1TFHA

Extracellular domain of human tissue factor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
207
structure length
202
Chain Sequence
NTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Coagulation factor
molecule keywords HUMAN TISSUE FACTOR
publication title The mechanism of an inhibitory antibody on TF-initiated blood coagulation revealed by the crystal structures of human tissue factor, Fab 5G9 and TF.5G9 complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 202
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tfhA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tfhA02
2BY3A 4Z7VA 1NCWL 4JKPL 5D72H 1CDHA 5IR1B 3KDMA 2FEDC 3D2UD 1AY1H 4H20H 3HZKA 3FO9A 1SBBA 3OTTA 4JFXB 4P2QD 4A6YH 4X5XB 4JRXD 4G3YH 5I71B 1MVFA 4RGND 4X5LA 3MLRL 2VYRE 3RL2A 1PKQA 4MLSA 4D0CB 2CLRA 3MCLL 5B38A 1WITA 4U1HB 4PY7B 5IVNA 2JIXB 2DM2A 3MBXL 4WW2C 3RNQA 2GTZA 1AQDB 1WVZA 4M43H 3P30H 4PJCF 4YC2B 3D69B 2YD7A 4PJ7B 5IEKB 4A6YA 2VLKE 3H3KA 2AGJH 2XTJE 3LB6C 1R0AH 2VWEE 3AY4A 3WFEH 2QKIA 1YPZA 5HDOA 4UUJA 4PV8B 5IV2B 5I1LA 4MJIE 4CADB 2VE6A 1MIEH 1GC1C 1V3JA 5J13B 3L5HA 3QEUA 2IFFL 3B9KD 3F7YB 5ISZA 4JY6A 1CICC 2NY7L 2Y6SD 1J1PL 1JWMA 3WYRA 4NFDA 4UTAL 3GK8H 3CSPA 3ROLA 1LP9E 5E2UH 3UP1A 1AR1D 4KKLD 3CVIH 3RWJB 3MRGB 3FHAA 1WFUA 4M7JH 8CGTA 2CKBH 3W9EA 5D5ME 2OL3L 1ZK9A 4OLZL 3FB8B 1TJHL 3TBTB 3O9WA 1JL8A 1IL1A 2BRQA 1OSZB 4N0UA 4JFDD 35C8H 4EUPH 1NBVL 1VKXB 1LILA 4LBEA 4GLRI 5J11B 4MXWH 4NUGL 3MFFA 1JF6A 5SWQA 1FV1B 1ND0A 3AY4C 3GZKA 4JAMB 4KRNA 3WNOA 3SDYL 1CK0H 2J5LB 5D2NB 3I6LE 1C5DB 5IMMA 4EUPA 4MX7A 4WHYH 1H15B 3CLEL 3FKUS 3E8UL 1OY3B 4HXAL 2J8UF 1L9NA 4JO1H 1D5BA 1S5IH 4UINH 2HN7A 4LKCA 2G60H 3SE8H 3RDTA 4FQHA 1ZEAL 3QXAB 4YDKH 2VSDA 3PL6D 3WFDL 2QHLA 1FVDA 1GGBH 4EIGB 1OAZH 4NHCL 4LRNH 1KCRH 4AM0A 3F58L 3I75B 2C1PB 5HYFA 1EFXA 1FC1A 4OLYH 4UT7L 3VXQB 1BJMA 3HAEG 4YWGH 3VXNB 3MLYL 4I18B 3PQYA 4PLKD 3O9WC 4WGVB 3IJHB 1MLCB 4O02L 1Z0NA 3HE7D 2O61B 5C92A 1HZHL 5JW3H 2NW2A 2GJJA 3DPBA 1UWXK 1NBQA 3BPOB 2IC2A 1CIUA 3QIUA 3G6JE 4PJAB 4KJYA 1FHGA 4L1DA 1A3LL 3W0WE 1MCRA 1RJYA 3RUGB 4Q2ZB 2VN7A 4OZHA 3E3QE 1NMCC 5C71A 4ESKA 3HFML 3TH3T 3VD9A 2WP3T 4CMMA 4U1MA 1AGEA 3RDTC 2D7OA 3BXNA 1AD0A 3LDBB 4H88L 1FYTB 2C4XA 3TYFA 5J6GA 1A6WL 1AD9B 2BSTA 3FT2A 1T0NA 1WIUA 3MGOA 3ZE0E 1HDMB 1AE6L 2EO9A 5GGSB 4Z7QE 1S7RA 4MD5B 4PB0H 4YR6A 3NA4A 2KH2B 2GSGA 4WFGE 1DBJL 1T4KB 1UM5L 1N6VA 3G5XB 3V8OA 4X9IA 4LLUA 3MJ7A 5C6PB 2BP3A 1MJJA 5CJQH 1DBBH 4O4YH 4IDLA 1YEIL 1KIPA 2X6MA 1A7PL 2CUIA 4JGJA 3RTQD 5JW5B 3NCCB 1C12A 4OFIA 1W72H 5I15L 4WRLA 3BZEB 2DKMA 1YEKL 2GT9A 3KLDA 5T3XD 1P53A 4ONGL 3I6GB 3GMRB 3SN6N 4PD4J 1I8IA 1QQDB 4FXKB 4ONHB 3QIUC 3UTQA 3PHQA 3TPKA 3OQ3B 4LLAA 3ZE2E 5GGRY 3MRHB 3NZ8B 3QEQA 4MXQD 3LY6A 1SJVA 4DN4L 5BRZE 2L7JA 4HHAA 4PJGE 5EU7E 4RGMB 3WKML 2HLAB 3L5XL 4XXDA 1W72A 3GSXB 4QTHB 1RUQH 4RMWA 1VACB 3M17A 1ORQA 3RIAF 2VLKA 3LH2L 4XZUB 3ZZ1A 1CF8L 4CN4A 5K9QI 4QXTA 2QSTA 1INEL 3BH9B 4LEXH 1CZ8L 3L3GA 4MJIA 3OJ2C 4FTVD 1QBLL 3B5GA 5CJ8A 5I8CA 3TZVB 5JO5B 1HILB 4NQDE 1TCRA 2BNRE 3R4DA 5F88B 5IGXL 2YRLA 5GGTH 2Y36L 3CCHB 2MPAH 1EUUA 3E1F1 4LHUG 5GS0H 3QUZA 1J05A 1F3RB 5E2WL 2YPLB 4JLRA 1BPVA 3B9DA 4LQ1A 1L0XA 1LP9A 3WO4C 4L9LA 4X7DC 4U1NA 2D3VA 3RWEB 4JG0H 3O45A 5E4IA 3KJ4B 5ETUA 1U8HB 4Y5VA 4HXBL 1OAKH 5GGTA 3E6HB 4XPHL 3ZE1E 1ZWIA 4HJGB 3TJHC 2MKWA 4WWKD 1Z2KA 2EYSB 3L7EB 4EDWH 1U8IB 1OT2A 5C0AD 4S1DD 5F6HI 3SDAD 2IANE 3MLVL 3U48A 1FL6B 3TO2B 1I1FA 4JQIL 4U0RC 1BM3H 2FZ3B 5HJ3B 2ZUXA 1UJ3A 5D7IF 5IJVA 4XCNB 2FIKA 5ADPL 2X44D 4PG9B 3VDAA 2XTJC 1J8KA 5CEZL 4R96B 5EN2A 2VWEC 1IEHA 1G7IB 1SY6H 3N9GH 2I25N 2YKLH 1BFOA 2ZJSL 4KK9D 4FHBD 1JZ5A 3PGFL 3CDGA 3JUYA 4YHZL 1N59B 2Z8SA 1VGEL 4Y2DB 2F58L 4ZS7L 4XXCA 4JO3H 4C55A 5LAXB 1IQDB 1CDCA 4UOW1 5IIEA 4J4PD 4U1GB 2DTML 4X6DB 4QHNA 3QIBA 2VC2L 1UC6A 3QUZC 5CSZA 4FQ2L 3D25B 1TQBB 2ITDB 3MV11 5CJBA 2A74B 3PWPB 3DOSA 2IPTH 4L9LC 3RWDA 3B2UD 4ODUA 4TSCH 3VWJD 1FGVL 2DAVA 2H8PA 3U0TB 4Y5VC 5BV7B 1Y0LA 3MRIB 3P0VL 5DD1H 5T1LB 1KEMH 1LEGB 2W65A 1B0GB 1UQSA 3DI2B 4GW4A 5IMOA 3CSBA 2R39A 2PR4H 4EOWH 7CGTA 1PD6A 1G7PA 1CFSB 3P9LB 2ESVD 1T0PB 2VMFA 5H37H 5EU4A 3LZFL 2Y1VA 1BBJA 1CDBA 1UJ3C 5HYJA 4UAOC 5TPWL 1P84K 5CD3A 5KVDL 3KPNB 2PW2A 3IAQA 4P5TD 3CX5J 4P2OA 5AAMA 1JZ7A 2C3VB 3G6JA 5DMKB 4HV8A 4FFWC 4Y19D 3DJ9A 5EBLA 3T3PF 2DBJA 1UB6A 3TH2T 3VH8G 4KJPD 2WBJD 4LLMB 1DE4A 2A2QT 4G7YL 2ATKB 2GKIA 2A1WL 4PJHF 3B8YA 4Q6YA 1CQYA 1G7LA 1BAFH 1N0XH 4XXCC 4M3KB 5F9AC 1IM3B 3MRFB 4EXPX 3NACL 1RUKL 1NAML 1OQXA 3Q48A 4S1RL 1QLEL 1C5CL 3QIBC 3ALXA 2EXYD 2Z8VC 5CSBA 1EXUB 4K9EC 4OGAC 4PGEA 4AIZA 3QQ9D 1J12A 1FLTX 3K80A 1VGKB 2CK0L 3QNZB 3R0NA 5GHWL 2IFGA 4HLZH 5E2JA 1NKOA 3L95B 4M6AA 4KV5F 2O5YH 2O5ZL 3BGMA 3BZ4A 3OAYK 2ZSWA 3L6FB 2GSIB 3MLWH 4KI5E 4LP5A 1CLCA 1JVKA 3U7YL 4D9LH 1R3HB 5I2IB 4MA7L 1KTLA 5E70A 2AXGB 4QWWD 4H8WH 2W60A 3B2VL 4NQCD 3EYOB 1JHKL 4RDQG 4P2OC 4JRWA 3EAKA 2VXQH 4UNUA 1S3KH 3OJMB 5K9JL 3QRGH 3O3AA 3JWOH 4JY4A 2A83A 2B2XL 3OKEA 1PJ9A 5D1ZB 3CK0H 3DVNB 3E3QC 1BZ9B 1YA5A 4R26H 3UTTD 5E94B 2GUOA 4F7EA 4RMUA 4BA8A 4NBZB 2EEAA 2XFXB 3BKJH 4LSQH 3WIFB 3K2UH 4JFOA 1UZ8A 2F19L 4QXUH 2FATL 4YHKH 5B8CB 5F1IA 4O9HH 5C0DB 7FABH 3H2WA 3IFLL 3SDXF 3VXRB 3V4VL 2XTLA 2DQIH 3HCVA 3UZEA 3L3KA 5EU3A 4NQDA 3WUWG 3GBNL 2BNRA 5JR1H 3Q6FB 4XMPL 1HQ4A 1WWAX 1FG9C 2D9QB 4HG4K 3BRGC 1Q0XH 3DBXB 1LNUB 5EIVA 4NQEB 1P84J 6CGTA 4ZAKA 1YDPA 1BWWA 4KTEH 3UTSB 2R0KL 5CIPB 2Q8AH 4QHUB 1IFHH 2HVKA 5DYOB 1GGUA 3UBXA 4JFQB 4MCYA 1RU9L 3PWLB 3V5HB 5I1DB 1U8MB 3HB3D 3BD5A 4WFFE 5D1XB 3LD8B 3MGTA 3L5WB 4OF8A 4NT6A 4J1UA 1HWHB 25C8H 5HVHC 4JHBA 3ZDYF 5C0ND 3ULSB 4MQTB 3VW3L 4WU7A 4S0SD 5C8JB 4R90L 4KTYA 1A9EA 4LSPL 4N1CA 4YHNB 1JWUA 2BSSB 2LAGB 2QEJA 1AHWB 3FFCD 2I9TA 5JLZB 4H8WC 2CGRH 4GW1A 4ZOEA 3TBYA 4JFZL 3WS3B 3ES6A 3F7RA 5AYUL 4OFYD 3JV4B 5MEOB 3EJJX 3ZKXC 1QO3A 3DVGA 5DJYB 4PJBE 3JWOC 3WNMA 1MH5A 2ZCHL 5C0JB 3SCMD 3MV7D 3FZUD 4PJFF 5E4EB 1XF4A 2PCPB 3IVKA 3PJSA 2Q1EA 3OGCB 5T5NF 2I60H 1AIFB 4LDLB 3WCYA 3GO1L 1K8IA 3O8XD 3LKNB 1ZT7B 4KZDH 3CU1A 3WFHB 4ZAKC 1SYSB 1S7TA 4HUUB 4IJ3B 3CLFH 1QFPA 1Q9LB 4QOKD 3PWJB 2FD6H 5DEFA 1PEZA 3BX7C 1ZHKB 3DX8B 2AK4B 1CG9A 5J12C 4DVBB 4PJ5D 4YQXL 1RIHH 2GK2A 4YEFA 3C5JB 4TTDC 5GSVB 1A9BA 2DBLL 1CGYA 1DQTA 1ACYH 5D4QA 4ZFOB 2OJEA 4LNRB 3UC0L 5HGBA 5FV2A 4H26B 4OZGF 1DANT 4ONFH 2Q86A 1EO8H 1F11B 4QF1B 1QBMH 2YD6A 1ZHLA 3TVMB 3LVEA 3O6FA 1CXHA 4M1GL 4KKCC 3NGBC 1YEJH 3FRPG 1EHXA 1QRNB 1MRFL 1ED3B 4PJ7E 1KOAA 1EV2E 1AC0A 1XGPA 5E5UB 1U58A 2ICWI 2EDXA 3AS1A 3QDJA 5MI0B 2OR9H 2KQMA 3BEWA 2DB8A 5EWIH 4MA8L 4XP9H 2AJVH 4TPRH 2AEQL 1MIMH 1VPOH 5JNYA 2QSCH 3QIWB 1EIBA 3TFKC 4Y16A 4EI5B 2X4TB 5DJ6B 5M7QA 3HZMA 3P2TA 3NOIA 1GPOL 1JGVL 1JMXA 3MOAL 5IHUL 4X7FC 5T1KA 5JPNB 5E08H 3O6ML 3UJJH 2VH5H 2W59A 3BWAA 3HMXL 3JZ7A 1K2DB 4MB3A 4P3CH 4RSVA 5HI4C 2RAMA 1N5AA 5E24E 1OAYH 5DD0H 2A9NH 4JZJB 4NC2B 2FX7L 5MEQA 3I3EA 2VERN 3BP4B 4PJCE 1G7QB 4KY1L 4NP4L 3W11C 1W0VA 3O6KL 4XTRD 2FWOA 4B41A 2VAAA 2V7HA 2VDRL 4JANB 5J0BA 4X4YB 3LKQA 4O2EB 3V2AR 2QSVA 1BBDL 1P7QB 2IG2L 1YEFL 2HG5B 4GG6B 3JVGA 4K23H 4MB4A 2K3TA 3U4BH 4CRPA 5C2BL 4CJ0A 1NC4A 1LDPH 2Q76A 4XGZA 5FYLH 3LKRA 2PTTA 3VGAC 2EYRB 1SM3H 3ZTNL 4WDIB 2BOBA 2IFFH 1ULVA 2ICES 3D39B 4J6RL 2HT2C 5D7LD 2NY7H 1CFVH 1E4XI 3LAFA 5INDA 4YXLL 1QLRA 2LVCA 2VDOL 4Y16C 3J8F7 4I48B 3H6JA 5FECA 4JFHE 4HH9A 4NFBA 4WV1B 5L2JA 1VFAB 2A77H 3OKLA 2BDNL 5I1GL 1C1EH 1JN6A 2F74A 2NYYD 3VWKB 4DGIH 1ZA6B 4XBPA 1LEIB 5DC9B 3LKOB 4YXHH 1RZ7H 1N5YH 4JPKL 2IH3B 4XC1H 5HVFB 2ADGB 5EZOL 3AREA 3MOBH 3MNVB 2UZIL 4M61A 1FLRL 4A2MA 4D0BB 2OL3A 3JVGC 3I9GH 2H2SC 3VGGA 4BH7B 2IQAA 2AV7A 1CL7L 3T3MF 4ERSL 2H9GA 2CRIA 1OPGH 4FXGA 4CGTA 5E7FA 1HKLL 5GISL 4RWHA 2JJSC 3C08H 3DV4B 1UVQA 5HHOD 5CD5C 4RA0C 1ZSDB 4X0KB 5CEZE 3U4EA 4QTIL 3HPLA 2R9HC 2VAJA 4Y1AA 5EBWA 5B38G 1CYGA 1UZ6F 4QRSA 1BZQK 1I7RB 4KK8D 1QFHA 4HC1H 1H0DA 3OB8A 1NUDA 2VLRA 4G8FB 4JVPA 4ZXBD 3DRTB 3D87B 1JF1B 1TZGL 2CDFA 2YEZA 4G9FE 2EZ0C 3QJFA 1I9JL 4E9LA 4UT7H 4BZ2H 1NSNH 1T2JA 2IJ0C 5E2TL 5GQBA 4PLNC 3QEHA 5ID1B 2CJUH 5EOQL 1RUAL 1KCKA 2NY3C 1B0RB 4Z6AT 1CDJA 4HC1A 3HR6A 3MOQA 1LO5A 4TVPH 5J6HA 2F53B 4Z18A 4K7PY 4G43A 3GGWA 5DMKA 3AREC 3RAJH 2YD1A 4U1KB 3EFFB 4ENED 3BT2L 1KN4H 5IR1A 4GG8B 4KRPD 1AI1L 2FGWL 2VQTA 5FYJH 3E6FB 2APBA 3I6KB 4FFZL 4JFXA 4X5XA 1YNTB 1NCCH 3T0XA 4Z7NF 4FQLL 4YK4B 4D0CA 5CCKH 1BLNB 4U1HA 4PY7A 2VKWA 3D0VB 2JIXA 3O2DH 4LSUL 4OAWB 2Z31B 1H3UA 1AQDA 3HNVL 1AP2B 5EO0B 3IKKA 4OZ4A 3ULUL 4XHJD 3D69A 2X1XR 3REVB 4PJ7A 4RQQB 3WE6B 5IEKA 2GJ6B 5DRWB 1G9NH 1UWXH 1XCQB 5GSRB 4ZO6A 3VGDA 3WIIL 5EIIB 4B7IA 5E8PB 2XN9E 3HI6L 3O2DA 4PV8A 2JB5L 5IV2A 1DBJH 3GNMH 5K59E 1GOGA 5E99H 4CADA 3EJYC 5FDWA 2N56A 4GKZA 2H2PD 3B5HA 1MI5B 3F7YA 5KVGL 3WLWC 4Q0XH 4N0RA 1UEYA 2NNAB 4PJ8B 4DKDC 1J18A 3MLZL 4DN3L 2BHZA 3RGVD 3QZWG 1F2QA 2F9BT 3ZT6A 3BMWA 1S7UB 3RWJA 3MRGA 4TTGA 1S7VB 3FN9A 2GY5A 4RGOL 4NN5B 5C6TL 1GIGH 1I8MB 4GBXB 4P23D 4YO0B 5JHDE 2HTKC 4HPYL 4X7EC 5I71C 1T04B 3FB8A 5EUOF 3TBTA 2ZUUA 5IESL 2VZ1A 3BPCA 2X4OB 3RIFK 1TCMA 3D2UB 2FR4A 3DNKA 1OSZA 1WBZB 4HFUH 1P7HL 1RK0B 4JRXB 5AZ2H 3S9DB 3MNWA 4OJFH 4RGNB 1VKXA 1EEZB 5I18L 1MREL 4MS8D 4YC2C 1RJZA 4TNVK 4QHKI 2OQJB 1XR8B 3HC4L 1FV1A 2ZOKB 1VERA 2RCSH 1DBKL 4FOMA 5D2NA 1C5DA 4XVJH 4HF5L 1JRHH 1H15A 2Y06H 1MRDH 2QQKH 4BFEA 4I8DA 5J13C 2AJYH 4D9RE 2FGZA 1G9NC 4X6DE 3ILQC 3QXAA 2LTQB 5DDHB 3WFZA 5HHME 4Z7UB 3B9KB 4DOHE 5JMRA 2QQLL 1EFQA 3QQ3B 4HQQH 3I75A 4NCDA 5MP6L 2A38A 5L7XL 2EDYA 3VXQA 1TVHB 3MLVH 4N68A 4O5LH 3VXNA 5JTWA 2JJTA 4I18A 4YHYB 2C4FT 3O2WH 5F9WB 2EDWA 4ONOA 3IJHA 2D2OA 1MLCA 5ADPH 1YYMH 2EDLA 2ADIB 2O61A 4DK6A 4HUNB 4NNPH 4N0CD 3KHOA 5FO9B 2PXYB 3FQWB 4OBSA 5J1SC 2MJWA 3HC3L 3UJTH 1SYVB 5J11C 5CILH 4JFDB 1PKOA 5KJRL 1FPTL 3HS0B 3VFPB 4PJAA 1NCNA 1WBXB 1LO2H 2J5LC 1D5ZB 4HT1L 4Q2ZA 5D2NC 3RUGA 4XNUL 1FO0L 5DHYB 4KAQH 2DTMH 2X4QB 4BYHA 5KS9B 3CFJB 3TLRA 2AJZB 4XWGL 3MJ9H 2FCBA 1EZVX 3KPRD 5IT2L 4JG1H 2YRZA 2HKHL 4P2YA 4TOYL 1II4E 1AD9A 5IMLA 2P24B 1FGVH 3MCG1 2AQ3A 1HDMA 5GGSA 5TQ0L 3ZL4L 1ETZB 3OX8B 1YECH 4Q9BA 2JKXA 2NZIA 3PL6B 2J88H 1T4KA 5BXFB 1EK3A 3MJ9A 4P9MH 3G5XA 1H8NA 1EUTA 3BMVA 1ITCA 1A7OL 1BP3B 2JJTC 4ELMF 4I18C 2ATPA 5D2LB 3T3PE 3NN8B 4X83A 1ITBB 4MNGB 3DHMA 5JW5A 4EBQH 3OKDB 3BZEA 1ZHNB 1G0YR 3BPOC 3GMPB 3K81A 2KL6A 3I6GA 3GMRA 1QQDA 3PHSA 4FXKA 4ONHA 1P9MA 2DQCH 3HE7B 3L9RB 3GI8H 2AABL 3U9PL 3NA9L 3MRHA 3NZ8A 3OG4B 3KYKL 4PBXA 2AJSL 2HLAA 1CD0A 3H0TB 3NTCL 5EORL 3GSXA 2RB8A 3FOMA 4QTHA 4E41B 4ZOCA 5DWUL 1CR9H 1VACA 3SE9H 3LPGA 1ZMYA 1I3UA 4XZUA 1MCKA 4Y2OA 2C1OB 3LDBC 3HHRB 3P0YL 1BWMA 1KELH 3BH9A 4KWUA 1JGDB 3TA3B 3TEUA 4MCZB 4JRYE 1C7SA 1A5FL 1NLBL 1U36A 3TZVA 1YQVH 3O9WD 1HILA 5JO5A 1SEQL 4LMQI 5F88A 4XVTH 4KTDL 3LQAH 3CCHA 4E0RB 1IT9L 2MNUA 3RWGB 1NUGA 1T6WA 2FECI 2YPLA 5BZWB 3UTSE 3B2VH 2BVQB 4NNYB 2DL9A 3UXFA 4S2SB 4HKXB 3RWEA 4MLIA 3VXUB 5IHZA 4NBXB 5DUML 1U8HA 4MZ2A 4NPYB 3E6HA 4MA3B 4HJGA 2ADFL 4U1JA 3D85D 3WKNA 3O6LH 1P9MC 3L7EA 5ACZB 3TJEL 1U8IA 4W6XB 1UXWB 1P4LB 1MRCL 2XA3A 4BSWB 5TE6L 4HLJA 1IGML 4BSJA 4RGMC 1FL6A 3TO2A 2VZTA 4P4RB 1XGUB 1U92B 2FZ3A 5HJ3A 4AQOA 1MF2H 4XCNA 4W4NA 4Q9RH 2E8ZA 3KXFE 4MAYD 5DQJB 4PG9A 1U8JB 1MY7A 4U3HA 4R96A 4O51B 1DQQB 1G7IA 3CVHL 3P9MB 2OJZL 4M7ZB 1EFXD 4L3EE 1CD9B 1NFIB 4G6JL 1KXQE 1UM6L 1N59A 3L3HB 4QCIB 4Y2DA 4C54A 4XAKD 3EDJA 3GB7B 3PQYD 1MUJB 2IEPA 4JY5L 4X8XA 3ET9F 5LAXA 3TZVC 1RIUH 1IQDA 5CEYB 4U1LB 5BV7H 2OTWB 3IDJB 3Q2CA 2FX9H 5F96L 3BHBB 1RURL 3OXRB 3SDDB 2IBZX 4X6DA 4ZDHB 2CSPA 1ZA3B 4DJMA 2DJUA 3D25A 2ITDA 3R06B 2A74A 3PWPA 3NZHH 3RWCB 3QIUD 4R8WL 1ZTXL 2IPUK 3RU8H 1WEJH 3KJ4C 3U0TA 1YN6B 4GRWE 3MRIA 4R7DB 5T1LA 2BMKB 5DMGC 1BIIB 3VW3H 1LEGA 4LSPH 5C9JB 4I3SL 1MLBB 1B0GA 1BVKB 1P4IH 5KW9H 1MFBH 2X10A 4GXUN 5C3TA 1JCKA 4GJTB 3Q6GL 4NGHL 3GEWB 3P9LA 1CFSA 1BQLL 2W1NA 4JFZH 1TETL 2X1OA 3MTRA 4WWKB 1WSST 4MXVE 1HIML 5TF1H 4OI7A 1KT2B 5C0AB 4UT9H 3KPNA 1MAKA 2DTSA 1H3VA 1OGAE 2C3VA 5E6YA 1F42A 1D6VL 1QA9B 4IOFC 1HHHB 3LPFA 4KXZH 4YHIB 3RA7L 3U0WL 1NKRA 4LCYB 4LLMA 4XPAL 1CBVH 3V0AC 2ATKA 4EIZC 3OHXB 3UYRH 2R15A 2ZNXA 4Y2DC 3GO1H 1A64A 2E7CA 5GJSL 1IM3A 3MRFA 5KOVC 1RQ5A 4LASH 4WTXA 3NAAH 3MJ6A 3VFNB 2J8UB 4KMTH 3TCLB 2FJGB 3IGAB 3RWIA 4NRYB 1I9EA 3IU4L 1EXUA 3TJHD 1TQBC 1IKFL 4L5FH 1IGIL 4RFOL 1VGKA 4XPFL 1QSEB 3N85L 3QNZA 3C8DA 4DKFL 3QEQD 1YJDH 4OB5H 3MXWH 3L95A 3OR6B 3VWJB 3L6FA 2GSIA 4M1GH 4L4TE 4YXKL 3LMJL 4G8GB 5JHLL 3DGGB 3MX0A 2OMNA 3N1GC 5BS0D 1R3HA 2XYCA 5I2IA 3FOLB 2AXGA 5EZLB 2LAAA 5TQ2L 4LQFH 1N7ML 2VXTH 4OI9A 5T3XL 4YHPB 5I1CH 1U91B 5FM8A 2P45B 2XKUA 4JB9H 5E8DL 3UBXG 1P6AB 1HYRC 1OB1B 2DQDH 5LXGH 5J3HD 1I3GH 1U3ZA 3ULUE 2IADB 1FQ9C 2DQTL 4HZLB 1PQZB 1UG9A 1GGIH 2UUDH 3O11B 3D39E 1WWBX 3QUZD 3U0PB 4Y19B 2YC1B 1CWVA 4WY7H 5D1ZA 3DVNA 2JELL 1BZ9A 3LEVH 4KVCL 1GHFL 2WBJB 5E94A 4QNPE 1OARH 1U95B 1IQWH 4WVRA 4PBWD 3X11B 4C4KO 2XFXA 1N26A 4FFYL 3WIFA 3SE4A 4DVRL 1DQLL 5B8CA 4P57B 1RK1B 2HT4D 2D4DA 5CIPH 3KLAB 5GS0D 2FYYB 4J2XA 3MRBA 2BNQD 3F7PC 4X99B 4DGYH 3Q6FA 3GIZL 4WEUD 2ZKHH 4F80A 3DBXA 4ZFGL 3H3PL 1G9EA 5DVOA 4NQEA 1L4IA 2OI9B 3LRHA 3IDXH 3KPQB 5I74B 3UTSA 1RZFH 5CIPA 4QHUA 3V52L 3BN9D 5DYOA 3TN0B 3SJVD 4FFWD 4XPGL 1KB5L 1IGCH 4JFQA 3PWLA 5HHXL 3T2NL 5I1DA 4HIIB 1U8MA 1YJDC 1RV6X 4UZGA 1NFKA 4J3TA 4K3EL 4GS7B 5D1XA 4LEOB 5JOFB 5D71H 1DBAH 3L5WA 3MXVH 3CAFA 3ME0A 4OFDA 3F6IA 2YXFA 4H25B 3ULSA 4J6RH 4UDTB 1MY5A 5FGCB 5C8JA 2VDPH 4YHNA 2DWEB 1HQRB 2AEWA 1AHWA 4RMQA 5JLZA 5DFTA 4JHZA 2VDOH 4J8RB 5D1ZC 3WS3A 4QHMB 3JV4A 5DGQA 3GHBH 1ZKAA 5MEOA 4XCCH 1GYAA 2KZWA 5ICXB 1J5OL 1OAXL 3OZ9L 3SE4C 3QDMD 5B8CC 5FM5O 3ELAT 5DJYA 3UTTB 5I1GH 1A0QL 4KDWA 5C0JA 4XMKL 2NY2D 3AC0A 1K4DB 2PCPA 4OLEA 3H8NA 2EDRA 5MERB 1UH3A 4HAFA 1NL0H 4JPKH 5E1AB 1XCTB 3LKNA 1ZT7A 3T77B 4HULB 1GZQB 2AJXH 3OF6A 4NQVB 3WFHA 3T3ME 4C56E 4HUUA 1Q9LA 1VFUA 3PWJA 3AVEA 4P46D 1X3DA 2AK4A 4DVBA 3LN4B 2DWDB 2F5AL 2EDKA 1F90L 4OF3A 2C4FU 3LD8C 5D1XC 5GSVA 2HKFH 4QRPD 4ZFOA 4LNRA 1WWCA 1KTDB 4H26A 5HHVH 1FORH 3NABH 1F11A 4QF1A 1L6ZA 2YBRB 5GRWA 1ZGLB 1YMMB 3TVMA 2W0FB 2X05A 1AHWC 3QXVA 2F8XC 3G9VA 4K71B 3EYFB 4W81A 4XCYB 5D96B 1QBBA 1QRNA 2X4NB 1OGAA 1ED3A 3SKJH 3JSSA 5D7IB 2GJ6E 3RHWF 3FFCB 4EQ2A 1OTTD 5FUOL 1ZLSL 2NY5H 1MVUB 3O4LD 3AGVA 4X6CB 3MACH 4PG2A 2XV6B 5E4EC 4DKEH 1WAAE 4JFFD 1MI5E 3V4UL 3QIWA 1GAFL 1V7ML 1CDGA 4R9HA 3SCMB 4EI5A 2X4TA 3L3IB 4W4OA 2DLFL 2VXVH 2XXMB 1GL4B 5JPNA 4Z7NE 5IJKA 4IJ3C 3BOVA 1AI1H 4FMFA 1K2DA 1B4JH 2XQBL 4FFZH 4IRZL 5DJ2B 1RMFH 1N8ZB 1KJ2B 3NFSL 4M93B 4JZJA 3BP4A 3T0VA 1G7QA 4QOKB 3ZKND 4RBPH 2J3SA 4Q58C 5HSFA 1G0DA 3SGEI 3NCJL 1SJHB 1E6JH 4PJ5B 4JANA 5KSAD 2JF1A 4X4YA 4O2EA 3KPSD 2YZ1A 1T7ZA 2VXSH 4LCWD 5JORB 3TVMC 1IGFL 5EG6C 1JZ4A 1P7QA 3WXVH 1NQBA 4GG6A 5AD0B 2CLVB 4P2QE 4JRXE 1D5XB 2Q7NA 4OCWL 2C26A 3WIIH 1VDGA 5DUPL 3HI6H 1JPFB 1QTYT 2H32B 4FQIH 1F4YL 2EYRA 2WINB 1A1MA 2KPNA 3V5DB 4WDIA 5C6WH 4YNYB 5MI0C 5IG7B 1AGDB 3D39A 5B39B 4NNXB 4PG2C 5DK2B 4XMLH 3BPLB 5KANG 3DLQR 4KK5C 4XPBL 1IC7L 5HVWA 2XG4A 4I77H 5HHPA 3BDXA 1KG0B 2XZAH 3QIWC 2CXKA 4EI5C 4W4OC 1UADC 4I48A 4JKLA 1A6ZB 3VG0L 4Z7UE 5FHAH 5IJKC 3WHXB 4FZ8L 2CO7B 3C87A 2VIRB 3QH3B 3ZSSA 2AJUH 5C6TH 3GI9L 3DO7B 5IFAL 4WV1A 1VFAA 3UROR 5IQ7H 4I9WD 4M1DL 5DK3A 4JZJC 3QQ4B 4ODVH 4BUHA 3VWKA 3F12B 3ULVH 4P49A 4PJEF 4R4NC 1LEIA 2QJDA 3PP3H 1OP3K 2P1YA 4DQOH 3LKOA 5I8KH 2IH3A 4KPHL 1HOCB 2P8PB 1G9MH 3MNVA 4JPIA 4RDQF 3RFZC 4NKIL 2L7UA 3MJ8B 3FQRB 4D0BA 4CN1A 1F58L 5F8QC 3DROB 4TULL 4BH7A 1LO4L 3ESVF 4Q9CA 3QPQC 4R97B 1I7ZB 3KHQA 4OD2A 4X7TB 4PGJA 3MUY1 4JFDE 2IPUG 1NLDH 5D8JH 2E7MA 3GRWH 5F7WC 4N8VG 4Z7WB 5DK0B 3ULUC 4J3XA 3DUUB 4KUCD 3STLB 3ARYA 3DV4A 4BKLB 4X0KA 1ZSDA 3U6RB 4OGZA 5LQBL 1BD2D 1JGLL 1SMOA 3TBVB 1BFSA 2DYPD 1ZAGA 3SY0B 4QT5B 5DI8A 5KS9E 5GPRA 1MFCL 4GAJL 1IAIL 4GMSL 5CP7B 4JZOB 5KAQF 1UCBL 4PRPD 3GRWA 1F8TH 1U3YA 3IDIA 5D7LB 1UA6L 5F71A 4G8FA 5JW4R 4Y0GA 3DRTA 3SGDH 1JF1A 5I66A 3QFJD 4S1QL 3W11D 5M94B 4LCIH 1PZUB 5L7XH 4NWTL 4WV1C 1M7DB 4CVXB 2APTA 5ID1A 1QSVA 1D7FA 3VWKC 1B0RA 3MLUH 3O6FD 5EULV 5BVPH 5AAWA 5C2UB 4C56A 1CE6A 1MCQA 2F53A 4NIKB 4FZEL 4GOSA 4K94H 4M62L 1NCBH 1RZ8B 4AK1A 5E8NB 4U1KA 3EFFA 5DMJB 4ZTPL 3UBXI 6FABH 3AM8A 4GG8A 2DQHH 2V2TB 1KCVL 4YBQD 3ULVC 5I1EL 3I6KA 5AWNL 3WEXB 2LU7A 3SBWA 5MENB 3FL7A 1UJTA 3EO0B 3BIBX 4F3FB 3QCTL 1UH2A 1YNTA 4PGBB 4N90D 1N6QL 1JHLL 1G9MC 5DD3H 1BLNA 4GH7B 1YYLL 2R2HB 3D0VA 3CC5B 4JGMA 4OAWA 5IB5B 2Z31A 3VFGH 2P5EB 5IT2H 1AP2A 5EO0A 3EYQD 3DURB 4S1SL 4HK0B 1EHLL 4TOYH 3REVA 4RQQA 3WE6A 4U1IA 1BHGA 5HHOB 2GJ6A 2BVYA 5DRWA 1D9KC 5FUZL 1CQKA 1ZVHA 1XCQA 5GSRA 5EIIA 5E7BA 5E8PA 3BZDA 4ELME 4YFLI 1CE1L 2W38A 4RISL 3ARDD 1JMZA 4OIIL 4X4MA 1LD9B 1WAAA 3T0EE 1MI5A 1XAUA 3QEGL 3U7AA 3DXAD 3CMOH 4HWBL 2JJUA 4PJ8A 1JNNL 2H2SD 1JPTL 2LVEA 5I17B 5HI3D 1VEMA 2GEEA 1OAUL 5HPMB 2IWGA 4L4VB 1S7UA 2BVEA 2H41A 3CDCA 3HZVB 1JTTA 3HKFA 3AM8C 3BUTA 1N64H 1S7VA 5J89A 2V5RA 3IS0X 1I8MA 4YO0A 5CD5D 3BAEL 1IAMA 5I1HL 2DQGH 3SBWC 3PV7A 2W0KA 1HI6B 2AJSH 5DLML 1T04A 2YUVA 3DI3B 2CRMA 4YK4C 4KRPB 2V5SA 2X4OA 3D2UA 4K94C 4G7VH 5T3XE 1WBZA 3VXPB 5FYLD 4N9OB 2Z31C 4OZGB 1RK0A 4JRXA 5HYSG 1Q1JH 1EEZA 4K7FB 1MQKL 4Y4FD 2EZ0D 12E8L 1ZT4A 2OQJA 1XR8A 3C60D 2ZOKA 3CD4A 4KUZH 1GSMA 5EZJB 1DQML 5D6DA 3JV6B 5F7HA 4PR5B 1FZMB 4KJWC 1TTGA 3LQZB 2FX8H 2HLFC 2NPLX 5J4MA 4OM1H 2CDEB 1JF5A 1R3KB 2DLHA 1A2YB 5IBUB 4KKBD 4I2XE 3BESR 5F7EH 4PJ8C 5DDHA 1JUFB 4FTVE 1MAJA 4Z7UA 3B9KA 3O81A 2B1HL 5EA0L 1YEGL 4G6AD 3OXSB 1ZANH 1QFWH 4PRAB 3QQ3A 4JO2H 3VFTB 1NAKL 5A2FA 4WCYL 4DFIA 2J6EL 3M8OH 5I8OH 5MEPB 5LVEA 3CXHJ 2IF7A 4NN5C 1TVHA 2OR7A 3JWDH 1E4KA 1VENA 1DBMH 4Y1AD 4PY8I 4P23B 4PJ9D 3IB4A 1AKJD 1J10A 2ADIA 5DMIL 5E9DD 5FO9A 4RGNC 2PXYA 3KR3L 3STZB 3A6CL 5C0AE 1NGXB 3SKNB 1T5XA 5DQDL 1SYVA 4JFDA 4G6JH 5I1JL 3HS0A 3VFPA 3QULB 1S8DB 3U7WL 4P2RB 1WBXA 1NEZA 5D6DC 1PG7L 1D5ZA 5DHYA 4WW2F 4LLQB 4YHML 1K8DB 2X4QA 5KS9A 3CFJA 4PP1C 2AJZA 4WJ5B 1TTUA 2LTQC 1GRWA 2Y07L 3B9KC 2P24A 1AGFB 2B1AL 1ETZA 2FJHB 2Y6SC 3OX8A 4TVPD 5LWYH 3PL6A 1QFWM 5BXFA 3CDFA 2NTFB 1XF3B 3GHEH 4L8CB 4HUXB 4NGHH 4YDIH 2VABB 5TDPB 1AR1C 5KTEL 1AC6A 5FYJD 4KKLC 4POZD 3BYYA 1E4KC 3DIFB 5D2LA 1HH9B 3HI5H 5F9WC 3NN8A 1RUPH 1B3JA 3OAZH 2EEDA 4MNGA 4Z7VF 1WZ1H 3D9AL 3OKDA 4UILL 4HAGA 3S37L 3K4DA 3MRPB 1ZHNA 1LO3H 2BXZA 2PXYC 5DRZB 1RJCA 2W9DL 5E00B 3WFBH 3GMPA 3RA7H 3SEPA 2ESVE 2Z91B 3OAUL 1TTFA 3D6GA 4NM8H 3JWDC 3HE7A 3L9RA 4APQD 3TIEB 1LK3H 3H42L 1M7IB 4Y5XB 2F5BH 5DJAB 3S34L 3H0TA 3BJLA 3VRLF 5GXBB 1DP0A 2WM0A 4E41A 3MLXH 2NTSP 1PDKA 1IBGL 1PVHA 2OM5A 3IU4H 4AEIL 3RVVC 3UJIL 4C4KT 5DD6B 3PXHA 2C1OA 2GTWB 4Z95H 1BQHB 4RFOH 1V05A 1IM9D 1BGXH 1YPZF 4FXLA 4LPVA 4S0TD 4DUWA 3IJSB 3RPIB 3O3DA 1JGDA 3LV3B 3TA3A 4MCZA 4QRQB 2EE6A 4POUB 3HE6D 3KJ6H 1U42A 1L7TH 3KPRB 4PLJD 5FOBB 3PL6C 1IC4H 4J3VA 4E0RA 5GRVL 4I0PD 3BKCH 4XT1C 3PGDB 1XF5B 5BZWA 5DD5L 1MHPH 1ZVYA 1CT8B 2BVQA 4NNYA 4S2SA 4HKXA 4UQ3B 3ZDXE 5AYQA 3O2VL 4KU1A 1KFAH 2ID5A 4NPYA 1IAKB 2OSLB 4MA3A 3TT1L 1FNSH 1J1XL 1F4XL 1UWEH 4CVUA 5ACZA 3HE7C 2QQNH 3OB0K 1Y6NR 1UXWA 2VB5A 4NQCE 1P4LA 5FGCE 2ZOLB 4BSWA 4N8CL 1PG7X 2EC9T 3BGAA 1K3ZA 4P59H 2DIJA 4P4RA 5KVMC 1XGUA 1U92A 4DGVL 3DYOA 5DQJA 4AL8L 4TUKH 1U8JA 3I02A 4DZBB 4KDTA 3MROB 4O51A 1DQQA 3P9MA 1XF1A 1FAIL 3HI1B 4LPWA 5GS3A 1NFIA 2B4CL 1GGCH 3L3HA 4QCIA 3TA3C 1CFBA 3HG1B 4ZFGH 4QXGL 3GB7A 3G6DL 1MUJA 5CEYA 1CI5A 4U1LA 2IGFH 5FAAA 2OTWA 3IDJA 4LSTL 5IB4B 3BHBA 3OXRA 3SDDA 5F6IB 4ZDHA 1B90A 1ZA3A 1Z9SA 5EO1B 3S98A 3T2NH 3O3BB 3RWCA 2Z93B 4OQTL 2OS7A 4JQVA 5C09D 1YN6A 3QT2A 4TUOA 2CKBB 3W9DB 2BMKA 1BIIA 3CZFB 4HBCH 5C9JA 2IALB 1MLBA 5HDBE 3QWRA 2YD2A 2VDML 2BVPA 3W2DL 2QR0B 2IMNA 4JO4H 4WWKA 1SMAA 3D85B 4P4KB 2MCPL 1FYTD 2DN7A 5DUBB 4HWZB 5DT1H 2EDEA 2WQRA 1KT2A 5C0AA 1OAXH 1T03L 3X3GH 5CP3H 1EJOL 1KENL 4MXQC 1BREA 4HIXL 3P3YA 4KDTC 1GC1L 1QLFB 3FFCE 3UEZA 1HHHA 4YHIA 4M7ZC 4MAYB 5KVEL 2IAMB 5CZVL 3OHXA 4XVSH 4O2FB 2FECL 1RIVH 4WIQA 1F6LL 4OZHF 5CP3A 3GJFK 1MPAL 4O58L 3LSOB 5LCVL 1XZ0B 3UX9B 3RX5A 2J8UA 3SDDC 3TCLA 2FJGA 3IGAA 3MV7E 4K3JH 4HWUA 3Q1SH 5F1KC 3VI4F 1F90H 5EBMB 1JRHI 4MWFB 4JQVC 1QSEA 4K3DL 1K4CB 4PJXB 1XGQB 5D72L 2CXGA 4QOKE 1DEEB 1AY1L 3VWJA 4FQQB 2BFVH 4JN1H 4PJ5E 4H20L 2EKJA 4JQXA 4PV9B 4A6YL 3NCYS 4G3YL 1OLLA 4WWKC 3FOLA 5EZLA 3DHJA 1XMWA 2MTPA 3KAAA 4YHPA 1U91A 2ESVA 2DQEH 5C0CE 5IVXB 4M43L 1RZIB 1OB1A 1T83A 4GKSA 4M9PA 3EW3B 3EFDH 4GO6B 2AGJL 5E2VH 2IADA 3S8WA 4H1LA 4HZLA 1PQZA 3P11H 4MMXC 3WFEL 3O11A 3ALWA 3U0PA 4Y19A 2YC1A 2YPLD 3BD3A 3DSFH 3JTSB 4NN7B 2DLFH 2GQHA 3IDMB 4KK9C 3UDWA 2IMMA 2WBJA 5C07D 2NY0D 1U95A 5IWLA 1MIEL 3X11A 3L5JA 3A6BH 5I1IH 5JXAH 4RCAA 4P57A 1RK1A 1F97A 3B43A 3NFSH 3KLAA 2FYYA 4HMDA 1NCTA 3GK8L 2CK2A 3K0WA 4X99A 3DWTA 4NZTH 2A9ML 4L3AA 1T22B 5E2UL 2EDTA 4XP5L 3CVIL 2HFEB 3D48R 4U31A 3GKWH 3KPQA 2VTFA 3VWJC 4M7JL 2CKBL 3K2MC 4OD1H 5J1AB 1LP9F 3DMMD 4O2CB 4J3WA 3TN0A 5GZOD 4JQXC 5TE7H 3LPWA 4NJ9H 3JTTB 3NCFB 5DUPH 4HIIA 3FO2B 2XPGB 4U49A 1YMHB 1F4YH 4BZYA 4LEOA 4OF0A 5JOFA 2WV3A 5D5MF 3ZKSD 1W0WB 4NDMA 5BS0B 4H25A 2DLGA 1T83C 1C16B 1UYWH 4UDTA 5EOCJ 4MXWL 5SWZB 3EYSH 5IB2B 5KBNC 1MCCA 4Z7WE 2DWEA 1HQRA 1LHZA 4M6OH 2WMPA 1CK0L 2OTUB 4J8RA 4I4WB 4EXKA 2PNDA 4QHMA 4KJPC 3UDWC 3PWPD 1NGQH 2A6JB 1AO7D 2WBJC 5TDNA 5IWLC 1I1RA 5GGQL 5IB3B 4JO1L 5ICXA 2X2YA 2Q8BH 1S5IL 5D7LE 4UINL 5T1LD 3PUCA 4LGPB 2G60L 3SE8L 4OFPA 3UTTA 4M1DH 4X6FB 4ZTOH 3LIZL 4YDKL 4LKXB 4QGYA 1T80A 4RMRA 1RFDL 3DECA 3IAPA 3WUZA 1GGBL 3S88H 2EXYC 1OAZL 5MERA 4LRNL 2ZP0T 3QQ9C 5E1AA 1XCTA 3PABB 4UT6H 3T77A 1FG2B 2N1KA 4JVUA 3OJVC 1GZQA 2OI9C 4JM2F 4NQVA 5TE4H 5B3JE 2BNQB 5I74C 5BO1H 4OLYL 1NBZB 3P4MB 5CGTA 4YWGL 1TJIH 1F4WH 3KPLB 3TN0C 3PDOB 3NH7H 5A2JH 1RUMH 1IZKA 4WI7A 2C3HA 3LN4A 2DWDA 5K9KB 4U6XB 5C0BB 1T1XB 3UO1L 4EQ3A 4PFEA 3UZVB 4GS7C 2VSCA 3FQNB 5GRUH 3SJVB 5JW3L 3WL9B 5MHSD 1KTDA 4AEHH 4QWWC 1ZLUH 4MVBC 1EZVY 1I9IH 2YBRA 3BWUC 1ZGLA 1YMMA 1MFEH 1K6QL 5CLWA 1MFCH 2W0FA 4PPTA 5ESQB 1K5NB 1IAIH 1UCTA 4OQ1A 3EYFA 4XCYA 1UCBH 1A1OB 4LSDA 2X4NA 3G6JF 2V9TA 4GQ9L 3WNKA 5D7IA 5HHOE 3FFCA 5AG8A 4Y7MA 1BFVH 5IBTH 5HTSA 1U8OB 1EH9A 1MVUA 4OFYA 3TYGH 4MNQD 4X6CA 4JN2B 5IEHB 1MJUH 1XGYH 4ZD3H 1MQ8A 4HUVB 4NOBA 3B83A 1DUYA 1MCBA 3QDMB 1KJ2H 4PB0L 4WENB 4HSQA 3S4SB 4YGVB 3SCMA 3L3IA 4M9OA 1UWGL 5FCUH 4OKDA 3ZE0F 4Z7QF 1KCVH 2V9QA 5L8JB 5CJQL 4R2GD 1DBBL 4O4YL 5DJ2A 1N8ZA 1KJ2A 2PO6D 1ZGLM 4QOKA 1W72L 1Q0YH 2ZPKH 5IW1B 4P46B 1DR9A 5H35B 1IRAY 1SJHA 2H32H 4PJ5A 4U0QB 3SGKA 4OCXL 5JORA 3EJZD 4S1SH 3BVNB 1WICA 4AMKL 5AD0A 3CH1B 4QRPB 3C6LD 2CLVA 4HMCA 1NEUA 4K71C 5C0NC 5FKAB 2I5YH 4ZO9A 3RZCB 5LGKA 3VXRD 2QBWA 4KDVA 1JPFA 1RUQL 1IAIM 3HRPA 3VFUB 4D0DB 2H32A 1FL3B 3ZE2F 4E42B 2WINA 4NKMB 3GSNH 4M5ZH 4PJGF 2V17H 1XH3B 3V5DA 2YUXA 1KN2H 3EO1B 5IG7A 1AGDA 4DKAA 5B39A 4LIQH 4NNXA 4ODHH 5DK2A 3C09C 4LEXL 4U6HA 4P0DA 3KPTA 3MFGB 5DURD 1KG0A 4LCCB 1URLA 3O4LB 4FABH 3SCMC 4E5XB 3FZUC 1A6ZA 4R3SB 2MPAL 4ODTH 5D1XD 4JFFB 1U8QB 3WHXA 4AIOA 3WBDA 3QH3A 5GS0L 4PUBL 1LVEA 4X7CC 3DO7A 4M7LH 1T7VA 3O8XC 3F7QA 2B8OT 2D03H 1P2CB 2ORBH 1MCDA 5I1HH 4BH8A 3HAEB 4Z0XB 4M93C 2DQJL 3W81A 4HKJB 3F12A 1U6AH 3ARVA 5ESVB 1OAKL 2LU4A 4WO4B 1MWAB 2A0LD 4TQEH 3SGKC 5K9OB 5I76B 1J88A 1HOCA 4R0LA 2P8PA 2XKSA 4EDWL 1X5XA 3MJ8A 3FQRA 4RMSA 1I4FB 2X1QA 5T1DH 1CXEA 3ZE1F 3DX9B 3DROA 5KSAB 2MQ3A 4PRID 3KPSB 3KPOB 4X7TA 4LCWB 3BZFB 1BM3L 1KPRB 2EC9U 3EDFA 4LLYB 3RIFF 4B7LA 2IBZY 3QCUH 4Z7WA 5DK0A 3DUUA 1WBYB 3STLA 1F3DH 4QO1A 1SY6L 3U6RA 3L5IA 3RVTD 2YKLL 3OF6D 3BPLC 3TBVA 3S7GA 3SY0A 4QT5A 3I3DA 3QDHA 4TNVF 5DO2D 3BE1H 4JO3L 1WLHA 4JZOA 5CP7A 2AK4D 5D7LA 3MRJB 5SX5K 4HIHB 1YN7B 2ZUYA 4YUEH 3BJ91 1DLFH 4BSVB 2DM4A 1T7XA 1Z0MA 2D0FA 1M7DA 4CVXA 3VJ6B 3CPLB 4XNYH 1M71B 2IPTL 2A6KB 2B5IC 4ZFFB 5IKCB 1I1CA 2CKNA 3ARQA 4TSCL 1QHPA 5LGHH 4RAUB 4QXWA 5DD1L 1KEML 2J6EA 2FO1A 4M8QB 1QRND 4R0LC 5CUSH 3KR3H 1WFTA 1RZ8A 5C9KA 5E8NA 1A7QH 3T4YB 4BQ6A 3MV01 4EOWL 4WHTB 3MRCB 2K9UA 4MNHB 2Y25A 1G0XA 3U30B 2E9IA 2FEEL 3U7WH 5C86A 3WEXA 5MENA 3EO0A 1KYOJ 4I0KA 3HRZB 4F3FA 5T33L 4PGBA 4YHMH 3GIVB 2K1MA 1G6RB 4JKKA 2R2HA 3QIWD 4EEEA 3CC5A 5IB5A 3GDBA 2E7LC 1MJ7H 4LMQE 3DURA 3OWEA 3WHE1 4HK0A 2HFGL 4KFZC 2DMBA 1BAFL 1QSFB 1N0XL 5HHOA 4GMTH 4ZSOE 1W2KT 2YRPA 1O7SA 2ZUQB 1BD2B 2DYPB 5C70A 2WIIB 2ICWB 5KVFL 3BH8B 1Y6MR 4NC1C 3WXWH 4PRPB 1LD9A 2G2RB 2XQYK 5ICYB 2A73B 3C5SB 4LHUB 4H5SB 4G6KH 3QFJB 2FBOJ 2AQ1A 1TPXB 4Q97A 5FO7B 1Z5LB 1CGUA 3VFSB 5I17A 3H9SD 4HPOH 1PKQE 5HPMA 1A3RH 2W9DH 1I85A 2NY6D 2O5YL 4Q74A 3QCVL 4L4VA 3MLWL 3HZVA 1CTNA 1HSAB 5C08B 4Y4KD 4M00A 4D9LL 5GRJH 1KACB 1D5IH 3H42H 4H8WL 1HI6A 4KI5F 1EX0A 4F15B 4JPVL 3FMGH 3IJYB 5IBLD 1MCWM 3VXPA 2X89A 3MJGX 2VXQL 4OZGA 3MRDB 1S3KL 4K7FA 3QRGL 3FO1B 5L8LB 3JWOL 2EDQA 1A4JB 1PEWA 4XP6L 5L9DL 3SKOB 1HHGB 3CK0L 5DHXB 5M95B 3QHFH 4R26L 4OZFG 5EZJA 4PJDB 3JV6A 4KGLA 2EICA 4PR5A 3QHTC 3VWKD 3BKJL 3LQZA 4YHKL 3LKSB 4OCSH 2EEBA 4KK8C 3TBWB 4O9HL 2CDEA 4JREB 7FABL 4NZDA 3D1MC 1NEZG 4IRSB 4PP2B 2DQIL 1R3KA 2FHBA 3FHQA 1TENA 1A2YA 1O0VA 3ARDB 2D7QA 5JR1L 4LSVH 1JUFA 3I84A 5KN5B 1Q0XL 3ULVD 2BHYA 1VFBB 3OXSA 2PYFB 4PRAA 4N0UE 1I85C 5J9PB 4WTZA 5CSGA 3VFTA 4KTEL 4NZRH 3QNYB 3T0DA 2Q8AL 1F4XH 1IFHL 5MEPA 3LKPB 4RA3A 5CJXA 3HPJB 4XNXH 1ZLWH 3ALPA 2ERJB 3IXTB 1QHOA 4IDJH 4ENEC 3FFDB 5DVKA 4KRPC 4PYGA 1KCUH 3AMKA 4DGVH 4JZNB 25C8L 3QNXB 4P23A 2PETA 4AL8H 4MB5A 4QRRB 5F9JB 1IAOB 4OGXH 1JNHB 4A2LA 3STZA 3MCKB 2N4IA 1MHHB 1NGXA 3SKNA 2HWZH 3VH8B 2CGRL 5ANMB 4YE4H 5A16B 1HXYB 3QULA 1S8DA 1CFNB 5FA4B 5HPOA 2UVEA 4XHJC 4Y4FB 1UACH 4D94A 4LLQA 1K8DA 5K9QG 2BERA 1GOHA 3C60B 4LSTH 3QXWA 5F3BB 3T65B 4XI5C 4WJ5A 3C9NB 4LGSB 2R2CA 2I60L 4OT1L 3BKMH 4XAKE 3PQYE 4PJBF 1IMHC 1XT5A 3Q5OA 4KZDL 3A0OA 4OLXH 5BOZG 1AGFA 2D7TH 2FJHA 3WN5C 2AKRB 3BKYH 3CLFL 5CJXC 2FD6L 4PJXE 3BW9B 2NTFA 1XF3A 4L8CA 1HINL 4HUXA 2Z31D 2GIYA 5TDPA 1RIHL 1LEKB 5DTFB 3QISA 4P5MB 4BFGA 4EI6B 3S6CA 3DIFA 3FQUB 1HH9A 3BRFA 4RX4D 3UAJC 4PJEB 1ACYL 1AJ7H 4P23C 1S7SB 3V79C 3RJDA 3ECBB 4HIXH 3MRPA 4ONFL 1EO8L 1QBML 3WJJA 5DRZA 4Z77A 1DL7H 2FBJH 5JW4Q 5E00A 4KJWD 5HDLA 1JZ6A 1LE5B 3T0AA 3OJDB 2HLFD 1YEJL 2Z91A 4PJ9B 3EZ8A 5IVXE 4LL9A 1G7JB 1AKJB 5E9DB 2NY4B 2AK1H 3BSZH 3LS5H 1M7IA 4MS8C 4Y5XA 1U93B 5DJAA 5C0IB 3QDGD 2IQ9H 3BP7B 4X6EA 4P99A 4F9LA 2ZCKH 2DS4A 2OR9L 5EWIL 4PJ7F 3WIHH 4XP9L 2E9WA 5DD6A 2AJVL 2GTWA 1BQHA 1MCWW 5IHBA 4TPRL 5D6CB 1CGTA 2VRAA 1VPOL 4XVUD 2QSCL 3QHZH 4GBXD 3IJSA 4K3DH 3RPIA 3LV3A 2ICWJ 4QRQA 3WUWB 2UYLB 3G08B 4F7PB 2F54B 3FO0H 3KPRA 3QAZC 3TT3H 5FOBA 5F7DA 5E08L 2BSRB 4NQSB 4FMKA 3UJJL 3D3VB 2VH5L 4P3CL 3B9AA 1MCJA 3UCRA 1V5JA 1OAYL 1Q9WB 5DD0L 2A9NL 1QACA 3PGDA 4DUXA 5TFSL 1XF5A 5EOCH 2PUQT 3SGDI 3QEQE 1PFCA 4LOUD 3BUYB 4UQ3A 5KSBB 3B6SB 4G42B 2DRUA 3WJJC 1IAKA 3MRQB 3X12B 2OSLA 3L3JB 5HHNB 1AFVH 4K23L 4JDVB 3U4BL 4GSDH 4OZIB 1HNGA 1GJIA 5FUCE 4GLRH 4GUPB 5KG9B 4NM4H 4N0CC 4PP1D 1CS6A 1LDPL 2HVJB 2ZOLA 3PDGA 4Y5XC 5EBGA 5FYLL 2O26U 3U4AA 1FNAA 2V5TA 1SM3L 3HLAB 4LVNB 4APQB 2P47B 4ZG1A 4F9LC 3SOBH 1P4BH 4YHOH 3BP5B 4I3GA 4UIMA 1XFPA 2YPKB 4HW6A 1CFVL 3MROA 5DQ9B 5F21B 4POYA 5FK9B 1NANI 5TDOB 2GJZB 3HI1A 4ZUVB 2A9MH 2BK8A 3BQUD 3AU1B 2BY2A 5DFWH 3WS6A 5C0GA 3HG1A 5JPMB 4XP5H 4EVNB 5HGDB 1IM9B 4G80B 2DI7A 2UV3A 3QYCA 1NFDB 2Z92A 3LEXB 2A77L 5IB4A 1SBSH 3HE6B 1C1EL 4OD3L 5EO1A 1FCCA 2PXYD 2BNQE 5K33A 4XPTH 4DGIL 3O3BA 1V3KA 3JBG7 3V8CA 3VXMB 2A6DB 4I0PB 2Z93A 1RZ7L 5GRYA 4YXHL 1N5YL 4XC1L 1A8JH 1OT1A 4IEFB 4CNIB 1ERNA 3MOBL 1A7BA 3RX7A 2CKBA 1XF2B 4NO2B 3W9DA 3PGCB 3CZFA 3NIGF 2P5WD 2D0HA 2IALA 3I9GL 3SJVE 4DCQB 1I1AB 2K7QA 1X4ZA 2QR0A 5I75C 3RVVD 3HR5B 3IT8D 4WFFD 3D85A 4P4KA 1OPGL 2BVOB 1F2XK 2VLMD 3NIDE 3CMGA 3IFOB 5DUBA 3P9WB 4HWZA 3REWB 5GGQH 3C08L 2HFFA 3MBED 4HJJL 1FIGH 2J4WH 2MCG1 2EDBA 1QPXA 4JHAH 1QLFA 3LIZH 4OSUH 2N7BA 2X4PB 4MAYA 1RFDH 1UT9A 4Z76B 5IF0B 2IAMA 4URTB 4V2BA 4O2FA 1CU4H 2Y5EA 4HC1L 5FKPB 2OYPA 3KLHC 1JTPA 3WS6C 4ZNEA 2Y4SA 4IBLT 5F89B 3LSOA 4BZ2L 1TVDA 1BMGA 1NSNL 1XZ0A 4H1LG 4JJ5B 3QWQB 4MQ7B 2CJUL 1FFOB 3UO1H 4YAQB 2HRPH 5EBMA 4PRBB 4ZMAT 4TVPL 5D7JD 2ZCLH 4MWFA 2FJFB 3TNNB 3IS1X 1KPUB 1K4CA 3RAJL 5HYJE 1HKFA 4PJXA 1JYNA 1XGQA 2J12B 1KN4L 1K6QH 5FYJL 4E41D 2W91A 4FQQA 1WF5A 5C09B 2OCFD 2XQYG 1QD0A 3ZKMD 4PV9A 1QFWI 1NCCL 3T1WA 3WD5H 5JZ7D 4P4KC 3ZTJH 1AGBB 5GGVH 4GQ9H 4QRPE 4GFTB 5CCKL 3J7HA 3O2DL 3CDYA 3TA3D 4AEFA 5E8OB 4MQSB 1KJ3H 5ACLA 5IVXA 1RZIA 3VFRB 1WGOA 3RKDD 3WDJA 3RVWD 4MAYC 4OCRL 4MJ5A 4F57H 2IAMC 1G9NL 1MFDH 3N50A 4QRUB 1ROWA 1JTOA 4FFVD 3CFDB 1TZIB 3JTSA 1UWGH 3GNML 3IDMA 3MGAA 5HY9B 3HZYB 5E99L 4F7TB 4MDIB 3MRLB 2CR6A 3O4LE 3VXUD 2YD3A 1PBYA 4CL7A 5I1KH 2ZZUT 5C7XH 5K59F 4Q0XL 1X4XA 2GY7B 4XBEL 3S3JA 5GRVK 4LARL 2DDQH 4HS8H 4RRPA 2ICEB 5J7CC 1J7VR 3QG6A 3VD3A 1SJXA 1KB9K 4M4RA 4ZO7A 5DXWA 1ZT1B 1CFQB 5KOMC 4NKDB 1I8KB 4YX2L 4KQ4L 1HXMB 2HFEA 4OCXH 4JHWH 3T2OA 5DVNA 4AMKH 4V1DD 1GIGL 5GS2H 1PY9A 4M6MH 1KSRA 5J1AA 2R0LH 1BJ1J 4O2CA 5JDJA 2X9WA 4D9QD 3JTTA 1G7HB 2HMID 3FO2A 5JXEA 2XNAB 2XPGA 5BCAA 3F6LA 4LU5H 3IKCB 4ALAH 1A6PA 4HFUL 3KPSE 2COQA 4LCWE 5AZ2L 1W0WA 4OJFL 5BS0A 5KSVA 1MCOH 3D18B 1C16A 2XZQH 5SWSD 3RY5A 5IB2A 3IFPB 2RBLA 2RCSL 3SDDD 4UU9A 2RFXB 2OTUA 3K1DA 4I4WA 4NN7C 3PF2A 4XVJL 1G1CA 1WFNA 1JRHL 5T3ZH 5I6XB 2Y06L 3MLSH 1MRDL 2A6JA 2QQKL 3VDCA 3F65A 1NGPH 2AJYL 5IB3A 4PJIE 4PUBH 2GYSA 4Z78B 4GAYB 4QHKJ 5DGRA 5DS8B 1VHPA 4X6FA 5C07B 1QNZH 4KQ3H 2NY0B 1FE8H 4LKXA 3V6BR 2DQJH 3QWRD 2PYED 5HD8D 2VE6B 2P8MB 1WV7T 4HQQL 3ARTA 4X6DF 1WTGT 3TBSB 1R5VB 1MEXH 2BNQA 3ROOA 1NBZA 1A6TB 3P4MA 4I9WE 5FYKH 4WI8A 1A7NH 1WC7A 3VA6A 4O5LL 3KPLA 3EBAA 3PDOA 3JXAA 2VITB 4ZQKB 1I1YB 3ISWA 2OBGA 3O2WL 5K9KA 2X70B 4U6XA 5C0BA 1T1XA 2Z9TA 5JXEC 1JZ3A 3MLTB 3O3UN 4ODBD 5CHNB 1YYML 3DMMB 3SJVA 4NNPL 3EOTH 1KLUA 3WL9A 5FUCC 1HEZB 4YHLL 5ITBH 4L8DB 3UJTL 5CILL 2B0SH 2Y7QB 4LAQH 4Q6IB 5ESQA 1K5NA 2JCCE 1LO2L 1MCIA 1L7IH 3QUMB 4CUCA 3A67H 5J3HC 2X09A 4KAQL 4Q9QH 5D7KD 3GSWB 4OLVL 3ZT7A 1KB9J 1SY6A 2R8SH 2ENYA 1QSED 4NQXB 1BD2E 1M6OB 5CEZD 5I1AB 3MJ9L 1TNMA 2DJSA 2MFNA 4JG1L 1AO7B 4HIEB 3KYNB 4JN2A 1S7WB 5IEHA 3HUJB 3ARUA 3VGBA 5B3NA 4PRPE 4HUVA 2WWMD 4Z8FH 1WFOA 3QDMA 4G8GD 4ORZC 4KI1A 4QYOB 5F1SA 5H94B 3RZWA 3CFBB 4IM8A 2HT4C 5IM7B 4PRNB 2VKXA 4EJ1C 1YECL 3QFJE 5B39G 4YGVA 3S4SA 5GS0C 5CJOH 3QZWB 4BK4A 2J88L 4AEEA 4P9ML 2HT3D 3L1OH 3GSOA 1KNOB 3H9ZA 4YPGB 3G6AB 4XCFH 5SX4H 2DD8H 5SX5H 3FT3B 1J11A 5T33H 5F8RC 4F2MB 5EPMB 4EBQL 4F58H 3BN9C 5GRXG 5IW1A 1U41A 4P46A 5H35A 1CIDA 5D1QD 1ZLVH 3SO3B 4WUUD 2DQCL 1WUNT 3QDJE 3GI8L 1FVEB 3BVNA 2HFGH 2V2XB 1YUHB 3CH1A 4QRPA 1A6AB 2HTLC 4RAVB 3OKMB 5FKAA 5JIKA 1ORSB 3RY4A 1FZJB 2HRLA 2NW2B 4D0DA 3VFUA 5IOPB 3FB5B 1FL3A 2Z8RA 3CUPB 4E42A 1CR9L 5KVFH 2VUOA 4NKMA 3V6ZB 3SE9L 4PJDE 1XH3A 1MSPA 5BJTB 3TH4T 2YR3A 1H8SA 3EO1A 1AR2A 3BFOA 1KELL 1A6VL 3N06B 3HAEH 3TN0D 4OZHB 4LCCA 1GGTA 4MNQB 3O4LA 1I7TB 1YQVL 2NY2C 4NFCA 4E5XA 4B0MM 3QCVH 4LVEA 3H7BB 4XVTL 3LQAL 4R3SA 2W0PA 1MWAH 4JFFA 1U8QA 2Z8WC 3DXAE 4Z0BH 4TUJB 1P2CA 4X7SH 5IQ9B 3V4PH 4MVBD 4WFHD 3HAEA 4Z0XA 5IW6B 2WBWB 2YHGA 4JPVH 4K55A 4HKJA 3VMNA 4P46C 1V3LA 4R2GB 4WO4A 3WDIA 5K9OA 5I76A 1QEWB 1FL5B 3FB6B 5ESAB 2PO6B 3O6LL 1OGTB 4U6VH 1I4FA 4XP6H 5JHDD 1MHCB 5L9DH 1IC1A 3DX9A 3V5KB 5KSAA 4BK5A 3KPSA 3KPOA 1KF9B 3BZFA 4LCWA 1KPRA 3GSUB 1HHJB 1MF2L 5FYLE 4Q9RL 3C6LB 4LLYA 1M05B 3S3PA 1JGUH 1N4XH 1SEBB 3QA3A 5KAQG 4XXDB 1OTTC 3F5WB 4Z5RB 1QKZH 3MYJB 4LLVB 4LCCC 4PJIA 1LDSA 1RIUL 3ZMRA 4PRHD 3MRJA 2VLKB 5BV7L 3SPVB 1QBAA 4HIHA 2FX9L 3MNZB 1YN7A 5DURB 5KZCB 4D9RD 4HGWA 3GSVB 4BSVA 1FBIH 4KMQA 3VJ6A 2YPVH 4MQXD 3CPLA 1QPPA 3NZHL 3S5LB 1BVLA 3ZDZE 5DZNA 2A6KA 4UV7H 5E95B 1YMMD 4ZFFA 1OP5K 3RU8L 1WEJL 4RAUA 5JDSB 4WO4C 1AH1A 1F02I 4FQXD 4M8QA 1VB9A 4KHXH 4ZUTB 1G6RH 1P4IL 5KW9L 3T4YA 3ZKNC 1MFBL 1ZVSB 4G6FD 2R1XB 4GRWF 4WHTA 3MRCA 5IFJB 3DX6B 4MNHA 1KGCD 5KSAC 2WQ8A 2JK5B 4Y1AE 4GAGH 3ARZA 4DW2L 5TF1L 2D31B 1T66C 5JOEA 4UT9L 5JIHA 3FONB 1CGVA 3VGHA 5D5MB 2VLRE 3THMH 3FQTB 3B3IB 4PRIB 4K2UL 1G6RA 4R4FL 4XNZC 4MXVF 1BVZA 3MRNB 2JCCA 4IMLB 1RZKH 3QI9D 5ABDE 1CBVL 3PDDA 3UYRL 3BO8B 4OT1H 1CXIA 4TRPL 4DTGH 1BD2A 1I9RH 4LASL 2DYPA 1OSPH 3NAAL 2WIIA 1AXTH 4KMTL 5IMKB 2AXHA 4GQPH 2R0ZH 1FVCB 1S7XB 3BH8A 1HINH 3CDGB 4PRPA 2G2RA 4L5FL 1PX4A 5FDYA 5ICYA 2A73A 3C5SA 4LPYA 1RULH 3AMLA 4H5SA 4DAGH 3QFJA 3ARBD 5FO7A 1Z5LA 1CLZH 1YJDL 4NC0B 3BRDA 4TVPE 3VFSA 4OB5L 1H3PH 5BW7A 1BECA 2M1KA 3MXWL 2VR9A 1MCNA 1RI8A 4JM2B 3U1SH 3QBTB 1S5HA 5KSBE 1HSAA 5FYJE 5C08A 1ZS8B 3QO0B 4DK3A 3EOBB 3U30C 5GS1A 3S96B 2VISB 2CIIB 5I8EA 4LQFL 2VXTL 3S36X 4HUWB 4HG4J 5F9OH 2M26A 3IJYA 5I1CL 4CMHB 4JB9L 1UQSB 1WTLA 2DQDL 3PG2A 2P42B 5LXGL 3MRDA 4DFHA 5J06A 1I3GL 4YBLB 4U4BA 2Q7YB 1T89A 3FO1A 1Q9OB 1RPQA 4KRLB 2KZ1B 2O5XH 1GGIL 1BBJB 3VFMB 3QJHB 1JYXA 1E4XH 1OAQH 1WIPA 1HHGA 2V2WB 3SKOA 4WY7L 4OF7A 1R3IL 4W6YB 3LEVL 4DWHA 4PJDA 3ULUF 1OARL 4K7PX 3G6JB 1IQWL 3MC0A 3RGHA 3TV3H 1VESA 4M48H 1Z9LA 3W0WB 1RZKC 3LKSA 4Y4HD 1IAII 1Q9KB 3K3QA 4IRSA 4QNPF 3U83A 4PB9H 1NFDE 5TFSH 4XWOD 4DGYL 3ARDA 1R5WB 4JRYD 2ZKHL 5KN5A 3JV5A 4S10A 5BW7C 1HWGB 1VFBA 2PYFA 3IDXL 43C9B 5J9PA 3DXAA 3O6FC 5KSUB 1REIA 2UVFA 3DO3A 3QNYA 1RZFL 1QR1B 3GUTB 3LKPA 3HPJA 4L8BA 1V7NH 3H9SB 5GS1C 3RVUD 1IGCL 4M7KL 3ZT5A 2NY6B 3IXTA 5JA9A 4FN0A 3FFDA 2WUCH 3WV0A 4F15C 5D71L 1DBAL 5EC1B 3MXVL 5TH2A 1NCDH 4HCRH 4JZNA 4Y4KB 5CBAB 5D2NE 3QNXA 2VDNH 2X4SB 4YBQC 4OCMC 4QRRA 2WWKO 1IAOA 2HFTA 1D5MB 5F9JA 2EDJA 1INQA 1JNHA 4LAJH 3U79A 3KYMB 2VDPL 3MCKA 1T89C 1MHHA 4FNLL 2Q6WB 1L9MA 3VH8A 3MV8D 4HS3B 1CDIA 5ANMA 1DSFH 5A16A 1KCLA 4OLWH 1HXYA 1CFNA 4HCRA 5FA4A 3WO3B 5HVHB 3PXJA 3EYQC 3GHBL 3G5VB 4XCCL 1FDLH 4Y4FA 3I2CH 3KXFD 2APFA 4K8RH 5BRZB 3C60A 4PJGB 4JREC 4CAGA 4G5ZH 1BF2A 5F3BA 3T65A 4OD3H 3PHOA 4IRSC 4M5YH 3TC9A 4HKZB 1NUFA 4C58B 3C9NA 3ARDC 3NIGE 3G04B 2FL5B 1T7WA 3I50H 1NL0L 1X5LA 3C2AH 1UZ8B 2AJXL 5MEND 1JPSH 4ZFOL 2AKRA 2UWEB 4OCNC 1JNLL 5HI3C 3BW9A 4NQDB 4JPWH 2CMRH 2ERJC 2P5ED 3W5NA 1LEKA 5DTFA 4P5MA 2WIMA 4EI6A 3VI3E 4PJAE 3CFCH 3FQUA 2HKFL 5C09E 1H3GA 2XA8H 1IC5L 3WLBB 3RUGE 4BZ1H 1S7SA 4HJJH 5HHVL 3ECBA 1FORL 3NABL 2HJFB 3PWUA 4NQUA 3UBXB 1Z9MA 2AXJA 4MCYB 1LE5A 3OJDA 4FP8H 5GJTH 4PJ9A 3LN5B 1G7JA 1AKJA 2EO1A 5E9DA 1FYTE 2G9HB 3OKNB 3SKJL 1U93A 2R4SH 4Y4FC 4AY0A 2QL1A 1HHIB 4YDLB 5C0IA 1T0MB 1E4WH 2IANB 4WEMB 5CEXB 2NXYD 5DRNB 3C60C 3BP7A 1BQUA 2GK0A 2NY5L 4WI6A 3MACL 4C57C 4L4VD 4DKEL 3Q3GB 2DLEA 5D6CA 1EVTC 2AV1A 1M71A 3T4AB 1BJ1H 2CD0A 2RGSA 3WUWA 2VXVL 2UYLA 2VR4A 3G08A 2F54A 4KKBC 1WAAF 2BSRA 4NQSA 4YGAB 3DX7B 3D3VA 2CRYA 2VO5A 4GXVH 4G6AC 1B4JL 2X89D 4YZFE 1ZGLP 1Q9WA 1RMFL 1WQVT 1OQOA 2R1WB 3QB7C 5ECJE 2X42A 1IEBB 3BUYA 2RJMA 1E6JL 5KSBA 1QZ1A 3B6SA 4G42A 1YY9D 2VXSL 3X12A 1FFRA 3MRQA 3L3JA 3WXVL 4L4TD 5HHNA 4JDVA 4OCRH 4PJ9C 1QRKA 4XX1E 4OZIA 1BIHA 4GUPA 5KG9A 2NY4C 4N9GB 2JLLA 4J3OC 2HVJA 4XI5D 2M2DA 4FQIL 4AENB 5HDQH 1KTKE 1XEDA 3HLAA 2ZG2A 4APQA 4MA1B 4D2NA 3T0BA 4IHOB 4ZUSB 2Q87A 3BP5A 4EUPG 1C5BH 2O93L 4XMLL 2YPKA 2HH0H 3I85A 4OTXH 5DQ9A 4XBEH 5FK9A 3UTZB 3QDGB 5TDOA 4P9HH 4LARH 5E6ID 3VGEA 4I77L 2GJZA 2YPLE 1JNJA 2R29H 3GMMB 2XZAL 4ZUVA 2F15A 3AU1A 3TNMB 1CGSH 5C07E 1SVZA 15C8L 4YX2H 4KQ4H 5FHAL 5FHBH 4EVNA 5HGDA 1IM9A 4G80A 3BEWB 3UAJD 2AJUL 4WNQB 1NFDA 4MJ6B 4WHYG 2VDQL 3QXDB 5D7SH 3LEXA 5IQ7L 2MMXA 3HE6A 4KZEL 2BC4B 4Z7UF 4ODVL 4J23A 4CW1B 4Y16B 3ULVL 3BP6B 2X9XA 1DVFD 5FYJU 2ARJQ 3VXMA 4DQOL 5T1KB 2A6DA 3P73B 4I0PA 4WHCA 5I8KL 4NBYB 4CNIA 4I5BB 4P2RD 4POZC 1G9ML 3BPNB 3NFNB 5F93C 1XF2A 1EGJH 4NO2A 1YNKL 1EAPB 3PGCA 4PTUB 3WFCL 3UPRB 4JAMA 4DCQA 1I1AA 2YA2A 3P4LA 4QEGA 2YSSB 1T6VN 3HR5A 3FRPA 1NLDL 2BVTA 2BVOA 5D8JL 1N2RB 3GRWL 3IFOA 3QP3A 4LVNC 3REWA 4APQC 2VL5B 2V5YA 3TESA 1UKQA 4NYLB 1F3JB 2AP2A 4UIKH 4AT6B 4M6NH 1KIUA 2FDBP 1NC4B 4Z7OE 2X4PA 4Z76A 4XGZB 3PWPE 1AO7E 3C8HA 1F8TL 2NZ9D 2C1PA 3G5ZB 3HUJE 5KS9F 4X6BB 1MCPH 3JUZA 1ZV5A 5F89A 4LCIL 4JJ5A 3BQUB 2VZSA 1TJGL 5INDB 3HE6C 4MQ7A 1JV5B 4PLJC 3MLUL 1FFOA 5BVPL 3PP4H 2NXZD 4PRBA 4I0PC 2FJFA 3TNNA 3QUXD 5FGRA 1YY8B 1KPUA 1OCWH 4K94L 1NCBL 4YHLH 5L2JB 1NJ9B 1YEEH 6FABL 1JI1A 2Q3ZA 2DQHL 4RRPG 2F74B 1NMAH 3F7VB 1FH5H 1H8OA 5C09A 2YD9A 2P5WB 2H26B 2R56H 4XNQB 3PNWB 3QXTA 1AGBA 2XWJB 1TVBB 4OLVH 4Y8DC 5DD3L 2OZ4H 2XY1A 4M61B 2OL3B 1J1OH 5E8OA 3VFGL 1S9WB 3V6FB 3VFRA 2OK0H 1FYTA 1L0YA 4YDJB 2ZNWA 3MBEB 2GAZB 5J57B 4QRUA 4MD5A 2OZ4A 4LSSL 4UOW0 3S3SA 4JKMA 3DRQB 1TZIA 3QFDB 4GAFB 4NHUB 5HY9A 1FN4B 3HZYA 3QQNA 4F7TA 4MDIA 3MRLA 4MNQE 1CVSC 3H9YA 3INUH 4N1EA 1BEYL 4LPUA 3CMOL 4OF5A 4JFYB 2KQNA 2ENSA 2ICEA 2AW2A 4PJBB 2CDFB 3QJFB 1ZT1A 1CFQA 4NKDA 1I8KA 1DANU 1HXMA 4OIBA 4YFEA 3MMEB 2PTVA 1N64L 2V6HA 3HA0A 5D7JB 4B50A 1CLOH 3VCLB 4XB7A 5HI5D 2X41A 2DQGL 3OSKA 5E03A 4GXUM 4YPJA 2IBGA 2HJLB 2XNAA 4G7VL 1MNUH 3IKCA 3F62A 5EZIH 3KLHD 1MCSA 1Q1JL 3HG1D 3UTOA 4N8VB 3V0WL 3D18A 5BOPA 3X17A 1R5IB 1XIWB 2MSPA 1F45A 1A6VH 3IFPA 3VXRE 3SDCB 4KUZL 2DL2A 2RFXA 3MUGB 2GW5A 3S97C 4OM0H 2FX8L 4LGRB 4MHHI 4OM1L 5DF0A 3IETB 1C8PA 4OZ4B 4HEME 4NQEE 4Z78A 2KBGA 4GAYA 2D4FA 1FNGB 5DS8A 1UH4A 2SEBB 5C07A 5F7EL 5B21A 1RZGB 4JGUA 1ZANL 1QFWL 1KBGL 2P8MA 4JO2L 5FDWB 3U2SB 4GKZB 5HVGB 4P4KD 2EYSA 3TBSA 1R5VA 3K8MA 3HNSH 3M8OL 5I8OL 4P3WA 4Z9KB 3TWCH 1EAJA 4NKQB 3IAGC 5EOTB 1A6TA 2EH7H 4BJLA 2VITA 4ZQKA 1I1YA 1WZLA 3DTXB 3JWDL 3OAYH 3S4SG 1DBML 4DEPB 2VLJD 2X70A 3ZHDA 3S36H 4V1DB 3MLTA 4ODSH 3QUMH 5CHNA 2IAMD 3DMMA 4ETYA 4U3XA 4UBDD 4MD0B 2R2BB 4HH8A 4PJCB 1KJMB 5INCB 2DQUH 1HEZA 4BQBA 4L8DA 1OM3H 4LSRH 2Y7QA 1B0WA 2BJMH 4PRIE 4PY8J 1B2WH 3K7UA 4JDZB 3BPCB 4LVOB 4Q6IA 5DZLA 4NWUH 1H5BB 3SGJA 2FR4B 3GMLB 4TSAH 2AS5M 3T09A 3QUMA 4K7PH 5I6XC 5H37G 5SWSB 4WUKH 3MNWB 1Q72H 3GSWA 2H1PL 5JOPD 5CKAA 3UPAA 1DQDL 4NQXA 1RJZB 4OLUH 2H3NB 1M6OA 2YK1H 4LFHG 5I1AA 2VL4A 2PF6A 2FB4H 1AO7A 4HIEA 5HXMA 2NY0C 3KYNA 1S7WA 3R8QA 3HUJA 2AK4E 1FNHA 5H94A 4QYOA 3LQAC 3CFBA 5IM7A 4PD4K 4PRNA 3LHPH 5FGBA 2J7LA 1IZJA 3QZWA 3SQOH 5LWYL 2YA1A 5A2KH 2PYEB 3GHEL 4YDIL 4ZOBA 1YEHH 3EGSB 1KNOA 4YPGA 1I3RB 1HH6B 3G6AA 3HI5L 3FT3A 1RUPL 1NDMB 2ADJB 4DW2H 3CU7A 43CAB 2FIRT 4F2MA 1WZ1L 5EPMA 1S7QB 3DMMC 1QRNE 2OP4H 4YEEA 5GZOC 1J0JA 1LO3L 4K2UH 3LRSB 4R4FH 3X13B 4KKAC 3MLPA 2J2ZA 4HLZG 3WFBL 2XICA 5DEGB 5L88L 1OP5H 4NM8L 5HYSB 3NCEB 1QVOB 1FVEA 4Q6IC 2V2XA 1LK3L 1HCVA 1YUHA 2GITB 1A6AA 1DFBH 3RL1B 3SGJC 4BM7A 4RAVA 4TRPH 3OKMA 4G6ML 5DVLA 5LGJB 2NR6D 2F5BL 4NKOB 1ORSA 4U1GC 1FZJA 1DN0B 1UM4H 3MLXL 5IOPA 3FB5A 3DETD 3CUPA 4OGYH 5F72S 5IK3B 3V6ZA 1S9XB 5BJTA 4Z95L 1BGXL 1X5FA 4J7RA 5GZND 5BV7C 1MCEA 1RZJH 3KJ6L 2YD5A 1L7TL 4R6UA 4MNQA 5FGBC 1CDYA 1I7TA 1OL0A 2YUZA 5JXED 1IC4L 3H7BA 1JP5A 1J87A 2P8LB 3T0ED 3BKCL 5FM4A 3NFPB 3DVIA 2YMXL 4F37F 3L7FB 5GS2D 4XC3L 2VDLH 4TUJA 1EERB 5IMLB 4G9FB 4P2CG 4GG6E 5IQ9A 1MHPL 3V95A 4NRZB 3EYOA 5SWZD 5IW6A 4JR9H 3H9SE 4OCYH 1BOGB 4LDOB 3A6OA 5FV1L 2ZG1A 1XR9B 1KFAL 2XXCB 3GSRB 2ILLA 1FNSL 1QEWA 2DLIA 1FL5A 1UWEL 3FB6A 5ESAA 2PO6A 3K74B 3GJEB 3H9HB 3SO3C 3ZDXF 1OGTA 2WWKT 1F5WA 2QQNL 2ATPB 4RWYH 2P7TB 4PBVC 2A6IB 4XAWL 1MHCA 5EFIB 3V5KA 1R3IH 2JJVA 1TXKA 4H0HB 4P59L 4U3CA 5D1QB 4WUUB 3MV9D 3GSUA 5E56A 1HHJA 3GM8A 4NZUH 4HJ0D 1BF8A 4JFPB 3C6LA 4TUKL 5T3ZD 1M05A 4AQ1B 5E8EB 5C0DA 2YN5A 3VXRA 3LS4H 3RWHB 1SEBA 3GBMH 3ZLQC 3BEVB 4K3GA 1KV3A 3OMZA 3F5WA 4Z5RA 1GGCL 1J9CT 3MYJA 1J8HD 3FOMB 4LLVA 5ALCL 4H0GA 1LNUA 4ZUWB 5D70H 3WSQH 2IGFL 1PW3A 5C0BD 3LEYL 3SPVA 1PYWB 4XP1H 3MNZA 5LBSH 1QP1A 2XN9B 3GSVA 2HAZA 3V5HA 4M7KH 3AAZB 5FYKD 2UWEE 3U46B 1RZJC 1NAMB 3S5LA 2PKDA 4BQCA 3ULVE 3CX5K 2E7HA 3EHBD 1MJ8L 2HTLD 4YIQB 4R2GC 5JDSA 1P6FA 4HBCL 1X7QB 3OR7B 2BSSA 2PO6C 4ZUTA 4FNLH 4EKXA 3MODH 2NX5D 1ZVSA 2R1XA 3IDNB 4JO4L 5IFJA 3DX6A 2QQQA 1A4KB 2JK5A 4KVNH 3E0GA 3QWOB 5IHZB 3QXUA 3EJZC 3C5ZD 5HDBF 3HMWH 5CZKA 5DT1L 2D31A 1RVFH 5JHDB 3C6LC 3FONA 3X3GL 5D5MA 4U1JB 3FQTA 3B3IA 4PRIA 4UB0H 3MRNA 4IMLA 2ZSVB 3OGCA 1KEGL 1AIFA 4XVSL 3BO8A 1RIVL 1Y6KR 3UYOD 1FIEA 2OLDA 1X9QA 4OUUB 1BQSA 1GZPB 4AG4H 4G8IB 3QUKB 5DFVC 1SYSA 5LG1A 4JFED 1L0QA 2F53E 5IMKA 2WAHA 4X6CF 1UB5B 5DR5H 3FAWA 1JNLH 4K3JL 1ZHKA 3EDDA 1FVCA 3DX8A 1S7XA 3BYTA 3Q1SL 4KHTH 1KJVB 2DLTA 3BIAX 4K9EH 3EYUH 5EU6D 2KUTA 4PRHB 4F9PA 1PLGH 3C5JA 1T2QH 4F8QA 2WUBH 3WDHA 4HFWB 1IC5H 2DM3A 2EE9A 5J1TC 1FGNH 1U8LB 1HSBB 3X14B 3RZCD 3SGEH 5ELIA 3HNTH 2VZVA 1DJSA 5HHMB 3RVXD 4JM2A 3GBLA 4RFNB 4DOHB 2BFVL 4JN1L 3ZYOA 4CVZB 1ZS8A 2AEPH 3QO0A 1J0HA 2A0LC 3EOBA 4MAUH 4FQXB 3S96A 2BRRH 2CIIA 2VISA 5F97E 1NGYB 5L2KD 3BIKB 4HUWA 4IRJB 4G6FB 1X5JA 3DYMA 4MD4B 2DQEL 3ARXA 4I3RH 1HYSD 1Z3GH 3HC0B 2C3GA 3EFDL 1IILE 4X4ME 5E2VL 2Q7YA 1Q9OA 4ZPTB 3MRMB 3P11L 3VFMA 2B39A 3QJHA 4WEBH 4WW1B 2V2WA 3DSFL 5DJ6A 2L0DA 3RVTC 4UV4H 3MA9H 3QDGE 3QI9B 1JZ8A 2X7LB 5ILTH 3A6BL 4KKNA 5DO2C 3W0WA 5I1IL 5JXAL 4QY8B 4WO4D 3OKKB 4ZS6D 2YN3A 1Q9KA 5DJDB 4F9PC 4CJ1A 3VFWB 2C7UB 3BGFB 3IF1B 4NZTL 5HGGS 1R5WA 3UTPD 1G1YA 5TJWK 3FN0H 1TNNA 3RWIB