1SXAA

Crystal structure of reduced bovine erythrocyte superoxide dismutase at 1.9 angstroms resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Crystal structure of reduced bovine erythrocyte superoxide dismutase at 1.9 A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Oxidoreductase
total genus 41
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1995-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1sxaA00
1MFMA 1PU0A 4MCNA 2AEOA 1S4IA 3K91A 3CQQA 2ZKXA 1ESOA 1RK7A 1OZTG 2Z7ZA 3QQDA 2C9VA 2SODB 1Q0EA 1SXBA 3ECVA 1L3NA 3L9EA 1OAJA 2XJKA 2AQSA 2K4WA 2Z7WA 4OJAA 5KBKA 1COBA 2VR8A 3QQDB 3MKGA 1IBHA 2AQQA 1DO5A 3F7LA 2V0AA 1SRDA 3GZOA 1P1VA 1HL5A 2WWNA 1F1AA 4A7TA 2WYZA 4A7UA 1AZVA 1BZOA 1SXAA 1YAIA 3KBEA 2WWOA 5KBMA 1EJ8A 1IBFA 3KH4A 5CU9A 1OEZW 1N19A 4A7GF 1HL4A 1E9OA 2NNXA 2ZKWA 1PZSA 2AQTA 1XTMA 1JCVA 1Z9PA 2Q2LA 3GZPA 3GTVA 1SXCA 1YAZA 1SDAB 3LTVA 1KMGA 2ZKYA 1OZUA 3H2QA 1E9OB 4OH2A 4B3EA 2C9UA 1SPDA 3HOGA 1SXZA 3H2PA 1JK9A 3HFFA 3KH3A 2ZOWA 2AF2A 2WZ0A 1SXNA 1E9PA 1SOSA 4BCZA 1IBBA 2Z7UA 4U4IA 1JK9B 2WYTA 1F1GA 3F7KA 4BCYA 2GBTA 3GZQA 4A7VA 1EQWA 1QUPA 1SDYA 1IB5A 4N3TA 2AQRA 1E9PB 2GBUA 5KBLA 1XSOA 2Z7YA 1FUNA 1CB4A 1N18A 2E46A 3CQPA 4N3UA 2LU5A 4A7GA 4A7SA 1IBDA 1CBJA 3KM2A 4L05A 2WZ6A 1PTZA 3T5WA 2C9SA 1B4LA 3GQFA 1B4TA 3CE1A 1DSWA 3PU7A 2E47A 2VR7A 3KM1A 1F1DA 1UXLA 1SXSA 1YSOA 3RE0A 2JLPA 1UXMA 3S0PA 2AQPA 2WZ5A 4BD4A 1TO5A 1OALA 2XJLA 3ECWA 2VR6A 2WKOF 3L9YA 2APSA 1BA9A 3ECUA 2AQNA 1U3NA 1XTLA 2WKOA 3GTTA 2GBVA 3HW7A 3KBFA 3SODB 1E9QA 4A7QA 3MNDA 4FF9A 2JCWA 4MCMA 1TO4A 1E9QB 1F18A 1Z9NA 2R27A
chains in the Genus database with same CATH superfamily
4XE5B 4MA1C 1YNTF 1DQLH 4X98A 2R39A 3QEHA 2R69H 3QIUC 4JJ5A 4U6XB 5FKAA 1BG1A 2AK4B 2VDPH 1M7XA 2OCFD 2XC8A 1QYGH 1U91B 2Z7ZA 3H9YA 1J1PH 1NWPA 1YO4A 3OLIA 4PUBH 3T2NH 1I8KB 4APQB 5F7HA 4OCYH 2X6CA 1LK2B 4JRYD 5D5MA 2V17H 2AQ2A 1W72L 2QSCL 4QY8B 4LL1A 3UGUA 4CU8A 4Z8FH 3ZR6A 4NCC1 4KKLC 4U6HA 5E2TL 3HMWL 2JWYA 5G55A 4D9RD 4OTXL 1K8IB 1MIML 1NBCA 2RMNA 5AAWA 5DK2A 4CMHC 1RUPH 4G72B 4XGZB 3ZT7A 2J56A 3QUGA 5H37H 2W07B 1RUKH 1JGDB 3LNEA 4N0FA 4G3YH 2X41A 4OKVA 2VZUA 5CS7A 3CPLA 2O5XL 1TJHL 1PLBA 3LRMA 5CINL 1SZNA 2ZKWA 5HVHC 2BNQB 2HSIA 3ASWA 4L8DA 2F68X 1P9MC 1NKRA 4JJOA 1T7WA 3LTVA 3QDGE 1ORQB 1A7OH 1HHHA 1OZUA 3P2TA 1E3FA 4YL9A 2B0SH 3VD2A 1WQVT 2H2PD 2K8MA 4PRDB 3KLHD 4HA1A 1T0MB 4Z3TA 1XR8A 3LCYA 3WFDH 4NP4L 4JK0D 5FO8A 4DW2H 4FJ6A 5AB9A 4YX2L 4C56A 1MHEB 4GIAA 3DK2A 1QRNB 4NNPH 4G82A 5IFHH 5INDB 1WHPA 4NRXA 3BCFA 1BXXA 1IQDA 1OP3H 2B2XL 3DX9A 3QCUH 1ZLSH 2ZWSA 1Z66A 4F7TA 1RPKA 3DTUB 1P4BH 3CQPA 1A5FL 5ACZB 5IMMA 4NO2B 4FFZH 4FEIA 4FKEA 5DRNA 3VFVB 5ACLA 1XB6A 4WTXA 4AW4A 3GQFA 1HZHH 3ZT6A 3VFUB 3IRPX 3FH8A 5FYKH 3PHQA 3OZ9L 3TYGH 4PP2A 3L5XL 1NCIA 3ARVA 1CU4L 4MD5B 3G04A 5H2BA 4S2SA 4L4TD 3T0AA 4BSJA 1MLBA 3N0PB 1NLBH 3L4TA 1UZ6F 3BAWA 3QEUB 4RWYH 1FV1B 2ZAHA 3MOAL 2Y3NA 3UMTA 3ULUE 4XVJH 1R3LB 4G6MH 4Y4HD 3SGKA 5E2UL 1UOKA 4QTFA 4ZFZA 3VB9A 1ZE3H 1SFDA 4Q56A 2GUOA 9PCYA 2EUVA 2J2ZB 5KSAA 2DQDL 2GBVA 3FRUB 2R0ZH 2Z31B 3ZDYF 1USZA 4OJYA 2CO1A 1HILB 1JMXA 3IS0X 2A38A 4WFHD 1ZY9A 3QPXL 4FMKA 3ZRSA 4KKAC 2LAGB 4RAVA 2GAZA 3IFLH 1JV2A 4OF8A 5DHVB 3ZTEA 1R5WA 4QOKE 3Q2LA 1LO0L 1Q72L 3LKSB 1G7PB 5FEBA 4I1PA 4GRWF 2V9RA 2WLYA 1JZ8A 4MNQD 3CX5K 1L3NA 2EDNA 5B38G 5CEZE 4ESKA 1VPOH 4YO0B 1SN2A 3W0WE 2XVGA 4IRJD 1AQKL 3V4VL 2ESVE 4BQCA 1VCBC 4WENB 3M8OL 2RCSL 5BS0E 5FB8A 1WSST 4P2RE 3STLB 3KBEA 3FPXA 4FG2A 4MDJB 1GSMA 2ERJB 3L3JA 3WIAA 4HCGA 1FLTX 3IM1A 4ODVL 3T4AC 3MRQA 1A4JB 2OYLA 4RCAA 1PFCA 3BPCA 1L7IH 3H56A 2BIHA 4ODTL 2WKLA 1SY6A 3PAUA 3L3IB 5HJ3A 3O9WD 5CZRA 1MJJA 4QWWC 4OJCA 3WGUB 3GEFA 4AJ0A 4TOYH 3DXAB 4Q14A 5EFIA 2ZWKA 1HEZB 3O4OB 4WK4B 2NSMA 3GBLA 4N5EC 1EEYA 2ITDA 2VQTA 4H8WL 1RZFH 4UQ9A 1ZLVK 1YNLH 4EI5A 3RPBA 4ZFGH 4KQ3L 3ZUNC 2CO3A 4JZOA 4OLUL 5GSVB 5DD6B 1C5CH 4UT9H 5H94B 3FL7A 1OAZL 3J27A 4FG6D 2HUHA 1JGLH 1UA6L 2X2HA 4FQ2L 4CVWA 4L05A 3QUYD 4HOWA 1H15B 4L4VD 4X6CB 2VDOB 4JRYE 3OXSB 4JHZA 3EO1B 2EH8H 4ZUUB 4AYMC 3OWEA 4LSTH 2FK9A 4FI8A 3V0GA 3GRWL 2QMKA 3MU3A 5D1ZD 4J12A 4QT5A 3N50A 4D9RE 4Q9CA 1EHNA 4MQXC 1C16A 1EO8H 3X3GL 4YDVA 5CUSL 4TLSA 3E6HB 5DS8B 2EINB 4ZDHA 2OX5A 4PJEB 1TMCB 5KSBB 4GIPD 3IVKA 4WUKH 1U93B 4UTCA 4JFQA 1Z5LA 4KU1A 1OCWH 1A6VH 2ED7A 3RAJL 1BM7A 5L9DH 1QKZL 3O2WH 3WTSA 2IFGA 2OMUA 1A3LH 1A2YA 4XCFL 4AI7A 4KJWD 1F6AB 1UWGH 4P99A 4WCYH 1PJ9A 3LNIA 1IBZA 2DYRB 2WVSA 1AVAA 4LPWA 2E59A 3UO1L 3F7RA 3MLSL 1BYNA 4QI3A 2W38A 4XHQA 4JFVA 2GJ6B 3B9EA 2F7RA 3FZUD 3EH1A 1T0NB 1QZNA 1ZPLA 2BSDA 3OQRA 4KDTC 3EFOB 1WFIA 5DUML 4WI0A 3ZL4L 4ANUA 5JORB 2OULB 4I89A 4DGYH 1NGZB 5BQDA 1JPEA 3OB8A 3GZOA 1ZTMA 2YKKA 4WFFD 3O3EA 3OB0K 3V5DA 3MACL 1QFWH 2WYZA 1YDPB 5DJ0B 4N2GA 4ZTPH 1AKPA 3QW9A 4U3SB 2VMJA 4LZKA 4HK0A 5F1IB 3Q05A 1KTJA 1ICTA 3H9SD 1EBAA 4YGAB 4YBLB 4XT1C 4ZS6D 5HGBA 5BO1L 5I5RA 4HUNB 1XF5B 3EH5B 2VLKA 1N19A 4L4TE 2Q87A 1E9OA 3GSOA 3Q1SL 4HIHB 4FG4A 5DJXA 4U1GC 1NCTA 1CCZA 3U2JA 1MRDH 1NMBH 5C86A 3A4DA 4YLQT 5CJOH 3ROLA 3T0XA 4AIXA 4WFHE 1DJXA 1FCGA 5JXEA 3HNTH 1TPXC 4P23A 4XPGL 4OCSH 2AV7B 1T80A 3DI2B 4R8WH 3H9HB 5MEOB 2EH7L 1ONQB 2YC1A 4NDMB 1Z0MA 3C09B 4LCYA 5E6ZA 4GO6B 3D05A 5FO9A 2IOOA 4YWGL 3CFTA 4WGWB 3ZKQD 5AOJA 3VU2A 4LOEA 3U46B 4U1JA 4MNQE 2J12B 1BSIA 2NUPA 4FNUA 1N0XH 4N8UA 2IDFA 1D5IH 1TYJA 2MMXA 1TSRA 4BKLA 1HCVA 3CDCA 2APWA 4NAMA 2WVVA 2XYCA 4P4KC 4B96A 3U0PB 2UY7A 5EZJB 3GXMA 5IMKA 4MJIA 4XB3A 1YPZB 1AQDB 2GJRA 4HJSA 1ZJAA 5TE7L 4G5AA 5GGRA 1E30A 3EAKA 2YSTA 4N8VG 5C0FB 4NHUA 4IDJH 4MQ7A 3S4SA 1CGYA 1YQ2A 3HTLX 3KPRA 3UYRH 3WELA 1HH6B 1ZKAA 3GLEA 3MGOA 4Z7VA 4HQQH 3S36H 4MA8L 1QNIA 4NPYB 4PJIB 1Y0LA 2BSTB 3QH3A 5JW3H 5AW7B 3CVHL 4I48A 4H8HA 2DBLH 2H0PA 2XWCA 2AAVA 2R2EB 4KXZI 3D39A 2R1YB 4YSQA 1E5AA 1Z32X 5IQ9B 3X1EA 4YVUA 4PJ7F 1W0WB 3FCTB 2GCYA 4NKDA 2BNRD 4M6AA 3CSYA 1QWUA 5HY9A 4FE9A 4HMEA 4YFDB 2BWDA 1BVKA 3LXUX 2PW2B 1MHPL 5E9NA 4KHXH 1MSPA 2E75C 2H2SC 4AC2A 1CI3M 5T33L 2EXYD 3HPJA 4YC2B 1VHPA 3NA9H 4BHUI 3APDA 4X80H 4UAOC 4KMTL 3GSXA 4ODWA 4QHMA 3V0FA 5JHDA 1GY2A 1FQ9C 3G5XB 2CLVA 2YN3A 3ULVH 1M71A 2EIMB 4L4VE 4TNWK 4OM0L 4HWZB 1WIUA 3D50A 5K1JA 1UXWA 1JNJA 3DO7B 1VFBB 4TSCL 2GIXA 5BXFA 4HBCL 4HSQA 4D8PA 2A2QT 1J9SA 1AJ7H 2QADB 1GOHA 3O6LH 4G5ZH 3V95A 4B9YA 1PKQA 4PJCE 4OQTA 2XWJB 1ZLUH 1SXCA 1AGEB 5F7DB 2ZP8A 5K93A 1IGJB 2VXUL 3BP5A 3H2QA 1U8JB 4CSSA 1G87A 3J2PA 4JB9H 5DK3A 1BECA 3GMPB 4JG1H 2VDRB 4GW1B 4NQDD 4MAUH 1ZMYA 3FW6A 1C1EH 1KB9J 3MZTA 1JI2A 3QJHB 5D70H 5GZOD 2Y7OA 4Y0GA 1V3KA 2DLTA 5D7IB 1TQTA 2OQJB 4ZX4A 4KRPD 4W9LC 3U30B 4C59B 2XN9B 3IBEA 1TZIA 3GHEL 4XPBH 1OSEA 2ROYA 4LSUL 4Z7NE 3RBSA 2LU5A 4UUJB 4A7GA 4YHPB 1DQKA 4K8RL 4BWWA 3V4PL 3HBPA 2C4FT 5I5MA 1QFHA 3EYUL 4RSVA 3ARWA 3NCFB 3VB8A 1VFAB 2XXMB 1MLCB 4FXGC 5E4OA 5GGSA 4DZ8B 3L5JA 2WZPA 1YSOA 1P6WA 4RGNC 4YLBA 4R7XA 4MS8C 3HN3A 2WYIA 4WFFE 4HIIB 2EDOA 3OAUH 4D9LL 3CVIL 3VFWB 5E1AB 4GXFA 3J7HA 1RZKL 3LAFA 2EYRB 4NQSB 4G8EA 1D5ZA 3H9SE 4CADB 4JZJB 2Z1KA 3W9EA 2VM4A 2YAMA 4WWKB 3S5LB 1X5GA 3SO5A 5BOZG 5F0PB 3D9AH 4R4BB 1ES0B 3KHQA 4O02L 1DBJH 3C5ZD 3VXSA 4YPGB 3SD5A 4WY7H 4JG0H 3SZKC 2RQ8A 3RWCA 3C5SB 1I3VA 4FJYA 4IRSC 5G5DA 3TBSB 4KPHH 3F7YA 2A73A 1FDLL 4XN8A 4I18C 1FSKC 1I8LA 4HUVA 2YBRA 4JEGB 3SCMB 3R19A 1AZCA 3O3BA 2DM7A 2C9QA 2H32B 3AB0B 4ABVA 2AXGA 1RD6A 2IAMD 2BRQA 2XJKA 5F0LB 2ADGB 5AOZA 2XWDA 2WSKA 5KJRH 3QHZL 3RTQA 4LSTL 2AJVL 1DFBL 4HG4J 4MNHB 3VXRB 5KVDE 4APXA 2X4UA 3QORD 3K0YA 1FGNH 3UDWC 2P48B 1UC6A 1ZVYA 3VX1A 2ZCLH 5LAXB 4UTAL 2VDQB 2R23A 4AXWB 2CNYA 4JY5H 1EAJA 4ZSOB 3UTTA 3VXPB 1WC7B 5EORH 2XXCB 1NEZG 2JB6B 4U0RB 2UY6B 2ZICA 3I6KB 5AUMB 1T04A 1U42A 2IH3A 3TF7C 4OFDA 5KS9F 4FQLL 2VQ4A 4W81A 2CHDA 1IKNA 3B9KC 3NCMA 3FAXA 3LHAA 4NM4H 3QUMH 1UB6A 4F1ZA 4M6ML 3QZWG 4P2YA 3KLQA 1QBLL 2ZCHL 5FA4B 3GBDA 4Y4KD 1CLVA 4JFWA 5E4EC 2E7BA 5DUPL 3UZVB 1KXTA 1GJIA 2GBTA 3NFNA 2KZKA 2FL5A 4Y1AB 5BZDA 4K23H 1F41A 2DMGA 3O6KH 4OT1H 3EG9A 4N24A 2OAAA 4H1LH 2FUQA 3S3PA 5JW4M 3LIZL 3KR3L 4MKTA 3F12A 2B4CC 4PS4L 1L0QA 1THAA 1QTYT 3MBED 1D5XA 2BNRE 5AYUH 3O3DB 1I9JL 1HZKA 4WI9A 2D8KA 4BFGA 2XQYA 1HOCB 2HWZH 2JLLA 4RMSA 1OPOA 4LT7A 4IHOB 5I16A 3AREB 1G7LB 1RUMH 2F18A 3LKNA 4FQIL 5EU3B 1ML0A 2IH8A 4H5SA 3RA7H 4W9GC 1RV6X 2N59A 3RZCC 4L5FL 4N5UA 1OCOB 1R3HA 1Y6MR 1TTGA 4PU2A 3DUUA 4A2DA 2FQEA 5C0BD 5EU7C 5EUOB 4DQAA 5F9OH 2WZ5A 2XTSA 1P4IH 2F19H 3TA3C 5I0WA 4IBSA 1IX2A 2BHUA 2JJSC 4ZX3A 2EKSA 4X7EC 1V7NH 5F8RC 2JKRM 5EDXA 1KELL 1W8OA 2B1HL 4WIQA 2KH2B 1A4BA 3PCYA 4O51B 1FYHB 1IE4A 1TTAA 4L37B 5CHNA 3X14A 3P77B 2CM5A 3DVGB 4G7SB 4MCMA 1I8AA 4IK7A 4ZUWA 1UZ6E 3W3BA 1Q9WA 2RIKA 2LFEA 2PWEA 4NQDE 3KPQA 4MAZA 5GGUA 3JWNH 5DJ8B 3FQNB 1S3KH 1ZK9A 1TG8A 3OGOE 1E43A 2V6HA 3D52A 1GS8A 3HZKA 2VB5A 4LF3A 5AOKA 1MFEL 3ZDYE 4BFIA 1UTDA 3G5YB 5D2NC 4AYEC 2VERN 4P5TD 4HCIA 2D73A 3H6AA 4PAZA 1D6EB 2YQ2A 2X9WA 3I74A 3O2DH 4K94H 4Q4IA 1Q8MA 4S1DC 2AKRB 4N6RB 2E9BA 2DJUA 1MEXL 2VN7A 3HUJB 3QDGB 3WXWH 3CK0L 4IMLA 2UX7A 4GRWE 1EEUA 2HLEB 3OF6D 3TOPA 4PN6A 4F5CE 1F4YH 4GAYB 4RBPK 3CZNA 1S9VA 5H8DA 4UBDD 3GMQA 3V6FB 1MZZA 3RVTD 3NYKA 4R2GD 2A74B 5GRUH 3LIUA 3EYQD 2WO3B 3LOWA 4AGLA 3IMVA 3M07A 3Q8BA 5EB9A 1JHLH 3RU8L 1XF4A 3SDAC 4YHMH 4OFVA 2WZ0A 3MRCA 2YMXH 3MR9B 4WUUA 2BCKA 5PAZA 2UXGA 1VESA 4ANVA 5JPNA 1SBSH 2MHAA 1MFBH 4IIQA 2X05A 1A7BA 2O72A 1JZ2A 1O9WA 1PD0A 4NKOB 43C9A 2HG5A 2OJZH 4TVPH 4E68A 1BIIA 2F1EA 1WTGT 3QA3A 3U48A 1G7HB 1XAKA 4LL9A 2W9LA 5IHLB 5DHEA 1BVOA 5K5YA 3F6IA 4A7SA 1UH2A 1YEDB 5HDQL 3HNVL 5A6MA 3S8WA 4OCRH 3HG2A 3QEQD 2H6PA 4OLZH 4WNQA 3AMLA 3KPPA 4KK9C 4AM0Q 3OR6A 5DR5L 3K2UH 2G2RA 2AJUL 1ERNA 4PW3A 3FHAA 1QPKA 1SGKA 4G9FD 4NO0D 2EVGA 2ZXAA 4F2MB 4BD4A 3BQVA 5B8CA 4QUOA 1BFOB 4RFOH 5D5MF 4NUMA 1P84J 4OJFL 4EN3A 5JQ6L 4TLKA 3P0YH 1S7SB 4LKCA 3QIUA 2YD1A 5BO0D 5I71B 3GTTA 1I1FB 1FVCA 3RHWK 4DSYA 3RVUC 1I9IL 1JTPA 4LEXH 4QOKB 1H3PH 5HYQB 1HKLH 5T3ZL 3VH8A 4MA3B 1LK3L 3LQAL 4G6AC 1YEGL 3L7EA 3OLEA 3PV6A 4GAJH 4GKZB 4JHBA 3WU1A 4JNXA 3MI6A 1EHXA 3MCLH 3E6FB 4X6BA 5DD3H 1XGTB 1JZ5A 2EILB 1NJ9B 2ESVB 3VFRA 4QHNA 4PV8A 3AS3A 3L81A 4YHYB 3TIEA 5DVNA 4ADGA 5BS0B 4R4ND 4U3HA 1WAEA 4MXQD 4P2RB 5J89A 4XZUA 4H8QA 3II3A 3ASNB 2DQGH 4DHLA 3LMJL 4TL4A 3DA0A 4DWHA 3WTWA 1DSFH 1HCFX 4UYPA 1Q9LA 5KVEH 1I4FA 1P9MA 3Q6FA 2AJ3A 3C8DA 3X12B 3VFNB 1F3DH 4O9HH 3QWOB 2H4EA 3P3SA 4W9HC 1E2WA 1NH6A 1NM4A 3ECQA 3ATDA 2CUIA 2BY0A 1UWEL 2K4AA 3ILDA 4JFDD 3MLRH 1OEZW 5A3ID 5L8LB 1VADA 3CVCA 3NIGE 2E9IA 3UGXA 4XVOA 1AACA 5C0BE 5I19H 4XWGH 4D0CB 2OR7A 2FO4B 3R0MA 5KJ7E 2X1OA 1J11A 3ABGA 4DKFH 4ODHH 3QQ4B 4IK6A 2EDFA 4JUTA 4P59L 3RIFF 5GXBB 2EIZA 1CZ8H 1V54B 3ZZ1A 3D6GA 3HNSH 5IFJA 4TPRL 1G9NH 1M6OB 3WFBH 3CHRA 3W82A 3CFUA 1KB5L 1T03L 1A7NH 1SOSA 1PY0A 5PCYA 1UA7A 1O0VA 3MRFB 1OWWA 2IV9A 4R7NA 5KYUB 1MWAA 3DDGA 2YOAA 3H0TA 2CIIA 4HCFA 4JRYB 3N6YA 2FX9L 2X4OB 3DI3B 1LQSR 1KLGA 2E46A 3L4UA 4FFVD 1BQHA 1HTYA 2ALWA 3A67H 5EEZA 1XCQB 2WWKO 2FATL 5FOBB 3SE4C 1P7KA 4JDVB 1WH0A 5EZOL 4PJAB 3TV8A 3AQYA 3IGUA 1FIGH 1MJ7L 2YA1A 4XZ4A 3S88H 2VR7A 3MV9A 3FMGH 4N2DA 5SWSA 3KXFE 2KKQA 1XCXA 2BHYA 5C6TH 3RDJA 1FE8L 1JPGA 2HVJB 4AENA 3W81A 1L9MA 4M43L 5JLZB 5GGVH 3Q8EA 2AJSH 1Q4NX 4RGOH 4F20A 4H20H 4KVNL 4ONOA 1CXIA 4OGQC 4PB0L 4R26H 4XP1H 4K8RD 4UNIA 5MEPB 1MCRA 1UM4H 5I0ZA 5SWQA 5EU6D 1BF8A 5E24E 4AGPA 2VZVA 3BWUF 3D0LB 4JMNA 4RFNB 3UFIA 2DQUL 1XGZA 4J3WA 4TQ8A 3QZPA 2Z31C 2VGLM 2YPLA 4HS8H 5E2VH 2J3SA 3JVGC 4OD2B 1E27B 2Y7LA 1D2PA 2GITA 5CCJA 3LD8B 1NEUA 2YD6A 5EOQL 2CK0L 2BVQA 3TEWA 3QUKA 1SF3A 2ITCB 4EIBA 2WQSA 4JCMA 3O0RH 5ICZA 4Y9GA 4JFZL 2CKBB 3KS0J 5I66A 4LAQH 4X9FA 4X8JA 3HBZA 2DLFL 4QXTA 5AOMA 3T4AA 3GC3A 4L4TB 4DO6A 5ADPH 1F6FB 1QFUH 1CGXA 2HFGL 3V4LA 3IJHA 3CHOA 3I3BA 3QXVA 4MJJA 5E8PB 3T2QA 3WAKA 5KWYC 1YEJL 4PJ7E 1A9BA 2D9CA 4Y4HB 1JHKL 5CKGA 1KYFA 2VN4A 2F74A 2WIIB 3QEQE 1ETZB 2FGZA 1YJDC 4LLVB 3WEOA 4U2ZA 2EQDA 2QQQA 1KCKA 4G9FE 1E6OH 3KPOB 2AQTA 2L7EA 1XTMA 4B9CA 3NDZE 3MQIA 2Z93A 4NQXB 3NH7L 1UOLA 2I60H 1PG7W 4KZDH 2ERJC 1PDKA 2OMYA 1EJOH 3DJ9A 3WY3A 1MREL 2CZNA 5ESAB 1OAUL 3NCJH 4XXCC 1NSNH 1N8ZB 1A6WH 1AAJA 1YMHB 1Z9OA 2N01B 1IFRA 2ZOKB 3E7JA 4AH2B 2I7SA 4PLNC 4PJ5E 2BP0B 4JO1L 1WIPA 3KGRA 4MNQB 3UJJH 3UPAA 3QQNA 4LVOB 1QEWB 5C0RH 4L0YA 3G5ZA 4KX7A 3O4OC 3MYJB 1MCIA 2NY5L 3GMNA 4XN2A 3VGFA 4KRMB 4IRJB 3OJVC 5IVXA 3NCYP 5AWNL 1AD9A 4KRNA 3DYOA 4O00A 4YDNA 1V27A 1XGUB 1U8QA 1B4TA 4M8RA 4X7DC 4RQQB 1WT5C 5B22A 3EYFA 1MW2A 1NCDH 3N3EA 5EULV 2XT1B 2GFBB 3RGVD 2GIYA 3IDMA 4JPIB 4PBXA 4XP9L 3I2CL 3QJVB 4PJBB 4CJ1A 4OGYH 1RZJH 5IROD 3V52H 5C3IA 2B15A 4YN3A 4JFDE 2APSA 3FDWA 3O9WB 3LKPB 3LPGA 1UJTA 2JJTC 3VWKD 1U8PA 1ZV5A 4JHWL 1EJFA 1Q94B 2YQGA 4FQ1H 5IP4A 3KL3A 2ZPKL 5DLMH 2ZAIA 3HFMH 3KJ4B 3VG0L 5F93C 4PG9B 3P73B 4KDTA 1IIKA 5BV7L 2FVNA 2VDNB 4HEPA 2RHEA 2VL5A 4XODA 3RVXC 3UADA 1G4RA 3RQ3A 3S3BB 3PG2A 3VFPA 2PLTA 3LKOA 4ONGH 3WLBA 1ESOA 4QDGA 5DO2D 1I7TB 1OP4A 3L95A 2OW7A 3DMMA 4IOFD 5AW9B 3IFOA 4YHLL 3QUYB 2UXFA 2VM3A 4HIPA 1BPVA 3M6DA 3RWEB 1ID5I 1DEEB 2NNCA 2WVUA 3EZ8A 2FSEB 3GXNA 3BRGC 2OZ4L 3N9GH 3QBTB 5ALCH 3NZHH 1IM3D 2MCPH 3JV4B 5D1ZB 4YZFF 3WNOA 2KZ1B 3BSGA 4E5XB 4PJCB 2IBBA 2CDFA 2CU9A 3NEOA 2A83B 3T77B 3K81A 2Y1YA 4HISA 3DGCR 4TMPA 2WWOA 1TEFA 5E4IA 1OM9A 1OPGL 1CJYA 2DTSA 5LGJA 2Y2TA 4U31A 4XB8A 1YY8B 4HLZG 3AXIA 3QHTC 4Z7UA 2VZ3A 2H26B 5ILTL 2EACA 5IB5A 4YBLC 2HLAB 2W9EH 1ILUA 2WNGA 3FU6A 2HN7B 4XP6H 1CF1A 5CEXB 1CD0A 1QA9B 6TAAA 2XBDA 3I9PA 4G43A 1TFPA 2LTQB 4R97B 3A22A 3MRLB 3P4NB 2AF2A 4U6TA 5EU6E 4K71B 5BRZA 1T6VN 1NBQA 3CC5B 2QPEB 5B1JC 4HLJA 1ZHBA 4HWEH 1IB5A 1NFKA 4OBSA 2ID5A 1XF3A 3FQWA 3GSNH 2Q2EB 5L2JB 3IJ8A 3TH2T 5KS9E 2XWZA 2G5RA 2UXTA 3GMMB 3IF1B 2VXSL 1PCSA 2FECI 2BHZA 3D25A 3QCVH 4P4KA 1J0HA 4MRBA 2WLKA 3EADA 1H6FA 4LGPB 4OZGE 4BQ8A 5TH2A 2K70A 3C09C 3OGCB 4XN4A 3U7AA 5L8JB 3H9SB 3VI3A 3HAEA 3BOVA 5DYFA 2FNBA 4HKBB 4ZOEA 2F15A 3MZGB 3MUZ1 3HR6A 2NNFA 4HAFA 2WLNA 4FNSA 4QHUA 5I1LA 3PPSA 2IQ9H 1JZ7A 4JRXA 5JIMA 5FCUL 4D2NA 5ESQA 3U2SA 3ALXA 2FLRT 1UB5A 3NCWA 4P0DA 4JPQA 1PAMA 5HHNA 1KTCA 5BVJA 4WJ5B 3RNQB 4F58L 4NLAA 2KMWA 3BSZA 1JPSL 4IS6A 2KLTA 1E9QA 1IKFH 1A9EA 3AY4C 4M7LH 4M6NL 3ES6A 2G5BA 1M53A 5T5NG 5KG9A 4FP8H 5F3BB 3NJJA 1DUZB 2AEPH 3BWAA 2ADIB 4E41D 5DI8B 2FJHA 5EOTA 1DQLL 2R69L 1KXQE 3MCKA 3AQXA 3M7OA 3AT0A 2V2WB 2VDPL 2ZCZA 5IKCA 1YNTB 1QYGL 2VN6A 4PUBL 5KVFE 1J1PL 4G8IB 4PGDA 2AVGA 2WVTA 3ARBD 8PAZA 1KBVA 4OCYL 4G83A 4LXFA 2KQNA 2V17L 3FQUA 3L3DB 4XRCA 5T3ZD 2OSLA 5FK9A 4RX4A 4HKZA 5IB3A 4Z8FL 4XNMB 3BXNA 1FPTL 4HJGA 3PFUA 3TJHC 5FDYA 4AG4H 3WUZA 1CFVH 4YC2C 3VM7A 1RUPL 4JANB 1EO5A 3GTNA 4G3YL 4A7GF 4GB9A 1GOFA 3PAYA 2NNXA 4RDBA 3DSNA 4TQPA 1TU2A 3G9AB 3LS5H 4ZTEA 3CFDB 1BVNP 4PJ6A 3VAEA 5IHZA 1A7OL 4Y2DD 1YEWA 2QADC 1MW3A 3PWPA 4WKZB 1QPPA 4ODUB 3WG7B 1XL4A 1RSFA 3IBOA 3KYAA 3RVVC 1CD1A 3SDCD 4L1LA 2BNRB 2D7NA 3WFDL 1X5MA 4G59C 1RSYA 3L6FB 1WCBB 2X4PA 3PXHA 5IFHL 4L8SC 3BZEA 5GPRA 2IGLA 1TYEB 3QJXA 1KZYA 2AV1A 4FXGA 1OE3A 1V10A 3QDJD 1IFHH 5MEND 4PJ8D 1LE9A 3ZIYA 1MW1A 3MJ7B 3QCUL 4OB5H 4U4BA 1J8KA 4TN9A 3U6RA 3KDMB 1E2VA 1P4BL 4PM1A 5T5NF 3AU0A 5FIEA 3U30C 1TVHA 2VERA 3GI9H 4ZK8A 1LEIA 4AIZB 4HGWA 4FMVA 1B4JH 4FFZL 4YBQC 5B4MC 1B0RB 4NRZB 2NZIA 1UATA 3TO4D 2ZUUA 1KTLB 3TL5A 1HZHL 3FOLB 1M2VA 2VR3A 3MNZA 3EBGA 4JCWA 4AE1A 1T5WA 3TYGL 1RIUH 4PWJA 1A7QH 3MROA 1XAUA 2J73A 1NLBL 3CIAA 1KTRL 3IS1X 1X7TA 1W72B 4J3OH 3NRPA 1JTOA 5C0JA 1A0QH 4RWYL 5E8NB 4N68A 1IQWH 4LRIC 4IRSA 4FQXD 2G2NA 1EVUA 4PCYA 4G6ML 5BRQA 2XPGB 1MRFH 3CN3A 4H0GA 1N12A 3BGMA 4I18A 3PIQA 5FYKU 4NQDB 5LBSA 2R0ZL 3UP6A 4BZ1H 4JZJC 2DOCA 2H6OA 4X6DA 4WWKC 3MLYH 1T1YB 3QZMA 3DECA 4KRPB 1W16A 3L3KB 5EEWA 3SB3A 4I0PD 1TVDA 3ZDYB 3CSFA 2HLFD 3H3BC 1QASA 1BVLB 5F2FA 3WXVL 3IFLL 1DJSA 4W6YB 5AB1A 3VXOB 3LPPA 3VD4A 3AZUA 3US1A 4G8FA 4NEHB 4IRZA 5T1KD 3UDWA 2NR6D 4F7PB 2DF3A 2ZOOA 4F92B 2WP3T 1CYGA 4OF5A 2W0LA 4WU5A 3PXLA 1F2XK 1VPOL 2K7QA 1KLUB 4NZDA 2DH3A 3SCMC 4GRWB 3QZNA 4E9WA 4N2MA 4UOZA 5AVSB 4AM0B 1R3KB 3AB0C 3NQIA 2NTSP 3UYPB 3ZHDA 1JVKA 4Y9EA 1FAKT 2VXQA 2WLLB 4MFHA 1BZOA 4XMTA 5CGYC 1LP9F 3BN9D 5IY5B 1KIQB 2PCPB 4F9LC 4LIQH 4MNGB 4KJQD 1CR9L 2X44D 1XCWA 4PRPD 3KW7A 1ZHKA 4P2OD 5B39A 1ND0B 3UTQA 4MDIB 5DVKA 5B7FA 1Z9PA 2Q2LA 3ZYJA 3FB7A 1TT6A 1ZA3B 4LCCB 2IPUK 2XACC 5JW4R 4KVPA 4LSQH 4NENA 4U0RC 4XBMA 1L7IL 4H88H 4QCIA 2HX9A 1HU8A 1HINH 3O4LD 1CVSC 2KZBA 5HI3C 1ZAGA 4TOYL 2NY2D 4BCZA 3BFWA 2E7MA 2MQ0A 4LOUD 5J1AA 1LLAA 4BZ2A 3WE6A 3GJFK 1VENA 1EFQA 1PS3A 3RPIB 1GRWA 4PI0A 3WIHA 4NWTH 2IAMB 1YNLL 1LD9A 4BSWB 4E41E 3GLZA 3AITA 3N41F 3SYAA 1WD9A 3P4OB 2J8OA 3RZCA 1K2DB 1RJZA 3TJEH 2HJKA 4UT9L 2MCMA 5C0CA 1JGLL 4IGBD 1FZJB 3DX7B 3QORB 4FXLA 1XD0A 4CMMB 3HS8A 2JJSA 4LLQA 4IEFB 5LO7A 3WCYA 3C9NA 1ACYH 2EH8L 1OTUC 5T3ZE 5L88H 3AREC 4OLXH 4BFEA 3N1FC 3IE4A 4NQED 4YSSA 4BUHA 2V5MA 2HFFB 1EO8L 1UCBH 4NKQB 4I88A 1JPTH 1OALA 1PQZA 2JKTM 3BEWA 1B0IA 3PGCA 3AMKA 3HA0A 5B38B 1ETB1 3N04A 3OQ3B 3EYSH 4XXDB 4WUKL 1I3RB 1UYWH 4Y4KB 4K55A 4C57C 4KROD 3TT1L 5E9DD 1MAKA 4HDIB 1OCWL 1A6VL 4ONHA 1X4ZA 1XZ0A 3O2WL 4B5EA 1A3LL 2JSFA 2ZOUA 4FJZA 5DZOA 5L4IA 5D2NA 3K71B 2ZNWA 1UWGL 1U8NA 3B34A 4WCYL 1H3GA 5GGTA 1CYWA 3QYMA 32C2A 3WHXB 3ZHFA 1HYSC 2VLJA 2MOGA 1FFQA 3BP4B 4NZJA 2ADFH 5BZZA 3QIWD 1QO3B 4KO6A 3FO1A 3QDJE 5MENE 3QR0A 5HJBA 3VGDA 3S7GA 1Q90A 3AQDA 5DYOB 4YXHH 3EXJA 1NL0L 4DGYL 5EOCH 5L0QB 1Z5HA 4K3HA 3NIGB 1N5YH 1L9PA 5C0BB 3VSTA 4K07A 1JPFA 1QFWL 4ZTPL 4KGLA 1FWXA 3CXHJ 4KKRA 2Q3ZA 1RIHH 4HJ0D 4OIIH 4H8UA 3V0EA 4KFZC 4C54A 1DYZA 2RGSA 3SDAA 2UWEF 3LHPH 4KXCA 3PWVB 4G2AA 4QEGA 1SDDB 2F54D 5AZEH 4F93B 3ASOB 1ZT4A 2APTA 3PAVA 4U3CA 2E8ZA 1CL7I 5GS0H 3QAZB 1J8RA 4OLYH 2IMMA 4HU8A 4LGRB 3V5HA 4WI3A 4XNXH 1MRDL 2J8UF 2EECA 3WIIH 1T1WA 1YC7A 1BXAA 3KYMB 2ZUVA 4RETB 4GQQA 4JE0A 2A74C 2WNKA 1U8HB 5D9SA 3MX0A 3DOIA 4GINA 5DQ9B 1KCUH 1FJ1A 2HJLA 3OSKA 7PCYA 3HNTL 1YEFH 1FFOA 4OCSL 1XBDA 2Z35B 4R8WL 3L9RB 1Z9SB 2GSGB 4P5TB 5SX5K 1OXYA 3SE6A 4MJ4A 3MNMA 2VLRA 2NUTA 2GQHA 2HX7A 1VACA 1YG9A 2CBPA 1BBJA 2QGBA 3GLDA 2X4SB 3STBA 4LCWD 3QARA 4RIRA 1AZUA 1N0XL 4GXUM 2VLLB 4QRPA 2W0KA 4U6YA 4Z78B 1D5IL 4KO9A 1BD2D 5A7EA 4JJHA 3IMUA 5DTFA 1OE2A 3K5SA 3ULUC 2I27N 4R96B 2P80A 4KGJA 3J8F7 4Z7WA 4XTRD 3DX8A 5FKPA 4EDXA 2CAKA 3WLWC 3DYPA 5DJDB 4ZJ9A 2XWXA 4NIKB 4O2FB 3HHSA 4ORGA 2WINB 3GS7A 3R06B 3HS9A 4PRPE 5F7LB 4ZI8A 4IDJL 3EF4A 4D0BA 2OXHA 6PCYA 3IETA 3UYRL 2Z8VC 3C75A 1LWJA 2QJDA 1PSKH 1YEEH 4HQQL 2NSXA 3S36L 3QAQA 1CFQB 1AXTH 4U6XA 3G9VA 3T65B 4F2FA 5I71C 5JW3L 2AK4A 3MV8D 4IU3B 1QI4A 2D31B 2ZXWB 5D96B 2DBLL 1G1KA 1RPUA 5DD0H 1OAYH 1CVRA 1U91A 3O4LE 2XIBA 4FQHB 3QNYB 3O8XD 4OZHF 1I8KA 4APQA 4LMQI 1HXYB 1LK2A 4NJAH 3OHMB 4QY8A 3S2AA 4N0CC 1S9WB 3M88A 3RWGB 1F90H 1FI8C 4PJ7B 2MTPA 5MI0C 1M6UA 4KHXL 4OFYA 1R9FA 3IDGB 2BHFA 1K8IA 2DL2A 4I0KA 4ICXA 1QFPA 3QEQB 3NJMA 4XGZA 4YHYC 4NM8H 2W07A 4X80L 5LXGH 5CP3A 1JGDA 4G9FB 1I8IB 3CDGB 4NO0B 1B3JA 3U7YH 3LSOB 3ULVL 3HC3H 1E4JA 3DUHA 2QGEA 5ICUA 3IEAA 2BNQA 3T2LA 1MUJB 1KWKA 3EJZC 5IVOA 3VG9B 1DQTA 3P54A 4NAJA 2H0EA 2OR9H 1ORQA 2YAPA 4NQEE 1O7DE 1AJ7L 2OBGA 3O6LL 4KOBA 2VSKB 2ZT9C 4PRDA 1YA5A 2FBRA 1T0MA 3SO3B 4YZFE 1UXSB 4KK5D 1BQSA 1MHEA 2KZWA 4ANKA 1QRNA 4J3XA 4WO4D 5INDA 3RZWA 1KYDA 4MDRA 4JB9L 3QFDB 2FJSA 1AG6A 4IYKA 4JG1L 4LDCA 3HI6H 4GJTB 1SJHB 2NY0D 3CN0A 4MAUL 1C1EL 5E9DE 3TBVB 3VJ6B 4LSVH 1W0VB 3SE4A 2O5ZH 4X4ZA 3HG4A 5ACZA 4NO2A 2R9HD 3O11B 2OMNA 2WUBH 3VFVA 1UWYA 3RILA 4XPBL 3GFUA 1F6LL 1PZ3A 2GVYA 4N8VB 3QJTB 3VFUA 3L4VA 4M3JA 4ENZA 5A2BA 2EXTA 1FL6B 5FYLH 4BRJA 3T0ED 1PNCA 3MV7D 4MD5A 3FO0H 4Y2LA 3V2AR 2BSEA 3QEUA 1FV1A 1B6DA 4JFDB 3S2CA 3B5TA 3BRDA 4KI1A 2EABA 3HE6D 1GC1C 1R3LA 2K0RA 2D7TH 3QWRA 2H45A 1WJ3A 5DRWB 4O2CB 4F80A 3OAUL 3QYCA 1I31A 2J2ZA 1ET8A 3ULVF 3FRUA 6CGTA 2Z31A 3RFZB 4PH8A 4URTB 2XDHA 3G6AB 1HILA 4YSDA 3JVGA 2YXMA 2F54E 4XMWA 3D9AL 1XIWD 3OHXB 3DV4B 4GSDH 2IWKA 4F8OA 5DHVA 3U4EB 5TPWH 3KLHC 4WY7L 4JG0L 1DANU 4F37F 3LKSA 5IEHB 2XG5B 4DF9A 1G7PA 4KPHL 3CWGA 3GIVB 5E8EB 3WFCL 5FGRA 4RFNC 3WTVA 4NZUH 4YO0A 2B1OA 4P3CH 3H4HA 2VSDA 7PAZA 3NSJA 3ZTDC 4DPCX 4XX1G 3MODH 2A9NL 3NCCB 4B3VA 4XVTH 3DGGB 3MO1B 3LD8C 4WWPA 3CSTA 5KJRL 4N85A 3EJJX 3STLA 4DPAX 2ZYSA 4M93B 1X9UA 3LKQB 5AB0A 3A6CL 3K80A 4MDJA 2JF1A 1CBVL 2YD7A 4LCWE 2ZCLL 3V0VB 1GGUA 1A4JA 1QW8A 1UM5H 3V4PB 3SYPA 4JY5L 1IEBB 1T2XA 4IQHA 4XXCA 1BD2E 4U1MB 5ENWB 5T3XD 1HZLA 5EORL 5EU6B 1ACCA 4Y4HC 3CZFB 3L3IA 4UB0H 2FWOB 1XO8A 3DXAA 1HEZA 3UMNA 4LQFL 2A77H 4Y1SA 1IFGA 4NM4L 5KS9B 2VDMH 3QUML 5DMKB 4N28A 3OM3B 2CSPA 4PLKD 2DJSA 2EUXA 5GSVA 1BZQK 5DD6A 3V79C 5H94A 3MV8E 4GUCA 4A63A 3TCTA 4K23L 1WT5A 4MJ2A 2NY7L 4OT1L 3BVTA 1A7PL 3RL1B 4O02B 4ZPTB 1H15A 4CN4A 5CBAB 2W92A 4X6CA 3OXSA 2UXVA 4LP4A 3X1NA 3EO1A 5AYUL 4ZUUA 3QHFH 1AY1H 1OF2B 4LVOC 4B9JA 2HWZL 4HUMB 2VISB 3VD5A 4HSCX 4IRJC 2N1TE 1F1DA 1YN6B 1RUML 4QRTB 7FABH 1JF6A 4GQPH 2JJTA 3SKNB 3RA7L 1ADWA 5DS8A 3E6HA 4YSOA 3ESMA 2CBQA 2ZG1A 2GI0A 1MAMH 2EC8A 4YBHA 4PJEA 1PLGH 5KSBA 3IDXH 4IKIA 5FYJH 2ARWA 5F9OL 1U93A 1JZIA 1P4IL 3FUFA 3PQYD 4TRPL 1GGYA 1MIEH 1KFGA 1V7NL 5JZ7D 4AQ1B 1CDBA 3HC2A 2FEDD 3SODB 2C9AA 5AVUB 4I7ZC 1F6AA 2IXQB 5CZXD 1K6QH 5I76B 1G94A 1DBML 4ZW6A 3O9WC 3U83A 3NEEA 3NVQA 4ERSH 2XRAL 5HHOD 2GJ6A 1KDIA 1NIFA 2FGWL 4ZMWA 5K9JH 3KJ4C 1RMFH 3C60D 4M3KB 1T0NA 4ZUSB 3B7SA 3LH2H 4OF0A 3EFOA 4HPOH 4P5MB 3TYFB 1NEZB 4PB9H 5JORA 1U8CB 2CK2A 1NGZA 2KQMA 3A6OA 3US0A 3WMPA 1H0DB 1I7ZB 1QLEH 1E4KC 1S3KL 1YDPA 4M1DH 4U33A 5DJ0A 4FG6C 5L2KD 1ZEAL 4U3SA 3BWSA 3QUYC 5F1IA 3BDBA 1IEAB 3RGVB 3QZWB 3UTZB 3OG6B 3MNVB 4P04A 4KUCF 3O2DL 4K94L 3T0EE 1CTMA 1XF5A 3MV7E 3HHMA 1WD8A 3Q0HA 5D1ZC 4HIHA 3N43F 2X40A 3L4ZA 1LE5B 2PABA 3U9PH 3H3KA 3VWKB 3ZW3A 5C0GB 3KYKH 2P5ED 2MH4A 2JFCA 1S78D 3LRLA 1F4YL 1MCOH 4GFTB 5B1JA 1J5HA 4GMTH 2Y24A 3CSBA 4CJ0A 2Q1EA 2ZXGA 2IAND 3GMLB 3ZN6A 3W11D 1QEXA 4ANWA 1M1XB 2HVKB 1VZHA 4MLSA 1N3NB 4AZ8B 2VRAA 5A2AA 1GYVA 4I9WD 1JHLL 1GW0A 2XZQH 1DHKA 3TONA 1LP9E 4YHML 2KHAA 4EE2A 2J57A 4IOIB 5LNGA 2AV7A 3KWUA 3H9HA 1SBSL 4KJWC 5MEOA 1O5PA 1MFBL 1ONQA 2AQRA 2LTQC 4NDMA 4R97C 5FA3B 1EHLH 1SLVA 4K71C 1QSED 2OJZL 4IKLA 4TVPL 3U7WH 2HG0A 3O45B 3U46A 3L1GA 3VFOB 2WUCH 4ZTOH 4HMCA 2Z4TA 3VRIB 4R0LB 2N0KA 3PWLB 3JWDC 4HBQA 5CD3B 2BVOB 3IMRA 2BINA 4P2QD 2NW3B 5HYFA 4ALAC 3U0PA 4OCRL 3WTYA 2ZUWA 5EZJA 3MC0A 1AZBA 4OLZL 1OLLA 3AY4A 5TDNB 1YPZA 1AQDA 3LVEA 3S96B 5AKRA 1XH2A 4PJ9D 1T2QH 3K2UL 4R7LA 5C0FA 3IFPB 4ZS6C 3CJJA 4LHUG 1HH6A 2BY1A 4L29B 2X2YA 4P4RB 4RFOL 4X8GA 3ZDZF 4EI6B 4NPYA 1WAAE 3P0YL 4PJIA 2BSTA 1BVNT 5T3XE 4CSPA 3TA4D 2R2EA 2R1YA 4LEXL 5IQ9A 3ZE0F 3KG5A 3I50H 3FRPG 1HKLL 1W0WA 1NCBH 2AQ3A 3FCTA 1V3LA 2WGXA 3HB3D 4FNTA 3MCLL 5FV2A 2Y9RT 5DD3L 2PW2A 5FPIA 3X1BA 2LOEA 2FCBA 2KDGA 4RRPA 1QMUA 4KDVA 2FWLB 3CG8A 5MP6L 3GMRB 3GEWB 4QTIH 4ZNCD 4HHWA 3G5XA 2DN7A 3F7LA 1OB0A 4RGMB 2DQGL 4CVUA 2Y2YA 4HWZA 3NCBB 4LB8A 1DSFL 2EVIA 5IBUG 3DO7A 4A7UA 1VFBA 4XC3H 4WWID 3SE3C 4F15B 3PS6A 5IB4B 2AP2A 4O9HL 5E6RB 2JTDA 2DH2A 1J5DA 3MUY1 5KEZA 3NIDE 1WFMA 1ZS8B 2XWJA 4JAMB 4AYID 1AGEA 4IBQA 5F7DA 3AG3B 3MLRL 2J44A 1IGJA 3N1PC 1U8JA 3HAEH 4BBWA 1R5VB 1YMMD 5FUCC 2JIXD 5I19L 4XWGL 1J48A 3A5VA 3GMPA 3ARXA 4DKFL 4GW1A 4E9LA 3PQYE 1CTNA 2XV6B 3QJHA 2P5PA 4IMKC 4JFFB 4E41B 4UT6H 1CZ8L 1HHIB 5D7IA 2OQJA 1TCMA 1ZSDB 2DIJA 2RALA 3HNSL 5FAAA 3T1FB 3ULVD 1G9NL 2VQUA 4V1DD 2XN9A 1CGWA 1NC2D 4ABWA 5C2BH 1A7NL 2Z0UA 1ZGLP 2ZJSL 3BSZH 2UWEE 2Q5BA 2ATPB 4B27A 1CN4A 2MOVA 3ARBB 4KY1H 4UUJA 4YHPA 1N6UA 5HHOE 2E7CA 2X88A 5DO8A 4XAWH 3OSVA 3VW3L 3WKPA 1VFAA 2QKSA 1MLCA 3CZLA 1ZS2A 4XO9A 3VM5A 1FG9C 3LEXB 1H8SA 2YN5A 4GP8B 3U36B 4DZ8A 4EIUA 1KIRB 2EVJA 4LRIA 1U2YA 2EXYC 4M4PA 3IDUA 4HIIA 2QVTA 5L2KE 1FIGL 3VFWA 3SDXF 3S88L 1DJYA 5E1AA 1XWVA 3FMGL 1DE4B 4U6VH 1NANI 3IYLW 4EJ1C 2J1WA 4CC0A 1IEHA 2EYRA 4NQSA 1VA9A 3WNJA 4CADA 5C6TL 4JZJA 3AG2B 2AQPA 4WWKA 3S5LA 5LXVA 1T4KB 4U1NB 5KVGL 3DHJA 5GGVL 2EYSB 4RGOL 4H20L 4R26L 4R4BA 1ES0A 4XP1L 3SY0B 4YHNB 4YPGA 1OD9A 4NKMB 1D9KD 1UM4L 5E7FA 3LZFH 5SV3A 3WD5H 3MRPB 2P5EE 3SDCB 1IGMH 3C5SA 5IUSA 3V55A 2O61B 1BJMA 3NJKA 3TBSA 4PWFA 4OD3H 4ZW5A 2L3BA 2V8MA 4FFWD 1Y07A 2IANE 1R75A 3PPEA 4HUKB 2Y4SA 1BJ8A 3QDJB 1KXVC 4XCNB 1OD7A 3SCMA 4PJ8B 5MENB 5GZOC 4HS8L 4I9WE 4XCEB 3GJFH 1HQ4B 2J7LA 2H32A 3BKCH 3BVWA 4KRPC 2ADGA 4OU3A 1IILE 3EDKA 3D4CA 3NJLA 3FT9A 4Q58C 2UYLB 3TO4B 1QSEE 4MNHA 3II1A 1KB5B 4XVSH 3VXRA 4JL1A 1BFTA 1VAHA 3O0RL 5F1KC 4F9LA 1TEGA 3NJHA 3V0WH 4FULA 4LHJB 3JT0A 3V6OE 5LAXA 2KPWA 1SUHA 1I3GH 4N25A 2X28A 1Q9KB 4JFXB 4NERA 3NMEA 5B1KA 2WSPA 5EU4B 5ADPL 4ZSOA 5H35B 1BOYA 3GO1H 1WC7A 1AFVH 4OZHE 3VXPA 3LH9A 2JB6A 2LGNA 2UY6A 3I6KA 3GSRB 4FQXB 4P2QE 5GRJH 5AUMA 2N1KA 2QSVA 2ZG2A 1U3YA 3GF8A 1KN4H 3CV5A 15C8H 2B3IA 1OT1A 1ZGLB 1E6OL 1I9EA 4D8OA 1SDAB 2BOLA 2G9HB 2YEZB 4N90D 5ECGA 4NUGH 5FA4A 2A6DB 1WZ1H 3QRBA 5CLZA 4I0PB 2Z4QB 1E6JH 3UZVA 2OP4H 1QFWM 2PPFA 2X4QB 3QB7C 1EJOL 3C5ZC 5D55A 4Y1AA 5EC1B 5F1SA 2NDFA 2AABH 1IBBA 2GIMA 2V3EA 2Y1VA 4LCCC 3NCJL 1JK9B 5T1DH 4CC1A 4U1SB 1NSNL 2YZ8A 3RBGA 1EQWA 1A6WL 2A0LD 1U36A 1C5DB 4N1HB 4EVNB 2E6QA 5LBSH 3CX5J 3KPSD 3LV3B 3O3DA 5DUBB 3NABH 1Q38A 1HOCA 3UJJL 5C0RL 1U4EA 2BP8B 3A21A 4A2MA 4IHOA 3AREA 1G7LA 5I1EL 2CUMA 3UZEC 5EU3A 5G2NA 4JVUA 2IAMC 4LLDB 4M02A 4WV1C 3TTSA 3TVMD 4BFRA 1N9PA 2W94A 3KZ8A 3ZYIA 2VJXA 4HD9A 4IRZH 4B6ZA 2P8MB 5EUOA 3V10A 5FFOA 1NCDL 1I85C 3QORC 5DZJA 5KSUB 5BZXA 4PRPB 3UCRA 3UL4A 4P2OB 1L4IA 1WA2X 2NYYC 4QGTA 2Z8WC 1MWOA 4PSRA 5EU5B 1EAQA 4O51A 4QIRA 4XO5A 4L37A 5TQ2H 2M8XA 1RZJL 2YAFA 1QHPA 2W8CA 3O4LB 3P77A 4KUCD 3SE9L 2QDWA 3DVGA 2C3WA 4NJ9H 3S5ZA 1U58B 4PCSA 2NY2B 2X0UA 1YMME 5DVPA 3MNDA 1NKOA 4FQ1L 1BCIA 1F4HA 3FQXB 4W9CC 4PV9B 4NAQA 2AEOA 4Y4KC 5DJ8A 3FQNA 1UD8A 3CQQA 3SBRA 3ULVE 3DYMA 4EQ2A 1M05B 1BHGA 1N68A 2CPCA 4NPKA 1KOAA 4ONGL 1GY1A 2B4CH 4IKJA 3TWYA 4DK6A 3QO0B 3G5YA 4IGBB 2MCAA 1AGBB 3D3VD 4CVXB 4BZ2H 2X6UA 4GH7B 5HYJB 1D6EA 1VZGA 5SX5H 2P8LB 2Q20A 3N9GL 5ALCL 5TK2A 3NZHL 1P1VA 2AKRA 4N6RA 3WIHH 4N1EA 3HUJA 3A6BH 3WGVB 3QDGA 4YDJB 4OCXH 5BUGA 5I73B 4NQEB 2MCPL 2CRZA 4YEEA 2YK1L 4WW2F 3EJPA 5EWIH 5L0QC 4GAYA 4H8WC 3OAZK 2Y7MA 4YDZA 4ACPA 2WN2A 4JLRB 5FDWB 1L0PA 3GKZA 1LJMA 4GEIA 4M9OA 3V6FA 4D7PA 3N40P 3HLAB 1CDYA 2A74A 2E4FA 2BSBA 1MG3C 4KROB 5E9DB 3V5KB 3JV5A 3V0JA 3GXFA 2W9EL 3MR9A 4PLOB 4WNJA 2DB8A 1P2CB 4XP6L 1E8XA 1XEUA 3GGWB 4FTVD 1JF5A 3QXUA 2FDBP 3QAZC 1JN6B 4NKOA 3HMXA 2BM3A 1A1MB 2XQBH 2YJLA 5TFSH 1F1GA 1MJUH 2Y2WA 5DK0B 3TTYA 2WXMA 3QIWB 1G7HA 4FL4B 4HWEL 4KTYA 1BZ9B 4ZMTA 3FT2B 2CO2A 3GSNL 2WCSA 3KPMB 1YEDA 3QZBA 2R51A 3CIQA 1F13A 5D7LD 2LLLA 1KCSH 5BV7B 1JVOA 1PNDA 4HUXB 4AXWA 4YLCA 3SQRA 3QCVL 4LPCA 5EO0B 1WGVA 2Y1ZA 3LVTA 4LOFA 2PO6D 5GGTH 4CBZA 1HT6A 4X6FB 4ZAKD 4P5TC 4Z3EA 2JMRA 1RK0B 2VWEE 3ESVF 4F2MA 1BFOA 2F54B 1S7SA 1OP5K 4TVPD 2IQ9L 1I1FA 1KSRA 1X5KA 1OSYA 3PWJB 2V9QA 3ARRA 3SGEI 4QOKA 3VX0A 5ES4B 3F58H 4ZMOA 5HYQA 5TDOB 5IOPB 4MA3A 4G9DB 4LDOB 2J88H 2KLSA 4GKZA 4UBDC 4UV7H 3D87B 1A14H 4M7LL 1IKFL 3E6FA 4M29A 2XN2A 3EYQC 2BOCB 4N90E 1XGTA 3ARTA 3PHAA 4MZ3A 4AKQA 4FP8L 1NJ9A 2ESVA 4XX1E 4YSTA 1AO7D 3K91A 4WTZG 1AZZC 1T6WA 4FX5A 2YD3A 5BS0A 5D96C 5DA4A 4P2RA 2BNUB 3KPSE 4Q6KA 2DBJA 3GMOB 3WUWG 2QHRH 4LHUD 4LCWB 3X12A 3VFNA 1PD1A 1MELA 2Q76B 2XWBB 3QWOA 5IJBC 3BSHA 1OARH 1JJUA 2DWDB 5J5EA 3RY4A 3HG1D 4P07A 4DP9X 2HT2D 4AG4L 3EH2A 4UQIM 4AITA 3C8HA 4OUUB 4XCCH 1CFVL 3HPLB 2R56H 3KLKA 1SYSB 1JYVA 3HZ3A 4D0CA 2FO4A 4XNYL 2WBXA 4X0NA 3QQ4A 5DVOA 2I9TB 1G0XA 3GTVA 3LS5L 1M6OA 3VG9C 5KTEH 4PS8A 3MV8B 4R3SB 1Z6JT 4A2GA 2Z92B 2DEWX 3MRFA 4N4YB 3VACA 4W4OC 1M2OA 3O8XB 5KYUA 2J25A 4HUWB 4EDWL 1N2RB 4JRYA 4O58H 1BAGA 2X4OA 3LRHA 3PHOB 3ZZSA 4TSBH 5H4YA 2GI7A 3CLFL 4PGBB 3V0IA 2EEFA 4OI9A 3CBRA 1S7WB 2ZYRA 3K46A 1XCQA 1HWHB 4I1RA 1CDGA 5FOBA 1BJ1H 4JDVA 4OB5L 4PJAA 4IKNA 2X4NB 1U3ZA 3DDFA 2XWRA 4R4NC 2YAEA 4YAQB 3GI9L 4MXQC 3D3VE 1B4JL 3MCYA 3EHBD 5ANME 3WFEH 5AAMC 2HVJA 3NK4A 5JLZA 2XVLA 4Q9QL 4H40A 1TJGH 3KCWA 4DVRH 2Q7YB 2V3FA 4N2NA 3QISA 5GJTH 1VEPA 2AK1H 4JREB 1RIUL 3GBEA 4MGXA 1Y1DA 1J0KA 1S9YB 2XYBA 4AY0A 1A7QL 5MEPA 3SGJC 4KI5D 2YR3A 3B1TA 5CP3H 3FCGA 1A0QL 1EERB 1MRCH 1IQWL 5A3IC 2FT8A 1BV8A 5ALBL 5JA8B 2OV0A 4WO4B 3TCXA 1MRFL 3PJNA 3D0LA 1HL8A 3WEMA 4LARH 3RFZC 3II2A 4BZ1L 5KOMC 3MLYL 4YDMA 4OD2A 4UNTA 4DP5X 1E27A 1BF2A 1H9DA 4FTVE 3OHXC 4JPSA 4PGCB 2ITCA 4X7FC 2ZNXA 3M1CA 2CKBA 2YD2A 1WZAA 4NKIH 2NLJB 2ZUTA 2APBA 3T0EB 3RB7A 3AROA 5GGVY 1FNGB 1PZAA 3MV7B 4L4TA 3MGAA 5I9QB 3MLZH 4FFVC 3DRQB 3ZE0E 5E8PA 5J13B 5D7LE 3HE6B 1ZIBA 4Y4HA 4PWIA 2WIIA 2CBTA 1ETZA 4LLVA 3DVNB 3SKMB 4MZRA 3Q8FA 2X1WL 2ILLA 3KPOA 5TQ0H 3CZSA 4NYLB 4M93C 4YGVB 4H7VA 3DWTA 4NQXA 1NUNB 2XG4B 2FRGP 2YJQA 4KO7A 4LIQL 3L48A 1LP9B 3TF4A 1FG2B 3LQZB 3SEPA 4TVPE 1XIWB 3WJJC 1UURA 2C8NA 4K8RC 1EPFA 5F8QC 5ESAA 4KKBD 2ZUSA 3CFJB 3T3PF 4IIZA 1W15A 1N8ZA 2X6AA 2ZOKA 1YMHA 3HVNA 4LSQL 3VQ2C 4AH2A 4H88L 3QQ9D 1HINL 2BP0A 5CU5A 2N56A 3OMZA 1KUMA 4MNQA 1QEWA 1BZEA 4RMWA 4FXKB 5B1CA 3MYJA 2D9QB 3AJ7A 4LDLB 4UIKL 4TKWA 4IRJA 3UBXI 2N7SA 3OC8A 4L2YA 1RZKC 4LE8A 1AO7E 4R7DB 1XGUA 2E3VA 2YARA 5DHVH 4HZLB 5I1CH 5ITFB 2L7QA 4RQQA 3TJEL 1T7XA 3ZKSD 1WWWX 3BVNB 4HEME 1UASA 3N41B 5FM4A 4XBEH 2K3TA 5JNYB 2XSKA 4ABQA 2GFBA 3LZNA 2WANA 2OCCB 4JS7A 1W6WA 4JPIA 2WZAA 1ACYL 1J9QA 5C0EB 1KFAH 5FECB 4XMLH 4PJBA 5HYIA 4NZTH 2Q7AA 3IGKA 1UXMA 5L88L 2VABB 2L4OA 1NBZB 4OLXL 3HG1E 4OVVA 1RIVH 3HIZA 3O9WA 3LKPA 4GNKB 1USQA 3Q6GH 2R2CA 1T0OA 1Q94A 1UCBL 3F6LA 5E51A 1THCA 1JPTL 3K7UA 4S1QH 4ZT1A 2WKOA 2IH1B 3NSXA 4PG9A 3MGTB 2FWSA 3P73A 3UPRB 2CUHA 2EXSA 3EYSL 1SHWA 1M9SA 4OZFG 3SDXE 1UYWL 2BZDA 2DPKA 1NAMB 3L54A 3IXAB 4AQ1C 1E4KA 3FO2B 5AFAA 3KDPB 1CQYA 1MCQA 1PU0A 3VXMB 3MUGB 5HJDA 1I7TA 1P1ZB 2CUAA 1G7IB 2NY6B 3QUYA 3LZQA 1NCGA 3RWEA 3Q06A 1DEEA 4KH2A 2FSEA 3E0GA 4N0UE 5GS1B 1X9QA 2JKSA 1F4AA 1QZ1A 1OGSA 2ADFL 2P45B 2WQVA 4N2HA 4EBQH 4ELMF 5LN8A 3JV4A 5D1ZA 2QPDB 12E8H 4FZEH 1CICD 4E5XA 3FU3A 4PJCA 3T77A 4OJEH 2A83A 4YXHL 1UD2A 1K85A 1XGRB 5EOCL 2MWCA 2ZX8A 3UCQA 1OCCB 3FYIB 5CCHE 1ZVHA 1YY8A 1PFOA 3L16A 3B83A 5DEZA 2JKIS 1RIHL 1WFTA 3PQYB 5DVMA 2H26A 3RGVC 3VRJB 3LNFA 1WK0A 2HLAA 2O6FA 5DCCA 4U7SA 3WFZA 3LHPL 3E8VA 2HN7A 5E5UB 5CEXA 2VN3A 1U30A 5IMOB 5AZEL 1QA9A 5IROC 2FX7L 4KI5E 2J6EA 5GS0L 2UWEB 3IAQA 3MRLA 3BW9B 3P4NA 4PMEA 3RGBA 3VWKC 2JE8A 2R1XB 2VXVH 2DQCH 4PV1C 4XNXL 3CC5A 5HHOB 1NBVL 2DQEH 4Y5YB 3C60B 3WIIL 2N7AA 4EKXA 5L4JA 5L2JA 3CDZB 4O4YH 2ZD0A 2J8UB 5D2LF 5BMFH 3GMMA 3EOAB 3GNMH 1JGEB 1KCUL 3IF1A 3T6VA 4QTHB 5DO2C 5L2KB 2PP7A 1RLWA 1YEFL 4IOFC 3GUFA 4MS6A 4NRYB 5KVGE 3F01A 5IB1B 4KNQA 5HPMB 3R8BB 4Q2ZB 3OGCA 3H9SA 3CFKB 5F7EH 4HKBA 4NO5B 5CD5D 2ZWNA 1IC7H 2KL6A 3FTSA 4Z3JA 3HG0A 3N1QC 3F7PC 4R0LC 5HDRA 1GMEA 4I13B 3KLLA 2P5EB 4FHBD 1AXIB 4HIXH 3GPSA 1Q0YH 4WJ5A 2WCPA 3RNQA 4GO8A 3U6XA 5FGCE 2IANB 3EUUA 1FHGA 3D0VB 1DJIA 2MNJB 5E0FA 2WLJA 2R4RH 1E5UI 5F3BA 3HG3A 2OI9B 1DUZA 2ADIA 2DMCA 5DI8A 2YD5A 3CH1B 2JCWA 4CN6A 1CGUA 1U6AL 1PSKL 1YEEL 2YFOA 1AXTL 2V2WA 1RHHB 3F65A 1QSEB 3TFBA 4HYTB 1P4UA 1YNTA 4NZRH 5DD0L 1OAYL 4G8IA 5KW9H 4Q6IB 1RK7A 4BSVB 2IDUA 4K7PL 3ZXAC 4NJAL 3SE3A 3DOHA 3L3DA 3Q2CA 3MHZA 3RWFB 3MAWA 5EOCJ 4OZHB 4XNMA 4F3FB 1XX9C 4JDZB 3ATBA 4P2QB 5I1JH 5D7IF 3E8UH 5JIIA 3QULB 1TEYA 1VRSA 5LNEA 3HBGA 5CN1A 5IT2H 1BQLH 1F1AA 1PX8A 4JANA 3ROOB 1NTDA 4AX3A 4NM8L 1QATA 5LXGL 3ESUF 4PJ9B 1DLHB 4RGMC 5F7UA 2EE9A 4IMKA 3HC3L 2G3NA 3FQRB 3CFDA 3TPKA 4F15C 4JFHD 5JDJA 2E27H 2EICA 4GLRH 4NSKB 4WKZA 4LPVA 4ODUA 4TLUA 4ZMYA 3APCA 3R7RA 1QWNA 1I9RH 5E8OB 2BNRA 4HXBL 3QS3A 3CFCH 4G6FD 4P23D 3HB3B 3F5WB 3L6FA 5EIIG 1WCBA 4OQ1A 4EUPG 4DKEH 4K5LA 2V5SA 1SVBA 5BNXD 3D48R 3CUPB 3GKWH 1ECZA 2HKHH 3MJ7A 1M56B 1MHHB 3ZYZA 2R29A 1JDDA 1N4XL 3KDMA 4LSVL 4FQQB 2Y23A 2O5ZL 2EDXA 4YXLH 4AIZA 3WNIA 3EJYD 1B0RA 1IU1A 1H8LA 2WUBL 2WNWA 4NRZA 2CCVA 1F4WH 1IBGH 3NRQA 4B9GA 5KYYB 1KTLA 3ARBC 3FOLA 5GS3A 1PTZA 4S0SD 4GKSB 4D94A 4KK8D 3CE1A 5IGXH 5EEXA 5FYLL 3AM8C 3W39B 4JFED 1UXLA 3LQAC 2P7TB 3FO0L 1NWOA 2DWXA 2C9PA 3LNGA 1DQIA 2VC2B 1W72A 1AR2A 2E74C 2IPTH 1MNNA 5E8NA 1QUNB 1OP3K 3QI9D 1NANH 4G80B 4QF1B 5GRWA 4X5QA 2D7TL 2XPGA 3EH4B 4JO4H 1RI8A 3WIFB 1N64H 4LASL 3AVEA 1KXVA 4NQDA 5F0MB 4EI0A 5GZOA 4TSAL 1S9XB 3ZTJH 2VQ1B 1B9ZA 1URZA 1S5HB 1T1YA 3L3KA 5IUCA 4V1DB 3APNA 1EEQA 1NC2B 2Z91B 4Y2DC 5HVWA 1OL0A 3NJFA 4GSDL 1BVLA 1L9TA 3SDCC 3VXOA 5TPWL 1MOEA 1PG7L 4F7PA 3BT2L 4JR9H 2VUYA 2ZKXA 4J3OD 1OOWA 1CFTB 3UO8B 4NZUL 1KLUA 4PJ8C 4JX0A 4P3CL 1CFBA 1RJYB 5I24A 3IGFA 2P8PB 1R3KA 4AM0A 3BWUC 5GS2H 4B7IA 3UYPA 4F5CA 3MODL 3MRHB 2CCWA 4XVTL 3N0AA 2WLLA 5ESVB 1HAWA 1JVLA 4GKNB 3TO4C 3IDYB 1CXFA 3HZVB 1KIQA 2PCPA 4FHJA 4XVUD 4MNGA 4WO0A 2OZNA 4Y5XC 2KI6A 4AW7A 1IM9D 1ND0A 2XV3A 5DHDA 4MDIA 4LCIH 5HGDB 3WS6A 4BUGA 5I1HH 5JHLA 3EYVB 5B1AB 4RESB 1ZXQA 1ZA3A 4DCQB 1UM5L 4LCCA 1ID2A 1PZSA 1TTRA 1EVTC 4FQXC 4HOZA 1YEHH 4DT2A 5F6HJ 4UB0L 4AYGA 1WUZA 5FLVA 3TM6A 3K3QA 3RURA 1FP5A 4ZODA 5F7AA 4M1CD 4YQXL 2YD9A 2FEEI 5EUOF 2QSQA 1KF9B 4I77H 4ZOCA 3RPIA 2A77L 4XPFH 1ADQL 3U9UB 4DIXA 2VDML 2IAMA 3DROB 3MXWH 3PABB 2V2XB 1MVFA 4BSWA 3I3DA 2JKNA 3P4OA 4I0PC 1U2HA 4Z77B 2EUWA 1K2DA 1E9PB 3RIKA 1XSOA 2WW8A 5IEKB 1H8OA 4OIAA 4BXSV 5LCVL 2XPYA 3JWOC 4P3WA 1FZJA 1XF1A 1I85A 1WFJA 2ZF8A 3DX7A 3QORA 4CMMA 2HZHA 1GAFH 2NR6C 2QFPA 4H8VA 4PRID 4UNVA 4IEFA 5C6WH 3A4AA 4D0DB 2VL4A 1AY1L 3QHFL 1ZD6A 2C3GA 2VUOA 3VTAA 4PYGA 1K5NB 3VGAB 3UAEA 2HFFA 1BIHA 4P5KB 7FABL 5AKSA 2XX1A 5AZ2H 1SBBA 2BIOA 3VCLB 2DWYA 1MAML 5B38A 3BN9C 2PW1B 4Z7QE 1JXJA 1PLGL 4NB7A 4XXDA 4EIZC 3IDXL 2HFEB 5FYJL 1I3RA 4KJQC 3UOAB 4GRLD 1E65A 4OFPA 4Y4KA 1DVFB 5T5FA 4P2OC 1GYUA 2TRYA 4HDIA 1KCWA 1MIEL 2QQLL 2RFXB 4M6OH 1QFWI 4ES9A 5ADOH 1GJUA 1DN2A 3K71A 4ANXA 1K6QL 1O6VA 1Z9NA 2D0FA 4X9IA 3TIDB 2DIEA 3KPSB 3WHXA 2GEEA 2H1XA 4ERSL 4GFXA 2MNUA 2NY2C 3BP4A 4LOUC 6PAZA 2FSDA 3BEVB 1KGXA 5FYJU 4G6JH 1AGCB 3OX8B 4UI2A 5K9JL 3RTQD 4HOXA 3P9LB 1QO3A 1RMFL 4DP4X 3LH2L 1HI6B 1N0LB 4N9GB 2DV6A 4PB9L 3QUZD 3D12B 4MLIA 5DYOA 3TVMB 3QUMB 2MIZA 1PEZA 1QLEL 2XA8H 1IBHA 5D7EA 3S6CA 5C0BA 2IIJA 4HX1B 3HHRB 4M1DL 4XMUA 4IGBC 4IU2B 3B43A 3MTXA 4LSPH 5JOFB 1JPST 4DEPB 1AZVA 4XWOD 3PWVA 4JFEE 1SDDA 3IDJB 2CXGA 2I9LB 3D0AA 5I73C 3O41B 1KTDB 3QWNA 1O7DC 4W1TA 2NY5C 4HKJB 3GRWA 3U9PL 3S97C 1ZHLB 3KYKL 1TCRB 4Z7VE 2Q8BH 3N43B 3AXLB 3Q5TA 4OF3A 5I75B 1KMGA 2P5WD 1MCOL 2E86A 2K78A 4GMTL 3TBTB 4PIRF 3KYMA 3RTLA 1PZCA 3P9WB 3QG6B 3GSUB 1U8HA 4PP1D 1SN5A 4XN5A 4KROC 5DQ9A 5D4QA 1XGYL 4IDLA 1KGCD 1QVOB 4DZBB 4TUJB 3F7KA 5D8JH 1H5BB 3KVPA 2Z35A 3BP7B 1CLZH 2YBGA 3L9RA 1Z9SA 1JNHB 3U4BH 2GSGA 3D3VB 4OFKA 4P5TA 1FNAA 4FLQA 2Z7YA 1J1XH 2NYZA 3KBPA 1N18A 4M1GH 1EHLL 4HPHA 3JTBA 4NFCA 3U7WL 5JYLA 5CZVH 5JIPA 2ENYA 3GBNH 4HIJB 2LE9A 3QIWC 4FL4C 3IPBA 4Y7OC 2X4SA 3T3PE 2EDDA 4ZTOL 2WZ6A 2VLLA 4Z78A 3OF6A 1G0DA 2XNAB 4R96A 5BV7C 1DL7H 2YGPA 2HRLA 2XI9A 3DTDA 1TDQA 1WG3A 5DJDA 2ZKHH 4HJ0C 3AACA 4WFED 1G6RL 2NYKA 4O2FA 1T2QL 2WINA 3R06A 4FYQA 4XI5D 1RVFH 1ASPA 5A16B 4HJ1A 4KXBA 4LVNB 3F7VB 4P8QA 3MJ6A 3T65A 1CFQA 4FTVB 1BEYH 4IU3A 2D31A 4M8UA 4PJXF 5DJ2B 3NCYS 3ELAT 5TJWK 1OF0A 4FQHA 3QNYA 4XNDA 3ZO9A 4M62H 1HXYA 2CNZA 1S7RB 1KT2B 5IESH 4WTQA 3ZE0B 3B9DA 2EIDA 1S9WA 3RWGA 4FCAA 4XN9A 4PJ7A 5D7LB 1WA1X 4RAHA 2R2HB 1IJNA 3IDGA 3OV6A 3K74B 3QEQA 2EDWA 3Q44A 3BZ5A 1YYLH 3BD4A 3HMXH 2K4WA 2PO6B 4FXTA 5FWQA 2R8SH 4FLRA 4LIQE 5EN2B 4ZAKB 4QTIL 4G9FA 1P7HL 1I8IA 3CDGA 4NO0A 1TIUA 5EMYA 1YRKA 1VFUA 5GQBA 3LSOA 4PRIE 4KVCH 3WMSA 3H85A 4JHUA 3BQUD 1KEGL 3LKRB 1GZQB 3FJTA 2HVBA 1MUJA 3QJZA 3ULUH 4XC3L 3HI5H 3M45A 4YK4B 2DYPD 4Z3FA 2MPAH 3UABA 3SE8L 4CDHA 1TTUA 4W4OA 5KYNA 1P0SE 3QQ3B 4B9KC 4XTRC 5I1KH 3U6XS 4XXWC 5GRZA 2QLYA 4L8CB 1UXSA 4K7PY 5TGBB 3QFDA 5BRPA 1WE5A 1KPRB 1SJHA 3TBVA 5EUKB 3SDDD 5IBTH 1AO7B 3KH3A 3VJ6A 4MB5A 1W0VA 2ROXA 4UT6L 5T1JA 1CXEA 1J8HD 1WV7T 1YY9D 3S9DB 3WAJA 3OXRB 1QR1B 2YGOA 3P3RA 3ABLB 3O11A 2Z65C 5D72L 1R17A 2MSPA 5C2BL 1L9NA 3GSWB 3ME0B 4N8CH 3NGBB 3T6WA 1IV8A 2XZZA 3BSZL 3O8XC 4M9PA 5AAMA 4N8VA 5CEZH 1BZ7B 2HRHA 4L3FA 2C3XA 4U1IB 4LHUB 4NHCL 1Z2KA 3MMEB 1FL6A 4XAWL 3U4AA 2XVBA 4I5BB 3SGJA 2XWTB 3T5WA 4JFDA 3NAAH 4KX9A 1JFHA 1PAZA 3I6SA 3SPCA 3FRPB 1EDYA 1R19A 1YEIH 3AWGA 5C0ND 5DRWA 2ZKMX 4O2CA 2NX5D 5D2LE 2YFNA 4U6VL 3CHQA 2B14A 2H47C 2JI1A 2XKNB 5C0AB 3RFZA 3MRDB 3G6AA 3SDXB 4W68A 5C71A 1J9RA 4NQQA 2IPUG 2VOTA 5KANI 1JUFB 2WTRB 4JREC 3OHXA 1U3NA 1XTLA 3DV4A 4LSSH 3HW7A 1G9MC 3UEZA 3A4EA 2X89D 3U4EA 3WD5L 3QYNA 1CDUA 3LZFL 5IF0B 1S7UB 4OY9A 5IEHA 2XG5A 2P5WE 3GIVA 3FFCD 4OD3L 4WO4C 5E8EA 5C9JB 1HKFA 5IBUB 4EAEA 1UWXK 2Y5TB 4DEWA 1OANA 4W9FC 2WQWA 1PLAA 2WLZA 3H2WA 4NQCD 4OD1H 4PIBA 5FO7B 1A3RH 3BD5A 4LEOB 1SHXA 1KGCE 2ENPA 3B9KB 3BKCL 2ZF9A 1AP2B 3DGGA 2SODB 2D4DA 3ECVA 2EE3A 3MO1A 5JXAH 1X7QB 2R9HC 1TZGH 3EHBB 2R83A 2LR4A 1SEBB 3LKQA 4KX8A 3RLSA 1SQMA 3AS1A 3F3HA 4YSRA 3T0EC 1LEGB 2FNWA 4LEBA 5I9QC 3V0VA 1WTLA 3U0TB 2HH0H 3WJJA 1GC1H 1XVSA 3V4PA 2PWGA 1IEBA 4NNXB 5ENWA 4U1MA 4NOBA 1F5WA 3GO1L 1AFVL 3MNWB 1JD9A 3HE6C 4LLMB 5EU6A 1CLOH 1BX2B 3CZFA 2FH6A 2ZXBA 3D07A 5F7WC 2C26A 5I1DB 2FWOA 2WBWB 2NXYD 1QW9A 1H6TA 1KN4L 4W9ZA 4AJWA 5IZ7A 15C8L 4TNVK 1E3ZA 1BBDH 3BVUA 3QZOA 5KS9A 2Z6FA 3BAXA 5DMKA 4NUGL 4HAKA 1WZ1L 5JR1H 3L2NA 2WP3O 1FH2A 1U8KB 3TA3B 1E6JL 1XIWC 2OP4L 3MRKB 1OK0A 1CI5A 4HU2A 4AUUA 5T1DL 3RL1A 1JAEA 2B9BA 2OR8A 4KKNA 4PPTA 4O02A 4ZPTA 5CBAA 1MDAA 1KB3A 1JERA 5IHUH 4NBZB 3ZQXA 1OSZB 5E6SB 2BDNH 1OF2A 3COOA 3D09A 5CLYA 3IRZA 3NABL 4FXKC 1KJVB 2VISA 4DGUA 3OC5A 3CLEH 3V7MA 2F8VA 1YN6A 2O26U 4QRTA 5J11B 4QYOB 1NIEA 3SKNA 1QD0A 1Q1JH 1XZWA 1AYOA 2E47A 5DEJA 2BH0A 1YC8A 3LZOA 2CKBH 4GBXD 1MCWM 3NPZB 5FGCB 5SV4A 1YECH 3WNLA 4Z76B 4OLWH 2Y69B 5FUZH 1G7QB 1XXFC 4L1SA 3K6OA 3AU1B 2VW7A 4AQ1A 2IGTA 2VZOA 3QDAA 4HGKC 4UILH 4KZCA 2VR6A 4KH9A 3RJOA 4ENED 2IXQA 4E9TA 5I76A 2DQHL 4N2IA 5TQ2L 3OAYK 3EW3B 1K5WA 3MJ8B 1DSYA 4QGYA 2VM9A 1ZDSA 3WV0A 4JO2H 1BFSA 3O81A 3QO1B 5ECJE 5LQBL 3AUVA 4ZUSA 3NSYA 1EFXD 4P5MA 2FLMA 3TYFA 1NEZA 3BH8B 1U8CA 1H3TA 4PLKC 4UM9D 3T8MA 1J8HE 2JKXA 1A9VA 4BH7B 1H0DA 3M86A 5IM7B 1I7ZA 2VXTH 4ADIA 2H0FA 1L9SA 1VJSA 5FHBH 1KBKA 4PGJA 1GIGH 1A02N 5AD0B 4PS7A 3P30H 2NY6C 2OSWA 4POZD 4Z7NF 4FYRA 1IEAA 3RGVA 4JMXA 3QZWA 3I6GB 1JP5A 4MB4A 3UTZA 4BFNA 3MNVA 3CHPA 5GS1C 2AXHA 4LSRH 4JDTH 3LIZA 1OB1B 3WIHL 4P06A 1U8OB 5AOLA 3A6BL 1GGBH 4OCXL 5IROA 1LE5A 5F0JB 3G7TA 3VWKA 5C0GA 5EWIL 2M2DA 2NX5E 5SX4I 4FNRA 2YEVB 1SLUA 1C08B 4Q89A 4WW2B 3U0WH 3GMLA 1NGWB 1M9WA 1OAXH 1U8IB 1M1XA 2HVKA 4ZRGA 3PP4H 1N3NA 4AZ8A 2WV3A 2B5IB 3WTXA 3L7FB 5JZ7C 1SEQH 5K59F 2FEDC 5GZND 4IOIA 1YN7B 2CALA 2LW3A 4I0CC 1AD0B 5CZXC 3QCTL 4UOQA 5D1XD 5FA3A 3L3OB 5FYLE 5HHQB 2J1XA 1KIPB 1KC5H 3PLYA 2I7OA 3MLUL 2XQBL 3LNHA 4BELD 1MJUL 4N3TA 3FFCE 1KPUB 3O45A 4P46D 4NP9A 2VDNH 5FM5M 3OLDA 4Y5YC 3VFOA 3C60C 4H13C 3VRIA 5HHVL 1FO0H 4R0LA 3PWLA 4X4KA 4NQCE 1CICB 2QELA 1XB8A 1HIMH 5CD3A 2BVOA 3MPCA 3ISRA 4I4WB 2NW3A 1KCSL 4AEFA 1XL6A 2X42A 2FQDA 4K9EC 5INCB 5CSZB 1N6QL 3B56A 2TAAA 3OJMB 1QNZH 4DO5A 1UZ8B 2CHXA 5GGTL 5TDNA 5A2JH 2AANA 2Y07H 4P57B 3S96A 1HL9A 3QWQB 3M1BB 4PRNB 3UAJC 4A38A 4KC3B 3QDHA 3NZSA 3IFPA 4WHDA 2DY2A 4ELDA 4L29A 4P4RA 4EI6A 3P4LA 3DV6B 3CFEB 1B0GB 1H3VA 4AV0A 1BW8A 3QG7H 4OV5B 4LOVA 1S78C 3F58L 3RIAK 1KWGA 1NFDF 1MG2C 4QXGL 2J88L 4L3ED 1CF8L 4UV7L 1MXDA 3W11C 1A14L 3DMMD 4KTDH 4X5RA 3X17A 3ZKND 3FH5A 2OI9C 3BYTA 1URLA 2J6EH 1NCAH 2WY3B 2AJYH 1IO4C 1C7TA 1SMDA 3GMRA 4R9HA 3MLPA 3CNKA 2E7LC 3VYOA 1IMHC 2R2BB 1ZCRA 1GYWA 2A9MH 3FSAA 4HPYH 1CK0H 3FS9A 1F4XH 1M7IB 1PY9A 3ESOA 4JVPA 3S48A 3DC0A 1DANT 2GJPA 4Q6IC 3F64A 3BT0A 1QBBA 1G1OA 1NCOA 3IFNH 1DJGA 5GISH 3V6OC 4ZPVB 2QHRL 3QXDB 4AL8H 1N67A 4JO3H 4GMSH 5AW1B 1MJ8L 1WIOA 4JQIA 5IB4A 2NY1D 4ODBD 4ALAH 4DGVL 2XTJD 5I1IH 1CXLA 2HTKD 1OARL 1A6UH 2HP4A 1VFOA 4KNTA 1ZS8A 3GSNB 4JAMA 1AMYA 3CC1A 2PN5A 5D1QD 1M3JA 4GW4B 2EDKA 4TUOB 2QEJA 3V9CA 4XCCL 1R5VA 2R56L 4E9SA 5LDUA 4PJ9C 1RAMA 4JBSA 3WS3B 4WDIB 4NC2B 3P4MB 4BA0A 4NX0A 4JFFA 4E41A 1HHIA 5I8OH 3AW5A 3L45A 1IARB 1HJCA 1ZSDA 3T1FA 2C9UA 1HCYA 1FL5B 4OZ4B 4Y8AA 5KTEL 2Y5QA 5DJZB 1GHFL 2CWRA 3K1KC 1C9SA 2ATPA 2R0KH 8CGTA 3ARBA 1HWWA 1Y18B 4O58L 3AY2A 3HB3C 4UINH 3ZYOA 5IVZB 4NXKA 3AM8A 1CLCA 1IRAY 2DQIH 4HHGA 1N7MH 4ZQTA 1SM3H 3LEXA 5I0VA 3EJSA 3U36A 1KIRA 3D1MC 3CU7A 3FQ1A 3B6SB 2X3AA 5KVDH 1C5BH 5HI4D 1AG0A 2ED6A 1L0XA 1ZHNB 4R90H 1DE4A 4JRXD 4GUQA 3CZUB 1JGUH 2IOMA 2G0KA 3L3HB 4Z7QB 4RAUB 2Y36H 4QHPA 4K3EH 3WFEL 3WHE1 1TJXA 3TO2B 4ODSH 1T4KA 4GW5B 4U1NA 1XH1A 2EXWD 3CXDH 1KCVH 2EYSA 4DVRL 4ES8A 4XMVA 3TT3H 4DTGH 1RPQA 5GJTL 1BWMA 2AK1L 3SY0A 4YHNA 4ZUVB 2QVIA 2X6VA 3CSPA 4NKMA 3HZYB 5I82A 5J0BA 3MRPA 3SDCA 4AV5A 2O61A 2EZ0D 2G3XA 2K45A 2PR4H 4HW6A 3WI9A 1MRCL 4G6FB 4D7BA 3GYRA