1SXAA

Crystal structure of reduced bovine erythrocyte superoxide dismutase at 1.9 angstroms resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of reduced bovine erythrocyte superoxide dismutase at 1.9 A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE
total genus 41
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1995-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1sxaA00
3F7LA 1PZSA 3H2PA 1OEZW 1SXZA 2Q2LA 4BCZA 1F1AA 1E9QA 2XJKA 1XTLA 2WYZA 1EJ8A 1F1GA 1YAZA 1MFMA 2VR7A 2JLPA 1SXCA 3F7KA 4L05A 3QQDB 1CB4A 1SXSA 1E9PA 1UXMA 1Z9NA 2Z7UA 2WWNA 4OH2A 2WZ5A 3HFFA 2XJLA 2E46A 3GTVA 2AEOA 1CBJA 3CE1A 3ECUA 1JCVA 1F1DA 4A7GA 5KBMA 1U3NA 2AQSA 2R27A 1BA9A 1KMGA 2AQQA 1YSOA 3H2QA 2Z7ZA 2WZ6A 3GZOA 4U4IA 4N3TA 1TO4A 1OZUA 3GZPA 1HL5A 4A7SA 1UXLA 4FF9A 1IBDA 2GBUA 3PU7A 1ESOA 4BCYA 1SDYA 3MNDA 2AQRA 3KM2A 2WKOF 1E9OB 1JK9B 1N18A 2WWOA 4MCNA 1TO5A 2V0AA 2WKOA 1IB5A 3HW7A 3KM1A 1IBBA 3L9YA 2WZ0A 1SPDA 1PTZA 2NNXA 3CQQA 4MCMA 3GQFA 5CU9A 2AQTA 1B4TA 1F18A 1HL4A 1PU0A 2APSA 3KH3A 1SOSA 2ZKYA 3KBFA 4A7UA 1E9QB 3GZQA 1QUPA 1SXNA 2Z7YA 2Z7WA 1SXBA 1YAIA 1B4LA 1DO5A 2ZKWA 3HOGA 2GBTA 1EQWA 1SRDA 2LU5A 2C9SA 2C9UA 3ECWA 3SODB 1Z9PA 1AZVA 3K91A 1P1VA 2AQNA 3QQDA 2ZOWA 1IBHA 1SXAA 1E9PB 3CQPA 4B3EA 2GBVA 1SDAB 1DSWA 1OALA 3LTVA 4OJAA 1L3NA 3T5WA 3KBEA 2C9VA 4BD4A 4A7VA 1XTMA 4A7TA 4N3UA 1RK7A 3ECVA 3L9EA 5KBKA 2JCWA 3MKGA 2VR6A 3S0PA 2SODB 2WYTA 2AQPA 3KH4A 4A7QA 2VR8A 1BZOA 4A7GF 1OZTG 1COBA 2ZKXA 3GTTA 1N19A 1FUNA 2AF2A 1E9OA 1JK9A 1OAJA 3RE0A 1IBFA 1Q0EA 1S4IA 5KBLA 2E47A 2K4WA 1XSOA
chains in the Genus database with same CATH superfamily
1XSJA 2XQBL 5H37G 4XPFL 2HPTA 3AWFA 3O6FC 5EF1A 1QRNA 3L5IA 2FO8A 1RSYA 3GGWB 4PJ5D 4TNGA 2IQ9L 3BFQG 1U91A 3NSFA 4GO9A 2WLLA 3RPIA 1NPJA 4NO2A 3LN5A 3OHMB 4S1QL 3FHEA 2G3NA 3N41B 3APCA 3FB7A 2E27L 4W6XB 1G6RL 1UXSB 2XQYK 5JUEH 2EXWD 4XN9A 1X5KA 1BZ9A 3QUYB 4UT9L 1AZUA 4U1JB 5AYUH 5AAPA 3ES6A 2FGZA 3WEBA 5FECA 1BD2D 1OW0C 1MOEA 3MLVL 3S88H 1Z66A 5B3JE 5IEHB 2R2EA 4U6TA 5AW2B 4DESA 3X3FH 2DLGA 2ED7A 3JTTA 5F72S 1LO4H 4UMSA 5FO8A 4EIZC 4J27A 2RGSA 3B7SA 2CLVB 2DY2A 1J9QA 5KSBA 2GHZA 4MDRA 4PLJD 1H8SA 1JE6A 4AK1A 1CLOH 5DJCB 2H1PH 1N70A 3MRJA 3U9UA 2Q86A 2Q7NA 4K23L 3SEPA 3DJSA 4M1DL 4PJIB 2KH2B 3G5YA 1XIWD 2P8PA 1Q38A 1DQDH 4J3OG 5BOPA 3TV8A 1SY6H 3OHXC 4GXFA 3BPOB 5DD6B 4Y4KD 5ALBL 1EHNA 2CIKB 1IQWH 1KCRH 5JZ7D 3PCYA 4LVEA 3VFPB 5AVUB 1Y7VA 1T7VA 2E74C 4TF4A 4UCFA 5KS9A 1WZ1L 5KUMA 4Z3JA 3IBEA 3HRPA 3RWDA 1PF3A 4WY7H 5CD5C 2IOOA 4GAYB 2KC0A 4M5YH 5BO1L 3VX1A 1IILE 1NCAL 2QVFB 1KXTB 1BAFH 4OKVB 5HI4C 4IBTA 2IQAA 1I4FB 4JFXA 5SWSD 2HKHH 3WNOA 4JBSA 4ANWA 2N0KA 3BWUC 3MGOB 3L6FA 4DKFL 1KJVB 1ND0B 2WXGA 3C6LA 3APMA 5KW9L 1TTUA 1B0GA 4D0BB 5JLZA 2DRUA 2GUYA 4UINL 2A5UA 3OJDA 5D8JL 4M7JH 3KH4A 5EOCJ 4NSKA 3TN0D 1JXFA 2BW5A 1PGRB 5CZXC 4AGPA 1ET7A 3HZMB 4ZUSA 4OM0L 4QF1B 3U36B 1T2JA 4IU2B 2APBA 1H9DA 2K6YA 5AW4B 3L4ZA 1ZSHA 1OANA 1SMOA 2P5EA 3DV4B 1MLCA 3QPQD 5I30H 1AD9A 1OAZH 3KLSA 3QEQE 4JHWL 3MA9L 1T1YA 4WUUD 3T1WA 2NNCA 4R7DB 4LGRB 5EZOH 1U8OA 4QPEA 2JNZA 1A6VL 2E76C 3DBXB 3CV5A 3EJZC 3LNGA 3RUGA 3SCMD 5JW3H 2EE6A 5L7XL 5C0FB 5EO9A 4XNAA 4NQQA 3WCYA 1JPGB 4LNRB 4MB1A 4MSWA 3ROLB 5E8PB 2ZXAA 1WFOA 1I8IA 4G6JL 3TIEB 4NQTA 4MDJA 4V2BA 4ZZFA 2PW2A 1FGNL 4XTRC 2WHVA 1PKQB 3U7WH 2F5BL 5IQLA 5GGVL 5FM8A 3QFGA 3O6LH 1X7QA 2EDXA 3P77B 4ZFOA 5K5YA 3QDAA 2WXPA 4PCKA 3FTGB 3VGGA 4RFEB 3HE6D 3P4MA 3CLFH 5H94A 1UQSA 5IP4A 4M7ZB 1OSZB 4DEUA 4XBMA 5KVEL 1O7DE 5TQ0L 1CFQA 2NUPB 4LHUG 5DF0A 2NY5C 1KIQA 3P0VL 4TLTA 4WHTB 1AO7E 1XAKA 4FQ1L 1TT6A 3H1ZA 5C09D 1KMGA 2AK1H 2OYLA 3QIBC 2HSIA 2EUWA 3WKQA 4U1HA 4U1KB 4R4FH 3ZHLA 2Z91B 1ZLWH 3Q13A 2JJSA 4U1GB 5E8EA 4XVSL 1SVZA 1OGAD 5IHBA 2ZPKH 4QRSB 1WA2X 3V6BR 3DROB 1IARB 1U8HA 3ULVD 3STZA 1G1CA 1U8LA 2WVVB 1EVUA 1MIML 2RALA 4MQSB 2YAPA 4JMXA 4XPBL 4GKNB 4F91B 5IR1B 4QRAA 3FK3A 2VXVL 5L2JB 4MHHG 2BSRB 3MQIA 4PI0A 1P4UA 2ZSWB 3GJEA 3N0PB 3O9WA 3RL1A 1NUFA 3P0VH 3ETBJ 2E7DA 1EQWA 1GY2A 1T0NB 1ADWA 2VXSL 2OJZH 2E7LA 4E5XB 3HZKA 1XR8B 3IDMA 3FHAA 3OR7A 3VE0B 3KPSD 3NH7L 1GS6X 4W4OC 4XCYB 2XTJB 1DTUA 1JWUB 2VLME 4WKZB 4KKLD 3O6LL 3ZDZB 1JPSL 3KJ4C 4L8BA 3ZW3A 4LLYA 4M5SA 5BXFB 5HP5A 5MERA 1QI4A 3U9PL 3UYPB 4LOUC 2XKSA 3MCLL 3V0IA 3ZQXA 1N0LA 4G6JH 2V7HB 1A4JB 1VPOL 4G6AD 4ONGH 3WFBL 2W07A 1SOXA 1UXWB 2IAND 4GOSA 3E1ZA 4P46C 1LQSR 1YJDL 4Y4HD 3D87B 3O3DA 2P8LB 5K1VA 1M7DA 3VB8A 1QSEB 3BP5A 3APNA 5IEKB 3P02A 5DYOB 1KB5H 4HSQA 1GOHA 3RY6A 5C08B 4F2FA 2P44B 1HEZB 3FRPG 2XN9E 3P4OA 1RAMA 1I1AC 3VXRA 1KGUA 5FO9A 2AKRA 2UXFA 5IQOA 3I6SA 1CQKA 2WWKO 1NFIA 2YHGA 3ZE2E 2XWTB 4DQOH 3NDYE 2G5UA 4YK4C 4KBPA 5FYKE 1XIWA 4KRPC 4PV1C 4S1DC 3BH8A 5IFHL 3MACH 2PCPB 1XQ4A 4AM0A 2VXTH 1HEHC 3BGAA 3L3DB 3ZYOA 1OSEA 1PKQE 4PTUA 3JV4A 1EZVY 5BO1H 3BUDA 3TVMD 3FB6B 4BZ1A 4JFZH 1A9EB 4WU5B 4AENA 2VDML 1U95B 2RB8A 1JXKA 1JMZA 1R3IH 1SFHA 3WY2A 1RP9A 2ED8A 5A2FA 3KDMB 1RKRA 1WAPA 5FO7A 3PWLB 4IRSC 4LZKA 2H26A 2C7FA 3CFBA 5LGJA 1SY6L 1UXLA 4IEFA 3OPZH 3F5WB 1HWHB 2D31A 4GMTH 5HDOA 4N1HB 4XH2A 1UT9A 5L2KB 3NGBB 2DWEA 2WUCH 2MRYA 3T3MF 1RVFL 1EGJH 2AV7B 2BERA 1AJ7H 3BLPX 3TH3T 1CLOL 2JI2A 1Q0XH 1MUJA 4O58H 2ATAA 3DUSA 3NA9H 3P9MA 5AOZA 5KANG 1E9QB 3BOVA 1LO4L 4NT6A 1OB1A 4DGIL 4NENA 5E8NB 3LN5B 4G42B 4CVZB 1OCZB 2DLHA 4WFGD 2YXWA 4A6YB 4UTAL 1MNNA 2QSVA 1M9SA 4N2EA 3IKCB 3IETB 2XQ0A 3GSVA 4HKBB 4JFHE 5AW9B 5GJSH 2BRRH 4H8VA 1IC5H 3D18A 3RNQA 2AXGA 3MXVH 5HHMD 2I60H 5E0QA 1I7ZB 5FECB 1FN4B 3MRHB 3WHE1 4LSUH 3RY6C 2DJMA 1TJGH 2WD0A 2YBRA 1HCYA 4N3UA 1N6UA 1PYWB 4P04A 1FFOB 2K8MA 4WEBH 3ZDZE 3PWUA 5FYJD 2Y07H 2YMOA 1WZLA 3GRGA 3FTZA 4RESB 3UTTE 2BVPA 1RZQA 5HI3D 2IQ9H 4QAMB 4P5MB 1MH5A 5I76A 4I18A 1YEEH 4J6IA 2P52A 3UAJA 4Z76A 4XPFH 3KYOB 3C5ZB 1K5NA 3CN3A 4X8JA 1RSFA 4MMXB 1CL7H 3OGCB 3RWEB 1D5XA 3AABA 3MNZB 4K7PY 4PY7A 4X9YA 4YDMA 4DP6X 1E27B 2OMNA 1KPRB 3WFDL 1D5RA 2Y25A 4MNHB 2R51A 4YXLH 4NWUL 3VFWB 2NX5E 2YA0A 4C57C 1GL4B 3BDBA 3MJ8A 2Q76B 1PG7L 2B2XH 2LAGB 2VH5L 3ATAA 3HC4H 3INUH 2IPKA 1ZV2A 5CP3A 5JHDE 3VFPA 4JO5A 4HEMA 3GI9L 3IBOA 3K6DA 3GTNA 2DMBA 1RUMH 5KS9B 4P2RA 4I1PA 1W6LA 4EN3C 2DM4A 3ZMRA 4HBQA 4EN3D 1IT9L 1QI3A 1ZD6A 5D7LE 5FM5O 1MCNA 3GSUB 3O9WD 2DIEA 3I9GL 3UJJL 5CBAA 3HMWH 1CI5A 3SBWC 1JWSA 3ARFA 5DDHB 2JCCB 5DMYA 1BXUA 3H4FA 2Y5TB 5DRWA 3PXJA 1AG6A 1G6RB 3A4AA 2ZOUA 5CGTA 3BISA 1KZYA 4NXKA 4B9IA 1AKJA 1G7QB 5AVXB 5EU3B 4IBVA 3OJDB 4AGOA 1MF2H 3U82B 5CMAB 4OKDA 2VCOA 3ZKMD 5EORL 3JWDC 4LPYA 3G6AB 4IU2A 1HQRB 2GQHA 2XVLA 3VSTA 5E6IC 2IMMA 3MRFA 4JFTA 2C9RA 1D6EA 2B08A 3RVTD 3SYPA 2FO1A 1GYVA 3HUJA 3ZTNL 1PZ5B 3LZFL 4O2EA 4X4ZA 1OAXL 1X3DA 4HK0A 4HWEL 4MJJA 4MXWL 4LCIL 2YN3A 4NQDD 4OVUA 4OZFB 4NQCD 3F7VB 3T3PF 5CSZA 1E5CA 2FH8A 1K4CA 1MDAA 1CF8L 1NCNA 3QHFL 2YGQA 2F2HA 3H3PL 1RFDH 2OBGA 3FO9B 4Y88A 4QRPA 5BZDA 4XC1L 1PIFA 1WIOA 1NIAA 2J8UB 1P4LB 5IMMB 2E7BA 4X6BA 1SDAB 4G9FD 3GEFA 1PS3A 3WHXA 5T3ZE 1M05A 4RGNE 2EDJA 5FUZL 2WXFA 2PR4L 1HZKA 1TIUA 5KBKA 4ZT1A 2CR6A 3BSZA 5KYWA 2XA3A 3MKGA 4RGND 4P5TB 3KBPA 5E1IA 5T3ZD 4WDIB 5DZVA 1HHIA 2X6MA 3NK4A 2RH0A 2Z35A 5DK2B 1FORL 4YL4A 3VH8A 4NBXB 4U6YA 2W95A 4UT7H 3FSWA 3MR9A 5ISZE 1BIIB 2ZXCA 3NIFB 5ANME 1BQKA 1OK8A 1OM9A 3Q6GL 3BSHA 3IMSA 4NQCE 5EUOE 1ECZA 3VXPB 4MAUL 5CEYB 4WQOA 1I1YB 3VD4A 4WW1B 4MJID 1DFBL 4PJHA 2AV1A 5D2LB 4C56B 2NX5B 1V3KA 4Y1TA 1JHTA 2FO4B 3N43F 4FXTA 3SDXA 3UYOD 4OCWL 1SLVA 1U8PB 5I1JL 5LWYH 5IW6B 5SWZE 1DSYA 3QQDB 1JMXA 2VC2H 4RMUA 1ZT1B 1A6WH 2DIBA 3B9EA 4WKZA 5F97E 4FNRA 5DWPA 2BWDA 2CCWA 3ARRA 4NN6C 4NQEA 3UH8A 4AYFB 3DVGB 2P1YA 5K9JH 4WWKA 4H8WC 4N2NA 3TBCA 1VIWA 1Q9OB 4HPOL 2I26N 4LLDA 3NN8A 3SYCA 3TWCH 4M6MH 3WIIL 3LKQB 5C0BA 4AG4H 1YNLL 3N40P 3GPSA 3PDOB 3HFML 3PHAA 3BQUA 3KG5A 3OXRA 5KG9A 5BVJB 1AZCA 1H0DA 4M8QB 3MA7A 4HG4K 1J86A 4M7ZC 2FB4H 5F9WB 5E5MA 1O5PA 4OV6F 1XEUA 4AMKH 3VFRB 2IWGA 3PG2A 1RXLA 3QZOA 2C3GA 1M2OA 1OCOB 3V4VA 4BFFA 3TBWA 1I7RA 1N64L 1U3HD 4NUMA 3KPSB 1XGZA 5F1IA 2KZ1B 3EFOB 3DIVA 3AG2B 4NHCH 2WXQA 2APTA 2Z8WC 2MCMA 2WLNA 4OZHA 2NNFA 4OLVH 4D0DA 3BAYA 4JZOA 3MOBL 1ZTXE 3QHTC 4FNLH 1SXAA 3VSVA 4YGAB 1AGDB 4HWZB 3ETBF 4G7SB 3S35L 1QNZH 2DB8A 4HFWB 5DUBA 3IXTA 5DLML 1ZJAA 5D7KD 5C0CA 5E6ID 5DC2A 1TCRA 1HX0A 1NMBL 5F7UA 2YR3A 2NNAA 4BHUI 3VRJB 4YXKH 3TN0C 4JANA 4N2AA 3UEZA 3HPJB 1A6TA 3QNXA 4HGWB 3HUJE 5M94B 2XFXB 4IBZA 4PGCB 1MVFA 1T5XA 4OLXL 3VFMA 1V5JA 3NYKA 5BRZD 4NQDB 2IDCA 1KIPB 1ETB1 1VGEH 2C7UA 5F9JA 3IJEB 3NZSA 5KBLA 1NWPA 1NCCL 4JN1H 2R83A 4Y9EA 1A21A 1A4KB 3MTRA 3DUSB 4GRLD 2NXYD 3WS3A 1OIOA 1PQZA 2H3XC 4OCSL 5GRUL 3HG2A 4FS0A 3O81A 4LO9A 1BEXA 1BBDL 2CDGA 2ZP8A 4DZBA 1H19A 3GIZH 4Y8AA 1EV2E 1MCBA 4A6YA 5JXED 4HV8A 2CG9X 2A6KB 3WFEL 3O4LD 1HYSD 4KNTA 3H7LA 4HLJA 2AEQL 4OH2A 5DHDA 5BZWA 1YEDB 2NQ3A 4I0PD 2WMPA 5LVEA 3LZLA 3H9SA 2VDKH 4GSDL 5E94B 3ZMEA 2H45A 3SGEI 4LASL 1Z0NA 2YO3A 4XPTH 3V6ZA 1XF4B 1FFOA 3UBXI 1TR7A 1L9MA 5F1KC 4J3OF 5F6IB 2BVPB 2ZCHH 5DRZB 5DI8B 3VI4E 4LDCA 5AB9A 1Z3GH 3NCBB 4PYHA 3TBTA 2VERN 5BQDA 3KGUA 4QHMB 3C5ZA 4X8JB 1N9PA 2CU9A 4FFZL 1IGYB 4PJFF 3HE7C 5FHBH 2KHAA 3RWEA 3T0XA 4NQCA 2DM7A 2ICEA 1JZDC 2C34A 2HG0A 3N44F 5FUOL 4KVNH 2DM2A 3FONA 3QUYC 1BIIA 4UQAA 1SYSA 2P7TA 4WTXA 3L3JB 4OUOA 3FOMB 1B2YA 5ERWB 4JPVL 1NCTA 2QL1A 2RACA 4XI5D 2LVCA 3LHAA 2IH8A 1Q9LA 1QEWA 3MRRB 4FKHA 4G8AC 2EO9A 4I4WA 2ARJA 2CRMA 3V6FA 1R47A 1IBHA 1YNTA 5FK9A 2O6DA 3UDWA 3IK2A 4ZYKA 4TKWA 2HT3C 4WTZG 2PUQT 3RVUC 1JNLL 3TJHC 4HGKC 2WLKA 1AR1C 4URTB 4HMEA 5IHHA 4GP8B 3LKSA 4KRLB 3KGRA 3L9EA 4QXUL 5DQJB 2K8QA 1HJBC 3VTAA 1KFAL 3PYCA 3T2NH 3JXAA 4FQJL 5K9KB 1NBZA 3IMVA 3FYIB 4IHOB 3QP3A 3RDTA 4J6RL 1P84K 1JF1A 3UTPE 4RLDA 5A40E 3S8WA 1FWXA 2XTJE 5ICYA 3FQWB 5CD3A 4FERA 1KDIA 2CZNA 4FMFA 2XCMC 1SJEA 5BMFL 3O6FA 4GIAA 3O4LB 32C2A 1VEOA 2AF2A 5CLZA 3MV9E 2A73A 5FHAL 3FUKA 2Z31A 3IFLL 4UYQA 1KEMH 2ZWSA 1CL7L 5MENB 4OZFG 2F5AH 3RY4A 1P53A 3NAAL 3QUKB 3AGVA 1UFGA 5E8DH 1MCHA 4J1UA 2XZCH 2HKFH 4AKOA 3F7VA 3DGGA 3X14B 1T1ZA 4GFXA 3IU4H 4W9CC 2X05A 5CN1A 1TF4A 4HBCH 3VH8G 4FQLL 4L3EB 4MFHA 4AL8H 5EDXA 3SQBB 4X8GA 3CIAA 4IBLT 4ZX6A 3I02B 4N2IA 3F04A 4HKJA 2I60L 4LSQH 1UCTA 3LMJH 1I1AD 1IJNA 3IJ8A 4LBEA 1PW3A 5C0CE 2IAMB 1OAQH 1I4FA 3WHXB 4JFXB 3TV3L 2Q8AL 2QADB 4M1GL 4OCXL 1J9TA 2CALA 3AB0C 5GGQL 4LSSL 5DZLA 2VM4A 1JZ2A 3ECUA 1Q9KB 3FTXA 3OWEA 3UTSD 1KJVA 1ND0A 3C6LB 5GRJH 4JFOB 3NBNA 2AK4A 1BM7A 3DUHA 3VFGH 4KWUA 2F58L 3Q5OA 4OFYA 1HESA 2F74A 2Q3AA 5ICXA 4UZUA 4KXCA 4N20A 5CFHA 5DUPL 3HNSL 4U6YB 2GT9B 4XVTL 2Q8BH 5CN3A 2WWOA 3D3VB 3RWCB 5C09A 1VADB 4BDVB 3OPZL 2DWTA 4QCIA 4DP1X 4N1EA 1S6NA 3GKZA 1IEAA 3QULB 1Y18B 1PU0A 2NW2B 1GCYA 4FZ8H 4OBSA 4LF3B 1FZJB 3LB6C 3PWNA 3I6KB 1QUPA 2YSSA 1SXBA 5EULV 1FH5L 4Y4HB 4PTTB 1D3CA 1K6QH 2VLLB 2FQGA 2OMBA 4GG8A 2NR6C 2X6UA 5GSRA 5C0AD 1OAYL 1PKQA 5JIHA 4WSKA 2F53B 1LNUB 4OD3L 2A74A 3QUXD 1W6WA 1QSZA 3AADB 4AQAA 3SOTA 2WQSA 1QKZH 5ADOL 1GOFA 2X53A 4YHMH 4NQEB 1JZEA 2VSMB 3R4DA 2VW4A 1J48A 4J8RA 1IU1A 4HS6B 3H9ZA 1CFQB 2NUPA 1T4KA 3LDBB 4KH2A 3HBGA 1E8YA 2GSIA 2G0KA 4G8IB 4DQOL 1IKFH 3HCVA 3WLWD 4IRJA 1WRFA 2X5PA 5EMYA 5LXGH 2FSEA 1Y1DA 4KFMA 2ZYHA 4XAWH 2WK2A 1ETJA 3M07A 2ZF8A 3DETC 3QWNA 4DTGL 2EDNA 1S7XA 5DTFA 2J3SA 2ZCLL 5F3HB 2MCAA 1U8HB 3RVXC 3F6LA 3VQ1C 2E6QA 3WJLA 1KBPA 3T08A 3O4LE 3AW5A 2H32A 5K39B 5E2VH 4RMQA 3VW3L 1OHZA 1YJDH 3VXNA 5GRVK 2EZ0D 5ESAA 1RMFL 3EF4A 5IR1A 3NTCH 4BV1A 1VPOH 3WGVB 3QUHA 3NRFA 4OCMC 1MCCA 1F1GA 2J57A 4CVUA 3GLZA 4I89A 3MCLH 5AALA 4AYGA 2ADGB 3ZE2B 4KI5D 3VXOA 1E6OL 2VR4A 4P2AA 3MBEA 3L9RB 5LAXA 3IDMB 3NH7H 4ECNA 3HHSB 3CDGB 4RQQB 3ZMNA 1JWUA 3JSSA 4ZD3H 3NACH 4NX0A 2X4QA 3O2DH 3S2AA 3Q7JA 3SDDC 4EI0A 5KSAC 1NCJA 1TSRA 2YMTA 3T65B 2DJSA 1QSFB 4XN1A 4NUPA 1WJ3A 4Z7VA 4HKXA 2WLZA 4PRIE 1W0WA 5IK3A 1FDLL 1CT8B 3E6HB 4KTYA 3UIYA 2AQ1A 1S7UA 2JKRM 3LKNB 4PIRF 1I1AA 4P0DA 2VMEA 3HG3A 3MLRH 3CHXA 4KJQD 2BHYA 2OXHA 1ACZA 2NXZC 1AY1L 3DX1A 5I73C 3CXDL 5IEKA 3CN4A 2ARJQ 1KCSH 2ZPKL 2LABA 2VN4A 5D4HA 4XVSH 2ZX6A 3VFVA 4MTMA 4X5XB 4WGWB 3HIZA 4R4FL 3RJOA 3OTTA 1A4KA 1PY4A 4A04A 2ICEC 5EO0B 3ILDA 2DQIH 3C5SA 5JO5A 4P9HH 4NBYB 2H9GB 2QVIA 3FB8A 1RJLB 3FQ1A 1A5FH 4X9BA 4IU3A 3LQAL 4PG2C 1GPOL 1ZHBB 4MWFB 4Y2NA 5FLVA 3VD0A 2HG5A 1I9RH 1AI1H 1JNHA 1RZJC 4BCXA 1U8JB 2ADJB 3BESR 1HILA 1KGWA 3SKJL 1I8AA 2BSSB 5I8OH 3VWKC 1UGNA 3H9SB 1CFVL 1Z3RA 4MXVF 1TXKA 4OD1L 4BGDA 5TDNA 2F5BH 4H8WL 1XGYH 4JDZB 3CZJA 1UEMA 2DQDL 4ZTPL 4RAVB 2ZUXA 3TF7C 5F0MB 1IBYA 5E03A 2CO6A 3VCLA 4MD0A 2AQPA 3KDMA 4ZOBA 5FO7B 5KSAD 3ZO0A 4O02L 1WQVT 5AAWA 1AACA 1BZOA 5JW3L 5EZOL 1ZT4B 3M17A 2VB5A 4AUYA 3K1DA 4YSOA 4LCUB 2FTAA 3SDDA 5I30L 2DWEB 4JRXD 3M8OL 3PL6C 3CHQA 4M62H 3SY6A 1O6SA 4AEFA 3KPOB 2QPUA 4L4VE 4OM0H 5JIIA 1I8MA 3FOMA 4M6OL 3HC0B 4P3CL 3ZHNA 3QIBA 4KZDL 3VGAC 1C8QA 1MCIA 2XJKA 1BGXL 4UINH 5JW4Q 3CVDA 3N1QC 1G9MC 2EECA 4NENB 4OF3A 5KW9H 1MN4A 4QNPE 5C0JB 4G8GA 3KDPB 4RBPK 4DCQB 2Y1YA 1X5MA 4PHXA 3S3BB 5JPMA 4L9DA 4QRRE 4UIMA 5IVXA 3KPMB 4LGPB 1KYAA 1MCLA 1PFOA 2DIJA 4CBPA 1IM9D 3KPRB 4ZYKB 5J12C 3QDGA 4OJDH 6FABH 4JZJB 2APXA 4JO4H 3FU0A 2R4SL 1I3GL 4HHWA 2FECI 1OV8A 4GFTB 1ZLSL 5KVMC 5DQJA 1SHXA 1ZWIA 1JV2A 1B3JA 1S9WB 1J8RA 2DAVA 4J3WA 2ZSVA 3KYMA 4IS6B 4BQ9A 3L4CA 3QAQA 1JF1B 1NL0L 3LQZA 4XP4H 1YDPB 3PQYA 4MNQB 3GSNH 1MLBB 5HHMB 1K5NB 4QGTA 1DQDL 5CHNA 1A9VA 1HH9B 2R1YA 3IJHB 1AFVH 4BWTA 3O6FB 4KKBD 4R8WL 1SHMA 3SE3A 2P5WB 4JVWA 5FYJU 5A2LH 4Y16D 2Z31B 3Q3GB 4ZMYA 3P9WB 2LV4A 3NJLA 4ODHH 5IREA 1CTMA 5B7EA 2Q7YB 5HHOD 4JQIA 1E5BA 1M6OA 2X4RB 4QXTA 1MDTA 4YUEL 1E65A 2CKBL 5KYUA 4W70A 4ANKA 3BFOA 3U83A 3AZUA 4L3AA 3U0WL 2IXQB 2QSCL 3TGXA 3II3A 5I71C 4FG0A 4HU2A 1U8CB 2VIRB 1CD1A 2O30A 3WE1A 4BSJA 5IQ9B 3GMLB 4HUNB 3RFZB 5I1EH 4NB7A 2A74C 4LSVH 1GS8A 4UUJB 4FI8A 2ZAGA 4U1SA 4FZEL 2WN2A 3R1GH 3L1GA 4AVHA 5C97A 5JHLL 5DMKA 1N6VA 1M7UA 4NZFA 1RZKH 3VJ6A 4K5PA 3D2UB 3F2LA 1H6TA 2BNQE 3NFSH 2C4XA 2ZKMX 1KTDA 1LM8V 4ADJA 4L4TE 2VLKD 2VN3A 2WUBH 3NIGB 4WI7A 4QNPF 3OAYK 1D7FA 1EUUA 4R8WH 3EH4B 3MPCA 1AFVL 5D7LD 4C83A 4L23A 3TBYA 1H5BC 4K3DL 4XMPH 3VSUA 5IHUL 5TQ2L 1YMHB 4PGJA 4F2EA 2NW2A 1BDYA 2NR6D 5FW6A 3QDJE 4PRPA 1FGVL 3UBXG 2E9JA 3N06B 1MW0A 2EYTB 5E51A 4N2CA 2HP4A 4GY4A 3HC3H 4XCCH 2VXQL 2MJWA 2E8ZA 2DQCH 4ZX3A 3PGDA 4YPGB 3FRPA 4GUPB 5GGRY 4ZUTB 2QPDB 4LP8A 4QRFA 3IU3B 2WZ5A 3ZRCC 3TCLA 3UJTL 1I53A 3DO7B 4YIQB 3JV0A 2O93L 4N25A 3CBJB 1E4XL 4IRZH 2H6PA 2J20A 5GS0C 3F65A 2AS5M 3VDAA 1NGYA 1F4XH 2QQLL 2AITA 4FNSA 3DUUB 2OQJB 1CLZL 3X3GL 1J11A 2DLFH 2RQ8A 4MCZB 4F20A 3S8GB 2FLRT 1F3DJ 2WZ6A 2XDHA 2VZSA 4ODWA 5KJ4A 3UTTD 2AERT 1EVTC 4WW2C 4G9FB 5B3SB 1DJGA 3PIQB 5D6CB 1EEQA 5EEUA 3HRZA 3ZUNC 1FSKB 4J28A 3MI6A 3QORA 3TT1H 1SVBA 2PW1B 2VJ0A 1YYCA 1VZGA 3FDWA 3MNDA 3D06A 1S9YB 4EI5A 1SDDB 4UM8B 2GJPA 3I50H 4NKOA 1P7KA 3EDDA 1X5GA 2R1WB 3V7AE 2WXRA 1WBYB 4ZFOL 5J89A 2Y0SA 3BVXA 1G1OA 1CYXA 1AR1D 3CXHJ 2AV1B 1JBJA 2DWYA 4GO6B 4MA8H 5GQBA 3Q0HA 3B5HA 3DSFL 5I1CL 4V1DB 1BZ8A 4N2GA 1XR9B 3D2UD 3H0TA 4PRHB 4H8WH 4M8VA 3ZDWA 1GJWA 2JK5B 4FLRA 5L4MA 3R0MA 1J5OH 1CFVH 1DQKA 4EZKA 5GZNC 1ODAA 2ZOLA 1OCCB 4JG0H 1HAWA 2OTPA 3CSTA 4MJ4A 3HHSA 3CUPA 3KCPA 2VMDA 2VQ1A 2OL3L 8FABB 3OKDB 1XCQA 3G5ZB 2J1XA 4WTWA 4X7SL 1G6VK 2K9UA 4ALAH 3V0WH 3ZSTA 4XP5L 5L0QC 2LT9A 4PLJC 4JO1L 2ZUQB 3US9A 3GYRA 1W72H 3U46A 2ZCZA 4OZGB 1UM4L 5HTSA 1M71A 1YMMA 3RX7A 1MJ7H 2XYCA 5B22A 2XN9B 4P9HL 4F8PA 2EDYA 4QI3A 3V5KB 2C9XA 1Q0YL 2EDTA 2JB6A 3HE6B 1R17A 4GAGL 2WSDA 5TE6L 1QFWL 1LVEA 3SKMA 5I18H 5BVJA 3QS3A 3WY3A 1KCSL 1K8IA 4PJEE 3EHBD 1AOZA 3RE0A 5CO1A 2WNWA 1HE7A 4NZRH 2XWXA 4X5XA 1EO7A 4Z7QF 5E4AA 4H1LB 3OJVC 5FYKL 3W1ZA 2CHZA 3P3RA 2A6JB 1K85A 5IB4A 3NIDE 1GS7A 2PYEA 1RZ8A 3V0VA 1I7RB 1MI5A 1BG1A 3LHPL 4UU9B 4Z7VF 2ZOKB 2JLLA 2VR7A 2M83A 4E5XG 5EUKB 1VGKA 5I66A 4D3CL 4UDTA 3ZE0F 4EIUA 1OD9A 2HG5B 4RMTA 2DBJA 5IM7B 4FFTA 1IKNC 3NACL 4ZPVB 2JCCE 2EC9U 3BSGA 1IGML 2PCXA 5IMKB 1CDHA 4EI5C 1ZHLA 2BSSA 3OKKB 4HWBL 3CDZB 3MLSH 4H1LH 3KXFE 3NCYP 2WB7A 2EE2A 3QGVA 3IXTB 5CJ5A 1BEYL 3KD4A 4AT6B 5ITBL 4M6NH 4HUVA 1BWMA 4R83A 3HNVH 3FFCA 1A64A 2AP2A 1XF3B 5EIQA 3NTCL 12E8H 3QB7C 1RMFH 3EH2A 4JANB 3VRIB 1ZA6B 3VFOB 3D39D 3NPSB 4OJFH 4PJCE 4PN6A 4Y5YB 5TF1L 4K7FB 1XXDC 1VACB 3SDDB 3VFMB 5KSAB 1U92B 2ZCLH 1W72B 4WUKL 4ZS7H 4GLRI 3RWIB 1KV7A 3G6JE 4JM4H 5J0BA 3CFUA 2N56A 5DC0A 5DEFB 3CMOL 5DS8B 3SE3C 1Z5LA 3CXFA 1GSMA 4OBRA 4FFYA 4P2YA 1AYRA 4LOFA 3MROB 1KYFA 1CDBA 3RKDD 3DK0A 4BZ1L 4NO2B 5FC9A 1SOQA 2Q0ZX 2AQ2A 3GEWB 4YDIH 2IPUK 4NRXB 4G8GB 3HAEA 2WXNA 1O6TA 2ETWA 2OULB 4GRWB 5A16A 2MOVA 4YHML 4ONHB 1QKZL 1BJ8A 1WUNT 2FWLB 2OZ4L 2BW4A 2EEBA 4DEPC 4DHLA 4PRHE 2J88L 3WXWH 4IOFC 1P4IH 3DO3A 3QJZA 1W0VB 3QRGH 3U0TB 2XBZA 2JFCA 1UWFA 2HZHA 4BWWA 1NOFA 2DD8L 1HI6B 1UCBH 3O4OB 4X80H 4X6EB 1HSBA 4U6XB 1CGUA 4H0IA 1PX4A 4MJ5B 2DQHL 1FZMB 3DHJA 4R7VA 4ZG1A 4QHMA 2BK8A 2IANE 1YYMH 4LPUA 5C70A 1IGYA 3EKCA 3AXLA 3IJHA 4HGMA 4R90H 5F6HJ 2NZ9D 5DZAA 5FFGA 2YD0A 2XG5B 4HD9A 4YX2L 2DQGH 2O5NA 4C4BA 1MFDH 1ROCA 4JQXA 3ARFC 3M6DA 5D2LE 1UZ8B 2BCKB 2P8PB 2A4EA 4C56E 5T1KA 4H8PA 4UM9B 1YVLA 2CUHA 2XACC 4PJXE 2KQNA 4H7VA 1K2DA 3EXLA 4OF8A 4WK0B 1MRFH 3WNJA 4ZMXA 2GY7B 4XE5B 1S46A 4Z7UA 3FQXB 4LLWB 3HB3B 3UPCA 3FSVA 3NA4A 4LSSH 4U6HA 2QVTA 1CE6A 3TXAA 2Z7UA 5DU7A 4S2SB 3UROR 3LKPA 2WNXA 3QFDA 1UB5A 1X9LA 4FN0A 3FU6A 3LIZL 1G9NL 3RFZA 5KEZA 1RJZA 1VFBA 1DBML 4GS7B 2WSPA 3V0HA 2BINA 3BVNA 3KYKH 1USZA 5D7IA 4FQLH 4LLMB 2EVGA 2A9BA 4GKZB 4ZXBD 4XN7A 5K9KA 2I7OA 3F58H 2PNDA 4WAFA 1ZA3B 3Q43A 5DUMH 4UAHA 2XZCL 3D2UA 4L8DA 2OMZB 3OX8B 1VRSA 3C6LC 3DX8B 4FF9A 5D72L 3PU7A 1U93B 2VLRB 4Q9QL 2E4FA 3KLKA 5DT1L 3O0LA 3O4LA 1VHPA 4HJ0D 2VC2B 3RWJA 4PJCF 5FHAH 3S35X 4ABVA 3GWJA 5ESQB 3HZVB 5LGKA 3L3HA 3VU1A 1P7HL 3WTUA 5DC9B 4WFEE 3ZE1F 5LCVH 3Q48A 2GIXA 3BKJH 1CUOA 2YQGA 3G6JB 2PXYC 2N01B 3GSXA 3TN0A 2WP3T 3K4ZA 2Z9TA 2QHRL 3SO3C 4NZUL 4FQJH 4JFPB 4LLVA 3AT0A 4R4BB 4UDUA 4I77H 4KY1L 4FP8L 3WY1A 4JY6A 1QWNA 3WD5L 5BOZG 1JHLL 3ETSA 4D94A 3QG6B 1IC7H 2WQVA 2ZOWA 5IV2A 1F4WH 2XZQH 2OTUB 4OI7A 1TETL 4Y5XA 4BA0A 1IC7L 1UQSB 1U6AL 1V10A 3ARFD 3ARBB 4RGOH 3K2MC 3AT9A 1XH3A 3ZTJH 1IAKA 4WUUE 3QI9D 3EDEA 4FP8H 4R5TA 4PLNC 2MHAB 3DX4A 5AAWC 5IW1A 3JWOL 3MZTA 5D1QC 4UQDA 2G2RA 1CDGA 2J8UE 3N85L 3WNMA 4L8CA 1D5BA 2QV2A 2YOAA 2FZ3B 2GTWB 1JXDA 1H8OA 3LRSB 4NS0A 5GS1B 3SDXF 4U1HB 2O5ZL 4YO0A 3UZEA 1IMHC 1DQML 1LWHA 1YEIL 3RWFB 3ZZSA 1XWVA 2CJTA 2XOTA 3CVHB 5ITFB 3PHSA 1S9YA 5I6MA 3A22A 1BQSA 4HS3A 4Z0BL 3L4WA 2XV0A 3B9KA 3FO1A 3V79C 3E80A 4LIQH 5HGBA 4Q4EA 2J7LA 4F7TB 4P2CG 4NO5A 5JA8B 4S0HA 3FT4A 4GKNA 4TNWF 5E4EB 4RMVA 1N7MH 2MCPL 3WUWA 1E0OB 1Z3GL 5F3BA 4XTRD 4N26A 3N9GL 3L4XA 5LLIC 4FFYH 1FNSL 1EXGA 2HWZL 4PJ5E 5EU5B 2JE8A 1ASOA 1WHOA 3O45B 4PRHA 1DBMH 4JZNA 3RTQA 3MN8A 4W9GC 4P8QA 1R9FA 4K8RL 4G6FD 4S1SL 4BJLA 5F88A 2F54D 2OMVB 1R46A 3WNIA 3K6NA 2HYMA 5D6DC 1YRKA 1XCQB 3G5ZA 4WO4C 2DQFB 5E9AA 5E0FA 1PG7X 4RMSA 3P3SA 3EDFA 4LL9A 3QIWC 4Q89A 3VG9B 3NIGF 4Y1SA 1IQDA 4OZGA 3ULVH 3ESVF 2V7HA 4LLQB 2ZYSA 4M9OA 5JTWA 4GIPD 4PREA 1MRFL 2OMYB 1EJOL 1NCHA 2XZAL 3RVWC 5SWSB 3BP6A 3OB8A 1TENA 4RAUA 3PE9A 2PP9A 3Q6FA 4YSCA 3TJEH 5DVLA 1HYRC 3KHQA 2HRPH 5AOIA 4KY2A 1VGEL 5D7JD 3X11A 1ZANH 2GVYA 2IDFA 4EMZA 5AL8A 4AZ8B 4NNXA 4Q9RH 3RRQA 1XXFC 5DWUH 5G5DB 1PZAA 5F1NA 4NQVB 1DVZA 4YWGL 1KJ2B 4YXKL 3ULUF 1F41A 1JN6A 1NEZA 2Y7NA 1SXNA 2COQA 3QHZL 1KCBA 4HISA 1ZPLA 3EJQA 5C92A 4JQIH 1XIWB 4P23B 3EO0B 3A67H 5AVTB 3VXOB 2PCPA 3PJLA 2ZNXA 1P4IL 2VRQA 4K7PL 3FTWA 2OV0A 3I9AA 4KITB 2JB5L 5I17A 1PBYA 5AAMC 1OCWL 5ALCH 3CDGA 4RQQA 1I8LA 3FU7B 4CKVX 4MVBD 5ICZB 4OLVL 4LQFL 5E1AB 4APQB 2VT0A 1S3RA 3LPWA 4XRCB 6TAAA 4UQ2B 3X1GA 4ZZKA 5IY5B 3LSOA 5DR5L 4IIZA 1AIZA 4ZMNA 4F7PA 5IFJB 4Z23A 3E6HA 5F0PB 2MPAL 3VRLF 1I1AB 4E42A 1IBGH 4ZMLA 3SDAA 4JM4L 3KBHE 4DN3L 4HK3N 1VDGA 4ZS7L 2UYLA 4NLAA 1MWAL 1CMOA 2CPUA 1RUAL 4W9JC 4RZCB 5IT2L 2B1AL 4G7VH 2YGPA 12E8L 1N5AA 3B2VL 3P2DA 2Y22A 4L4VB 3TYFA 5JORB 4RWYH 3GBEA 3MROA 4I0PB 1C16B 2EDOA 4LSTH 5MEPA 3CDFA 3WMSA 3HNVL 4TRPH 4RCAA 4NRXA 4CVZA 5AW6B 5I6LA 4AIOA 3WTTA 1PLBA 3VG0L 4A38A 5A16B 1NCOA 2ITCB 3IKCA 2SEBB 3LAFA 3O0RL 1F4YH 3D18B 3RNQB 3QJXA 4M43H 1CGSL 3LZRA 5HPOA 1TVHB 2J73A 2H0EA 2F7PA 2X0WA 4I2XB 2YAFA 5GGTA 1B88A 2G4EA 5KSUB 3T6VA 4N5UA 3FH8A 2MFNA 5D1QE 4OIAA 4WVRA 1A9BB 3BYYA 2H3KA 4XN5A 1KG0A 2AQSA 5EIIA 3KL3A 3WUZA 5I76B 2X2UA 4WI9A 2E6PA 4CADB 1FZMA 3BN3B 4JREB 4LCWE 1TU2B 2VQ4A 3KYOA 2VDLL 5IVZB 4U3SB 5KSBF 4K3EH 2WXHA 4DUVA 4HLZG 3UX9B 3CJJA 4OGYH 5AWNL 1E27A 1KPRA 3GMMA 4DN4L 3QPXH 1VZHA 3BN9C 1O6SB 5TE6H 5I18L 1I8LC 1UJ3C 4FQXA 1ES0B 3QWRA 3QUXC 4Y0GA 5LNDA 2O5YL 2FLMA 3MJ8B 2PO6C 3IYLW 3GZKA 3QIBB 4G11A 3GGWA 3QJFA 1MJ7L 5IJKA 4RISH 4FABL 2ATPB 4YL9A 1BAWA 3BCFA 3RL2A 4KXDA 4LEOA 3WXVL 2HUHA 4G7RB 4FTVE 4ALAL 4L5FL 4CSZA 4IJ3B 4BFRA 4KX7A 5C9JA 2R0KL 3CVHL 3KPRA 3QFDB 3GSUA 3ES6B 3CH1A 3LJ3A 4HCRA 4Y2OB 1YQ2A 4AC2A 2BOBA 1EMTH 5DDHA 4F7CB 1R3HA 4WU7A 2JCWA 1HN1A 3ULSA 1JTOA 5HDWA 1GMEA 5DHVA 2JQMA 3SO5A 4D9QE 2HTLD 4RVBA 2BCMA 5CXPA 1EEZB 2B59A 1BVZA 1NCGA 4OLYL 4LCIH 1MLBA 3CLEH 3FB5B 5IJVB 3RI5F 2WXJA 4GAJH 1NIDA 2V7NB 4J23A 4TULL 1N59A 5DHEA 2KMWA 2AVGA 3RX5A 5ESQA 4L4TB 2CBTA 3C60C 3TT1L 3ZE1B 4XN8A 3V7AG 4W9FC 5TTRA 5BZXA 4XP9L 5DD6A 4A66A 3QAZB 1MF2L 3MBWA 1F1AA 4XPGL 2CGZA 1CLZH 1G7IB 2WYZA 4Z7UF 3L4UA 5KSVA 3FO2B 4N9OB 2EILB 4UILH 1G87A 1DCLA 5AVZB 2E9GA 3S3JA 3VI3F 5BZDB 4G9DA 4HEPG 4PVMA 1WITA 3QG7L 1U8CA 4KO6A 2RA1A 3QFJD 4LIQE 3VU2A 1B9KA 1MRDH 1LILA 2OTUA 5HXMA 4YHYC 5ABZA 1P9MC 3O3BA 1TQUA 5J1SC 1N8ZA 15C8H 1T7XA 2BS9A 4L3EE 3VO0A 5IF0A 4M5ZL 3D3VE 4G5AA 4ZTEA 1L9TA 1ZLWK 4Z77A 2DMCA 4FTVD 2Z8RA 4WHCA 5DMKB 4NHUB 3GBNL 4YBQD 1Q4NX 2NR6A 5L8LB 3KS0J 4X8CA 2P3YA 2H3NA 3PREA 4PJ9D 1T2QH 4K9EH 4PJ8A 4ZUWB 2VW7A 4JK0D 2DZEA 1KLFB 2W65B 5HGHB 3TOPA 2EYSA 1N18A 1PVHA 2P26A 3HW7A 2W0KA 2YN5A 4PS4H 1NC4D 3IMBA 5CEYA 3QO1B 3ZTEA 5C0GA 5IB2B 3WTXA 1QUNA 4GRMA 5C8JA 2BP8B 5EOTB 5FYJL 3IE4A 4PGDA 3RI5K 4P5KA 4ADGA 4PRPB 5BZZA 2XC8A 4UV4L 4H40A 3TT3L 2GJ6D 4WJKB 1RJYB 3PGFH 4H0LC 1E8XA 3F62A 3MV8B 2ZJSH 3OL2A 1EWHA 4LSVL 4MKTA 1TJGL 5I1EL 4KK9D 4PBVC 3MREB 3FQYA 1A66A 1JOIA 3AAZB 2HLEB 3M1OA 4ZUTA 3COOA 1AGCA 3FTGA 1P6FA 1IGFL 1HKLL 3TA3D 3MRMB 1JPEA 2G0LA 2F54B 4B50A 4BD4A 4K0OA 3HI1B 3C60A 4Z5RA 1BD2A 4MQXD 4Q2ZB 3U0WH 1LDSA 4UTAH 3E7JA 4YHLL 1EAPA 3FQTA 3MX0B 4GRWE 4GW4B 3QNFA 4N2OA 5J5EA 1EO8L 5BUAA 3EJCA 3QQ9D 1URIA 3NA9L 4O2FA 5FKAA 5I1LA 3CG8A 5FB8B 4YFEA 2J43A 3KPRD 4NQEE 2BLFA 2EXWC 3I3EA 3OXRB 1N19A 2D3LA 2HVKA 1RVFH 1GTFA 4JKNA 1X4YA 1KTBA 1DQTA 4GMTL 2WQAA 4OGAD 2FHFA 4U1IA 2C9QA 2J8UF 2XZZA 2MNWA 4YBLC 1UYWL 4XP4L 5SX5H 3SDCA 1KJ2A 1VFMA 1X9RA 3V4VB 1NCUA 1XAUA 3KLHD 1TZ8A 3DYPA 5I6XB 3FFDB 3VYPA 3MGTB 1F0LA 2LFGA 3H8NA 3I6LE 5KYXB 4G3YH 5DGRA 3GHPA 4JY4B 1XR9A 3H0TB 5CZRA 4AM0Q 5HYQA 2RFXB 5GS3A 1U2YA 4QRQB 3HA0A 4FQ2H 2EACA 2X38A 2P4AB 3MRNA 1MJ8L 1Z7JA 4U31A 1TQBC 2VXTL 3GM0A 3CNKA 4EBQH 1DDHA 5CFAA 1ADQA 4WW2A 1C8PA 4NRYB 2NXZD 4X98A 1QBBA 1B9ZA 2KQMA 1CZ8L 3HPLA 3HRZC 5HYSB 2QDVA 5ENWA 5C0AE 5DURB 4LDEB 2WTRB 1U42A 2WLHA 4M6OH 4BSVB 3G04A 3KPNB 1QBML 3AS3A 2AZAA 3FC8A 4M62L 3BP5B 4N86A 5FYJH 1KB5L 2D2OA 4WWOA 4XN4A 3BPLB 1ASQA 4H88H 2B4CL 4N6RA 1OF2A 1T22A 3GRWH 4J7RA 1O9ZA 2XRAL 3E38A 1I9IH 1OD7A 1RZJL 3SKNB 4TN9A 3ARDC 4YZFE 4LPTA 1FL5A 4PD4K 1IKNA 2ATKA 4UNUA 3SPIA 4Q0XL 2BFVH 3IN2A 3L4YA 2Y2WA 2B1HH 3HOGA 2BXYA 4JE0A 3UFIA 1LP9E 4O02B 3Q2NA 1A7OH 1HKFA 5FF6A 4JFEB 2A6KA 5DZPA 3GINA 1DQJB 3GUTA 5D4JA 3TCXA 2CMRL 5AB0A 2ZF9A 3OZ9H 5CKAA 1UASA 2VAAA 2FJGB 5IMKA 5CAYB 5HYJE 3LTVA 2WMPB 2I9LB 4L29B 4PJ7F 1AI1L 5DURD 2YPLD 3MAWA 2X4SA 4ZW6A 1XGUA 1DLFL 3HB3C 3TZVC 4JKWA 5H35A 1MRCL 1V3MA 5DJ6B 1AKPA 2CXKA 1QVOA 1A3ZA 2YLKA 1E5ZA 4J8QA 1KJMB 4J3VA 4QWWC 2CGYA 4ABUA 4CADA 3CFBB 4UILL 5LGJB 1O75A 2CRZA 1IL1A 3H9SE 5AVYB 3TU6A 3RWHB 4OLZH 1QQDA 3OJMB 5CBEB 2FAUA 5CU5A 4ZPTB 1JGIA 4LSPL 1D6VL 1JZFA 1JK9A 4NP9A 4XP9H 4NKDA 3S5YA 1YEHH 1JERA 1ETZA 5IG7B 1FQ9C 1ULVA 3ZIYA 3S36L 3ZXAC 2GJZB 1CLCA 1FDLH 1UATA 4QYOA 3KJ6L 4TULH 4QOKD 1TMCB 4CU8A 2GK0B 3GK8H 4OLYH 4GI6A 2FWSA 5TQ0H 1VFAA 1RURH 3IM1A 3CCHB 3CSGA 3EO1A 3O2DL 4DWHA 4F37K 1UXMA 1X6LA 2YAOA 1H3PL 1PFCA 3GSWB 3TEXA 4AYMC 3ISWA 4PJAA 3WV0A 3LEXA 3U79A 4KI5E 1Q1PA 3W9EA 2VDLB 3LS5L 3GTVA 1E3FA 4JEGB 3GF8A 3UDWC 5HHOA 1L7IH 2FEDD 4PJEA 4PGBA 3I6LD 2G2PA 3BEWA 4EOWH 5A3IC 3PWPE 4KTDL 3R06A 3ENEA 4ODUB 3RDTB 4I18B 2JCCF 3J2PA 5L7XH 2Y7QB 2VERA 4KKLC 1HL5A 4H5SB 3WXVH 4N0CC 3FQWA 1THCA 1YN7A 1AGEB 1I9JH 3MNWA 4NUGL 5HYSG 3LPFA 1F5WA 1LXMA 3OGCA 3L2MA 1CXIA 1GSKA 4Q56A 1OAZL 2FUTA 3MYZA 4JHWH 5HDQH 2R9HC 3EBHA 2R15A 2A73B 1OGTB 2ZOOA 1D5MA 1CLVA 3D0LB 4X5RA 5D2NE 3NIDF 5MENA 4HQQL 1NKGA 3C9NA 1HXMA 2GC4C 3NPSC 4XAWL 1IM3A 1NGPL 1CIDA 3MUGB 1MQKL 4R7LA 4O51A 5DEZA 5AWNH 5LNGA 5D8JH 3KW7A 3MBWB 4KZEL 5DD5L 2IPKB 1T1ZB 4LCCA 4AYID 1AE6H 3IWVA 3W57A 3HE6C 1KCVL 2GBTA 2W60A 4JFSA 1JHKL 3SQBA 2HKHL 3K91A 4DVBA 5F7WC 4NM8L 1DBAL 4K94H 5ACZB 2B14A 4N90D 1DJIA 5JA9A 3V7MA 4B60A 4HAGA 4ZK8A 1E40A 4LCYB 4MLSA 3NJIA 4M7KL 1D9KD 1NGZB 5F7MC 4EKJA 4Z77B 5C7XH 3HG0A 3SJVD 2AK4B 5DRNB 5I0YA 2ZWYA 3HVNA 3NFNA 4PRBB 4PP2A 4TNEA 5DO2D 5CMAA 1WC7A 3CHOA 4JG1L 4HIEA 3AXHA 5CEXA 4EI6A 1J5CA 2VRKA 3SBWA 1FZOB 3HZVA 2YPVA 4MD4A 1A6AA 2OSXA 5JPNB 4LFHG 2QKIB 4HUMB 5TGBA 9PCYA 4YSEA 1G7LA 3WIFB 1ZGLA 2BHFA 3QULA 4LFHD 1ZVSA 1DVUA 1WFMA 1GZPA 2YD7A 4S10A 4TL4A 5DJAB 5KAQG 1RJYA 3RB7A 2VLLA 4M48H 5KSUA 2JJTC 1VEPA 4X5WB 3SDCC 3L95B 4L05A 2F53A 3BPOC 2X88A 3TV3H 1A1OA 2CA3A 3HKFA 3MLVH 2XV2A 5IV2B 3QDME 3AAZA 3GHBH 5E2UL 1DLHB 4QYAA 4OFKA 2D7MA 2VMJA 4Y5XB 5D5MF 3WJJC 4HUUA 3FTUA 3HI1A 3QE5A 4Y16C 5JPMC 1U21A 5CEZE 4PRHD 4LARL 3IJSB 5AENA 4LEXL 3ZR6A 3CVCA 4NZTH 2O6FA 3KR3L 5AOLA 5IB5B 2G2RB 1YN6A 3OVUB 5H2BB 1WH0A 2HKFL 1SJVA 2MQCA 2FZ3A 2GTWA 2K70A 5CEZD 2Y36H 5B4MC 1A6ZA 4KZCA 4ORGA 1KEML 1UB6B 2Z93A 3IFLH 1MIEH 4Z7UE 1E9OB 2LTQC 3NUKA 3WIHA 4X99A 4WCYL 2R69H 1SPDA 1UH3A 2OX5A 2QQNL 3WOVA 5GGTL 3VXPA 1F3JA 3BHBB 5HSFA 4WW1A 7PAZA 2XKUA 1U41A 2FL5A 1JZHA 3M7OA 2ZKWA 1BREA 4GSUA 4LHJB 5D1XA 1JGEB 2ADGA 4JRXA 5K59E 2CIIB 4ODBD 4Q74A 2XUWA 3L9RA 1MW3A 1JNLH 4UAOC 1KLUB 4WEMB 4X5LA 4X8XA 3ULVL 2YRZA 3DX3A 3H7BA 1BVKA 1DUYB 1FL6B 1ZPUA 2BIMA 4X4YA 3BAWA 2C9PA 5AVQB 4QAWA 3FH7A 5HPMB 4IW4C 3BGFB 4WWKB 4ZXBB 4K2UL 4PG9B 3D69A 2Z1PA 4S1SH 3S0PA 3ZYZA 1N6QL 1UD6A 3MRLB 2Z92B 3HAEG 5IMLB 5ENWB 1P6WA 4WV1A 4L9LB 1A3RL 4ZRGA 2J5LC 2H7WA 3BKYH 3EOAA 4KXBA 5GISH 5HDBF 5JHMA 3GTTA 2CDEB 2OXHB 3QZMA 4FHKA 3N9GH 4XVUD 2QR0A 1ZS2A 2OP4H 2ERJB 3EFDH 3HVDA 4AEHL 3FQUB 4OLWL 5FHBL 1S5HB 4GUOA 4F57L 1MCOH 4IIQB 3U30B 5ID1B 4QHNA 3BO8A 1U8IB 4F8LA 1TYEB 1PZSA 4AEHH 3LRHA 3PQYD 2I5YH 2OP4L 3O6FD 1JN6B 4KGJA 3B3IA 3TBWB 5FYLE 1ZMYA 2LU3A 3IDGA 4JPQA 5D71H 4RSYA 1BFVL 4BH8A 1RIVL 2OI9B 1A3RH 5FF6B 2ICCA 5DO8A 3QWOA 2VDQL 4QRPD 1E4JA 3QIWA 5MEQB 4J3OH 3UBGA 1UWGH 4G80B 1HWGB 3S96B 1G43A 5FR3A 2BNQA 1H15B 4HIXH 3CFJA 3H4HA 5ICZA 1V3JA 1J5DA 3ISRA 1U6AH 4HFWA 5I71B 4PRDB 1JWMA 1E43A 2NY4C 2OW7A 3GHEH 2MKLC 2DS4A 3C08L 1NLBH 1X7SA 3LSOB 3VRJA 2V9QA 4Y2DB 2OJEB 4PR5B 5FM5M 1JHLH 5IFJA 3CZKA 4PJ7B 1BVLA 3ROOA 3SJVE 1JXJA 2QHRH 1DQLL 4PGCA 3TFBA 4YN3A 4R4NC 4XNDA 3BUYA 4LCWB 1JDDA 2GSMB 4Y16B 5HDBE 4NKDB 3IJEA 5T1LB 1G94A 1LGVA 4Y5XC 5LCVL 1PTZA 4RZCA 2X10A 1K5WA 2CK2A 4WCYH 4IMLB 3BYTA 3JYCA 1S7SB 4JRLA 4RBPH 2C8NA 1FO0B 3EGDA 1UENA 2A9NH 3K4AA 4LOVA 5DLMH 3WDIA 3FSAA 2IJ0C 4L1BA 4A37A 3W3BA 3F58L 4BH7B 1MHEB 2X87A 4P2RD 4MASA 3F7YB 3NJJA 3REVA 4WK2B 3KYKL 4WJ5A 3GSRA 1L3NA 4AW7A 1JVKA 3ZZQA 4M5TA 3VX0A 4AIZB 1RI8A 1G9NH 2H32H 3D0AA 3LIZH 4CNIB 3TLRA 4XMKL 2MQ3A 1MREH 3IFNL 4RMRA 5EU4A 3LN4B 3BGMA 2XKNA 3ECQA 3BRFA 5A2JH 4CC0A 5C0EB 2N7BA 1OP5K 2EE9A 4M48L 4MNQA 4OLUL 3TBTB 2H2SC 5IQ7L 1G7JA 3UO8B 1QPXA 3NABL 2ZKXA 4U6VH 3BMWA 4QLWA 1TQTA 2ICEB 3N04A 1WA1X 1D5MB 3D0LA 5I8KL 3ULUE 2AW2A 1KJ3L 2XIIA 1N4XL 3L3JA 4HF5H 1U8NA 5E99H 4BRJA 4C56D 3KWXA 1MFDL 4OI9A 4QXTB 3ULUL 5CWSA 4MNGE 5JIQA 2IDUA 1FNEB 5T5FL 4ZSOB 2G3XA 1MFMA 2FEJA 4JG1H 1RIHL 2Z6FA 4R97C 3UTSE 5K9JL 2M1KA 1CFBA 1FIGH 2GJRA 3MXWH 3EH1A 3IF1B 4XO3A 5L88L 1Z9NA 1KB5A 2N3JA 4KKQA 1P5VA 1MPAH 1KXTA 3P4LA 3CZUB 2OTWA 3D7PA 2XJLA 4L8SB 4DP2X 3LD8C 2EDLA 3QRGL 1L9PA 2GFBB 2YMXL 3LKSB 4WFHD 4ZFQA 5EG6C 3DX7A 1AKJD 2FLBT 4KX9A 1NGZA 5A6IA 3AS1A 1B0RA 1OE3A 1Q8MA 3AU1A 1Z5YD 1UH2A 4ATWA 3VJ6B 3WN5C 4I18C 4NLHA 1JHKH 2V2XA 3ME0A 4EJ1C 3ZSSA 3R8BB 4PVNA 2PPDA 4ERSH 4EN2A 2GBAA 4PJIE 2AJZB 1SJEB 2QFPA 5DD5H 2QGBA 4DP4X 1D5IH 5AEAA 3T77A 4BQBA 4QIRA 1BYOA 5TGBB 1NIBA 4HCFA 3BAEL 3VWJA 4RRPM 1BXXA 4WUKH 5KOVC 1QFWI 5F8RC 2ZX5A 5HDQL 1ZVSB 1N3NA 2J8OA 1C1EH 4XP6H 1AQDB 1JXGA 1TG8A 5TF1H 3U6XS 3FT1A 4JLRB 3B9KD 3MV7E 4FI6A 2FIKA 4XPHL 2PR4H 4FNPA 5C86A 1GMIA 1TJMA 3B2XA 2DEWX 3SDXE 1B6DA 3FRPB 4JFFD 1E9PB 2EINB 1A0QH 2LE9A 5ABAA 5KVGL 5ES4B 1ZLEA 4YHPB 5AB1A 4NQED 4HUUB 4XC1H 3ZKXC 3LS5H 3MLSL 4NGHL 4NFBA 2XV6B 2NLJA 1KBKA 1RFDL 2W1NA 5T1KD 1OAUL 3TZVD 1KIQB 1QR1A 4OQ1A 5DJZA 2WLJA 3KS0H 3OZKA 1RURL 4A7QA 2H8PA 3BVWA 4Y2LA 5ICXB 3U9WA 2BSED 4E2OA 2JKLA 3ZTNH 1AHWA 1BSIA 4XO8A 5GZOD 3DX0A 4HKZB 1S3KL 3T04D 2VMCA 3GT6A 2RJMA 5AQ0A 3KEHA 4WFHE 2MOGA 1SQMA 5E6IA 2R1WA 1YEHL 4WSJA 4NFCA 3BMVA 1UVQA 1IEAB 1D6VH 3WNPA 1D5ZB 1WBXA 3NQKA 3ABZA 4LP4A 3UXFA 3WJMA 4KDVA 3LDBC 4XAKD 2RAMA 2ZP9A 2X4NB 1TJXA 3Q1EA 3RIAF 5H8DA 4Z1PA 3ERXA 1KBVA 1UM4H 1SN5A 1AMYA 3G3LA 4HJGB 2ENQA 4JFDA 3OAZH 4FA8A 1OGPA 1HQ4B 3QA3A 4HIIB 2F54A 1KCLA 2VQ1B 3AS0A 5T3XL 2XWEA 4XP5H 3QQ9C 3V0WL 2ESVB 1FFNB 1BD2B 2QGDA 2W92A 1X5HA 4H13C 4QUOA 3RGVA 3OD3A 2OMWB 1U8QA 3MV8D 1MY5A 3S36X 3OZ9L 4N0FA 5G4MA 4BK5C 4DP5X 3DGDA 1H8NA 2PMZA 4MQXC 4X7CC 3HC4L 3HCVB 4ZO8A 5FKAB 2JSFA 2JI3A 5ISZA 4KPHL 4Z0XB 4NN5C 1EXUB 3OMZA 4YLQT 1RZPA 3ZZLA 4AXWA 3C2SA 1XB6A 3JWNH 2QR0B 1F13A 3Q8AA 4QTHA 2EDBA 5F3HA 2X4OB 3WFDH 3ZVVA 1E28A 1NAMB 1A2YA 3K8KA 4G43A 5BW7A 5ADOH 1W9XA 3DRTA 1XF2A 3JWNC 5B1JC 4H88L 5GRYA 2AKRB 1IAOA 1LO5B 1YEEL 3CZEA 1IUZA 5IB4B 4AVJA 3RZWA 1QX1A 4AQEB 1JJUA 2E56A 4BH8B 5SWZA 2ITFA 4C4UA 1NGWA 2CSPA 3IDXH 2VN6A 5I24A 5T1JA 4KK9C 3QWOB 2RFXA 4PWJA 5CZVH 2DLFL 5IM7A 2CD0A 2WKGA 1CZ8H 3MRNB 1F42A 1J12A 4PJ9C 3VXSA 2YZ8A 3NCWA 2X4QB 4EBQL 1E4XH 4IRZL 4WU5A 5F8QC 4W4NA 3FU5A 4GG6B 1Q90A 1JWMB 1KGXA 4OZIE 2DQMA 4JPKL 3EYVA 2V9RA 5I1DA 4MQ7B 4FMVA 4FQ2L 2W0LA 4GW1A 5I0XA 3WO4B 2VXQH 3V6OA 4XCCL 5KS9F 1EHLH 1MEXL 3MOAH 4G3YL 4D9RD 5KANI 1LEGB 3BD3A 3BE1L 3QFJB 3VI4A 4P9MH 3X1NA 1AJ7L 2F1BA 3O3AB 3CPLB 3C8DA 5J57B 3WMPA 1W72A 4ETQB 3L3KA 4LL4A 3KPQB 1EEYA 2EKJA 3I9IA 4A2FA 5F1OB 3VFVB 3BQUC 3QEQD 1FL3B 3GXUB 5IBLC 5I8CA 5FA3B 3NZ8A 1S8DA 1RLWA 3EGDB 3MLWH 1TPXC 4I2XE 3WBDA 1KIUA 4O2CA 2EH8L 3PHQA 2PF6A 5BUPA 1A65A 1RZKL 2YAHA 4QDGA 1MHEA 3MBXL 4ZOAA 1MJUL 2WSKA 3PDGA 4QRBA 3V9EA 1ZS8A 4G82A 4GQZA 2D0GA 1I7ZA 3HS0B 1FN4A 3MRHA 3VD2A 4F15C 4WIQA 1YPZB 5IFHH 3QUZA 4JPWL 5FFLA 3GLAA 4V11A 2D9CA 3SCMB 4E41A 1NCBH 1HI6A 2ZYIA 1NMAL 3GIVA 4JFFA 5E8OB 5F9OH 3UAAA 5DJ6A 3EOTH 1ITCA 3SYQA 1P4BH 1ZVYA 2X3AA 3MYJB 4PJCB 4BFJA 1KJMA 3QIBD 5C0EA 3S4SA 5D1QD 4Z76B 1RUPL 2HUEA 4QRUB 35C8L 2EO7A 4UV4H 2UY6A 4FFVC 4MMXA 4Y1AD 2YD3A 2XG5A 3TYGH 1W16A 3I74A 1YA5A 1A14H 1O9VA 4N1CA 4B9GA 4PJDE 2R0WL 3POCA 3C09B 2IWEA 3K6IA 5C2BL 3QIUD 1WICA 4Y7MA 2NSXA 1CE1H 5CWSB 3GZQA 2ICES 1Y1UA 1J0HA 1M1SA 3Q8EA 1KGJA 4JGJA 5F7FA 4JM2B 2PWGA 4DETA 5C0JA 3FB7B 1NL0H 1WIUA 1ZE3C 3DV6B 5IMOA 3GBNH 3QDGE 5IZ7A 3KPSE 1JPSH 1OPGH 3DVNB 3OGOE 4LRIC 1UWYA 3C6SA 4X6DE 3U4EB 4AL8C 4L8SA 15C8L 3EYOB 4NFDA 1B90A 3BQVA 4JO4L 1BQLH 2QTEA 2Z4TA 1BYNA 4TTGA 2WQRA 1JPFA 4YR6B 3TNMA 4TQ8A 1KBGL 1AKJB 1G7QA 1KB3A 3AU1B 4GG6E 5DQ9A 1ZA3A 4QWWD 5IVNA 2V2XB 4H5SA 4XXWC 3SY0A 1XH0A 5KSBB 2CQVA 2MNJB 5C3IA 1Q1JH 2D9QB 2WN3A 3VM5A 4P5RA 1A7NL 5AG9A 2VDNB 3FN0L 3TH4T 5JYMA 3U2SA 3MRKA 4P3CH 3MFFA 1O5DT 4ELME 1FRGH 5IKCA 1D6EB 1VSCA 2GHWB 3FRUB 2DKSA 2W8CA 4NJAL 3KPPB 3VVVA 1JGDB 1NBCA 3X13B 4LBAA 3U4KA 1SXZA 5J06A 2AK1L 3TN0B 4KMLB 5CSZB 4P4RA 4FQ1H 1TFHA 4HA1A 1IFRA 4YZWA 5AVVB 1CK0L 2G5BB 3REWB 3P0GB 2VDRH 4MNQD 4UT6L 1UKTA 4DJMA 4ZX4A 4FLSA 5D7LB 3MNVA 2BJML 4JY6B 4CW1B 5KVEH 1DN0A 5C08E 5DJ0B 3QJRB 3O41B 3BWUF 5EBGA 5F3FA 1PPIA 1OWRM 2BVYA 3ARPA 2GJ6A 4TUJA 3FOLB 1CO1A 2CHNA 2N4IA 3ARBA 3GMLA 4KK5D 4OD1H 3HTLX 3LRGA 3UYRH 3MRQA 5TD4A 3MGOA 3U1SL 2XVKA 5JMRA 5LHDA 1QR1B 2HAZA 1UOVA 2F19L 4D0BA 3FCTB 3O3EA 1I9RL 2OW6A 4N3TA 2Z35B 3P54A 2H8PB 3MLYL 2R2HA 1E50A 1VA9A 4UT6H 1NKRA 3T6ZA 1TZAA 3VH8B 3FNKA 4KQ4L 4EI6B 3STLB 2ZX7A 4IMKC 1A1MB 1OARL 3GMQB 5ECGA 4A2EA 1S7TB 3QNYA 5T3ZH 4WF7A 4G70B 2QKIA 4LHUA 1NBVH 2IEPA 4E9YA 1EZSA 2ZWLT 2VLKE 3OQRA 2IBGA 1P7QA 3O6MH 5HVHC 3WIFA 1WGOA 1HL4A 4M7JL 4NRZB 4A7UA 4Y1AA 4MVBC 3ROLA 2X7LA 4K3EL 1Q1JL 4MAYD 3MC0A 1OM3L 4FYSA 2PW2B 4Z7OE 1WGVA 3QYMA 2HFEB 4YEEA 2JVUA 5IW6A 2QVMA 3UG4A 4PM1A 3TZVB 5I0DA 2WXMA 1XCXA 3DMMC 1NCAH 5C0BE 1QFOA 3K71B 1KCWA 2F7OA 5H94B 5EEXA 1UM5H 1A6PA 4WY7L 3AM8C 3VNZA 1BLNB 2H6PB 3DVGA 5L9DH 2OMWA 3AFLA 2EH7L 4LL1A 2Z0UA 5AD0B 1OPGL 3CX5K 4U33A 1YHPA 3NN8B 3BP6B 3OAYH 5GSVB 1R3LA 5I5MA 4TRPL 4R2GC 5J6GA 2IDTA 2OK0H 1X6NA 4IGBB 1T7YA 5E8EB 2VUYA 4M1DH 4Q7DA 4DUXA 2DPKA 1FNAA 2E8YA 3LZOA 4F9PC 3VGBA 1TTCA 4G43B 1T6WA 4NNXB 4RFNC 3T3PE 4D9LH 3ZR5A 3JV6A 2B1AH 2XIBA 1CD0A 3ILQC 3NSDA 4G7VL 1F3RB 1P7KB 4F5CE 1DZBA 1Z9SB 2AQ3A 4JO3H 3V4PL 4NCC1 5JW4R 4DPAX 3OKYA 5PAZA 2QFRA 1G0XA 4DTGH 4AQEA 1WAAE 3EZ8A 5LKNA 3QUMH 3X3FL 4P23A 1FFQA 4LGSB 2Y72A 1IKFL 3S88L 3HZKB 3BXNA 1XR8A 2JXMA 3EJYD 3QZNA 4XO5A 5F7EH 4KXZI 1AGDA 2FHBA 1WV7T 2ZXBA 3OKDA 5CLXA 5JUEL 3UAEA 4JKMA 4LLYB 1TQBB 1A22B 3QJSB 1C5DA 4Y19B 2V5MA 5HPMA 1KV3A 4XRCA 2IO5A 4MJ2A 1CN4A 4XZ4A 1PD6A 1R34A 3B1TA 3U46B 4CN4A 4NIKB 5FYKD 1MJUH 4JM2C 2DYPD 5EBWA 3RJQB 3RZCC 1S78C 4LSRL 4U4IA 1W15A 4ZMZA 2JKJA 2XQBH 4M1CD 3V4PA 1MJJB 4YFLI 1SQ2N 3II2A 3C09C 3SDAB 5I1AA 5HDLA 3CPLA 4YWGH 4JHAL 4P07A 1K8IB 2EDQA 3D51A 4WHYH 4NQDA 1KELH 2C7UB 3QXWA 2V0AA 1BPVA 3GRBA 3KPQA 4R0LC 4MCMA 2YOCA 3P4OB 3PHOB 3DIFA 2OMTA 3EJTA 3W11D 1AXTH 3TO2A 4EZLA 2CLRA 4KK6C 1S8DB 3NG5A 5JORA 2PYEB 5KOMC 2XWTA 4HUCA 1OTTC 3PWVA 1KIUB 3LXBA 4O2CB 1IKOP 4UU9A 3B2UD 3CBRA 1NBYA 4JN2A 5ICUA 2CJ3A 1R5VA 4Y4FB 1TOXA 2VL5A 2PTUA 1MWAA 2LU4A 4YQXL 3BH8B 2XZAH 2OZNA 3CWGA 3QZPA 1BXAA 4XE0A 5EBLA 3CXHK 4B7IA 5EPMA 5LN8A 3NEXA 5A43C 4OQTA 2UUDH 5EH1A 4UIKL 4XNBA 3VMOA 4F92B 8PAZA 5EF0A 2GIYA 4Q9CA 1MCEA 4OCXH 4FQCL 2Q8AH 3ZDZF 3VFNA 4X9IA 3JUZA 4P3WA 1YEJH 3RVVD 4LMQI 4HCIA 2A77H 4JDTH 5SWZD 3MLZL 1SEQL 3BWAA 3D85A 4PJCA 4TQPA 3GMRA 1YUKB 2L7UA 2X1OA 3PWLA 4DGWC 1JZJA 4PJ7A 2NXYB 4KROD 3V5DB 2CUAA 1QSVA 1T3FB 1TZGL 2FATL 3QEQB 4JMNA 4NQXA 2VN7A 4FFYL 1RHHA 4HAKA 3I75A 4Y16A 1ACYL 1N7ML 2DIAA 3ZGHA 3U0PB 3ZK0A 1A7QL 1R5WA 2DJ4A 4Q6YA 4YH6A 1CICA 1ES0A 1XSOA 4JRYD 4N4YB 2XT1B 1I3UA 1JPTL 1S9XB 4XOEA 1Y07A 5ISZD 3MV7A 1EFXB 3MUY1 1ZTMA 2DICA 3P9MB 3NGBC 1A1NA 4HJJL 4KC3B 5D7JB 1FO0A 1SM3L 3IPFA 2WOBA 3IGUA 4HFUL 1OB1B 4OIFA 4E0RB 1G9NC 1WTGT 1GGUA 1IV8A 2O6PA 5CF3A 5ANMB 1MVUB 4N2KA 4I3SL 5D5ME 3V52H 3F7KA 4CC4A 3UOAB 3H42L 2XBDA 1MFAL 3DVNA 3W5NA 5B7FA 3QDGD 3UTSB 5KJRH 2Z4QB 4BUQA 2XNAB 1OAKL 1ZK9A 4EF3A 4QJ4B 2ITDA 4UBDD 1HOCA 1GAFH 4RGOL 1WS8A 2NY6D 3WG7B 1W0YT 3ORJA 2VM3A 5BCAA 4OAWB 4RH4A 4WWID 3SDAC 4OW6A 1D9KB 2EEAA 4IOSD 2EVHA 1HSBB 4FEMA 3H2QA 1MH5B 3WD5H 4NI3A 3DWTA 3KPRE 1EEZA 1A7RH 1OZUA 4DT2A 1GHFH 7TAAA 2NY0B 4IK7A 5F6HI 3KYNA 4BZ2A 1MCWM 2BWQA 5KUKA 4JAMA 1WD9A 4OF0A 2E9IA 1FG2A 5K33A 3BKJL 3FRUA 4L4TA 4I1NB 4WSGA 1SZNA 1JGDA 1KYOK 3X13A 1F58L 1AXSA 2P49B 2XXGA 4F24A 1HNYA 4Z7AA 3L54A 4WFED 3X1BA 3LQMA 3OC5A 3K6SA 4P99A 5B38G 3CFQA 1K3IA 4IOFD 4Q9QH 4KFZC 1UJTA 2UWEF 1BFOB 4PBDA 3N0AA 4PJBA 1O6VA 2NQCA 4X9FA 1RQ5A 4M7LT 3UGEA 4LLUA 3IF1A 4G9DB 5DUML 1KGIA 2ZCHL 1YC7A 1UKQA 4B3EA 1XL6A 4JQXC 1YNTF 3SBRA 3CU7A 2W9EH 4XPTL 3DURA 3O3BB 1XZ0B 4HPHA 1JWSB 3ARFB 1BQHB 1SLUA 2WINB 1WPCA 1FVDB 4GSDH 2O72A 3RQ3A 4HETA 1NH6A 4UTBH 3RY5A 4JFOA 1QACA 1RIUH 2CHWA 2NQDA 3AMLA 4NHUA 1RK1A 2EDHA 3ZPDA 2H3NB 2V2TB 3B2MA 3WEXB 2NW3B 1NGQL 3VSQA 4A2MA 2MH4A 2VISB 3PJSB 2QPFA 5HYJD 1A1MA 3GMQA 1OT4A 3ZO9A 4PB9L 3D3VA 4F33B 2HT3D 3VTTA 1S7TA 5K69A 2R29H 1L5GB 3VWJB 1OP9A 3CDYA 2BMKB 5C0GB 3SGJA 5IB2A 4GEIA 4MJIB 4YX2H 4R90L 3PWNB 5AW8B 4JQVA 3IEAA 1AQDA 1ODUA 3L08A 4X9GA 1JYXA 4PTTA 1QASA 5L6YH 1J5HA 4MDIB 2R29A 5D7SH 3QG6A 1E4KA 3I85A 3QUZC 5I0VA 2WYIA 4X6BB 2Y7MA 1YY8B 5D5MB 1KJ2H 2WV3A 4HH8A 1GGTA 1U3HC 4KK8D 1SBSH 4OVVA 4QD2E 2FT7A 3T6QC 1SLXA 1X5XA 5DVOA 4GRLB 2NLJB 2WM0A 1UG9A 1EAPB 2ENPA 3AG4B 4PJ7E 4PI2A 4FNLL 1FBIL 4MJ6B 3MOBH 4QOKA 1EAQA 4N0UA 5D1XC 4L8CB 4PH8A 3ARTA 1TO4A 3FFOA 4CSPA 4B5ZA 3NDZE 4U1LB 3N5AA 3NK3A 4YO0B 3TURA 3NESA 2OMUA 3D6GA 2PO6A 4WUUA 3ULUH 1M2VB 2P42B 2ZXGA 1J1OH 1OB0A 1EX0A 5EC1B 5D1ZB 5F7NC 3JV6B 5K39A 4TQEL 3VD5A 4DVRL 5EF3A 2W0FB 4PJ5A 2ZX8A 3KMDA 4PV9A 2AEWA 3UTPD 5I75B 3LNIA 4WV1C 3LPGA 2Y6SD 3TIDB 5IQ7H 3UO1H 4YSUA 3CSBA 3QVAA 1CI3M 1L9SA 3JBG7 4RZKA 5DSCA 1YNLH 3GXFA 1HXYB 1AC0A 1JGVL 3KVPA 3WIIH 4V2CB 4M6ML 5CN2A 3U4BL 1DEEB 1FYHB 3OKEA 5FOBB 1URZA 5I75C 2HT2C 4YC2C 2GG1A 2GBVA 3MJ9A 3CZFA 3QA3B 4M6NL 4XMKH 1PZ3A 3AQXA 5AKSA 3DSNB 1BLIA 1L0PA 3ILEA 1KPUA 1INDH 4KUZH 2VSDA 3VXRD 1VKXA 3KXFD 3MV9B 3SD5A 2P24A 3KXFA 3N44B 2V5YA 5HYSA 5MENE 2B0SH 4XNXL 4H8QA 1NINA 2JQZA 2WTRA 4LPCA 4MD5A 3IKKA 1H6FA 3V4PB 5DK0A 2D0FA 3IE9A 1DFBH 2YKKA 3QI9C 2OZ4A 4ODSH 3D25A 3EW3B 2EP6A 5E9DD 1E28B 1NAMA 1A2YB 4OZGE 4E68A 1MAJA 2BVTA 5GGRA 2P8MB 1NDTA 1JZ8A 3E3QC 4R3SB 4DW2L 3VFSB 5EZJA 3S34H 4ZSOE 4PJHF 4NQVA 1FL5B 3DX9B 3EBGA 3C5SB 1DVYA 4TM9A 4C4KT 3V0JA 1GC1C 1X5FA 1IM9B 2BVQA 1RZGA 5HHXL 2GTZB 2OYPA 1R5VB 4Y4FA 5L4JA 2YRLA 4LVNB 5BRZB 1JGUH 3QQXA 3PPSA 4OU3A 2YD9A 1KTLB 1FFRA 3HHMA 4LEEA 4M7LH 3V0AC 4MMZB 3DI2B 1AHMA 1HSAA 5BJTB 2XU9A 3OBAA 3C08H 3GHEL 3C5ZD 5E1GA 3VWJC 4DO4A 2CGRL 1GAFL 2X4UB 5DJ8B 4GG6A 3BIAX 1HHGA 2OL3H 3ULUD 1OAKH 2H2SD 4TTDC 5CGYD 2O26U 4PRAB 5CR8A 3EYVB 4ABWA 4AGLA 5JDJA 5H35B 5B21A 2JKNA 2W9LA 2ZCKL 5KJRL 1YPZE 1FO0L 1UD2A 3T4YA 4PRPD 1J5OL 2VDQH 2TRYA 4PS3A 1BFSA 1T0MB 5GGUB 3U7AA 4L3ED 3V52L 3CK0H 3SPGA 5D93B 2ZG1A 4NQXB 5D71L 2A6DB 4KUCD 5I74B 4XMTA 2EE3A 4OD2A 1TVDA 2JTYA 4JGMA 1JK9B 5F9JB 4LCWD 2ALAA 1R5WB 3NCFB 3IWUA 2F53E 4NKQB 4HWEH 1MCOL 5FFOA 3DX6B 4OLWH 1UA6H 4XGZB 5C0ND 1B4JH 1E6JL 4L4VA 1H3XA 5KZCD 2WLLB 1TZGH 1MCDA 3MRIB 2GK0A 1CFNA 2YIHA 3O9WC 3SGKA 5B3JF 7FABL 3W5MA 4L2LA 5FV2A 5EFIA 4MYWB 5HDBB 4FL4B 4ZNEE 4AV5A 2GJ6E 4OZHF 1VFAB 3BDYH 4HV8B 1UXSA 5F96H 1FVCA 2YA1A 2SEBA 4JDTL 1BZ9B 3QUYA 1ZS8B 4XOAA 5DGQA 1YEDA 5BRQA 3QDGB 4PW4A 4QRRA 4K5NA 2EIEA 4FQCH 2DQEL 1WIPA 1WWWX 2F1AA 2PXYD 4E41B 4Z7OB 1FNGA 1SJMA 1T1WA 2W0PA 5FCUL 3R4RA 4Y9FA 1CFSA 3HG5A 1KG0B 3FS9A 2OI9C 1ITBB 2DQCL 2ZSVB 2NY1B 5I8EA 4JNXA 4XP1H 4YQXH 1YDPA 3PQYB 3OKMB 4Q6IA 2PCFB 3BH9A 2WQXA 4FLHA 1AGEA 3MNWB 1FAIL 5CHNB 4FKEA 5GHWL 1T04A 4ABQA 1LE9A 1PG7H 2B2XL 4NQCB 2JELL 5D1XE 3RFZC 2I25N 3DOHA 3BSZH 1Z32X 1PIGA 2X1PA 4H8HA 2QQNH 3PXHA 3C9NB 3CSPA 2P7TB 2NPLX 2BZCA 3CC5B 3BPNB 3EZJB 1M6OB 2X4RA 4DFHA 2CIKA 4N2DA 5AW1B 4LCCB 2QEJA 3L5WB 4LCCC 4FTVA 2XBTA 3S5LB 1XCTA 3TASA 2EDDA 1IE4A 4L4TD 2Y36L 5F89B 2A9DA 1TZHB 2ARJB 5IW3A 4RMWA 4FZEH 3L1FA 4DEWA 3X12B 4MAYC 2CLZA 2QELA 4LARH 4DO5A 4WEBL 2AANA 1EHAA 4PWHA 4HIHB 1I8UA 4LSUL 1F6FB 2WINA 3NMEA 4UAOB 2BO0A 4AITA 2ODHA 5TPWL 4AWJC 5DHVB 3APDA 4U1SB 3BAXA 3GHBL 1CQYA 4HDIA 4IOIB 3VYNA 4L48A 5DRNA 2XWZA 4IHOA 4OY9A 2DMHA 2HLAB 2QSCH 3L16A 4HW6A 1RK1B 4PW3A 2B59B 4IRSA 1YQVH 3MUHL 4H26A 4Z9KB 4XCEA 3D50A 4XBPB 3U6RB 2X6AA 3F83A 3U2SB 4X7TB 2HT4D 1T6BX 4W1TA 1MLCB 5LG1A 5JXEC 2OPCA 2EUVA 2JTDA 1A6AB 2L7JA 5JPNA 3T1FA 1DVSA 3VXUA 5B7MA 1G7LB 4LHQB 5LBVA 1B4TA 4TS6A 1LO3L 1HDMA 1IIKA 1LHZA 5K9QG 1VAHA 3X14A 4OFQA 1E8ZA 3CZSA 3WL9A 4P4RB 3TVMC 2IBZY 3BWZA 1ZGLM 3BRGC 5DQDH 1ZXKA 3Q8CA 5T5NG 5I6KA 2F18A 4W68A 3L3OC 4UOW0 3I02A 5INDB 3P77A 3O4OC 1R3IL 3WFCL 4X6CA 3EGXB 1LLAA 1BZEA 3U7YL 4N9GB 3ZTCC 1JSYA 1QZNA 3AU0A 3ESNA 2Y24A 6FABL 2HT4C 2P46B 5AW0B 3CVIL 1TITA 1G7MA 4DEPB 3T09A 3RNKB 3AREA 4JFWA 3FCGA 3IFPA 5D2NC 1NDMB 3FCTA 3ML9A 3O3EB 4HAFA 5C7ZA 4FXGB 4ODWB 3WI9A 1CVRA 1JV5B 5F70A 4QRRD 1A6ZB 3I6GB 5J6SA 2D7PA 4F8QA 1CXFA 5I1HL 1BGXH 2NY0D 3O6KL 4ES8A 4Z7WE 4KZDH 2FUQA 2GI7A 2EYSB 1SDDA 3RWCA 4AVIA 2YD1A 3QNYB 5D1ZA 1J9CT 1IEBA 3K2IA 1LWJA 2F68X 2VNCA 4HQQH 4NKOB 4NBZB 5I6NA 5E6UB 4B6ZA 3QI9A 3BHBA 4FQPA 4L4VD 2DLIA 4KAQL 4KQ4H 4NUGH 1T0NA 1TKWA 2XPZA 2WZPA 4TPRH 2X1XR 4ONGL 3WFBH 2F9BT 3B3BA 4KTDH 1DEEA 4PBXA 4E5XA 3MREA 3GSOB 3HZ3A 1M53A 3QXDA 1W2KT 2WBJC 2DQDH 1XGYL 3RB5A 1OXYA 1KPVA 2P80D 4RIRB 5IIEA 5MERB 3JWNG 1MCJA 4OUUB 1BQHG 1AGFA 4DERA 4FYTA 4L3CA 4A7GA 5C08D 5AD0A