1TFHA

Extracellular domain of human tissue factor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
207
structure length
202
Chain Sequence
NTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism of an inhibitory antibody on TF-initiated blood coagulation revealed by the crystal structures of human tissue factor, Fab 5G9 and TF.5G9 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Coagulation factor
molecule keywords HUMAN TISSUE FACTOR
total genus 40
structure length 202
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tfhA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tfhA02
1BFOA 2E9WA 2O61B 3HNTL 2AQ1A 3U7YL 4H8WL 3VXUE 2APXA 2IH1B 4JQXA 4X6CF 3FO1B 5FM8A 4DKEL 4U1HA 5CEYA 4HPOH 2AJVL 4PJFA 3KLAA 2R1XA 4XBPB 3WMSA 3MRCA 3PWPD 4HUUB 4IIQB 3UJIH 4LLMA 2EIEA 4QTHA 2BJML 1J5OH 3SGDH 1WIUA 4TNWF 3BP4A 4PJCE 3FO1A 4S11A 3GI9H 4N1HB 4OT1H 4B50A 4F9LC 4G3YL 3DX6B 4K3JH 2F53D 2FCBA 4R4BB 2VR4A 4ZFGL 2PUQT 3ZTNH 3BD5A 4K3DL 1E0OB 3VA6A 1PG7X 1I1AD 2N1KA 3R1GH 4CN6A 1U3HA 3ZE0F 1LEGA 3P30H 4JPKL 4HBCL 3WKMH 3MV9E 2HLAB 4MJ2A 3RY6C 5C0JA 5FO8A 1IZKA 1K8IB 1FAIL 3UROR 1AO7D 3ES6B 1F6FB 1FZJA 2D7TH 1D9KC 2HRPH 1YYLH 2X4OB 4HXBL 2ED7A 1HSBB 2A77L 3SJVE 2E7MA 3DMMD 4UILH 4LPWA 1I1AC 4ONHA 4XNMB 4KZEL 3TPUB 5ID0A 2IAMD 5FV1L 1S9XB 3MBXL 4MAYB 3JWDC 5DK2B 5C2UB 4D0DB 3QULA 1U6AL 3QJHB 2VLLB 3QEQE 4PRNB 1B90A 4KHTH 1OAKH 5SV4A 2FLRT 2J12B 4WWKC 3CDGB 1HH6A 4W6WB 5IB3A 1EAPB 4LHQB 4M7LH 4EKXA 1UXSB 4Y4HD 1K8IA 4JHBA 1CGUA 3ETBF 1JNHB 2UZIL 1UM6L 4U0RC 3ESVF 5A16B 3ARED 1MPAH 1J11A 2NXYB 2VXSH 4WW2A 1I9JL 2OL3A 4HFUL 5E4EB 2JK5B 5DRNA 4K7PH 3HR5A 5D72L 5J12B 4YBQC 2ICEB 4J4PA 4RDQG 3TJEH 4QRQB 3RWFA 2BNRD 1AGDB 1KCRH 1NL0H 2A83A 3T4AB 3I2CH 4AEHL 3NACH 3KYAA 3ZDYE 1MRCH 4LVOC 3ZKND 2EYTA 3AREC 2GJ6B 2DLFH 4FQJH 5J9PB 1D7FA 1NBYA 1UYWH 2Y7QA 4ZYKB 5GGTL 5I71B 2EDJA 4YO0A 3U6RA 5IM7A 3ABZA 3KLSA 1BFOB 2HLFD 1CFSA 2QJDA 1QSFB 4LNRB 3UDWC 3O6FB 3KPMB 4LBEB 5HVWA 2EDFA 3HAEA 3D18A 2AI0H 5ICXB 5FF6A 1ZWIB 3P2TA 4L3ED 4L4TE 3MLPA 2DQDL 3MRFB 4R4ND 4XGZB 3VD3A 2W9LA 4MJIB 2W0PA 3QAZC 5EUKA 3OKKB 2JTDA 4P2QE 2XQBH 4Y19B 5C0RL 5ACZB 1R3IL 1ED3A 3AM8A 1WVZA 3TA3C 4ODSL 5I66A 1FPTL 1K5NB 1MFEL 1SMAA 2ITDB 4HG4K 5KSBE 3BZDA 3WV0A 3VXOB 5DYOA 3VA2C 2HJFA 4M5YL 4XPTL 1A6UH 2PXYC 4YIQB 3ULUC 1ROWA 3LHPL 4LKXB 4YDJA 3OAUH 2IANB 4DUXA 3RVWC 2JELH 4MJ4A 2E5EA 1SY6A 4P4KA 1KN4H 2I27N 3BH9A 5T1KB 1GZPB 4P3CL 5C0BE 3VFTA 3WFDL 3OGOE 5C0ND 4EN3A 1QSEA 1X5XA 1L7IH 3MGTA 2F19L 5GGTA 1OGAB 1RZ8B 4QCIB 1H0DA 4DVBA 4Y5XC 1A7OH 4L5FH 3V6FB 3ECBB 4PREB 4PJDA 1HYSC 1IARB 4PR5A 4TUJA 2BNUB 3P0VL 2J6EL 2P45B 4V1DD 4ZTPL 5T33L 3MCG1 2VDKL 3GSNH 5D2NA 5JOPD 4X9FA 5JW5A 2HTKC 4I2XA 5INCA 4X4MA 3UMTA 2E6QA 5I6XC 5SWSA 4WDIB 5ENWA 2KUTA 1F4XH 3TNMA 5I76A 4OBSA 5I17A 1MVFA 2ENYA 1UXWA 1PG7L 3KHOA 4RCAA 1I9EA 4CW1A 1U8PA 5B8CA 3TESA 4BM7A 2CLRA 5J6GA 5ECJE 1DBML 5EU6B 1FRGL 4PGBB 4JZOA 1MRDH 5JLZA 2ZSVA 1JUFA 5JW4M 3HPJB 2P8MB 3K1KC 1FYTE 1HILB 1Q9OB 4J1UB 1CI5A 5BS0E 3MFFA 3BPCB 1RIVH 1PZUB 4WO4A 3NFPB 5CEZD 1YY9D 1A6ZB 4NQCE 2Z8RA 2QQLL 4JO1L 4ZO6A 1JNHA 4WFHD 3W82A 1INEH 1WFOA 1KEMH 3CPLB 5FECB 3RY6A 1MY5A 2HFEA 4GUPA 5FKPA 3TYFB 3O2WL 3BZEB 2R2BA 3BD3A 4P9HC 3ARBA 1T66C 5I1AB 3X11A 4C54A 2ADFH 2AQ3A 1MREH 1RJLA 4MAYA 1VFMA 5DZOA 3S96A 1R0AH 5EZJA 3ZE2E 1JGDB 4PTTB 1LO3H 3O2VH 1LE5A 4FQCL 3WS6A 5MENA 4S10A 2ESVB 5HHQB 4FFWD 1T3FA 2VZOA 3MRGA 4I0PC 4YHKL 3WFHA 1YYMH 3UJTH 1T66D 5ITBH 5D2LB 4FQIL 5FF6B 4KHTL 4TVSa 4RNRA 2J5LC 4HJ0C 3MRLB 1MIML 4LSSH 5E94A 5F7WC 3UZQA 3THMH 1FDLL 1MCDA 5M95B 2R0KH 4ELMA 2ZOKB 4Q0XH 2VL5A 4AIZB 3C5ZB 3HN3A 2Z8VC 4D9QD 1CTNA 1TJIH 3GJFH 3G9VA 1AJ7H 5BJTB 1E6OH 4JFHE 5GGRA 1OQXA 4D0CB 3BN9D 1IEHA 4Q58C 3SGEI 3WDHA 1MQ8A 5JIPA 2XKSA 4M7JH 3PIQA 4JFYA 3TNNA 2CR3A 4BSVA 4X9GA 1RK0B 5E2UL 3HTLX 4P3DB 1GRWA 4XVTH 1V3LA 3OR7A 5DI8B 3VFOB 1G0DA 2OI9C 1M71B 2VNCA 1JPTH 4UT7L 3U2SA 4LGPB 4P48A 1NDMA 2BSTA 4RFOL 1ZVYA 1DVFC 3J7HA 4MD0A 4EDWH 2ZPKL 3PWPE 2NNAB 5D1XC 3IS0X 4RSVA 1VADB 3BW9B 1RZJC 1LK3H 2X40A 1TQCB 2D0HA 2VZUA 1T5WB 4NRZA 4NZRL 4U31A 1JGLL 3TC9A 2GFBB 5KZCD 3G6JA 4LVNB 4ODBD 3VFPB 1A6VL 4EXKA 1H8NA 5HI3D 3WNKA 1F3DJ 3R0NA 1AKJA 4X6DB 3BWAA 5I1DB 2VQUA 4M1DL 2NY0B 4JFPB 5GS3A 4KXZI 1JK8B 4J3WA 4OFYA 2G5BA 4UOJA 1OT1A 3W11C 3D39D 4HC1A 5GRJH 2DL2A 5ALCH 1NEZA 3D85A 1LEGB 5EN2B 4JGMA 1YQVH 4AK1A 2CDEB 1I8MB 4KRPC 1RJLB 4AIOA 2VZSA 3PABA 5GGTH 1I7RB 3CZFB 3A6CH 5EPMA 1JYWA 2B2XL 1GPOL 3X12A 1RUML 3AREB 3HLAB 5DA0B 2UWEA 3PGFL 2OCFD 3W2DH 3O8XA 4Y5XA 3RIFF 2F19H 3T77B 4TSAH 5DHYA 2Y6SC 4X6EA 2FATH 4NQUA 2BNRB 4PJXF 4PV8A 4TUKL 4UDUA 4YQXL 3PQYA 1BGXL 4OI9A 3C60B 1BM3L 1A9EA 1U8LA 1FIGL 4DZ8B 4JFEE 1MCBA 4M9OA 2BVOB 3NOIA 5EU6E 5C0GA 1NEZG 5I8OL 3VFNB 5DD0L 2VZ1A 3IGAA 1CL7I 4FQ1L 4YAQB 3H9ZA 3BN3B 1R6VA 2BNRE 3BZFA 3VFSB 5EU3B 1HHHB 3ARYA 4WIQA 3BXNA 3SE3A 2EIDA 3NGBC 1T1ZA 4LCUB 4P5TD 2RCSL 3I2CL 1INDH 4JFXB 4W68A 3MJGX 3QT2A 2BX5A 3QQNA 3O81A 4PTTA 3HI1B 1IAIM 3HG1A 5CINH 3U30B 5FHAL 4JB9L 1MNUL 1KCVH 2YMXL 2MCG1 2DJ4A 1RUQH 1Z9OA 1FN4A 2IG2L 4GBXC 4LAQL 4QHNA 2OR7A 3OKLA 1IKNC 1QFWM 1KFAH 4WFFD 3IF1B 2IPUG 1TENA 3C2SA 3MUGA 1SY6H 1ZHBA 4OF3A 4CMMA 3GI9L 1NUFA 2UZIH 2AJZA 3WYRA 4Z7UA 5C0AA 4MYWB 3GZKA 5KOMC 2NY0D 3ZYOA 3CXHK 1YQ2A 4LARH 2K9UA 3WUWA 2YEZA 3DMMB 2ERJB 4NQXB 3ULVF 4KJYA 3OKNA 4JY5H 3L7FA 2IAMA 3ARGC 5FM5M 4GW4B 3V5HA 1GGBH 1F8TH 3UTPD 4AG4L 4PJGE 4XVJH 1KJMA 4X6DA 2P8LA 4FQXA 4P2CG 5EORH 2XWBA 5K9OB 1G6RL 5C0BD 1PSKH 1OP3H 4F2MA 4P9HL 1HHGB 1IZJA 1I8KA 1N59B 1IMHC 4P3CH 3MCKB 2IPTH 3SGJC 2LQRA 5T3XH 2Z92B 1MJ8H 3EJZC 1S7TA 4L4VB 5A2FA 2D7QA 2XV6B 3RL2A 5IG7B 4ALAH 3RQ3A 2EDOA 5ADOL 1MSPA 4WUUA 3GSQB 4L9LC 2EKJA 2X9XA 3SY0A 1JWUB 2LTQC 3QWOB 2DQJH 5DRZA 5T33H 3MLTB 3V6ZA 2YRLA 3K3QA 2OK0H 4OUUA 3WIIL 2CUIA 2ICES 4RGMB 4P4RA 2HJKB 3QIWC 2OZ4A 4ODXA 4PTUA 4Q74A 1EPFA 5H8DA 4CVZA 1KCRL 3MR9A 5I75B 1QKZH 4OLZL 1YEHL 5HXMA 2ARWA 1DVFA 3S36H 5BJTA 1NGYA 3K81A 1OTSD 5IB3B 1G84A 3CX5J 4J7RA 2NY7L 1I1YA 1G9NC 4NN7B 2EE6A 3PGDB 4V2BA 1CDJA 4HD9A 5D4QA 4M62H 4LK4A 3RWDB 3WFDH 4M1GH 5B38A 4YE4L 4JHZA 4PJEB 4GAGH 4RIRA 2EDYA 3STLA 1IEAB 1A6PA 3N9GH 3H0TA 4NO0D 2XWTB 5EULV 5HYFA 2DQHH 3MV11 4G9FD 1OSZA 3HKFA 3WJLC 4IHOB 1C1EH 2QQLH 4JO1H 1MJ7L 1CL7H 1TZGH 1WEJH 3QO1A 4YPGB 4BZYA 5IBUG 5BZWB 1YMMA 3KJ6H 1S78C 1A0QL 5I0DA 1SYSB 1J0YA 4Y89A 3HZVB 3P73A 2E7CA 5ICYB 4W81A 1WFTA 2JJSC 2X05A 1A6TA 4HJJH 4MMZC 4AM0A 3ZL4H 4QXGL 1AC6A 1YEKH 1NCBH 4HK3J 1EA9C 3K8KA 3KPNB 4KPHL 3GSRA 4OKDA 1MIEH 1PX4A 2ADJB 1UADC 4Y1AA 3L6FA 5JMOC 3GGWA 1ZS8A 5HJ3B 3ES6A 1CGSH 3IYLW 2C3WA 4YHMH 3CPLA 1S7SB 1YEGH 3S98A 1DBMH 4ODVL 2J88H 3GKWH 3NCYP 3TJHD 5J7CC 2KL6A 3S3JA 4LIQH 2BVOA 4IMKC 2GAZB 5CSZB 3QPXL 5DVMA 5FYLH 3VGHA 3VXUD 5IV2B 1IAOA 1VFUA 2DTSA 2UYLA 2DI9A 3MYZA 2X7LB 4PRHB 4V1DA 3RDTB 1OARH 4C4KT 1JGLH 5IR1A 2V5MA 4AEEA 5FO7B 4Q0XL 4BFIB 3HB3C 1YNLL 5C6WH 3MV7A 3SN6N 1MCOH 4G8GE 1QBLL 1KV3A 2XQBL 5MHSD 1RZIA 4YXHL 1D6VL 3DNKA 1EFXD 3WE6A 3CFEA 3IJYB 4U1GB 5L88H 3SDDB 3WKML 1P53A 4OJFL 1G7LB 1DUZA 3BGFC 5GISH 5C6PB 1NKRA 5C08B 5I2IA 3KXFE 3C2AL 4G7YH 4OCWL 2NCMA 5EZIL 2XG5A 2V9QA 4Q7DA 3TO2B 3JWNC 1JHKH 2VXQH 1D5IH 2RFXB 4JFEA 2XFXB 3LHPH 2EO9A 3ECBA 3BPNC 4PJGA 3IU3A 4Y4HC 4YHYC 4WI4A 5B21A 4KUCF 1BX2A 2R23A 3WFCL 5DD5L 1J88A 1X5GA 2OXGA 4R96A 4UAOC 1H3VA 2VMFA 4GMSH 2IALB 1FDLH 4CNIB 1A02N 3PWJA 2GJZA 4NGHL 5HYSB 1EEZB 5MEPA 5E1AB 1LO5A 1XGPB 1BD2A 1ZT7A 5D1ZB 3MJ7B 1ND0A 1NCWL 1Q0YL 1R3KB 2J2ZA 2V9RA 2YA2A 4LLMB 3E2HB 4M7ZB 4F9LA 3WXWH 4F33A 4JDTL 3V5DA 1OD9A 4URTB 4Y2DC 4K8RD 2IADB 1MQKH 5GSRA 1WITA 5IMOB 3FT3A 3QIUA 3UPCA 3GBNL 3V6OC 1AGFA 2F54E 2RQ8A 4FQLL 4PJ5D 1ERNA 3ZDXE 2VSCA 4BSWB 3ARRA 4E42A 2BOCA 2DAVA 5CINL 4N5ED 1FQ9C 4AQ1B 5F8RC 5SWQA 2VXTL 5F44A 1GPOH 3OKDA 4PGEB 4Q9BA 1NGPH 4M6NH 1MFAH 3AMKA 3QAZB 2FSEB 3SKNA 2RAMA 1A7BA 4BKLB 1BJ8A 4X7TB 1ZANH 2FEDD 3EYSL 4R4NC 1HHIB 1W0VA 3F6LA 4XX1E 5F7KC 4X4YA 3PWPA 4JFED 4JJ5B 2R69L 3SY0B 4UT9H 5C07D 4J4PD 1S7UB 3T8XA 2FZ3B 4G42A 3VH8G 4JO2H 5DD0H 1U58A 2DQIL 2WUCL 1HNFA 1INQA 1NCNA 1F3RB 3CFBB 4RMUA 5TH2B 4BFEA 3VFVB 4GQ9L 3B2VH 1AGDA 4F7MA 1XIWB 1DZBA 3X13B 3JWOC 3ULUD 4EI6A 1ZHLA 1ZVSB 4OGAC 4Y4HB 4YHYB 2BY1A 3MNZB 2Q7YA 2P8LB 4FQXB 4M1CC 4PRDA 4XBGB 5C0NC 2IFGA 1IBGH 4KXZH 1J86A 3T0XA 4XRCB 3NCFB 3T0VA 4JANA 4Z77A 4P2QB 3QFJB 3F7VB 3HZKA 1X5JA 1UXSA 4Y19E 5FUZL 2PKDA 3ZKMC 5GS0C 1G6VK 1S8DB 4MA8L 3QDAA 4ZXBC 4I48B 1TITA 1QTYT 1OGTA 4JVWA 4WWID 4HF5L 3O3DB 4D0DA 4JRYA 5IBTH 4ORZC 4XNQB 3ULVH 1ZHLB 1ZVSA 3MLYL 2EZ0D 3RZCB 8FABB 1XH3A 3WIHA 4TOYL 5FYJH 2W92A 2YPVH 4M8QA 1B9ZA 3MLRH 1MAKA 4BUHA 1DL7H 2BCKA 4WW2F 5DC4B 3BIKB 3KR3H 1IEBA 1YEKL 3V8CA 5D93C 3QUYC 1MCEA 2LVEA 5F7HA 4NO0B 1NFIB 4HK0A 4AG4H 1KPRA 1YDPA 4KJPD 5I2IB 3EBAA 4C4KO 4XNXL 4ZFFA 3O6LH 1T83C 5JW5B 4JREB 1XGTB 5INDB 4MB5A 1VFAB 1EDQA 1B3JA 5D9SA 1KN2L 4MA1C 1G7HA 4M1GL 1QBAA 4Z7UF 3QPXH 3QUYD 4K55A 4CL7A 1YY9C 2HTLC 4GRLD 3BSZH 3CVHL 5K93A 1O7VA 3CC5B 2XWJA 2ITCA 3IDNB 4PGCA 4E42B 1XF3B 1QHPA 1ITCA 1JVKA 2HKFH 2ZUSA 3TBWB 2ATKB 1FIGH 1OAZH 3O2DL 4PV9B 2HWZH 2W60B 1MCOL 1YUHA 4P5TA 2XTJB 5B3JF 3KJ6L 5DO2C 5GJSH 1INEL 2QQNL 2BFVH 3G5XB 5MEQA 4OZFA 2A0LC 4DAGL 3DRTA 3QDJD 4F33B 2X4UB 3F58L 4JZJC 5F7YC 5D1QC 2Y5TA 3QXDA 4PJAF 4S1RL 3FHAA 4ZQKB 2NY6B 4XMLH 1ZLVH 4BELD 2A2QT 2OQJB 2CUMA 2ED9A 1D5IL 2E7HA 5C3TA 4UQ3A 1B0RB 4Y4HA 4F7EB 4XNMA 1IGIH 5C8JB 2W0FB 5B8CC 3RX8A 3IAGC 2DDQL 1U8JA 1G0YR 1KGCD 3K0WA 1GC1H 3PDOB 3BMWA 3GRWL 3LV3B 3P9LA 2E7LC 3WFBL 4GW1B 5E6IA 3DV6B 2I5YH 4OGXH 3TV3L 1JTPA 1OVZA 2VUOA 5JW4Q 4YFEA 5GRVL 5DLML 3U2SB 2H9GA 2Z91B 4Y2DA 4NZUL 4WO4C 4HUVB 2NY2C 2X9WA 4RAUA 2WLYA 4PS4L 3BT2H 1CZ8L 3S4SA 2AK4A 5IVXF 3RWHA 1UC6A 4P99A 4YR6B 4MLSA 3DTXA 3VFUA 3RZCD 4YLQT 3DV4B 4QTHB 3GNML 3EYUL 1U95B 4U7SA 1KTDB 4O2EB 4EJ1C 2PTTA 3SPVB 4YHOL 4OGYH 4I13B 5FGRA 4P5TB 1KOAA 2HJKA 4HIJB 4K9EH 4NUGH 3L3GB 1JNNH 3V4UH 3WS6C 4CVXA 3KLHD 2ZCHH 2Z91A 4O2CB 5JTWA 3MX0A 4HS6A 1UCTA 5FIEA 1IQWH 2C4FU 3UBXI 4OIIH 1WBYA 3MLZL 1G6RA 3VFRB 1KLGB 1ORSA 5IVXB 1YMME 2ZUVA 1MCJA 5E1AA 4OLYL 4NQDB 4G8GD 2JKXA 4FN0A 3SQOL 1ZHNB 1MRFH 4PJ8C 4LSQL 4OSUL 5MHSE 2DWDB 4P23D 1A7NL 2XZZA 3VGGA 3FAXA 1XF5B 2DBLH 3B2VL 5DD1H 4CMHC 3IB4A 5F7DA 5FYJU 1KNOA 4K94C 4YFDB 1IT9L 4X6FB 4G6MH 4P5MA 3IFOB 5JXAL 4LU5L 3UYRL 3RGVB 3H42H 2NXYC 2OJEA 3MXVH 1SBSH 2R0LH 4JFEB 4K9EC 4HDIA 3QZWB 5DQ9B 2NW2A 4NHCH 2Z93A 4NQCB 4OD1H 2C1PA 1HQRB 1U8NA 3X17A 4D2NA 4MD5A 1T20B 2BXYA 4CVZB 4AEFA 2WBJB 4ZXBA 4S1DC 3O6KL 1NGXB 3REVB 1KJVA 1UM5L 2VDLH 4DKDC 1DEEA 1V3KA 1W72L 3NN8B 2EDLA 4HEME 2ATKA 1OGTB 1T21B 1ED3B 2WQRA 4Z8FH 1QFPA 4MMXC 3CFJB 2NY3B 4HUNB 1ZEAH 1YEFL 5ANME 1MCWW 5C9KA 5KSVA 3I3EA 4RA3A 2DBJA 1EHLL 2OP4L 4YBLC 1FFPA 3QIBB 3VDBA 4H0IA 2A6KB 5E56A 2IH1A 2O5YH 1JPFB 5HHVH 3U4EA 3IKKA 2R1YB 4L8SA 2A9NL 2EH8L 3MV8B 2DKMA 3WEXB 4M02A 3OV6A 2DTML 1IGML 3FB8A 1L7TH 5IFHL 2P5EA 4JN2B 4I3GA 2F54D 2R8SL 1OPGL 5E4EC 1J8KA 1KPRB 1YDPB 4WI6A 5IJVA 1NSNH 4XI5D 4NKDA 1RZJL 2NZIA 5GRVK 3EHBD 4WEMB 3TWCH 4A6YA 4Z78B 3ARFD 4QGYA 3SKNB 4ERSL 1UJ3B 3VG0L 3V6FA 4F8QA 3V52H 4HZAA 5IIEA 3DYPA 1XZ0B 3BVNB 2BNQB 2ESVE 3QR2A 3VXTB 3JZ7A 5C0GB 1WZLA 5EB9A 1XCQB 3QJFB 5DRWB 5EZLB 1A7PH 2PETA 5EWIH 5D7IB 3BP7A 3IDGA 5CEZL 3ZZ1A 4XP9L 2WWMC 2OJZL 4NKOB 2CXGA 3FONB 3O8XC 3FT4A 1AP2A 5H35A 5FAAA 3O3EA 4LP5A 4YIQA 4FTVB 4LSTL 1IJ9A 3OKLB 2R4RL 1KPVA 2WINB 3FQTB 3DARA 1QR1B 2ZJSH 1ZT4A 3ULSA 1P6AB 1MQKL 2XN9A 4LGSB 3MNZA 1W0WA 3Q1SL 1ZA6B 4G6AC 4YNYA 1KYOK 3C08L 4DKFL 1KSRA 1I1YB 4QOKD 3FQTA 3HI1A 1WBXB 3B9EA 1ZHKA 4NC1E 3MRHB 3SE3C 4MNGB 1A9BA 1AGCA 3HG1E 4KAQL 3U36A 3T3PE 4XVJL 5I16A 3TCXA 2L0DA 4ZPVB 5GGSA 2DKUA 3ARSA 3O3EB 1BJ1J 5H2BA 3OPZH 2MCPH 2AGJL 4IRJB 5B38G 3NZHH 1NFDA 4UNVA 5JNYB 4M6MH 3O41B 3SDDA 4DCQA 4PJGB 2LV4A 2HWZL 5IWLC 4GKZB 2P49B 1XF1A 2NZ9D 4X7TA 3OJDB 5KJRH 2Y23A 5FA3B 5E2WL 1CICD 3CLFL 2WUCH 4U3XA 4Y4FA 4N0YH 5GIRB 3QUZA 5HY9B 5FB8B 4JDTH 3LZFL 3UC0H 1SYVB 5FOJA 4N9GA 1BQLH 5BCAA 1HCFX 3GB7A 1PZ5B 1G7JB 1N59A 3EO9L 2F5AL 3AS0A 2AKRA 1Y0LA 2A77H 1F4YL 2VDNH 3TZVC 2FRGP 5KANI 1CICC 3GB7B 3HC0A 5CZXD 4EUPA 4G8FA 1IBGL 3MRNA 3LS5H 2CIKA 3GJEB 4D0CA 3O8XB 5DUPH 3RVTC 3QIUD 2ZKHH 1GGCL 4TNVK 3KHQA 1JZ7A 2DYPA 4WGWB 5CEXA 3U0PA 3OR6A 5FOBB 1ZMYA 3MLZH 1KYOJ 2I24N 2NYYD 3BPOB 2OZ4H 1X5KA 3T4YB 1BF8A 3DJ9A 3TV3H 3N0PB 4Q6IB 2NX5B 3HI5L 4MXVF 5GGUB 1MHHB 3QI9D 3QNYA 4KUCD 4OT1L 4IS6B 1S78D 3GSNA 3C6LC 4XH2B 2Y36L 1QNZH 4ZFGH 5JNYA 1NEZB 1NGQH 3C5SB 1EGJL 3QDJE 4XAWL 4HW6A 1EERB 1D5XA 2FO4A 2CXKA 5JR1L 5T1LB 4JRYE 4HS8H 1VADA 3O3AA 3MJ8B 5L2KD 1E28A 4L9LA 1KB9K 4IOIA 4HAGA 2IPKB 1R3LA 4H25A 1M6OB 3RGVA 3WIIH 3QDMA 1Y18B 1DBKL 3C5SA 1IC5L 2APTA 3NCYS 1DEDA 3B5TA 3TVMA 8CGTA 1VGEL 1DQJB 1SYSA 1ZA6A 4GH7B 5FGBC 1CQYA 3OWEA 5TDNA 1UGNA 1JHKL 2VXQL 4RGNB 2VXTH 3KPSB 3OKYA 4Z7VF 4AEIL 1JNNL 3ILPB 3V4UL 3W9DA 2F54B 1OAUL 3OKEA 3FQRB 2AK1H 5K9JH 5GGRB 4ZNEA 2H1PH 1D5XB 2FO4B 3BDBA 3KS0H 5EBWB 1CD8A 1H15A 1U2CA 3V0VB 4OV5A 5CEYB 1CDGA 3PXHA 4JY4B 5D70H 5MEQB 4YHIA 4GS7C 1J1XL 1TETH 3B83A 1C7TA 5IQ7L 4KKNA 1Z9SA 3ULVD 3F65A 1Y0LB 1P5UA 2EYSB 1DSFL 1G7IB 4JDVB 1YEDB 4ZOEA 1QZ1A 5JMRA 2H32B 3KPRE 4MA7H 1T22B 1SJHB 3LPFA 3IXAB 3FN0H 2QQKH 2VH5L 1JWMB 2DBLL 2P8PB 1LEKA 1D5ZA 2YC1A 1UJ3A 3GHBH 5DC0A 1MFEH 3CIQA 1UKSA 1IGFL 1OSPH 4DEPB 5D1ZD 5HPOA 1I9RL 3KPPA 5ESAB 2CMRL 3MLWL 1T80A 5E8DH 3WFHB 3SE9H 5KVDH 5BV7H 2Q76B 3OAZK 1AFVH 3OX8A 1MWAA 4OD1L 1KLUB 1HIML 1SM3H 3VI4F 2BNQD 1K2DB 1S9WA 4U2YA 4R4FH 2A6JA 2CSPA 2ZNWA 3GJFB 4KMLB 1VGKA 4PLJD 4XB8A 2BVQB 3X11B 4RBPK 1NC2B 4HGMA 4X5XB 4QRSB 2FB4H 1JK8A 2IPKA 2QADD 2QSVA 4WCYH 1S7WB 3DROA 3DI2B 4UNTA 1CIDA 3MNVA 2YUZA 1ZLWH 1NAKH 2FYYA 4IM8A 1BVKB 1E27B 1IM3B 5C08D 5DFWH 1IC4L 5JHLH 3DGGA 5BQ7B 1IC7L 4EIZC 2Z0BA 4NZUH 4JM2C 2QQNH 3SEPA 3QUXB 1FVDB 1KIQB 4N0CD 4ODUB 4ZUVA 3UPRA 4WW1B 2KQNA 4N5EC 3L7FB 2BRRL 4NN5B 4NDMB 4NC2B 1AO7B 5E0QA 4QHNB 2CQVA 5JXEA 3QUXA 2DQUH 1FORL 4RZCA 1I1CA 4I3SL 6FABL 1QVOB 2HT2D 3D6GA 3GRWA 5E6ID 2IC2A 4HX1A 5J12C 4UBDC 3E6FB 3HPJA 5IB2B 5F96H 5A1AA 1OY3B 4XHJC 5DD3H 1DFBL 5EUKB 1ZANL 3CFDB 2GSIA 3DRQB 4X7SL 4HKXA 4Y4FB 4EUPH 2R0ZL 2ARJA 2CO6B 2BJMH 2PW1B 5CBEB 1J5OL 1HINH 1AP2B 1TVBA 1NCCH 5ERWA 5LAXB 2HAZA 4XXDA 1FN4B 1EHAA 2VDRL 4FABL 5TE7H 3QUMB 3PV6A 4G43B 1MRFL 4FZ8H 1HQ4A 3P4NB 4PJDE 1JHTB 4JM2F 4XP1H 2J6EH 4PPTA 4HS6B 1MFBH 1FO0B 1PW3A 2FIKA 4ZS7L 1I9JH 1JPSL 3LZFH 1MUJB 5IFJA 3OJMB 3FQWA 3IFNH 3PG2A 3R1GL 1JHLL 3KPTA 5DUML 4AT6A 5E8NB 1YJDL 2R8SH 1EJ6A 3BQUA 4PLNC 4EXPX 4X6EB 1YPZB 2HTKD 3UPAA 1S7VB 5SWQB 4EBQL 1KULA 4KJYB 1FVDA 1KIQA 4DZBA 4NN6B 4LSRH 3MGTB 5L7XH 2ZUTA 2BY2A 1KN2H 2Z4QA 1I3GL 1U6AH 5JW4R 3MOQA 1AD9B 4R0LB 3QIBA 5E8OB 2V5YA 1Z9MA 1H15B 3KGRA 4UQ2A 4K23H 1Z9LA 2OMNA 2V7NB 5GRUL 1HKLL 1U41A 4K3GA 4CVUA 2G5BB 4PJBE 4R0LC 4KZDH 4OIBA 5H94B 2P5WB 4XAWH 3D39A 4HGWB 3RWGB 2Z31A 1K3ZA 2FL5A 1DLFH 1I7UA 4JVPA 4NQSA 3BPCA 3VW3L 4TTDD 1KCUL 1B0GB 1NBVL 3N1FC 4HFUH 5AWNL 2MSPA 1BZQK 3O3UN 3Q0HA 2Y07H 3ZKQD 3FHQA 3G6JB 3X13A 4PJDF 1FL3B 5CHNA 4QOKE 5LG1A 4E41A 3TEUA 4OCSH 1BVLB 2VLME 3TCLA 3VXNA 2Y7QB 4GMTH 3HG1D 3TYGH 1YC7A 1BEYH 2JB6B 5C6TL 3O3AB 2DLFL 4X5XA 5GZNC 1KLGA 3SCMD 4FMFA 4AT6B 1UZ6F 1J87A 1N26A 4XXCA 3D69B 3R8QA 3UJJL 1RVFL 5I6XB 1T1XA 1MCPL 1TTFA 2HYMA 5TGBB 1ORQA 3KYOB 2QR0B 4KDTA 3QXTA 3BRDA 1N2RB 2GTZB 3MV8A 1ITBB 4K8RH 3DX8B 3KYKH 4MJ6B 4F3FA 1RIVL 4BSJA 3GIVA 4BKLA 3U7WL 2KQMA 3GSWA 4L5FL 3HAEH 4UIKH 4HKXB 1I7TA 3QISA 4CDHA 4KUZH 4XTRD 2UWEB 3O2DH 1OAZL 2EDBA 2LVCA 1JWMA 3ARUA 2JCCE 5IKCB 4B7LA 5I1CH 2H26B 5E00B 3QSKB 2EH8H 2DI8A 3INUH 5HDOA 4F58L 1RZ7H 3FRUA 1Q9LA 3SE9L 4UDTA 3SPVA 2CDEA 1NJ9A 1WZMA 4XTRC 1BFVL 3NACL 3BN9C 4JY6A 3S34L 3JTSB 4YDVB 1IEBB 4Z7NF 1ZLUK 2MCPL 2E9BA 2F8OA 3HFMH 4DGYH 5HHQA 3HNVL 5C0JB 2HA1A 3WN5A 3QG6A 4FTVE 1WT5C 2WW8A 1WWCA 1DP0A 3VI4E 4IS6A 5D70L 4XNQA 4IDLA 4OZFG 4P2RD 1VHPA 2CDGB 4RGOH 1T2QL 4QOKA 4E41E 2NLJB 5I18L 3BZEA 2X42A 3PL6C 2K1MA 4M7LT 2EIZA 1S8DA 4ZTOH 1QBMH 4JRYD 3GBML 4OZIF 4LQFL 1JI1A 2FX8H 4PJXB 3TO4A 5EA0L 1FSKC 4Y5VA 2V2TB 4ONFH 1TZIB 4HAFA 3P4MB 1MJUL 2PYFA 3U0TA 3NCMA 1YMHA 5IMKA 3GMLB 3HC3H 2H41A 2Q7YB 4JRXA 4N8CL 2NX5A 2UUDH 3RWJA 1N8ZA 4XWGL 3MMEA 2AJUH 4OUOA 1CD0A 5J6HB 1RZIB 3FJTA 5F6HI 3PIQB 4EI6B 3G04A 5D6CB 4C56A 3NIGF 3OGCB 3VGAC 4FHBD 2CD0A 1VACA 3ARDD 1UZ8A 4PJ8B 5KSAA 5D7SL 2CR6A 1HDMB 1N4XL 2R56L 3OJDA 4UTBL 5F3HB 3D0VB 4LOUC 4Z7VE 3C5ZA 4QRRD 4WRLA 2HVKB 3U9UB 3S7GA 5INDA 4PJ7E 4LEXL 1T1WA 3QUKB 4L4JA 4PV9A 4Y4FD 5SWZD 1W8OA 3CDYA 3SJVB 2R39A 1N6QH 4IRZH 2J8UF 5MEND 4GRMB 1U8QB 1YMMD 5CWSA 1MFBL 2Y6SD 5JPMA 5BV7C 1RSFA 3FL7A 1AE6L 1QSVA 5A2IH 5A43C 4MDIB 4HLJA 4LOUD 4LSQH 4OSUH 1JHLH 1P84J 3S36X 1QO3A 2GSGA 3NGBB 4ZAKA 5EOCH 3GMQB 3MJ9L 4PS4H 2PTUA 1U92A 1B4JL 2B4CL 4MAYC 5TDNB 2H32H 3PNWB 1TVHA 3ARXA 3VRIB 1OGAA 1QRNE 3B9KC 5TPWH 3AS2A 3BZ4A 3D0LB 1CBVL 5IW3A 4P2OB 3TH3T 1B6UA 4PY7A 3K4AA 1QA9B 3TWCL 1GZPA 1AXIB 1J8HE 5H37G 1V7MH 4I48A 1S5IL 1UH2A 1OB1A 2QV2A 4GW5A 4NFDA 1X4XA 1AO7A 5GSVB 1IE5A 4G9FA 4IHOA 3LS4L 1WZ1H 4HFWA 2X1WL 1MCLA 2CRMA 5IFAH 2IQAA 4N8VA 3CNKA 4S2SA 4LAQH 1I1AA 3LN5A 1RIUH 2IMMA 3MOBH 3ZDXF 5BXFB 2FATL 4R2GD 1WUNT 1T21A 1EGJA 4M4PA 2W65A 2OSLA 4JO4H 4JRYB 1EBPA 3CSGA 4FZ8L 4UAOB 2IANA 4BQ6A 1FLRH 4FS0A 2ZSVB 4M7KL 2BMKA 3MACH 4P2RB 5BZDB 4YBHA 1K6QH 2HVJA 2NW2B 5HD8D 2CIKB 4R2GC 1QLRB 4GSDL 3WHE1 2IMNA 4CW1B 5B8CB 4WW2C 3IRZA 4O51A 3RNKA 1T0NB 2VERN 2BSRB 2PF6A 3SKOB 3E8UH 1VFAA 5LXGL 5I8KH 1UWXK 5D1QB 4IJ3B 1W2KT 4X83A 2YD9A 3VE0A 4U33A 5L8JB 5EU4B 5E6YA 4OF0A 5L7XL 3U1SL 2PO6B 4XP5H 1OL0A 1TVHB 1XIWA 4R7NA 2YWZA 5DEGB 3CXHJ 5D1XA 2VKWA 4JM4L 4LLDB 2IG2H 4HEPG 2WWMD 5C2BH 2H1PL 4HMDA 3FQNB 1ODAA 4PLOB 3MV8E 4RQQA 5I19H 3DPBA 4EDXB 5EUOF 2HVJB 4Y4KC 4ZOBA 3VH8B 3WIHL 1D5ZB 2ESVD 3ARPA 3O0RH 4U1KB 2CPCA 3HS0A 5DEFA 4LDLB 3VXMB 4OZ4B 3O4LB 1TZGL 1WEJL 1AQKL 3QHFH 3BO8A 4WHDA 1KJVB 1OD7A 5HGHA 4Z76A 3KPLB 1GH7A 4IRSD 3FCTA 4F57L 2YA1A 4YHIB 3TT3H 3CLEH 1NMBH 1UKQA 5K9KB 5EO1B 4KI5F 4YDKH 2AXGA 4E0RB 2VXVH 1VCAA 2FR4B 3O6MH 4FG6C 4HDIB 4PJ9C 3O4LD 1MCWM 5I1KL 3LSOA 4MS8C 4Z7UE 5C0AE 5IQ9B 1WV7T 1L9MA 2I9LB 1NSNL 1YEGL 3O2VL 4APQC 3LMJL 2E7BA 1ZAGA 5EORL 3QNZA 4KGLA 1QHOA 4NCDA 4ZDHA 1FNGA 3QRFM 2YMXH 4JFDD 3PDDA 4H88L 4PJFE 2N4IA 3LQZA 3ARVA 1SEQH 1WC7B 4TVPL 3WSQL 3BP6A 4LLWA 1XGRB 2YK1H 4HC1H 3CXDH 4QXUL 2XXMB 3VMPA 4P4KC 4KDWA 1C5CL 2EDHA 3FONA 1HINL 4GJTB 1BQHB 3I6GB 4PGDB 1X5LA 2CDFB 5D5MA 1T1YB 3ILQD 1NGWA 2W0FA 1YNKL 3IJHA 5TF1H 3VXTA 2PCPA 1MHHA 1RZKC 1SBBA 1XCTA 3FN0L 4TSCH 4LSVL 4MCZA 3T65B 4X9IA 1MF2H 1NBYB 2X4QA 3PGCB 4L29A 2I9TB 1FYTA 1U8KA 4CJ0A 5DMIL 5HHPA 4WNQA 1K8DB 5FYKU 5CD3A 3ILQC 5FYKD 1RIHH 3IGAB 3RVTD 4APQB 3RWFB 1U3HB 1BAFH 3MR9B 2MHAA 2R15A 4UDTB 2H32A 1JPST 3HPLB 5HGHB 3EDEA 3CDCA 3NFSH 4JR9L 4R97C 1HHJA 1KB9J 3QI9C 2IAND 4K8RL 1KXVC 1X3DA 2PYEE 5GGQL 4X7SH 1CFNA 1ONQA 3BD4A 5GIRA 3QPQD 1RUPH 5KAQG 3OGCA 2AXFB 5IG7A 2B1AL 5AEAA 2XA3A 3DTXB 3VFUB 3C8DA 2I9TA 5EC1B 2AJ3B 1P1ZB 5JHDB 2UYLB 2VJXA 5JPNA 4Y8AA 2AJXH 2CDGA 1L0QA 1PJ9A 1JZ5A 1WF5A 5C09B 4ONFL 1EGJH 3JV4B 3OB8A 4L3CA 1C5BH 4TSBH 1X5YA 1K4CB 5L88L 4YWGH 5DUMH 3MRQB 2VAAA 2IAMC 3ARGA 5E2VH 3C5JA 4PJXA 5GISL 3TO4B 1FBIL 4O51B 3AAZB 4OLZH 1MIEL 3MLWH 3D2UA 5D6DC 5HYSG 5I0ZA 4KFZC 4OQ1A 4BQBA 3KPNA 4DOHB 1J1OH 5EO9B 1AKJB 2X44D 4AY0A 1BIIA 5C7XL 3UJJH 5IVOA 4FTVD 4NNYB 4ODWA 3U9PH 1KJ3L 3VFPA 1NFKA 1FGNL 2FJHB 3MRDB 4XCEB 4ZUUB 4I0PA 3T4YA 4LPVA 3TBWA 5HYJB 4G5ZL 4QHKI 5HTSA 4E41D 5DSCB 2BERA 4U1IA 5JDSB 2FLBT 5L0QC 4PP2A 5CSGA 4J8RA 1XGRA 4I8DA 1OSZB 3OTTA 4P2QA 3ZYJA 5EO1A 3SCMA 4DN3H 4OLEA 5IMLA 3ULVE 5BO1L 4HH9A 3OR7B 5DI8A 3VFOA 3EGSB 1WBZB 1YA5A 2GK0A 3UTSB 5DS8A 1FNEB 5FYJE 3DVNB 4MQXC 5IB1A 3IFNL 1EZVY 5AWNH 4F9PC 4KKBD 3PGDA 1XGQA 5GGVH 4PFEA 4M3JA 5GZOD 3MOAL 5FCUH 4P5KB 4QRTB 2R2HA 1S7XB 3ZDZE 1OW0A 3EOBB 4RFNC 3K74B 3LKSB 2CK0L 4RFNB 5HHOE 4ODXB 1Y6MR 5DJ2B 4KTEH 4MCZB 4PLKD 3O3BB 1ZK9A 4UU9B 5F1SA 4Q9CA 3RIAF 1X5FA 4XX1G 3RX5A 5KW9L 2E3VA 3GO1L 1LVEA 4X98A 5SWZE 5L9DH 5BMFH 4G43A 1NFDB 3IDJA 4Y16D 5LKNA 1J8HA 5MENE 5I18H 3KPOB 3RBGA 3CD4A 3QWQB 3UTTE 4DUWA 4YDIL 4TUKH 2G75B 3RU8L 4A6YH 1UVQB 1RFDL 2V2WB 3RIAK 3BGMA 2ZCKL 3TIDB 3OKNB 1A2YA 2J8UE 2J8OA 1A0QH 1CFTB 3ZE2F 3DO3A 3X12B 1QRND 3F7QA 3RVWD 3TN0C 1CD1A 5I1HH 3EFFB 2JB5L 3BKCL 5I1AA 4NQDE 4PJIF 4E9LA 1OSPL 5GSRB 3H9SE 4R9HA 2LABA 3L1OL 3M8OL 3NABH 4NZTL 3WFZA 4XHJD 3TO4D 3UPRB 4PJ7A 1TMCB 2ED8A 2G75A 1FL5B 4JM4H 2EIZB 3D85D 3NCBB 1PLGH 4P46B 4WHYG 3H7LA 5J0BA 5I19L 4GAYA 4U6YA 1U91B 5E24E 1KNOB 2R9HC 5BVJA 2WIIB 2XKNA 4JCMA 3JUYA 3ZSSA 1OTUC 4P57A 1QPPA 5IIEB 3O3BA 2YN3A 5AAWA 3WN5B 3PL6B 4HSQA 4GG6A 4KZDL 4JFZL 4XXDB 3K1DA 1H3PH 3LKSA 4ORGB 5ISZA 2P44B 2I26N 3HZYA 4R3SB 1AR2A 1RD6A 1KF9B 3T8XB 3QUYB 5T1MB 3L3HB 3G5ZB 4X9HA 2EXWD 3VWKA 3C5ZD 5F6HJ 4QRRA 3TNMB 4DTGH 4UINL 5KS9E 1KB5L 1E4KA 2GKIA 1FH5L 4YUEH 2CKBB 3C8KB 4CVXB 3TPKA 1LNUB 4XWGH 1I85A 1OWWA 2YN5A 1HYSD 2XTLA 1U3HD 4RMWA 1J12A 4QRPA 3DBXB 3TBYA 1CLZL 1T2JA 4Y1AD 2J8UB 4I3RH 4KQ3H 1Q72H 5CBEA 3ZDZF 1P4LB 3QI9A 1FP5A 1G9EA 1PVHA 2Y25A 5JXEC 4WI3A 2WQ8A 4JRXD 2Q8AH 5GRZA 3RZCA 3DMMA 2R1WB 1UCBL 1IFHL 4OFVA 1SMOA 5T3XL 2HMIC 3EDDA 4JDVA 2B1AH 5DRNB 4XCYB 1QVOA 4LEOA 5D2LE 3QEGL 1AXTL 4HQQL 5TE4H 4JKWA 2Q20A 1DQLL 4J3UA 5FKAA 4R26H 4CBPA 3IDUA 2FBJL 3MNVB 2EIBA 3RJQB 2P5ED 2A6IB 2HMID 1OB1B 1FL6A 2X9YA 1OTTD 2B4CH 3A67H 5DURB 3QB7C 5JA8B 4N0FA 1RZ7L 5C0AD 4O9HL 5DO2D 4QO1A 5GGRY 4GXVL 1G7MB 1FL3A 4XNYH 4F7EA 2B4CC 4K2UL 1RULH 2W91A 3KYNB 3DX7A 4KVNH 1MFDL 3CH1A 1JPGA 2YUVA 5BZWA 3S8WA 4JFDE 3UTSE 1BOGA 1UM4L 15C8H 4U1LB 5CJQH 4YHML 3D5OF 2X4OA 1MCNA 5CILH 4NC1C 4HJGA 1WZ1L 3E6HB 2BVYA 2JJTA 3MRMA 1L6ZA 1WBYB 4YXLH 4UQ2B 1JZ3A 1M71A 4QTIH 4OZFB 4WU5A 3AU1B 4GKOA 3Q6FA 5E9DA 4OLYH 4N68A 3R06B 2GFBA 3RPKA 1JWSA 4XCCH 5FDYA 3OL2A 3P40A 3H8NA 5JPNB 4KK9D 4WEBL 4HLZG 5ESAA 5I9QC 1U3YA 2YWYA 5DUBB 1WSST 3OZ9H 2VISA 3QRGH 5EA0H 3F7YA 5DWUL 3QCUH 2GY5A 1MAML 4XCFL 1MCCA 3GSWB 4XNUL 2FHCA 3OKEB 1FZMB 1IGJA 2PW2A 1M05B 4WUUD 4N9OB 5AYUH 4D3CH 5DJ0B 3E2HC 3QCVL 3LKQA 2VE6A 4YX2L 3NZ8A 4ZODA 1M4KA 4P4RB 4KPHH 1YEJH 4ZSOA 4PUBH 4ZFFB 1U42A 2WAHA 5C1MB 4Y0GA 2X1QA 4A2LA 3MRLA 3IRPX 1IGIL 3QWRD 2X4RA 1ULVA 1ZSDB 4CKVX 4OCXH 1PEWA 1EAPA 1V8HA 1R3LB 2JJWA 5MP6H 2FBOJ 4U1MA 5FUZH 3RL2B 5MI0C 4Y1AB 3BPNB 3UJIL 5GRWA 4Q9QH 2VLLA 4PRNA 3L9RB 2GY7B 4JQIH 4KDTC 3HA0A 3IETA 1M7IB 3QQ9C 3IJSA 4RIRB 3F12A 5EU5A 4JGUA 5CP7A 2ZCKH 5KS9F 1TDQA 1C1EL 1MWAH 3B2UD 4JPIB 3AFLA 2VC2H 1KJ2H 4YH6A 1P7HL 1C08A 3FTGB 1XF4A 4DVRL 3MLRL 1L7TL 4EN3D 1A4KB 3UYRH 1PAMA 1F11B 1YC8A 3BP6B 4LCWD 3GJEA 1DUYA 3VDCA 4OJFH 2QL1A 4M5YH 3QO0A 3MLXH 4QF1A 3MA7A 4DUVA 4U7KA 3UTTA 1K5NA 3GM0A 1F4HA 1EXUA 1A4JA 1NUDA 3VGFA 2YA0A 4AQOA 5ANMB 3U9PL 3O4LA 2QLVB 3DGGB 4KTYA 5IQ9A 1HKFA 2YSSB 4DGYL 5MERB 2VABA 3BESR 1Q94B 4C83B 3QEHA 1U93A 4Z8FL 3WFCH 3UTQB 1C5CH 1FNAA 4QHKJ 4IMKA 4Z6AT 3EDKA 1M1SA 2EDNA 2A1WH 4RGNE 5JORA 3D25B 2D03H 3HAEB 5J4MA 1A22B 4DCQB 1NPUA 1A7RL 4ZUTA 3VWKC 3CVHB 5F1IA 1HILA 2VDQH 1FO0A 4F7PB 4WI8A 5FYJL 4NQVA 2CRIA 4DK3A 5D1QA 1MHCB 4LCCC 1RJZB 1H9VA 1HHIA 5EUOE 3PHSA 1LE9A 2LU4A 5IROA 2X41A 3GGWB 4OZIE 4JKKA 2VWEE 1N6VA 1G1CA 3TH4T 3SDDD 1DQDH 5E8EB 5TPWL 3RTQC 2KZ1B 1AGCB 4EZMA 3M45A 1BBDL 4IOSD 2DMKA 4KRPB 4RFEB 3NABL 1X9QA 3KYNA 3MFGB 2CK2A 3MLSH 2BSSA 1X7QB 2DN7A 2GYSA 1DDHB 2R29H 4OLXL 1PKOA 2AGJH 4QNPF 2R4SH 1T1YA 2Q3AA 4XI5C 5EOQL 3U7AA 1T2XA 4GAYB 3WSQH 3ARFC 2UZYB 1T0NA 4G9DA 2APWA 1HWGB 3STZA 5C92A 3RWGA 3UBXB 2ICWA 4OQTH 43CAA 3GRWH 1E4JA 3MRBB 4PJDB 4HUXB 3UTTD 3LDBB 2HT4C 2PN5A 2V7NA 2X1XR 1G9NL 3BJ91 4G9FB 1BP3B 1FC1A 5JOFA 2DQEL 1XGPA 2EDEA 4POZD 5F88B 1N6QL 4NQEE 1JGVL 5E2WH 1HZHH 2WM0A 1D6EB 1A4JB 4I0PB 1F45A 4TULL 5HHVL 3RVUD 1OT2A 3KJ4C 1N0XH 1P4IH 2N7BA 3A67L 2XQYK 4N8VG 2JCCF 4NQDD 2XZQL 5KVEL 2GT9A 3K46A 3AXLB 4MNQB 3LOWA 4ZAKC 4EUPG 1YNTB 1UH3A 4P9ML 3BH8A 4XNXH 4AENB 1EZVX 4GKNB 5I73C 3IDGB 1YYML 5DEZA 5DJYB 1BD2D 3S5LG 5F9JA 1GZQB 2A6DA 4XPBH 4QHUB 5F9DC 3WDIA 4L8BB 3IETB 2M8XA 4PRPE 5IFAL 3DX6A 1KG0B 5LGHH 3PHQB 1L7IL 3BSZL 3CVHH 1XGUB 4PRHD 2N56A 4GLRH 5LQBH 5ISZB 2DL9A 2E6PA 3NFNB 1E4XI 1U93B 4PJAE 4BH8B 4YAQA 1C5DA 1P9MA 4Z95L 3OZ9L 4L4VD 4UT9L 4QHLB 1SJHA 1BZ9B 1HCVA 4F57H 1SEBB 4GRWF 4HX1B 3EDJA 3PWUA 3LEVH 4G6KL 2OLDA 2XG4A 3WEXA 5DD1L 4HIIA 3RWJB 1I7RA 1U91A 2NZ9C 4F7TA 1OLZA 4WW2B 3LPGA 4Y4KB 4HH9B 3MCLH 4IMLA 1FL5A 2J4WL 4ZPTA 1GXEA 3EO1B 4P59H 3O4LE 4UT6L 3U79A 4JHAL 1EH9A 3REWB 3WL9A 4KAQH 1BAFL 1A1MA 5M7QA 2ILLA 1DN2A 4JZNA 3VG0H 4X8JB 3RWHB 2Q8AL 4P4KD 2GJZB 5I1IH 4JAMB 3EJYD 1KN4L 4K71B 2JK5A 4XP4H 4DK6A 3WCYA 1UWGH 5HVFB 2QBWA 1YPZE 3RUGB 3WS3B 5BMFL 3V4PH 1OAKL 4AYFA 4DOHE 2FIRT 2L7UA 4IRSB 4OD3H 5C70A 5I30H 5CGYC 3MRMB 2EDQA 4M48H 1YEFH 2FECI 3L3IB 3QH3B 1KIPA 1E28B 4L9LB 3NCCB 2NTFA 5DA4A 3P0VH 4ZO9A 1FO0H 4AZ8A 3CU1A 3U48A 3FN3A 4C56D 2HH0H 1ZHKB 3PV7A 5KN5A 3MTRA 3LKNB 4B53A 3Q6GH 1SJXA 2Q76A 2P5WE 1FBIH 4MXQD 5DQJB 1P1ZA 5E00A 4JFYB 1YEJL 2X4PB 2YD2A 5E5RB 4C55A 1XGYH 4WV1A 1U3ZA 3SBWC 1MI5D 4M6AA 2NNAA 4OKVA 1OAUH 3LDBC 4XZUA 4D0BA 3EO1A 4K9EL 2VLJA 3GSNB 4PTUB 5D7JA 3WNLA 4YZFF 2DDQH 1N5AB 2JJVA 3T2QA 1VFBB 5E5MA 2ERJC 3QFDB 1MELA 4B5EA 2PYED 5DRZB 4PG2A 1T89C 3DETC 3D3VB 1E4XL 1UZ8B 2ARJQ 3FOMA 5KSAB 1F3DH 4WY7H 4BJLA 3VH8A 1JRHI 1K8DA 1LQSR 4N0UE 1HOCA 2F58H 2NX5E 4J8RB 3TJHC 1BOYA 4WFGE 5CKAA 2VLKD 3O6FC 4WUUE 1KG0A 2YBRB 1CDUA 4EOWL 3G6AA 5I76B 3O11A 3VXPB 1OPGH 5DMYA 1FAIH 1IGYB 3IJHB 2NW3B 3MLXL 4I2XB 5F9JB 4X80L 1TZIA 3G5ZA 3T08A 2D0GA 4PUBL 4PB9L 5E03A 4NIKB 3MRPB 3O9WA 2FD6H 3ARBB 1HE7A 4PJGF 4Z7VB 3BH8B 2ZG3A 1HXYB 1U2HA 5DK0B 5F89B 1DQQA 1IGCL 1P5VA 2OL3L 2YPLE 5KBNC 2HN7A 3TA3B 3HI6H 5H37H 3C60D 1TTUA 5BRZA 1LE5B 1OCWL 5C0EB 3O41A 1GYAA 2VN4A 4R7DB 1M7XA 4Z5RB 5IWLA 3HRZB 5E99L 4RMRA 3QEUA 4KKBC 4BH7B 2ZOLB 4NFBA 1EJOL 3S37X 2DQFA 3ZYIA 3C60C 4JKLA 3KXFA 3MO1B 4KK8C 4GG8B 5TJWK 4K3DH 4PJFB 2JLLA 1Q8MA 3DRTB 4LCWE 3BQUB 1U8PB 3KPSD 1LP9B 3QDGB 1Q0XH 2FEDC 4N1CA 2EDRA 2FJFA 2V9TA 4ODHH 4UV4L 4OF8A 4BZ2H 2R0LL 5ACZA 4HUWA 1B88A 1XZ0A 3VFMA 3HMXA 4DWHA 4P9HH 4WUUB 3IU4L 5D2NB 2F53A 4LRIA 1SVZA 3OPZL 4OZHA 5DDHA 2FGWH 1WWWX 4FQQA 1MHEB 1VDGA 3Q5YA 2R0ZH 2W0KA 3WHE0 4K23L 4RGND 3BKJH 4ELMB 1XR9B 3OKOA 4LDEB 4TTGA 4HKZA 2V5RA 3HZMB 1S9VA 4OIIL 3VD9A 4Q6IC 1T7WA 4O2CA 3FB8B 1I3RA 2A6DB 5BVJB 5TFSL 3NTCL 4KJWC 4WWKA 4OCNC 4X4XA 5DVNA 2VAJA 4O00A 1TVBB 3GMPB 4G6JL 2R4RH 5B4MC 3QQ3A 2NY4C 1YEEH 4PJEF 5DJ6B 4RGNC 1A9BB 3VD5A 2DQFB 2Y1VA 5LWYH 1FNGB 3OB0H 4YR6A 4UTAH 4X6CE 4DGVH 4KJWD 5CD5C 5CBAB 5J1SC 3ULUL 3HR5B 4J4PC 3DURB 5GPRA 1QSEB 1PG7H 3L5JA 2NY5L 5IB1B 4GRLB 3DYMA 3D2UD 4WHYH 5JUEH 2B2XH 4RZCB 1EBAA 1RVFH 5GJTH 1KCVL 5FKPB 1UYWL 5F97E 1QLEL 4EQ2A 4KTEL 2FYYB 4O5LH 1AGEA 4TPRL 4GG8A 1EMTH 5T5NG 1B2WL 4FTVA 5TH2A 4KKAC 1JV5B 3O6KH 3QXAA 4OZGE 3NAAH 5CD5D 1NGZB 1CLCA 3KPOA 3MRPA 5F7FA 4XCEA 4QOKB 3L5WA 1JMXA 5GS2D 5B22A 1DSFH 1XF5A 2EXWC 4M5ZH 2EDWA 1NBVH 1XR9A 2R2EA 3OKOB 5DURD 5BRZB 1YEIH 4TUOB 1QSFE 2Y07L 3BYYA 5IK3B 5JIKA 4X4ZA 5CLTA 3VI3E 1FJ1B 3FO0H 3BXNB 5C0CD 1NC2A 4P59L 1ZT1A 1FPTH 1A6WH 1AI1H 1ZTXL 1LO4L 3EFDH 2P8PA 3BKCH 4GRMA 1B4RA 1I3RB 3MODL 1VGEH 3GMNB 4N0UB 4QT5B 3VMOA 1U0QA 4V2CB 1ZGLB 3I9GL 1RUKL 2CKBH 4ERSH 1HI6B 4XNZC 1Z6JT 1VENA 1S7QB 1HDMA 4OCXL 1PEZA 2IFFH 3FFCD 4PYGA 3VRLE 2GSIB 1CG9B 5CMAA 3ARTA 5IEKB 5I30L 2GEEA 5D1QD 1H3XA 2VISB 4OV6F 1BGXH 1S7QA 1WAAE 2A74B 3KPSA 1ZKAA 3DX8A 1X4YA 1FIEA 1RUAL 3C6LB 4BYHA 2Q86A 1TLKA 2EDTA 1LP9A 3LQMA 3QDGA 1JZ8A 1JF5A 4POUB 4CUCA 3GMNA 4QT5A 4TQEH 1YMHB 4GRLC 4LCYB 3OHXB 2VDKH 2ENSA 3O2WH 2WP3T 2DQGL 3M1BA 2D4FA 4MJID 4JFFB 4PGJA 4XVSL 3VRLF 5D2NC 5AD0A 2MPAH 5D1ZA 2RCSH 3PWVB 4G6FD 1BVLA 1E4KC 3TBVA 3PWJB 2R0WH 4LSRL 4PRID 4L3EA 2PCPB 1A47A 4ODVH 2C26A 3WS3A 4M62L 4M43H 3CFEB 3GHEH 5F96L 1HSBA 2BZDA 2NY4B 2CLVB 4JHWH 4JVUA 4P46C 3GSOA 3L3IA 3QH3A 5SWSD 3KYMA 3RZCC 1OAXL 2JJUA 1CLYL 4MD0B 1MFCL 3QFJA 2UWEF 1EJOH 5FO7A 1YECH 1KJ2A 3OG6B 3PHOB 4JM2B 1NLDH 5ITFA 4P3DA 2HH0L 1AIFA 4MXVE 1J1PL 4JKMA 1AD0B 1B4JH 4MAUL 4P46D 1Q9OA 3FB5B 4OZIA 1VA9A 2P5WD 4OD2A 4G80A 1RZGA 1S7VA 1DBKH 1C5DB 3DXAE 3STBA 3VFWA 1ETZA 3ALWA 1CXFA 4WFHE 1W72A 4XPFL 4EUPB 2Y4SA 3GUTB 4OD2B 3GMMB 3IU4H 1UKTA 3G5XA 4KQ4L 4HHAA 1P7QB 4PG9B 5HPMA 3MMEB 2XXCB 2AKRB 3GKWL 4YHKH 4KMTH 4LCCB 1UFUA 2G60H 3NH7H 4YHZH 3IS1X 5LGHL 3U0WL 3ARDC 3B2UC 3EZ8A 2JJTC 3ISWA 4DW2H 4WTZA 3VMNA 4F8TA 1EX0A 5DJZA 2R69H 4PRIA 4OTXL 5I74C 4LLDA 1TQBC 4XCCL 1T3FB 4LSUL 2Q3ZA 4PJIA 3WJLA 4PGEA 4CU6A 1IC7H 4XP1L 5I74B 4WEBH 1VEOA 3QDME 2DM7A 4L3AA 3HRPA 4HKJB 3ARFB 4HS8L 3R4DA 4LCIL 5EO0B 2FEEI 1GGUA 4HGKC 4NSKB 5KANG 3QUZD 4OLVH 1Q9KB 2CDFA 4NQSB 2BDNL 2YD5A 1DTUA 4Z0XB 3AUVA 4IOIB 4JE4B 4OLWL 4KY1L 4L8DB 1BWWA 4JFFA 4UI2A 4XP5L 2DQUL 1FNSH 2AJSH 5E2UH 4IRSA 2AXGB 4NC0B 1FAKT 1N64H 2C3XA 43CAB 5JQ6H 1S3KH 3NFPA 4EVNA 1EHNA 2CO7B 3GI8H 4R4BA 4ZS6D 4ENED 2I9LA 4I1NB 4F15B 3MROB 3BX7C 3QUMH 1MCSA 3AB0C 3OJ2C 4EQ3A 4X8JA 5KVFH 5C0EA 1D5MB 1XMWA 3MC0A 2IQAB 3MSPA 4KU1A 1QD0A 1ADQH 3B5HA 5DJCB 3CFBA 3V4VH 2BVEA 2F58L 2COQA 4LF3B 4IOFD 5KVGL 2FZ3A 2I60L 5EIIA 5EOCL 2L7JA 1GHFL 3KPSE 3LEVL 2DI7A 1HWHB 4WWKB 1ZGLA 1ORQB 1GGTA 4JLRB 3HE6C 5L2KA 3VE0B 1A1OA 1HHGA 3B9DA 3UAJD 4DGVL 5DMJB 3L3KB 3LD8B 4N9GB 1AKJD 2FEEL 1U8IB 4UV4H 4BZ2L 5D71L 1H8OA 1A21A 5A3IC 1YN6A 2X1OA 1RMFL 2BHUA 2GJ6A 3SDXB 3FO2B 5D7LD 4GG6B 4ZO7A 5MERA 2Y5EA 4HPOL 4XPBL 1RU9H 5GGSY 1MY7A 5EU4A 3RRQA 5FUOL 5JO5B 5IR1B 1XGQB 1OP5H 4HIEA 3LB6D 4POZC 5E5UB 1YEDA 3SDCC 1UACH 3HUJF 4I4WB 1SVCP 3SO3C 4IRJA 1ACYL 1IAMA 4G6AD 5GGVY 1E4XH 4KKLC 2FDBP 4MD5B 4X5WB 5JOFB 1CL7L 4GLRI 3MUGB 4TRPH 1S7SA 2BFVL 1F13A 1I1FB 5D6CA 4C56B 1D5MA 3VXOA 3FT2B 1N0XL 3CMGA 2C4FT 4PP1D 4GQ9H 1SHMA 3SDCD 4H26B 3WFEH 3U83A 5I1KH 2MQ0A 3FT3B 3QIUB 4OCLC 3O8XD 3C6SA 3B8YA 3LVEA 4ZFZA 3BZ4B 4NN6C 5EBLB 5LVEA 1EUUA 1RHFA 5HGDA 1F58H 4YK4C 1A3LH 2PYFB 4UIMA 3DVFA 1V7ML 3BGAA 1MI5A 3P9WB 4ZNCD 7CGTA 1CS6A 4L8DA 3B3IB 2FECL 2DMBA 3T1FA 5IEHB 3AAZA 3PP3K 1MNUH 3STZB 4P2QD 4NKOA 5DJZB 3BZFB 3VFSA 1Q9KA 1VGKB 4LQ1A 4NM8H 3LKOB 4CN4A 4K7PX 3MRKA 2Z8WC 3JWDL 5DF0A 1R5WA 2XTJD 3F6IA 5HBBA 2HKHH 3VDAA 1P84K 3CAFA 4OFYD 3O11B 3G6DH 4JFOA 1KTLB 1LO2H 1U8MA 2HG5A 2NR6C 4XVUD 3BPLB 2WIMA 3ZTNL 1QO3B 5AYQA 3QIWD 5DDHB 2YPVL 4LFHG 1W72B 2G9HA 5IGXL 1JE6A 1MH5B 3QFJD 4X6CA 1TVDA 1VPOL 5EFIB 3MRCB 4WFFE 3QIUC 4WJ5A 2VZVA 2FJGA 4MNGE 4EI5A 4F7PA 3VXRB 4P23A 2YKLH 2J4WH 2BHZA 1JCKA 1JJUA 1F4AA 1KXTB 3PWUB 3CK0L 3S4SG 3MA9H 5D7JB 2EDXA 5DJAA 5TQ2H 3VG9B 4EI5B 5C0FB 3P4MA 1JFQL 2YOCA 3ZMRA 3X3FL 3T0WA 2D7MA 3FFCE 4JG1L 3HI6L 5E6IB 3MRIA 2FGWL 4V1DE 3U0WH 5BRZD 4HWEH 3QQ4B 2JF1A 4MXWL 1BOGB 1H3WM 4LPUA 2VL5B 3MRDA 2FJHA 5CUSH 5B3NA 2B1HH 4G8IA 1A7QH 2ADIA 5F6IC 4NHUA 3F12B 1NAMA 5I1LB 3MJ9A 3PHOA 5T3ZL 1SJEB 4DN4H 2XWBB 4LLQA 3S5LB 5IVZA 5J11C 1QQDA 1CTOA 3L3JB 4RMTA 4TSBL 3DSNA 2KDGA 5E2JA 1ZS8B 4HJGB 1NMBL 2ZCLL 2VO5A 5HJ3A 4CAGA 9CGTA 2RFXA 3VXQA 4HPYL 4JGJA 4U6HB 2VLRB 1F97A 4YHNA 4XMLL 2ESVA 3U36B 2Z31D 5IVZB 1VESA 3OHXA 1DLHA 1OGAD 3E8UL 2FO1A 2APVA 4LIQE 2EEDA 5LBSH 5EZJB 4FQJL 5BS0D 4X7DC 2CIIA 1LEIA 3RWEA 4UQ3B 1BQSA 4J3TA 3BJLA 5BOPA 1KCSL 3BEVB 5GJTL 4JCLA 3P0YH 1D9KD 1MI5E 1NGPL 4M6NL 3TFKC 1IGCH 1E6JL 2OL3H 5EC1A 2ZCHL 1W72H 4LRNL 1GC1L 5FECA 2BVTA 1UQSB 1AGBB 3SDYH 3MLVH 4M7LL 3OXSA 2EC9T 1IVLA 4KWUA 2YPLA 4WUKH 1N2RA 2GTZA 3PWLB 5TFSH 1MOEA 5J13C 2H6PB 3FMGH 4LVEA 1G7JA 1NCWH 1Q0YH 4PGCB 1P7QD 3W9EB 3EYOA 4LHUG 1KTDA 5IF0B 5CMAB 5IEKA 4BH8A 3QUYA 3F58H 3HAEG 5F9AC 4LHUB 1X44A 3DXAD 1U8KB 2AEWA 3IFPA 1FV1B 3L1OH 2X4PA 1T04A 1U8MB 1XGTA 4HMEA 2YXFA 5EC2B 1TJGH 1JWSB 1T5XA 2IJ0C 3RDTD 5TGBA 4QHUA 2VZ3A 4ZG1A 5JQ6L 3IDIA 3NFSL 1VSCA 3QDGD 1R5WB 4NUGL 1CGSL 4N5UA 4D9QE 4GKNA 2DWEB 3QXVA 4JM2D 1Y18A 4N0FB 5IB4A 1AY1H 5ESQB 3RBSA 3LAFA 4YHZL 4NNXB 5EOTA 4HWZB 4DGIL 1G7PB 4RAHA 5E9DD 3LV3A 3VWJA 5KSVB 4AMKL 4KRNA 3H3BC 3BIBX 2HJLA 4HF5H 3LQZB 5J3HD 1IEAA 1T2QH 3OAYH 2B0SL 3DXAB 3WUWB 1LK2A 4ZFZB 1YNLH 3AVEA 2I60H 3BKML 4PJHB 1EFXB 1LILA 4K7FB 3QQ4A 4AH2B 3SO5A 1NCUA 2AXHA 4HWNA 4U1GC 2XNAB 1IILE 4UBDD 4ODSH 3KR3L 1JUFB 3UX9B 5L0QB 1U8NB 3QXAB 4OM0L 1QFOA 3F7VA 5M94B 1CWVA 3HC3L 2HRPL 4IMLB 2J8UA 4ODHL 5F3BB 3TN0D 3EYQC 3QP3A 4QWWC 4RISH 3KDMB 1CFVH 3DURA 5AZ2H 3QJFA 5DRWA 3BUYA 4HZLA 3RKDC 3DXAA 4HKJA 1A64A 1NCTA 5F8QC 3HS0B 1NQBA 4RWYL 3ZTJG 4MHHG 3ARGD 4AL8L 5HHXL 3BGMB 3WO4C 3MXWL 4NO5B 5F93C 5D7JD 4PJHF 5LAXA 1KTKE 5J11B 2EYRB 4LLUA 1E4WH 1KC5L 2WLZA 1NMCB 3EZJB 2IH3A 4M9PA 1OTUD 4QYOB 1CDHA 4JLRA 4ZSOB 2P7TA 4TQEL 1LO0L 5T1LD 4MAUH 4OGAD 4FZEL 3OX8B 2GITA 2LU3A 2HFGL 2LAAA 2F5AH 4B7IA 2BNRA 5FCUL 4R3SA 1D9KA 2EE3A 3RAJH 3VXSB 2PW2B 1IRAY 5DMIH 4K7PY 1GJIA 3UTQA 4M03A 4EEEA 2QEJA 4P2YA 1CDCA 5I16B 3L95A 1JF6A 4KDVA 1WLHA 3S3SA 3X3GL 2WP3O 2QSCL 15C8L 5CJQL 1WBXA 3V6OA 2IQ9L 4KKAD 2AABH 1HH9A 2ITDA 1B6DA 3NIFF 5EU6D 3J8F7 3WIFB 4Q97A 5DS8B 3GO1H 3P0GB 4CU8A 4LPYA 2BXZA 4UOW1 1A5FH 4RX4D 4LGRB 2V2TA 5CKGA 5K59F 2VDPL 3IF1A 3PP4H 5FFLA 4I2XE 1ADQL 1I1RA 2FBJH 4OIAA 3AS3A 5DSCA 5HYSA 1FLTX 5EPMB 2VITB 3HRZA 4H1LG 4LHJB 4Y5YC 4NQEA 4OBRA 3S35L 1LEIB 1LK2B 1IGYA 2YUXA 4NJAH 3B4NA 1E27A 1YEEL 1I9IL 4JPKH 3NCEB 4I5BA 1MVUA 1Z2KA 3A6BL 4XP6L 4UUJA 1J18A 1OW0C 4GAFB 5C0CE 2NPLX 1OTTC 5GRXG 1S9YB 4JEGB 4K07A 1N7MH 3M8OH 4Z7OF 3BP5B 4ZQKA 4QLRA 2C3VA 4KQ4H 5C07A 3KPMA 4LBEA 4J2XA 4X6BB 3B9VA 1MHCA 3IAPA 1RHHB 3I9GH 4LCYA 4XMPH 1NJ9B 5F9OL 4X98B 1O7SA 3I85A 5HVGB 3VFNA 4C59B 2H6PA 3M17B 4ZUTB 3ULUE 5GGUA 4XMKH 4KVCH 4PY8J 3KNBA 1VFBA 4NZRH 4KHXL 2AJVH 3WHXA 5JHDA 5D93B 2R1WA 3QEGH 4YBLB 1AHWA 1RY7B 4OI7A 2ZUUA 1CLYH 1DR9A 5HSFA 3CC5A 3RY5A 5I1GL 2CKNA 1QUNA 4WNQB 4QY8B 4L8SC 3WNNA 2Q7NA 3W9EA 2CRZA 2D9QB 3QFJE 4WV1B 5IGXH 2W1NA 3MZGB 1D3CA 2ZCLH 3HHRB 2H2PD 5DT1L 5E5MB 4Q2ZA 3S97C 1W8NA 4YFLF 5ITFB 4G6ML 3JBG7 4GXVH 4XNYL 2DLIA 2YXMA 1UWEL 1BMGA 5BV7L 3HB3D 1LDSA 1NCAL 3UYOD 4PJCB 3TIEB 4R6UA 1VKXA 4MJIE 1AR1D 4OLWH 1H5BB 4KC3B 5F1OB 3FQUA 3RIFK 1T7XA 4FXLA 5JW3H 1BBJA 1LD9A 3P0YL 2X4QB 2H2PC 3PGCA 5EU7E 5C7XH 3S37H 3DUSB 3BFOA 4JG1H 1RUKH 1CGXA 4WVRA 4XPGL 2FHFA 4KRMB 4M61B 1CF8H 5HDQH 4PJEA 1QEWA 3GSVB 1DVFD 4HC1L 5EU7C 3SGEH 1T5WA 3VXRE 2K3TA 1M6OA 4GBXB 3E1F1 1H3TA 5T5FL 2VDQL 5C0BB 4GQPH 1G6RB 1CFNB 1ONQB 1YN7B 4FA8A 3KPQA 3I50H 3KLAB 1GHFH 4NT6A 1ZLUH 3KAAA 1FFOB 5DJAB 1OGAE 5ALBH 2V5TA 5FHBH 5KTEH 4GRLA 3MV7E 3DHMA 3WE6B 1V7NL 1AFVL 3F5WB 3BE1H 4KK5D 3KLHC 3MA9L 5GS2H 5FHAH 1CDIA 5BV7B 1FE8H 3TZVA 2JIXD 5T1DH 4RMSA 2DKSA 4KI5E 1K85A 4J3XA 5SX5K 3QCTH 3U7YH 2ORBH 5HHXH 5MP6L 3FFDB 2YZ1A 3TP4A 1A3RH 1CFQB 1UM5H 4FQXD 3KPLA 2X2YA 5E2TL 1IAOB 1W0YT 4Z9KB 1LNUA 1JYXA 4Y2DB 3WFBH 1MCQA 2UUDK 2VTFA 4WUKL 4FFVC 5FV2A 4X0KB 1HZHL 1KACB 2VC2L 4X7CC 3QUZB 1MLBB 1FVCB 4CADA 1U36A 3QRGL 4K94L 1FYTB 1FJ1A 5H2BB 1E6OL 4OLUH 4ZUSA 5HYJE 4U1LA 5C09D 5HGBB 4OFIA 2F53B 3QDMD 4GOSA 4TUOA 5DTFA 4O58L 3VWKD 1JNJA 3BYTA 4ODTL 3AY4A 3F62A 4WHTB 4XPAH 3N06B 5K9OA 1KUMA 3NIDE 4P2OC 4AEHH 5IBLD 2AQ2A 3U30C 2OSLB 4LVNC 1NGZA 3D39B 4HGWA 3NPSC 4JFQA 3LN5B 4PREA 5E9DE 2NTSP 1IL1A 4LSDA 5KZCB 3ROOB 1HN1A 4P2RA 4ZMAT 2PR4H 4FNLL 1UCBH 5IW6B 2OZ4L 2G60L 3C6SB 3RWDA 2Z4QB 3MFFB 3C6LA 1DEEB 3NN8A 1VB9A 2VLRE 3CZJA 4ZUUA 1XFPA 4HS3B 1FSKB 4N90E 1P6FA 1KJ2L 3HE6D 4LLVB 5C0IB 3V4VL 5GS0L 1K9TA 1NCDL 3IU3B 3HNSL 4ZTPH 5L8KB 4DJMA 2OS7A 4FQHA 3GKZA 3CSPA 2OI9B 5J8OA 5A3ID 3LRGA 2OTWA 5E7FA 1D9KB 4Z0XA 3TVMC 1MLBA 3FCTB 4KK6C 4OZFH 2VQ1A 2JB5H 2WBKA 1BEYL 3P9MB 3FFCA 1TJHH 4KKCC 4Y4KD 5FGBA 5EG6C 5F7DB 5FK9B 2F53E 1MJJA 2RB8A 2AABL 1CE6B 5DEFB 4FQCH 3VGEA 3SDXF 5T1MA 4XP4L 4RRPG 5CILL 2CRYA 4RWYH 3MV9D 4IRSC 3IFPB 1CXLA 1Q1JL 5D7LE 2ZWLT 5ABDE 3QHZL 2EYRA 3V4PL 4PRIB 1CFBA 4DGIH 3LKPB 3DRQA 3QEHB 2FX7H 4TSAL 4LCWA 5CWSB 2EO1A 2A83B 2HKHL 4YQXH 5CEZH 1T22A 2WZPD 5TE7L 3GMRA 4YHPA 5DK3A 1MCRA 4QXTB 4X9BA 5EIIB 3MA7B 3JV6B 4P4KB 1ZLSL 2VH5H 4G6KH 3OXSB 4JM2A 3QEQD 5E08H 3UC0L 3ZT7A 3TZVB 2GCYA 3P77A 3VXMD 1XEDA 4TN9A 3QEUB 2YEZB 3I75A 3F5WA 2NLJA 1F58L 3MGOB 4L4TA 1JP5A 3L5IA 4MDJB 5IMKB 1UM4H 2V17H 4H20L 1RUQL 2H2SC 3UO1L 4PJ9D 1U8OB 4IRJD 1GGCH 2MNUA 4Y5VB 2JELL 5D8JL 5CJXA 1BQHG 5IUSA 2M1KA 3SDAC 3BWAB 1NCCL 2P47B 1CDBA 2DWEA 3IDJB 3QULB 1U8JB 4F15C 4WI2A 4LASH 2R0KL 3QA3B 4MNHA 3O45B 4I18A 4PJAA 4HUMB 4EIGB 4IRJC 1T5XB 4G7VH 3MYJA 1UJTA 3RKPA 1P4IL 4Q2ZB 35C8H 2A74A 5BVPL 3GMMA 4IJ3C 3DSFL 3K4DA 3BHBA 1BQLL 3A6BH 4XP6H 3RTQA 3WJJC 1OM3L 5ALCL 1H3UA 4MJ5B 3QCVH 4DFHA 2HLAA 1UB6B 2PO6C 4MNQD 4XB7A 1S5HA 1BJMA 2NY2D 4JPVH 4YC2B 3X3GH 4OGZA 3EOAB 1JN6A 3RDTA 1AGFB 2NYYC 1KCSH 3T0EC 5IOPB 1QP1A 2V7HB 5LJYH 3EYSH 2EXYC 1A3RL 2ZUQB 1NUGA 4NKMA 2VYRE 4XAKE 3W2DL 4QEGA 4Y5XB 1A5FL 5CJBA 5C0DA 3JWDH 1LK3L 2DMCA 3MJ7A 2R1XB 3PP4L 5FA3A 1RZGB 1NAKL 4JQVA 4JPWL 3AB0B 4ONOA 5AG8A 4WY7L 3GMOB 3MLUL 3OBAA 3MRGB 5D9SB 3L3DA 3PUCA 1MVUB 1CE1L 1JPGB 3CGTA 3NIDF 2V2XB 5IJKA 2OBGA 3ARWA 1I8MA 1JGEA 5C0CA 1JBJA 1A3QA 5ESVB 4XWOD 4NP4H 3D85B 1PKQB 4KRPD 1I7UB 4Z7OE 5GQBA 3WNMA 3SE4C 1HHKB 3L3OA 4BQ8A 3TFKD 5KVDL 5I1DA 4UT6H 4RAVA 3HUJA 1PKQA 2RJMA 3MRHA 1RQ5A 1REIA 4MQSB 5D7SH 1XH3B 5JOPE 3SGJA 3JV4A 3ORJA 1CICA 3T0BA 5IHUH 1PQZA 2VZTA 4MWFA 1ZA3B 4MQXD 1WCQA 3UZVB 5DD3L 4JO4L 3H7BA 1A6AA 1ZGLP 4N8VB 4QTIL 1NC4A 5EU6A 3BIAX 1I7TB 1QBML 5J57B 4NKMB 4GW5B 5B39G 4K94H 3HC4L 4ZD3H 4XBGA 1CT8B 2GJ6D 4YGVA 1FYTD 1P69B 3NIFE 3ZYZA 1NUNB 4HJJL 3JTTA 2OTUB 4PRPA 3MBEB 1KGCE 5IKCA 2XY2A 3PNWA 4NQCD 2RBLA 4Z0BL 1T03H 4Y2DD 2HRLA 3NFNA 3RTQB 5D5ME 4BK5A 1GOFA 5J6GB 2PW1A 4YXKH 3RGVD 3JV5A 4ISVB 3H9SB 4NO3B 1QSZA 3VGDA 4OLXH 3KYOA 4IIQC 4Y88A 2P7TB 3D9AH 4LP4A 4LIQL 2W9DL 4EDWL 4MX7A 5EBMA 5FK9A 4GAGL 1PG7W 1BREA 3EYFA 1T1WB 3QUKA 4DEPC 3VFTB 4G8GB 3LN4B 2O5XL 2UY7A 4AENA 2UY6A 1SY6L 5ADOH 2O93L 4MVBD 1D5BB 5E4IA 2ID5A 2VDOH 5DHYB 4KUZL 3SQBA 3VD4A 1JGVH 2DQIH 3AXLA 4E41B 5HYJD 2GIYA 4Z77B 1TZHB 3CMOL 5KSUB 4YDKL 2GK2A 5DYOB 1JPSH 4NJ9H 4DQOL 3F7RA 3CJJA 4NCC2 4OZGA 4D8PB 1NC4D 3GHBL 5I8KL 1BQUA 2HT2C 3I75B 2QKIA 1NMAL 3V5DB 1I1AB 4JG0L 5F7LB 5F70A 5JW3L 1DVFB 1F11A 3V2AR 4MQ7A 1DQQB 4X5WA 1D5BA 5D7JC 3H3PH 2J88L 1LDPH 3QDJB 1F02I 3IFOA 4OCMC 3MPCA 4U1JB 1RV6X 1JL8A 2I5YL 4OGXL 5EUOA 5CP7B 5BQ7A 3C5ZC 2N7AA 3N1GC 1T89A 3PWPB 4I18C 4MZ2A 1DBAH 2BRQA 1X5IA 1AO7E 2BNQE 2Z8SA 3GSQA 3OMZA 5DHVA 3ULVL 3U7WH 3C09B 1QYGH 2B20A 3O9WD 2YD7A 4WFED 2A1WL 4M5ZL 4YC2C 2DQEH 1JRHL 1GAFH 1T4KA 4ZXBD 4F7CB 4NQTA 1BM3H 3SDXA 1WGOA 4E5XA 4HWZA 1FCCA 1U58B 1OWRM 1IGTA 3BAEL 5LCVH 2KH2B 1HSAA 4ZO8A 3D18B 5ICXA 5BVPH 4U7MA 4YXHH 1DBBH 4KV5F 2BSTB 1CVSC 4S1RH 3D3VA 2OK0L 4JZJB 2PO6A 4XVSH 1LHZA 1MJJB 3VFGL 1FZOB 1YYLL 4LCCA 3QFDA 3JSSA 3IJYA 1QFWH 2J6EA 4G8EB 1QFWI 3DVNA 2NXZD 1FZKA 3TYGL 1INDL 2YS4A 2A6KA 1N7ML 4LLYB 3KPRB 4EBQH 4HCRL 1V05A 1U95A 1UQSA 3CFDA 1QFUL 4TVPH 3EYVB 4MNQA 5K59E 4H5SB 3IDXH 3MBEA 4NWTL 5MEPB 4U1SA 3V8OA 2X4TA 1MJ8L 4AIZA 4OQTL 3P4OA 3PABB 2Q6WA 5B39A 3C09C 3R06A 5DR5L 5CZXC 5IJKC 4G3YH 5CGMA 1T1XB 3T04D 1R3JB 5E94B 1HKLH 4I18B 3U0TB 1R5VA 1I8LC 3SDCB 4XZUB 1RHHA 3MRJA 5I1GH 2VDRH 4HKBA 4NQCA 4XCNA 1IL1B 2AEIT 5EO9A 1ZLSH 3BT2L 4HV8B 4LKCA 5HHMB 1FO0L 5TDPB 5JZ7D 5HDLA 4I0PD 4JFPA 4CVWA 3IT8D 2X4NA 1QRKA 2W9EH 3FQXB 3HMXL 1LP9F 5GZND 4LMQI 4ODTH 1G1YA 1PQZB 4N8CH 1LO4H 4OCSL 5I8CA 4JPVL 5HGAA 1CGTA 5EZIH 3BQUC 5C6TH 4LRIC 3CUPA 4OGYL 3X14A 1NAMH 4U6XB 4U6VL 2GTWA 3KWWB 3V0WH 2AEPL 3GFUA 1G6RH 1BBJB 1Q1JH 3B43A 2R56H 3VD7A 4PJHE 2IFFL 1FVCA 3MV7B 4R8WL 5DHXB 4CADB 1CXIA 3L3JA 1U8QA 3FOMB 4O02H 3NAAL 3KJ4B 1CF8L 1VKXB 1T7VA 4NQVB 3EAKA 4IDJL 4JKPH 1PYWA 1ZEAL 4Y4KA 3CSBA 2A9MH 1YY8A 1TNNA 5E99H 1Q9LB 4LASL 4RDQF 4DZ8A 3I02A 1AQKH 2W60A 3PJSA 2GAZA 5JORB 1BZ9A 4O4YL 4PB0L 1GGYA 4JY4A 5EOCJ 1BPVA 3ROLA 1K6QL 5I8EB 1F3JB 2YHGA 3N50A 5FB8A 1CLOH 4MGXA 2AV1A 3MJ9H 2VRAA 3L95B 4HBCH 3TBTA 5D2NE 3NIGE 2X1PA 5KG9B 4O2FB 4ZPTB 2IGFH 3HC0B 5E70A 2OR9L 4OFDA 5KTEL 5T3ZE 2X5PA 3CZFA 3DGCR 1CGYA 3ALXA 4X80H 4FP8L 2EC8A 4RAUB 3UTTB 1MUJA 1OF2A 1FZOA 5IFJB 3LMJH 3SOBH 1C8PA 1J05A 2FD6L 4F37K 3I6KA 3QWOA 4K3EL 5ADPH 1KENH 2O5ZH 2Y72A 2EKSB 4L1HA 4LMQE 4FXKA 1T83A 3QEQA 2NY7H 1MCIA 3GHEL 3B9KB 5CJOH 3HNVH 1B2WH 3VXQB 3I3DA 5EWIL 3W81A 5GGQH 2VR9A 3W9DB 3EO0A 5DD5H 4S1SH 2OJZH 3UTPE 1RURH 3CH1B 3WO4B 1OARL 4JPIA 4PJFF 3T0EB 3UXFA 5HGAB 3TPUA 4MLIA 1I8KB 5FXCH 3HZVA 3S96B 5DFVC 2VXSL 3W5MA 5FEBA 5C0RH 1KJMB 5T1KA 1BQHA 2FX8L 1J0ZA 2AJYH 1BECA 1QOKA 1WWAX 1LD9B 3MRIB 3AS1A 5ICZB 5DT1H 3C08H 4DKFH 4JY6B 2DS4A 4F58H 2XWTA 4XRCA 4J3SA 25C8H 1F42A 1JGUL 4WO4B 2WBJC 4PJHA 1RJCA 4YNYB 2R0WL 4MB4A 3BO8B 5CEZE 3OAUL 3O6LL 1QLFB 4OZGB 2QADB 1PLGL 4GFTB 2X4TB 4KZEH 1S5IH 1XCQA 5DHVH 2P46B 1KELL 1FGNH 1WAAF 5FO9B 1XF3A 1FZMA 1IGJB 3SDAB 3V0AC 1KPVB 2WINA 4RFEA 4FFVD 2AV1B 3EW3B 43C9B 4MJIA 4PY8I 1OCWH 3MRBA 3KVQA 5LGJA 3L7EB 1WT5A 1JZ2A 4MJ6A