2AJUL

Cyrstal structure of cocaine catalytic antibody 7a1 fab'
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
216
structure length
216
Chain Sequence
DIVITQDELSNPVTSGESVSISCRSSRSLLYKDGRTYLNWFLQRPGQSPQLLIYLMSTRASGVSDRFSGSGSGTDFTLEISRVKAEDVGVYYCQQFVEYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY 7A1 FAB'
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
total genus 49
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ajuL01
1G1YA 4PRIE 4DN4H 3VXOB 4DN3H 5DZLA 5IHLB 5I0DA 1WEJL 3T4YA 4PREB 5IQ9A 3K8MA 5DJDA 1EAPA 4JFYB 5KSVB 3GMLA 4TSAH 2IADA 5C92A 3AM8C 5D7KE 2VSDA 4G6KH 4NJAH 4A2MA 3QUMH 1CLOH 1EEZB 1HSAB 2EXWD 3QUXC 5F3HB 1J87A 3SDDA 1JF1B 4K8RH 2Z91B 5F1OB 1GXEA 2DL9A 3FFCA 3K2UH 5F1NA 2NXZD 3D0VA 5DD6A 1WZ1H 4CADA 2XTJB 4GRMB 1K8IA 2AP2A 5A2LH 1BOGB 1TTFA 2BXZA 3VRIA 3RWGB 4DVBA 2P5EA 1ZGLM 2ZKHH 2ENSA 5FYLD 2MMXA 4YHYB 3B8SA 1RK1B 4OCSH 1UM4L 3LEYL 2R0ZH 4O2EB 5ID0B 5C0BB 1XF1A 4QRSA 4RBPH 4GQPH 5MI0C 4KTYA 5L9DH 3G6JE 4P3WA 4B7IA 1Y6MR 5CEZD 2FSEB 4QT5B 3SEPA 1JWMB 5E95B 1DEEB 3NFSH 1BJ1H 4KFZC 5L2KA 3D39E 2CR6A 2A6JB 4OTXL 2XN9D 1OAZH 2VC2H 4YH6A 4OZ4B 4XWGL 3B5HA 1OM3L 1ZEAH 2Z93B 2EE6A 2AJVL 2HJFA 4Q6IA 2OL3A 5A2JH 1SEQH 4ODUB 3RHWK 2DYPD 1I1AC 5LGHH 4IMLB 1D5IH 4LK4A 1KCRL 2NY7L 3O8XC 4Y4KC 2VH5L 3OSKA 4XNXL 3D39A 4NQVA 4WGVB 2CXKA 4DFIA 3MLSL 1QSFB 2FHCA 3QIUC 1UJ3C 3NACL 5I15L 5JNYB 5FB8B 1BECA 3BFOA 3V9FA 2FB4H 1RUAL 3TA3A 3KJ4C 3REVB 5CSZA 2R0KL 1K5NB 1A5FL 2O26U 1OAKH 5DEFB 3N0PB 2P5WD 1AY1L 1IT9L 2ICWI 3OJVC 1BHGA 4WGWB 3MNVB 3RP1A 3VCLB 2GQHA 3UAJC 4ZNEE 5I19L 5BZWA 4HEPG 5E56A 1VEMA 4LVEA 2VLJE 4P2QE 2VABB 3C2SA 5KVFL 1FBIH 2Q87A 3SCMD 4EZMA 5FKPB 1NC2B 1F6AA 4D8PA 1RIVH 1J11A 3DETD 3ZO0A 4PJDE 3REWB 1IAKB 1RZIB 4JHWL 1UFUA 2W07A 3BJLA 4G80B 4I5BB 5GRZA 4ZNEA 3WJJC 4ZSOA 2OR8A 3BXNA 4P5TB 2VLJA 2EICA 5E2TL 3ZYZA 4X99A 2HVKA 2B4CL 4RX4A 1K8DA 3AS1A 3BHBA 3QSKB 1NBQA 3KWWA 1ES0B 3DI3B 3MO1B 2CDFB 5T1DL 2GTZA 2X05A 1CE6A 2K1MA 2VL5A 3O3AA 1N0XL 4JM2F 3VFWA 3OKMA 4HZAA 1KN2L 5F9JB 1I1RA 4U1SB 1JMXA 4ISVA 3QPXH 4KHXH 1MF2H 1WJ3A 1MJ8H 4UT6L 3HUJF 3VG0L 1U3HB 4NCDA 43CAB 4K3EH 2X4PA 1W2KT 4QF1B 4ZFGH 4ONHA 2F53D 2E7MA 3Q5TA 5IK3B 4WFEE 5BZDA 3E1F1 1EMTL 4G8IB 5DJ6A 4OLUH 4HX1B 2C26A 3CFKB 2NY1C 3PHOA 3H9HB 2ICES 4PRHE 5E8PB 1MJJB 5DQDH 2X1XR 3LV3A 1GC1C 1FGVL 1OGTA 3THMH 4GKZA 2AV1B 3NZ8B 4NNYA 3RY4A 5JW5B 1A21A 3DX8A 4ETQA 2X42A 5IMMA 3IYLW 4HPOL 5HI4D 4PJIE 4JDVB 3LS5H 4ZO8A 3PJSA 1FLRH 4G6FD 3HRZB 3NAAL 5KSAB 3FO9B 1RU9L 4OQ1A 1H3PH 3HZKB 2O93L 3RVWC 4P4KD 4MX7A 5DXWA 3U36B 1BF8A 3VXRE 1ZVHA 1KYOK 5IW6B 1PQZB 1XZ0B 5CJXA 5GISH 5B39B 4Y4HB 2QSTA 1C7TA 2C9AA 2WANA 4X6CF 3BZEA 4PJIA 4RGND 4JR9H 5GHWL 4GBXD 3ROLA 4LARH 4JO2H 3IKCA 3VD3A 4JFFA 4X6EA 2IFFH 4JREC 1BVKB 2DD8L 1QO3B 3QDJA 5F1IB 3VXRA 3U9UA 2LAGB 4IJ3C 1CU4H 3R1GL 2VDLL 4HMEA 4HUVB 3KXFE 4KK5D 4MYWB 3VGEA 2BHYA 4K23L 4OD1H 1MEXL 4HDIA 5GGQH 1SJHA 2HJLA 4WHCA 3EDJA 4X4YB 3MA9L 4RZCB 1ZT1B 3SBWA 4F7PB 5CLWA 2BOBB 1MVUA 4H1LH 4PJEA 1D5ZA 2A73B 4HIIB 1A3RL 4MJ2A 1CFTA 5KN5B 1CTOA 3NOIA 4C4KO 1A7NL 5IQ7L 1MCWM 3VXOA 4M8VA 3ROOB 4EUPB 3AUVA 2EH7H 1WZKA 2AQ3A 3KPMB 5I75C 1G9MH 4JFYA 3ORJA 5KSVA 35C8L 1CLYL 3MGTB 5K93A 4JFEB 1HSAA 1M05A 5F3HA 4BKLB 5HGBA 3B5TA 3OGCB 5F9OL 2Z91A 4EOWL 4HJJL 4XPTL 5DZOA 4NM8H 3OB0H 3BJ91 2EECA 2EXWC 2BSRB 5DYOB 1EGJA 4FQXA 4BK5A 6FABH 1MIMH 4P49A 1S9YB 1B88A 2H45A 5F89B 5GGTH 2QQNL 2UZIL 3RWGA 5I18L 4PRNB 3EYSH 3KPRB 1PKQB 4UTBH 4PY8I 2DLTA 2IGFH 2VXVL 4K7PY 1RK1A 4XCNA 1L0QA 2IBZX 5HI3D 4XP5H 1Z5LB 4O2EA 5MERB 5ID0A 5C0BA 1Q38A 3P2TA 4UNUA 1G9NH 1T21B 3W2DL 7FABH 2DRUA 5JIPA 3ZDYF 2XZCL 3NCEB 4OFPA 1Q0YL 2FSEA 4OZHF 1CCZA 3JVGA 4N1HB 4U7KA 4ZUTB 2J8UB 1JWMA 1DEEA 4XCYB 4C56E 4JM4L 4TVPH 5TQ0H 3A6OA 2NY3B 3WD5H 2A6JA 1KLGB 5FXCH 2BMKB 4RGOH 6CGTA 4OZ4A 1LO0H 2Z93A 4Z7VF 1OWWA 4A6YL 5EB9A 1IGIH 4IRJA 4K55A 4ODUA 2BNQD 4QY8B 1C8PA 3KHQA 4L4TB 2CKBH 2Y36L 3C9NA 5FHAL 4LLWB 4IMLA 1BJMA 3C2AH 1SY6L 2W0FB 1I85A 2VOTA 1MOEA 5HVFB 1QSFA 2BXYA 1EEUA 5IJKC 3UTOA 2UWEE 5FB8A 4LCYB 1K5NA 5DEFA 1QYGH 1VFBB 4ODHH 4P2OD 2OK0L 4H5SB 4BZYA 2AEPH 3P0VL 5AAWA 4MCZB 1DVFB 1W8NA 3HI6H 3MNVA 1MREH 4U1MA 3HMWH 4Y16A 4I3RH 1UXSB 5E5MB 4UOJA 2VABA 4F15B 2ICEB 1NC2A 2EDJA 3G5ZB 2Z8SA 1P6FA 3REWA 3WEXB 1SYVB 1IAKA 1XR8A 3QHFH 3SCMC 1JMZA 3C5SA 4N1CA 4I5BA 3H3PL 5K59F 2APWA 4R26H 5KSBA 2ZG1A 4P5TA 4ZTOL 2H32H 1A3QA 3SKOA 1W72L 1YEJH 2Y07L 3RWIB 1N64H 3IXTB 5DRXB 4PJ8D 2FJFB 3BKMH 2P24B 3MJGX 4B50A 1YC8A 4OCRH 4O2FB 2X1QA 3PDGA 2Q8AH 5FECB 1ES0A 4I9WE 2CDFA 5IUSA 1J0JA 4K3EL 3V6BR 3Q48A 4H8WL 2I26N 5JA8B 3G9AB 3O3BA 4HK3J 2QHRL 3S5LG 5ADPH 1ETZB 3RGHA 4MA1C 2F19H 1IBGL 5GRJH 5D1ZA 5F9JA 3BW9B 5CHNA 4JRYB 3WHXB 3GRWL 1GIGH 3SO3C 5DJYB 5HYEA 1C5CH 1ADQH 1U3HA 1QR1B 4JFHD 43CAA 3O2DA 2VDQL 3CMGA 4L4JA 4QF1A 5GGVH 3WMSA 3V4UH 5IK3A 3S36X 5EU3B 1JI1A 1U8JB 4G8IA 1NCBH 1ORQA 3QO1B 4HX1A 1UJTA 3CFKA 3HKFA 4GG8B 1NMAL 3H9HA 1YJDH 3TPKA 4OIBA 5E8PA 4Z0XB 1MJJA 2R8SL 4LPXA 4QOKE 1QFWM 3BYTA 5LQBL 1T83A 4XNMB 2AV1A 2E7BA 3NZ8A 5JW5A 3UTQB 5JOEA 2AK4D 5GQBA 2AABH 3CDCA 1NUNB 3RI5K 3WFHB 4F58H 1OHQA 4JDVA 4XGZB 5KSAA 1A1NA 3HRZA 4EDWL 5BRZD 3EDFA 1JHTB 2VZSA 3HZKA 1WWBX 4MB3A 5INDA 3FFDB 2EYSB 3GMOB 3MBED 3U36A 3MYJB 3HNVH 3WUWB 3T0EB 3W0WD 5IW6A 1PQZA 1XZ0A 4NN7C 1SJXA 3ZHLA 2ORBL 5B39A 2VWEC 4CVUA 4M1GH 4LSQH 1LK2B 1S5IH 2D7PA 4Y4HA 4JO4L 5C0DB 1RPQA 2CXGA 4DZ8B 5J0BA 1EFXB 5T3XE 2V9TA 2MPAL 5EUKB 1I9EA 2V17H 5D5MB 1TNNA 2APTA 3LMJH 5JR1H 3KLSA 4BZ2L 1T80A 1WUNT 1BVKA 3QA3B 1QO3A 5F1IA 4RGNC 5J7CC 5CKAA 3RTQB 3D25B 4TUKL 4GBXC 4DK6A 4PB0H 4PG2C 3SKNB 5TDPA 2ESVE 4XVSH 5DSCA 43C9B 4MXQC 4HUVA 4XXCC 3CFEB 2DMKA 3VFVB 3WKML 1FRGL 2X09A 5HYQA 2VDPL 1YEDB 3QIBD 4M61B 4LASL 3ULSB 4YDJB 5I1JL 3VGGA 5B3JF 1U8PB 4KK5C 2Q3AA 4IRZH 5GRXG 1T5WB 4RZCA 4Y0GA 1BBJB 3QEGH 3BD5A 3T0BA 2BOBA 2G2RB 3TCLB 4LP5A 4HIIA 4JFEE 4XPBH 5H94B 5KN5A 3MBXH 2ZJSH 4U1GB 4GSDL 3ROOA 4EUPA 1LD9B 5LWYL 1EH9A 1FE8L 2EDNA 4JQIL 4MVBD 2NTFB 4L9LB 5C07E 4WTXA 5C0RL 4LCCA 2DJSA 1ONQB 4OT1L 2NY5L 5EO9B 3N1GC 4MQTB 3SY0B 3MGTA 5HPMB 3KPRE 2ADIB 1PKQE 4BKLA 4X5WA 1SEBB 3OGCA 3LPFA 5IVOA 4WHYH 3V6OA 3TNMB 1TDQA 1NLDH 1E28B 3Q2CA 2YKLL 1QFWI 3ARYA 2BSRA 3QR2A 5DYOA 3FN0H 3Q6GH 1F5WA 1TQBC 3SQOH 4M6MH 1S9YA 2J8UE 3MRCB 4MAYD 5F89A 1VGKA 1U58B 3ARBC 3PV6B 5H35A 3TVMB 1CDCA 2C4XA 2V2WB 1YNTB 4IDLA 3RIAK 1Z5LA 2C1PB 4GW1B 4KROC 4P23C 4U1NB 2FJGB 3VFSA 1T21A 2PO6B 4LRNH 4X7TB 2VDMH 4UB0L 5E2WH 2PXYB 5HI3C 1N0LA 3P11H 2ZUYA 1KB9J 4ZUTA 4IM8A 1RUKH 1FSKC 1S9WB 1KLGA 1F2QA 2BMKA 4E5XB 4XBEH 1FAKT 2E27H 2YPLE 4LVOC 4Y19B 2H1PH 3TH3T 4QY8A 1CFSB 4XVUD 5CEYB 3IU3B 4L4TA 1AH1A 3TJEL 5FGCB 1ZGLB 4W68A 1M1SA 4LLWA 3HS0B 4Y88A 2Z31D 3A6BH 2W0FA 4ZS7H 2OS7A 1TXKA 1RHHB 3GBNH 3CVHH 3VMNA 5ABDE 4KKAD 1U6AL 4LHUB 2IF7A 2OTUA 4LU5L 3ZT6A 2GAZB 1FL3B 4PPTA 1VB9A 1U93B 4JFQB 3CFDB 3GI8L 1ZTXH 4H5SA 5ETUB 4Z95L 3ZE2F 4MCZA 1WIUA 4TRPH 4R26L 1UXSA 5E5MA 3OZ9L 4O51B 4P2OC 4BM7A 4MDIB 2R69L 3TH4T 1JRHI 5FM5M 2NY0B 4KUCF 3G5ZA 4F9LA 5DF0A 5DUML 1SYVA 2BDNL 2BJMH 1JGEB 2GFBB 3BISA 4Y5XB 2BP3A 4P57B 2XWJA 3RY6C 4KJPC 2FH8A 4XMPH 5JHDA 3SDYL 1OAYL 4BH7B 4N8CH 2WUCH 2QV2A 5FYKU 1LO2L 4H88L 3RWIA 4MZ3A 5GGUB 3IXTA 4JJHA 5DRXA 1MIEL 4X8XA 2P24A 4O2FA 2V7NB 3V8CA 4JRYE 5HGAB 3TZVC 3DO3A 4KJYA 2VXUH 3BP4A 3P0GB 5FECA 2B0SL 2DWEB 4PJ8C 4XPAH 3ARDD 3K8LA 1NC4A 4P2CG 3IDIB 4OCYH 3VFPB 1ETZA 1T7YA 3PABA 3MGOB 5E00B 4GMSH 1E4WH 3S37X 3ARFB 5E94A 4JRYA 3WHXA 1D5MB 2WINB 3DWTA 5ACMA 1P9MC 3RDTB 5DJYA 3F7QA 1F42A 1ACYL 4K7PX 3SDAB 1B4RA 3QRFM 4ZXBB 3GSUB 5EU3A 1U8JA 4LDOB 1AGEB 3P3YA 2OR7A 4GG8A 2KPNA 2PYEE 3SGEI 3CPLB 1BLNB 5EA0L 4AL8L 2CR3A 3BGFB 3QWQB 4Z0XA 2V5TA 2XG5A 5IOPB 1QSEB 1H0DB 2EO1A 1JYWA 4ZD3L 1NPUA 2J4WL 4XNMA 3UTQA 3S8WA 1KENL 2E6PA 2FATH 2C5DC 4XCCL 3O6LL 4PGBA 2CRIA 3GSOB 4R2GB 3TPUA 4X83A 1DBJH 4OZIB 1EVUA 3QDGD 2DMBA 3WFHA 2X89A 1PJ9A 4XGZA 2F5BH 4LLDB 3FB8B 1NBVL 2AJSH 4O02L 1JHTA 1PYWB 5D5ME 1YEEL 2AXFB 3FFDA 4AY0A 3GMOA 5F7FA 3WUWA 3T0EA 4M6AA 1I8KB 4GO6B 1T6WA 1A4JA 1FL6B 4LIQE 5DMKB 2JK5B 1LK2A 5C0DA 4TVPD 2CUMA 2G9HB 3EDKA 5E5UB 1PX4A 1RUPH 1BFTA 3L5XL 5EUKA 4K94L 2ZSWB 5D5MA 1IAIM 2A6IB 5DVOA 5SX4H 2QLVB 3QA3A 4JFDD 2BY3A 3TYGH 5ID1A 3D25A 1XGYL 5HI5D 3X17A 5I1LA 3MJ9L 2J6EH 3D3VE 4J3XA 5CP3H 3SKNA 4IHOB 43C9A 3D9AH 4YZFF 3TBTB 3TFKD 4LBEB 3FZUC 3VFVA 1WFTA 2F5AL 3MLVH 4D3CL 2X9YA 3O4OB 1YEDA 3FOMA 4M61A 4KHTH 3ULSA 1A7QH 1GGBL 2I9LB 4YDJA 4Z6AT 1Q0XH 2NY4B 4DFHA 2Y06H 1U8PA 4QRPD 1BVLB 1BQUA 1V05A 1BBJA 3GB7B 5JXED 2EH8H 2G2RA 2E7LC 5D1QB 4Q0XL 5H94A 1B2WL 4XZUB 1U3YA 4KRPD 1LD9A 1FO0B 2NTFA 4L9LA 4LVHB 4J7RA 3G08A 1Z0NA 2QQLH 5F96H 2NLJB 4F57H 1MQKL 4MXWH 3L3OA 4ONGH 5EO9A 4GG6A 3RGVD 3SY0A 3MLRL 4MVBC 2DKMA 5DGRA 5HPMA 4D0DB 3LD8B 5D8JL 1SEBA 2GUOB 3MRPA 4P59H 4P2RA 1E28A 1NLBH 4CMHB 4M1CD 5C3LD 1A8JH 4HGWB 4WO4C 4KMTH 2VDML 5ESQA 3BPCB 5I1HH 1TPXB 5E99H 4PJFF 3VFNA 3ZKND 4HQQL 1I8MA 4E0RB 5DHVH 1PG7X 1JGLL 3R0NA 1U58A 4KZDH 1RIHL 3O4LB 5F8RC 3TVMA 4FN0A 2C1PA 4GW1A 3L3DB 4U1NA 3IU4H 2FJGA 4X7TA 1OSPL 2WIIB 5D7JD 1J8KA 3MLTB 3WV0A 5DT1H 5F7YC 1XGRB 2PXYA 3V79C 4Q9CA 5IMOB 3RIFF 1PZUB 2NX5B 3MCLH 2OL3L 5BVPL 1MCSA 4OV6F 3BX7C 4OZHB 1S9WA 3T2NH 1IKFL 1F8TL 4KRLB 4QXTB 3PWUA 3SDCB 12E8L 4PP1C 3EJZD 1IAII 2RFXB 2LU4A 4KI5D 1KELH 5TE7H 4Y19A 3BZ4B 3RA7L 2WWKT 5TGBB 2DICA 5TFSH 2ZCLH 5CEYA 3DYMA 4O9HH 4U49A 2FD6H 3IU3A 5FV1L 3DMMB 5F7DB 1HHGA 1ZGLA 2P45B 3HS0A 4MA7L 3EFDH 4QXWA 3VXUD 3D2UD 5BV7L 4XVUC 2P8PA 4HCRA 1RHHA 3K4AA 4M5YH 2IQ9L 2OCFD 4LGSB 3V6ZB 5HYJB 1CDGA 3OKNB 4TQEH 3WL9A 2HFGL 4LHUA 3RX5A 1R0AH 1I3RA 2GAZA 1FL3A 4NZTH 4AG4L 4G5ZL 1S7VA 4NFCA 3LH2L 3CFDA 4KKAC 4Y4FB 5DUPH 1J1OH 3VWJD 4N9OB 5ETUA 2NY6B 3KS0H 1KIUA 1MJ7L 2CGRH 3QRGL 5A16B 1KTRL 4YDIL 4I13B 1V5JA 4BQBA 4O51A 1D9KC 3N1MC 4MDIA 1HNFA 4RRPA 1OCWH 4PJ5E 5K9JH 2DQHL 5AZEH 1T2QL 1KEML 3PQYE 4LSSH 1JGEA 2GFBA 4FXGB 4P57A 1REIA 4KJWD 4PJ9C 1XR9B 4GKNB 3N85L 5CJQL 2C3HA 4F33B 4WUUB 4HZLB 2OBGA 4BH8B 5IBLD 5GGUA 5I30H 3VI3F 3SKJH 4NQEA 3GMQB 3AB0C 2V7NA 5DJXB 3P40A 5C08D 2CRZA 3HMXH 3DUHA 5HGAA 1O7SA 5AAMA 3EYOA 3RUGF 3WXWH 5KSUB 2MQ0A 1UA6H 5EN2B 2DWEA 4L1DA 3BPOC 4U0RB 4LSRL 4BFBD 3TH2T 3HUJE 3MV8B 4YHMH 1QFHA 1T7VA 3MGOA 5E00A 1AJ7H 3IDUA 3ARDC 2ZNXA 1DQML 5GS1B 5CCKH 3ARFA 1U8KB 3QQ3B 1D5MA 2HT4D 2WINA 3D85B 3ZL4L 4ALAH 3EYFB 4M4RA 2XQBH 4TNVF 3RDTA 1PD6A 4WEUD 3SDAA 4HXBL 4KU1A 1PDKA 2NR6D 1I1FA 3GSUA 1UH4A 1OL0A 2VDKL 5FM5O 4NN5C 1J1XH 2AS5M 1AGEA 3CLFL 4YO0B 4YX2H 3VGFA 4F7TB 1T0NB 3CPLA 1BLNA 2DDQL 5DHXB 5MP6L 5IOPA 1QSEA 2YD4A 1H0DA 4TPRL 2N56A 2DJ4A 1D5XB 3U7WH 3SDDD 1JWUA 2CMRH 1OP9A 2HWZH 3F5WB 3FFCD 2A6KB 4OZIA 5DFWH 3BSZH 3CH8A 3C6LA 4UTAL 4WFGE 3HNSL 2B5IC 4LLDA 4KDVA 5F93C 4FQ2L 1PYWA 3ESUF 1EZVX 2AXFA 2NY5C 1FC1A 2P5ED 3PWPE 5AD0A 2DKUA 2OR9H 5KZCD 3JV5A 4AEIL 1V3JA 4DGYL 2R56H 3OF6D 1FL6A 2FJHB 3L3HA 4I18C 2DQTH 3EOAA 4K2UL 5MEOA 5EZIL 1YQVH 2FHFA 1L7TL 2G9HA 2IPKB 1AC0A 5C2BL 1FG9C 2A6IA 1A1MA 2A0LD 5HXMA 5L2KD 1YNLH 2N7BA 1FIGH 1IFHL 4LSDA 4XPHL 3BE1H 4XX1G 2OMBA 4DOHE 4IHOA 2KQMA 3TBTA 5I74C 4OJFH 4LBEA 4DJMA 3GBLA 4U7MA 5DD0L 1OAUH 3BWAA 5HI5C 1WISA 4BQ8A 3O0RL 4NP4H 3WDHA 3TFKC 3D39D 4TOYL 5CLTA 3DSNA 4O58L 3UYRL 1BVLA 4GQ9H 4ZOBA 1IC1A 3EO9H 3GB7A 2DL2A 1Q1JL 1QA9B 1A7PL 5FDWB 3AREB 3GSNB 1T1XB 3GIZH 2DM4A 5F9WC 3MPCA 1YYML 1BGXH 4XZUA 1XCTA 4JPKL 4EVNB 5HHOB 5JXEC 1FO0A 1QKZH 5I17B 5CFHA 3AC0A 5D7IF 2R29L 1JPFB 3MV11 2NLJA 1RJYB 2K9UA 4L8DB 4RMUA 4KRPC 4PJGF 1YEKL 2VAJA 4X7SH 4LCWB 1EGJL 5I73C 4D0DA 3O4LE 4X8JB 5EZOL 1HCVA 2Z8RA 3IFPB 5FUZL 1NJ9B 3MLYL 2ADJB 4N68A 4L3EA 4HGWA 5CZVL 4UNVA 3BPCA 4YPJA 2FX9L 4FQLH 5F6IB 3FT2B 2L7JA 2NX5E 3ZDYE 2DKSA 3H3KA 1E4JA 3HI1B 4GW4A 4E0RA 4X80H 5JDSB 1MHPL 2XPGB 1TQCB 4OZHE 4WW1A 3O4LA 1TVHB 2VLJD 3ARVA 4PRBB 2XQYG 5J12B 4LEXL 3L3DA 1G0XA 2BSTB 1L0XA 2WIIA 2EKSA 4Z7VE 1DANT 1XGRA 3WNLA 1IQDB 5F9AC 2NX5A 3VXMA 2APVA 3J8F7 4LOUD 5E1AB 1HN1A 4FABH 2VXQH 3F6IA 5D6DA 2BVTA 2BFVL 1G7HB 3SDCA 4YXKL 3JWDH 1FORH 2RFXA 4OD3H 2NTSP 3H42H 1BD2B 4MQXD 3BKJH 1V7MH 3P4MB 3QWRA 5HYJE 1AGFA 4GLRH 3QIWA 4NKIL 3BZ4A 5TGBA 3PL6D 4RNRB 5ITFB 3ARTA 3DMMA 3EJZC 5F7DA 5GRUH 4OUUB 4KI5C 3ILQD 3LDBB 4S0TD 5FHBL 2FR4A 3I2CH 3KPSE 1T1ZB 2A2QT 4YC2C 2VUYA 3ARSA 3DX6B 3U7YH 3IDXH 2EEAA 1MFDL 1GGTA 1J0ZA 3ARGA 5HYJA 4FXLA 4X7EC 3OKNA 1HH6B 4MA8H 1YJDC 2EDLA 3LKSA 1JN6B 2EDXA 4GS7C 3CDFA 5D70H 4Y4FA 4WFED 1OGAB 2HVJB 3CUPB 4HF5L 5A16A 3NTCL 4OLYH 5EZLB 3B9KB 3QCUH 4NHCL 4Y5YC 5T3ZL 4K3GA 4JG1H 4NC0B 3VWJC 4P4RB 4WUUE 1MUJB 5FO7B 5K59E 5LBSL 5A2FA 1NAKH 5FUOL 4IOFD 3T0VA 3CCHA 2OI9B 4BSWB 3L5HA 4GOSA 4XRCB 3W9EB 1NFDF 1KCVL 3OKYA 4ODTL 5A3IC 3RY5A 1XR9A 1PFCA 4GKNA 3RJQB 3WJLC 1CGXA 1C1EL 4WUUA 3LN4B 4HZLA 1FN4B 3MV8E 4BH8A 4D9RE 1IGML 4ZUUB 4OZFH 4K9EH 4KJWC 5CJBA 2ATPB 3VXRD 3GMQA 4K71B 3SE8H 3SGJC 1AXTL 2VXTH 4QO1A 5IBLC 2VTFA 4OIIL 5KSUA 4CN6A 1KEGL 5C3TA 4NNXA 4RMWA 5EN2A 2AJ3B 1SM3H 3A0OA 1CQKA 2IAMC 2WSKA 1YN6B 3MR9A 3MV8A 4I2XB 5KAQF 5ISZB 3O2DL 1ZANL 5ILTL 1B9ZA 1EEYB 1KF9B 1U8KA 3IRPX 2V9RA 1MCBA 3QQ3A 4QHMB 4KPHH 3T09A 4ZODA 2QR0B 1IKNC 3EYFA 3EZJB 3KXFD 1EUTA 1RIUL 1NGQH 1LK3L 4Y5VB 3IGAB 1DQLH 1T66D 1N5YH 1D6EB 1L9NA 2HT4C 3H0TA 5CINH 2WQRA 4YO0A 4OD2A 1OTSC 3IDJB 1T0NA 5D7SL 4MXVF 4NWTH 1T0PB 2WMPA 2OTWB 3BYYA 1I9IL 5D2NB 3QG6A 5DRNB 4CVWA 4MLIA 3GMRB 3SE9L 1D5XA 2EEDA 5L7XL 3E6FB 3F5WA 4M43H 4G3YL 2IG2L 5A1AA 2A6KA 2HTKD 1AGDB 3RWJB 1KLFA 1A0QL 3SDDC 3GO1L 5DMYA 4Q9QH 2XTJD 5I8EB 4WI2A 4DTGL 4OGZA 5IVXF 1WZMA 2JJWA 3SKMB 1DDHB 4POZD 1S7QB 1GZPB 3ZDZF 5C0BD 4K3JL 2HKFH 5J13C 2OP4H 3CFCH 5ADOH 1X4ZA 2SEBB 4UQ3A 3VXNB 3D69B 2IPKA 5MEPB 2OZ4H 1S3KL 4TULL 5F72S 3AMKA 4HUXB 1LE5B 1PGRB 1KPRB 1CTNA 1MI5B 5E9DB 5T3XL 4M7LL 1F4YL 4EQ3A 3EO9L 4U6YB 4PJBA 5B3JE 2A0LC 5I71C 3BKYL 5CGMA 1LDSA 1BGXL 3ILPB 3L5JA 1KXTB 4NFDA 4HXAL 1EJOH 1JNNH 5HHOE 4FMFA 5HVGB 1QSFD 4G6AD 5KJRH 1JTOA 3VW3L 5HHXH 3WNPA 1R3LA 2ADGB 2V5RA 3JWOL 1G7LB 1OW0C 5D9SA 4LCWE 1QA9A 3HRPA 5FDWA 3AREA 3GSNA 3FQTA 1RUML 1QFUL 3WIFB 1MWAB 4CUCA 5TF1L 3QXDB 4S1DD 3S9DB 3CXDH 4MJ4A 2NXYB 5HHOA 4EVNA 2XZAL 1ODAA 5EOQL 5I17A 2A1WH 4LVNB 1JPFA 4R4FL 1RJYA 3FQRB 4L8DA 4PBWD 5BV7C 1MCPL 4YK4B 1KB5B 4RGMC 3MRHA 3ZT5A 1QRKA 3EYUL 4X8JA 1I7TB 3S5LB 2J8OA 1NJ9A 3FOLB 2G60L 5L8JB 1CDHA 3MV01 2ADJA 1QOKA 1J5OL 5IB2B 3QFJB 1XH3B 1AE6L 3FT2A 1EPFA 1Q9KB 5EIIB 1DLFH 1CL7H 4LHQB 2RGSA 4XBPB 5JDSA 2XPGA 4PJFB 1EHAA 2OJZH 4P5TD 2BVOB 1TVHA 2I60H 4FNLH 3LVEA 1JPSL 4OCXL 4QEGA 5HDLA 2FX8H 2BSTA 2P42B 3NA9L 2CJUH 2F8OA 1GGIL 2DLHA 3WN5C 2VLRB 3MRDB 1MY7A 4HSQA 4HT1L 4OGAD 2UZYB 4GXUM 3HC3L 1QLFA 1RQ5A 2R2HB 5HD8D 3U1SH 1G7HA 3QCTH 1P5VA 3DVGB 4P3CH 4M7KH 3T77B 3TF7C 2DI7A 2AQ1A 1BD2A 4YHLL 4L3AA 3P4MA 3EJYD 5EORH 3C6SB 3FN3A 4PRPB 2VQ1B 3HC0B 4I9WD 1VSCA 4JEGB 4M48H 4MQXC 4OUUA 1BZ9B 1U3HD 1L6ZA 1GGYA 3SE4A 4WWKB 4BFEA 5DFTA 4NC1E 4FS0A 3PL6C 5CUSL 1OGAE 3UBXI 4OZGB 5DRZA 4NUJB 4R3SB 4Y1AB 2H2SD 3ILQC 4KZEH 3HNTH 5CMAB 1M7XA 3ZE2E 1MLBB 4JB9L 3HA0A 3N1PC 3LZFH 2CK2A 4N9GB 4F7MB 1JN6A 5JW3H 3VJ6A 5JA9A 4ORZC 4KTDL 5T1LB 3EDDA 1OGAA 4IDJL 2HVJA 3CUPA 3B9KA 5KSAD 4P4RA 2PR4H 1YDPB 3K3QA 4IS6B 5FO7A 2DQEH 3U2SB 3MNWB 2YA0A 4JHAH 1CGSL 2JCCB 1FZKB 5HHME 4XRCA 3W9EA 4UIKL 2IANB 3L3GB 4U1LB 4YXHL 3VXSB 4Y4HD 1N3NA 2DM3A 4IOFC 3SDXF 5CJXC 5JO5A 32C2A 2HFEB 1KULA 3LN4A 1CF8L 5ALCL 1LNUB 1FN4A 4ZUUA 1E27B 1RJLB 2ATPA 2X4QB 2PUQT 3QQ4B 4U31A 1JBJA 2LAAA 1NGYB 5E2UH 2FGWH 1A9EB 4YHKH 4DVRH 3L3IB 1XGUB 2BNRB 3LRGA 1HYSD 1ZT4B 5T3XD 2AJ3A 4N0YH 1ZHKA 2B1AL 3O3DB 5B22A 4QTIL 4DKEL 2OJEB 1YY9D 4I2XA 5ISZA 1GGCH 1OP3K 1K6QH 3A67H 2DLFL 1EEYA 1CGUA 4MWFA 4FQJH 4QHMA 3O6FC 2QR0A 1HXMB 5D2NE 3QCVH 5HBBA 1P84J 2WW8A 4FTVA 4Y5VA 2CKNA 4QRTB 3SBWC 5B3NA 3D18B 4XVTH 2YUWA 1H8NA 2FECI 2X4OA 2ZCKL 1MCRA 1I75A 3IDJA 1QBMH 2GT9B 1T66C 3RPIB 1HHKB 4LSPL 5DRNA 5D2NA 1J7VR 3GMRA 4JFED 4S1SL 1JK8B 1MFAH 3E6FA 3QI9B 2B1HH 5BOPA 5CEZE 2CPCA 4Y8DC 5L2JB 5LGJB 4Z78B 2VRAA 2I5YH 5I8EA 2XN9E 1Y6NR 5CJ5A 4QXGH 2LTQB 1HQ4B 2HTKC 3KPRD 4N0RA 1MI5E 3T2QA 5E9DE 4UOW1 2I25N 1DDHA 3KDMB 1QBAA 2HJKA 3I6GB 4JN2B 1S7QA 2AJZA 4OLWH 3IDGB 1BFVH 4OSUL 2SEBA 3VXNA 3D69A 4JZJB 4YHYC 1CIUA 1UVQB 2FEEL 4LGRB 1PG7W 1DSFH 5MEPA 3K0WA 2R1XA 4LIQL 4FZ8H 4YZFE 4MS8D 4WHTB 5H37H 3M17B 4KI5F 4HUXA 5INCB 4JKMA 1J9CT 2NY3D 1O7VA 1KPRA 1MI5A 5E9DA 3S4SG 5I1CH 5DVNA 1F4AA 5C0AB 4V2BA 2R0LL 1JNLL 5FA3B 3OR7A 3U4EB 2P8MA 5DWUL 1YMMB 5HDQH 3QG7H 4XB8A 2P5WE 1XIWA 3DO7B 2J7LA 2HTLD 3VFGL 2EXYD 4W81A 3CVIH 1EXUA 4M7LT 1RD6A 4QLRA 3UDWA 3VDBA 2Q76B 5DEGB 1H5BB 1V7NH 1C5DB 1MCEA 4LPUA 3RVTD 3X3GH 1WBYA 5JPMB 1DCLA 2ADGA 1Z6JT 1G7LA 3U0TB 3PP4L 4CVZB 1LP9F 4G8EA 3VFOB 3W9DA 1I85C 1MWAA 4G6AC 4Q6YA 4R6UA 2YPVH 3QXDA 3NABL 2O5YL 5JZ7D 4OQTH 3S36L 4IOSD 5KANG 5E8NB 3RHWF 3MYZA 3KLDA 1VFMA 4M93B 1MFBL 3FQRA 1DVFD 4OFIA 4S1DC 3V7MA 1MHCB 2WLZA 2JB6B 5IMKB 1KB5A 5TE4L 4PJFE 2I60L 4K7PH 1I7TA 3S5LA 5J6GB 8FABB 2A77H 1NQBA 2LE9A 1ZHLB 4U3XA 4DUXA 5JPNB 3WFBL 1S7WB 2Y23A 1P7QA 3RZCB 4ZS6D 3CAFA 5EUOF 1OTUD 4HLZG 1CK0L 2JJTA 4XPGL 1CGYA 5IB2A 3QFJA 4OFYA 1XH3A 5F9DC 2Q8BH 2VLRE 1IGCL 1IC7L 1Q9KA 4ODVL 5EIIA 4N5UA 2VXSH 4FQCL 4YGVB 1MFCL 4JPWH 2BVOA 1BEYH 4ZPVB 3O41A 4P9ML 4U6VL 1OQOA 2L4OA 3QZWG 4HC1H 1OTTC 4N8VA 4HGMA 4R7NA 5KVDH 2VDOH 4WUKH 3DV4A 1WITA 3PV7A 2AK1H 3HB3D 1PZ5A 3HAEG 4P5TC 1KCUH 4PRPE 1CG9B 4CBPA 4E42B 3ELAT 4OF3A 3L1OH 3MRDA 2F53E 4LLYB 1L7IH 2YD9A 1JGUL 2RIKA 3U0PB 3QISA 2R2HA 2VMFA 4Z5RB 3DVGA 2WBJC 5JUEH 1RMFH 4OZGE 3T77A 1MNUH 4MCYB 4XNYL 4WDIB 4Y1AE 5ALBL 3WIIH 4OGAC 3GMPA 1UWEL 1CZ8H 3C6SA 4HCRL 4HUUB 4JRYD 5HD8C 2ZUUA 4PRPA 1OSZB 2V2TB 3GMMB 3KPPA 3MUHL 2BCKA 2APXA 5CILH 3WS6A 1BZ9A 3EJYC 4G7VH 3QUYB 4P46B 5EFIB 2VR4A 1B4JL 4WWKA 1VENA 3GEWB 1FYTA 1UQSB 4OZGA 5CSGA 4NUJA 4R3SA 1U8MB 4Z7OF 1D5BB 5CJOL 4TVSa 2HLFD 5CMAA 1MLBA 4QXUL 1P5UA 4RA3A 1QP1A 1FZOA 3WIHH 2V5MA 2P7TB 1HKLL 5C8JA 4ORGB 5I0ZA 2ADFL 4JFXB 5LVEA 2ZP0T 3KR3H 3IFLL 5T1LA 4YHZL 4IEFB 3RWFB 4K7FB 4YBLB 1WAAA 1TCMA 1T83C 4M5ZL 2X89D 4PGEB 4H0GA 3S97C 2DQCL 4OGXL 3QH3B 2D03H 4NGHL 1A6UH 5E7FA 3PWVB 4WJ5B 4ZOAA 4IS6A 1GAFH 3MNWA 3Q1SL 5DK3A 2JCCA 1FZKA 2Q1EA 2B2XL 5KSAC 3MV9B 5E2UL 2IANA 3L3GA 4U1LA 3VI3E 1IILE 3BPNB 3VXSA 1QRNB 1B3JA 1PSKH 1B0GB 2BNRE 1FV1B 1EIBA 2W9DL 2XKNB 4R7DB 2EO9A 1EFXD 2WWMD 3RUGE 1RZFH 1YN7B 2FH6A 4WNQB 2HFEA 1UM6H 5F97E 2F74B 1LNUA 1CLZH 4ZFZA 4I3SL 1F13A 1E27A 1RJLA 5IFJB 2X4QA 2W0LA 1FGNH 1U91B 4JQVA 3RTQD 3QQ4A 3OX8B 2DQUL 4I48B 3WS3A 1NGYA 4NRXB 3MXWL 1A9EA 3AROA 4YUEL 1XGUA 2EDDA 1PG7H 1ZT4A 4ZUVB 1OOAA 3O3DA 2OJEA 4KAQL 4OM0H 3WE6B 1INQB 1JHKH 3QHZL 1SBBA 3C5JB 5FA4B 1HYSC 5BW7A 5JXAH 4L8SB 1BBDL 4APQB 4ODSH 4JANA 4JO3H 3T1FB 1HXMA 1YY9C 2Y5TB 4S0SD 1KJ2H 3WCYA 2X4SA 5DJCB 5B8CC 4X9BA 4QRTA 4OCWL 5C86A 1DQDL 4KY1L 5IM7B 1ZVSB 5TE6H 5DGQA 3OV6A 3U82B 3VFRB 4R4BB 5C0NC 1KN4L 5IBTH 5AZ2L 4GW5B 1T4KB 2I5YL 2GT9A 3RPIA 5GJTH 3BRGC 2J88L 4HIJB 2Y72A 3HC4H 2HRPH 5I6XB 2ZSVB 3JWOC 2E9IA 1FZJB 3RIFK 3OBAA 1JK8A 1XF4B 2JJUA 1WLHA 4JKPH 5DLMH 2AJXH 3AY4A 3QI9A 1AFVL 4ZG1A 1NH6A 4RDQG 3S98A 5GGRB 5DJAB 2EE2A 1KJ3H 4NJ9H 3B9AA 1P2CB 5L2JA 1MH5B 3TT1H 5LGJA 5CD3B 3V6OC 2YA1A 1DANU 3KJ6H 4LLUB 1P4BL 4FP8H 5FV2A 1I4FB 3WXVL 5IB5B 1HQ4A 4MA3B 4J3TA 5DHYB 3TVMD 2YBRB 1U3ZA 4UQ2B 3KDMA 4JN2A 4MMXC 4LSTL 4WENB 4OFKA 4WV1B 4HG4J 2PO6D 3IDGA 1OLZA 2IPUG 4I77L 4JZJA 1UVQA 2PXYD 3L3KA 4PGCB 3OPZH 2VERN 4WHTA 1AQDB 5CWSB 1Z3GL 5INCA 4OCLC 1IAMA 5C0AA 1QFWH 2BHZA 4OF5A 3W81A 4MS8C 4BZ1L 1RFDL 5FA3A 1PY4A 2FCBA 5DK0B 3U4EA 5CAYB 4Y19D 3CFBB 2NY3C 1I8IB 4FHBD 1YMMA 3EYQD 1LEGB 1KFAL 4U7SA 1NCCL 3K80A 1HILA 3DO7A 1ZLVH 1KXVC 1F3RB 4PJ7F 3S37L 1H5BA 1C12B 1C5DA 1FO0L 1Q9OB 2HTLC 4L3CA 2EXYC 5D7IE 4CVZA 3VFOA 3RBSA 1MRDL 4LHUD 2XIDA 2JJSA 3BT2H 3ESVF 1JPTH 2CLVB 4PBVC 3C60A 1DUZA 1UEMA 5E8NA 3QEQB 5ERWB 3RNQB 1E4KA 4WFHD 2X10A 4O4YL 1MHCA 2JB6A 2E7HA 1MELA 5HGGS 5ACLA 2QSVA 4PIRF 5ACZB 4GRWF 5J6GA 8FABA 1DVFC 5JPNA 1ZHLA 4H0IA 4DUWA 2X9XA 4PJIF 3RZCA 2NY0D 3B43A 3T1WA 2FIKA 3CSBA 3S34L 5E8DH 5LKNA 1UKQA 3PXJA 4F15C 3Q3GB 3STZA 4P3DA 3I84A 4ZS6C 5IMLB 1J05B 1OP3H 4F9LC 1CE1L 4YGVA 5C0IB 1DBML 4TNVK 1IL1B 1QLRA 4ZPVA 5DRWB 1UEYA 3D5OF 4FFYH 5D7LB 4WVRA 2GJZB 5FYJE 4K9EC 4YHOL 5BS0B 1Q72L 2UY7A 1CG9A 1JVKA 3ZTNH 3UO1L 3S35X 4G8GB 4E42A 5KTEL 4LLYA 4LL9A 4O2CB 1NBZB 4UDUA 3HB3C 3QULB 5F1KC 4G7YL 3B83A 5FYKH 1N4XH 2IH1B 4PJEF 2PW2B 2Y1VA 4RFOH 4MCYA 4WDIA 3UTZB 4CDHA 5I8OL 4D0BA 5KW9H 3MNZB 1LEKB 3ARFD 3CLEH 4HUUA 5JQHC 3SOBH 1OSZA 2V2TA 3GMMA 3RDTD 3UJIH 2WP3T 3CXHK 3SDAD 3QUYA 4P46A 5EFIA 2D9QB 5EC1B 1AO7A 4ZXBD 1TETL 5E70A 3V4PH 1R3IH 1UQSA 1HDMB 4HWEL 3STLA 1VFUA 1U8MA 2CK0H 1D5BA 4UILH 1T0MB 4JKLA 1O0VA 4YAQB 3MREB 3KYAA 4W4NA 2P7TA 3W0WE 3F7VB 1ITBB 1QSED 4H20L 4I8DA 5J06A 2A9NL 3HG1B 4ORGA 2HLFC 3CX5K 4JFXA 1X3DA 1CVSC 1KBGL 4H1LG 3QUZA 2E6QA 4R2GD 3RWFA 1QRNE 4XP6H 3V0VA 2VE6A 3G5VB 1NFDE 2GY7B 4NZRH 3BP7B 1NUFA 1CXKA 5MI0B 4RISL 1TZHB 4LNRB 4WJ5A 2UYLA 3NH7H 4ZUSB 1GOGA 1NDGA 1G6RA 2GK0B 4KDTA 3AGVA 2CO6B 1TJIL 3PGDB 4L8CB 3MV9A 4KVNL 3JTTB 3SGEH 4H0HB 5I8KL 3DROB 1B0GA 1FV1A 1PG7L 2XKNA 3NCJL 4R7DA 5CEXA 5HDOA 1QR4A 2LU3A 5GRYA 3DIFB 1YN7A 1F90L 4WNQA 5C0CB 2F74A 4OB5H 3UJJL 3FN9A 4XB7A 5IFJA 1KGCD 1MCQA 1U91A 1CXLA 2WWMC 3GJFH 2C1OB 3L7EB 3OX8A 4HWZB 1JPGA 3KYMB 4JO3L 4NRXA 4OGYL 2BC4B 1IE5A 2NYYD 2XKUA 3N9GH 4JY5L 1T5XB 1MVFA 1MRFL 3RTQC 5DI8B 1NMCB 5L88L 5FIEA 1INQA 4WW2A 3C5JA 2NY4D 5FA4A 3V7AE 1DBAL 5AG9A 1H3UA 1T6VN 3HC4L 3KVQA 4APQA 3GSVA 1A9BB 3T1FA 3V5KA 3ALWA 3BAEH 4DKAA 5D1QD 2GJ6A 2Y5TA 4MXVE 2R2EA 3K7UA 4U2ZA 3R8BB 5IIEB 3WFCL 3O45A 4DWHA 3O3EB 4YPGA 2CLRB 1ZS8B 5IM7A 3B2VL 1YEIH 4G6JH 5E6IA 4LAQH 3VFRA 1IQWH 4R4BA 2BY2A 4JKKA 3V5DB 1JJUA 4GW5A 1JGVL 1T4KA 4U1GC 1FL5B 5CSBA 5JIHA 2FWOB 5JQ6L 4DW2L 4HIJA 2A83A 3IKKA 1UADC 2V7HA 1J86A 3SGKC 3S88H 2ZSVA 4L9LC 1JZ3A 1FZJA 3EYVB 4LLQB 1XF4A 4GFTB 2DLIA 3EFFB 1KTLA 2X44D 3VH8G 4G9DA 3CZFB 5IVXE 1EHLL 5GGRA 5DJAA 4DGVL 2IPTH 4I4WA 5KSBF 4ONFH 4JKWA 1P2CA 3TBSB 3ZDZE 5I1GH 4J12A 5CD3A 4I0KA 2GJJA 1I4FA 2HT2D 2VZOA 5MEQB 1OPGL 5IB5A 4MA3A 3O4LD 2YBRA 3KYOB 5C9JB 4UQ2A 5FYLH 5FEBA 3DSFL 1AP2B 2R1WA 3BN3B 4L4VB 4WV1A 3ULUE 5IB1B 2MSPA 2V5SA 3TVMC 4M62H 1CR9L 2NX5D 5CEZH 3WFEL 1P4IL 1AQDA 5CWSA 5D1XB 2PO6C 3LHPL 5DD5H 4LQ1A 1A7BA 3F58L 5JOFB 2PXYC 3SDCD 3WLWD 3OKOB 3EHBD 5DK0A 3QWRD 5CD5D 1MFEL 2IH3B 3CFBA 2W9LA 1P7KB 2HH0L 4NZDA 3TN0C 3BIKA 3OQ3B 1LEGA 1D3CA 1VDGA 4HKBB 1P53A 3DMMD 2FBJL 3GSNL 4CW1A 3MV7B 2XA8H 3TESA 4OLXH 3EYQC 3A6CL 1LDPL 3QEQE 7CGTA 1C12A 1UCBL 5BVJA 1Z2KA 2R4SL 4V2CB 2FEDD 1Q9OA 4QRRB 1HXYB 2JLLA 5HYJD 2MCPL 4CMMB 1Q9WA 2DMCA 2JKXA 3OMZA 1I8LA 5DJ8A 5C1MB 5HDBF 1LP9B 3M07A 3MLWL 3MRKB 4QHKI 1IEAB 3PGFL 4QNPF 1PY9A 5TH2B 4Y4FD 3QEQA 3RNQA 2NY6D 4OKDA 3EOTH 1UZ6F 5GS0L 3KPOB 1PEZA 5JHLL 3Q6FB 1VACB 1NEUA 4JG0L 5ACZA 4LGPB 3FJTA 5D7LE 4B53A 1VHPA 2O5ZL 4XC3H 5T5FH 3SJVB 1KCKA 3V0WL 5ICYB 4M6OL 1YEFL 4Q2ZB 5HHVH 4OLZH 2DBJA 2DQJH 3L7FB 2AI0L 2B8OT 3EDEA 3Q3GA 3RX8A 3TWCL 3NFNA 5IMLA 2NY0C 1J05A 4G42B 1RZJL 2OXHA 1YQ2A 4TUOB 3FB7B 4EBQH 1JRHL 5C0IA 4WUUD 1IVLA 1DFBL 1IL1A 1F11B 4Y5XC 4EXKA 3FONA 4NNPH 2GJZA 1Y6KR 2VLKB 3E2HB 1J1PH 5BS0A 5F1SA 3FRUB 4MNQB 4ZFFB 2AEQL 5HSFA 2YD6A 4ZFOB 4G8GA 2CQVA 1A7OH 4RDQF 1A6AA 2JELH 4J6RH 5FO9B 1W0VB 4I1NB 4O2CA 1NBZA 4XVJH 3MA7B 5ESAB 4WI9A 1NKOA 2IH1A 4J4PD 5IT2L 2PW2A 3MV8D 2G5RA 4XNQB 4D9RD 1JHLL 2AXHA 4OLVH 2ZG2A 3UTZA 3MNZA 1LEKA 2R4RH 1KJ2A 5C9KA 1XCQB 4A2LA 3D85D 1B90A 2XWTB 3W5NA 3RPKA 4CU7A 4MGXA 4MD4B 4YE4H 3HG1E 3ARFC 4GXUN 4HFUL 1YPZB 3OKEB 5EC1A 2D31B 5TDNB 3G5YB 5E6ZA 5EO1B 1HH9B 3RDTC 1OAXL 5CIPB 3L9RA 1JL8A 4TSCH 2ZPKL 5C6TH 2Z4QB 1T0MA 5D2LB 3MXVH 2QQQA 2ERJC 5DMGD 4ZXBC 4AIOA 4PV8B 3GDBA 3MREA 3T0WA 2P47B 3F7VA 5C0FB 5DVLA 1WF5A 3HG1A 3D0VB 1WEJH 3VI4F 3BGFC 4Z7UA 4NWUL 5DMJB 3CFIC 1EEQA 5J11B 5IW1B 3G5VA 3E8UL 3BP7A 5C09B 3NIDF 4HBCL 4NBXB 2YMXL 1TZHA 4KWUA 2OM5A 5F21B 2ILLA 5JLZB 5K9QG 3SDXE 2GKIA 2GK0A 2ITDB 5GGSB 1MAML 2AAVA 3PGDA 4L8CA 2HYMA 2E8ZA 1C5BL 2ITCA 3JTTA 1MCCA 1A7RL 5IVZB 3DROA 1DEDA 1OVZA 4WHYG 3VD5A 2XG4A 4JPVL 3DIFA 5C0CA 1NCWL 1CWVA 5D96B 3X12B 1UM4H 3LEYH 3K81A 2F54B 4KUZL 1NBYB 3TT3L 3RVUD 3O8XA 1NUGA 3L7EA 4HWZA 3KYMA 2BC4A 5IFAL 1U8IB 4QYOA 5HYIA 2D0GA 4NQVB 4OTXH 5EU6A 1KCSL 5DI8A 3TBVB 3BZFA 1DE4B 3UTTB 3FMGL 2NYYC 3FO0L 4XWGH 1OM3H 1A22B 3BDBA 1NCDL 2AJVH 2MTPA 3IS0X 3O4OC 4NQDB 1A9BA 3TA3B 2MHAB 3LIZL 3ARED 4WEBL 2NY4C 3ZLQC 1KCRH 1VGEL 2NY7H 3IDMA 1BIIB 3AMLA 2XRAL 5IROA 2VH5H 4XNXH 4MQSB 1MPAL 2CLRA 1ZS8A 5HHOD 1FNHA 1T03L 3MLSH 5EOCJ 5D1QC 4GXVL 1UM5L 3O2VL 5HTSA 1CICC 2W60B 3GK8L 5F7EL 1I7UB 1FL5A 5BZWB 3NACH 4XT1C 4LSVL 5I15H 2FWOA 4LCWD 1RUAH 4LVHC 1F6AB 2R0KH 1A5FH 4LLQA 3NIGF 4HWNA 2ZUVA 3EFFA 3WJJA 1SHMA 4U0QB 1AY1H 3CZFA 1IT9H 2Y4SA 3CH1A 4PP2A 1F3DH 1HINL 1JYXA 3IJSB 3ETBF 4UDTB 3ARQA 1BAFL 5GS0D 3LD8C 4N8PA 4ZSOB 5I19H 1N5AB 4CMHC 1RAMA 4KRMB 4HIHB 1I3GL 5KVFH 3LQZB 4X99B 4U05A 3ULVE 1VKXB 3KYOA 1TPXC 5C9JA 1AP2A 4JHWH 2HT2C 4L4VA 4FG6D 4CVXB 3RKPA 4KJQD 2VL5B 3LN9A 4U1KA 3VXUE 3VFWB 5E2TH 1QQDB 3MV7E 5D1XA 4IMKC 4XHJD 1BFOB 5AWNL 2B4CH 1HCFX 5E4EB 4NT6B 4OI9A 3OKOA 2VR5A 1BD2D 3GI9L 1FNSL 4QRRE 1X5GA 2IH3A 4L29B 5T1DH 5D6DC 1P7KA 1OP5K 2D7TL 3SDCC 2X4PB 3WLWC 1AKJA 4HKBA 1LP9E 4W6WB 4Z18A 3TIEB 3EHBC 1PW3A 1N0XH 4HPYL 3MV7A 4XAKE 1X5HA 1MWAL 1IAIL 2XWBB 2EC9U 1KN2H 3P77B 4NQSB 2VIRB 5DK2B 1UWGL 3MSPA 1WBXB 3DMMC 3GNML 2E5EA 4PJ7B 4JJ5A 1HXYA 4CMMA 4YDLB 1JYNA 1K2DB 2I24N 1A14L 1A47A 1OGTB 4M6NL 5KG9B 4UT6H 3VG0H 4M8QB 2AJYL 4NNYB 1KB5L 3MRKA 2FEDC 1BMGA 4QTHB 3LN5B 5I1IL 2IMMA 1EMTH 1J0KA 3SJVE 1DJSA 4TUJB 5TH2A 3DXAB 4QRUB 3DX7B 2VZVA 1OGAD 4M4PA 5EUOE 1JZ2A 3T08A 4NN7B 3MMEA 1S9XB 5T5NG 3KPOA 3B9KD 3MUGB 3Q6FA 1VACA 3VA6A 1IC5L 4Y4FC 1FGVH 2W0PA 4LLMB 2NY6C 4LPYA 4DAGL 3M8OL 1DUYB 1HZHL 1PAMA 4GRWB 4E9LA 4XNZB 4HPOH 4MNQE 5ICYA 1R3JB 1UZ8B 5D5MF 4Q2ZA 3L7FA 3NAAH 1QBBA 5C7XL 4W4OA 1RU9H 4OF6A 4ONOA 4G42A 4JFFB 4X6EB 2XQYK 2D7QA 2GHWB 3FB7A 2VDRL 3Q0HA 3QDJB 4CKVX 1CD9B 3AS3A 3LKRB 4M1DL 1F11A 5EBLB 1QVOB 5F7NC 2VLKA 4FRWA 3FRUA 1EO8L 2UV3A 4OIAA 4HS8L 1C08A 4ZFOA 3INUL 1EHXA 5B4MD 5GHWH 3CU7A 4UU9A 2HAZA 5FO9A 1W0VA 4EKXA 5CP7B 1SJHB 3MA7A 5ESAA 1Y0LB 5HYFA 3RL2B 4XNUL 1QNZL 2OSLB 4XNQA 5ISZD 4MAUL 1CFVL 1MCOL 5ICXB 3R1GH 4GH7B 2VDLH 3WUZA 2V6HA 2XFXB 1XCQA 1M7IA 3V4VL 1CFTB 1X44A 5E2VL 4J4PC 3G6AB 4Z7OE 3BGMB 2XWTA 4RSVA 5BJTB 4PS4L 4MD4A 1EAJA 3FFCE 4K23H 1MEXH 5FUCE 5GS1C 5T33L 4OKVB 1YPZA 3OKEA 4GG6F 2D31A 5TDNA 3G5YA 3VMPA 3MA9H 3QWOB 5EO1A 1HH9A 5IG7A 4LDLB 5CIPA 4WI3A 5C09E 2Z4QA 1G7IB 2P5EE 1M05B 5D2LA 1A3RH 5HGBB 1WVZA 2RJMA 4PV8A 5IJVB 1A7NH 5IQ7H 5C0FA 4OV5B 3CIQA 3S4SB 5FM4A 3EAKA 3ARBB 1DN0A 1HHIB 1CD8A 4FQXB 1GYAA 4I0PC 5IW1A 1NAMB 2FEEI 4KROB 35C8H 1CLYH 2H41A 4P23B 1BFSA 5C09A 5L2KE 4XP4L 1OF2B 3TIDB 5JLZA 5F9OH 1NCNA 4XCNB 2D7OA 2J5LB 4EOWH 2ITDA 4HJJH 5GGSA 3QDAA 3D1MC 4XPTH 2ZG3A 3GBML 1UACL 1FSKB 5IVZA 4R0LB 2QQNH 2UZIH 5I18H 2R9HD 2HT3C 2X40A 1RI8A 2VXVH 3X12A 5GSVA 4M03A 2E9JA 2F54A 4HJGB 1MI5D 4YHPB 5E9DD 1NBYA 4IRJB 1PVHA 3W2DH 2XZCH 5TF0A 3U46B 4NQDE 3TNNB 3NGBC 1Q0YH 3NN8B 3C9NB 1U8IA 5I8CB 1JV5B 1U8NB 5IJKA 4JM4H 2XY2A 3RVUC 4JFPB 3O11B 1GOHA 3TBVA 1DE4A 4PJHB 3HLAA 3UTTA 1VPOL 4A6YH 1EJ6A 5DD3L 3LB6D 2P44B 4NQDA 4MZ2A 2Y36H 4U3CA 2MHAA 5FHAH 1BIIA 3QZWB 2C3VA 1SY6H 2NXYD 4X98B 1J8HB 2HFFB 3HAEB 4YDVB 3ARUA 3AREC 4U1MB 1PX3A 2GI7A 2W60A 4DQOL 4DKFL 1I7UA 4Y16B 4ZSOE 15C8L 1IM9B 1IGFL 3SCMA 3P30L 2EC8A 3E6HA 1BP3B 3LAFA 2RAMA 1E4XL 4UAOB 2OK0H 1G7JB 1XR8B 2IQAB 1ZHBB 3IJSA 3P0VH 3C5SB 5EH1A 3CNKA 4UDTA 3QFJD 4OFYD 2XTLA 4NUGL 5KSBB 1N5AA 5BMFL 1WV7T 4GJTB 4HKXA 3RAJL 4HIHA 5DEZA 3SKOB 3TZVB 4H26B 1A6VL 1JNHB 1S5HB 3LQZA 1FNAA 5GS0C 1VKXA 1I9JL 1CQYA 1E6OL 1YEHL 2QL1A 3GHBL 4RAHA 2BRQA 4CVXA 2MWCA 2DQGL 4CRPA 2EDEA 3H3PH 2VISB 3LEVL 5L0QC 2VLRD 3UZQA 5JW4M 1JZ4A 5J12C 3O3BB 4ZTOH 4K3DL 1SQ2N 2M26A 1QQDA 1W72H 4X6FB 3X3FL 2Y07H 5D1ZB 2B39A 1BFOA 1KC5L 4X6BB 4KJQC 5CHNB 2YXFA 2BERA 4NT6A 4PJ7E 1INDL 4WCYL 4NQXB 3FTGB 4L29A 4XHJC 4PRPD 1P4LB 3O6KL 3OXSB 4UV4L 4H8WH 3TIEA 4PJCB 3U7AA 2QHRH 1ORQB 2WUBL 4BK4A 1IBGH 2XWBA 3P77A 4WWKD 4NQSA 2VIRA 4G6ML 5DK2A 1WBXA 5HYSG 4YBHA 4Y1AD 3LDBC 3N06B 4PJ7A 1U92B 3GRWH 2CRMA 4IRSC 1K2DA 3SE4C 3WBDA 4U1IB 5KG9A 4M8QA 2VDQH 5LAXA 4OZIF 3QJHA 4QTHA 3LN5A 4GRWE 2Y5EA 1CBVL 4TUJA 3DXAA 5T1LD 4QRUA 4F9PC 3DX7A 4OM1L 5DDHB 4AEEA 1A1NB 1NMAH 3FKUS 1LQSR 1T1WB 1S9XA 1SMAA 3MUGA 4WHDA 4JFFE 5INDB 2R8SH 1IARB 3QDJE 4NC1C 5LQBH 2X70A 4LLMA 2FYYB 1OWRM 1DUYA 4XPFL 4RCAA 3OJMB 5E4IA 2Y6SD 3B9KC 4XC1L 1R3JA 1UZ8A 2IAND 5A43C 5J8OA 1URLA 3R0MA 3FB5B 4EDWH 4QHKJ 3I50H 4GBXA 3ZSTA 5I1KL 2OI9C 3IF1B 4LDEB 1JYVA 5KVEL 4YWGL 4XXCA 3LKRA 5GS3A 5EBLA 1QVOA 5K9QI 2ORBH 5TDPB 5DSCB 2ATKB 3BOVA 4PJEE 3BRFA 4ZNCD 3NA4A 4JO4H 5FYJL 5HYQB 3B8YA 2BK8A 2BNRD 2MPAH 3WO4B 5EIQA 4D9LL 1CIDA 4UINL 4K71C 5CP7A 1FVDB 1Y0LA 4BZ2H 3RL2A 1TLKA 1LHZA 2OSLA 4PR5B 4TUKH 5B4MC 1QLEL 2AEWA 3DUSB 4YHNB 3B6SA 5E24E 5ICXA 1HI6A 1LGVA 1LILA 2WWKO 2XFXA 5DJ0B 2FIRT 5FDYA 2E8YA 1BX2A 3G6AA 3BGMA 3WKMH 1FRGH 2VDPH 5BJTA 4E41B 1YY8B 4JVWA 4LASH 5I1JH 4OKVA 1S7SB 4LCCB 1F02I 1MCHA 5DMIL 2XTJE 1U2CA 3QWOA 1EX0A 2X2YA 1INEL 4Y5VC 4WO4B 1G7IA 4PJAA 1J88A 5GJSL 4WI6A 4X5WB 5IJVA 4OV5A 5C0BE 4GSDH 4X9FA 3MQIA 3S4SA 4QHUB 5LWYH 3QB7C 1FE8H 1X4YA 4JQIH 2AJUL 3VRLE 3ARBA 1HHIA 3QI9D 3O81A 5C0RH 1G6RL 4RIRB 5D2NC 4PD4J 1XGPB 4OT1H 2NY5H 1WWAX 1NAMA 2VL4A 5DFVD 5DTFB 4P23A 4G8FB 1VGKB 4AZ8A 2NXZC 3W5MA 5H35B 5IFHL 1OF2A 5DURB 4ZDHB 2BRRL 2H26B 2J2ZA 3TIDA 3QXTA 2RR3A 5IR1A 4P9HL 1XMWA 2YKLH 3VFSB 2VDNL 1KCLA 1OAQL 1KIQB 2RQ8A 4PGZA 4YBQD 2GITB 3IDNB 4XMKL 2OMNA 1BJ1J 4WTWA 1NL0L 5D93B 4R0LA 1WICA 1A2YA 4WY7L 3ALPA 3B5GA 2AGJL 1BZQK 1F58L 4PJHE 1QSFE 4HJGA 4YHPA 5HVHB 3ES6B 4PUBL 5C0AD 2R9HC 4L8BB 4UB0H 2BNQA 2W65B 3U46A 2R2BB 3U0WL 3KNBB 3JV4B 3TNNA 1S7UB 3NCYS 3NN8A 5CGYD 1YMMD 3U30B 4ZAKB 1JV5A 1U8NA 5I8CA 5H2BB 4ZO6A 4JFOB 3IAPA 3O11A 4JFPA 4PJXB 4NQUA 3HPJB 4PJHA 3PHQA 5EPMB 4TYUA 4RFNB 2OTUB 1QBLL 4HWBA 3UDWC 3TJEH 5BO1H 3JSSA 3QZWA 3OXRA 4TSBL 3LB6C 4X98A 1J8HA 1D9KB 2HFFA 5T3ZE 3HAEA 1UGNA 1MRCL 4YDVA 2YR3A 1WK0A 5KSBE 1IM9A 1U6AH 2NXYC 5IHBA 4LU5H 3JBG7 3DV6B 4LSUL 4C58B 4LVNC 4PJ9B 3GI8H 1FAIL 3LQAL 3RZCD 1G7JA 1CGVA 1H3VA 4YK4C 2IQAA 1ZHBA 3IAQA 4Z95H 3PGCA 2XWJB 1FH5L 1TNMA 3DETC 1ZLUH 3GSRB 4PFEA 4EDXB 5JHDB 3AB0B 3C5ZD 3OZ9H 5CZKA 3WLBB 3TZVA 1G1CA 3MLZL 1CN4A 4H26A 1JNHA 1NFIB 1S5HA 1X6LA 2R69H 3R8QA 1K4DB 3R06B 4PJ8A 4X6DB 3CGTA 1EV2E 3KLHD 3K4DA 2QSCL 4JY4A 4KJYB 5DUMH 2BDNH 4BYHA 3BP4B 4KH2A 3V2AR 2VISA 1NC4B 5DC9B 2R0WL 5E08L 3MLUL 5DR5H 3SDYH 3ULUL 1OAYH 3BD4A 1BWWA 1KSRA 1G9EA 3PABB 1X5AA 4FFZL 4X6FA 1LO2H 3F7RA 4H88H 1P9MA 3MOAL 4H1LB 1MIEH 2VITB 4X6BA 3QYCA 5E94B 2XKSA 5FYJD 5AYUL 2O5XL 1T22B 4NQXA 3FTGA 3PNWB 4NPYB 2B0SH 3UX9B 3MFGB 1F4WL 1P4LA 4OZFG 3OXSA 4V1DB 4PJCA 2H2PD 4X4XB 3QUYD 4P46D 4N1EA 4EEEA 4N8VG 3GKWL 5HDBE 1I1YB 5E8OB 3QUMA 1JF6A 3FB6B 3BESR 4XCFL 1LO3L 3HE7B 4MD5B 4QNPE 1U92A 3M45A 2L7UA 3DLQR 3E3QE 3P4NB 4U1IA 3F8UB 1NSNL 1UZ6E 1ACYH 3X14A 3NCBB 3F7YB 4PGBB 2AK4A 3RU8L 4YXLL 3TPUB 1FHGA 5DDHA 5JMOC 3QEUB 5EA0H 4AL8H 1T1WA 3I50L 4Z8FH 3BIAX 1OARL 5HI4C 4I18B 2JB5L 1ZLSL 4ZD3H 2J4WH 3MODL 3T3MF 2FYYA 2AV7A 1A4JB 1KENH 4XCCH 3O6LH 4WIQA 4P4KC 3DOSA 5ESVB 2KUTA 5LXGL 4ERSL 1QRND 1P1ZB 3FB5A 3M1BB 1NBVH 4JY6B 4MSWB 4O02H 4P2YA 3TBYA 2X1WL 1YEEH 2Y6SC 3IF1A 4PJBF 2H3NB 5I74B 1XT5A 5ID1B 3K46A 2QTEA 5I1LB 5F3BB 5JTWA 4DCQB 4NKOA 2ATKA 2RBLA 4IBLT 1DBKL 1GJIA 2XZQL 5J89A 1ROWA 4Z7QE 4Z0BL 2X4RB 3L5XH 4K94H 4E41E 3FOMB 3DBXA 4TNWK 1ZLWK 1FVDA 5CGTA 2E7LA 3RZWA 4JN1L 5HPOA 3LS4L 4PR5A 3U4BL 1UYWL 1XGYH 3DUSA 4YHNA 3MJ9H 1T1YB 3I75B 2VAAB 5DJ0A 4APQD 2C4FT 2ZOKB 3V6OE 2F5AH 4D3CH 3GGWB 3SQBA 4E41A 3VE0B 1HIML 1YY8A 5I2IA 4RWYL 1GGBH 1N6QL 3PDDA 1S7SA 3G08B 2DS4A 3SKUD 3OTTA 3L3OB 4R90L 4GG6B 1QZ1A 3IFOB 3VI4E 1RZKL 2VZ3A 3U6RA 2BVQB 4WO4A 1TTUA 4YFDB 2QQKL 1ZMYA 4Q0XH 1B2WH 3MRPB 3PWLB 1LO4L 2C3WA 3NIDE 4P2RB 3OAZK 3DTXB 4QHUA 5A2IH 2FECL 5ESQB 5C6WH 1IEBB 2IALB 4G9FB 5EU5B 4RIRA 3VFNB 1RVFL 2YD5A 1MQKH 1XGPA 1I8MB 4JLRA 5DTFA 3MLRH 4G8FA 4HIEA 4RMVA 3AY4C 1TJHL 4PYHA 4ZDHA 1GPOL 5D8JH 2H26A 4BUHA 1DN2A 3VD7A 1JTTA 1FNFA 3IETA 4X4MA 4X9IA 5F7UA 1TJGL 2FX7L 3BUTA 4XP9L 3VWKB 3MACL 1KIQA 3QNXB 4FXKB 4NRZB 2LTQC 4L4TE 2GITA 4MJIB 3IDNA 2VZTA 4HQQH 4Z7WB 4KKBD 4D0CA 1W72A 2DQIL 5IB3B 3SGDH 1JGLH 3IB4A 5I1AB 5A2KH 1RIHH 4PJXE 3CDYA 3EIFA 3PWUB 1UENA 3BP5A 2ICCA 3GUTB 4YBQC 5CBAB 4Q9RL 4JZJC 3ES6A 4KVCL 2B4CC 3NZHL 1GHFL 1OSPH 4L8BA 3S35L 2W65A 2Q86B 2R2BA 3CDGB 3JV4A 1E0OB 3KNBA 1Y18B 1S7UA 4YC2B 3ULUD 2AW2A 1HHGB 2OL3H 5BVPH 3HFML 5TPWL 4ZAKA 1EZVY 5BO1L 1QACA 5H2BA 2UVFA 4HKZB 1WFNA 4JFOA 1IKFH 3WFDL 1F8TH 1FPTL 4PJXA 4UT7L 2P8PB 2MQ3A 3HPJA 12E8H 5CGYC 5TQ2L 1PLGL 2PW1B 1G7MA 2FDBP 1SBSL 5EPMA 3WL9B 3RA7H 4GS7B 3NMEA 1I3RB 5MENB 1S7VB 3MOBL 4MA7H 4WRLA 3IT8D 1GH7A 3VMOA 3O2WL 1X5JA 4Y5YB 2V9QA 3CK0L 5BV7H 4FMKA 1AGCB 1D9KA 3P9MB 3NIGE 3I85A 2YD8A 1KNOB 4HMCA 3QEQD 1S7RA 2IQ9H 1RZ7L 5JHDE 3OJ2C 2JJSC 1TVDA 2YK1L 2HFGH 1W0WB 4AG4H 4G5ZH 3DV6A 1SVCP 3MROB 3LH2H 3BUYB 4PJ9A 4M93C 2WK2A 4ZTPL 3P9WB 5J9PA 1MJ7H 3QRGH 4BA8A 3GSRA 4EDXA 5DR5L 4YDIH 3RZCC 3WLBA 3QXAB 4UT9L 2VYRE 1XF2B 1NFIA 2DBLL 3QT2A 1K4DA 2DQHH 4NQEB 3R06A 4X6DA 2VJXA 5D7LD 3C5ZC 2EIDA 1T2QH 1KEMH 5IHZB 1EHNA 4OBSA 1QTYT 2IAMB 3EYOB 3BKCL 5BS0D 3ULVL 3ZKQD 1JZ6A 3SPVB 1J0HA 3N85H 3RWCB 5CJQH 4XMLL 3KLHC 3WYRA 4V1DE 5CBEA 4KC3B 3BEWB 4ETYA 2YPKA 4H1LA 2VITA 1T22A 1H9VA 1GC1L 3PNWA 5HHPB 4NPYA 4KQ4L 4V1DA 4LSRH 1JFQL 4Z76B 2YZ1A 1I1FB 3EOBA 4X4XA 4LCIL 5KS9A 2YZ8A 1I1YA 1T7WA 5E8OA 3DVNA 3BRDA 1ND0A 3FB6A 1DQMH 4GAJL 3HE7A 4MD5A 4Z8FL 2H2PC 3I6LD 4RWHA 3ZL4H 4P46C 4HUMB 3P4NA 4RAVB 25C8L 1JWUB 4PRIB 3T0EE 2QKIB 4HXBH 3F7YA 4JRWA 3OG6B 3HG1D 2VDKH 2DLEA 3TJHD 5E03A 5GGTA 3CLFH 3C6LB 3QNZA 4LFHG 3R4DA 5L6YL 3NCYP 3QEUA 4NO0B 4XAWL 5BXFA 4OUOA 2DDQH 4ODXA 4X5XB 3WSQL 4AMKL 5MP6H 3Q5YA 4I18A 4TPRH 5AD0B 4PB9L 3UROR 4LMQI 2EEBA 4YBLC 3D87B 2V2XA 3L3HB 4U1HB 3EOAB 5MEOB 1V8HA 5ESVA 3FHQA 3MBEC 4PV9B 3UPRB 4UTAH 1FNGB 3HNSH 1P1ZA 1OLLA 4GRWH 3T0XA 3M1BA 4JY6A 1NMBL 4MSWA 3UJTL 4FQ2H 2YRLA 1A1MB 1AI1L 4POUB 2MKWA 5I71B 4ZFOL 2YD3A 5C0CD 4S2SA 2H3NA 4RQQB 3OB8A 3BPNC 3LKPB 4AEIH 1VADB 2HKHL 5F3BA 3H6JA 4DCQA 4DGYH 1U3JA 3CSYA 2CKBA 4JDTL 4YQXL 1RURL 4K2UH 2DTML 5EZIH 4CDGC 1L7TH 3NCFB 5FF6B 2FL5B 5C2BH 3BWAB 2X4RA 1A4KB 2Z0BA 3VH8A 4LQFL 3CVHB 2E3VA 5I9QB 3QAZB 1IFHH 4XPHH 3QIBC 4GG6E 1T1YA 5K33A 5EOCL 4DKDC 5JXEA 3I75A 2VAAA 2ZOKA 2R15A 3TV3L 1ORSA 5DD0H 1XCTB 3GGWA 4P2RE 1CDBA 3VE0A 1HOCB 5M94B 3UAJD 3O0RH 5IWLA 4L8SC 4RGMB 5LGKA 2R39A 4TOYH 1AHWC 3U4AA 4G9FE 1HHHB 4O58H 3KYKL 3UYRH 4BUGA 1T2JA 1FZMB 3ZKMD 3IFOA 1FG2B 1GRWA 3BQUB 2A9ML 3BIBX 4NOFA 1Q1JH 2BVQA 1A7PH 2BVEA 4X9HA 2XT1B 1YYMH 5DQJA 3PWLA 4JPKH 4S1QL 3GKZA 3DTXA 3BZDA 4L3EB 2GYSA 5D72L 4JQXA 2KKQA 3KLAB 1IEBA 4M7ZC 1NFKA 3SN6N 2IALA 2R29H 4G9FA 5EU5A 5I6XC 3I9GL 4MJIE 4LLAA 2H32A 4KKLD 1YUHA 4GW4B 1YEKH 4Z7WE 2Y9RT 1K9TA 3BH8B 1EGJH 4WW1B 2DQDL 1IM3B 1YNKL 5EZOH 4P2QB 3WN5B 2ARJQ 1U8OB 5FUZH 3RBGA 1J10A 4MAYC 1JUFA 3MLYH 4FQIL 4Y19E 5CZVH 1RUQL 4PJDB 3VWKA 2EKSB 2GIYA 3QNXA 4FXKA 4NRZA 2FX9H 4L4VD 3LQAC 4MJIA 5FGCE 3VXMB 4YJZL 3W39B 4Z7WA 5IB3A 1X5IA 1MHPH 5I1AA 5TDOB 3MOQA 4WV1C 3GUTA 5D1XD 5CBAA 2DJUA 1YMHB 3ZT7A 4LEXH 3ULVD 4KKBC 4O00A 4N0CD 1AGFB 3QIWB 4PGDA 3H8NA 1ADQA 3C08L 4XTRD 2Q86A 4HIXL 2HP4A 3CDGA 4ELMB 1Y18A 4NZUL 1TZIB 5HGHA 3O6ML 4OZGF 2F8XC 2FR4B 4HKZA 4LKCB 1MJUL 1YYLL 3RX7A 4EN3B 4HS6B 4UV7L 1T04B 4H8WC 2BFVH 3MV7D 3ULUC 4YXKH 4WFHE 3O9WB 4JAMB 5JIIA 3MRQA 4N90D 1KYOJ 2PW1A 2Z31C 1KB9K 3ARGB 4NKIH 4LRIA 1XF5B 3WNMA 3DGCR 1I9RL 4QRRD 5MENA 3LKSB 2ZCHL 4L9DA 1T20A 5FHBH 3G6DL 1WAAF 3GIVB 4Y5YA 1AGCA 3CMOL 3VWJA 3P9MA 4XAKD 1KNOA 3NCMA 1GSMA 1MFDH 3WO3B 4O5LL 2H8PB 4GKOA 2JCCF 4YDKL 3MLXL 4PRHB 1W0WA 4S1RL 3MROA 4NQEE 5IHUL 3BUYA 3DJ9A 3CCHB 4LLVB 3FQNB 3WJLA 4KI1A 1XF3B 1YEGL 3OG4B 2NNAB 2QADB 1KLUB 3SJVD 4BFIA 1E6JL 1ZLWH 4RMQA 4HF5H 3NTCH 4NHCH 5T3ZH 2G75B 3OGOE 3QDHA 3PIQB 2OQJB 2ZOLB 3QXAA 5I76B 1XF2A 5LBSH 1F3JB 2MJWA 3DVIA 5FUOH 4RMTA 3L3JB 4X9GA 3UPAA 4NKMB 5IHZA 2VLKD 3D0LA 1KPUB 2IAMA 2P43B 4MNQD 3MRGB 1KCVH 4NNXB 4ODTH 1S7TB 3SPVA 1N7ML 3RWCA 2W92A 1C1EH 1UXWA 1FP5A 3O6FB 3BEWA 3BDYL 1ZA6B 3MR9B 1IKNA 1IGMH 4M7JL 1UG9A 3MZTA 1AXTH 4W6XB 2DN7A 3TYFB 1BQSA 3OAZH 4UMGA 5HHPA 1QSEE 4OIIH 2HRLA 1YA5A 5F7WC 2EDTA 1KEGH 4YEFA 5JW4N 3OR6B 2IBBA 3H0TB 4Z76A 3QJFB 4GAGH 3H9ZA 4QCIB 1NCAL 4OZIE 3O2DH 4GMTL 1ZANH 2F58L 3DECA 4OD2B 1T89A 5ILTH 3TM6A 3IDYB 1KTDB 2BHUA 1LO5B 3QG6B 2VQUA 1RIUH 1IC4L 4RAVA 2IFGA 1LK3H 2VZUA 1DQQB 4PRIA 2IC2A 2QKIA 2VLLA 3VGDA 3TCXA 2BSSB 2YA2A 1R5VA 1MCDA 1Z9OA 5DHVB 5LCVL 5IB4B 1KPVB 2Y7QB 3GZKA 5D7SH 4NO0A 4H25B 1HK6A 1I9IH 4X5XA 5C09D 3TJHC 1RZKC 3PP3K 3SE9H 5L7XH 1KGCE 2GEEA 2FLRT 4G3YH 2IG2H 4U1HA 3OF6A 1I3UA 4HH9A 3DX9B 4UQ3B 4PV9A 3FCTB 3UPRA 1A0QH 1G7QA 3U9PL 4CNIB 3GO1H 1FNGA 4GKSA 1N26A 1M6OB 5F7HA 2XI9A 3IFNL 2IMNA 5HHNB 5D71L 4DTGH 4RQQA 3LKPA 5SWZB 2F54D 1JZ8A 1VADA 1WT5C 3MTRA 4WEMB 4PJBB 4BSJA 4K3JH 4XP1L 1NDMA 1B0WA 2EE3A 4TTGA 3G6JA 4DGIL 5FF6A 2FL5A 5ITBL 4P5MB 1A4KA 1S3KH 5FGBC 4TULH 1II4E 4AENB 4C56B 1OW0A 5IGXL 3CVHA 5T3XH 4M7LH 2GSIB 1F4YH 3UTTD 4D2NA 5K9KB 1R3LB 1TZGL 5D9SB 3BKYH 1NMCC 3FQTB 4NQDD 3HZMB 1CL7I 3TA3D 1CD1B 1R6VA 2CSPA 2WAHA 4HXAH 4KKNA 1DBBL 1HOCA 4L3EE 2N1KA 2VSCA 1E4XI 1HHHA 3FQUB 4EUPH 4JO1L 4KK8D 2EE9A 3VW3H 1FZMA 3JWOH 1FG2A 3BQUA 3MRHB 5IROC 2QHLA 2UWEB 5EO0A 1FC2D 1RUMH 1QFUH 1NAML 5TF1H 2R1YB 1BQHG 3ZKMC 3H7LA 1ZE3C 3RGVC 2XZAH 5D6CB 3ZYJA 4JFZL 5EOQH 3CU1A 1Q94B 3C09B 3KLAA 4JVUA 1NGPL 5KVGL 5ELIA 4R4FH 2N4IA 4M1CC 4RFEB 3VXME 4FZEL 3SO5A 4NM4L 3BH8A 1MCPH 3NPSC 3IJYB 2JTDA 2F8VA 3EYUH 1YECL 1IM3A 4P2QA 1U95B 5EBGA 1A6ZB 3ZKNC 3WN5A 1EVTC 1U8OA 4KKLC 2G60H 3UZEA 4RX4D 2Q20A 5HYSB 4PJDA 1J5OH 4L5FL 5IESL 5E8EB 1HNGA 1AE6H 4ELME 2WBJB 1HEZA 3W39A 1CVRA 1QLFB 5C0EA 3FAWA 4NOBA 5D7JC 5TDOA 4PLJD 5EDXA 1JE6A 1JPSH 4OCXH 1YMHA 4HH8A 2WNGA 2AQ2A 3NA9H 4OF8A 5I66B 2QSQA 1GGIH 5D1XC 5SV3A 3PL6A 4ELMA 4FQ1L 1TZIA 3ULVC 2W9EL 3V52L 2HLAA 4N0CC 4HT1H 4OBRA 3HC3H 4HWBL 2E9WA 4LKCA 4EN3A 4YEEA 4HS6A 4XTRC 1T04A 4R8WL 3BVNA 4EI6B 2DLGA 3O9WA 5DRZB 4JAMA 1BQLL 2BY0A 4YHLH 3MRRB 1XF5A 3Q5OA 1VESA 2EDQA 2VO5A 1MY5A 3QPQD 3VJ6B 3GHEL 4TTDD 3QO0B 3KS0J 2GCYA 3MFFB 3LSOB 3GIVA 3HI5L 4CN4A 3FRPG 5CUSH 4JCLA 1TENA 4FFVD 1NUDA 1GGUA 4QWWD 3DXAD 2I07B 2H8PA 5SWSB 2ZUTA 4JB9H 1FFPB 3OAUL 4PRHA 4YIQB 3UC0L 5I1EL 4QOKB 1FFQA 3I02B 1Z9MA 3MRLB 1R5WB 5FOJA 1TIUA 4KTDH 4LLVA 1AGBB 3FQNA 1XF3A 4FQQB 4U1JA 1G84A 2NNAA 4IDJH 1YZZA 1KLUA 4XXDB 4QGYA 1N3NB 1B0RB 3TC9A 1M71B 2XXCB 5JO5B 2G75A 2HA1A 32C2B 2CRYA 3PIQA 1MCFA 2OQJA 2ZOLA 4Q97A 1SJVA 2APBA 5KOMC 4JDZB 5I76A 1BM3L 4JFFD 1F3JA 4GRLB 2J6EA 4MXQD 4QRQB 5CP3A 5EULV 3QDJD 1CGSH 1WBZB 3L3JA 4HBQA 5SWQB 1A3LL 4NKMA 1AQKL 4UIKH 4JRXB 4W4OC 1XGTB 2KH2B 3B4NA 4YXHH 1KPUA 4AK1A 1JTPA 1TFHA 4HHAB 1FDLL 3MRGA 1C7SA 5C71A 5FYJU 1S7TA 2C4FU 4DN4L 4U33A 4WW2F 1ZHKB 3EJJX 5EC2B 1CF8H 3O6FA 4DN3L 3E2HC 1ZA6A 4GAGL 4K94C 4UIMB 5ALCH 2VB5A 4P48A 3UTPD 1S8DA 5B8CB 4MWFB 4TSAL 3TYFA 2PTUA 2ESVB 2IWGA 4G6KL 4NJAL 3QUML 4BQ6A 2C3GA 1CLOL 3KXFA 4FTVB 1H8SA 3BWUC 5EWIH 4K8RL 4KXZH 3OR6A 2B1AH 4DKEH 4QTIH 4WI4A 3QJFA 2VKWA 3K2UL 2X4OB 4QCIA 4PREA 1WZ1L 2DLFH 4LEOB 1KTDA 2NR6C 1LO5A 2EIBA 1NEZG 1EEZA 2ZKHL 1DQQA 1WC7B 4OCSL 1JF1A 2R0ZL 2BSSA 3N50A 2EDHA 1EUUA 3VFUB 3T3ME 2LVEA 5C07B 3ARBD 2ZCKH 5DHVA 5L9DL 4FQXD 5IB4A 1KPVA 3P73B 5DUBB 2Y7QA 1QFPA 3F65A 4GRMA 3NFSL 4H25A 3WNKA 3NPZB 4KROD 4LSPH 4P23D 1X5XA 5FUCC 1BOGA 3JV6B 4S1SH 1OAZL 2ZUQB 2M1KA 2VC2L 2HJKB 5SWZE 5J11C 1ZEAL 2AJZB 4NBYB 4PJBE 1X5FA 3DX9A 1SEQL 3FCTA 5FGSA 2R1XB 4JZNB 4CNIA 2J8HA 4OFVA 4QT5A 5EZJB 5GGRY 5LGHL 1M6OA 1D5IL 5HHNA 2UUDK 2XYCA 1BOYA 3ULUF 4YFEA 5SWZA 2CDGB 3OR7B 4IRJD 2P8MB 3D48R 3RWEB 4OSUH 3H2WA 4OCNC 5D96C 2FB4L 4LIQH 1XIWB 4P5MA 4Q6IC 1EXUB 1OAKL 3VXPB 1ACZA 4AENA 4C56A 2LV4A 2GSIA 2LU7A 4XH2B 1WBYB 5K9KA 2W1NA 2R0LH 1JNLH 2YPLB 4G8EB 3FT4B 3W9DB 5DWUH 5JNYA 3L6FB 5FGRA 3HZMA 1CD1A 1FBIL 4Z7NF 3REVA 2WP3O 3QQ9D 1RIVL 5EU7C 3VFGH 2JIXB 1J8HD 5GPRA 1J18A 3F12B 4Z77B 3TA3C 3FQUA 2B7DT 4KV5F 5GS2D 5HY9B 3VCLA 2JE8A 3PP4H 4Y16D 2YD2A 2UWEA 1IM9D 4P0DA 4FQPA 4KK8C 2R1YA 3NABH 1NC2D 2O5YH 5FKPA 1P7QB 2X4UB 3S36H 5F6HI 5D6CA 4KJPD 4Q9BA 1Q94A 1RZIA 1XAUA 5B38G 5T3ZD 5LJYH 1MFBH 4U6XB 4RFEA 1V3MA 4IOIB 4G80A 3N1QC 4GT7A 4OZFB 5TE4H 3IJYA 3TZVD 3IAGC 2J1KA 3O41B 1U95A 3VDCA 1A6ZA 3DYOA 3HMXA 4N8VB 5KBNC 3WFBH 4LNVA 3VGBA 3I3BA 1BD2E 3PF2A 4R7NB <