3UTTD

1e6-a*0201-alwgpdpaaa complex, triclinic
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
199
structure length
199
Chain Sequence
EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMRGDSSYKLIFGSGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Structural basis for the killing of human beta cells by CD8(+) T cells in type 1 diabetes.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 199
sequence length 199
chains with identical sequence I
ec nomenclature
pdb deposition date 2011-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uttD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uttD02
1WCBB 3FFCD 5IB5B 1KIUA 3STBA 5FM5M 1J8HD 5DD5L 1NCDL 2XZZA 4GJTB 3MRRA 2PTTA 4HXBL 3O2VH 3WHE1 4F9LC 4PJGB 2HFGL 4WWKC 3H7BB 1IC4L 4X7CC 1G7IB 4JM2F 4NQVB 4BK5A 3QI9B 4L4JA 4JRXE 1J12A 2DQJH 1HINL 4LRNH 4ZDHA 5JHDB 1MNUH 1QQDB 2APBA 3A6CL 4P2RD 3JV0A 4R8WH 4DUVA 3VFSB 1DBKL 4RBPH 2CLZB 1DANT 1G0DA 5DUBA 4KMTH 3L3JB 1CN4A 3ZDXE 4U1MA 3SCMC 5BV7H 4F15C 3P0YH 1ZT7B 4Y1AD 1U2HA 3Q6GH 4X8XA 4UTAL 4LNRA 1KENL 1S5HB 1D5ZB 1RZ8B 2PXYD 3KWWA 4PTUA 5CKAA 3DMMA 4RA3A 4P3CL 3QDME 3IRZA 2NW2B 1I8IB 3LKRA 3HMXA 5CJBA 4NC1E 4YXKH 3KLHC 3ZE0F 5E5MA 1WZMA 4X7DC 2C4XA 3WS3A 5HI3C 3EDEA 4BKLB 4JFYB 3IDXH 1NKOA 1YJDL 2NLJA 4QOKE 3T0ED 4LMQE 2X1QA 4L4VD 4OZIA 2ZKHH 4HGWB 2IBZY 1CD8A 5J7CC 3CNKA 4DAGH 4RAVB 4FP8H 3OAUL 1NC4D 1NLBH 2VDLL 2KDGA 3DVFA 4GRWF 4OSUH 1UWGH 4QHKJ 5D6DC 9CGTA 3C8HA 4MJ2A 4U1SB 5EG6C 2DDQL 3ZHLA 1P2CA 1XZ0A 4ZAKD 1JNLH 3SKOA 5FGBA 4ZFGH 3CFDB 3FRUB 1G84A 2BNQE 5AZEL 4M6AA 3SOBL 2V2XA 3NCBB 3MRNB 3AU1A 3O81A 1YEEL 4QYOB 4MA1B 3I75A 4N8VG 5D7IA 1S7RB 4M1CD 5E2TH 2R56L 3NZ8B 3UTSB 5IFJA 4UAOC 5HVFB 1JMXA 5GS3A 4WI3A 1RAMA 4JREB 5L0QC 2C3GA 3GIZH 4HT1L 5EO1B 4Z78A 1L9MA 2Q87A 4MJ5A 3B9AA 4BA8A 1FNAA 4PRPE 3ILQC 3EOBB 5E6IA 4L3CB 2GHWB 1BX2B 4BSWB 35C8L 2EH8L 1INEH 2NY3D 3EJYD 3GSRA 3NMEA 5GISL 1U42A 4OGXL 4C56B 1B2WH 4ISVA 3IU4L 1FFPB 3MLWH 3ZDZF 1BM3L 4NT6A 5JQ6H 1UB5B 5JXEC 4F57H 1A7NL 1MOEA 3LN4B 2JCCA 5IJKA 4AM0B 2A73B 1F58L 1MCWM 3VMPA 1N5YL 2X6MA 3QAZB 2IPTH 2VXQH 4JHZA 2DQDH 4XBPB 4MX7B 2B1HL 3C08H 2BNRA 1BBDH 3E8UL 4KRLB 4CADB 4LPUA 4P2QD 5B4MD 1SEBB 2H41A 3GBNH 4X9FA 4WVRA 4Y19E 5SX5K 3P4NB 3QXDB 4YHLH 5HYQA 3MCG1 5FAAA 1RK1A 2X4UA 1IGJA 2YZ8A 3HB3C 2NXZC 4I5BB 3BEWB 1JRHL 5E5UB 5IG7A 1LDPL 1WCQA 4XTRD 3ARXA 3MXWH 5I8KH 1KN2H 4OCYL 3LEYL 5I1IH 2H32H 4XCFL 1RI8A 3O6FB 3B9DA 3MRBA 1FRGH 3KYMB 2EIEA 3SDCB 2E7BA 4OLZH 4GMSL 1PYWB 3MLZH 1FAKT 2XICA 1PQZB 4YFLI 4PPTA 4J4PD 3QUXD 1I7UB 1E0OB 3KNBB 2WUCH 3MYZA 4WW2C 1NCUA 5LBSH 4YGVB 2B5IB 1GZPA 2P42B 3P4OB 3ZTJH 1A6UH 1TFHA 1Q0YL 3VD9A 4WU5A 2A9ML 3HR6A 4J3OC 5DRWA 5IEHA 3VFMA 3ULUD 1UVQA 1T1ZB 2IAMD 1JPST 1RZKL 3Q1SL 4OM0L 4Q9CA 3QDHA 4HUUA 5HXMA 4NBZB 5BRZB 3AXLA 1RK0B 1IKNC 1S78C 2HTKC 2FEDC 1EUTA 3OR7B 2J8UA 1JVKA 2VQ1B 4U6YB 2GJ6D 1M4KA 2DTML 4U1JA 2YK1L 2BMKA 1HH6A 4HWUA 4G8IA 4LIQL 2W07A 3HRZB 2D31B 5IVZB 4KMQA 3TN0C 3JWNC 2X89D 1GPOH 2QQKL 3O4LD 2IQ9H 5LWYL 1U8LB 2AGJL 1BEYL 3RUGE 4MYWB 1U6AL 4KDWA 4JDTL 5FM5O 3RDTB 3MFFA 1OAQL 1QYGH 3LPFA 4UT6H 1H3PH 5DWUL 4WWID 3GGWA 4XNQA 4RZCB 4QNPE 3HFMH 4PTTB 3U36A 1NMCB 1DVFA 3V0VA 5IB2B 4X7SH 4X4MA 3CX5J 4UNVA 4JFPB 3S88L 5HY9B 1JGLL 2IAND 4J3WA 1UB6A 2JLLA 5DHXB 4ZSOB 1D9KC 4P23C 5D9SB 1X5FA 4G43A 1AI1H 3FFDB 4RWHA 3CFEA 1Y6MR 1HHKB 3SJVD 2AJXH 4EEEA 1LILA 1LO0L 4PJIA 4XNYL 3AM8A 5ADPL 4IRSD 4LK4A 3DUUB 4NKQB 4N68A 5MHSE 3ARGA 4Y4KA 1B0RB 4GAFB 5T1DL 3RZCA 2X4NA 1I3RB 1KB5L 1XGUB 1EFXA 1MIML 4XP4L 3C87A 3IETA 3VXOA 1KJVA 2VZ1A 1GZQB 4UV7L 5IHUH 5EBGA 3FQWA 4RFOL 5CJ5A 4OI8A 3IJSA 1RZIB 2R1YA 2BHZA 1T03L 1OGTB 3BH9A 1UQSB 4PRHD 5C08E 1MRDH 4G3YL 2FATH 1Q9WB 2R0ZL 3IFPA 5DMIH 4OCXH 3PP3K 4F7MA 2XTLA 3NCFB 4D9QE 1FFOB 1EJOL 3OF6A 4X9BA 5KVGH 1K4DB 1A9EA 2AXGB 3TWCH 4HCRH 1W72H 3K7UA 3P0VL 4XMKL 2C3WA 3OKMA 3M1BA 1MVFA 2SEBA 2WP3O 1AC6A 2L7JA 1E28B 3UJIH 4DEPB 1QBLL 2FH6A 3K4ZA 2A1WH 4YBLB 3V5DA 1AGFB 1S7XB 2DTSA 1Z6JT 4O2FB 4F7TB 4XBGB 3D0VA 3OB0K 2WUBH 5I1CH 2C4FU 3F7VA 5KS9A 1EBAA 3HG1B 4KQ4H 4MDJA 4O51B 2XWBB 3VXTA 1DDHA 1SYVB 3WDIA 1S7VA 4MJ6A 1RIUL 4MNGB 5KN5B 3TIDB 2ZNWA 2CRYA 2KQMA 2XWJA 4GRLA 4LP4A 1A02N 3HUJA 4KTDH 1TIUA 4YGAB 2GTZB 3G6DH 1F00I 3BISA 4RCAA 3F62A 2VXSL 5FK9A 3LKQB 2F5AL 3KPLA 4QRQB 1OW0C 3CXHK 1G7HB 1J10A 3LDBC 4PJ8B 5D5ME 4E5XB 1MI5B 5DVLA 4Y16A 1ZLSH 3ZHDA 4JN2A 43CAA 3RI5F 3JTTA 3WDJA 5LGJB 2F19H 5FXCH 2M26A 1BECA 5INDA 3QEUB 2YPLE 1T1WB 2J7LA 4TNWF 3QIUA 2FB4L 3VMOA 1KEML 1CU4L 3REVA 4M1DH 1FL5A 2WAHA 5INCA 4AZ8A 2GFBA 3L1OH 4DWHA 2DWDB 3AC0A 3WFCH 3GNMH 5BVPL 4PGEA 2R0KH 2XQYK 1A7RL 1UJ3C 1G9MC 3GSNA 4DOHE 1K8DA 4KJWD 4YHIB 3EYFB 3AUVA 3VXPB 5GZOD 2JCCF 1A4KB 2R23B 3MA9H 3SDDB 4RAHA 4FQXA 2EDWA 2PYED 1ZAGA 4HC1H 1CR9L 1MLBB 1PAMA 1A7BA 1A1NA 3ZKXB 1TZIA 2FECL 3RY6A 3WDHA 2VUOA 3VWKC 4QTHA 5EB9A 4PJHE 1LEIB 5J06A 4NRZA 3ARFB 4GAJH 1FNGA 1UWXH 5K9KB 3WMSA 2VXTL 4MD4A 1M7IA 3BZEA 1MCJA 1CI5A 4JANA 5FKAB 4XVSL 1IGFH 3WKNA 4EIGB 5GGUB 1RPQA 2AKRA 1Z9SA 3D9AL 1S7QB 2IADA 1AQDA 2KUTA 4JFEA 3BIBX 4HLJA 2DN7A 4JO2L 5DYOB 4CW1A 5C0AA 3BUYA 5JW5B 3IDYB 3NCCB 1UYWL 1ORSB 2EDLA 4P2YA 5LAXB 4ELMB 3D18B 1SBSL 1ZLVK 5B39A 4GW4B 3MRIA 3QIBB 5CLTA 3ZDYE 4JFFA 3RU8H 3QCUH 3STZA 2PETA 1AD0A 4L4TD 2BC4B 1N2RB 4XX1G 1N64L 1FO0H 3HN3A 4PV9A 3KXFE 5TE4L 3T3PE 3QQ9D 3U7YH 5MEPB 1B0GA 1CLYL 1T5WA 1IAKB 1AO7A 5GRYA 5I2IB 3W5NA 1EFQA 2P47B 5DLMH 5GS0D 5CGTA 5HHVH 4FFVC 4HWEL 4HZLA 5FYJL 1WK0A 5HYFA 2CGRH 3G6JE 1A6VH 1G0YR 2VDMH 2W65B 3HR5B 3QEQD 3CH1A 2GTWA 2EH7L 4WUKL 1RUPL 1VGKB 2CLVB 3TO2A 4PJ7F 4UNUA 4XBEH 3DGGB 5I75B 1JUFB 4NKMB 4LF3A 4KVCL 5HYEA 5BS0A 3HE7B 3BE1H 5C09B 1F13A 2BJMH 2NNAB 4DW2L 1MH5B 5HYJE 1UA6L 4PB9H 2NX5E 4R0LB 3LIZH 1LO5A 2DOCA 2DYPA 2QADB 5T3XL 1UFUA 3FT3A 3O8XB 3GHEL 4C83B 3BGFC 3OXRB 2BVUA 2A9NL 4HX1A 4MVBC 5FECB 4N5EC 4MWFB 2F58H 1WICA 4PJ5E 1JF5A 3V6OC 3LKNB 2VH5H 1NFIB 2VQUA 3PGDA 2IQAB 5GS0L 2AI0L 5CMAA 1BQHB 3UBXA 1D6VH 1NDMB 1G9NC 4KTYA 1HI6A 4I0KA 4P9ML 5ESAB 4LCCA 3KVQA 4R7NB 2Y7QA 4F9PC 2O5YH 1A6ZB 1NJ9A 2VDOL 4HKZB 4UILL 5FHAL 1ZS8A 1RZGA 1ZLUK 3TVMA 1H15B 3UDWA 2CKBB 1CD1A 1GGBH 3QO1B 1CE1H 3SN6N 4A2LA 4HXAL 2Z0BA 2CUMA 3QFJA 2D9QB 2RCSH 3C5ZC 4R97B 2A6JB 5E2UL 1U8HB 4O2CA 4Z7WA 5MEQA 5C8JA 2D7MA 2J8HA 2C26A 3VFGH 4Z0XB 3AREB 4LFHG 4H5SA 1JPFA 4J8RA 5F3HA 2VNCA 4NQXA 2GK0A 5GGTA 3KPPA 1KJ3L 1TTFA 4GUPA 5E08H 3RBSA 3QG6A 5CEYA 1G6RH 3ARRA 4YNYB 5LCVL 3FQRB 2DWEA 3PQYD 5F7FA 1NMAH 2AJZB 2WV3A 4PV8A 5CGYC 2Q6WB 4L29A 2NCMA 1MCIA 1N4XL 5E4IA 5DMYA 1HSBB 2VRAA 4NC2B 5DTFB 3CLFL 2H9GA 1LEGA 2PTUA 4PY8J 4KVNL 4RMWA 1RUMH 1FGVH 4U3XA 1EO8H 3SE8H 1U3HA 3VI4F 3EYQD 3PXHA 4OZFG 4R90L 3MRCB 5KS9F 4HH9A 4YX2L 1OTUC 3IDGA 4Q9QL 3MLTA 3MCKB 4JQIL 1U95A 1QRKA 3LHPL 1WC7A 1AFVH 4XHJD 5I16A 1ERNA 1Q9OB 3EJZD 3IDMB 2F8OA 4XVTH 3HUJF 4ONFL 2ZNXA 1JGVL 5CD3B 3QNZB 5IVXF 2VO5A 4ZFFA 2A2QT 4KHXH 4KKLC 2FD6H 2F53A 2V7NA 2X4TB 3MMEB 4ODWB 2DQGL 1TCRB 3EFDH 1AGEB 3VD5A 5FA3A 4GG6F 2Y36H 1FHGA 4OUOA 3ZSSA 5FYKD 4CVXB 1P84J 4NQDB 4FQQA 3QQ3A 2PW1B 4XP6H 2N1KA 4F8TA 5HHOD 4L1DA 4X0KB 1CXLA 4KHTL 4NRYA 1YMMA 3HI6H 5EZLB 3VFWA 3NH7L 5HHNA 2NY7H 1JK8A 3MRPA 4JAMA 4FQ1H 4NPYA 1I8MA 3T4YB 5GRUH 4GBXC 5JOPE 4HMDA 3IF1A 3TBTA 1R24B 3B6SB 3S36X 4FXLA 3FN0H 4ORZC 1WBYA 5BV7B 4G9FE 3DPBA 3GI9H 4YZFF 1ZHNB 4D8PA 1NCNA 1BQLL 5DJ8A 3F7YA 4W4OA 3OXSB 3ZE1E 3HZVA 1JTTA 3K8KA 3TYFA 4L8CB 4C56E 2AEPH 3KPMB 4HWBA 5TQ0H 4OLWH 4KKAD 1X5AA 3MJ9L 2RBLA 4KK5D 1BQUA 1Q0XH 4HFUL 5KSUB 4MMXC 2H2PD 5HPMB 3L3DA 2WSKA 1TQBB 3ARBA 1JP5A 4HIXL 3U0WL 3DVIA 1Z9OA 4PRAA 5EH1A 1ZLWK 4TNVK 2OL3L 3UXFA 1G9NH 4IMKA 5MI0B 2YD5A 1YNKL 3T2QA 5M94B 1IAIM 3QNYB 4NWTL 4JE4B 2X42A 4F7CB 2LFGA 2OYPA 1DN0B 4OCWH 4JRXD 2J6EL 4PJAA 1NAMA 3IT8D 4V1DB 4HS6B 2HG5B 4TVPD 3OKDB 3WIFB 2EYRA 1JPSH 1RUKL 3KLAB 4ZUVA 3O4OB 1FV1B 3ZT5A 3ZKQD 5LXGH 3EHBD 1XF4B 1FORL 5DK3A 4N0FA 5DVKA 2DKMA 5DA0B 3HZYB 4JFXB 4CU7A 1Z2KA 1P6AB 1Q1JH 3SE9L 5DHYB 1I1AA 4LCYB 3QHFL 2KH2B 3ZYZA 2BY2A 4EBQL 1JJUA 3MLYH 3REWA 3U46A 2ZUSA 3BZDA 3HNSH 5HHPA 1IEBA 5CUSL 1IKFH 3QDMD 4G8GB 3TZVC 2P5WA 3BRDA 5D2NB 4X9HA 3LZFL 3AB0C 1AQKH 1EEQA 3KPTA 3CFCL 5EIVA 5I73B 2Z31B 4QOKD 5FM8A 1OGAE 5J13B 3RWJA 3MV7D 4FQPA 5I8CB 5D7JD 1OAKH 2KZWA 3PHOB 4NKOB 4WEBL 2YS4A 1WEJH 4KKNA 4LSTH 1QP1A 4RMVA 4K3HA 3QUZD 1C1EH 1P4IH 1OM3L 1QFUL 3DUSB 3HAEA 4MD5A 4UT9L 3THML 4QTIH 3CVIL 4P5TA 1IGTA 2NY1D 4LCIL 5CJOH 5BRZE 5C9JA 2VLKB 1JYXA 4PJ7B 1ULVA 3VH8G 4FXKA 2AEIT 4LSUH 2ERJC 1DBMH 3PABB 1UJTA 4AG4H 1GC1C 5DEFB 1NCCL 3EKCA 4HBQA 2XRAH 5EBMB 1FFQA 1X4YA 2EKSB 4B5EA 3MJ6A 3DOSA 1YY9D 1ODAA 4NFDA 3O6LL 1WIPA 1IJ9A 2WIMA 3WS6C 2CMRH 5E1AB 2FIKA 3BEVB 3KLSA 5CFHA 4QXGL 5GPRA 1YECH 2X4SA 4Z9KB 3W9DB 4PRPD 2H32B 2Q8AH 2PN5A 2FLBT 4UDUA 1TLKA 3WNPA 3O2WL 1AIFA 4XVJL 5DK2B 3F58L 3QJFA 4XAWL 4ELKA 1IFHH 1QSFD 4KUZH 5C0BE 3QDAA 1DQDH 3PDOA 1JHKL 3V4UH 4ZSOE 4OIAA 4F2MB 2R1WA 4FG6C 5F44A 1TMCB 3QIWA 1QVOB 1KJ2H 2A6DB 4Y5YA 4HFWB 1A6WL 4X7EC 5CHNB 3CGTA 3G5XB 3SCMB 1BP3B 2C4FT 5E8DH 3DECA 5EBWB 5CJQL 3KPRD 4ETYA 4Y19D 5I1HH 3OG4B 4HJGA 2OJEA 4KFZC 3MRHB 5I1AA 3DMMC 2V5RA 1EMTH 3VXSA 1ND0B 1QRNA 5FIEA 2AJ3B 2EDNA 3W11C 4LARL 4HUVA 3JV5A 3JV6A 3L7EA 4XHQA 3ZKMD 5EIIA 4ZQKA 5JA8B 1INQA 3FFCA 4YR6A 5I8EA 2EYTB 5IFAH 1J8HA 1Q94A 4PRBB 7FABL 4P2CG 4IOIB 1KPRA 4RBPK 3TNMA 1BF2A 5CEZE 1E4XL 3MOBL 3L6FB 1YMHB 4DN3H 1AP2B 4YE4L 1T7XA 4F3FA 1MAML 1OTSC 3H6JA 2JB5L 1I7ZB 4GSDH 5FGBC 1M7DA 3SDXA 2NXYB 1KN4L 5FYLH 4LBEA 4P2RA 5C0EB 4LSSL 2EDTA 4NN6C 4JZJC 3ZE0E 5TDPB 4QEGA 3WKMH 4POYA 4WNQB 1F90L 1L7IH 3MO1A 1SY6H 4ZTOL 1YEFH 1XF2A 4N8VA 5E1HB 4OLXL 4UAOB 3VXUB 3ZO0A 2XACC 1P7KB 4X7TA 3E1F1 5E8NA 3ALXA 3D3VE 4WHYG 1I3GL 4Y1AA 5IVXB 1XGTB 4OFIA 5HHMB 3WFZA 2HKHL 4NUJA 3R0MA 4HULB 2PXYA 5E6IC 4GRWE 4M7JH 3NFPA 1CD9B 2FL5A 2JB6B 2OXGA 3OKKB 4OZ4B 3SO3C 4AIXA 1MNUL 3X12A 1NLDH 4GG6B 2C7UB 3NPSC 3WIIH 4OLVH 4JFDB 4W70A 5HJ3B 2OQJB 1HYRC 1MI5E 3BP7B 4KMTL 3T0EA 4O9HL 4A6YL 4L4VA 1WITA 4Z0BH 1EX0A 2H1PH 4MB4A 1R5WA 4MQ7A 3P0YL 1A14L 1DR9A 4U1LA 4YBQC 2EZ0C 4JEGB 1NC4A 1GC1H 2OS7A 3U7WL 3OBAA 4H0GA 3UJTL 2MCG1 1W72B 2V2WA 4Z8FL 3QUMH 1MF2L 1DBBL 5KAQF 5I74B 5BO1L 4PREA 4YK4C 4ZAKA 4Q6IA 4XNUL 5DVMA 5KVDL 3DVGA 4NNYB 3BMVA 4Y88A 2X4OA 2ZKHL 2A77L 4HS3A 1BD2B 1CD0A 3ZDZE 5FGRA 4DAGL 5MHSD 2VWEC 4OZGA 4FP8L 1S7WA 4MNHB 2MHAB 1NLBL 3I6LD 4PJAF 1UWGL 4ZYKB 1HHIA 3FTGB 2ZP0T 3RHWK 1S9XB 3ZT7A 3NFSL 3PHQA 4JM4H 1JNLL 3CDYA 4E9LA 4ERSH 4ZFGL 4BQ9A 4D0CA 1J0YA 3FB7A 1P5UA 4D9QD 5CIPB 3VXMB 4ZFOA 2ICEA 3DSFH 3OKOA 4ETQA 3P2TA 4B50A 5M7QA 1AH1A 5I1DA 5E2TL 3G5YB 1TDQA 4FFZH 3T09A 3X3GL 2K3TA 4QRRB 3WO4C 4FQCH 5A1AA 4P46C 1EVTC 3GIZL 2PYFB 3NIGF 4MCYB 3FQXB 3RL1A 4GH7B 4QRUB 1FNEA 2CR6A 4K7PX 3BH8A 4HIEA 4P2QA 3PWVA 1ZWIB 3VFVA 2LU3A 2W9LA 5FDWB 1G0XA 1U8JA 4NM4H 3MV9E 4M6OH 1YEDA 2P7TA 3IXAA 1CVSC 3U1SH 5E9DA 32C2B 4BZ2L 1HQRB 3TN0B 4DQOH 4MJID 2I5YL 4JKMA 4F7EB 5F7EL 1RZFH 4POZC 1A5FL 3F7PC 4Y2DD 4JCLA 4OZHA 5AUMB 2IMMA 2VXQL 5DQ9A 5HI5D 1QFWM 2ZG2A 4OV5B 3F65A 4P4KB 4K7FB 4D3CL 3VE0B 1U91B 2XXMB 3QUXA 4J4PA 3DRTA 5F1IA 4HKBB 2ZUUA 1S7UA 1DVFC 3MUHL 1VPOH 5C09E 4PP2A 5MERA 5GHWH 2JJSA 4HF5H 2DM2A 1F42A 4XXCA 1INDH 1KLUA 4X80H 3A6BH 2G60H 2BOBB 1KN2L 4P23B 3FQTB 4HAFA 4YHYC 1MFEH 5I1IL 1N3NA 3W9EA 1YPZF 2AK4B 1KIPB 2F54E 1BJ1H 1M1SA 1RZJC 2YPLD 4U2YA 2IAMA 4Y4FB 1W8NA 4GXVH 4JHWH 3E0GA 3AM8C 3MLZL 4OLZL 4XAKE 1ORQB 2YEZB 5M95B 4H25A 3ARGC 4Y4KC 3RZCC 3BKMH 4IDJH 1NGPH 5HYSB 2F9BT 3S4SG 4RIRB 4WW1A 5H35A 5C0ND 5LBSL 4H0IA 2GJ6A 1E27B 1A6UL 1NL0L 5H2BB 5B8CB 2AXFA 4KJQD 2CDEB 2QR0A 4YBHA 2Y25A 1JPGB 4OF0A 5LGKA 1R3IL 2X89A 1MHCA 4TUKH 5IBTH 4X8JA 3BD4A 2ADJA 4LPCA 3O4LA 5C3TA 1AHWA 4D0BA 3L95A 5AG9A 3RJDA 1T1XA 2AEQL 4QHUB 3X17A 2VL4A 3KS0H 4S1SH 5CINH 3MX0A 4NQCB 2Z4QA 4H26A 2XZCL 3NCYP 4JO4H 3ZL4H 1PFCA 5TGBA 5T33H 3OZ9L 4TUJA 2IANA 4LVHC 4G7VH 1NFDA 3IDIA 4JB9L 4MAYD 5D1ZD 3UTZA 2IQ9L 2VDQH 2C3VB 3MJGX 4GMTH 1MRCH 4QCIB 1K3ZA 4PY7A 3SJVA 3C2AH 1CDUA 1C7TA 4UT6L 5ICZB 4IRSA 1U8KA 2OTWB 4DTGH 3T0VA 4C4KT 4EUPG 5JA9A 4NZUL 4WCYH 3KXFD 4GKNA 5ESVB 2GCYA 3E6FA 2YZ1A 1I8KB 3OJDA 4GRLC 4ODSH 3HNVH 1GOFA 1FFRA 2ZCHH 2DQTH 4J7RA 1CL7L 3SDXF 2C1OB 1G7QA 1UZ8A 4FZEH 3T1FA 4HIHA 5JORA 2ESVD 2R4SH 5CZXC 1S8DA 3C60D 4PRHA 3MRGB 2DLHA 3EFFA 3EYVB 1A3RH 3WL9B 5A2IH 3EO1B 2WBJB 5SWSE 2H6PA 1IL1A 1FZJA 4Y16C 5L9DL 1OB1B 4EI6A 2XPGB 4K71B 2HLFC 4RDQF 3BMWA 5D70H 2EE9A 4LPVA 2R0LL 4M7KH 5FGSA 4CNIA 3IKCA 1K85A 2ZSVA 3QIUC 4UBDD 1P7QB 4UOW0 1CTNA 5IHUL 1NANH 3L3HA 4LSVH 1MUJA 1G7LB 2ADFL 3SE3A 2HMID 1JV5B 4I2XB 5HYJD 1UJ3B 2NX5D 2NY0C 2FATL 2NQCA 2W9EL 4HHAB 5DMIL 3S37H 3U0TB 4OCXL 3RBGA 1IAOA 1BVKA 4NQDE 4XNMB 3S34H 1NGYB 4FQXC 1RJYA 5K9OB 4EI5A 3TT3H 2UY6A 1YN7B 3QNXB 3N1FC 1I3UA 4P3DA 5F1NA 3UO1H 1H5BC 4PJ5D 5E5RB 1I8LA 2ENYA 2AP2A 3TCLB 1JI2A 4G6JH 4ONGL 2X4RA 5JPNA 5TFSL 3VJ6A 4QKXB 1MRFL 1T7VA 4DGVH 1VFBB 2KKQA 5FYJU 4PJXA 4OAWA 4ONHA 4JR9L 1T2QH 5FOJA 1RZJH 3J7HA 3GMRA 5I1CL 1GAFL 3JWDC 2ADIB 2L7UA 4ODHH 1NUNB 1X5IA 3G5ZB 4GQPH 4M93C 1FN4B 5GGVH 1QUNA 4YQXH 1U92B 4JY5H 4UV4L 3MRFB 3QFDB 2IALA 4WUUB 4XB7A 3FQNB 4HUXA 2QSCL 5JXAH 2IFFH 2E9JA 5JW4Q 3B5TA 4LLYB 3QO0A 3WUWB 3OB8A 1XGPA 3ULVE 1U58A 2VLLA 2YD6A 3Q3GB 3T65A 3QI9D 5DJXA 3L3IA 1I85A 2FHCA 5TF1L 5JHDD 4J3SA 4JQXA 2D7QA 1DFBH 3NA9H 1UWXK 2VR4A 2JJWA 2LVCA 5EU6B 1K5NB 5KW9H 2XIDA 1A0QL 2PYEA 5DD6B 4BZYA 4PGZA 1P7HL 1XGQA 3CVHH 4LP5A 1R0AH 3DVNB 3RVUC 4L8SA 4MXQD 4X5XA 1WSST 4N1HB 1JTPA 1I9RH 4AYFA 5JDJA 1NCTA 5B38G 4ZUTB 1KJMB 4K2UL 4WTZG 4GLRH 4GKSA 2EDEA 3FKUS 1KTRL 1T22A 2IH1B 3T0XA 3BP6A 5FA4A 1CGVA 3KYKL 5IIEB 5D2NE 4KJYA 4R2GB 2EICA 1UM4L 5CEXB 3VDCA 1MCQA 2ITDB 4GO6B 1AD9A 3BGFB 4TTDD 1CDBA 3WXVL 1WZ1H 1PGRB 2YD2A 4DUXA 5C71A 3E3QE 4RMTA 1F97A 4L4TA 4Y5XA 5SV4A 2B8OT 4WEMB 2E5EA 1LE9A 1A21A 2DL2A 4PJ7E 3O3BB 4M3KB 4WY7H 4A2MA 3RVVC 4HS8L 5JIIA 2ICWB 2W60B 3ULUF 2ITCA 3I2CH 4YDLC 5GRZA 1TZGL 3P4MB 2VIRA 4LCCC 1TJGL 4JG1L 3L5IA 4KV5F 3CJJA 4GS7C 1EAPB 1MLCB 1HNFA 4FQ2H 5L8KB 1UACH 3HZMA 3I3DA 5MP6L 3UTSD 1FZKB 3QEQA 4XPBH 1YPZB 3QCUL 1UWEH 3F8UB 1OP5H 2VZUA 3HZKB 5JOPD 1IT9L 3CSGA 4NUGH 4LPXA 3UDWC 2WINA 1FO0L 4GKZA 4WJ5A 5MEOA 3GSNH 1I7TB 2KQNA 2GW5A 3C5ZB 3M17A 3U7YL 1NGXA 1WV7T 1MJUL 3QULB 4G9FD 3DV4A 2OXHA 4S2SB 3ILPA 5FB8B 1D5XB 3U48A 3W39B 3HI5L 4K3DH 5HHVL 4AIZA 2AQ2A 2G9HB 1Z5LB 2AK1H 4C56D 1YA5A 4BFBD 1MCWW 3BP5A 5A16B 5EU3A 4PJEA 1G7PB 1IE5A 2YA2A 1WTLA 3CK0L 2AABH 3SKNA 4MA8L 1UXWA 3D2UB 3GHBL 4OIBA 2GQHA 3TPKA 5IQ9A 4XBEL 3O45B 5DZLA 4ZUUB 3DSNA 3RGVB 4JLRB 1U8OA 2APFA 3UZEA 3FB5A 5FKPB 3OHXA 5E8EA 3JWDH 3D25A 2BJML 4JN1H 2Q20A 3HNTL 3BPNC 3MODH 3DETD 2I60H 1XIWC 2XG5A 2JK5A 5HGAB 5FUZL 2ZSWA 4LLMB 1IQDA 2CDFA 5L88H 2ZUTA 3RVXD 5JO5B 1A6AA 5EU4A 5F1KC 4R3SA 4U1GB 1R6VA 1EGJA 5J11C 2FSEB 4YHNB 4MA3A 5I66B 3GSOB 1EERB 3O6FD 4XCYA 1I1FA 4F33A 3WEXA 2BRQA 3FQUA 4RFNB 5DJAA 4NKIH 3SDCD 1DBAH 1KTDA 3CUPB 2R1XA 1CDGA 5TDOB 2I27N 1CE6B 4I18A 2B4CL 4PJBA 3ZYOA 3PXJA 3I6GA 4LAQL 3V4PL 2V7HA 3MRLA 4PLKD 1C08B 1GIGL 2EIDA 5JOEA 1BVLB 4L3EB 1RQ5A 1KBGH 1F5WA 2JTDA 1KPVB 1OGAD 1DBJH 1ACZA 1C12A 3BN3B 5KS9E 4IDLA 3BPOB 3ARQA 2R2BB 2Z35A 4JFQB 4XCCL 3KPOB 4ZO6A 4Q9RH 3WV0A 1DQLH 1BJ1J 3PQYA 3MJ7B 1G9ML 5BRZD 3QEGL 1J1OH 2QKIA 1V8HA 3HUJE 3HCVA 2RCSL 3BGMA 3O3AB 2AJSL 5IVXE 3FT4B 3NN8A 1FIGH 2HVKA 3LH2L 4ZO7A 1HOCA 4UIKH 1F3DH 1MCEA 1YY8B 1OARL 5D4QA 2DKUA 5CSZB 3MGOB 1FSKB 3NTCL 1UENA 4IBLT 4F58L 4GG6E 1HHGA 2X2YA 2HYMA 1G6RL 4JFDE 1J0KA 4HBCL 5K93A 1T2JA 3FO9B 4PGCB 3RDTD 1H3VA 1HXMB 4WV1A 3TO4B 4OQTH 2NY5L 3KS0J 1F4XL 4XCNB 5DQJA 3T8XB 4IMKC 3T77B 1RUML 4LPYA 3HC0A 3LMJH 1CIDA 2FWOA 3FO1B 4JPWL 2NY4B 3GSUB 4NOFA 4LRIA 3KR3H 2J6EA 4BFIB 1CLOL 2GT9A 4KU1A 1WT5A 3GMQA 4YZFE 1KXTB 5HHOA 3C9NA 4ZS6D 2F15A 2JE8A 5DJDB 1JPTH 2VLJB 3AMLA 4X5WB 4U6XA 4JRYB 2UWEF 1I1AC 1RJZB 1CFVH 4HV8B 2DD8H 1CK0H 1J88A 2UUDH 3KYOB 1A3QA 4YHPB 4J3TA 1OOAA 4X99A 5SWZB 1U8PA 2NY6C 3TZVB 1OAUH 1KT2B 3O11B 4I4WB 5GGTH 5FO9B 3U2SB 3AB0B 1DE4A 4JM2D 4MDIB 2X1XR 1A1MA 4K8RD 4XP6L 3MLVH 1QSEB 4OGAD 2VZTA 4NNXA 1L0QA 1LVEA 5IBLC 2ADGB 1TTGA 5CZVL 3RNKA 1VGEH 3AAZA 1TZHA 3VFPB 1WAAF 5EN2B 3TC9A 2LV4A 3CFJA 2VN4A 4Q0XH 4M5ZL 4WHDA 4G6AD 3O6ML 5ISZA 4P5TC 3P40A 5CEZD 3IYLW 4TSAH 5ALBH 5E00A 3VRIA 3FN0L 2R2EB 3NABL 3T2PA 1X6NA 4MCZA 3MNWB 5EOQL 1U8NB 3QUYB 4MXWH 4JRXA 1Q72H 4LDEB 5ID1A 3WNMA 1UEYA 4EJ1C 1MELA 5TQ0L 4CDGC 2MKWA 1Q0XL 1YNLH 4WO4A 2DQFB 3HG1D 5I30H 4Y8DC 1HDMA 2ARJQ 2VN7A 5ACLA 2Q86A 4UQ2A 1IAIH 5HI4D 2PCPB 1EJ6A 2P5EB 3D3VD 3OKEA 1LK3L 3V6BR 5EC2A 1JGDB 5BS0E 2CIIA 3RWHA 3MRRB 4OCWL 4IS6A 2R2HB 3C09C 5J6GA 3QDMA 1FDLL 2JJUA 2XKNA 2E7CA 3WHE0 4E41B 1EA9C 3FO0H 3S36L 3HLAB 3LD8C 4XZUB 5EOCH 4QOKA 5ICXB 3EO9H 1MI5D 1W0YT 3FOLA 3MV7A 4X9IA 5D7JA 5JLZA 2FYYA 2WANA 2YN3A 4HQQH 5DS8B 2AK4E 3QIWC 1NANI 1X5KA 3QUZA 3VW3H 4Y5YC 3UAJC 3U6RA 5F71A 2XY1A 4PP1D 1U93B 3SY0B 2VUYA 2I07A 4XNXH 2ZG1A 1CGTA 2BXZA 3IU3A 4HWBH 4LQFH 3P77B 3G04A 5AD0A 5E5MB 4YPGB 3SDDD 3MXVH 5ID0B 4KKCD 5DD1H 3H9HB 1U0QA 1OAZL 5HGHA 2P8PB 4RRPG 1YJDC 1J5OH 1YYMH 3ARFD 3ISWA 4Y4HB 1IEAB 3QFJE 3QP3A 1FLRH 1KB9J 4PRPA 5DUMH 4NQCE 1MHEB 1DBML 3ESVF 5DURB 3KJ6H 4R4FH 4LKXB 4HKXB 1QSFA 1FG2A 1VADA 5JOFB 2DLFL 3N1QC 1JWSA 2DMBA 2X1PA 3AY4A 5EO9B 1XR9B 1O7SA 3O6KH 1OQOA 4NN6B 4JZJB 5AYUH 4LEXL 3K1DA 5C0CB 1SJEB 5I71C 3G6AA 3QIBD 4I77H 3DRQA 4PRNA 3WNOA 2Q8AL 2MNUA 4JQVA 2BSRA 3K74B 2B2XH 4TRPL 5AZ2H 4Z78B 3CFKA 4CU6A 5I8OH 2RAMA 3KPRA 4PJFF 3FB6B 2R0WH 4AEHL 1DQQA 1IQWH 2DLGA 4KUZL 2PXYC 1OF2A 3B9KB 1AXIB 4O4YH 5K9JH 3SO3B 3V4UL 4AJ0A 3MRDA 1TENA 3QH3A 1CG9B 1XF1A 3HAEH 2F74B 5CWSB 1KJ2L 2YA0A 1OY3B 5ETUA 1JFQL 1PEWA 4IIQA 3VFNB 2ZOKA 5C0JA 4XPAL 4QT5B 1R3JA 4A6YA 1J7VR 1F11B 1WTGT 3B43A 4UB0H 4HJJL 4JFHE 2AS5M 3HE7D 5C09D 5HGGS 4XWGL 4JHAL 1IILE 1ETZA 4M62H 4ODVH 1LP9A 1IGYA 2YBRA 3DIFA 5E8OB 4I2XE 3KDMA 1U8MB 5E99L 1UKTA 4HWZA 3X13B 1HHJA 4TOYL 2UY7A 1IC1A 5DJ0A 4ZAKC 4Q6IC 2QADD 4ZFZA 3PP4H 3O8XD 1C5BL 4QXTB 4JDZA 5IKCB 4XAKD 4OQ1A 5CBEA 2IGFH 4OFPA 4BQBA 1MFCH 4M1CC 4U6HB 1SMOA 4WFED 3MR9B 5DD5H 1NCDH 1NH6A 5F9AC 4HXBH 4GAYB 3MROA 3IXTA 3I9GH 1MJJB 4DN3L 2H8PA 2OJZL 2X70B 3E2HB 1AXSB 2VE6A 2O61B 1GZPB 1TCMA 5FYLL 3MRQA 2NY3C 2RQ8A 3EJYC 3GBLA 5ACMA 2VLRB 4R96B 1R5IA 4RX4D 1AR1D 1F02I 3WO4B 5KBNC 3KPSA 4P46B 1ZVHA 3GRWL 2ZG3A 4LCUB 1PZ5B 5H94A 4UTAH 1KENH 2UWEB 2EEAA 3HPLB 4KK6D 4PJAE 4P3CH 1HWHB 3GIVA 4U1IA 5B4MC 2XFXA 3ARED 1WUNT 3VGDA 2DBLL 3TEUA 3BT2H 4OLVL 1YJDH 1YDPA 3L3GB 5TF0A 5F3BA 3B9VA 5D2LB 4XTRC 4WHTB 5ANMB 5EU6E 3MV11 3P73A 1UT9A 2DQUH 1L6ZA 5J6HA 4EVNA 4DZBB 5D6CB 2BY1A 2N7BA 3TIEB 5TDNA 4ZNCD 1GC1L 2VDLH 3RWIA 4S1DD 2AV1A 3MCLL 4QLRA 4X98A 3NIGE 3M07A 4J4PC 1GGYA 2FIRT 4JFZL 4J3UA 5T1MA 3FO2A 3QUML 1BQHG 5F1OB 2O93L 2DDQH 2P24B 3DI2B 3CXDL 4FMFA 5SWSD 3IJHA 4KK8C 2JJSC 5AZEH 4XXCC 3ZDXF 1A7OH 1QLFB 1EEYA 2FEEI 2YKLH 3CMGA 3LKOB 1YEEH 1JGEA 2R39A 1A9BB 2R56H 3EOYG 3ULUC 1JNHA 2VR9A 5ILTH 4XNZC 3VD4A 3VFOA 2IAMC 4X4XB 5FEBA 2NYYC 4NQUA 4MSWA 4HT1H 1VFOA 4F7PB 3ARGB 3G5VB 1HNGA 4HEPG 2Z92A 3EGSB 5A2LH 4XP9H 3HRPA 1FGNL 1S9VA 4Z7QE 5IUSA 3S4SA 1MFBL 2NW3B 35C8H 2EH8H 1MFDH 3CCHB 2RHEA 2HJKA 4ODXA 1CQYA 5I76A 4PLOB 4ZOAA 5GISH 1KEGL 4OGXH 3DSFL 1IZKA 2M8XA 4JO3L 4NQDD 3WN5A 3IU4H 1OWRM 4EXPX 3B3IB 1BM3H 2DS4A 2GJJA 3LN5B 5CP3A 3DGCR 3DURB 5C86A 4F7MB 4MJIA 1HEZA 5EUOB 3DTXA 3QUKA 1CIUA 1F58H 4Y2DA 1ZHKA 4FQCL 4XI5C 1ZGLA 4I3SL 1N5YH 4M1GL 2E27L 1AHWC 3PIQA 4KROB 1MHHA 1KF9B 1YPZE 3U82B 3VGBA 1YEHL 4BFGA 2CRZA 1O0VA 3HMXL 4TVSa 3E8UH 1QA9A 3U30C 3JV4B 3EYUL 4LLDA 3UTPE 3CVHB 5IM7A 1KG0A 4OF3A 4NM4L 1B90A 3TLRA 1OCWL 4M6OL 1JRHH 4LVHB 1S9YA 5B22A 1UZ6F 4Z5RB 4TNWK 4L9LC 2Z8SA 1OD9A 1WFTA 4Z7UF 4OCYH 1RZFL 3VGFA 4ODUA 2NZIA 3LEYH 4HKJB 4HUWA 5SX4H 4XCFH 3F7VB 1HIMH 2JELL 3UBXI 4PG2A 1L7TL 1G7MA 4RGMC 3X11A 1BWWA 1AR2A 5F9WB 2WIIA 1NBYA 2YPLA 4GMSH 2J4WH 3VXTB 3QSKB 1UH4A 4IRSC 5TPWH 2XWJB 4EUPA 2AV7A 3ULVD 1RHHB 2X1OA 2D4FA 1JN6A 3WBDA 1VPOL 1Y0LB 4FN0A 4JY4B 5EZIL 2Q7YB 4K7PL 5GHWL 1CXHA 3I02A 1Q0YH 4LLAA 4LVNC 4V1DD 1INDL 1QRNE 1TVBA 5GSRA 2A9MH 3GSWB 5IV2A 3BRGC 1F6FB 5C0IB 2E9WA 3Q1SH 4Y16B 1NSNL 1PG7X 3BOVA 1K6QL 4OM0H 4JN2B 43CAB 4GXVL 3R06A 3KJ4C 4JHWL 1NBVL 3JTTB 1ZGLM 4PJHA 1JHTA 4FABL 4PR5B 1J8HE 5GZND 3QIUB 4IDJL 1NGPL 5E7BA 2BOCA 5IF0B 5T1KB 1A1OB 2YK1H 1G6VK 4YAQB 3TJHD 4LIQH 3SE3C 4PJFB 5J56B 2DJ4A 4L3EE 2NY0B 3TA3B 2Z31D 3SDXE 3N9GL 1XH3A 3MRJA 2QQKH 1MCPL 4ZUSB 1XF3B 4MAYA 5LWYH 1MREL 5D1ZA 4BELD 2AGJH 3B2VL 1U6AH 5JDSB 4JDTH 1FJ1A 4WI7A 3HE6B 4YDJB 1PKOA 4M8VA 3NIFF 5CP7B 1H5BB 2FHFA 5JIPA 4M6ML 3EBAA 4XH2A 1LP9F 2VABB 1ITCA 5D1XB 2VLKD 3KXFA 1I8LC 5I15H 3LKSB 5BXFB 2R9HD 4IMLB 3BW9A 5F8QC 1U8QA 3U0PA 4LLWB 2AAVA 2HFTA 3TYGL 4G7VL 2ESVA 2EDBA 3C60A 4JFOA 2AKRB 1IAII 2IADB 3GMOA 3G6JA 3WE6A 4NYLB 1KLGB 4LHJB 3QXAA 3T0EE 3C2AL 2CD0A 4M93B 2BVEA 4XNYH 1LO0H 3MLPA 2FLRT 5ADPH 3S35X 4K07A 2C9AA 5T1DH 4JDVB 4WCYL 5ICYA 4P57B 3ROLB 4XVUD 4ODSL 5GS1A 4WEUD 4GKOA 2CKNA 2EO1A 3CDGB 4UV7H 3LRSA 4XCEA 4NQEB 4G3YH 5HYJA 4Z76B 1B0GB 2NX5A 3NIDF 5GRXG 2R0ZH 3HS0A 2ATKB 4KJWC 2Y5TA 3O41B 2A83A 3OX8B 1BIHA 5GZOC 4M02A 1BZQK 4I1NB 5DI8A 1F6AB 3WJJC 5D70L 5E2JA 2X4QB 4LDLB 2BVQB 3BJ91 4YFDB 3P0VH 3VCLB 4XMKH 4K7PY 4PJ5A 3ETBF 3KPQB 4YPJA 2MSPA 4D0DA 3E6HA 2GAZA 1C16A 3X14B 4NJAL 1QBLH 4YO0A 5E8PB 2CDGA 1J86A 4WTZA 5SWQB 2GEEA 5DJCB 3S37L 3DUHA 3Q5YA 1MWAA 3Q6FB 6CGTA 3BKYL 4NOBA 1H8OA 2CXGA 3SQBA 1RJCA 3P9MB 5SV3A 3TBVB 5CD5D 3X3FL 1Y6NR 1ED3B 1KTLB 4P99A 4Q6YA 4JJ5A 3BYTA 4GW5A 2ZCKH 4QRTB 1VDGA 5KSVB 1WCBA 4G6KL 5IB5A 4OBRA 2G2RB 5MENB 4ONOA 4W4NA 4P2QE 4Y5XC 5L8JB 1KLFA 4PJGA 2VXSH 4PBXA 2F5AH 2QSTA 3H7BA 3QQ9C 1G7IA 4NQVA 4XGZB 3RAJH 1RZJL 1K9TA 4EDXA 3QI9A 2HAZA 3QWRD 4YDLB 2Y6SC 5E9DE 4CVWA 5JHDA 2NXYD 4KRPB 5GS0C 1QQDA 1SJHB 3ZTJG 3PL6B 3VFSA 4GS7B 5AAWA 3T3MF 2EXWC 2CLZA 1CF8H 1KSRA 4OCMC 1A3LH 1NGQL 5CLWA 3L3JA 1EXUB 5JXAL 3VXUD 4BZ1L 3ARZA 2FB4H 4PRIE 1CU4H 1EEZB 4KGJA 1SEQL 4NN7B 3PUCA 4Z95L 5HHMD 5BVPH 3RPKA 3ILQD 1S5HA 4M00A 2YPVH 4O58L 5F7DB 1D5ZA 1RZ8A 5MEQB 1SJVA 1ONQB 2IMNA 2DB8A 5BMFH 2A6KB 4UQ3B 2NW2A 4E41E 1I8IA 1PDKA 3U9UB 2BSTB 3VDBA 4ZD3H 4JFDD 1GH7A 4BKLA 4JFYA 3ULUE 1A4JB 1N6QL 1CR9H 3L5XH 3KPPB 4M4PA 1R0AL 3CMOL 3G9AB 4HGWA 3BZFB 4G9DA 3CX2A 4NGHL 4G6FB 3NCJL 5JUEL 1R3KB 2FZ3B 4RAVA 1I9RL 1QLRB 3TH2T 5T3ZE 1UM5L 2EECA 5HSFA 2VXTH 3PV7A 2GJ6E 1LEGB 4XVSH 3JWOL 4X5LA 4IJ3B 5DC9B 3VXRB 5E2WL 3D9AH 1XIWB 4KAQH 4U1SA 5A40E 1H3UA 4JO2H 1YEGL 4O2EB 1OP5K 4BSVB 2MMXA 3O2DL 2XV6B 3C8KA 3CFIC 3CFDA 3FRUA 3TBYB 1UYWH 4CVZB 5FO8B 5EZJB 5CJ8A 1U95B 4FHBD 5GQBA 4QYOA 4Z7UB 1SBSH 1S7RA 1BD2D 1WZ1L 1V5JA 3NZ8A 3UTSA 3EAKA 3EDJA 5IW6B 3RNQB 5EO1A 4I18C 1FVEB 5TE4H 3M8OL 1R3LB 2NTSP 1CLYH 3EOBA 4G9FA 4B0MM 4L3CA 4BSWA 1BX2A 3GKWL 5FA3B 3PGCB 1OT2A 2E7MA 3VXMD 4PLJD 4C56A 4O5LH 1FFPA 1UB5A 3WJLA 4WUKH 1RUPH 4NQSB 4AQ1B 3LN4A 4QRRD 5IK3B 4AM0A 3DX6B 2VDKL 2A73A 5C0CE 1J87A 3GJEB 5E0QA 1REIA 3GSNL 3TNNB 2B20A 3MRPB 4KVCH 4XBPA 4MX7A 1UCBL 3HC3L 2V5SA 3ESUF 1WFUA 1KYOK 4CADA 4EN3C 5TH2B 4DW2H 2CUIA 4LOUD 3P4NA 1UA6H 2XTJB 3QXDA 4PRHE 1HYSD 2LU7A 5E70A 5BW7A 1QFHA 3EYQC 1RMFL 3NCEB 1Z3GL 3BDYL 3BEWA 3DARA 4I5BA 5T3XH 1F45A 3TN0D 2AABL 3HMWH 4UOJA 3GHEH 3O6FA 5E56A 2XN9B 4XHJC 2A9NH 3RIAK 3EJZC 3JZ7A 3KYMA 5I17B 1DUYB 3SDCA 1ZHBA 4WV1C 1M6OB 1PYWA 3JTSA 4P4KD 1PQZA 5C2BL 4JN1L 1G9EA 1I7UA 1FZMB 5GS0H 1YEIH 3IFOB 4QY8A 5DQDH 4OD1L 3BN9D 4YGVA 3P4OA 3S6CA 5C7XL 5EOTB 4XPGL 4P9MH 5L88L 3MUZ1 4LRIC 2V2TB 5EU7C 3MGTB 2X7LB 2Z8VC 2P8LB 4PFEA 4WI6A 4QHNB 5L2JB 1GYAA 2EYRB 2VDOH 4OUUB 1WT5C 4UILH 3VD7A 2AK4D 5LJYH 1IM9B 1T1ZA 4NKIL 4Y4FD 1OSZB 1N26A 5HYIA 4HXAH 3RWFB 5BRZA 5F96L 1RK0A 5EFIB 3ZKND 5DGRA 2ORBH 2PR4H 2RFXB 5E2UH 3OR7A 1WWAX 2VQ1A 3BIKB 4U6YA 3MLUL 1T6VN 3L7FB 2NY6B 1VACB 2P5WB 4KUCF 1TITA 5GGRB 3QB7C 3P9WB 1FFNB 1ZKAA 2D31A 5IVZA 1KC5H 4MQXD 1KJ3H 3LKPB 2VMFA 5F7YC 5LCVH 2V5YA 4Q9RL 1S7TB 2BVPB 1A7QH 1DQLL 1U8LA 4KK5C 1MFAL 3RDTA 4RFEB 1J1OL 1PG7W 2H2PC 2PW2B 5F7MC 1N4XH 15C8H 2VLMD 3QZWB 3ZKSD 3CLFH 5DK0B 1JRHI 1IGTB 4KVNH 1CDJA 1CFTB 1BFVL 4NQCD 4BUGA 4QXUL 1FNHA 1FIGL 4OZFH 2UWEE 4PTTA 5IB2A 4Y0GA 4YC2B 1BJ8A 1MCHA 1YUHB 2YSSB 4JFPA 5J12C 5SX4I 5HY9A 4YX2H 4C58B 1EGJH 4Q9QH 1HZHL 1CFBA 4JQIH 2GJZB 4ZSOA 4J3VA 4IRJB 3LHPH 2D7TL 2UUDK 1T7YA 3D39B 3OGOE 1HHKA 5D2LE 1BAFL 4ONFH 3EHBC 5ANME 3VGHA 4Q7DA 2FDBP 3DUUA 4PJGF 4C55A 3TPUB 1B0RA 5HYSG 4N1CA 1I3RA 4EQ3A 1WAAE 1XGUA 3PWUB 4Q9BA 3I6KB 1EO7A 4HK0B 1D5IH 4S11A 1L6XA 1GZQA 3C09B 4N9OB 2P48B 1RZIA 4NRXB 5T5FL 1OGTA 4NC1C 5IESH 4JM2A 3UROR 1Q9WA 2WBJD 1BLNA 3OL2A 4XC3L 1X9QA 1FFOA 4KHTH 3GUTB 3S5LB 5LQBL 3NH7H 1K4DA 2AXGA 1WISA 3QUZC 2XG4A 3D6GA 4L4TE 4ZPTB 4JFHD 2A0LD 1P7QD 2NY1C 3FN9A 1E28A 1OAUL 1T3FB 4LHUB 1QOKA 3HPJB 5GGTL 2OJEB 3RQ3A 1NGWB 3BQUB 1GXEA 1BQLH 1S7XA 4F7TA 4XBGA 5F6HJ 8CGTA 3ZYJA 4NP4H 1TVDA 3MUGA 3DHMA 1S9WB 2VZVA 1MPAL 4HFUH 3QEQE 2VDNH 3HG1A 4D9RD 5F72S 1YY9C 1H0DB 4O51A 1KACB 1FG9C 2XWBA 1SYVA 1TQCC 2JIXB 4MNGA 5F6IC 5IHZB 5KN5A 2OL3H 3D3VA 1K8IB 4RRPA 4KGLA 3TIDA 4NWTH 4DKAA 5ALBL 5FYKH 2J6EH 1Q72L 2GTZA 3S7GA 4JKLA 4D94A 1J11A 4QRQA 4F3FB 1RUKH 4TPRH 1G7HA 4E5XA 4HG4K 1MI5A 5I30L 1M7DB 4L3AA 3UTOA 4OIIL 4RQQB 4JCMA 5LGJA 2FGWL 3B8SA 1F2XK 3SE9H 1PKQB 4WUUD 5I71B 1A6TB 3QEUA 1T1WA 3CLEH 1IC5H 1WGOA 2DM7A 1JWMA 4W6WB 5CUSH 4M61B 5IFHL 1VFUA 3MYJB 2DWDA 3FO0L 4XP1L 3VGAC 5IB1B 3LZFH 5FGCB 4M43L 4AL8H 2X44D 3CFCH 1QPXA 1QBAA 1FP5A 4YHIA 3EYFA 5EOCL 3BPLC 1OLLA 2VJXA 3OKYA 4QHLB 4U0RB 1A4KA 2R23A 3SDDA 3BWUC 12E8L 2A6IB 3QISA 5EU6D 4Z7NF 2OM5A 4X4YB 4PJDB 4CMHC 3H9SB 2GSIA 3VW3L 1MLBA 1OM3H 3ZKMC 4M8QB 1QFUH 4UT9H 3THMH 3CVIH 4LCIH 5IQ7L 1LEIA 3GSQB 3ARFA 4MJ4A 1R5WB 4MZ2A 5K9KA 4K3GA 4LSQL 1HE7A 4PRDB 4YWGL 1KCUL 2G75B 5FKAA 1X5XA 4HWBL 3UPRA 3K46A 2XKSA 1LGVA 1NCCH 1OTTD 5GGUA 4R2GD 5KAQG 5F9DC 4PJFE 1RULL 5DYOA 2ZUQC 3RVWD 5JW5A 5DD1L 3O6LH 2OR8A 3DVGB 4JVPA 5HDQH 1ORSA 4FXGB 1NEUA 2H2SD 5D7LB 3WFBL 3AVEA 5LAXA 4ELMA 3RZWA 3D18A 4HH8A 4QXGH 4GW4A 3QIBA 1NAML 4OZGB 4RGNB 1FLRL 2BC4A 1N2RA 5DUML 3WUWG 1S5IH 3O2WH 4XVJH 3F58H 3KJ6L 4KJPD 4XAWH 1F4WL 5MEPA 2GY7B 4XXDB 1JTOA 1IAKA 3CFBA 1N5AB 4JRWA 5I2IA 3VXNB 5ADOL 3I85A 3MOQA 4ZG1A 3ALPA 4KI5E 5FDYA 4DK6A 5AYUL 3DNKA 1MY7A 4J1UB 5FV2A 2W65A 3HR5A 1TETL 5D93C 1UKSA 1A6WH 1VGKA 2CLVA 3R0NA 1GCFA 2NMSA 4X6EB 5AZ2L 3UTPD 3RL1B 3DGGA 4KY1L 1JUFA 4LKCB 4NKMA 2BVTA 4J6RL 1PX3A 3GRWA 2HTLD 2CLRB 3HE7A 5C09A 3VFVB 1ADQA 4IHOA 2NNAA 4V2CB 4NQEE 1MH5A 2FECI 4R0LA 1CLZL 1DZBA 2J3SA 4LARH 4YXLL 5IT2H 5HHOE 1T04B 1JNNL 4K55A 3O8XA 1ZSDB 5EUKB 2IPKB 5KVEL 2ZZUT 4C83A 3OXRA 4MNQB 3D2UD 5FECA 1CCZA 3MRMB 3UTQB 4MWFA 3RGVD 4GFTB 7FABH 3LKNA 4PJ9B 2NTFB 3S96B 3MOBH 1E4XH 1MJ8H 1NFIA 2I9TB 1WBXB 2E6PA 1AGDB 4YE4H 1QO3B 5F1IB 2IQAA 3T0DA 2HLAB 1BQHA 2JB5H 2Y06H 4FZ8H 1NDMA 1EHLH 2HFEB 4PP2B 5ESAA 5E4EC 4G8FB 1A22B 1TNNA 4LSSH 4R7NA 1A6ZA 1F90H 4ZTOH 2IGFL 5DMJB 4HKZA 4RX4A 4NSKB 1MFCL 5L2KB 2IPUG 4OLXH 2F8VA 4WHYH 1BZ7B 1T4KB 4JZNB 5ISZE 1H15A 2CKBA 1I3GH 3QO1A 1L0YA 5CGMA 4AIOA 1VKXB 3I9GL 2HKHH 2A6JA 3EIFA 1U8HA 4L3ED 5H35B 1MCOL 1KB5B 1KIRB 4TVPE 4Z0XA 3AREA 3RIFK 3GJFH 3WN5C 4ALAL 3LQZB 1SYSB 4NCC2 3MFGB 5AWNH 1LO3H 4O9HH 4A6YH 4JG0L 3O4LB 4YNYA 3FQRA 4I0PB 4Y2DC 5KSAC 2FJFB 1A14H 2Q6WA 2AJZA 5HI5C 1RZ7L 4PD4J 3U7WH 1HSBA 5DTFA 3SKMB 3U30B 1EIBA 3UJTH 4Z8FH 4LGPB 4Y5VC 1MF2H 1DBBH 3EOAB 1MSPA 5BO1H 2J5LC 3MRCA 3BT2L 1TPXC 1XR8B 4XNUH 5SWSA 5GRJL 5KOVC 5KVDH 3MCKA 3MV7E 4L9LB 1NFDB 3IDIB 1Q9LB 2A77H 2DQUL 4TULL 4RGMB 3IDMA 1Q9OA 5IMLB 4PG2C 3V7AG 4NKDB 3SJVB 5KVMC 3L3KB 1ES0B 5IMKB 3EDDA 1LO4H 3TO4D 3V7MA 3QNZA 4FQLH 1ZA6B 1PW3A 3LQAC 2B1AL 2OP4L 2X4TA 4AENB 3MMEA 2BVOB 3MA7B 3NFSH 1WF5A 4ODWA 5ESQB 1AGEA 2NY4D 4I3RL 5C0NC 5J1SC 1G7QB 1UZ8B 4LVNB 1A7OL 3FONB 2YKLL 4YFLF 4CVXA 4NQDA 4S0SD 2PW1A 4KJQC 5ILTL 3TBWB 1LE5B 1NGZB 3FB8A 4X0KA 4U7KA 3X3GH 1UZ6E 5C92A 5EZLA 5EA0L 5BOPA 4RDQG 4Z7UE 4HPYL 1NCAL 5K59F 5DMKB 4H0HB 4JRYD 4NO5B 3T4YA 4WGVB 4XP9L 3W0WB 1R24A 3B6SA 1MFDL 3TZVD 4GRMB 3L3HB 1QSFE 1BBJA 3WLBB 2VITB 3WFEH 1QSED 4BZ2H 2FO4B 1CFSB 3K2MC 4QHKI 3OXSA 2I5YH 1D6EB 5F7EH 4L8CA 1A5FH 3C6SB 3OQ3B 3ARDB 3W2DH 4MAYC 4UNTA 1FNSL 5KSUA 5HPMA 3OSKA 1NAKH 5HVHB 4EDWL 1FVDB 3L3OA 1T20B 2PO6B 2VAJA 4D3CH 1T0NB 3QQ4B 3TCXA 3KPRE 3QNYA 5D7KD 4F7CA 4H1LH 1DN0A 3QUYD 3PJSB 5E9DD 4RMSA 4V1DA 1C5DB 1KIQB 4HS6A 2HG5A 2XTJE 3OKDA 2YUVA 3WIFA 3C60C 4ELMF 1XMWA 2W38A 1QFWL 1HIML 1FV1A 3O3DB 2LTQC 1DJSA 1XF4A 4PRID 3HZYA 3NGBC 4X6CB 4JFXA 2J4WL 1T2XA 3NAAL 1R3HB 2XN9E 2P5ED 5DHYA 3QXWA 1QLEH 1F4AA 4LCYA 5TPWL 4KDTA 1W0VB 5I9QC 2GITB 2C3HA 1ZT4B 2W1NA 3NIFE 5GS1C 2XQBL 3B5HA 4UBDC 4CVUA 4ZFOL 3MJ8B 4KK9C 1LP9E 1AKJD 4E41D 1NL0H 4ZXBD 5D2NA 1NDGB 2HMIC 2RIKA 1DLFH 4N0UB 2VDRL 3L3IB 4TNVF 2Z31A 2XZQL 4DZ8B 1R3IH 2BFVL 5I8CA 3PHOA 4NKOA 5D1QD 2WWKO 2HT2D 1YEJH 3RTQB 4U6TA 4P9HL 2AEQH 3DXAE 4NDMB 4LSDA 4OCLC 1IZJA 1AY1L 2DAVA 5T3ZD 4M9OA 2OLDA 5I6XC 2YWZA 5I0DA 5DJ6B 1B88A 2XZCH 2VLKA 5BZDB 2EIZB 4PJ7A 3GKZA 4H88L 1NC2B 3OZ9H 3V5HB 3F7QA 1OP3H 4KH2A 4GKSB 2Y72A 1T80A 2Q7NA 3PABA 3CU7A 5DEFA 2H3NB 2XT1B 3C5SA 4G5ZL 4JB9H 3H9ZA 3BZ4B 5EBMA 1T89A 3VXQB 3NIDE 4DGYH 3V5KB 1A8JH 3LQAH 3VFUB 3EW3B 3QA3B 3NBNA 1PG7L 4EUPH 3KPSE 5E1AA 3O3EB 2E7LA 4HIJB 4CMMB 3BEVA 4NZUH 4Y4HD 2WNGA 4Z7VB 1IGIH 5HDLA 5I15L 3RWGB 1T7WA 3W9DA 2H32A 3RX8A 4WRLA 1CL7H 2DM3A 4NJ9L 2CSPA 2L0DA 5T5NF 1P6FA 1OAYH 4F9LA 5DK2A 5DURD 1R5VB 2DM4A 1IC7H 3ULUL 4JO1L 4JJHA 5ERWB 4YFEA 3QI9C 4JGJA 3H3PL 5F9OL 1RJLB 3FT2B 4K23L 4ACPA 2VZSA 5L9DH 4F2MA 2VZ3A 3D39E 4P49A 5C0CD 2VR5A 5H8DA 1QVOA 2R0LH 1CFQB 4LLVB 2VQTA 4KZEL 4RAUB 1J18A 1BFOB 1T6WA 5CHNA 4KRMB 3I6LE 1YN6B 3GK8L 3G5XA 5GSVB 2EYSB 4ZMAT 2WLYA 3L9RB 1MCFA 2QSVA 4WJ5B 2ZOLB 5EBWA 2ADFH 2WZPD 2DQCL 4MD0B 3BP4B 4RNRB 3MRHA 5DMGC 2QHLA 2W9EH 3DV4B 5F93C 3B9KD 1BGXH 1ND0A 2G5BB 2I9LB 2AJ3A 1U8IB 5BZWB 1TJHL 1NUFA 3BP5B 3U79A 5IB4A 3PWPB 2ARWA 4TTDC 1DSFL 4X6FB 2WWMD 3S35L 3T3ME 4P5KB 1QEWB 4YBQD 4ONGH 2EYTA 5TFSH 5IQ9B 4G8EB 2ZUYA 5C3LD 1MRFH 4PRBA 4BSJA 4APQB 3JUZA 4IOIA 1T1YB 4JR9H 3L6FA 1YMHA 5F7HA 3DX9B 2OK0L 1GAFH 1B4RA 3QWRA 4QRSA 1I7ZA 1G1YA 1GGUA 4EI5D 4OGZA 4OZFB 4MJIE 5C0EA 2J2ZA 3O2DA 5TDPA 2ZCKL 4UV4H 4WNQA 5AAMA 4MA3B 3T04D 2G5RA 4R26L 1AE6H 2QSCH 3VDAA 4F33B 4X7FC 3VXUA 4EZMA 3FQUB 1AGBB 1P7KA 5I1EL 1KTDB 4LMQI 5T1LB 2R1XB 3RWCB 4JVWA 4EIZC 5IVXA 1IM3B 3GM8A 3NCYS 1WBZB 1XGTA 1P4LB 3BVNB 3RAJL 2B4CC 4UINH 5IOPB 2JB6A 1GSMA 3OKKA 5TF1H 4MAUH 4GG6A 2C7UA 5FOBB 4JFDA 2VLRD 4UDTB 1A0QH 4LGRB 1CF8L 1V7NL 5HJ3A 2OQJA 3ZZ1A 1A3LL 2RGSA 3BP7A 5JXEA 3PNWB 1EHAA 1X5GA 1KCKA 2Z35B 4PS4L 4P46D 4HUMB 4LSRL 1MQ8A 2IJ0C 3QAZC 4K2UH 2ARJB 2YPVL 3PDDA 4HCRA 4EN3B 2Y9RT 5BMFL 3KYKH 4HDIB 1Z0MA 3EO0B 5FGCE 3I50L 4N0YL 1UM4H 4FQHB 3DETC 4YDIL 1K2DB 5D71H 2DICA 4ZD3L 3SBWC 4ZOBA 1DUZB 4IOFD 3L5XL 3RVXC 4NNYA 3W5MA 1NCWH 3WXVH 3GBML 4YDVB 5J3HD 1BD2A 3O6FC 1E4XI 1LK2B 3ULVF 2Z91A 2W0FB 2OR9H 4RGOH 3BRFA 4WV1B 2MHAA 3SDCC 5DJYB 4ZYKA 4NFCA 3FTGA 1Y18B 5J57B 5DQJB 2NZ9D 2GUOB 4PLKC 4HS8H 4K9EC 4KAQL 4GQ9L 2NY5C 2OL3B 1TZGH 2F5BH 2B5IC 1TJGH 4HMEA 4JG1H 5HGDB 5CIPA 3VXMA 2APXA 3DO3A 5TQ2H 5ITBL 3OKNB 2D3VA 5CJXA 3PWJB 2CIKB 5MP6H 2Y4SA 3G5YA 3VGEA 3DBXB 4QRRA 3ZYIA 1IT9H 1WLHA 3LRHA 2PYFA 3C5JB 4MCYA 3FQXA 4GG8B 5GS2D 1WFNA 3BHBA 4RGNE 2WP3T 5C0RL 1MJUH 3MRKA 5KSBF 1ZWIA 2ESVE 5GIRB 4CBPA 5FDWA 3HI5H 4G42A 2A74A 1PJ9A 3SPVB 4O5LL 1A1MB 1MQKL 32C2A 3TN0A 3CK0H 3RHWF 3MSPA 4MA8H 2EDDA 4F7EA 1XGRB 5AUMA 3GHBH 3Q2CA 4KROD 3RDTC 4AEFA 4OV5A 3N06B 4R4BB 1D5MB 2KPNA 4P4KA 4K7FA 4HC1A 3VE0A 1U91A 1GVIA 3HNTH 1VB9A 2YC1B 2LAAA 3KAAA 3C6LB 1NMCC 4HKBA 3WFDL 2D0FA 2K7QA 3VH8B 3S98A 5FUZH 1HH9B 3SDAB 1CXFA 3MPCA 3MUJA 4WU7B 3HMWL 4CJ1A 2BOBA 3EDKA 1Z9LA 3FQTA 1P1ZA 2AK4A 1KIPA 3BKCL 4Y4FA 4HW6A 5GJSH 3VFTB 3MBEB 2B4CH 1I1YB 2YEZA 5E6YA 4LAQH 3OKEB 3V4PH 3EOTL 1GIGH 1DEEB 5HYSA 1YEIL 2R2CA 4RIRA 2CIIB 5DQDL 3IVKB 1E27A 3S3PA 3TFKC 1IGCL 1F3JB 5H2BA 4IRZL 5IWLA 4QRPB 5B8CA 4E0RA 4Q74A 3DV6B 3KYNA 2CDEA 4JM2C 1E6JL 4HZAA 1A47A 1JPGA 4K8RC 5DHVB 3WD5L 4QOKB 4OGAC 3FOLB 4XCCH 5IMOB 1PLGH 3CPLB 1LNUB 3WNLA 3V0WL 1G9MH 1PD6A 3QEGH 2YPKB 5L2KE 3QUZB 4QHUA 2ORBL 4U1KA 2PR4L 2W0LA 1J0HA 4G6AC 2AJSH 5T1KD 4NQCA 4PJGE 3LH2H 2J12B 2AJUL 4XPTL 1P69B 2Q8BH 3ULSA 2AXJA 1XCTB 1FAIL 2X10A 1OARH 2IEPA 3TA3D 1ITBB 5J1AB 5DEGB 4L8DB 3NTCH 5JHDE 3RWDB 1KC5L 2IFGA 2MWCA 4HD9A 4F58H 3ES6B 1B6DA 2BNQB 4HBCH 4WI4A 3QPQD 1KCSL 3BWAB 1A7QL 2RR3A 4PGJA 4ZTPH 15C8L 3HE6D 4ZO8A 1HXYB 5ICZA 3OPZL 4K9EH 4NBXB 1XCQB 2OTWA 2NY5H 1F4XH 5HI4C 43C9B 5D1XD 1T66D 1J05B 5ESVA 3SGDH 4XP5L 1I8KA 2XA3A 5DD0L 1HCVA 4JPWH 1LO2H 3MOAH 3P9LB 5DFTA 2C1OA 1EGJL 4JY6B 5F88B 3QHZL 3MC0A 5DO2C 3VWJB 1CLOH 3MRGA 4KI5D 3EYVA 5HPOA 4LEOB 3WL9A 3EO1A 2WBJA 1JZ6A 5EPMB 5HGBB 2KZ1B 4L9DA 3V6ZB 4MS8D 3GMMB 1OB1A 2XPGA 1QR4A 4BH8B 2IWGA 3MLSL 1VFAB 4LVOC 3F5WB 2A38A 1D5IL 1P7QA 4P2OB 2EDJA 1TNMA 1CDYA 1I9IH 5C0DA 3VGAB 4NQED 1JV5A 4Y19B 4I2XA 4NNPH 2E3VA 1UJ3A 3BIAX 5IESL 5IHLB 3U0TA 4HHAA 4NZDA 3F7RA 4PY8I 5JZ7D 5A2FA 2EKJA 2J1KA 4XNMA 1T21B 5CZVH 1NGYA 4OB5L 1WJ3A 3ABZA 1LEKB 5K9OA 1M05B 1EBPA 3UTSE 1OT1A 4KKCC 4FTVB 2P44B 4UTBL 4M5ZH 3GJFB 1YN7A 3QNXA 1JGUH 3O6MH 3ARFC 4DKDC 4A6YB 3SGEH 3TCLA 2ZUVA 2E7HA 1JZ7A 5DSCB 3NABH 1MCLA 2OZ4L 3DROA 5ELIA 3W0WE 5EOQH 1RFDH 1VFBA 1OVZA 1JZ5A 5LGHL 1F4YH 3R8BB 4NP4L 1D5BB 2ADIA 2ZUQB 4L5FH 3MZTA 2VDNL 5IW1B 1XFPA 3IDYC 1FN4A 3NACL 1CL7I 1U92A 1NBQA 4E42A 5ISZD 3MRFA 3QFDA 4WUUA 4Z7NE 1LK3H 2YD3A 5IB3A 3FQNA 4G80A 1Q38A 5MEND 4WW2F 4DK3A 5FYKL 4ZUWB 3CZFA 4LLYA 2EDOA 1FDLH 7CGTA 3WUWA 5C07B 4K8RH 4AQOA 4ESKA 3S36H 3BXNB 3RVVD 3Q3GA 4JKKA 3UCRA 3O9WB 4TPRL 2VE6B 4WO4D 5DFVD 4ZS7L 2HT4D 4KRPD 4RWYL 3WUZA 3M45A 5DRXB 3CX5K 3PL6D 4XT1C 5IROC 4HMCA 5EU6A 1K5NA 3KYAA 4OF7A 4DVBB 2P1YA 1BIIB 5DD6A 3LB6C 3V52H 1MVUB 5D93B 3RUGB 3MLXL 1UADC 2FJHB 3CLEL 3BO8B 1IC5L 5CEZH 1FNFA 1GOGA 3S3JA 2OTUB 2EE3A 5I75C 4X6DB 1KJMA 3K80A 4ZUTA 2ED9A 4AL8L 2IH1A 1FYTB 1FZOB 4NWUL 2NY2B 5KSBB 1V05A 1XF5B 5IIEA 4PG9B 4UT7H 5CEXA 2J8OA 4R0LC 3FAXA 2QADC 1CICC 2ITDA 1OAZH 3RVTD 3O8XC 4F80A 2UZIH 4OLUL 5ACZB 2Q76B 4G6FD 5J6HB 5FYJE 4GRWH 1H3GA 4TVPL 2BSSB 1SBBA 3V6OA 3LY6A 5I1GL 1K4CB 3QDGB 3O3BA 2ZPKL 3VXRD 5GGSB 1XIWD 1KGCD 3VRLF 2ICWA 2W60A 1QR1A 2DLFH 4LU5L 5C08B 3PDGA 3PWLB 5HDQL 4H1LB 4NN5C 3LSOB 1ZHLB 4LEXH 1MLCA 2CJUL 5IW3A 1FZKA 1BOYA 1VCAA 1YPZA 5KTEL 1AR1C 5A3ID 3HZKA 5KVFH 4WFFD 4X9GA 3EYOB 4TRPH 1S5IL 3OG6B 1YYLL 4CGTA 1I7TA 3JSSA 4WWKB 2AJYH 4O02L 4AEHH 3C5ZA 1ZV5A 2DQEL 4ORGB 4R97C 4OV6F 3QULA 4KK6C 4S2SA 4R7DB 5FB8A 1D5XA 5DJZB 3W39A 3KGRA 3QRGH 3B83A 4WFGD 2G9HA 3AREC 4OLYH 1Z5LA 3WFHB 3WLWD 5A16A 3LS5H 1G7PA 5I1KL 1I1CA 1JFQH 3OAYH 3QUKB 4Y2DB 5KSAB 4XPAH 4F15B 1OPGH 2BHUA 3D2UA 4UU9B 2DRUA 4K3JL 4HJJH 2CK0L 3O45A 4ZUUA 3RGVA 4JLRA 4S1DC 5FKPA 4XWGH 4JHAH 1PZUB 4Y5VB 3GSVB 1HILB 2XTJD 3FMGL 3KLDA 5E99H 3MACL 4C54A 5HGAA 1YZZA 4TOYH 1T7ZA 4LLMA 5IT2L 5JO5A 5D5MB 4CL7A 2YUZA 3STLB 1C5BH 4CKVX 2FSEA 3DX7A 4I8DA 4YHNA 5I66A 3GSOA 4HUWB 1D3CA 3OAZH 2XN9D 2QV2A 4ZPVB 1FQ9C 3GO1L 4MB3A 3CSYA 2YPLB 5TDOA 4BQ6A 1CE6A 4R9HA 4U33A 5J4MA 1KCRH 3GJFK 5DT1H 5I18L 1QBML 1MJ8L 1C08A 2OJZH 1E6OL 1JN6B 4D9LH 2Y06L 1BVLA 2BP3A 4L3EA 4FZ8L 1EHLL 4K94L 5IGXL 1KPVA 4BH7B 3TV3H 5ECJE 4NM8H 1ZA3A 3OMZA 3HG1E 4U6VL 1IM9D 3DXAD 4LGSB 2R2BA 4OD2B 2BNUB 1FE8L 4AY0A 4MNGE 1X5YA 3UTTB 5L0QB 2N7AA 3GRWH 3MJ7A 2CRIA 4PJHB 1G1CA 3MBXL 1ADQH 2HKFL 3O3AA 3P4LA 4Q2ZB 3FRPG 5EULV 3FT4A 3DO7B 2NY6D 2VL5A 4PJCB 2ZJSL 2UYLB 3T0BA 5F7UA 4N90D 2DBLH 1YY8A 4GT7A 3BPCB 4OF5A 4TSBL 3RKDC 3GMNB 5FHBL 1YC7A 5CSZA 3MGOA 3F12B 4MQSB 2HFFB 5AWNL 1XH3B 1LO3L 3MRJB 4BUHA 3KPNB 5IJKC 3KPSD 3FO9A 4PGCA 1HXMA 1FJ1B 5DVNA 3V2AR 4QHMB 2L4OA 3TO4A 3MCLH 1IBGL 2WLZA 1ZK9A 3CXHJ 5K59E 4GXUN 4XCNA 4JFZH 5DDHB 3T8XA 4DJMA 2HA1A 3GMLB 3T77A 5MI0C 3V6FB 2VKWA 3ULVC 3FO1A 3CXDH 2P43B 1WWWX 3TBSB 1U8QB 2NXZB 3GSUA 5H37H 4KZDL 3V8OA 4IRJD 4OKDA 4BFIA 3B9EA 2CRMA 3D39D 1FC1A 5ITFB 2LTQB 2CKBH 3ZMRA 3GB7B 3NGBB 1JIBA 5DJDA 1N59B 1LO4L 2BSED 3A67L 2GSGB 3QEHB 4FQLL 4X5WA 1JF1B 4H8WC 2DJUA 4JRYA 1RJZA 5EO0A 2EE2A 4HV8A 3OWEA 4KDTC 1T5XB 3KYOA 2R8SH 1FGNH 3Q0HA 5GZNC 4WW2B 4YHPA 1SY6A 3OR6B 1MFBH 3FHQA 3W81A 5C1MB 3TZVA 1KT2A 3O11A 1EHNA 4I4WA 5FO9A 3SGJA 3U2SA 1KEGH 5D2NC 4JO3H 2ATPB 2NX5B 4MDIA 1QSEA 3FHAA 1FBIH 2Z31C 1X5ZA 4NO3B 2ADGA 4ELME 4I3SH 4M1GH 1DL7L 2E27H 1CT8B 3QZWG 5HHQB 4WI2A 4UIMB 3VFPA 5EN2A 1YEHH 2OCFD 3QJHB 3BSZL 3HMXH 3E3QC 2CK2A 3QCTL 2KL6A 3EYUH 4I0CC 1NPUA 5E24E 1NBZB 2E9IA 2FX9H 4RMUA 3MV8B 1C8PA 4LHUD 2EIBA 1W0WB 1J9CT 1OCWH 1JCKA 2R2EA 3PWNB 1C16B 5HD8D 4MMZC 2R9HC 3MNWA 1U8NA 3BQUD 3QUYA 3WFEL 5B38B 5KZCB 2GK2A 4XWOC 1CZ8H 1ZT1B 5C70A 1CWVA 4UUJB 1NQBA 3QPXL 1WZLA 3D69B 5IJVB 4LASL 1FC2D 3W2DL 4XB8A 2HH0L 1T89C 2JELH 4LLQB 1L7TH 3B2UC 3AFLA 2DQFA 3SGDI 1NAKL 1HHHB 4PRIA 4Z7QF 2JIXD 2PCPA 2E7LC 2P5EA 2B39A 8FABA 4J2XA 1JGDA 4XVUC 5EZIH 4K7PH 1I4FB 2R2HA 3JXAA 1AKJA 4E41A 4ZXBA 3HLAA 1D9KB 5FF6B 3ZLQC 1GGCL 4EDXB 2UZXB 4XZUA 1N7ML 2QSQA 3QQNA 5ICXA 3S5LG 5CAYB 1NSNH 1K6QH 3D1MC 4JVUA 5C0GB 5D1QA 1NBVH 5DS8A 3QWQB 1ZOXA 3H7LA 1UKQA 1OP3K 1QLEL 4FABH 1U36A 1TVHB 4WFEE 1HQ4B 3ECBB 2EE6A 4N9GB 4HSQA 3FOMB 3UC0L 3MLRL 4LHUG 4LHQB 1E4WL 1U93A 3SY0A 1JL8A 4UI2A 1FO0B 1DLFL 3CU1A 3TGXA 3VGGA 3N9GH 3P77A 4NO0B 1X4XA 1YNTB 2X9XA 3T4AB 4QRPE 1MCPH 4YPGA 3K2UL 1MREH 3B2VH 3QG7L 5ID0A 2EEDA 1YEJL 3H9SD 3SKUD 1RIVH 5E94B 3SGEI 3H9HA 5CD5C 5GGQL 1P84K 2P8PA 4M6MH 3NFNB 3ULVH 5GGRY 2P4AB 5GJTL 4G7YL 4G9DB 4Y4HA 1IEAA 2WBWB 1SMAA 5FUOH 5HTSA 1MHEA 3TYGH 2NR6D 5CSBA 4LKXA 4HKXA 5JW3L 5JOFA 4MB5A 3JWOC 5F89B 4DGYL 5EO9A 2FJGB 1XR9A 1D7FA 3C8KB 3LQAL 4H8WH 2V6HA 1FL6B 2NXYC 5DRNB 4JZJA 3RX5A 5D7LD 1FH5H 3RWEB 5C0CA 5C6TL 1SJEA 3GSXB 3TH3T 4HIIB 3QXUA 4K3EL 1IGIL 4RGND 1PSKH 4OTXH 3QXVA 2D0HA 4JZOB 1OAYL 1IC7L 1CXKA 3FB6A 4DKFL 2LU4A 5KJRH 2CR3A 4G9FB 3LDBB 3B9KA 4YIQA 5JMRA 5GXBB 4OI7A 1ZVSB 4CN1A 1LD9B 1CG9A 1KPUB 2F74A 5CWSA 2DLIA 5A2JH 4PUBL 4POUB 4I48B 1X7QB 3VA6A 4WDIB 3VFNA 3WIHA 4QT5A 25C8L 1F11A 1T0MB 5F7WC 4NJAH 6FABH 4WI8A 3QBTB 1DCLA 5E8OA 3BKYH 1BGXL 1U8MA 5I74C 4KUCD 2VDPL 3X13A 1BOGB 1BZ9B 1CDHA 1A64A 3BDXA 3X3FH 4QXWA 2BX5A 1RU9L 1S3KH 4QXTA 5DXWA 3VWKB 3RY6C 5IKCA 4MNQD 2HRLA 1F8TL 2D03H 3ELAT 4G6KH 3DYMA 4FTVE 2B7DT 4U6HA 1G6RB 4Y89A 3MR9A 1ZHBB 5DZOA 4MHHG 1X5LA 3T0AA 4GAYA 3JTSB 2FCBA 4PJ9D 1RIHL 1C5CL 1MJJA 4I9WE 3JUYA 2QHRL 4X6BB 4GAGH 4QY8B 1GHFH 2X70A 1N8ZB 1AXSA 3EUUA 3DJ9A 2O5XH 2O61A 4TYUA 4KK8D 3ARUA 2DMKA 3MNZB 1OGAB 4PLJC 2VLRA 4R96A 2HJFB 2VAAB 5CJXC 1NGQH 1AE6L 5L2KD 4BZ1H 4HGKC 2I25N 2NYYD 4P46A 3IAPA 1SEQH 3LPGA 5DD3L 1J0ZA 3TESA 4AH2B 4LCUA 1PZ5A 4N0CD 1PY9A 4Z95H 4PGDB 2UWEA 3HPLA 4O58H 4ENED 1VERA 1L9NA 4S10A 4UINL 2JJVA 4V1DE 5C07E 1GGTA 4MAUL 4LOUC 5J9PB 2IH3B 3BAEL 1VEPA 1HYSC 5IVOA 5FUCE 1J8KA 1N6QH 3L3GA 2UVEA 3TT1L 3SKJL 1ACYL 2JJTA 5D2LA 1QBBA 4P5MB 4WHTA 3K8MA 3CMOH 3KHOA 4RA0C 5ANMA 3MNVB 4XI5D 2XZAH 4I0PD 2R29L 4N8PA 4NGHH 4GW1B 4EOWH 3NCJH 5JUEH 1RHFA 4DZBA 5D6CA 3HC4L 3TIEA 1WAAA 1UM5H 4NFBA 1MWAL 3DX8B 4QF1B 4P4KC 3JWOH 4G8GE 1EH9A 3HI1A 4X6DE 3BD5A 5E2WH 2P24A 4PIRF 1YEGH 5D71L 5I1JL 1FYTE 1N0LA 3D5OF 4YXHL 3BN9C 3O2DH 5F9JB 1T0PB 2C1PB 5KSBE 2OSLB 5C0BB 1NEZG 3D0LB 3GMPB 4PGBB 4NHUA 5JNYB 1QLFA 2P45B 5JPMB 3LKOA 4QWWC 1NCWL 3ORJA 1UM6L 1A9BA 2COQA 3RL2B 5KANG 1Q9KB 2OR9L 4FQIH 1KNOB 4RGOL 3D48R 5F1SA 4X4XA 4Y4FC 2H26B 4U1NB 2PKDA 4MA7L 2VLKE 5EU5B 3U4BH 1N0XL 3M8OH 4F7PA 4Z77A 3G5VA 5GRVK 3EGSA 3ZKNC 4FQJH 1JZ2A 1KTKE 3WHXB 1DLHA 5DGQA 1RD6A 2NW3A 3QDGE 5KG9B 2F5BL 3GKWH 3CCHA 2VISB 4YJZL 3U9PH 4YHML 2HJLB 3LS4L 4M7LL 1AJ7H 5IWLC 5B8CC 2Z93B 1CLCA 5TQ2L 3B3IA 4JM2B 3LN5A 4U1HB 1M71B 1BLNB 3DURA 5EUOA 3N1GC 4ODBD 4MQXC 3MREB 3QWOB 1RURL 2VDKH 1E4JA 2P8MB 4B7LA 3TVMC 5JR1L 3IS1X 4AEIH 4N8CL 2FHBA 1UCBH 1EDQA 3HC3H 5IEKB 3W0WD 2FR4B 3JV4A 4HPOL 3CVHA 1CFNB 4F37K 1U41A 1RMFH 1OLZA 1Z3GH 2W0PA 3BDYH 5GRVL 4BYHA 4EXKA 5BQ7B 1VEMA 4Z5RA 1RUQH 4OZIF 5I1LA 1FL3B 4AMKL 1G7JB 3ARDD 4HKJA 5ENWB 4OCSL 3MUGB 1X5HA 2Z8RA 3ZE2F 4XMPL 2HN7B 5EC1A 5FO7B 5IR1B 3P3YA 4RMRA 1RVFL 2VTFA 2PO6D 5C2BH 2W92A 1JHLL 3D3VB 3T2NL 1HKLH 4OJFL 1RHHA 1QNZL 4OD1H 1U3HC 1ROWA 2UVFA 1Y0LA 4JY4A 3UEZA 5CIPH 2MPAL 2Q7YA 5C7XH 4XPGH 4YHOL 4GRWB 4LAJH 4YDKL 3G08B 1UG9A 1NUDA 3GSWA 1KUMA 5D7IF 2WBJC 4LVEA 1HK6A 5C0IA 4M6NH 3OGCB 2HT3C 1AXTH 1UXSA 2UV3A 5GJSL 1A2YB 4K71C 3UP1A 2FO1A 2O5ZL 5F96H 4LVOB 4PR5A 5HHXH 1BFSA 2A0LC 3MLUH 5IF0A 1I7RB 3N85H 1JWMB 5T1KA 1A1OA 4OBSA 5IP4A 3RPIB 3CSBA 4YAQA 1OAXL 1QSVA 1OHQA 4PJFA 3TA3A 1A7PL 4ZODA 3H0TB 4ZUSA 4NZTL 1PLGL 1XF3A 2R69L 1MFAH 3VRJB 5JDSA 2FX7H 3RTQD 2GSIB 3VXUE 5FYJD 5FYKU 4GBXB 5TJWK 3HE6A 4YDJA 5CP7A 3UTTE 5D7SL 1H5BA 4AT6B 1KJ2B 2EDRA 1EK3A 1BFVH 2VABA 4QXUH 5D1XA 5E6ZA 5HHME 1KCLA 1B4JL 2VERN 3LKSA 4TQEL 1NC2D 2Q8BL 5BXFA 4IMLA 4LLWA