3OB0K 5CIPA 3P9WB 2BXYA 1YPZF 1T1XB 4RISL 3C60A 4PP1C 2DQDL 5DJYA 1UACH 5I0ZA 2ADJB 2PXYB 4XP1H 4Y1AD 2P7TA 2DWDA 4NNXB 2ZG2A 3S36L 3BH9B 5CS7A 2BSRA 4QRRE 4KTDL 5EU7E 3L5WA 4U1GC 5TGBA 2J4WL 2FB4H 4F58L 1RZJL 3ECBA 3PGDA 1XR9A 2AJ3A 1T1YA 4CKVX 2NY4B 3VCLA 4DFHA 1E4JA 3H3PH 4AL8L 3GUTA 4HCRL 3E8UL 2P43B 5GSRB 4OBRA 4ZOBA 1GRWA 4UQ3A 2NXYD 4MXVF 1WZMA 1ZHNA 1D3CA 3EFFB 4WW2B 1AIFB 3HUJA 3MLSL 1FFOA 1GH7A 5AG9A 1U36A 4LLYA 3WKML 2FEDD 2QEJA 1W72B 5CZKA 3WFHB 1ZT7B 3BJ91 4LVOB 4LAJH 1XGUB 3LKNB 3VXUA 3Q1SL 2WSKA 3VXRD 2E9JA 4MD0B 1PY4A 4E41B 4GAYA 2WW8A 1CLYL 5EO0A 4PJ7E 4APQC 1OT2A 2BNQE 3M1BB 3KNBA 4L4TA 2OI9C 4QHNA 1INEH 4BZYA 3I75B 4UB0L 1TZIB 3CJJA 4GXUM 3O45B 1OSPH 3NIFF 1W2KT 5DMIL 4P23A 4PS4H 5HDQL 4BH7A 3H7BB 4Y2DC 1FE8H 1G7PA 3CDGA 4WY7H 3GBNH 5T3XD 5K59F 5CEZE 1BWMA 4HX1B 3CCHB 5F8QC 2E7LA 4G42A 4Y1AB 1FVEA 1F11B 4KAQH 3BO8A 4OCYH 1WC7A 1NMBL 2DQFA 5C0CB 1YEHH 5KSUA 3QUMA 4KZDL 5AZEL 1MI5E 1NGYA 5M95B 1J9CT 4CRPA 2SEBB 4G8GB 1I4FB 3G5VA 4LSTH 5HBBA 5J1TC 1SJEB 5FOBA 3A0OA 4ZOAA 4RQQB 1JHKH 4PYHA 5FYLH 35C8L 4LAQH 1I3VA 3QDGB 2EDFA 4M61A 4HMDA 1FAKT 1HOCA 3BGMB 3S5LG 2GITB 5ILTH 3EKCA 1F97A 4N8CH 3RVXC 1HQRA 2LV4A 4JRXD 1V3JA 3GMRA 1JF1B 1MRCH 2ICEB 5IVXA 4I2XB 2E7BA 5SWZA 1RIUH 1I7UA 1Y6NR 3O9WC 5DJCA 3RU8H 3S36X 1LK3H 2ESVD 1RULL 2E6PA 1FFPB 1YMHB 3VXRB 2GSGA 3GI9H 4WV1C 5KS9F 4HLZH 2O5YL 1FPTH 3LN4A 4LQFH 5E6IB 5EUKA 3SPVB 5K9JL 4WEBL 1G9NL 3B3IB 4U1SA 3K81A 3MRBB 2YEZB 2P8PA 2MTPA 5DD5L 1JP5A 1MCOH 3ZKQD 2ADFL 4X6DA 2R1XB 3D2UD 4PJDB 1J1XL 5FM5O 2FBOJ 1F13A 5D9SA 4CVZA 1IARB 2DQEH 4PFEA 5A16A 3IJYA 5BMFH 2WK2A 3LEYH 4OI9A 4H88L 5F88A 3S5LA 3QFJA 4DW2L 1WGOA 1L7IH 5CCKL 4L8SA 1SYVA 2AJVH 1EVUA 1KENH 3PP4H 1FJ1B 3ARXA 1SVZA 1A0QH 1I7TB 5DGRA 3WIFB 2VIRB 3MRIB 4JRYB 1JPTL 4MAYC 1NGWA 1U3HC 3HZVB 4QTIL 2ZNXA 1WCQA 4F80A 4AM0A 3MV9A 5D1QC 3DXAB 1N3NA 1ROWA 5BRZA 2APBA 1DUYA 3QH3A 4WI4A 4LL9A 4X6BA 3RWHB 3T09A 2G9HA 3UPRB 1DJSA 2LU4A 3WS6C 1Z9OA 3QYCA 3HS0A 4ZS6D 1Q9LA 4WFEE 3VFGL 4HF5L 2BVOA 1OB1B 3WDIA 2AKRB 4MA3A 2X4PB 2ZUSA 2Z0BA 3EO1B 5T1DL 5IF0B 4W81A 4XH2A 4Z95L 3ZDZE 4TSBL 1CDGA 4KJPD 3SO3C 3V0WH 3BKCL 3M8OH 1UKSA 3O2VH 4UIMB 3S35H 2HJKA 4MJ5A 3DBXB 1RUPH 1UCBL 4ORGB 2YPLD 4HKXB 3O2DA 4WTXA 1IC1A 3WMSA 1KF9B 3P30L 3D2UB 1GGBL 2WV3A 3B9AA 3EZ8A 4NGHH 1CI5A 5EA0L 2HKHH 3THMH 3IFPB 3UC0L 3B2UC 2A1WH 4TUJA 4M9PA 3PWLB 5DJ0B 3BFOA 4DN3L 2LVCA 4LIQH 5ID1A 3D39A 3HE7B 4PJEF 6FABL 4NC1C 3MRJB 2BRRH 1GC1H 1JNHA 5D7LB 4U6XB 3RZCB 3ZDXE 1HSAB 3IKCB 2FBJL 4IIQA 2OP4L 3CIQA 3D3VD 3PQYA 1WBYB 5FYKU 5C9KA 3PL6D 4XBPA 4OQTA 4UU9B 1KG0B 3CC5A 2ICWA 4HULB 4PBXA 4M7LH 3FB7A 4L3EA 2FJFB 4RWYL 5LQBH 2J8UF 3LOWA 4JREB 4RCAA 3VD3A 3RI5F 4ZUSA 4WVRA 1NBVL 4I0CC 1MCRA 7FABL 5CJOL 2IC2A 4OLYH 5F96L 1T3FB 3WN5C 5EU6D 1G0YR 3DYPA 5F72S 3IAPA 1N0XL 4A6YL 2NTFA 5D2NC 3PG2A 1YUHB 4D9RE 3V7AG 1EJOH 4K8RC 3LEXB 4DVRH 1CE1L 4YUEH 4NM4H 1TLKA 3GSNH 1E27A 1ZVSA 1OL0A 3NZHL 3KDMA 4PREB 2ICES 2X9WA 2YPLB 3TBWB 3NIGF 2DBJA 4FP8H 5HVGB 3WLBA 1AGCB 1CCZA 3OR7B 1J0HA 2RJMA 3GM8A 4XPGL 2APFA 5I1CL 4LCWE 4KGLA 2V9TA 4M1DH 5IW3A 3E6FA 5T3ZH 5KTEL 3HC3L 2OYPA 1A1OA 5FA4A 3ULUL 5BCAA 4XI5C 4YQXL 3ARTA 5GS3A 1OTSD 3KPSE 2BSSB 3C5SB 3NZ8B 3BP4B 4A6YB 4UTAH 4WIQA 3CXDH 1JUFA 2NY5H 3UTQB 3D18A 2VDNH 2FD6H 2EO1A 2HRPH 3MREB 3KYMB 3O3AB 5EBMB 3HI5H 2XG4A 5GGUA 3UCRA 5TQ2L 5GSVA 3K4AA 5CJBA 3AS1A 5IW6B 3W82A 4D94A 3RVUD 3V4VL 3QEQD 5CZVH 1CGSL 4IRSB 3HUJF 2EC9T 5L9DL 2I5YL 2XOTA 1WAAE 5T1MA 4DGVL 2Y23A 2CLVB 1T83A 4PGJA 5DQ9A 4L1HA 5EU6B 1LGVA 5HHVL 3STBA 1XGRB 5ADOL 3VW3L 5D70L 2NY6C 1HHJA 3UJIH 3W9EB 1TZGL 5DEGB 1CR9L 3PDDA 4YGVB 2IH1B 4YXKL 1GOFA 3FQUB 4TRPL 2F53D 1I9RH 3ZSSA 5GRUH 5D96C 3BEVA 2Q7NA 4P4RB 3KYOA 1CK0L 3GRWH 1NGZA 4YLQT 3T2NL 3QDMB 1KB5H 2ZUQC 3SCMD 4G5ZH 4LPXA 5E24E 1TJHL 3IJSB 4L5FH 2X1WL 4G80A 1U42A 2P5WD 5CJXA 2R0ZL 4U6TA 2VLJB 4PJXF 1ORQA 4KK6C 3TNMA 4HIJB 3BIBX 5FKPA 4AH2A 1ZHLB 1G6RH 1IGTB 5E95B 1XGTB 5GJSL 1LE5A 5JXAL 4YHPA 4ZAKC 1ZEAH 4R90H 2ARJQ 1EEYA 2PR4H 3CVIH 1JGVL 1UZ6F 4EVNB 1OAZL 1BX2A 4HH9B 2NXYC 3IXTB 4LCCB 4IOIB 2APWA 3OBAA 3CXHK 4LNRB 4AY0A 4X6DE 3E0GA 4Z7WE 12E8H 2GK0A 4S2SA 3VWJD 3MACL 1KV3A 1JPFB 1AH1A 1HN1A 2IMNA 1HWGB 1RZIB 3GSUB 4JM2A 3QT2A 5E99H 1XFPA 1CG9B 3RWDA 1F6FB 3V6FB 1MRFL 2A0LD 5CAYB 3I2CL 1UJ3A 3W11D 3BQUD 5IVXF 4XBEL 5GRXG 1N8ZA 4QXGH 1BIIB 1RIHL 3SE9L 5HHXH 1YEIH 5F21B 4CU6A 3JTSB 3RWJA 1CFVL 1KELH 4QXWA 4I48A 1L0YA 4K7FA 4RFEB 4OGYH 4N8VG 3CFDB 4XP5L 1E6JL 4X6FB 4F7TB 5BRZE 2IAMA 3NBNA 1EXUA 5B21A 1R3KB 5FA3A 4QHMA 4XPHL 3X3GH 1OT1A 3OKEB 2HTLD 5J7CC 2VISA 4X6DF 1OF2A 4ZDHA 3T8XB 5JPNB 5DQJA 2APXA 4IMLA 3VXMD 1A02N 4KKBD 1DEDA 3OAZK 1R3HA 2H32B 4QRPB 3UP1A 3DWTA 3OXSB 4RWHA 4MNQD 5E9DE 4N0RA 2MQ3A 5C0GB 1BMGA 3HR6A 1QVOB 4TULH 5IBTH 4PPTA 2WUBH 4WU7A 4NFBA 1BD2D 2LTQB 3ET9F 2HFGL 3VH8B 1U91A 1FORH 4Y2OA 1SQ2N 5TE7L 4TNWK 3QNYB 1PVHA 4I18B 5KSAB 2PNDA 1H3XA 2LU3A 3BPNC 3F7PC 5ITFB 2CLZA 1IE5A 1EK3A 3SJVB 4N8VA 3NA9H 5ISZA 1CD9B 4KQ3H 1H5BA 1KN2L 1F3DJ 5H94B 4ZXBD 1HNGA 2AJZA 4TTDD 3QEUB 3CLEH 5DUMH 1CBVH 4D9QD 1YNLL 2RQ8A 2IGFH 2R2HB 4JN1L 5KVDL 3D39E 5ESVB 4XRCB 5IW1B 4K71B 3KJ6H 3MLRH 4UAOC 3R4DA 1FFNB 2UVFA 2JK5A 2ZSWA 2BVPA 3DVIA 4GAGL 3RWFB 3PV6A 1X6NA 4NHUB 4YBQC 2NR6D 4P5TB 1PBYA 5H8DA 1DEEA 1P69B 1NC2D 4P3CH 2UY7A 5ICXB 1A5FL 1I8IA 4JPVL 3CFJB 3SDCA 2DQIL 1Q9KB 2EIBA 5JO5B 4Z7QF 4G9FB 2EDNA 1KSRA 1J12A 5FV1L 3OJDA 1F4HA 4CUCA 1AGEA 1WWBX 3B9KA 4DCQB 1FNHA 1QA9A 5I17A 4J1UA 5HGDB 4NQDA 1YQVL 1QFPA 3ULUF 2EEDA 2YR3A 4KI5D 2GY5A 1K5NB 3VXSE 4LPCA 3HI1B 2A6KA 2F54D 1UZ8A 1G9EA 4HKJB 3QULA 1UM5L 5ICZA 1KXVC 1BD2B 4FFZH 1QFWI 1JZ4A 1NAKL 1D5MA 2OTUA 3UTZA 4FQQA 2HFFA 4X99B 1C5CL 3ABZA 5C2UB 3DECA 4JQIH 3WFZA 4XP6H 1I3RB 4KK5D 4RFNC 5LKNA 3SO5A 5HHOD 1ZS8B 2AJYL 3LV3B 4JY4A 4KKNA 5I8EB 4HUUB 1E28A 2NZ9C 4PJFA 4NNPH 1SBSL 2VSDA 4HWNA 2DJSA 4KJPC 1S9WB 2PYEB 2FECI 2BNRB 1FNEA 3FO1B 5IMKA 4R26L 3C8KB 1JI1A 3BRDA 4C56E 1T03H 1E4WH 2CO6B 2DAVA 2RCSH 3HC0B 1SEQH 1GGIH 1NGXA 1RK1B 4HC1L 1AO7D 4UDUB 4LEOB 3L3IA 1JRHL 4PIRF 3U36A 3VFWA 4OZIA 4PJCA 1A6ZB 4OZHA 3BKJL 3UTSB 5HHPB 2GY7B 1YNKH 4KVCL 1LO0L 3KXFE 1X5HA 4U1NB 3ULSA 4KDVA 3O8XC 4K3JL 4XPAL 4ELME 4W4OC 3L7FA 5FHAL 2WAHA 4TOYH 1QYGL 5CILH 3NFPB 4YEFA 4CN1A 1FAIH 3QXUA 3UPAA 1VENA 2E3VA 4HUNB 1I7ZB 1C12B 1I3GL 1GC1C 1X5JA 4TSAH 4ZO8A 4NPYB 2FEEI 1CU4L 4MS8C 4JPWL 2ED9A 1RU9H 3P0VH 4YHML 3E2HC 3VXTA 1U8LB 2F54B 1NAMA 1I8KA 3INUH 4JZJC 4K94H 4JVUA 3O4OB 2RHEA 4PG2A 3RUGF 2X10A 1V05A 2FX7H 1WT5A 5TDPA 2CMRL 2N7BA 4JHWH 4Y4KA 2Y5TB 1ITBB 3RKPA 2EDEA 4F8TA 4F2MA 3J8F7 3MUGB 4OCRL 4Y0GA 2VLKD 2R0KH 4E9LA 4I8DA 1OM3H 3MGTA 1UADC 3SDAD 4I77L 3P11H 3B8YA 3U0PB 2IG2L 1U2CA 4MCZB 1RHFA 2WIIA 4O2EA 2AK4B 4HJJH 4Q6IB 5GS2D 4JANB 4UOW0 1BGXH 4K3HA 3W5NA 5J8OA 2D7MA 5HVWA 2YWYA 1DANU 4PGBA 2P8MA 5B4MD 5BW7A 1RJYB 1AO7B 1PZ5A 1PFCA 3FOLB 1MNUL 3T4AA 1TETH 4LLAA 1EVTC 4N0FA 4QO1A 3P77A 2MSPA 3QFDB 4EXPX 5K9OB 1RUKL 4BKLB 5I8CA 4YHLH 2KL6A 1NCWL 2OS7A 1M7IA 2KKQA 5E2WH 1KIPB 1AGBA 2ZKHL 4ZNEA 4ZTPH 3NIDE 3S4SB 1OTSC 5EBLB 1KTKE 4MCYB 4P59L 3U7AA 1KNOB 3PGCB 4BQ8A 1A4KB 1X7QA 1EAJA 1CLOH 3HTLX 3BKMH 3UPCA 1IM9A 1MIMH 3V4PH 4CMMA 1P5VA 3P4OA 3A6BL 3TA3C 3VRIB 1D6VL 1IGFL 1F58H 2OTPA 1XF2A 2IANA 4X9BA 1X5XA 1NCDH 4FFYL 2NPLX 1KUMA 3AM8C 5MENB 1KN4H 5D1QA 2VDOL 3C5ZD 4WI3A 3U4EA 3OKKB 1G7IA 4BZ2L 1KJ2A 1N4XL 3UDWC 2OZ4H 4JM2F 3FTGB 1AQKL 1N6VA 4HFUH 5DJ8A 5AUMA 1T1WB 4YDJB 2O5XL 2PTVA 1FYTA 3BD5A 5KSBE 1LP9B 1B0GB 4YHYC 5IESH 4J7RA 4KVNL 4YDLC 4CVXA 3QIWA 4Y2DB 5SWSD 3VGBA 3VXOA 2X9XA 1ERNA 5L0QC 4LFHG 3WHXA 5C9JB 2FSEB 5D8JL 2V9QA 5ANMB 4DOHE 1NEZB 4XAKE 1J8HB 3TN0A 2WZPD 4PGCB 3P73A 4Y5YA 1QOKA 1GOGA 2F5AL 3SCMC 4L4VB 3N1GC 4IRJD 2VKXA 5HTSA 5DJZA 3KPOA 4JR9L 4QRQB 1YMMB 4F33B 1UQSA 2CKBL 2XIDA 1I3UA 5GS1A 2CDEB 5DA0B 1DL7H 2D0FA 1SY6H 3RDTA 4J6RH 1T89C 4XCCL 1A6VL 2AEQL 3CFKB 5C7XL 5IWLC 5DRXB 1B90A 4FMKA 5JQ6H 1YJDH 1TVHB 1A14L 3G5YA 4KJWC 4NWUH 1N0LA 3Q0HA 3VWJC 3HE6A 3WNNA 4YDIL 5D7KE 1EHAA 5E7FA 5E8NB 2XTJD 3QO0B 3IFNL 3U4BL 1WBXA 5ETUB 5DK2B 3GNMH 4POZD 2BOCA 4UT7L 3WUWG 1F90L 3RP1A 4MJ6A 4XMLL 2X4UA 1R3LB 3V8CA 4FABL 3X3FL 1LMKA 3TO4A 4P2RB 4K3DL 1NFDA 5DFTA 2A0LC 4YPGB 3W11C 3BQUC 4JG1H 2NTSP 4LKCB 4HQQL 3MCKB 4ZS7H 2CKBB 1NL0L 3MRNA 1B2WL 5GJTH 4GXVH 3O3DB 2J6EA 5D7IE 2RFXB 4CU8A 5BV7H 2R4SL 1MF2H 1U93B 3EOYG 4L8CB 4LRNL 4X0KA 5D7SH 1HILB 3P40A 2NZIA 3K0WA 4KDTA 5SWSB 1JFQH 3SE3C 2X09A 5D1ZC 2BNUB 4U6YA 5D2NA 5BZDB 1OAXL 3ULVE 1CE6A 4OZGE 1N26A 3I6GB 4Z7VA 1I9JH 3DX7A 2HTLC 3QCTH 1XCTB 1XR8A 4NZUH 2AJXH 1ITCA 4QNPE 2DB8A 2YKLH 5ELIA 2W60B 2OL3H 2Z35B 5B8CC 3L3OB 4XCEB 1QBAA 2C7UB 4MQTB 2FATH 4E0RB 3Q5TA 3K7UA 4GMSL 3WUWA 1AKJB 3JTTA 2QQLL 3MNWA 1FIGL 3O6LH 4JHAL 4Y16C 5K9KA 1QFWM 1A9BB 5C0AE 2ADIB 4IDJL 1GOHA 2H2PD 3V79C 2OQJB 4J3VA 5JHDD 3DVNB 4QHKI 4JFDD 2A2QT 3DROB 3QQ9D 3G04A 4HXAL 5FAAA 1Q8MA 1GZPA 4OZIE 3D0LB 5BO1L 5F3BA 4OZHE 3ZKXC 4YE4L 5GSRA 2A74B 2YWZA 5F1OB 3IKKA 2X4SB 1T0NB 2EE2A 3EFFA 3EYUH 3QDJD 4ZXBC 3SO3B 1AIFA 5E08L 5F9DC 1HCFX 2P49B 3UZVB 1W72A 4G8EA 3WFHA 3QG7L 1ZT7A 2M8XA 2CDFB 1MJJA 1KCRL 4LSPL 1XGUA 4PJFF 3LKNA 3O6FC 3DV6B 3SDXB 1MFBH 1HKLH 4MD0A 3JV4A 4Z7UF 4I4WB 4E41A 2W91A 5GZOD 3QQ4B 4QGYA 3KJ4B 1TTFA 3T2OA 4HZLB 4Z6AT 3HFML 3M1BA 2NW3B 3QHFL 4BFGA 2AAVA 4OF7A 1RURL 3MA9H 4F37F 1OARH 3JWOH 1NANH 4JB9L 3RHWK 5E70A 3C9NA 1VFAB 1QSFE 5JQHC 4K8RL 4PJCF 4FQXD 4NRYA 4OZHF 4CGTA 3UTPE 1HHGB 3LQZB 4M1GL 4JFPA 1AE6L 4HX1A 4J3XA 4E42B 3ZYZA 4MHHG 4M48H 1X5FA 4BSVB 5L8JB 4Y1AA 5JPMA 3C08H 1F11A 3ARSA 4LVNB 1MFAL 1MCDA 5GHWL 1SJHB 5C0CA 2VLME 4YHOH 4M1CD 2SEBA 1I4FA 4JFDB 4KV5E 5L2KB 3ISWA 3MA7A 4JFEE 1MIEL 3V5KA 3CVHH 3WN5B 5HPMA 2CUHA 1NBYA 5DK3A 5E8DH 2YUZA 2N1KA 2NNAB 1RUML 1IEAB 3GIVB 1FNFA 4S1DD 4RX4D 1Z9SA 2FX9H 5E2TH 3KPNB 1JF1A 5MHSD 4KUZH 5EU3B 4I2XA 2R9HD 2C1PA 3GJEB 1FZJA 3FQRA 2O26U 1QLRA 2I60L 4HHAB 1FFPA 3PE9A 2VLRB 3MCLL 2BSTA 3VXRA 2VOTA 4I3GA 5KG9B 1IGIL 2DQUL 1PJ9A 2E7MA 4PV8B 3MRBA 4F57L 4PP2B 4PLNC 4GW4B 2GT9B 3BP7A 4N9GB 1DQMH 4PJBE 4UT9L 3QRGH 5I1IL 2C4XA 5AG8A 2HKFL 3VJ6B 4KV5F 4JHBA 5ID0B 2MWCA 3D85B 4PJDA 4WUKL 3GHBH 4HDIA 3BHBB 3DMMC 3O2WL 5DA4A 2BCKB 1YEJH 3WIHL 5JDSB 3FONB 4N1CA 3WHE1 3MLWL 4WI2A 3L3DB 5EOQH 3MXVH 4FQIH 1E4XH 5EIIA 5BZWA 5T1LB 3SDDC 1UACL 1IEHA 3B9EA 3CH8A 4NKOA 4XAWL 1FJ1A 1I75A 1C7SA 4K94C 1H3PH 1I7TA 3BZ4B 2AQ1A 2XA8L 3MGOB 2VIRA 4RMSA 3N1PC 4PJHA 4KRNA 1KBGL 4RAUA 5ESQA 5CWSA 5E8OB 1RZ7H 3VRLE 2AERT 4PB0H 4LHUD 5D72L 1MAMH 3RWHA 2PW1B 2VL5A 1YC8A 2NY6B 3SDAC 2XQBH 1KJMA 2X1OA 3DETD 4JRXA 3IF1B 4MQ7B 3U9UB 2H1PH 1A7NL 4G7YH 2OJZL 3F6IA 1MLCB 1T7ZA 2JB6B 5IF0A 2ESVA 1I1AD 3F7RA 5E5UB 3DHJA 1UWEH 3OKLA 4XVTL 3UAJD 3MRHA 4NJ9H 5EIVA 3LKSB 2BC4B 5GISH 1HYSC 4Z7OF 3JXAA 3PWPB 2C5DC 1J86A 1N2RA 1UENA 3S34L 5BOPA 4OGXH 5EWIL 4OFPA 3FZUD 4KROD 4HKXA 1ZT1B 3M17B 4OSUL 1XCQA 4EI5C 4R0LB 5EZJA 2W9EL 1BAFH 4U05A 1INEL 2ATPB 1QLEL 2VITA 3D2UA 3U82B 3L7EB 1WK0A 4X7CC 3MJ7B 1FZKA 4PS4L 1JGEA 3IFPA 5FYLD 5C92A 3CSYB 2HLAA 4QHLB 1FE8L 3PWLA 5DJ0A 3QQ3B 4DN4L 3C2AL 4M00A 3GBNL 4TVPE 3QHZL 3FT4B 3BX7C 4GAJL 4UOJA 2O61A 1EMTL 5KZCD 2AP2A 3MRJA 3NCJL 1WZ1H 3MLVH 3TBYB 4KAQL 4OCYL 1YEHL 5F8RC 1U92A 3F12A 2WNGA 3MX0A 2A9ML 4LSTL 1JZ7A 1Q1JL 1T6WA 1KGCD 3OB8A 4UU9A 3ZTNL 5M7QA 2W07A 1FL3B 2O93L 1AXTL 1NANI 5FYJE 4J3WA 3CFBA 3R8BB 1NFDF 2OSLB 1ZVYA 3B6SA 4N8CL 1X5ZA 1WIPA 2VABA 4PRAB 1K9TA 2EKJA 4M93C 5B3NA 2YOCA 2ITDB 1P53A 1YUHA 3P0YH 5C3LD 4XHJD 4RMTA 3KPRB 5C0FB 2GAZB 5I75C 3RVVC 3ULVH 1OAYH 4WI6A 1DFBL 3RGVD 2Z9TA 5J3HD 3LKRB 1U8IB 3U30C 2ERJC 4G43B 4PREA 1JTTA 3TBVB 2YPLA 2F8OA 4KROB 3TBWA 3OJMB 4Z7VF 4YFDB 4G6MH 4AIZB 5GGRA 1HXYB 5IFJB 1MCOL 2NLJB 2XNAB 3OR7A 2Q7YA 3HCVA 1RI8A 5DEFA 1S7UB 2Y9RT 5DFVD 4P3WA 2R29L 4PJAF 3LQAH 2JF1A 3B9VA 2DQEL 4P2OC 2PETA 3OR6A 2KH2B 3LEYL 3C5SA 3X13A 5I8KL 1MREL 4JFXB 5C0DB 4TNVF 5EU5B 4O02H 4POZC 5JIPA 1NUFA 3TC9A 3TH4T 3D3VA 5IBUG 1FDLL 3PL6A 3QO1B 5D6CA 1QEWA 3MJ8B 3KYMA 3O3AA 2IQ9L 5K93A 4LSRL 1AI1H 4N90E 4R7NA 5JTWA 3ZT7A 1LILA 4Y1AE 3X11B 2XWBA 5IEHB 1EEQA 3W39A 1P6FA 2MQCA 2N56A 4N5EC 5C0CE 3MODH 5EU6A 3G6DH 1XGRA 5EUOB 5AD0B 5JUEH 4WDIA 3VWKD 2P47B 4G8GE 2BZDA 2KQMA 1FG2B 1E4XI 1YA5A 1BM3H 1EERB 4U7SA 3IDMB 3W9EA 4X4XB 5HJ3A 2IH1A 3MRLB 4F3FA 3FQUA 4FN0A 4PJ9C 3VD4A 3V0WL 1QO3A 3OGCB 1HHIB 3QDGE 4QWWC 4ZFZA 2NY7H 3S35L 4P4RA 4NCC1 2VE6A 4L4JA 3QDMA 4HT1L 1EGJH 3WLWD 3ZT5A 3SHSA 2DLFL 1A7RH 2DICA 3O4LD 4RBPH 3TBSB 5DMKB 4XP9H 2Z31D 3IJSA 1AD9B 5D2LF 4AMKL 4JFQB 1JL8A 2W0FB 4I2XE 4OLWH 4XC1H 3NPSC 2X40A 1YNTB 4NGHL 3GJFH 4MXQC 3DSFH 2IADB 3Q3GB 1S9VA 2UUDK 5LGJB 5FKAB 1ZHLA 3QQ9C 4M8VA 1XGTA 2BFVH 2VXQH 1T04B 4HW6A 3QA3A 2YUWA 5DVKA 2AABH 3GKWH 4YHIA 1N6QH 5E00B 1LWRA 4KTEH 2EYSB 4Y4FD 3BMVA 3HPJB 1WJ3A 4LCCA 1GC1L 1GGYA 5I0DA 1D5BA 3MV7D 4QOKE 4PJDE 3R8QA 5E2UH 1S7RA 2R4RH 1JPFA 5F1NB 3EOBA 2P1YA 2VRAA 4JY6B 3H9HB 1RZIA 3K8KA 1N5YH 2FO1A 1CG9A 2OBGA 3T3PF 2EKSA 2EH8H 2Q20A 1ZLVK 3QEQA 4M7LL 4I3SH 3V6FA 4F7MA 3CUPB 1GIGH 3GFUA 4CAGA 5DJXB 5JZ7D 4NBXB 1XGYH 4QKXB 4OLYL 1U3YA 3T77A 1OOAA 3JTSA 3MYZA 2JTDA 1MEXL 4JRYE 2ZCLH 1BVZA 4QRRD 3D9AL 1R5WB 2UV3A 4FQXC 3G9VA 3DXAE 4X6FA 4W6YB 1MCSA 2F53A 4F7TA 3U1SL 2YXMA 2VWEE 1R3KA 4ZUWB 2VC2H 1HQ4A 2ZG1A 4G6AD 3GSNL 3KYNB 2BMKB 5CHNB 4ZUUA 3ZMRA 1X5LA 1PG7L 3QI9C 2Z92B 3E2HB 3SCMA 3T8XA 4PJDF 5D71H 4JZJB 2P5WA 5GS0D 1C08A 1P4BH 5I15L 2H32A 4QRPA 1YY8B 5JW4Q 3OB0H 4M1CC 3OXSA 5KSVB 2AK1H 4M1DL 5GGTA 5T3ZL 3QPQD 3PV7A 4HIHB 1N6UA 4B5EA 4L9LC 4NP4H 1ORSB 1E0OB 3QWRA 4RGOL 1DANT 1TCRB 1XGQB 3S35X 5DJ6A 3PIQB 4UTAL 3VWJA 4I18A 4PJHF 4XB7A 1HXMB 3HB3C 1A3RL 2VDNL 1FO0A 5DDHB 2HRPL 43C9B 1UG9A 1B3JA 4L8DB 3QZWB 2R9HC 3GSNB 4P3DA 5DVOA 4YDKH 3HI5L 3U0WH 4QRTB 1LDSA 2H26B 2QV2A 3KYAA 4YFLI 5EULV 3FO0H 2FCBA 3BQUA 3OXRA 2G75B 2ZSVB 4FXKA 5CZVL 1FH5L 1P4LB 5CEZD 1OHQA 3O11A 3L5XH 5D7LE 4BYHA 4H8WC 5E1AB 1T0MB 3O41B 3S37H 3ZTJH 3GMQB 5C07E 3NFNB 4HIEB 4PG9B 2XZQH 4NHUA 4NN6C 4QTHB 2X9YA 5T33H 1MI5D 3BD4A 5ICXA 5GIRB 4ALAH 4ZUVB 5DZLA 3LZFL 4KQ4H 2WM0A 3BKYH 4X4YB 2YN3A 4X6EB 2V2TA 5IHZB 3T4YA 3IDJA 4M7KH 2GJJA 4GQ9L 1FNSL 3GRWL 4QLRA 3IJHA 4ERSL 3TA3B 2DTML 4U1MA 5B8CA 3VXMA 1DLFH 3ARQA 1J0ZA 4WI7A 3RL1B 3HAEG 3MUJA 4WJ5B 1GGCH 1LO2H 4YDVB 3QUXC 5F3HA 1K5NA 4U1JB 2KBGA 3ARYA 1D5XB 4HKJA 1G6RL 4HXBL 3MROB 5C0EA 3SGKC 1PYWA 2XV6B 4ZTOH 4JRWA 3VFRA 1BD2A 3ZKMD 4PJ7B 4Y8DC 4Y5XC 4X99A 2PR4L 1PG7X 3OWEA 1RV6X 1T22B 1R5IB 2R0LL 2QSCH 5JXEA 3RBSA 1I3RA 2XZZA 3EZJB 4GRWB 4M6MH 1QBBA 2G2RB 4M7LT 4YO0A 3LV3A 5L0QB 4Q2ZB 3QUYC 4HUUA 1ZWIB 3VFVB 3B4NA 1ADQA 2VXSL 4HWZB 3GHEL 3F5WA 3UAJC 3TVMC 1KFAH 1S9WA 1CL7H 3T0WA 3RVTD 3MNVB 1JYWA 4X7FC 1K4CA 2AW2A 1IAKB 1U8PA 1C16B 1OAKH 3FZUC 4DUVA 2W9DL 5F7KC 1RK1A 1P7QD 5DTFB 4LEOA 5T5NG 3HAEA 3TYGL 4OCXH 1G6RB 3ARBD 4DZBA 3N1MC 5A2FA 1P84J 3ZKSD 5HHPA 1NC2A 1OSZB 3GSWB 3EUUA 5IJKA 3GSXB 4HIIB 3WNLA 3MFGB 4RISH 3WCYA 1BBJB 3X3GL 4XNZC 2XPGB 3FQTA 2V2XA 4NCDA 3NFPA 5I73C 3FQWB 3H3KA 5ICYA 3RJQB 4O00A 1I7ZA 3TZVB 2R1WA 3S36H 5B38G 4WFED 5JA8B 1S5IL 4NPYA 3E6HB 2J4WH 4F58H 3I9GH 1E4KC 3QXAB 1RZJH 4WUUB 2F54A 1H8SA 2WBKA 3OJVC 4JZOA 1M1SA 3QEHA 1KJ3L 3JUZA 4AL8H 1QSEB 5IBTL 1KLUB 2WUBL 3E8UH 4HCRH 3BH8B 5HDOA 1S7QB 2GUOA 3QDME 4NM8H 3TT1L 1G7LB 1DBBL 2IEPA 3G6AB 4DEPC 1CDCA 2Y5TA 1F6AB 2BVEA 1MCHA 3FFCB 3WKMH 5D1ZB 2H8PA 5A2KH 4P57B 4ZUTA 2VLJE 4MNGA 4NT6B 2B2XH 3LRSA 3NA9L 2W92A 4KQ3L 2OXHA 3MLUH 5GPRA 1P9MA 4Q6IA 3CLEL 2XYCA 5DUML 1CBVL 4U4BA 4JANA 3EYQD 1D6EB 3AXLB 2EDTA 5CLWA 3DYOA 4JFHE 1AP2B 3MLRL 1P7QB 1RJYA 2PN5A 1AO7A 1CFTA 1GCFA 3T0VA 5B38A 4UB0H 4HPYL 4YNYB 3FOLA 4RA0C 2YRLA 2EYTB 3KR3H 5FCSH 4JY5L 3QFDA 2NX5B 5HDQH 1JZ3A 1T5XA 4BKLA 4HUWB 2A77H 4S0TD 4YR6B 4WO4C 5J9PA 5HGAA 1BJ1H 3OF6D 3TWCL 1JV5A 5EBLA 2Q76A 4WGWB 1KNOA 1NMBH 1A4KA 1BQHB 4JDVB 5F6IC 5AZEH 4RNRA 1TJGH 1BEYL 3REWA 4YHZL 5FEBA 3ZSTA 2DQGH 2A6DB 1D9KC 4KRPC 3BP5B 4CW1B 1S7TB 4D9RD 1QR1A 3LIZL 35C8H 4OLUL 1BHGA 4G9DA 2A73A 3H9ZA 4AEHH 2OR7A 1UYWH 1VB9A 2VDQL 4Y4HC 3LKQB 1BFTA 3N50A 5JIIA 4P2QB 4HPOL 5J4MA 4HK3N 3HG1B 4NYLA 3OKKA 4ZFOB 2ZUUA 3TYFB 5K9QG 1T1WA 4QRPE 4YDJA 4C83B 1B0GA 2AI0H 2IPUG 3O3BA 4WHCA 4C57C 2EZ0D 2ZP0T 3BAEH 3QNXA 4LCWD 4S1RH 3F6LA 5K9JH 1HK6A 1T2QL 1J1OL 1V3KA 2FJHB 4Q9QL 2ZOLB 3VRJA 2D3VA 4HWBA 1AR2A 1GL4B 2AV1A 4DZ8B 1NC4D 4PJ8D 2ZUYA 4X8XA 3KPSD 3WLWC 4XGZB 1GPOL 1T03L 4PGCA 1GGIL 1D7FA 2JJTC 3T0EB 2Z31C 3CFEB 3SJVE 3GMLB 5LAXA 2FO4B 1YMMA 1VGKA 1J1XH 4ZPTA 1A1NB 4M7ZB 1YNKL 4FQ1L 4GG8A 4WGVB 4OLVL 1NCAL 1PDKA 1U8HB 4WU5A 1QP1A 3IU3A 4H88H 5HDBE 4DW2H 2DD8L 4TOYL 5DRXA 4G6FB 4ZSOE 1FAIL 1V7ML 1TVHA 3MBEC 4N0UB 3QUMH 3EO9L 5E5RB 1A6AB 1CXEA 1MCWM 4OKVB 1JPTH 4TSAL 5CSZA 5BQ7A 3TFKC 4QTIH 1CGVA 4Q9RL 2PO6B 5E8NA 3P0VL 3QO0A 3VFMB 5CUSL 3I85A 5ETUA 3SQBA 5I18H 3INUL 4K94L 2XQYG 3WJJA 4MDJA 2H3NB 4G9FE 3OKNB 1PZUB 4V1DB 5F9AC 1JN6B 4KY1L 2BX5A 1NGPH 3BVNA 3C5ZA 1LEIA 4LKCA 4AJ0A 2ZPKL 3VFGH 5FM8A 3VI3F 2J5LC 1CICD 2RFXA 2DL2A 4LLVA 1INQB 2CRYA 5F1IB 2IPKB 3SE4C 4MB4A 2R0KL 4LCWB 4TSBH 1OM3L 5I66A 3C6LB 3P11L 5EU7C 3STLB 2JCCB 5SWSA 3OGOE 1EHNA 2WP3O 1TPXC 4PJ5B 5BZDA 2PUQT 4K07A 5D1XC 3GGWB 3SGJC 1UCBH 4PJ8B 1G7JA 3RAJH 1Z6JT 4J4PC 4IRJA 4X5WB 4OQ1A 2OK0L 5TJWK 2W1NA 2W60A 3QRFM 1GGBH 2Z35A 4HKBA 5GS0C 1TETL 1L6ZA 4I0PD 4FQCL 2ATKA 5EO9A 5F9JA 2X89D 4E0RA 3X14B 4Z77A 4GW1B 1AKJA 2P8LB 4DN3H 2BOBB 2PYEE 3DV4B 5F89B 2BNRE 2V5MA 3GK8H 1A9BA 4IS6B 1F3JA 3FFDB 4GOSA 3DROA 1S78D 4HJ0C 4LF3B 2FBJH 1TNMA 2OP4H 1H8NA 3X12A 1FN4A 4DWHA 5EOCH 2EDHA 4C4KT 5I1GH 1MIML 1MJ8L 1G6VK 3QUZD 3KPMB 3UTSE 3OHXB 5BS0E 4LSUH 3MRPB 2DJUA 2X4SA 1T0NA 1TMCB 4G8IB 1F58L 2JIXB 2QQKL 1WWCA 1AGDB 4RWYH 5C2BL 5BRZD 4JFZL 1HHKA 4CN6A 5I19L 3DX9A 1AXIB 1KN4L 3D87B 3RWCA 2R23B 5IHLB 7FABH 5CJOH 3WJLA 2AXJA 3SDXA 1DQQB 5IT2L 5IMMB 4EI5B 2BY3A 3BN3B 4KI5E 4HFUL 4XPBH 1J0KA 4YHKH 4OZ4A 3FB5A 1U8JB 4HZLA 1QLFA 1JNNL 4UT6H 1CE1H 1MOEA 2HVJB 3HI6H 5E9DD 5BVPH 4BZ1H 1XIWD 3EJZD 3BZEB 3ZDYE 5IVZB 1KOAA 2N4IA 4ACPA 1IC4L 3C09B 1G7MB 5EO1B 4R4BA 2CPCA 1HHGA 1DBAL 4XPGH 3LQZA 3QPXH 4MMXC 4LOUC 3TP4A 1FLRL 4NJAL 5I1CH 4P9HC 4E42A 3LB6D 3GSQB 1X9QA 5FGBA 1DN0B 3PGFH 3HC3H 1MLBA 2AK4E 3ULUH 3ARGC 5I16A 3GEWB 1IGCH 4YQXH 1SY6L 1SJHA 4S11A 4J6RL 2JJUA 4S1SH 2AEPH 5JHDA 1JGDA 4JFDA 3H7LA 3OMZA 3D39D 3TBTB 1XEDA 2WP3T 4AIXA 1AO7E 4KI5F 1G1YA 4LDOB 1YJDL 5DVLA 3FT3B 3OAZH 3VI4E 5I74C 4NWUL 3FB8A 4P0DA 1WWAX 5TQ2H 1HH6A 2P44B 4OQTH 5DR5H 3SBWA 3GIVA 3QDJA 5FK9A 4CMHB 1MHEB 2V7NB 4Z7NE 1MELA 1CGSH 2YMXL 3Q6FB 2PTTB 5EU3A 5T5NF 2IBZY 5C0IB 2I5YH 3Q2CA 4PRHB 4JO2H 1I1RA 1DBKL 1B88A 4HHAA 4HKZB 4JG1L 4LKXB 3NVQA 4ZS7L 5GJTL 4WWKB 5ADOH 5KG9A 3VW3H 5D70H 2WQRA 3WNMA 1TZHA 3ARBC 5J06A 5I1KL 1TZGH 4PP2A 1KCVH 2GT9A 4YXKH 1TCMA 2VO5A 4TRPH 3MUZ1 4N9GA 4U7KA 5D7SL 1S7VB 3H6JA 3VXSD 1S8DA 1IGYB 4P99A 3VJ6A 1RHHA 5I76B 5MENE 3RTQD 4XTRC 3T2NH 1RPQA 3D85A 4FQXA 5ID0A 4KGJA 3QCTL 2BCKA 1TJHH 3NAAL 3BGAA 5D7JD 5JDSA 1F6LL 2R0ZH 3PJSB 4JG0L 4GAFB 5TE6H 1CGUA 4ZPVB 2PCPB 1LP9E 2OL3L 4WRLA 1VEOA 2EIDA 2EDDA 5T1LA 4QRSB 4F9PC 5GJSH 3VFNA 4XVSL 1XZ0A 5JXAH 1T2XA 1MHHB 3O6LL 5MERA 4X7SL 5JW4M 5E6ZA 4JZNB 1F4AA 1WBZA 3MGOA 1LO4L 4HH8A 5ANME 5IK3B 1J8HE 1OAZH 3HR5A 3RY5A 4KXZH 4L4VE 5E8OA 4YBHA 4C56D 1JWUB 1GHFL 4QHKJ 4BM7A 4L9LA 8FABB 5FM4A 3MACH 1YMME 3RNKB 2PW1A 2FR4B 1K2DA 3HZMA 5FGCB 3UZEA 2XY1A 2M26A 1WV7T 5CP7A 1TJIH 5SV3A 4FFVD 1BZ7B 3KXFD 1FSKC 3PWUB 1MLCA 4XX1G 3GSRB 2JB6A 2ED8A 4XBEH 4UNVA 1Y0LB 3TLRA 1YN6B 3SKOB 2P5EB 2E5EA 2OL3B 1EIBA 2BRQA 1RIHH 3KWWA 3SE9H 3ZE1F 3ILPB 3Q5OA 4CVUA 5BVJB 3BGFB 1H3GA 2BC4A 2DIJA 5DD1H 4LHUG 1MFBL 4P5KB 4P46D 3NPSB 4P9ML 3MSPA 5IV2A 3D0VA 3IRZA 4I9WE 4X4MA 4U2YA 4XP5H 2B39A 5C8JB 1Q94B 2QBWA 4XPHH 3MA9L 1L9MA 2XQYK 1OARL 3LH2H 4P2RE 5L7XH 2YD6A 4JPIB 1W0WB 5FYKE 3RWEA 2E8ZA 4I5BA 4NQEE 4EUPG 3C60C 3MJ7A 1ETZA 5ENWB 1J87A 3SGEI 3MLYL 2YXFA 4ODWB 1X5GA 5HGHB 1KPRA 5IM7A 1MQ8A 2X5PA 1DQJA 2C1OA 3FT4A 1NBZA 2XZAH 3IFLL 5DSCB 4M48L 4ZOEA 3TBYA 1Z5LA 2DI9A 1YDPB 2EXYD 4FTVE 2JJSA 2LABA 3V6OE 1ZA6B 1DVFD 5DD6A 4HK3J 4XVJL 5ERWA 5A40E 5TE7H 3QNZB 3GZKA 3G6JA 3SGKA 5EBGA 1QFOA 4KMQA 4LHUA 1RUQH 3MRMA 4MA7H 1FL3A 4HEPG 1CN4A 2MMXA 2NY0D 1CFBA 3RIFF 1ZA3B 4HV8A 3ARED 3CVHL 2IFFL 1JIBA 1KN2H 5E8DL 1CGWA 2EZ0C 2Q8BH 3BXNB 1A7BA 4L29B 1YNLH 1IEBB 4JN1H 1T7YA 5KVDH 3KAAA 4PRAA 1I1AA 1FC1A 4EUPA 1OW0A 2G5BB 4PJIB 3RRQA 2BK8A 1EBAA 3RX5A 3W9DB 4NNYB 2GAZA 3WXWH 4GAGH 3DX6A 3T04D 3LKRA 3UBXI 2R2BB 32C2A 3ETBF 3ROOB 3DO7B 4H8WL 4JPVH 4P23C 4PRIB 4AIZA 3IVKA 1BJMA 3EHBD 1QPXA 3TIDB 2F8XC 4LLQA 2D9QB 3L9RA 3O3UN 5IFJA 1HXYA 5HHNB 2XNAA 3QXTA 1IM3B 2DMBA 4GKOA 3CVHB 4LSSL 5KVEH 1KYOJ 1VERA 2KPNA 3GHBL 3AUVA 3SDXE 2E7LC 1YEJL 3DVGB 3LRHA 1YQVH 3T3MF 1IKFL 2HLFD 3DX8B 2P45B 3RPIA 3DURA 3FHQA 3MRGB 2MCPL 1J11A 3BW9B 4JFXA 4U31A 4MA8L 1UM5H 5EU5A 2J88H 3MUY1 1F4XH 4QXUL 1RJLB 2VNCA 4HSQA 5TH2A 1NAKH 1H3UA 3QO1A 4YPJA 4X98A 5ACLA 4HUVA 3LKOA 1C5CH 2VTFA 2ZCKL 2E7HA 2XKNB 5DUBA 4WCYL 4XAKD 4EEEA 4YFEA 3MO1B 4Y88A 1CICC 4D8PA 2UYLA 4D0DB 4IRZH 4NN6B 2IBGA 5KJRL 1SBSH 3MRRA 2XQBL 4X6CA 2F9BT 3L1OL 1Y18A 2H1PL 3L5IA 1FBIH 5EUOA 2WWMD 5AD0A 1LK2A 3SDXF 5T1KB 4BFBD 2IWGA 1A1MA 5L2KE 1QFHA 4R2GC 1UWEL 5DC0A 4HC1H 4X4XA 4NWTL 3MRLA 2D9CA 3RGVA 4NJ9L 3UO1H 1JRHH 5GISL 2IH3B 1F5WA 4TUOB 3OGCA 1FCGA 5EH1A 3F7YA 1SEBB 4KVCH 3JV6B 3RIAK 5D7KD 1MVUB 3TBSA 4K3JH 4XPAH 5EB9A 1H0DA 4JFQA 1SMOA 4QY8B 2W0FA 5FM5M 1T20B 1QYGH 3TM6A 3MZTA 3GSVA 4Z18A 4FXLA 4CU7A 2E9BA 2VLRE 1T66D 4OM0L 4ONHA 4Y5XB 3BPCB 4L8SC 3B9KD 1PX3A 3ESVF 2PF6A 1CU4H 1T04A 3BPOC 2R0WH 1U8QB 4PGEB 1IBGH 2Z4QB 2CGRL 1KTLB 1S9YB 1QFUH 1NUNB 2EYSA 4D0BA 3IETB 4MX7B 1ND0A 3HPJA 4J12A 1T5WA 1KC5L 4OGAD 3W0WB 4EI6B 3TJHD 1CZ8L 2CMRH 3Q6GH 1FQ9C 4U1IB 3ULVD 4AEFA 5HYFA 2EXWD 4V2BA 1XH3B 4NO3B 1J8KA 4JN2B 1R5VB 1FL5A 2OJEB 3IXAB 4OCRH 2VN4A 4BQ9A 4F7PB 3CUPA 4PTUA 5A3ID 1M05A 1SMAA 5EORL 1NDMB 5DJXA 2EE9A 4RGNC 4K7PL 5TDOA 3S97C 3VWKA 1EEZB 1BOYA 3N9GH 1VFBB 4U0QB 4X7TA 5IMLA 4O5LL 5C0AD 3QZWG 1JNJA 3DPBA 3P0YL 3HRZA 2GIYA 5IROA 1OCWL 1A3QA 4GJTB 1XF5A 5MEOB 1OAYL 3TIEA 2AJUH 1VKXB 1RUKH 2BMKA 3QIBD 1EZVX 2YA0A 1YECL 1IAOA 3LB6C 3KYKH 5EOTA 2A6IA 3O4LA 3WE6B 3D25A 4PY8I 1NCWH 1ZKAA 4MJIB 3EJJX 4Z8FL 4GBXD 1WFUA 4P59H 1LE9B 4TYUA 1EZVY 1JTPA 3PF2A 2H45A 4ENEC 1U8MB 3DUHA 1G0DA 3PWPE 4DVBB 4RDQG 1ORSA 4IIQC 3A6BH 1WVZA 3VDBA 2B1HL 1TCRA 3OKOA 1D6VH 4Y4FA 3IDXL 3VU2A 5ESAB 3AU1B 4MDIB 4FFYH 5BOZG 3DUUB 3MV7A 4K23L 1RZ8B 1HXMA 5DDHA 2C3WA 5D5ME 4KH2A 1X6LA 4R96B 3IDIB 4L8DA 3QZWA 1KLGB 5TE4H 2VDOH 1QSFD 1AI1L 4BZ2H 4QRTA 5B39G 4IJ3B 4WFGE 1NLBL 1AQKH 3UTPD 3FO2B 4U6HA 2Q6WB 3TPUA 1Q9WA 2F74A 3MRDB 1J88A 3BD3A 3BUYB 3U83A 5JW4N 3U2SB 5INDB 1CGXA 5ALCL 3RL2A 5E1AA 3O41A 3MRFB 4LCUB 5ABDE 5I8OH 3MODL 3NFNA 3G6DL 2NY1B 1YEFL 5D8JH 4QRRA 1CFQA 3K2MC 2VLMD 1BM3L 1UM6H 2F5AH 1FG9C 5F7YC 5GIRA 1A7OH 4X6EA 5F6IB 4HMEA 1KCLA 4JFED 3IS0X 2NY7L 4GMTH 2CKBH 3SQOH 3ZE2E 3ZL4L 4P4KD 3HNTH 2Q3ZA 1WTGT 4KRPB 4YXLL 4HFWA 3I6KA 2XN9B 1LVEA 1UXSB 4KK9C 4XCCH 1A6VH 4OCWL 4XC1L 5TF0A 2R56L 5C7XH 3RL1A 2MPAL 4OAWA 4Y4HB 4O4YL 4O51B 3V4UL 4YDVA 4AT6A 5EBWB 3KPRE 2IFGA 1A14H 15C8L 1D5XA 1HI6B 2EDOA 5HGGS 3RNQA 4PD4K 3QBTB 1A64A 2AV7A 2FWOB 4Y89A 2VXQL 2EIZB 4P2YA 4YDIH 1YQ2A 3MRCB 3IFNH 2AABL 2BSED 3GKWL 4PJ7A 4BFIB 1BPVA 4KTEL 1MUJA 4UT7H 4XMLH 1T22A 1R5IA 4UUJA 4FABH 1LO5B 4IM8A 1JRHI 3X3FH 4FFVC 3G6JF 4K3DH 1UJTA 2Q86A 4GS7B 2DDQH 4Q2ZA 4XMPL 5E2UL 1LEGA 1QSFB 1ZWIA 4UV4H 4F9LA 4NQVA 3VFVA 1AQDA 1HZHL 3ROLA 1C1EL 2R2EA 4BUHA 3ZE2F 3OTTA 2EC8A 3TESA 1YPZB 2R4SH 1KB5A 1T83C 4LBEB 3MNVA 4ZYKB 2I25N 4I3SL 4H20L 5DURD 2DLHA 3BOVA 1NFIA 4NQXB 5FO7B 3EGSA 5GZND 4HS6B 3GJFB 1XGYL 3QIWD 2CIIB 2FGZA 3RWGB 2R39A 3QIUB 5EC2B 3HMXL 4Q0XL 3L3JA 3PDGA 5C08B 1AJ7L 2EDYA 1MI5A 2HH0H 3Q5YA 1OSZA 2E27H 2QHRL 1ZMYA 5EZOH 3GSWA 2X4RB 5CBAB 3R1GL 3GSXA 1ZVHA 3CZJA 2VC2L 3RVWD 43CAA 2B5IC 5CJXC 4DUXA 1X5IA 5DO2C 3UYRL 1ACZA 1Q38A 3FQWA 2QQLH 5IG7A 5CKAA 4PYGA 1W0YT 4JHAH 1CXIA 5D71L 1J0YA 2EDWA 3GMPB 4EZMA 5GS0L 2D4FA 3MV8B 2R69L 2EXYC 1P4BL 5F71A 1ZSDA 1GZQB 1DVFC 4RAHA 5FF6B 1Z0NA 2DMKA 3CX5K 4M6OL 4HXAH 2X4OB 5CGYD 1KCUH 1DQTA 3WKNA 1R3IH 2J5LB 4YE4H 1KLUA 1MFNA 1S7QA 3VXNB 1PX4A 2NY2D 3PNWA 4BK5A 4M4RA 1XF4A 3LS4L 3UJJL 2HTKC 4LVHC 3NOIA 3SKNB 4JM2C 3BZFA 4GQPH 5JA9A 3NN8B 3EO0B 4P49A 3AY4A 1J5OH 3C8DA 4P57A 4NT6A 5KANI 1F00I 1ZGLM 3QG7H 4XNMB 5D1XB 3UYOD 4BH8A 1UJ3C 3MFFB 3X17A 4LSPH 4YDKL 1ZLSL 3U0WL 3IAQA 2X70B 2J6EH 5I1JL 1PAMA 4X6CF 2IQAB 3HFMH 5C09B 3AXLA 4TVPD 3QHFH 5EUOF 2VDML 5CEZL 1RURH 1AP2A 2D31A 1P7QA 2VZUA 2B8OT 2D7NA 4JLRB 4JB9H 3S37L 2IAMC 4HJGA 3ARBA 1IVLA 4K8RH 1O0VA 2C3VA 2I9TA 3GJFK 4KKLD 2AJSL 1TQCC 4KQ4L 5EU4B 4M1GH 4TUKL 4UDTB 3VE0A 2HLFC 4YBLB 3CFCL 5DF0A 1KEMH 2BHUA 4XXDB 5DK0B 3KPQB 1MQKL 1BQHA 2PXYD 3MV01 1OLZA 3ILQD 4FQJH 1INDH 3V6BR 3IDGB 1EHLH 3T0DA 3BP5A 3K3QA 4JDZA 1MIEH 5IKCB 1S7WB 5KS9B 1JWMA 5LBSH 4IMKA 2NY4D 4PV9B 1B9ZA 5IBLD 3D5OF 2VKWA 4P2QA 3HG1A 2ZWLT 4RMWA 4GFTB 4YWGL 1H5BC 4ZFOA 4U1KB 4KUCD 5DRWB 3TYFA 4M6ML 4NO2A 5HPOA 1OP3H 1A7PH 2WWMC 4NZDA 2D0GA 5H2BB 5J1AB 2I60H 1RUAH 3V9FA 5GGQL 3MCLH 3JSSA 4AEIL 4HUXA 1J05B 5JW5B 2VXTL 3VMPA 4OT1L 3VFSB 2HFEB 1CL7L 2HFTA 1BLNA 3VA6A 4QT5B 1JJUA 4UT9H 4X8JA 3ZZ1A 5E8EB 5I1IH 5C0BB 4XGZA 3CZFB 4JEGB 4PRPB 5CZXC 5E94B 3T0EA 3SDCC 3BEWB 3G5ZA 4E5XB 4OCXL 4R7DB 3SN6N 1FZOB 4LDLB 3O2WH 2X4NB 4KRLB 3T65B 2ARWA 3MLWH 4R9HA 1EJ6A 1PQZB 5I1DB 4N90D 4DKDC 3OF6A 3B9KC 1JHLH 1N64H 2DM4A 1LQSR 3WDHA 5I74B 4MQXC 3W81A 1T7VA 4WHYG 1UXWA 4XAWH 3VMNA 4PR5B 5MI0C 3P2TA 5I1AB 1N59B 3HZKB 4JQXA 4N0UA 5T3ZE 4YC2B 2XA8H 1A6AA 5C0CD 3ARFB 3S37X 2L0DA 3ES6B 4G8GD 3I9GL 1KBGH 1UM4H 3VFMA 4RAVA 2FLBT 5HD8D 3REVB 4M6NH 5J0BA 5TPWL 5D72H 5CD3B 5DI8A 1RJZB 1EDQA 2MOVA 3PHQB 3BIAX 2ENSA 4V1DA 1JN6A 5GQBA 1HKFA 3QDGD 1KPUB 4I3RL 4NM8L 5DT1L 5A3IC 4HG4J 5JNYA 1UWXK 1A7NH 2V5RA 3CPLB 2OJZH 4LPTA 2DWEA 4LLMA 3MLTA 3MJ9A 4GH7B 4ZOCA 4GRLD 3L3HA 1INQA 5LGHH 2B2XL 4XVTH 4IEFB 4LCWA 4AENB 1K8DA 3CH1A 3S3JA 1NCBL 3LD8B 3STLA 3MLUL 2VAJA 4GRMA 2F19L 3QWOB 3VFOB 1E6OL 5E6ID 2A83B 1P2CB 3S34H 5EWIH 3GGWA 1NC4A 4PJ8A 2XACC 4IOFD 3KPSA 5F9WC 1RZFH 4PJEB 1VHPA 4OSUH 4MD4B 3FO9B 4X5WA 4XVUD 2W9EH 4GRWE 1LD9B 4XNYL 1QLEH 3WS3B 1MJ7L 1UVQB 2N7AA 3FCTB 4XNQA 2HT4D 3KR3L 4GBXC 4RDQF 4JO3L 4QOKD 4XWOD 3BT2L 1YY9D 4ELKB 5J6GB 3X14A 2A77L 2QKIA 3CK0L 4DN4H 2BOBA 3C2AH 5KW9L 1RZGA 3QHZH 4GAJH 3DLQR 3S88L 4FZ8L 2HA1A 1EMTH 3BZDA 4N0CD 1A3LH 3KPLA 3NCJH 3FMGH 1WAAA 3WXVL 1CGYA 2VZSA 3V52L 4BUGA 4PRBA 1FSKB 3RGHA 2E9WA 4PG2C 1TJGL 2A9MH 2UUDH 1Q1JH 3OHXA 4JRYD 3MYJB 1WT5C 1PLGH 2XWJB 1IGJA 3ZTNH 2DQGL 4PJ7F 3FN9A 3PWNB 4G8IA 4Y4KC 2JIXA 3A6CL 1AGDA 3DXAD 1AXTH 1PY9A 3ORJA 5T5FL 4NSKB 4LU5L 3OG4B 1QQDB 2YN5A 4AEHL 1UYWL 5EFIA 2B4CC 4AIOA 2J1KA 1TDQA 4MD5B 4JHZA 1CICA 1W0VB 2OTWB 2XWTB 3VXPB 5DHVA 2V2WA 4GRLB 4ZG1A 3QXDB 1C5DA 4Z0XA 4WUUE 1CDJA 3D69B 4Q58C 2NW2A 1V7NH 2AI0L 5IR1A 3N1QC 2OM5A 4JO4L 1ZLVH 1R24B 1DFBH 3BAEL 4S1RL 5BW7C 1QSEE 1I85A 4OFYD 2P7TB 4NFDA 4MZ3A 3VFPB 3VGFA 2BSRB 1FFRA 1G7MA 4UQ2B 4Q9CA 3G08A 3FFCE 5TGBB 1MFEH 2PYFA 4I0PA 4Z7WA 5FDYA 4OZFH 1XR9B 2AJ3B 1T1YB 2NXZC 4MA1C 4QOKB 2X89A 2R29H 4KZEH 3GUTB 1DN0A 4UBDD 3KVQA 1I1FB 3LDBC 4JE4B 2RB8A 1J10A 4UQ3B 1BOGA 5FB8B 1ZHNB 3KLAB 1I1CA 3HUJB 1FFOB 2OZ4A 3DTXB 5I8KH 4LLYB 1MREH 5KOVC 3TBTA 3HE7D 3ZKNC 1L0XA 4KK8D 3CDYA 1FDLH 5D7LD 4LP4A 3RZCD 3RWIB 3QUZA 3QUML 3VG9C 5DLMH 2IQ9H 2NX5E 4XT1C 3VXUB 4LSRH 3RI5K 5C07D 1Y6KR 4FQHB 1WSST 1AY1L 4GAYB 4POUB 5EIQA 3MR9B 5IUSA 4HD9A 5I18L 3I3DA 1MHEA 4Y5VB 2UWEE 3Q6FA 2PTTA 4QHNB 2WIMA 1CDBA 4PRHA 1NGPL 3FN3A 3OV6A 4LKXA 4HKZA 1F4YL 4P23B 1ZOXA 4PRDB 4RZCB 4CJ1A 3QIWC 1RD6A 2H9GA 3ZT6A 4YK4B 3CDGB 4LQ1A 1AR1D 4PJXB 4GG6B 5E9DA 3EDDA 2MJWA 1NMCC 1JWSA 4EN3D 3TN0C 4DKEL 1XIWA 1LO3H 2QTEA 5FO9B 4Y5YC 4G42B 4CBPA 1FVEB 5H35A 5IQ9A 3RVWC 4P2QE 4HT1H 3HG1E 1P7KB 1SJVA 5IVOA 3QUMB 1U8NA 1OAQL 2DLFH 3RAJL 5EZLB 1NGYB 5J13B 3GSOB 2QLVB 3DGGA 3G5VB 4AMKH 5GS1C 5IIEB 5E0QA 3PJSA 4ZPVA 2FH8A 2V7HA 3NCYS 1DCLA 3RDTC 1Z0MA 2FRGP 2DM2A 5JMRA 4XPFH 5E4EC 1HSBA 2VMFA 1D5IL 1HOCB 1ZK9A 3QJHA 3UTTE 4ODVH 1MHHA 1UB5A 4N5UA 5F6HI 1HQRB 5HYIA 2DMCA 3GMRB 3GK8L 3UJTH 3PXJA 2XA3A 3HE6C 1MWAA 5IVXB 5KN5A 4M5YH 5SWZB 1GGUA 1A4JB 1I7UB 1FV1B 2DI8A 3T0EE 1JWUA 3ZDZF 5EOCL 5C07B 1XAUA 2GSGB 3RNKA 4MHHI 1ZLUK 3LN4B 3P4NA 9CGTA 5EUKB 3NCFB 1EFQA 3TO4C 5I1GL 4YZFE 4JO1H 1VPOH 4UV7H 4LSUL 4U1SB 1F3DH 4ODUA 4NKIL 1BZ7A 3ZYOA 3V2AR 1RIVL 4XBGA 7CGTA 4M5ZL 1Y0LA 5E5MB 1YN6A 4IRSD 5LG1A 3LMJL 5HVHB 4N0UE 3BDBA 5FUZL 3ILPA 3HZYB 4HBCH 3EYOB 2QR0A 4KDTC 1MEXH 2JB5H 1HDMA 2MKWA 4P5KA 3GMNA 3WL9A 3D9AH 3OZ9H 4XPBL 1BJ1J 1KB9J 4YHKL 5FHBL 3IJYB 4XPTH 4UT6L 3WUZA 2HWZL 3VXSA 3S5LB 4EN3B 3U1SH 5C8JA 4AK1A 3QFJB 3HI6L 2HMIC 2CLRA 3RTQA 3AB0C 4V1DE 5BVPL 4BZ1L 1PG7H 3ZDXF 1TFHA 3QDMD 5D7JA 4M8QB 4WTWA 4YX2H 4HS8H 1NGWB 3O2DL 2XI9A 4ODWA 5HI4C 2AVGA 5DWUL 2BHZA 4JKLA 5I15H 2PXYC 3VGGA 3MV9B 2VUYA 5FO8A 1N3NB 1I9IH 3NACL 5LWYL 3QPXL 5HHMB 5L6YH 4O2FB 3MOAH 2DRUA 2VLJD 3QH3B 4X6BB 4OI8A 2JCCE 3HLAB 3U46A 3VFTB 3PGFL 4GUPB 2UZIH 4U3CA 2GEEA 3HS0B 4PJ5E 1IGCL 1Q9LB 3BWAA 3BESR 2NY4C 4RGOH 5IBLC 4S1SL 2BVOB 3J7HA 2AEPL 4K3EL 5FUOL 2VR9A 3QSKB 3QNZA 3MRKA 4C56A 4XH2B 1CDHA 4JFHD 1A3RH 3DIFA 5EC1A 4M7JL 4WW2C 3CD4A 4PJGE 3MLPA 3WIIH 1DDHA 4OQTL 3KXFA 5DR5L 4LVOC 3BXNA 2X1PA 3MOBH 4I1NB 1IAIL 1IEBA 5FUCC 2NCMA 3PP3H 1G7QA 1UA6H 2GI7A 4ELMA 1FH5H 1F02I 2G5BA 2NY3D 4FFWD 4KKCD 4J8RB 2YA2A 4JO2L 3W9DA 2GJZA 4NNYA 3QXWA 3VGDA 4JQVA 2HVKA 4P46A 2CIKB 4PLKD 2BXZA 3I02A 3GDBA 2FL5B 4GRWH 1KCVL 3DO7A 5ID1B 3UBXB 3LZFH 3OKYA 1DZBA 4URTB 2YD1A 3VMOA 1KJVA 4GQ9H 4JPKH 1FNSH 4HWEL 4ERSH 5KAQG 2DTMH 1MCIA 3PQYB 4NKDA 2XT1B 1N7ML 4NC2B 5HYJE 3CC5B 3DX8A 5TE6L 2ICWB 3B2VH 3FB7B 4L3EB 4QRPD 3KLHD 1QSZA 3FAWA 3GKZA 5GGTH 3BW9A 4HXBH 4ZUSB 1RJLA 1A47A 1A6WH 1DVFA 1WAAF 4S10A 1A7QL 3QWRD 1XGPB 3SY0B 2R0LH 2HAZA 2NTFB 4HMCA 4GXUN 5FCUL 4UIKH 1WQVT 4ZMAT 3MO1A 2GKIA 3BIKB 3TGXA 4JJ5B 3AREA 5KSAD 2A6JA 5JIKA 1FO0H 1MY7A 4D0DA 5TFSH 3SJVD 2FEDC 1E27B 2VDRH 2WBJB 1ZVSB 2VXSH 3GHEH 5CP3H 5FYJU 1TJIL 4UNTA 1MCPL 1MFDL 3U6RB 4OIBA 3K1KC 1CT8B 5MEPA 3EYVA 2NY3B 2HP4A 4RMVA 2VXVL 3JWNC 4IOFC 2W9DH 1MCWW 4X5XA 1ZGLB 4HLJA 2VUOA 2FIKA 3FL7A 3TYGH 5HHQB 2IH3A 3E6FB 2NYYD 4TUOA 5DD1L 4U6VL 2XFXA 3QG6B 5FA4B 4A2MA 4P5TD 1UH4A 3JV6A 2GTWA 5EZIL 4ZD3H 2XRAL 1MVUA 4PGDA 1EHXA 1AHWA 5ACZA 3MXWL 3LKPB 3LH2L 3RUGB 5AAWA 5L7XL 1T20A 2A38A 1JK8B 1UEYA 4PRHE 2B0SL 3D18B 4N0YH 4G9FD 2YPVH 4Z7WF 2YD4A 4N0CC 1OQOA 2KZ1B 1S5IH 2FHCA 2ZCHH 5GGUB 5GSVB 2ZUTA 1U8QA 4PGEA 1GGTA 1T6VN 5KSBA 3RZWA 2I9LA 3ZO0A 2XZAL 3ESUF 1KJ3H 4MX7A 2QADD 1G9NC 1G9MC 4JFFE 4Z78A 3CXHJ 2VAAB 4EI6A 4BSWB 2HJLB 3QUKA 1UKQA 3TT1H 1DBBH 1RVFH 3AFLA 4H25B 5IJVA 1HHJB 4JN2A 2NQCA 4KKAD 1RUQL 4MA7L 5JXED 3IXAA 5E7BA 3OPZL 1OTTD 4HK0A 4OCLC 3BEVB 4G7VL 1WLHA 1I8MA 1NDMA 2Q8BL 3DUSA 1A6PA 1EEZA 2PYED 1Q0YH 3LEVL 2BNRD 4G80B 4MB3A 2FDBP 1OGTB 1KT2A 1IC7H 4Y19E 2K9UA 3RY6A 4ZSOB 3IDYC 4HPYH 1ORQB 1T21A 2D7TH 5FKPB 3WXWL 4AH2B 3HAEH 1M71A 1LE5B 4JY5H 5FGCE 1DR9A 3JWDH 3R06A 4YHPB 2OX5A 1MPAL 4JJHA 3TF7C 2GFBB 3UTSD 3WE6A 5BS0D 1EEYB 3TWCH 1BX2B 4MJIA 5ADPL 3FQXA 2P5EE 1UGNA 1ES0B 1OD9A 4XZUB 2GK0B 4S2SB 3ZE0E 2C4FT 4DGIH 5L8LB 5DYOB 5KVEL 3HE7C 5CJQH 3H9SE 4LVHB 2I26N 1BEYH 5D7IA 1CTNA 3RZCC 4YHZH 3WO3B 1X44A 5IEKA 3ARDB 1IZJA 2QADB 1TITA 2GJ6E 3LIZH 3AU1A 1JVKA 4NQCB 4OLUH 4MDIA 1YEGL 4NZTL 2J88L 1F4XL 1BFOA 1N8ZB 3DUUA 4FA8A 2VDQH 4YAQA 5ITBL 4HPOH 5JMOC 4OZGA 5DMGD 1KLGA 4JREC 3RWJB 4I48B 3D6GA 3DGCR 4K7FB 4M02A 4ZS6C 1BBDL 1JPSL 2FNBA 3WO4B 3FO2A 2QSQA 2IAMB 1EXUB 2Q6WA 5FA3B 3TT3H 4QHMB 4IRZL 3I50L 3U4AA 5JW3L 3G9AB 3MRDA 5C0ND 1Q9OA 1FNGB 4ONFL 2VISB 3U2SA 5INDA 1S7XA 4X9GA 3OX8A 4ZDHB 1T2QH 3MRFA 1J1OH 2AK4D 4LCUA 1RJCA 4Q9QH 4D9LH 1FBIL 4IMLB 5C0AA 4LPVA 5IB1B 1GPOH 4PP1D 3S8WA 5F70A 5HVFB 5EN2B 3UZQA 3UO1L 1CIDA 3QWQB 3QIBA 1P7HL 2E8YA 1O7VA 5HYSG 4FQ1H 5BS0B 4QF1B 4WU7B 4OLVH 4GW5B 1NCAH 2YD7A 1U91B 1UXSA 1CLZH 3WEXB 4GBXA 1KIRA 4F8QA 3PDOA 2DD8H 1NLDL 4PJIE 1T0PB 4YHNA 5E2VL 4TQEL 2CLZB 5HYQA 1V7MH 3PUCA 4LLDB 4C59B 4N8VB 5ISZB 4CNIA 5L88L 3EO9H 5KVMC 1UFUA 5MEPB 2FWOA 1XT5A 2AJZB 2EIZA 3STZB 4Q9RH 2R0WL 4OD1H 5DRNA 1MRDL 1IBGL 3PL6C 1W8OA 1FZMB 4BFIA 5CUSH 1GAFL 1QFUL 4PRIE 1ONQB 1OY3B 1H3WM 1X4ZA 5EPMB 1DSFL 3BJLA 2H6PB 3C8HA 2X42A 2CD0A 4MWFB 3OAYK 3BP6B 2JK5B 4KY1H 3MUHL 1AXSA 2ZSWB 3QDAA 3Q6GL 5MEND 4HS3A 3PV6B 1QSFA 3LPFA 4JFYA 4P48A 2ZPKH 4IRSC 4APQD 1Z9LA 4LRIA 4KPHH 3WSQH 1KLFA 1T7XA 1EGJA 4Q74A 3TEUA 1YPZA 4HIXL 3SDCB 3HA0A 2RIKA 3TNNA 1HEZA 5HYSA 5GGSA 1SVCP 1DQDH 4ELMF 5HSFA 1HH9B 5FO7A 2X4TB 1TVBA 5GS2H 4HS6A 3OJDB 3GJFA 3NH7L 4DTGL 4Y2DD 5J6HA 2EC9U 2OXGA 5I17B 5EC2A 3QIUA 2P42B 3N9GL 2RBLA 4HWBH 3QHTC 5DC9B 1BZ9B 4NQDB 2OK0H 1J8HD 1ZAGA 5SX4H 2GCYB 4L4VD 3SGDH 4ZFGH 4JFEA 2A6KB 1NGQL 4FQCH 4R3SA 2AJUL 3QULB 3IU4L 1IGMH 4HUMB 1YMMD 5GRJH 3F7VA 4JGUA 4P4KA 4U1GB 3LSOA 3W5MA 3KYKL 4WI9A 2OTUB 3UTZB 4FQQB 4J3SA 1CFNB 4PY8J 1BWWA 2MNUA 3P9LA 1MCJA 1GZQA 1P1ZA 1B6UA 2DQTH 3L3GB 5L8KB 4V2CB 3QAZC 1S5HA 2X7LA 3IDUA 2GW5A 3K8MA 4PJFB 3RVXD 2Y07H 4OCMC 4LCCC 1IQWH 4Z7UB 5SV4A 1MJ8H 3MOQA 3SE8L 2OMNA 2YK1L 3VXNA 4OLZH 4LGRB 1CQKA 1BREA 5EDXA 1WISA 1T4KA 2VQTA 3EOAA 1NAML 4I9WD 2QQKH 4PJBA 5F7MC 5C2BH 3HNVH 5C0RL 1CD1B 3NN8A 4JFZH 4XCFH 1GXEA 3RVUC 5I19H 3V7MA 3V5DA 5DZOA 4P2RD 2DLEA 3L3IB 4NKQB 5FYKD 3VFWB 4APQB 5DRZB 3FT2B 4PJCB 4NQED 5TE4L 4FFWC 3MFFA 4KKCC 3TO2B 3M07A 2OI9B 1ZT4B 5IT2H 2L4OA 1EUUA 3AGVA 3ARWA 2B4CL 2IQAA 3ULSB 1RQ5A 1JNNH 3L7FB 3DRQA 5KAQF 3NIDF 3C2SA 3W0WE 2CK0L 5I8OL 1LNUA 2FJGA 4FTVD 1IC4H 3EW3B 5FXCH 4GKSA 2D0HA 3IDNA 4TSCL 1UM6L 5I1HL 1DBAH 3W2DL 3VXTB 1V3MA 1AD0A 1I8KB 5EU4A 1FLRH 1A7OL 4NJAH 3DJ9A 4UDTA 1T1ZB 1XF3A 4GKNB 3WDJA 4GMTL 4O9HL 3SQOL 1S3KH 4I13B 5DK0A 1U3HD 2W0PA 5TDPB 3NTCH 3HNTL 4NHCL 1AKJD 5GGVL 3UYPA 2IPTL 1CXLA 1A9EA 4F2MB 3FQNB 2DLGA 4XC3L 2LTQC 4YIQB 1H3VA 1C7TA 5KSBF 1OQXA 3S98A 3P4MB 2J7LA 1S7WA 3EOTH 2LVEA 4XNUH 5MEQB 4I18C 2WIIB 2IBBA 4RFOL 4XCYA 4O2EB 4XNXH 3GMMA 3H42H 1QNZH 3O9WB 4R97C 4LEXL 3ARZA 3BSZH 1RSFA 2CRIA 4WV1B 4MJIE 1D5ZA 2YMXH 1R3JA 1A6UL 3WNOA 3T4AB 4NQEB 5H2BA 2DDQL 1DBKH 5JOPE 3CMOH 4UV4L 1YYMH 4N0FB 3P77B 4F37K 5IFAL 4YJZL 4K71C 4LSVL 4AQOA 2DKUA 3LHPL 1KJ2L 5I8CB 4OLXL 1WCBB 5F7FA 3VFSA 3BUTA 5D4QA 5I1KH 3O6KL 4QT5A 1M7IB 5IQ7H 3G5XA 4P5TC 1AGBB 1NCUA 1EV2E 3VGHA 1UB6A 3CZFA 4EDXA 2YZ1A 2K3TA 3B2UD 5E94A 1L7TL 4FTVB 1QZ1A 1X7QB 3U48A 1CFSB 5DJAA 1Q0XH 1IM9B 2HH0L 2X4NA 3NAAH 3T65A 2E27L 5EZOL 3SEPA 4CMMB 1U3ZA 1PQZA 1TIUA 5I1DA 4JG0H 4UINH 2Q8AL 4Z5RB 1FGNH 1T1XA 1VGEL 2IANB 3RFZC 2HJFB 4KKBC 1Q72L 4MAYB 5FECB 1U3HB 4XVSH 1HHHB 5IHUL 2ADJA 5I1AA 2PXYA 4RGMC 5D1QB 4NNXA 4X7SH 1B4JL 3BH9A 1JPGB 1G7IB 1LO4H 3ARFA 1RMFH 1WZLA 5D7IF 5JLZB 3ES6A 5DJ8B 5DQDL 1FYTB 3REVA 1GHFH 1KCUL 5F1KC 5L2KD 1GSMA 5CD3A 4GLRH 1R3IL 2FX8H 5TF1H 4D3CL 4DQOL 3QJFB 1CXHA 4CVXB 5JXEC 1JCKA 3VXOB 2HG5B 3B43A 1HINH 1OTTC 3MV11 3ULVF 3WHXB 3CSGA 4OZGF 3CPLA 2XN9E 4K8RD 4TTDC 4WW2A 3HPLB 3SGDI 3D1MC 3P73B 4Y5YB 3K74B 4QNPF 1J5OL 5A2LH 1EFXB 1MAKA 1AGFB 4AENA 1IZKA 2VLRD 4YFLF 5GS1B 2J6EL 4MYWB 4WWID 4P9MH 4MAUL 3CLFH 2IALB 4D0CB 2NR6C 1ZLWH 1TQBC 3VD5A 1UWGH 5DD3L 1WICA 4MB5A 3JWDC 4MD4A 5IJKC 3ZYIA 1LD9A 3I75A 1TZIA 1X4YA 2RGSA 3O45A 4XI5D 4G6JH 4OZIF 3D85D 2V9RA 2HT2D 4HCRA 3H7BA 3MLYH 4ELKA 2EE3A 4X5LA 4U1LB 2ITCB 3DRTB 1YPZE 2ZG3A 2DTSA 3FRUB 4MJ6B 5I30L 3IFLH 4BA8A 3CCHA 4KI5C 5FYJL 3TO4B 4B53A 1NFDB 1KEML 5TDNB 5T1LD 4TN9A 3KHOA 5HI5D 3AMKA 3OKDB 5C08E 4XVJH 3H0TB 4XXCA 5CSBA 4G8GA 5DS8B 4FQJL 1SJEA 5DMGC 1JGLH 5DVMA 3MJ6A 1INDL 3GI8L 5BXFB 3PWNA 1EHLL 4M4PA 2B7DT 4RQQA 3QEGH 5DJDB 4KK5C 2IFFH 5LBSL 3QDGA 3BGMA 3WBDA 4U6YB 5D2NB 2GITA 5C0NC 4TVSa 4MD5A 4MXVE 2NY6D 4Z7VB 4OUOA 3DX7B 1W0VA 4OGZA 3WNKA 3LY6A 3MV8E 1DTUA 2ICEA 3NPZB 4C58B 3T1FB 1A2YB 1P9MC 4GRLA 4Q6IC 3QXDA 3AB0B 2YSSB 3SOBL 1A7PL 1W72L 2R8SH 3D69A 1RUAL 1YMHA 4PJAB 1R24A 4EOWH 5E6IA 3SPVA 4C55A 3WUWB 3JTTB 3B3IA 4EXKA 3MNWB 3PWPD 2YEZA 3VFPA 4H8WH 4OKDA 5K9KB 4UQ2A 25C8L 4KK6D 3JZ7A 4FXGB 2UZYB 3F62A 3G04B 3NIFE 2YBRB 4ZAKD 1GZPB 4QOKA 2R1XA 4LSSH 1KXTB 5F3BB 1ZHBB 3NABH 1I1FA 5FGSA 3ME0A 4TPRH 1IKFH 4PY7B 2I07B 4WFGD 1JHLL 1N64L 5FB8A 5K59E 3KLAA 2MCPH 5C09E 1IFHH 3DTXA 4R4FH 4MA8H 1IRAY 4MQSB 4QXUH 4G8EB 4R4ND 2APVA 1SM3H 4PLJD 4LLUB 5C3TA 3RWIA 1MJJB 3WIFA 4JRYA 2ZCKH 3MRIA 3HZVA 3JV4B 4FQHA 1CD8A 3MCG1 1PKQE 4WCYH 1UM4L 4NUGL 4OIIL 3DXAA 2DN7A 3MR9A 4M6NL 1CF8L 4Y5VA 4X7EC 4PJBF 3DARA 4HUKB 3ALWA 5KJRH 3UPRA 1AFVL 3C9NB 3R0NA 4D2NA 3L1OH 1MHPH 4IBLT 2AXHA 3AVEA 2VZ1A 1K6QL 1OB1A 1UH3A 4H1LH 4NRYB 4PRDA 2AKRA 5D2LB 4QEGA 4RZCA 2X4PA 1EO8L 4F7CB 3EO1A 5D96B 1NMAH 4EUPH 3IRPX 5LGHL 4PJXA 4GG6A 3OJ2C 4NWTH 2C9AA 4U3XA 2XZCH 4JFPB 5B4MC 2ZUQB 4OCSH 5KS9E 5DZNA 3KPRD 5FO9A 4JKPH 5DUPH 2E9IA 4UIMA 4OFYA 5JPMB 3UEZA 2VDPL 4AQ1B 3TV3L 3DBXA 1P7KA 5KBNC 1KIQB 4ORGA 5EZLA 1RZFL 4FQ2L 2X41A 3GSOA 5CBEB 5IIEA 1O7SA 4GLRI 3P0GB 4ZAKB 2F15A 4KJYB 3NCEB 3VRLF 2GQHA 3MA7B 4YEEA 5D5MB 3V5KB 1U6AL 4OM0H 4TNVK 5HPMB 1NBYB 3LRGA 2NXYB 5H37H 5T3XL 5A2IH 2CGRH 4JGJA 5GRVL 2YA1A 2DBLH 2BVQB 3HE7A 1OGAE 5C0BE 2JELL 1A3LL 1A4JA 2C1PB 1REIA 1FZJB 1FV1A 3FQRB 3FMGL 1KC5H 3O0RH 4PRPE 1MCQA 1UH2A 1QLRB 4U6XA 5D7LA 3C5JB 3RZCA 1HSAA 3IKCA 4NZJA 1CZ8H 3HMWL 2OR9L 2JJVA 3WJJC 2BSTB 1WBYA 5C07A 3BMWA 2FGWH 1OP3K 3CAFA 1MCEA 1G9ML 1PLGL 2OLDA 3C5ZC 1KG0A 2C26A 3MC0A 1FL6B 1HYRC 3BP7B 2FJFA 3GO1H 1F8TH 4AG4H 5E5MA 4YBQD 5EORH 4K9EH 4K7PH 2IMMA 3HZYA 4HDIB 1T3FA 3ARVA 3EYOA 4LLWB 4MVBD 1V8HA 4O5LH 3V6OC 1VFMA 2GTZB 1V7NL 3LEXA 1OCWH 4EN3A 5EIIB 4XCNB 5BZWB 2WINB 3MNZB 4IRJC 4NKOB 3B9DA 5DVNA 1YECH 2LAGB 4P5MB 1J0IA 4M8QA 2CKNA 4DKFH 2DIBA 1AGCA 4NRXB 1SJXA 4RIRB 4PJHB 4Z8FH 4RAUB 5ESQB 1MFEL 5CWSB 2WLYA 1CIUA 4O2FA 4KZEL 3HLAA 3VFTA 1PEWA 2VL5B 4GUPA 3UBXG 2AGJL 1F2XK 3LPWA 1KJMB 4JRXB 3NGBC 3BPNB 2B1HH 3B83A 1OPGL 4PJEE 2BSSA 1F45A 3IDXH 4JVWA 2XTJC 3NZ8A 3BP4A 4A6YA 1MCLA 4ZNCD 2ESVB 2NZ9D 4K23H 3OKLB 1JGUL 3UTQA 2Z8VC 1TNNA 3MRHB 5INCB 3MREA 5DLML 5EBMA 4DJMA 5JORB 1N2RB 1KB9K 1K3ZA 1NLBH 4UAOB 3WJLC 1VA9A 3IDYB 3KS0J 3FB6B 5IW6A 1YEKH 2J8UE 4KUCF 2C3XA 1XCQB 4WW2F 1I1YB 4IRSA 5EZJB 3S7GA 2VITB 3KJ4C 4J8RA 4OZFB 5ALCH 2CLVA 3WFEH 1FZKB 1JGEB 1YEFH 4O2CB 2HLAB 2CIKA 3O8XD 4WFHE 3B5GA 4NOFA 2FL5A 5DEGA 4YGVA 3UBXA 4Y7MA 1EA9C 5D6DA 2ZOKB 2O61B 3NCYP 2ILLA 1LO3L 1T80A 3L95B 3OKMB 3FHAA 4LDEB 1RFDL 3ZL4H 1CTOA 2BDNH 5GRVK 2ADGB 1RZKC 3O6ML 3NIGE 4MS8D 3JV0A 1U92B 3F12B 3PABB 4YXLH 5FGBC 2DQCH 4M43H 5JR1L 4OCWH 2R56H 4LVNC 2MPAH 4QYOB 4O4YH 3V4UH 2VLJA 1PSKH 3DVFA 1PKOA 2GHWB 3WD5H 2H2PC 4XPFL 5L2JB 4HIJA 4LHQB 1X5YA 4O58L 15C8H 3CFBB 1IGTA 4K2UL 4QXTB 3B6SB 4ODVL 4RFNB 3UROR 4MMZC 4GSDH 1ZANL 5F6HJ 2VABB 3UJTL 4RMUA 1XGPA 4M5YL 2WUCL 3SY0A