1SXAA

Crystal structure of reduced bovine erythrocyte superoxide dismutase at 1.9 angstroms resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE
publication title Crystal structure of reduced bovine erythrocyte superoxide dismutase at 1.9 A resolution.
pubmed doi rcsb
source organism Bos taurus
total genus 41
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1995-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1sxaA00
2ZKXA 1E9PA 1COBA 2XJKA 1KMGA 2NNXA 1SXNA 2GBVA 2SODB 3ECVA 1OEZW 1HL5A 3GZPA 2WKOF 5CU9A 1E9OA 2AQRA 3HW7A 3QQDB 1PZSA 1TO4A 1XTMA 1F1GA 1YSOA 2V0AA 3H2QA 2VR7A 1F1AA 3F7LA 1IBHA 4A7QA 1E9QB 1IBFA 1SPDA 3T5WA 3PU7A 2JCWA 2WWOA 5KBLA 4B3EA 2GBTA 1QUPA 3KBEA 3CE1A 1SXAA 1SDYA 2GBUA 2C9SA 3CQQA 2K4WA 3MKGA 1BA9A 1SOSA 4A7VA 4MCMA 1Z9PA 1IB5A 1YAIA 1Z9NA 1Q0EA 1HL4A 3KM2A 2WZ5A 3RE0A 1FUNA 1SXZA 2ZKWA 2AQPA 3QQDA 4BCZA 4A7SA 1B4LA 1L3NA 1OAJA 1SDAB 1AZVA 2Q2LA 4A7UA 4BD4A 1P1VA 3GTTA 3K91A 1E9PB 1IBDA 1CB4A 3GZQA 2R27A 4L05A 3GZOA 2AQQA 1DO5A 4U4IA 1PTZA 1IBBA 2ZOWA 5KBMA 1JK9A 4OJAA 1CBJA 3H2PA 1EQWA 1UXLA 2XJLA 1EJ8A 1YAZA 3CQPA 2Z7UA 1RK7A 2ZKYA 3L9YA 2JLPA 3KH4A 2VR6A 1OZTG 2Z7ZA 1S4IA 3KBFA 2WYTA 3ECWA 3L9EA 1B4TA 3MNDA 1N19A 1MFMA 1OALA 1E9QA 3KM1A 3LTVA 1OZUA 3ECUA 1U3NA 2LU5A 1SXBA 1XSOA 2AQTA 2WZ6A 2WZ0A 2APSA 4A7GA 1F1DA 4OH2A 3GQFA 4MCNA 4N3UA 1BZOA 1E9OB 3GTVA 4A7TA 2WWNA 4N3TA 1SRDA 1TO5A 3HOGA 2AQNA 2AEOA 2AF2A 1N18A 3S0PA 3SODB 1UXMA 1PU0A 1SXSA 1SXCA 2AQSA 4A7GF 1DSWA 2VR8A 5KBKA 2WYZA 1JCVA 3KH3A 3HFFA 2WKOA 2Z7WA 1XTLA 3F7KA 2Z7YA 2C9VA 2C9UA 2E46A 4FF9A 1ESOA 4BCYA 2E47A 1F18A 1JK9B
chains in the Genus database with same CATH superfamily
4WFFE 3V9CA 3WBDA 5JYLA 1W9XA 1XGYL 4U49A 5E2TL 5LXVA 5L0QC 3WS3A 3PDDA 4CC0A 5C0JB 3K71B 4UAOB 2N01B 2WINA 4P07A 4B9IA 3MOQA 4G8AC 3EHBD 4AY0A 5H2BB 5EZJB 1JPTL 5CBEA 2X4NA 5FHAH 1RPQA 1BBJA 3IDXL 2GYSA 4KRLB 1IJ9A 3TEWA 4TQEH 4GQRA 3X1BA 5TF1H 4NPJA 3VI3F 3CU7A 3OHMB 5AWNH 3M7FB 3MKKA 3ZDWA 4QWWC 2KMWA 4JRYA 4Z76A 4UMGA 1YEWA 2GJZB 2NT1A 4HBCH 4QNPF 4PLKD 1N7ML 4NN7C 5TQ0L 1P84K 3PFQA 2CZNA 4L8SC 5G5DA 3NCWA 4GIPD 4L8CB 4TTGA 2AK1H 1I8KB 4X5XA 2IWGA 3FU8A 2IWFA 4CUCA 4NUMA 4O2CA 4AT6B 1M7IB 1FA4A 3NIFB 2AABL 4TV3A 5IMLB 4JO3L 4DGVL 1I7ZA 2ICWB 4N86A 3HHRB 2BSDA 5BO1H 3QIBA 4FG6D 1A47A 3EJQA 1PCSA 4OW6A 4HUWB 1EAPA 2ZXWB 4P04A 5F7MC 4FLRA 4JPVH 5I24A 3ARUA 2FGWL 3PWNA 4Y1AA 2E75C 3D0VA 3QDAA 1IQWL 5D96B 4ZJ9A 4RMVA 1U8IA 1F42A 3GSUA 1K8IB 3WEBA 4KJPD 3NQKA 3VA2C 4P99A 5AVZB 3QORA 4N8UA 3CWGA 4Z7WE 1WRFA 3L4CA 1TJIL 2CWRA 3BEWB 3HE7C 1HHIB 3L9EA 2BP3A 4PJFB 1A6TB 5HGDA 5FF6A 3RVWC 1CE1H 3FO9A 2VWEC 3SZKC 4UWQB 4H44C 4LLUB 4GXUM 3LS4L 3QZWA 4LLMB 1FFQA 4ABUA 1J86A 1DDTA 1H5BC 4W9HC 1ZHKB 4Y19B 5IUCA 3UZVB 4TQPA 4PJCF 1MJ8H 5JW3H 2D7MA 3MRFB 3OX8A 3GMLA 4PWHA 4X7TA 2AJ3A 1YEFL 2GK0B 4OF8A 3WXWH 4ONHA 5FKAB 1KPUA 1PF3A 1OE2A 3NESA 4KO9A 5EA0L 2ATPB 2ZYHA 2O6PA 4PJDA 5E9AA 1CGSL 4GG8A 1WPCA 2X2UA 3S8WA 5G4MA 1A7RL 2YN3A 3SO3C 1C7TA 2WYIA 3NCCB 2DIJA 1RZJH 3LRSB 4N90E 1F3JA 4KKAD 5F7AA 3EUUA 5KSVA 4WSGA 2VERA 4OUUA 3WNKA 3FT3A 3L48A 4K7PL 7FABH 1HEZA 3U0WH 3E80A 3OLGA 2R1XA 1I1FA 5GGTA 5AVWB 2O5YH 5J3HD 4J8RB 4JR9H 1XO8A 5F3HB 3FNKA 1L6XA 4PCKA 4HG4J 3P40A 1E6OH 4M00A 2W88A 2PWFA 4PS4L 5GXBB 3BI9X 4G6AD 2G9HB 5BOZG 2AV7A 1IT9L 1PIFA 1FH5L 3V0FA 1PX4A 2UXVA 2DQTL 4KQ3L 4YAQA 3CPUA 4Q89A 5GGTH 5B38G 1IJNA 2DLFH 1KNOB 3L3OC 4NO5B 4G80B 4XBPA 4YC2B 5E9NA 4LPWA 3W39A 4CSTA 4LCUB 3PREA 1P5UB 5DJDA 4POYA 2NPLX 4OKVA 1KXTA 4PY7B 4KZ0A 1FH2A 2GW5A 2ZX6A 4H13C 4E9XA 1JVLA 5KJ7E 5LHDA 1BQUA 4TKWA 5TH2A 2M26A 4W9JC 3D39D 4WV1C 2G3ZA 3KM2A 1T2JA 3SQOH 1M6UA 2R1YA 2P26A 4G5ZL 2UX7A 5CGYD 4DP0X 1QLRB 2WOBA 3FCTB 5GRVL 5IVXA 3SKMA 2RALA 4NP4L 4PJHF 3ZMRA 4AGMA 4ALAH 3OBAA 4LF3A 5LGYA 3AG2B 4YSOA 4KKZA 1MW0A 1SVCP 4IOIB 1JWSA 1DBJH 4R84A 3U4EA 4HCRA 4DWHA 1A2YA 4QXGH 5KSBF 5EO0B 3NGBC 3WIIH 3NCYP 4ACTA 1KCWA 3K6SA 2BNQD 3GMQB 3VCLB 2CGRL 2PYED 2V2XB 3EGDB 3P77B 2R9HD 4HS6A 4OF3A 3T3PE 3DI2B 4RISH 4GAGL 1OOWA 2B15A 4HCRH 4I4WA 4YH6A 3U2IA 2FNWA 2NNAB 2ENSA 3L4UA 1P1ZA 4L0PB 4OU3A 5BNXD 3MV9E 3GI8L 2AK4B 2LOEA 1B0GA 4YR6A 3UJJH 1NPUA 4BA8A 2J57A 2WQWA 1MWAA 2JB6B 4NO3B 3ZT7A 4E41B 2K1MA 4PWKA 1TU2B 1WFIA 4ONGL 3UMTA 2AJXH 1JZFA 1JFQL 5C6TH 1Q0XL 1FO0L 4NIKB 3VXTA 2QV4A 3WFEH 1B3IA 3GQFA 2FLMA 3IETA 2B9AA 4P57B 2O5ZL 4X5RA 1MWAH 3SD2A 3LEYH 4X6CA 5EUOE 1XMEB 4MA1B 1HHGB 2ISDA 4JPKH 3HR5B 3MRQB 5KZCB 3QRBA 5IMOB 1VADA 2CAKA 3PL6D 4XCFL 2A6JA 3GJFB 4JFDD 3RA7H 4JANA 3WFDH 4ATWA 3F7YA 4KV5F 1MUJA 1EERB 3RUGE 3QUXC 2DMBA 4R5VA 5CHNA 2WIIB 4YHZH 1CDCA 4YVUA 2JCCF 2EZ0D 1MJUL 1IAMA 1OGAA 1XCTA 1M1SA 2IPKA 1Z5LB 3QEHA 4B9PA 2C3VA 1A4BA 4M5YH 2WXJA 2VC2L 3STLA 2BXZA 3ARGD 5HPMA 2Z93A 4ZZKA 1EFQA 2OSWA 2B1HL 5D6DC 2QBWA 3PLYA 5CEZE 1TO4A 3NSCA 4J39A 4E9RA 1MAKA 1AOZA 1CLOL 4B9ZA 1KIPA 5D2NB 1IBHA 3MLPA 3HMXH 1LYQA 2E27H 5BQDA 1NCBH 4F24A 1F2QA 4GXVH 1M6OB 4WFFD 5DEFB 4DK5A 2C9SA 2F19H 2B4CH 3TBVB 1JRHH 4DCQA 3P11H 5AB9A 1ZLUK 3U4AA 3OPZL 5EOTA 3WG7B 3QDJD 5HJ3A 1KWKA 1AGFA 1T21A 2Z91B 4NCDA 1PEWA 3RWJA 1JCKA 2D9CA 2QADB 1FUNA 2G5BB 2LU3A 4OZHB 2DWEA 3SDCB 4AYDC 2Y06L 5D7JD 4Y2NA 1WFMA 5DMKB 5F1KC 4MA3B 1F00I 2X1PA 4EUPA 4P49A 5T3ZE 1UCBL 4JMXA 5AALA 2DQUL 5CF3A 3QS3A 4TUKH 1TOXA 3U82B 3IFPA 2JV6A 5E9DA 2A77H 4PR5B 3SOBH 2WBWB 4E0RA 3BQUC 2X5PA 2FT6A 1FJ1A 2YS4A 4ZS7L 5IFHH 3D0AA 3O4LE 4KHTH 1P53A 3BD4A 3JZYA 4EUPH 3TEZA 5BMFL 2OK0L 1KGJA 2RACA 2AEIT 5F1SA 4ZX5A 3QQ9C 4NDMB 2G3MA 1PZDA 2EDBA 4Z78A 3DX9A 2BSSA 5F7BA 3A4AA 1PCXA 1TKWA 2XX0A 4XO8A 3BYYA 3IU4L 4V1DB 3RDTA 1QSZA 1XGTB 1E2ZA 5CD3B 5E56A 2VDPH 1D2OA 3RZCA 3QC6X 3BQVA 4S1SL 1S5IH 3WIFB 2NY4D 2YAMA 4ODVH 5CBAB 1CPUA 3FMGL 3VX1A 4IIQC 3UL4A 4JZJC 2ZX8A 4XI5D 2EDTA 5LGHH 1I8UA 4FN0A 5E8PA 4PJ8C 3ZQ9A 4HIXL 4AMKL 1N12A 3N1PC 3AXLA 5DJAA 5EB9A 5E2VH 1BV8A 4R83A 4LSRH 4R4ND 3V5DB 3HJ0A 4R90H 5IBTH 4EN2A 3VFSA 3TZVD 1RERA 1LMIA 5DRXB 2OTWB 2QQLH 1XR9B 4KI5F 4G83A 3O2DA 2KERA 3KCPB 5CZKA 4HUMB 4PLNC 5HHQB 2FO1A 1E27A 1G6RL 5I16B 4XRCB 5FX3A 3U6RA 2CRMA 2N4IA 1VSCA 1P0SE 2A9BA 3IFLH 1JPST 3NCEB 3GZPA 3QI9D 4XMKH 1AXSA 1DLFL 1FQ9C 3LXUX 2X7LA 3O2DH 4OZ4B 3X1NA 3DK2A 4RFEB 4M6NL 4EMZA 5IMMB 1WDAA 3O3DB 5GRYA 1CFVL 2E4FA 1EX0A 4PIRF 3K6OA 4KJWC 1A3ZA 3S3CB 4N4YB 1KPVA 1G7LB 3NABH 3N85H 4N90D 4Z77A 5MEPA 2AEQL 4G5AA 4HGKC 3F05A 1NCNA 2OKMA 4C47A 4UNUA 1JNNH 4UYQA 3TVMC 4AWJC 2BHUA 3B9KA 4TVPE 3BGFC 1AYRA 5IK3B 4BFBD 1A6UH 4UIMB 5B21A 2EKSB 1M4KA 2L7QA 4IIZA 5DURB 1I8MA 5GRJL 2XA8L 3HRPA 2BSRB 1BFTA 1AD9B 3TIDB 5GHWH 5D6CB 4UV4H 4CW1B 1MFNA 2VO8A 4OI8A 5F89B 1PYWA 4HU8A 2X4UA 3RIFF 5IHUL 4WI8A 1T5XA 2XV0A 1KCSH 5I76B 4OLYH 4OCYL 4DVBA 2WZPD 3UFIA 2X4OA 3ALWA 1RZGB 3GRGA 1A0QH 3GZKA 1FNAA 4OZGA 5B1JC 1GGTA 2UY6A 5EZOL 4C4KT 4FDWA 4U6YA 1MG3C 4LLYB 2C4XA 3QRFM 2JIXB 1H3GA 3QUMA 4ABWA 4YXLL 4L9DA 4PJXF 3BJLA 1DJXA 1MJ7L 5CBEB 2ZCLL 4H8WL 3NIDE 4TQHA 3ZVVA 1N64L 1UKQA 3WY2A 1UYWH 1IAIL 2JK5B 3EJZC 4OCRL 4U1IB 1S3KL 3ECWA 4G8GE 3UXFA 4NUJB 3QUMH 3B2UD 1K6QH 3SQBA 2BVYA 4NN5C 4N1CA 1LD9A 2YD4A 3O8XA 1GSMA 2ZWKA 4W9GC 2G4EA 1DSFH 2OV0A 2Q3XA 4YGVA 1T04A 1WBZA 4AKQA 1T7VA 2W9DH 5G5DB 1XSIA 3RWCB 4X5XB 1RK1A 5GGQH 4P4RA 3LZPA 4O2CB 1SM3H 3VRJA 8FABA 3MRCA 2X4TA 4HZLA 2G2NA 4MJIE 4D9QE 1LM8V 2ZXBA 2F54A 1KJ2B 2AJSL 1VFAA 3NCXA 4BJLA 5KOMC 3H54A 1SBSH 3QIBB 1WWBX 3AGWA 3ZL4L 3CZNA 2JLLA 4B41A 4P2RB 4G9FA 1SY6L 4QRBA 3QHFL 3B8SA 5JDSB 3WFCL 1YDPA 3TWCH 3U1SL 3ECQA 4JVUA 5D1XE 4FQJH 1U3YA 3SO5A 3V10A 3ARDC 3MXWL 4MYPA 1FLRH 4J3VA 3V0WL 1L9SA 5DZNA 2YWYA 4K3JH 2P24A 4U4BA 3UAJC 1OB1A 4NQUA 1C08A 1I8LC 2VR7A 5FF6B 5HGAA 1WTGT 5T1KB 1BVNP 3WAKA 3FO9B 5ALBH 1RCYA 4YSQA 2AQ1A 3IRCA 5BZDA 1J18A 4J4PC 3X11A 3A4FA 2KZBA 2IO5A 4NHCH 1XEDA 1CF1A 3CFDA 2WNKA 2XWTA 4OY9A 1LO0H 3X14A 3M17A 1I8IA 3OX8B 4WGVB 1Z9PA 3GMLB 4ZODA 4X7TB 2AJ3B 4NWTL 4F1ZA 5MHSE 1AACA 4ONHB 3C5ZC 3MRKA 2WLJA 1NFIA 4NX0A 1A8ZA 1UUNA 1N6VA 1TQWA 1X5GA 4Q2ZB 2AANA 3MLVH 4GG8B 1GGCL 3DUSA 5D4IA 2CDFB 5JZ7C 5FC9A 4RRPG 1W0VA 4IJ3B 2EDMA 4NAMA 2H3NB 4XP4L 4HKZB 3OXRA 1QQDA 3FT3B 1A6PA 4ENEC 1LL1A 1HEZB 1OSPH 4UZUA 3MACH 2YGVA 3OJDB 1HNGA 1U2HA 3LQAH 4A38A 3NJJA 5IIEA 1MCOH 3H2PA 4M8VA 1EJOL 1J7VR 2G9KA 5F8QC 5C7XL 3EJCA 2WLYA 2CD0A 4L2LA 1V7NH 3DVFA 1CICA 2AV7B 3IVKB 2FBJL 4YAQB 3UJTH 1TQTA 1GH7A 2CKBA 4OCSH 4XBPB 2V9TA 3W39B 3DIVA 3I3BA 3SBQA 4BHUI 3RTQB 1NFAA 3FQ1A 3O4LD 4OKVB 4LSVL 4MNQA 5L6YL 1KXTB 1IX2A 4XXWC 1VEOA 4C55A 1EH9A 1NUDA 1E4XL 4IS6B 5TH2B 5FYJH 1CDJA 4Q9BA 2CKBH 3Q2WA 1TVHB 1J1XH 1QSEA 1UH4A 3KPTA 5DVOA 5F70A 3U30C 4DESA 4HCGA 2WBKA 3NACH 1MCRA 1IFRA 3TBSA 3TT1H 1ZA3B 4L48A 1J8KA 3F58L 3SE8H 4LF3B 1FHGA 3IRPX 4X7CC 4OGZA 3DMMC 1G84A 12E8H 5I1GH 4GO9A 3BDBA 4UF7C 4GT0A 4LIQH 5KSAA 3WNNA 2BW5A 3GBML 2V7NA 4J6IA 3APNA 2MPVA 3TO4A 4LEXH 1OCCB 3UH8A 2DICA 4P23C 5E8DH 1RULH 1DVZA 1HILB 2CLZA 4NUGL 4F8QA 3D9AH 1WEJL 3HHSA 4LCCA 4L4VD 3BWAA 4KJQC 3JTBA 4XNMB 2VDNH 3O6FD 4AUYA 4PJ9A 1LO3L 2D8KA 4FMFA 2AEPH 4OZFA 4B5EA 1RSFA 2C7UA 3JWNH 1U2CA 5INDB 1BCIA 3SJVA 3V5HB 2E6PA 1B0GB 4AJWA 1BMZA 2VOTA 4LLAA 1XCXA 4JFEE 1EANA 5KSUB 2RD0A 1MWAB 2Z92A 2QZ5A 3L1EA 5CGBA 4OZFH 3WKML 2GEEA 4IM8A 1LNUA 4Z7QE 3IU3A 2JKLA 2Y69B 3VXTB 2MHAA 5I8KL 1Z3GL 2A1WH 3VTAA 4LSTH 5D7SH 2WBJA 3LJ3A 2K8MA 4L8DA 3HUJF 4X6CB 4YBQD 3K5RA 1JAEA 2AJUL 2CIIA 3UTSE 3ARRA 3DGGB 5I17A 4G70B 4R26H 1VADB 1NM9A 2A6JB 2QMJA 2WWKT 4JANB 2O61B 3MU3A 1TVDA 1V7ML 5CHNB 4O58H 3SZ6A 3QIWA 5FHBL 1FYHB 2OBGA 2HZHA 4L3EB 5D2LA 2VDRB 1O7SA 4OUOA 1I7TB 2C3VB 2B9BA 5C0AA 4FGMA 4NXSA 4P59H 2NZ9C 5AVRB 4NZUH 3PQYE 5AW9B 4PS7A 3E38A 5IB3A 1M2VB 5AKTA 5C07E 2J44A 4TVPD 1QBLL 3RNQA 2VSDA 2EDDA 4LPCA 4ADJA 4IOFC 5MENE 4XP5L 1DQQA 5B7EA 3GK8H 1MF2H 2OX5A 3EYVA 3U1PA 4QRSA 4N8CL 1K2DB 4RWYL 4ODSL 3CVCA 3VYPA 1OSYA 2IAMC 5A2FA 3CK0H 4YSUA 2ZT9C 5MEQA 5A16A 1CI3M 5F7WC 3HNSL 4JREC 4P46C 1HH9A 8CGTA 4EIGB 4WW2A 3MLRL 4Z7NE 2ADJB 1H5BA 4JO4H 4ANKA 2D7OA 3CZLA 2E56A 4XNUH 5AOJA 3RWJB 1RJLA 1E4WL 3QEUA 5CSZB 1WZKA 2VISA 2DWEB 4JK0D 1YA5A 2L7EA 1GC1L 2EDHA 2Y5QA 1FL5A 4XP9L 3F7PC 4AYFA 5CWSA 4EUPB 1E28B 3RVXD 4HK0B 4KVNH 4YHYB 2EIZA 2BC4A 2Y07L 3IFPB 4KO7A 5E9DB 3ZO9A 5E99H 1R4XA 5HHVL 1FJ1B 3SGKC 4YHML 5FYKH 4QPEA 1O7VA 4D0DB 3WIAA 5TE6H 3VDAA 2PPDA 4L9LB 4AVKA 3CSYB 5FLVA 1CC3A 2H1PH 2BCMA 2YQBA 5DJ2A 2WK2A 2LTQB 2ROXA 3LD8C 2IGTA 4EAEA 4YOKA 2R69L 4D9QD 4MJID 4LSSL 1JTPA 4XPHL 1I1AB 5LWYL 2VDPB 3P3RA 4P2OC 3VMOA 2Y24A 5F88B 3B2DC 3O3UN 2OMXA 2HUHA 4GW4B 3PHQA 5I1CL 2A9NL 3VXOB 1E5BA 3RZCB 2A74C 1T7ZA 3RPIA 4ELME 5IG7A 1KOAA 3BWSA 3OKNA 3SGEI 5BJTB 2VDLH 4HUXA 5B38B 3WMPA 1Z0NA 3EOBA 5D1XD 3Q1SH 1KG0B 3JWDL 5JUEH 2X9WA 1TTAA 1ASOA 1JHTA 1RSYA 1ZHNB 3NSYA 4YWGH 4QRRB 5E8PB 5DT1H 1N59B 1TYJA 2PN5A 3QS2A 3OAZK 3AXLB 3BH9B 5FKPA 2AXHA 3NAAL 4GG6A 3TA3A 3T2PA 2EE9A 3E6FB 4G82A 1MQ8A 4ZFFA 3O2WL 1AR2A 1DQLL 4X0NA 1P1VA 3BAEL 3NSDA 5CEZL 4PTTA 1CLYH 4Y2DA 4F9LC 4YHKL 4WSJA 5HXMA 3G6DL 2KH2B 3L5WA 3WFBH 4F91B 3ABLB 4Z3TA 3TF7C 3L95A 5TGBA 5DHEA 1IQDA 4NBYB 4H0HB 5F8RC 4PTUA 4R7DB 4Y4HB 1YZZA 1NGPH 1F4XL 4MRBA 5A2JH 3ULVC 3A23A 4QYAA 1JERA 5AB1A 2X6BA 4LSQH 4X6BA 2Z8VC 3EZJB 1BIIB 1QACA 4E5XA 3LIZL 3MV8E 3VGAC 3RWFA 1DANT 2V9RA 3U36A 1PGRB 3I75B 1R5IA 4FQCL 5I0ZA 2HJLA 2B8OT 4H5SA 4WCYH 1R34A 2J8HA 4MA7L 4Z77B 1F4WH 4ZW5A 1ROWA 2YKLL 3BVNA 3CVIL 3DPDA 3FSVA 4KMTL 3DXAE 2VRAA 3OC8A 5C0BA 2Q8AL 5EORL 4YSEA 4U3SB 3VMPA 4Y4KD 1E43A 1VEPA 4LEOA 3B9KB 5IW1A 5JW4N 4N8VG 1IL1A 5CN2A 2DF3A 2F58H 4ODWB 1I8MB 3CN2A 4LHQB 3G7TA 3UBXA 6TAAA 3KXFD 3L1OH 5J13B 3KEHA 4HWZB 3SKOB 3RVUC 4ORGA 3TH4T 1HHJA 1CR9H 3CQFA 3UTTA 2HKHL 1SXSA 3ZHLA 2NCEA 1PYWB 4H0LC 4A7GF 2X4UB 1DVTA 1MRDH 4RMUA 4K07A 1QWUA 5I18H 4X4ZA 2OSLA 4K23H 4LL9A 4YXHL 1HIMH 1N2RA 3QBTB 3OMAB 4NWUH 4DEPB 3L3IA 1RLWA 4P0DA 3W0WD 2DQCL 4IRZA 2WPGA 2D3JA 5D6DA 3GO1L 1UC6A 4FNQA 2PTUA 5JNYA 1U41A 2YGQA 3LNDA 1VACB 4LGPB 1H8SA 1MHHA 3B43A 5CJOL 1UZGA 1AGCA 3O4OC 5TDOB 5DRZA 5D1QA 2Q8BL 1KCRL 1P4IL 1XXDC 3NCFB 4HSCX 4L1HA 5C3IA 1IGJA 2AEWA 4IRZH 2Z1PA 4R0LA 1TFHA 4GLRI 4DN3L 3NZ8A 4OZIA 4KFMA 3SDDD 1IM3B 4MSWB 2VLKE 3BVVA 1WBZB 2HX7A 4FHJA 3STZA 3TEXA 2B1AL 4GOSA 1JGVL 1F58H 1RK1B 4XNXH 2A0LC 3MZGB 4DZBB 1YJDL 5A3ID 3QPQD 3MRCB 4GKZA 2ZWYA 1H19A 3VI4F 1DE4A 2EDFA 4KFZC 5EG6C 3BHBA 1T6WA 3S96A 4J3OC 4R2GC 4PJEF 2GPZA 3L1GA 4LFHD 3V6OA 4G9FB 2B08A 5LBSL 4TSCL 1QLEH 1INEH 1YDPB 1IBDA 3GKZA 4I0PA 2HSIA 3QCUH 4GEJA 1B88A 4LE8A 3UTSD 5D4QA 1E8XA 1RXLA 2MTAA 2CR3A 3CSPA 1JMZA 2IDQA 5E6UB 5HVFB 2HWZH 3E9TA 1OB1B 1XH3A 4HQQH 3PNWB 3VD1A 3NUKA 5HGAB 3C5XA 4QLRA 2ZP8A 2NSXA 2WLLA 5AZEH 5KTEL 4N6RB 3V7MA 4XHJD 4ZTPH 5GS0C 5BZDB 2Z4QB 3X11B 2OXGA 1SFDA 3OMNB 4TVPL 1VF5C 1NGYA 3T0XA 5D7EA 5CJBA 1AGDB 3M17B 1I8IB 2W07A 5C07D 4MTMA 2GIMA 5E6YA 3W37A 1NCCL 3HAEG 1T5KA 3MRKB 1G7JB 2RB8A 4JY5L 3Q48A 3SE9L 5HYIA 5K69A 1CT8A 1GPOL 1J0JA 1KJMB 2R2BA 4J8QA 5B39A 3GSNL 1IEAA 2AV1A 2VLME 3FCSB 2E59A 2C3XA 2HT3D 2CM5A 2PTVA 4FNRA 4HD9A 5AKSA 1AYOA 1QFUL 2BZCA 3GYRA 3OXRB 3AQXA 4WEMB 2IH9A 1A6WL 4WEBL 1BXUA 3LVTA 3PJSA 4DP8X 5T1JA 4ZFOB 1L7TL 3I6LD 3NVQA 1BAFL 2GAZB 1YMHA 3MRLA 1KB5L 1XB3A 3QIUC 3MDJA 3KJ4B 2LGNA 2W9EL 1CICB 1LWJA 5C71A 5J7CC 1GMIA 1P69B 1VIWA 2F6AA 4LPYA 2CKBB 3H2QA 4DAGL 5ICYA 3WS6C 3FCBA 3IFOA 2P8PA 1EGJH 4X7SH 1E5UI 2X0WA 1SVBA 4MNQB 1F97A 5C6PB 4P9HC 2X4RA 1T2QL 1JE6A 1KYOK 4CMHB 2RIKA 5HHXL 4UM9A 3DK0A 2R1WA 2WTOA 3Q2NA 1DJHA 1YEGH 1QHOA 1AIFB 1P4BH 3EFDL 4A6YB 1TZHA 4ORZC 1DBKL 2FB4L 3QAZC 3CFEA 3QRGL 4J3BA 1OP5K 3P3TA 5ID0B 3MV7B 4GEIA 2ZP9A 5DI8A 3M86A 5KSAB 2HB0A 3OPUA 2C1OB 2BP0A 2E9BA 3WJJA 5CZRA 4XXDA 3VNZA 3E9UA 4DGIL 1UKSA 5ADPH 3MLTA 1LWRA 4PJIF 4MHHI 4AG4H 2VXQA 3C6LA 3HHSB 4LCCB 3ULUF 5I73B 2DH2A 1BX2A 1N0LB 4XWOD 1GHFH 2Z4TA 4OZFB 1KBBA 4FQLH 4NCC2 1I9JL 5E4OA 2APXA 3H3PL 1AZZC 1PY0A 2PP7A 3P2BA 4YHOH 3ATFA 2DBJA 2YHGA 3TL5A 2IPTH 2VXQH 3NCJH 3S37L 3ZYIA 1KGXA 3JV6A 4JRYE 4QRFA 4B3VA 4PJAA 1HSBB 3U1QA 1LNUB 3IU3B 3VVWA 3NEXA 4DK3A 3E8VA 4KO5A 3QWOB 3MBEC 4CVZB 4MJHA 2WBJB 5DQ9B 4L8DB 4K5MA 4JFZH 4JLRA 4LPVA 4C57C 1O6SA 2CIIB 5KYUA 3UYOD 5I17B 5K33A 1L7IH 2DYRB 3CXFA 4G6JH 2AK4D 5HYEA 2GT9B 2H2SD 4F2MB 5C0IA 4KGLA 4LQ1A 4YLBA 2YAQA 3FTGB 3C6EA 3SYCA 2Q6WA 4E41D 2APVA 3TCTA 3NJVA 4M61A 5D2LB 1CZ8L 4URTB 4XMPH 4Y1AE 4RZCA 1ZGLA 4WI4A 2JCCE 5C0AB 5LG6A 2YARA 3WEXA 4GYBA 3BKJL 4UQ3A 3OC5A 3WNOA 4BBWA 4DFIA 5IGXL 2GY7B 3DXAD 3A67H 3IJEB 3JYBA 4LASH 3N04A 4MAZA 4W9FC 3RIAK 5KZCD 2OS7A 2PPEA 3BH4A 3ARDA 3QXWA 5D72H 3AREB 3VWKC 5LDUA 2D3VA 2VL5A 4IKIA 4R96B 3UAJA 2VDOB 2OX5B 4FNUA 1HKLH 3EYVB 3UCRA 4QRSB 1NLDL 4Q58C 7TAAA 5AL0A 4TMPA 4MAYD 4JM2C 4JFOB 4Z7OF 2ITEA 3OLEA 5MEQB 3N41F 5E8OA 3ELQA 5CGMA 3EJRA 3DUUA 2XQYK 1CVSC 1ZPLA 1RJLB 2R4SL 3QGVA 5SWSB 2VISB 4FCHA 3S3SA 4EI6A 2K6WA 4PJDE 3UJIH 2WVSA 4HS8L 4UI2A 5LNDA 3HE6A 1C16B 3MJ8A 4UT6A 1FL5B 3WNIA 3HR6A 1YEHL 3FS9A 4YDMA 1LE9A 1AKJA 4M8QA 1EO7A 3AB0B 3VI3A 2EIZB 2IANB 5HDWA 2N0MA 4LAQH 4IKJA 4E9YA 1GJUA 4IGBA 1GCFA 1JNLL 3AU1B 3VD5A 1PG7W 1KBGL 2VLKD 3FQUA 4UT6H 1ZPUA 1L9PA 1WFUA 5FS5A 4E42A 4HH9A 2YUZA 3HAEH 4AXWA 3OVUB 1HAUA 3L5HA 4JHZA 2IWKA 5DJ2B 2QADD 2EEAA 3THMH 3JXAA 4JUSA 3SDCD 1BPVA 3PGFH 3PUCA 4WI7A 2OMZA 4LOVA 1UFUA 5SV3A 3NBNA 1JGLH 4NOFA 5L4IA 5CN1A 3L16A 2Z8RA 3LH8A 1TMQA 1Y18A 2WN2A 2VDLB 3FTYA 1LXMA 3OLDA 4OT1L 2I9TA 3PHQB 1ZDSA 4LPTA 1XGUA 3T4AB 2OMUA 4B0MM 2QZQA 2ZSVA 4ZQKB 3OKNB 1RPKA 4HUXB 4RFNC 3IPFA 2CE6A 3MLZL 4XXWA 3L4WA 1DQKA 4KNUA 5IVXE 1JHTB 3X3FH 1YEJL 4FZEH 1N5YH 1KV7A 3IEAA 4XN4A 1RVFH 1B6UA 5FKPB 4WU5A 1OGPA 2WYHA 3ARPA 2FEDC 3TA3B 4A2GA 4I18B 4Q0XL 2CRYA 3CHOA 4V1DD 5IW6A 3LSOA 3HZKA 2VDQH 2J25A 3BFOA 3EDEA 4KX7A 3RGVC 5D5MB 3BT2L 1UVQB 4EBQL 2OJEA 2PR4L 1U6AL 2FIRT 3L5WB 3HFFA 5DZLA 5B3NA 3L95B 2X0UA 1NL0H 3CUPB 3IXAA 3RFZA 4PTUB 2NXYB 3HRZC 1MNNA 1QRNE 4YZWA 4L37A 3CD4A 1E6JL 5D55A 5CINL 2GBVA 3V4VA 4ZMTA 4KK9C 2X6AA 3MA9H 1X5MA 4E5XB 4NZDA 2VLMD 1R5IB 5J57B 2HJLB 4H5SB 3V4VH 1D9KC 4HC1A 4HXBL 5IESH 2D31B 3BVNB 3ME0A 3BIAX 1S8DA 3R18A 4BEIA 3FFCB 4OV5A 1U4EA 2ZOTA 2E9GA 4NNYA 1NC2A 4ZFQA 4KVCL 4XB3A 1XCQA 4I9WE 5DC9B 4DPAX 4JHWL 4HC1H 3IMTA 2VR9A 3MLSH 3LN5A 3PWJA 2J4WL 5GJSH 3WFHB 4Y2OB 5FCUL 3BCFA 1OGAE 2NX5B 5ALCH 1HHJB 1JHKH 4ERSH 1IKNC 1NFDB 1SXZA 1ES0B 3QQDA 3H4FA 3B3BA 4G3YH 3FB6A 3C08L 2IADA 4PVBA 1N2RB 2I5YH 3GMOA 1U3JA 4KXDA 2VXUH 3L3IB 3VQMA 3I50L 4BH8B 3S2CA 3TBTA 4HF5H 4JW3A 5DURD 3GPEA 5EEVA 4LCYA 5JIDA 3TJEH 3RJDA 1MHHB 4BFNA 35C8H 5DRZB 1A3LL 3KPSA 1U21A 4TYUA 4BV1A 1BZ7A 3BKMH 4R0LB 5B4MC 4MCZA 4Y9CA 2UVEA 1T1XA 5IB2B 3NZ8B 4UTBL 5ACZA 4P9ML 3FAWA 2OZNA 2CRIA 4TUOB 1B4TA 1CFNA 1CBVL 1Z5HA 3WTXA 4M8UA 4U7SA 1XZ0A 2C9PA 3P9WB 5BW7A 5B1KA 1AXTH 1EJFA 4P4KC 5FFOA 2XWJA 2W38A 1AHWC 4GKZB 3DDFA 3WJLC 3NK3A 1W91A 5H35B 2CO7B 4PRIB 2UZYA 1K4DB 2WVVA 5F9JA 4X6FA 5CFHA 2PWEA 3FHQA 4JRYD 4ZI8A 3L4YA 2Y6SD 3UYRH 5ETUA 4JG1L 2IGFL 4Y1SA 2WNXA 2BSEA 2KZWA 3ZKXC 3IDJA 1IMHC 4I0PB 3PGDA 3VFGH 3K1DA 4AITA 2EKJA 1UD5A 3LB6D 4I1NB 4XMLH 2R0LL 1MCSA 5CU5A 3QIBD 1MRFH 4M7JH 3TH2T 4OV6F 1BLIA 3F3HA 4D3CL 5AW4B 1OEZW 1LP9A 4G1EB 1UADC 3QJOA 1PPIA 2R56H 4Y1AD 1YEEL 4X5LA 3WO4B 3RG1C 1RMFL 5F6HJ 3DPBA 2K7PA 4Y5YA 3VG9C 1N26A 2GG1A 3LQMA 1JPEA 3G6AB 4EI5A 4NKIH 2W95A 1THCA 3QORD 1CDIA 1OCZB 3HZMA 3H6JA 3PF2A 3RURA 1KBVA 3S97C 1WGOA 1SXAA 1N10A 3AXIA 4X5QA 2EQDA 4ZMNA 1DFBH 3D69B 3MJ9L 4G1MB 3NP4A 4YNYA 3GXFA 4J7RA 4P5SA 3BE1L 3FHEA 4PJBF 2R2BB 3EHBC 5B39B 1IC4L 2FD6H 4X6DA 3TBBA 4C56B 2Y7QB 5KOVC 3WNLA 3ZDXF 2G75B 4XVSH 5IBLD 3BPCB 4FTDA 2PO6A 4U1SA 5ESQA 1HQRA 1FNFA 1R3JB 4JPWH 3VYNA 3ATBA 3MYJA 1TT6A 3JVFC 4EZKA 1RUMH 1F02I 1SJXA 3S34L 5C0GA 5IFJA 3PJSB 1BSIA 2AJVH 1CLZL 1HHKA 2BVEA 2R27A 4FXLA 4PLKC 1PG7X 3IYLW 1OQOA 2D0FA 1G1OA 5E8EA 4DO4A 2CK0L 5SX4H 4JX0A 4OJAA 1B0RA 5D71H 2F8IA 1Z9SA 4LCIL 5ICYB 3PGCB 4JO5A 4AM0A 3VXQB 3INUL 1PY4A 1MIEL 3EW3B 3IFOB 4Y2LA 2P8PB 2VXVH 1Z66A 2JLPA 4IMKC 2ITCB 1I3VA 2L3BA 4FG6C 2C9RA 4FNLH 1CGTA 3TIEA 4ZFGL 2F53A 3VA6A 4B53A 3B5TA 2F7OA 4G42B 3EBAA 4FE9A 1J8RA 3RU8H 2R1WB 1HFUA 5JMOC 4KHXL 5IOKA 5FLUA 1QMUA 1QAWA 5J4MA 1MW3A 5HYSG 2FO4B 1TZHB 4DT2A 4KY2A 2LV4A 4KJPC 3CFEB 4N8VB 4JUTA 5H94A 3RTQD 5CO1A 2WUBH 5C0RH 1X9RA 4K3DH 5DI8B 5T33H 3KYNA 3KPOB 4OZGE 1BXAA 3ASWA 4HPOH 4XXDB 3QFDA 4GINA 32C2B 4LSPL 3TFKD 3LH2L 4LU5H 1JDDA 1T0MA 4JFYB 3RX8A 4WUKH 3RE0A 2CIKB 3SYQA 2CA4A 2MOVA 2XQBL 5FM5M 1L5GA 3VYOA 1BVLB 1ZE3H 3HCVB 3JV6B 1AQ8A 2FX7L 1OOAA 2FVNA 2YC1A 5DHXB 2BNRA 1INDH 1DVFB 2ADFL 1BOYA 2Y5EA 1MLBA 2E6JA 3V9FA 2G2PA 2GI0A 4UTAA 4FQHA 1QD0A 2BO0A 4M48H 4WTWA 5FA4B 3KLAA 2DQIL 4U0RC 4JLRB 4ABVA 3IE4A 1OAQL 1UOWA 4KKAC 3Q3GA 2F54E 5EV7A 4LVNC 3EH3B 4Z0BL 2CBPA 2GBUA 3UO1L 1AJ7H 1DZBA 3CQQA 2DQGH 4G6ML 3I9GH 4UTAH 5I71B 1NCAH 4P2YA 5PAZA 5I23A 3FQTB 1GMEA 5J3HC 2J43A 4YQXL 4M61B 2B77A 4RZCB 1RZ7H 1PD1A 3DVNA 4F8LA 1UB5A 2P48B 1FC1A 4G6AC 3RB5A 2PPFA 2F5AH 3O9WA 4I3GA 1L0YA 1AS7A 1UZ8A 4UQ3B 1SDAB 3H0TA 3QA3B 4A7UA 2D03L 5DEZA 1CL7I 1ZXKA 4H25A 3X3GL 1A3RH 3K91A 4UT9L 3FUHA 4Y4FA 3ZRFC 2AQQA 3KGTA 3M8OL 3IN0A 4I9WD 5DUMH 4CADB 2IQAA 4C83A 3BAJA 3HMWL 3DRTB 1OGAD 1FPTL 2VXTH 3DV4A 1A7PL 4DGWC 4JDZA 2YD3A 1ZIAA 5CGYC 3FQWA 2A83A 1ETB1 1FNGB 2HT4D 2DW5A 2MRYA 3D12B 2VW6A 4G8FA 5BZWA 1DQIA 1S9YA 5GJTH 1QI3A 1T5WA 2LLNA 3U83A 1Q9LB 1K5WA 1FBIH 1OF2B 4H8WC 3AY4A 3DUUB 3SPCA 1NKGA 2LHAA 4W70A 1A4JB 1DLHA 3T0VA 1BF8A 2Y9RT 1X44A 1UQSB 1JNHA 2BY2A 3HE6B 5FHAL 5LUMA 1GZHC 2JJVA 2R9HC 4FOMA 1MI5A 1LE9B 4QTHA 3F7VB 1P7QA 4TQEL 3IS1X 3HAEB 3VI3B 5TF1L 1A66A 3I6SA 4OQ1A 4XO9A 1HINH 5EZIH 5AWNL 4H88H 4WTQA 1D5BB 5DD5H 4JDTH 2CDGA 5ACLA 4PVNA 3NJHA 2YXVA 4HBCL 4E42B 1NPNA 4MKTA 4UBDD 1EHLH 1AO7A 3KLHD 1OPOA 4AXWB 3D85A 3ULVF 3UDWC 1T22B 3TYFA 2AK1L 1I1YB 3SDXF 2JWYA 2N7AA 1AG6A 2KS0A 3PHOB 3HNVH 4RAUB 1PJWA 1T89C 3GMRA 1EHKB 1Y18B 5FYJE 3QE5A 2VERN 4EE2A 3Q5OA 4KXCA 5E9DD 5BO1L 3IJYB 3QHZH 3PL6C 1GOFA 4R97B 4GBXB 3OMIB 3I6GA 4QAMB 2IWEA 4JPVL 2OMUB 4K5PA 4GSUA 3G5YA 3SDYL 2CR6A 1YQ2A 3T1FA 2EZ0C 1XGPA 1QSEE 1UJ3C 2GTZA 4PJ7F 4RAVA 3VH8A 5GGUA 4CSZA 5JHMA 3HPLA 4LIQE 4AYGA 4EOWH 3ARGC 4LLQA 1QUPA 5AVXB 1BG1A 2VDQB 2EEXA 3LNGA 3KPQA 1FFNB 4QOKA 2NY2B 2G2RA 2MKLC 1T7WA 1CE1L 5L2KA 4U31A 3RAJH 4UQBA 3RZCD 1XEUA 3HZKB 2A73B 1WAAA 5ID1B 1NLBL 4CC4C 2EIEA 5SWZB 1J1PH 1C5CH 1NCWH 3C2AL 2WXLA 2P9RA 1CGWA 1WVZA 3MRDA 4PJCB 2Q86B 3S3DB 1MJ8L 3FH5A 2YD2A 3KS0J 4X8CA 4YPGB 5JW3L 3IXAB 4KNTA 3RFZB 2KYIA 5EU4B 3SJVE 4U1LA 2BIIA 4L37B 3CLFL 4M9OA 5J89A 2ARWA 3KGSA 4FA8A 2XVGA 4QRTA 3VGEA 2ZD0A 5FR3A 3RQ3A 3ZLQC 5IV2B 1WA0X 3ETSA 3FK3A 1KIUA 5D7JC 1T0OA 2MSPA 4X7FC 5E8NB 1EZUA 4LLDA 1CO1A 2A4ZA 2DQDH 2WP3O 2LR4A 2QDWA 1A14L 3K0WA 1RZJL 5LGKA 1G87A 3KH4A 4X8JB 4XCYA 3ME0B 1KBPA 1S8DB 1S9WB 1OCRB 3L7EA 7FABL 4NNYB 5HHME 3U0WL 5M94B 3VG0H 5H4ZA 1TEYA 1V8HA 4J3OF 4JR9L 3VFUB 3N42F 1IGYA 2O93L 2AW2A 5DS8A 1NAMH 4EQ2A 4H1LG 1WFJA 1X6LA 1O5PA 2FECI 5G4NA 2RGSA 4A37A 2QMKA 5GGTL 2HLFD 3S5ZA 4EN3B 2DLFL 1IGTB 2XPGA 3O3AB 3GMOB 3GSXA 1K85A 5IB5B 4B0MB 3B9KD 4HKXA 4FG2A 3TBTB 4TQ8A 4ZPVA 5AW2B 3SE4A 1RAMA 2NDGA 4POZD 3SQOL 2V3FA 5DMIH 2NY4C 4AZ8A 3C2SA 1KTCA 1FG9C 3P0YH 3R4DA 4NC1C 2CUMA 4OBSA 2X3CA 4PJHB 4BRJA 4RGNB 2VWEE 4XI5C 1MCHA 4PHZA 1XT5A 1BZ7B 4ALAL 4MCZB 2ZXDA 4PJ5A 1TQBB 2PWGA 3L3JA 4R4NC 1F4YH 3M1OA 4JM2A 2RJMA 5KSBB 3TZVC 5SX5H 4QXGL 2P1YA 1LWHA 3FCUB 3KNBA 5FGCE 1BVKA 1NANI 3WIIL 1IM9A 1PZ3A 3CZFA 3T6ZA 2ICEC 5EU6A 2XG4A 2XWJB 4RISL 4HCRL 4QUOA 3SGDH 3QI9C 1RLBA 3OHXB 2XFGB 4X6FB 4CU6A 3VXMA 5AEAA 1IM3D 1CDUA 4PBDA 3SBWA 4IDJH 5JORB 1E5CA 1CFMA 2AJXL 4FXKC 1NCUA 4DZ8B 5C6TL 3IDJB 1NAKH 2CHZA 3X12A 4Q9CA 3HUJA 1EAQA 1ECZA 1W16A 5KVMC 1MWAL 3LEYL 2ZXCA 2AI0H 2F54D 2P80D 2B3RA 3HG3A 4PRDA 4JFQA 2J6EH 3DARA 3BKCH 3TP4A 1LEGA 1VZHA 1CD9B 3CBRA 4HIEA 4MJ6A 3WFDL 3WV0A 3MCG1 2MNWA 4G9FD 3EGXA 4PYGA 1C5DA 1UXWB 1NGXA 3MI6A 1NCHA 1QX1A 3GS4A 5CZVH 4IBWA 4NI3A 4M5YL 5FGBC 4MNGA 1PX3A 3O81A 3MRGA 3OJVC 2DDQH 4Y5YB 3FQNA 4N28A 1G7IA 1NSNH 1ORQA 4UB0L 2BVTA 1NOLA 1HX0A 4FFZA 4EI5B 4BFFA 4DP5X 1WUNT 2DIBA 4LBEA 1FZOA 2WLNA 5ES4B 2MEJB 4GG6E 4GAYA 3LTVA 4QGTA 5F7YC 1OZUA 3FU6A 3K2UH 2CK2A 3TO2B 4FFZH 3AM8A 4LPUA 3MLWH 5DDHB 1A21A 1YEDA 2W0LA 4X6DB 5CZXD 4HDIA 1I7UA 1NCBL 4G43A 3KPMB 4GXVL 4A7TA 2VH5H 3H2WA 5C09A 5ESQB 1CG9A 3HPJA 4J3WA 2F19L 2B4CL 3R8BB 3RGVA 4X6EA 3B2UC 3E2HB 3P11L 3M1BB 2DI7A 1OAZH 1M1XB 4KY1H 4N2OA 5C0GB 5IFJB 1CYXA 1KTDA 1GC1C 4YDNA 1YVLA 2OMYA 4XGZA 1MLCA 1X4XA 1BFOB 1MCPH 1O7DC 3TU6A 4U1KA 1OF0A 1YMME 2Z35B 3B34A 3VAEA 4HUUA 4AM0B 1NKRA 4IJTA 4TUKL 4UQDA 4WWOA 4IBVA 5E6IB 3SOBL 1OXYA 3VXSA 2A77L 4WFGE 3TIEB 2XIDA 43CAA 5C0BE 2FO8A 4KK8D 4ZW3A 4A2LA 3H9HB 3D4YA 1OQXA 5HDLA 4EO5A 2DM4A 3B2XA 5KJRH 1SPDA 1FV1B 2XZAH 3QG6A 1CTOA 4FLOA 3ZXAC 5J1SC 3US9A 4CDGC 1CICD 4Z7UA 3C9NA 3UTTE 1ZV2A 5FYJD 2E8ZA 4N0YL 5H94B 1CD1B 3C8KB 1GYUA 4ZX4A 2JQZA 4MNQD 1FGNL 4JPIA 3GIVB 1KXVA 3JWDC 2VDPL 3QFDB 1JI1A 1M7UA 1M9WA 1PD6A 2ZG3A 1S5IL 3QUGA 1G0XA 4ODVL 3EOYG 4ESKA 2UXTA 2X4PB 4DETA 1U92B 5D1QE 3MNZB 4NJ9H 4N2CA 3VJ6A 5LGHL 2E9WA 3K7UA 4LVOB 2XWCA 3JTSA 4FJZA 5I1HL 4ZAKB 4JFXB 1G9HA 2CSPA 5GGVY 4MXWH 5E2VL 1WHOA 1L5GB 1DQDH 3MV7D 4LSRL 1A65A 3BPOC 5KSAD 5K1VA 4R90L 4OZIE 3TO4D 2GABA 3CFIC 1IE4A 2XYCA 1OAKH 2BSTA 2QQLL 4BH7A 2D73A 2P8LA 3CBKB 3CH1B 5F9OH 1S9XA 3AAZA 3RPBA 3VXRB 1SOQA 1KJ3H 2H6UA 2C1PA 3KLAB 3MRNA 1EXHA 4PJ9D 4JVPA 3BW9A 3IFLL 2V5RA 4YXKH 4XMKL 1MVUB 1JL8A 3Q3GB 5K9KA 1FYTA 3O2DL 5INCB 3SJVD 3ZT6A 1U3HA 1XF2A 4N0CD 4RA3A 4P4KA 1S7TA 4MMZC 5ENWA 1BWWA 3KPNA 1XGQA 3Q44A 5GRUL 3L2MA 4JFVA 3GC3A 3D18A 4PWGA 4O02A 4PGBA 5EZPA 3DA0A 2WXFA 3NABL 5DD1H 3WOVA 2WBJD 2XN9A 5JLZB 4KNQA 4BUGA 4O2FA 1KCVL 4LMQE 3O6MH 3N1GC 4NQDB 2EXTA 3KGRA 4O02H 3A24A 1JNNL 2VR8A 4JNXA 3SSGA 3HB3D 1A6UL 3FN0H 5E1AB 4A2FA 2IQAB 4C83B 3QIWD 1MCJA 1MHCA 3ARBB 4ZSOE 4YDKH 5GHWL 2H32B 5EPMB 4G8FB 1QPKA 4UV4L 1Z9OA 5BZWB 1FL6A 5C0AD 1TPXB 1S9YB 1KCSL 1T5WB 2BP8A 1EHNA 1T6VN 4OLYL 4P5KA 5DYFA 4HIPA 4WSKA 5DGQA 1D7CA 5FOBA 1KYDA 1MFAH 3WLBB 5IZ7A 4DKTA 1A0QL 4XNZB 2XZZA 3LRKA 2XWDA 2PP8A 4FI8A 2H0EA 1HSAA 2BHZA 2W0FA 3BZ5A 2HFEA 5F1NB 1BLNB 3L3HA 4PJXB 1JNHB 3WD5H 3NH7H 4BFRA 2FWOA 3QXVA 2BP5M 1R1CA 1U8JA 5D8JH 4ZMVA 1UYWL 4QTHB 2KZ1B 1P7QB 1UACH 3PV6A 3O6FC 4NP9A 4TQIA 2X3BA 3WTYA 2ZXAA 1MIML 3QUML 1K6QL 4ZMWA 3DHPA 1WS8A 2CDGB 4M43H 5I1AB 1YJDC 1DSFL 4JJOA 2GQHA 4FZ8H 1AO7B 4WQOA 2W9DL 4I3RH 3D85B 2BW4A 2X6CA 3PWLA 1GZQA 5C0FB 4AEEA 5GGQL 2OZ4A 4XN2A 2M83A 4W9CC 3A4DA 1KY7A 2K9FB 1SM3L 2E9IA 3MLXH 4TLUA 5AAMA 3GUTA 3SKJH 2P5PA 1KC5L 2EO1A 2XCMC 2XIIA 2X9XA 4YBQC 4ZO8A 2GEQA 1XSKA 4M7ZB 4F5CA 4AGPA 2OZ4H 2C4FU 1KLFA 5KYXB 2FJFB 5LLIC 1OO2A 4N8PA 4D7PA 3IGLA 3C5SB 4BA0A 5ISZE 3UYPB 3CC5B 4RAVB 2O6DA 3VH8B 5GGUB 5JPMC 2EC8A 3F65A 1OLZA 3D4ZA 4ODHH 1NWOA 2VLRA 5GGVH 2PNDA 1FLRL 2FJHA 4R7XA 2VW4A 2VE6B 3DJZA 4K3JL 4AC4A 1BWMA 1BVZA 3WDHA 2X9YA 3OB8A 1S7SA 3IDMA 4EZLA 4MHHG 2G2RB 5DA0B 5ALBL 1NICA 5HDRA 4G59C 2BHYA 2P4AB 4FXGA 3PUUA 3QYMA 4NRXB 5DUPH 3CJJA 4NQCE 4WENB 1IEBB 1JZDC 2CA3A 3HKFA 3MRDB 2ZXQA 4NHCL 4DEUA 5F6IB 1OTTD 2R0WH 4NQSA 4U0QB 1LO0L 3CN0A 4ZUWA 1VA9A 9CGTA 2OMWB 2WQXA 1BJMA 4U1LB 1DFXA 1R5WB 3TA3D 3FF8A 2DIAA 1QEWA 3VD4A 1JK8A 3QUKA 3OAYK 4BWTA 4PJAE 4JS7A 4NZTH 4GFTB 3NPSB 2AXWA 1QBAA 1DVXA 3MLVL 1S7XA 1WICA 4Y2DD 5IM7B 2V33A 2J56A 4LLDB 1S46A 2WKOF 2PMZA 4M29A 1ZLUH 3RVXC 4ZMAT 3CVHH 1BBDH 5K93A 1A02N 1DUYA 1NAMB 3L7EB 1JGIA 2NXYD 2Y7LA 1D5MA 1OE3A 1XD1A 1OSPL 1TZ8A 1OCWH 3MACL 4JQIA 1GKEA 3LQAL 3R1GH 1BXXA 1MCOL 5DQDH 2JKSA 3C09C 2WLMA 1BZ9A 4UU9A 3BN3B 3T0BA 1V7NL 3UJTL 4JQIH 5AG9A 4A2HA 3KL5A 1J0IA 4OCSL 1IO4C 5KS9F 4UOJA 2J21A 2WJ7A 4WFGD 5C0BD 5I6XB 4QJ4B 5E2JA 1WITA 2QFPA 5HDBE 2MQ0A 5FYJL 2ZYRA 2BNUA 1J8HB 2CKBL 1C9SA 4N87A 4TNEA 4M6OL 1J1XL 4NGHH 5AOMA 2Q2LA 3WTUA 2NX5D 1NEZG 3MPCA 1FHNA 3NIGE 1H8LA 3NACL 1W8OA 3K8KA 5D1XC 3T8MA 3TT1L 3GGWA 2H9GB 1BW8A 3SE8L 3QDMB 2IH1A 12E8L 5I1GL 1U95B 5LJYH 4OFQA 1CFTA 1UM4H 3NZUA 3L3JB 4LIQL 3N6YA 2QHLA 4HUKB 3PXJA 3MJ7A 3B7TA 1EO5A 4MDJA 3KW8A 5E8DL 1A1MB 1RULL 4PJIA 5I9QC 2GJJA 5EC1A 2XETA 3LN4A 3KLLA 5EU6B 3RNKA 4IMLB 2UWEF 2ICWJ 1XL4A 4NAQA 5D1QD 4UT7H 2VDNL 3AMLA 2K6ZA 1I7RA 1ZSDA 2Y0SA 1XGZA 1TVBA 2AEPL 4QRPA 5A43C 2NUTA 1ACYH 1EPFA 4J6RL 3DO4A 4I7ZC 5F71A 2X10A 5I30H 3ULUH 4NUPA 3TM6A 5F3BA 1FORL 4BRVA 1PDKA 3IM1A 4K94H 5E1HB 3T3ME 4PB0H 2XU9A 2G0KA 5K9QG 4X98A 2FBOJ 3AVEA 4ZTOH 1KIQB 5F0PB 3B6SB 4G72B 1AE6H 3HOGA 4LSTL 5D7SL 4JL1A 2Q1EA 3HUJB 1N18A 3QQ4A 3F00A 1UXMA 1OHZA 1U9KA 2CO2A 3K6NA 4R26L 1NBYB 3SQRA 2ZPKH 4NFBA 4PRDB 3C87A 4Y4KC 1N5AA 3HFMH 4HIEB 3FDWA 1ETZB 2GB2A 4ES9A 2XXMB 3EGXB 3MRPA 1C5DB 1H8NA 1DBMH 5AVQB 1HC1A 4KX8A 1IKOP 2NOYA 3EZ8A 4I0PD 4IRJA 1BD2A 2EDXA 1O6VA 2FQEA 5LAPA 1X5LA 4D8PA 2WVTA 1CIDA 3FQNB 3C60A 4P59L 1PZSA 3D2UA 5GGRB 5SV4A 4LBEB 2BINA 2W5PA 1UWGH 1P6FA 3RY6C 3TFBA 2WGNB 5BV7H 4G2AA 4GXFA 5AW1B 4H26B 1IC0A 2Q2EB 5I74C 5B3JF 4QCIB 3B5HA 4YHPB 1FIGH 2MCMA 3IMWA 3IJHA 1NCIA 1ITBB 4N2FA 3GK8L 1MF2L 1YEDB 3ZDYF 5AQ0A 1I7UB 4PJBE 4Q14A 3O11A 3BP7A 5C09B 5DK0A 3CK0L 1Z9NA 2YQGA 5K1NA 4X6EB 4CKQA 1RIUH 1SFHA 2OI9B 1ZVHA 4GRMB 4JO4L 1QNZH 1IAII 1KTDB 2YZ8A 4XNUL 3SDDC 5ERWB 3V0DA 3DOIA 2OMYB 4UAOC 4XGZB 1MLCB 3BMVA 4RIRA 3QO0A 4AYEC 2ZE0A 3D08A 4JG9A 4P2QA 5HHOB 3KBPA 3WENA 1E4HA 2ZOOA 4C56D 1JZHA 1HESA 3FB5A 5A3IC 3FU5A 3QPQC 5D9SB 5AUMA 3J07A 4HUUB 1DZ0A 2X70A 3MREB 4KVNL 4FD0A 3B37A 1M05B 4NZFA 5IHZA 3VXSB 1EWHA 2JJWA 5E99L 43CAB 4K2UH 2FHBA 3X1FA 5F1OB 1XL6A 5BZXA 3E6HA 5E94B 1HJCA 2H1PL 3OR7B 3UC0H 1HZLA 4NO2A 4KKQA 4PWEA 4X4XA 4MBOA 4W9EC 3G6JA 3MUUA 3QEQA 2XLLA 3GBNH 2EEFA 3GS7A 4PD4J 3U2SB 3W11D 5HGHB 4FTVA 2JI2A 4JPIB 2AXJA 3POHA 2OA9A 4RESB 4QMEA 1T7XA 2OTPA 5CSGA 2XSKA 3RL1B 3AWFA 4F7CB 5IFAH 2V17L 1XIWB 1YPZF 2YMXH 3HZ3A 4XHJC 1Z6JT 5TJWK 4BKTC 2ZUUA 3AACA 3PAYA 2PTTB 3H7LA 2NXZB 3ZKMD 5JUEL 4YWGL 3TV3H 1V3LA 4J2XA 1V05A 3KPSE 5DT1L 2HVJA 4JM4H 3JWOC 3JTSB 2CO6A 5GSRB 2DWSA 5EOCH 5I6OA 4AE0A 3DV6A 3KPPA 1T1YA 1C5BH 1I8AA 4R5XA 5IQOA 5L0QB 3H7BB 3NDYE 4BQCA 4AQ1A 3OKEA 2P8LB 2QPSA 3ECVA 4CVWA 3C6LD 3OB0K 3UP1A 3AAZB 4JFHD 4Z7VF 1FAIH 3VSUA 4JQXC 1SMDA 2E74C 3UBFA 4MJ5A 1HOEA 1TQCC 3T8XA 2HT3C 2Q7YB 3BW9B 5K9KB 1FYTB 3NTCH 4UMSA 2ICEA 4LEEA 1NGPL 1MDTA 4WU7B 4WWKB 3BZEA 3T5WA 2ZG1A 3P2TA 1VCBC 5ENWB 4LSQL 5IJVB 3KPNB 1Q1JH 2GJ6B 1B9ZA 3GJEA 3CCHA 4P3DA 4G8IB 1KTBA 4O02B 1ZLWH 4HX1A 2IMNA 2EYSB 3BAWA 2PLTA 4L8SB 3QO1A 3FTSA 1Z9MA 3GXTA 1BAGA 4Q6KA 3P4NA 5D7IF 4PSRA 1F4WL 1RKRA 1TZOA 4KVPA 4TN9A 1U2YA 4FLQA 2VRKA 5CSBA 1RK0B 1MCQA 4HHAA 4TLTA 4KRPD 1IGCH 5HYJB 2F58L 1LP9E 5ECGA 4HFUL 3L1OL 1T83C 1MHCB 4IU3A 1Q0YH 2W65A 3IF1B 1CR9L 4P3CH 1E4XI 4NAJA 3PIQB 1MRDL 3TYGH 1P4UA 5I18L 1JHLH 3GMPA 4K23L 3GRWA 2DMCA 3OKOA 1HIML 4UCFA 1F13A 4NWUL 1A4KB 2Y23A 3LS5H 3V95A 3KS0H 4PBXA 1HSAB 3HE7B 1Z32X 5BRZE 2HFEB 3ATDA 2ADIA 3GRWH 2R39A 5BS0A 2FWOB 1U8JB 1JZGA 5ANMA 1A1NA 3WKPA 4PV8A 3B3IB 3PV6B 5KVGH 4XWOC 1R47A 3DURA 4IRZL 2A6DA 3UAEA 4QHNA 5TK4A 1F5WA 4G9DA 3TCLA 1MRCH 2FAUA 2GITA 3WUWG 1YNTA 3IMUA 1NOAA 4BFIA 1JZ8A 3MRHB 1Y6NR 3T1WA 4X99A 4JJ5B 1F58L 2HFFA 4ICXA 3FUFA 4APXB 2EIBA 3EAKA 3L17A 3HE6D 5C86A 3ZE1B 5MI0B 3VI4B 2ILLA 4AIEA 3GUTB 1AKJD 1SYSB 3HI6H 1JTOA 1U33A 1Q72H 3BP5B 1ONQB 4FFYA 2WD0A 4X9FA 5F0JB 3SO3B 3TBYB 5C0CA 5IVOA 4IGBD 3S8FB 4PJEB 4P5RA 4YFLI 1E2VA 1J11A 2H2SC 4H2AA 4FFWD 3BXNA 4L3CB 2F53E 1Q9WA 5I2IA 2X38A 2ENJA 2XJKA 1KLUB 2ED6A 4FKHA 1IBYA 3QVAA 4FFYH 1QLEL 1INEL 3B56A 3ZTCC 2D3LA 4RFOH 4ISVB 3O2VH 2VLRB 3F01A 3QC5X 4QRQA 2FJHB 4PRNA 4NT6A 2GJPA 4MA1C 2WOYA 4N2EA 1S7SB 4ZS6D 2HWZL 3L3OB 4HQQL 3MRIB 5KBLA 3RJOA 5AZEL 3PYCA 2ZG2A 4HUVA 3A5VA 3GB7A 4ZTPL 2WO3B 3T2NH 5FPIA 4NRYB 5MP6H 1O9WA 2VSKB 2HKFH 1PKQA 4WV1B 4YUEH 1NH6A 4WJKB 6PCYA 1QOKA 3LZNA 5IJKA 4MAYC 1A6VH 4NQSB 4U6XA 3NYKA 3CV5A 1TTUA 1VFBA 4K71B 1U93A 4Y9BA 5I19H 3UTQA 4BCZA 2OSYA 3F12A 3F8UB 5E1QA 2NY2D 4HK3N 1JPGA 3EYFA 1JK8B 3RWGA 3QUKB 5D7LB 2B0SH 4Z7WF 4GIAA 4FQIH 3CVHB 4ZW8A 1FSKC 4LRIC 2BNRE 5D2NC 2PABA 5IHHA 2HLAA 3DVGB 1NGZA 4NQXB 2CUIA 3NN8A 1RV6X 1XCWA 2ZOWA 4HKBB 1ZJAA 5IWLC 1EFXA 4XAKE 5CJ5A 1MHPH 1AQKH 3D4GA 5E2UH 1NJ9B 5JHDE 3LYRA 3MRJA 3LXBA 3FQXB 3MLUH 1W2KT 4YSAA 2WMPA 1IIKA 3VQLA 4PB9H 3MA7A 3B1TA 3GEFA 3VXUB 1F3DJ 1BZ9B 5IQ9B 4OCNC 2IBBA 2QADC 4YFLF 3SDCC 4MMZA 1MFMA 3PRZA 3BUYA 3RVTD 3CFNA 1G7PB 1A7NH 5IREA 3LXAA 3ZKQD 3QJVB 4X7SL 4S11A 5KANI 2ALWA 2P28B 3B1UA 4YFEA 1NC2D 2XBZA 2ZF9A 1YQVH 1FZJB 3ZE0F 1S7RB 4I13B 3PP4H 4JM0A 5BXFB 1VENA 4XZ4A 4AEHH 2CLRB 2ENYA 3K74B 1PLAA 1QI4A 2AGJH 4HISA 1PU0A 1YEGL 4WLCA 3MXVH 3EBHA 2FL5A 1P4BL 3GGWB 4EN3D 3PV7A 1T0PB 3MNWA 4ZUUB 2ZWLT 4PI0A 3GJFK 2Y36H 2H26A 3QJFB 1EDQA 4MDJB 2BSBA 3L5XL 5EF0A 4PJIB 5ADPL 2HG5B 3MRMA 5EC1B 5FUZH 4AG4L 3LN4B 3LZQA 2CMRH 4L8BA 5I0WA 4F7MA 1R3LA 1MI5E 1GHFL 2GTQA 3KPSD 4RGND 3U0PB 3JT2A 4JY4B 43C9A 4KXZI 4YHOL 2NUTB 1XMWA 2IPTL 2VXQL 3NCJL 4UINH 2WWOA 3IXTB 4L4VA 4W9IC 5F3BB 5EPMA 1ZHBA 3DUHA 3LKPA 4X98B 4FQQB 1V10A 4J3OG 2QSCH 3SKNA 3U9UA 4LDLB 4L1TA 1PLCA 4DTGH 1ODAA 2YXWA 4CU7A 1FAKT 4NQVA 3T3PF 1I82A 4PWIA 5J11C 1QFWL 3K81A 1KFAH 3G5VA 4WWNA 4HKJA 4ZXBA 1VKXB 2J71A 2IXQB 5KVDH 5T5FA 1L9OA 2QPEB 5A7EA 1A9BA 4IBTA 4C59B 3VFNA 2BSED 1CXHA 2P42B 3L81A 4XMPL 2QPUA 3QFJA 5TE7H 5BV7B 3FAXA 3FFDA 5AVYB 1BD2B 1MCWW 5BOPA 4U1JA 2QGEA 2WANA 4D8PB 1F0LA 2ZCKH 4AQAA 2ZX7A 5T5FH 1MFEH 1CGYA 1E50A 3D2UB 2XYBA 3A67L 4GT7A 5JR1H 4LASL 3ZDZF 4MCYB 2APWA 2AXFB 4QOKE 5EUOF 5F7EH 5HYQB 4K15A 5D72L 1RFDH 2XZQH 2VLJB 5L2KE 2HA1A 4S0TD 2CM6A 3IJHB 5DD3H 2Z9TA 4HEPG 1WAAE 1XWVA 1HKLL 4N2NA 1QG3A 5FDYA 3RUGF 4ONFH 3LMJH 1NDMA 3O11B 4FEIA 3MRBA 4PG2C 4Z7OB 1JOIA 1S9VA 5DK0B 4IIQB 1E8WA 4EI5D 2CNYA 2J12B 3N41B 4JZJB 2WZ0A 3OKKA 3J2PA 2BS9A 3ABMB 1I1CA 3FB7A 4ZUSB 3DVIA 3RTLA 3UZQA 1JN6A 4RQQB 2IGLA 4PJ8B 1X9LA 1I3UA 5I26A 2ROYA 3OWEA 3VACA 5K9JH 1RPUA 4RIRB 3V4UH 1BYPA 4M3HA 3ASNB 3NZHH 4P2QB 4F2EA 4J12A 2Z31A 2PW2B 4PN6A 4XAWL 3FB5B 5ABAA 4MXQD 2WLIA 3H3BC 3OQRA 1UATA 5AUMB 2PO6D 3P9LB 4U1HA 2A4CA 3CIAA 3HVDA 3VE0A 2EDJA 2P5EE 1P2CA 2XN0A 1DVSA 4KAQH 4UT6L 1P4LB 4FEMA 2AQ3A 2ZUYA 5K59E 2Y6SC 5DJZA 3THML 4QGYA 3ZRCC 1FFRA 1P7KA 3PGFL 4NO2B 5E6RB 3D3VA 3G5WA 5FYJU 5GGSY 1F1GA 4DKFL 3FF7A 1J12A 1JGLL 3G6JB 5ICZA 3LB6C 4DUXA 3FT1A 3QEQB 3JUYA 3ULVH 1QYGH 2YPKA 3D6GA 2OXHB 4Y5VA 1KT2A 3QIBC 4NQEB 2X40A 4FTVB 2F53D 3HIZA 2DMHA 1FFOB 4J3XA 3ROOB 2C3HA 4LL1A 4X7EC 4PJ7A 3CDGA 2DWYA 1I9RH 4OVUA 1THAA 1S7VB 2XQYG 1XF3A 1OM9A 2K7QA 4ODTH 3IKCB 3X3FL 4QJ3B 2R8SH 4BK5A 4Z7AA 4FZEL 2HVJB 4L5FH 1N5YL 2FYYA 4PJ5E 3QORC 4RDBA 5ICXA 1ID5I 1T1YB 3D07A 1LDPH 4J1UA 3WTVA 1OAXH 4G6KL 4I9XA 1NEZB 3ILPA 4ADGA 1KN4H 2QDVA 4OJCA 5T3XE 3OKEB 1HI6A 1IBBA 4BQ8A 1LO4H 3D2TA 2FLRT 3V4LA 2ICCA 3QSKB 3BP4B 4PHXA 4MJ5B 4RMQA 2FATH 3NFPB 2NYZA 3T8XB 5IBLC 4FQXA 1NL0L 2V5TA 2EH7H 2V5SA 4HULB 3JV4B 4IBYA 4XE5B 1U8OB 5JIQA 3VXME 1DJZA 3DIFA 4NN5B 4EEEA 3G5ZB 5DQJA 3E3QE 4W93A 2J72A 1LGVA 2YGNA 3MA9L 1RZJC 4CRPA 2BNRD 3GMMA 4I89A 3BKYH 4KI5D 2FH8A 5IUSA 2NSQA 2DEWX 2Z65C 3V4VL 3VFOA 5CLWA 3P4NB 3N91A 2J3SA 4IJ3C 4XAKD 3RL2A 4OH2A 5IESL 4HEMA 5DJ6B 2C26A 3QNZA 4HHAB 4PGZA 1H3PL 5DA4A 3I02B 1F3RB 2AF2A 4H8HA 3OZKA 1KELH 4WHDA 1DQJA 1ILSA 1PAZA 3GIZL 3MLSL 4HC1L 1KEMH 4HIHB 5GJSL 2JKNA 4IU3B 4JHAL 4I1RA 5ALCL 2W65B 4Y4KA 1JHKL 4ERSL 3O9WD 4MNGE 5EOQH 1RQ5A 5DS1A 1E65A 3KMDA 4G3YL 3GMPB 5LGJB 3NFSH 5JOFA 2I5YL 3RTQC 5FUCE 1PNCA 4WDIA 2VXUL 4EDXB 5ITFA 4Y4FD 4PVMA 1U8KB 3VFMB 4K7PX 4HF5L 1SLWA 5IQMA 5IF0B 1X7QA 4ALAC 1KENH 3WFZA 3MCLL 5CEXA 3TJEL 2ADIB 3IFNH 2EIJB 1YSOA 3JT0A 5EFIA 3TFKC 1YNKH 35C8L 3JVGA 2YPLA 3NJKA 4Z0XB 4AIZA 2YBRA 4RZKA 5GGSA 2OYLA 1A1NB 1OP5H 4JVWA 1WZAA 2P5WA 3BKML 3JV5A 1MCNA 4QHNB 4NBZB 2QLVB 1GGUA 5HD8D 4OGAD 3BSGA 2R2HA 4BFKA 4MBRA 5K5YA 3OZLA 2CUAA 4BFIB 4X99B 4PY8I 2J2ZA 3QW9A 1WFTA 3UPRB 1MOEA 1AXTL 1MI5D 5C0JA 3K71A 1P7QD 1TJHH 3VGDA 3K2MC 3NIDF 3H85A 4GY4A 4AV4A 3VWJA 5H2BA 2ZJSH 4BD4A 2JSFA 3OSVA 3V79C 4QXUH 3B2VH 4U2ZA 1LK3H 1Q9WB 4M4PA 5I2IB 3VB8A 3TGXA 1AO7D 1DO5A 3A6BH 3UYRL 1R33A 3D85D 1VFOA 2XTJE 3SCMB 2JNZA 3SE3A 5EN2B 2CH8A 3VFGL 2G3NA 2HMID 4Z7UE 4NLAA 2FT8A 4BKSC 1T20B 1TR7A 4L8CA 2LLGA 4FG4A 1MRFL 4M7JL 4XBGA 4GQPH 1I75A 4YX2L 1SZNA 4AT6A 1M7IA 4RDQF 3V2AR 2DI9A 3BPLB 4HUVB 2R56L 2DJUA 4HU2A 1N0XH 3LHPH 5IJCC 5IOPA 2ICWA 5IHWA 4XVJH 1DCEA 4Z8FH 3ARYA 5B22A 1TZAA 1E7UA 2HT4C 5DMGD 2JQMA 2AC0A 4NKIL 1B4JH 1VFBB 1GL4B 4QOKD 4KRNA 5GS2H 1DFBL 2AQNA 2Y22A 3F12B 3RX7A 3DMMB 3TF4A 3EYFB 3RWGB 5L2KD 1H3VA 1K8IA 5AW3B 1J05B 4XO5A 2B4CC 2FD6L 2A5UA 5IVZB 1UA3A 3NSFA 3BEWA 1BXVA 3ZDXB 4Q56A 4BKLB 1QR4A 4MB4A 1U58B 3IDIA 4XVSL 3WY3A 4PRHB 3HEIB 2BVPB 3L1FA 1F18A 1W72B 4GRLA 4I3SH 4JPWL 4QF1A 3LEXB 1NWPA 1KTJA 1RUML 2J1ZA 2DQMA 4FNSA 2XTSA 4LLMA 2BIMA 3MRJB 4O5LH 1A4AA 4X83A 4YN3A 3MNVB 3QWRA 4Y19A 3ZYJA 4UBDC 3UZVA 2ATAA 2HRPH 3UIYA 3KLHC 1BFVH 3DX6B 3MRFA 4PRPE 4ZK8A 3APDA 3FRPG 2GK0A 3J27A 4G11A 5FM4A 5FKAA 5AB0A 1MY7A 1NM4A 1OY3B 3T4YA 1EDYA 5D71L 1UOVA 2XN9E 1WUZA 2ATPA 3EJYD 5BVJA 1HTYA 5K1JA 3TX4A 1AXIB 4GKSA 2VXVL 4HSAC 5EO1B 4HVBA 4WNQA 2YD6A 4RVBA 2NY6B 4FNLL 3ASOB 4WK4B 3LPFA 4B60A 1MSPA 2WM0A 4BCXA 3LRSA 2F7RA 4ZX6A 3N1FC 4TNGA 3RU8L 5EMYA 3LZLA 2LTQC 4A04A 4AGNA 4DKAA 4LESA 2L7JA 2FL5B 1MXGA 1UHVA 4JO2H 1FG2B 5HYFA 1JGUH 4J8RA 3N44F 5F3HA 4Q7DA 4Z3JA 3SGJA 4DJMA 5C0RL 5T33L 1M7DB 3L3GB 2G9HA 3LNFA 4K3DL 3H1ZA 4JKNA 4WUUB 2H26B 2CU9A 2VTFA 4NRZB 4XMUA 1QTPA 4Q9RH 3RZCC 5DJ8B 3MRMB 2KT6A 2IAAC 2QSVA 1P5UA 1NGWB 1WD9A 2E4TA 1XVSA 4LU5L 4WGKA 4DUVA 5KBPA 4PY7A 1MKFA 4U6HB 5GIRB 4OSUL 1R3LB 4WUKL 4S1RH 4F7MB 5JW4Q 4KPHH 1PX8A 3A22A 4HWNA 2ZWSA 3T8VA 4F20A 1TG8A 4L4TA 4XCCL 4W9KC 4A63A 2YGPA 3FJTA 4JREB 4KUCD 4B9FA 4CNIB 1N70A 5CAYB 2GJRA 3AQYA 3AWGA 1INDL 2OR9H 2EDYA 2CO1A 5AOKA 1IM9D 4IBZA 2EXWD 3MV01 3U9UB 3NA9L 4IOIA 1MQKH 4A68A 5EU6D 1XSOA 5E08H 3PP3H 4M48L 1K72A 2PCPB 4BDVB 5EO0A 4NQVB 2B5IC 3KYKH 2O30A 3GMQA 3IJ8A 1AJ7L 2V2XA 3WUWB 2A9DA 3EGDA 4F5CE 2DQGL 4ZXBB 3I9GL 3P77A 4XPTL 3VXMD 1NCAL 1E5ZA 3CHQA 4G6FB 3WELA 4UTAL 2NTSP 4OAWB 2A38A 1A9BB 4IKKA 1AQMA 1EO8L 2AK4A 3KJ6L 1RZ7L 4W9ZA 1E30A 1A6ZA 3EFOA 4GRWE 3FB8B 1YLBB 2F5AL 5ESAA 3LIUA 3LD8B 1FL3A 2HLFC 4NO3A 3F83A 1E9PA 3P30H 4OFKA 4RWHA 1K4CB 1TU2A 4FL4B 2IF7A 5DVLA 3UIZA 4A55A 4R4BA 1UWXH 4ZMXA 1UWEH 4P2OB 1A3RL 2C34A 1BQRA 1QSFA 2ZWNA 3B9KC 1T0NB 2OMVB 4P57A 4PW3A 1NBZA 2CRZA 5DUML 3GBLA 5B3JE 5JIPA 1CDHA 1HHGA 5J13C 4N85A 3MRQA 5E23A 4POZC 5IMOA 2RMNA 1S5HB 2VXTL 3CFCH 3GJFA 2YSSB 5D4JA 1JS4A 2RCSH 1LVEA 4WAFA 1S9VB 5EU3B 5F1IA 4QRAA 2WIIA 3CFBB 1ZANH 4K8RH 3ZTJH 5K9OB 2P7TA 1X7SA 3FB7B 4W4OA 5L2JB 1F86A 2OJZH 4JKWA 2VO5A 4E9SA 2V7HB 4JZNA 1MCWM 1E5YA 2Z31B 4GI8A 5F9WB 1DBBH 2BCKB 4MD5A 3DSFL 5IMKB 1V3KA 5C09D 4CC4A 4LRIA 3U46B 1HINL 2I07B 1GY1A 5EZIL 5DD5L 4JDTL 1P2CB 3EG9B 1R3IH 2FX9H 3VW3H 1GGBL 1M6OA 3ISWA 1AHMA 1EHLL 5DEFA 3NJFA 4EJ1C 2E3VA 4MA8H 5DJZB 4Z7NF 3T0EA 4KQ0A 3TBVA 1P7KB 3D3VB 3NCMA 3SDXB 5HHOD 3HG0A 1GRWA 4OGYH 4Y16A 5KJ4A 3WY1A 3ZYOA 4EDWH 2Z91A 2ENPA 4M6MH 1RI8A 4N2AA 3AW5A 4I87A 3EO9H 3VXSD 1KT2B 3QHZL 1IZKA 4JPSA 4Q97A 1EVUA 4MA3A 1LJMA 3KYAA 3RWIB 4F27A 1N68A 4J23A 1KUMA 4JFFB 4JN2B 4K7PH 2XTJD 1ACXA 2DD8H 2HVBA 3S5YA 3FT2B 4KDWA 4C4KO 2VAAB 4PJ7B 4FAAB 3H9SB 4YHLL 4WTZG 4Y9EA 5CKAA 3WLWD 5H37A 1UOLA 1SLXA 1BQHA 4PS4H 2XA3A 5M95B 2FYYB 3D39E 1NCDL 2DH3A 3L2NA 4MWFB 4NDMA 3P9MA 4DP7X 3O6LH 2VDKH 4QHKJ 1VCAA 1VFUA 5H37H 4J1UB 3H56A 3RAJL 4E9QA 1P7BA 3MMEA 5AYUH 3WEOA 4HPYH 4UOW0 1HI6B 4JB9H 15C8H 1MCCA 2NMSA 3QQNA 1J1PL 1C5CL 3NSJA 5CZXC 1NCWL 3TJHD 5HBBA 4DP4X 3BZFA 5FXCH 1XGTA 5CD3A 3MV11 4PJ6A 2WQVA 1JP5A 3N9GH 3O4OB 2CLVB 3EYQD 5F0MB 1HWWA 3ROLA 4QRPE 3WIFA 5CBAA 2BNQE 2QHRH 4GUPA 1FP5A 1BZ8A 2PYEE 1PSKH 3KHOA 3PXLA 4QT5A 1N6UA 5DQJB 1FGVH 3CDYA 1B9KA 1O5DT 3GMMB 5HPOA 1E3ZA 1C8QA 1KLGA 5B7FA 5TDNA 3FUIA 2J8OA 3PU7A 3V5DA 2Q7AA 5KBNC 2DQDL 3QCVH 4M93C 2KQNA 5E51A 3P0GB 5DRXA 2CGRH 1QA9A 3LQAC 2OTWA 3RL2B 4OD1H 1XR9A 1T80A 1FYTD 1GCYA 2YN5A 1U3HD 3EH2A 4WWKD 5HHQA 1YC7A 4KK8C 3QCTH 3K80A 4N2MA 3IT8D 5IP4A 3N42B 2HUEA 4KZEL 3B83A 5LQBH 1DQJB 3D30A 2XWXA 3GHBH 4OZ4A 3L6FA 1G1KA 4AQ8A 2FJUB 3KJ4C 5I8EB 3O3DA 3DBSA 1CICC 4JFDE 4KZCA 2F61A 1JFQH 4ZMYA 2FUQA 4GS7B 4LHUG 2BFVH 3EBIA 2O5ZH 2BVOB 4WDIB 4U4IA 5EDXA 5ITFB 1G7LA 1X9QA 4FYQA 4XMVA 3LKRB 1GJWA 4DP9X 4DFHA 1U42A 3GT6A 4TPRH 4CMHC 1A6AB 1NMBH 2WQUA 5JDJA 4NYLB 5EFIB 2I25N 3P0YL 2IG2H 3VGBA 4NPYB 4RNRB 2FBRA 2Q7NA 3QWQB 4ACPA 4BQ6A 5JQIB 4UIMA 2Z7UA 1MJUH 2BJMH 4KTEH 4NQQA 2VUOA 3FSZA 3S4SG 5FB8A 3QPXH 1TTGA 3W2DH 1J5OH 3OMZA 2X6MA 4GMSL 1AD9A 1UEMA 1F4YL 1WJ3A 2N1KA 5D6CA 4CW1A 5KSAC 4XNDA 2B1HH 1UM5H 1GAFH 3TO4C 4PM1A 3V5KB 2O5NA 3GXIA 5I76A 4PRBB 2LVCA 3JWNC 3MFFA 2J2ZB 2UWEA 3IBOA 1DJYA 3BGAA 1RZGA 4LCCC 2NLJA 4WFHD 4X8XA 3ZTDC 3IDUA 2XG5B 3B9DA 3QDJE 5E7BA 3R19A 4F1SA 5A2AA 3EGSA 4IDLA 4LLYA 2B20A 4PJ9C 5T3XL 2JIXA 3VWJB 2H6PB 3U9WA 1KCKA 2X44D 5DVMA 4G7VH 4N0CC 3PAUA 4FLSA 5EIQA 3BEVB 1JJUA 5C9JA 4U1IA 2JK5A 5FOJA 3L08A 4IDJL 4M1CD 3OPZH 2Y2YA 2VR5A 3G04B 4NUJA 3H55A 1GIGH 1NAKL 2WBJC 3QIUB 3ET9F 1AH1A 4FJ6A 3RWCA 2K8QA 4OIFA 4JGNA 2J8UE 3HS9A 1MFVA 1UCBH 3BIBX 3BKCL 3QJSB 4LCWA 4OLZL 4XBGB 1JYXA 3HB3C 2R0KH 2J5WA 4ZS7H 3JZ7A 1KJ2A 5IOPB 3QIWC 1PY9A 5CZVL 2ZIDA 1PBYA 1BP3B 3GD1C 2H0FA 4LLVB 2DDQL 4P2RA 2VLRD 5J9PA 1NSNL 4Q4IA 4PJGE 1F41A 3O3EB 2GCYB 1U30A 1D5ZA 3QDGB 3LY6A 1KJ2H 5I1IH 5JDSA 1NBVH 5I1JH 1QFHA 5I6KA 3RI5K 4PUBH 5FAAA 2XKSA 4NC1E 5DVPA 1SJMA 2MOQA 2D0GA 2DWTA 3FUMA 3K2UL 4WTZA 4MDIA 4FFZL 3OM3B 1XGRA 4I0CC 3MLWL 5HI5D 4JRLA 2KBGA 3IDIB 2VH5L 5T1KA 3GM8A 4GRLB 4QF1B 1IC5H 4P3WA 2CXKA 5GRZA 5C7ZA 3ESVF 3KLQA 3OGCA 1OAZL 3AJ7A 4KY1L 4OJFH 4WW2C 4AVJA 4M4RB 2B7DT 4AMKH 2VZOA 4WGWB 2WWKO 2YK1H 1DUZB 2VZ1A 2Y7MA 3V7AE 1MCPL 3QISA 4U1NB 2JFCA 5EULV 2F68X 1SVZA 6CGTA 3T4YB 3IE9A 4MQSB 4HA1A 4E68A 2YA1A 4HJ1A 5BVJB 2FSDA 3MBEB 4GKSB 1P5VA 2K70A 2B14A 4Q2ZA 4WNQB 5C08B 5DUBA 2CDFA 4TL4A 4UUJB 2IBZX 4XX1E 1H3UA 3DJSA 1UURA 1QNIA 2H3NA 1NUNB 4N2HA 4YBLC 5KJRL 3WHXA 3ZE0E 4HKZA 2XZAL 1CFVH 3ISYA 3KWWA 4W4NA 1HCZA 3OJDA 2KPNA 3GKWH 2EEDA 2QLYA 5JOEA 3FW6A 5CEYB 2R59A 3EYUL 3DOHA 4NM4H 4I8DA 3HTLX 3PWUB 3IVKA 4YLQT 1OGTB 3C12A 4X50A 3SDAB 2N7BA 3LCYA 2AAVA 2DB8A 3DROA 5KVGE 1AZUA 1KACB 3RTQA 4HAKA 3VWKB 2NZ1A 3TN0A 1S78D 2EEBA 2C9AA 2ZZUT 4X9HA 3CIQA 2VJ0A 2XA8H 4OCWH 5T1DH 5BS0E 1DP0A 5ANME 4IS6A 2PETA 2J7LA 4NJ9L 4X9IA 1T66D 2O72A 2XKNA 2K4AA 1IAKA 1NGQL 1OTTC 4R3SB 4Z3EA 1TVHA 1UXSA 1ZT7A 1UASA 4MXWL 4L4TB 1DQDL 3EOAA 4XO4A 5IHUH 3AZUA 3TA3C 4TNFA 2DQJH 2O6FA 3KLKA 3J7HA 1B0WA 2XNAA 1ZA3A 3PWPB 1JYVA 4GUOA 3V7AG 5F9OL 3ULUD 5KYNA 2B39A 1RJZA 4QTIH 1KJ3L 1WF5A 2BRRH 2VM4A 4Y2DC 5EBWB 4XPFL 2EE2A 4UNIA 2YEZB 1HOCB 2CKNA 4LOFA 3NRFA 2YPVA 4YXKL