1QKZL

Fab fragment (mn14c11.6) in complex with a peptide antigen derived from neisseria meningitidis p1.7 serosubtype antigen and domain ii from streptococcal protein g
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
217
structure length
214
Chain Sequence
NIVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHFPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGKERQNGVLNSWTDQDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN G-PRIME
publication title Crystal Structure of an Fab Fragment in Complex with a Meningococcal Serosubtype Antigen and a Protein G Domain
pubmed doi rcsb
source organism Streptococcus sp.
total genus 52
structure length 214
sequence length 217
ec nomenclature
pdb deposition date 1999-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qkzL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qkzL01
4E41D 1HQRA 4KRPB 4AIOA 1I9JL 3I02A 3B6SA 3QRGH 1UCTA 2C4XA 3G08A 1E4KC 2UVEA 3MJ8B 5E4IA 2AEQH 2LQRA 3PQYB 3E6FB 2D0HA 4KXZH 4OM1H 2V9RA 3NPSB 4G5ZH 5BS0D 5IV2A 2ARWA 3MV8D 4QF1A 2NY3C 1DQJB 4RGMB 1OD7A 3UTPD 5IJKC 3QXVA 3IDXH 4MD0A 4CJ1A 3HB3C 5FYJH 4OZGF 1EXUB 1RZFL 1U8PA 4XBGA 5C0NC 2Q20A 3ZMRA 5CILH 2RJMA 5JQ6L 1BFVH 3OKOB 3QQ9D 3VXMA 3LB6C 2VDQH 3IFOB 5I71C 4KGLA 2FJFA 2Q76A 4L4VB 1F00I 4N0UB 3NCBB 1SJEB 4EI6B 1JPSH 5IWLC 5GGSY 2H45A 5H94B 2YMXH 4GRWF 2NXZD 2VZOA 2IC2A 5FYKU 2VO5A 3OGOE 3CFJB 1N7MH 4OCXH 4E9LA 3CVIH 3QI9D 1A1MA 4HKBB 2UWEA 3ROLB 4O2EA 2NX5B 3GBLA 1CF8H 3D18A 3SO3B 2EKSA 5EU7C 4GUPB 3B3IA 1BFOB 2IQAA 4OD1H 4Z76B 1H8OA 1MFDH 3C6LA 5F9JA 1NLDH 1XGPB 1UH4A 4HH8A 2C3VB 15C8H 2FR4A 3TM6A 2VLME 5AG9A 2FJHA 4OLEA 4PREB 4LLYB 3VXTA 3DXAE 4PJ8C 5HYJB 4P5TC 2J5LC 1E0OB 4MQTB 3GB7A 4PGEB 3UYRH 1JZ7A 3CVHA 2A74A 2XZZA 1LP9B 4M7ZB 5CUSL 5C07E 4AG4L 1VKXA 4NM4L 1DFBL 1FYHB 3AB0C 3QDGD 3A6OA 3O3EB 4MXVF 1T20B 1KBGL 4ISVB 5E00A 3T0DA 4DTGL 1N2RB 3BQUB 1KIRA 2QQKL 3QEQB 3A6BL 5HYSA 4YHMH 1QG3A 1MQKH 4QRQA 4QHNB 4APQB 1A7RL 2NQCA 2VXTH 3VG9B 4RAUB 2LTQB 4OZFB 1B0RA 4F58H 1NCUA 2CXGA 4J2XA 3KPOB 5F1OB 4NZTH 3HAEH 3BKCH 4ELKB 5TDOB 2X7LA 3WNLA 1GHFH 5DK0A 1GJIA 3EYOB 2IAND 2UYLB 3BPLC 5FGCE 1IKFH 4MA8H 3CSBA 5E24E 5DJAA 2DICA 4M1DL 5FXCH 1PJ9A 1R5VA 3RY4A 4KQ4L 4IRJC 5IBLC 5TQ2L 4XP6L 1IEBA 1N59A 4XC3H 4JFFA 2AERT 1R3HB 3GBNH 1NANI 1WIPA 4GW5A 3DVIA 2A9NH 4JFED 1LP9F 5T5FH 4HQQH 1CYGA 2V2WB 4LLWB 1I7ZB 5F8RC 4XNMA 2W9EL 1J10A 1A5FH 1P1ZB 1P7QA 2VKWA 2NR6C 4UUJB 1UEMA 3MXWH 1MCBA 3L3HA 2QSCL 5CJOL 2F53A 4OCWH 1IFHL 3B9KC 5F96H 1ADQL 3G5XB 2VB5A 5CEYA 1I8IA 1KB5B 3IU3B 3M8OL 4MMZC 3VD4A 1K8IA 4XXDB 5SV3A 4MD4B 1HH6A 3VWKD 4RDQG 4JFDE 6FABH 3W0WA 4LLDA 4P46B 2E7LA 1D6EA 4NRYB 1ZWIB 2R0LL 1EVTC 4JG0L 4YFDB 1ZA3B 4M9PA 2A83B 4X9FA 3V52L 4XNYH 1XGUA 3WFEH 4PJ7E 1W0WB 4AL8H 1H5BC 3LEVH 3WS6C 4KZEH 4O2CA 1KUMA 3PGCA 4R0LA 3RDTA 5D1ZA 2BVPA 3CLEL 5ERWB 4UI2A 1SEBA 3NH7L 1KF9B 3IJHA 1S5IH 4QCIA 3RVWC 4P2RB 4FQXA 1IKNA 3L3JB 3D3VD 1O7VA 5E0QA 2APVA 3RWGB 4NQXA 2LU7A 1MRFH 2X4OB 1S7UA 5DJYB 3F65A 3VDCA 5CJ5A 3LQZB 4EZMA 1V05A 1MVUA 4HX1A 2HJFB 5LGKA 1HN1A 1MNUH 2XFXA 3Q0HA 2PR4L 5BJTA 3QUYC 5K9OB 4G9FD 4TUOA 4CRPA 5TQ0H 4FQIL 5E6ZA 1M05B 4YHNA 4F80A 1P7KA 4IRSA 4MX7B 1XF5A 5T3XE 3WUWA 3CZJA 2OZ4A 1Q9WA 1HI6B 1VDGA 3PV6B 5C0RH 4QNPF 2HJKB 4QHKJ 4LHJB 5CGYD 1VEOA 3HNVL 4YO0B 4U1HB 1W72H 2VXSL 1T7ZA 2W07A 2X2YA 4TVSa 4YC2C 1J0KA 1RPQA 1WFTA 3QULA 5JDJA 4AK1A 2X89D 3IFLL 4XRCB 3ILQC 5D2NA 1ZGLA 5I75B 1PD6A 2X42A 1WZ1H 1D5MA 4FA8A 3W11C 4GMSL 1FHGA 3SDDC 4J8RA 3GUTB 2ZJSH 4OIIH 1WSST 4XGZA 1K6QL 1U9KA 4OZHB 3OKLA 3WLBA 1U92A 4DN4H 5KSAD 3QCTL 5DGRA 5J3HC 5C0CB 4OCYH 1GGCL 4PRHE 1QKZL 5E6YA 3VXNA 1F5WA 2JCCF 4JZNB 3QIBD 4Y5XA 3EOYG 4U7KA 3UJIL 3QDJB 4X6EB 4UQ2A 1U8HB 4OZGA 5GGUB 1ZT7B 3DI3B 2OQJB 2R4SH 3PL6B 1RZ7L 2AV1A 4FQPA 1JFQH 1N64H 4UINL 5DQ9A 4PV9B 4OLZH 5KOVC 4F7CA 4JY6B 3P0YL 4RAHA 4RGNE 4F7TA 4JN2B 4PY7A 2ESVB 4NQDA 5DRWA 1R5IA 5H8DA 3EYQC 2CIIB 1ZT4A 3TT3H 5GS1A 4YEEA 5HPMB 1ZV5A 5HDBF 2ARJA 3T1FA 2FYYA 1HZHH 1Y18B 3QFJE 4R4BB 3JTSB 3DUUA 3G6AB 3VRLE 2IGFH 3MJ8A 4L3EE 1IGIH 5FGCB 4OZHF 3PQYA 3E6FA 3BESR 4F7EB 4E41B 5HXMA 1SBSH 3FO0H 3S35L 4G7VH 3R0NA 1X6LA 4U3CA 5TDNB 5JLZB 4F2MA 1ZHKB 2C7UB 1F3DJ 2JB6B 3TIDB 3NVQA 3U30C 4ZTOL 1CL7H 4IDJL 1EXUA 4NSKB 4NQTA 4S11A 5BS0B 4K94L 2BXYA 3E1F1 5C09D 1J0HA 1JTTA 1MCEA 3U46A 4G6MH 3MV8B 5KJRH 3IFOA 3WYRA 4N0UA 4L4VA 4YDLC 3LEYH 3VFUB 1SJEA 5CEZH 4EI6A 2A6JB 3GRWA 1BZ7B 1I8LC 5H94A 3FFCD 1I9IL 4M48H 5HPOA 4RMSA 5I1JL 4WFED 4PJHB 3CFJA 2PW2B 3NABH 4LU5H 4ODWB 5J11C 2VDOL 3MOAH 4HKBA 3ROLA 2NX5A 4QYOB 1I1AB 2XY1A 4I3RL 4D3CL 2NXZB 1PYWA 4GUPA 1KXQE 1BFOA 4Z76A 4M1GH 5EU5B 3W2DH 1LO0H 3CGTA 1S3KL 1EGJL 2PXYD 3V6OA 1XGPA 1MWAB 3QI9B 1DQLL 4KMTH 2APXA 2WM0A 3LZFH 3HFML 2C3VA 2CQVA 2GJ6E 1RZJC 2OSLB 4PREA 4LLYA 1Q1JH 4FNLL 2K7QA 5HYJA 4LSRH 4WW2C 1NGPL 2KQMA 2G60L 1FIEA 1KN4L 3LKOA 4IDLA 3JUYA 4OCSH 4JFZH 4PGEA 4S10A 4D9LH 3V0VB 1LP9A 4EXPX 4NZRH 2IALB 1DQML 1RVFH 1DUYB 4N1EA 3S3SA 4FQ1H 2DQDH 4JQIL 3O3EA 5KVEL 3P30H 3AREC 4ZXBD 1T20A 4ISVA 4ZO6A 4PJHF 1N2RA 3BQUA 4OCNC 3O0RL 3QEQA 3A67L 1CD0A 2EYSB 4KKBC 4BZ1H 3F7YB 4APQA 4QHNA 5MP6L 2Z8WC 5DVMA 3VA2C 2R0KL 4RAUA 4ZO7A 5IEHA 4OZFA 1S78D 3E3QC 3GSQB 1VERA 5T5NF 3ZYZA 5IFAH 2F58H 3KPOA 1FNAA 5LJYH 4ELKA 5TDOA 2MHAA 3N1FC 4LCWE 5E2JA 3EYOA 1KFAL 4MJID 4GO6B 2UYLA 4DUWA 5LXGH 2WWMD 3ZKMC 2ZUQC 5IHUL 4M5ZH 1HH9B 4Z95L 3KGRA 4JQVC 4ZTPH 1NPUA 4HEPG 3CDGA 3ZYIA 1P69B 2FJGB 1R3HA 2I9TB 2IANB 5F1NB 4DGVL 1G7JB 3MCLH 3MUHL 2CMRL 3QHZH 3U79A 4MXQC 1X5XA 2YUVA 4JO4H 3CU7A 3CFCH 1AR1D 2V2WA 4LLWA 4CN1A 3K4DA 1P1ZA 3G6DH 1MCLA 4UUJA 4XPHH 5I1EL 4Q6IC 3CX5J 3S4SA 1MHCA 3T0EC 5E6IC 3DNKA 5DO2C 2IPTL 5ILTL 2CJUL 3G5XA 2WW8A 5JTWA 1KB5A 3IU3A 4MSWB 4XXDA 1MIEH 2BY2A 3V4UL 4GG8B 4MD4A 2P8LB 3THML 4IRZL 4Z7QF 5HYQA 2JKXA 1NKOA 4NGHL 4NQCE 5E2UH 4P9MH 4P46A 4GAGL 5EFIA 4NRYA 1HINL 1ZA3A 3WFDH 5C0BD 4U33A 2DOCA 3C60C 3VWKB 1W0WA 1J1PH 3TIEB 3QXWA 4KKAD 5TE4L 1NCWL 1S9KC 1E28B 5ERWA 2VLRD 4KV5F 4WUKL 4N0RA 4P2QE 5JW4R 4OLVL 1KCLA 1JCKA 4P2RA 3QJHB 5CCKL 1LDSA 5CSBA 1BGXL 3ARDC 5F6IB 1XMWA 5I9QB 2X4OA 1OAUL 2EDXA 2W0PA 3IKKA 1F8TL 2BVOB 1NL0H 2HH0L 3B5GA 5DJYA 2ICWJ 3FO1B 4GH7B 3LQZA 4YX2L 2HJFA 2H32B 1B3JA 2JCCA 3WNPA 3KYKL 4RMQA 5K9OA 3D3VB 2I24N 4KHTL 1T66C 1S9WB 5B38B 4MX7A 2Y1VA 1HI6A 3PV6A 1QFWM 2HJKA 2P5WD 2VITB 1RJCA 3D69B 2VN4A 4YO0A 4U1HA 1WIUA 1DBBL 4G9FB 4HPYL 1QVOB 2KQNA 5CKGA 3WMSA 2A73B 2MWCA 4QGYA 4YBLB 1XCQB 5ANMB 3QWOA 3BE1L 1OGTB 5DF0A 5FCUL 4XRCA 3WLWC 2AJYL 5MEQB 5HHMD 3NZHH 4OLWL 4FQCH 4Q58C 5CBAB 4W4OA 4UMGA 1JF6A 3SJVD 4HFWB 3GUTA 5TE7L 3P4MB 1DBAL 5A3IC 4Q7DA 4OZHA 3HMWH 4P3DB 3IDUA 4DOHB 5I8OL 1C5CH 5LBSL 5E2WH 5C0CA 1G7HB 4PTUA 4XAKE 5M7QA 5HHNB 1KCUL 1FZJB 2QADD 5GGTA 4G3YH 4GW4B 1W0YT 5JHDE 1SMOA 5AWNH 2UV3A 4JZNA 2BX5A 5DJXB 3PGFH 2F8XC 1M4KA 3MC0A 3QDJA 1U3HD 4X6EA 2WBWB 1U8HA 5KSAB 4L8CB 5GGUA 3MLRL 1I3VA 2AJXH 1ZT7A 4I0PC 3ULVE 1BVKB 2R8SH 3V9FA 2OQJA 2Y72A 3SO5A 1RZJH 3PL6A 1BBDL 4LCUB 1SJHB 4KHXH 3GMQB 2VQUA 4JY6A 2JJUA 3LY6A 2WZPD 2ESVA 3NIDE 1G9NC 5FYLE 2CIIA 5BZDB 4K55A 2YUZA 5HPMA 3S35X 1P5VA 1QYGH 4J3OC 5M95B 1Y18A 4R4BA 3BP6B 1QFWL 5I76A 3TESA 4Z8FH 3VFNB 3WBDA 3TZVD 3G6AA 2ADJB 2W9LA 2E9BA 1IC7H 5J13C 1AJ7H 4RMVA 1YJDL 1X5LA 4S1SL 3UJJL 3QRFM 4NN5C 3MREB 2AJ3B 2NPLX 4MCYB 5HVHC 1OAZH 5EU4B 4F7EA 3O6MH 2XQBL 2YD6A 4E41A 1SM3L 1OWWA 1OSPL 1A3LH 4TOYL 2PO6D 4XNQA 2J6EL 1T1XB 3EFDH 5I1KL 4D9QE 5TDNA 4H88H 3PHOA 1ZHKA 4J3WA 2C7UA 2GEEA 2JB6A 3TIDA 3UPRB 4NSKA 4ZD3H 5BS0A 5HYFA 4U3HA 4AQOA 4X5LA 4J7RA 3MV8A 5FKPB 3ARUA 4KZDH 2R2CA 2R69H 3GDBA 3VFUA 2ED8A 1RUML 1G0DA 4PRNB 1GGUA 2A6JA 3JUZA 4X83A 5A43C 1BZ7A 3KPSE 4FQLH 4CU6A 1NDMB 2E8YA 5C09B 4OCRH 5TGBB 4PJHA 5D7JC 4AY0A 4ODWA 4TQEH 3VWJD 3IRZA 1G1CA 1YDPA 3FFCB 1T3FB 3N85H 1CCZA 1Q0YL 1UM5L 4M6NH 5EU5A 4FQJH 4I4WB 3QI9A 1MWAA 2F8OA 1PAMA 3WIIH 2W9DL 4WHDA 3UAJD 1S7QB 4H20H 4YXLL 3F62A 3O41A 1YEIL 3DX7B 2OSLA 4TRPH 2XY2A 4FQQB 4Q9RH 4OSUH 1WFUA 2V9QA 4JFQB 3LN9A 2UUDH 1OM3L 2YA1A 3RBSA 2PXYB 4M6OL 4WHYG 1U8KB 5D7LE 5CD5C 3ZDXF 3MRLB 1RZ8B 2DQEH 4MNQD 2DQUL 4E42B 1MJ7L 3V0VA 2UUDK 1DUYA 4YH6A 35C8H 3C09C 2DKSA 2FBJL 1G0YR 5DD6A 1PVHA 4PR5B 2VABB 2EYSA 1VSCA 2J88H 5KVFL 1RUPH 3QDGA 2XT1B 3ZYJA 3INUL 4ELME 4ZXBB 1UEYA 1QBBA 3GSQA 2AABL 5J9PB 2DI7A 1OF2B 1ZAGA 4U2ZA 1KELH 2E7BA 2EICA 3SE3A 1AO7E 2AGJL 3ZZ1A 4BQBA 3JV6B 4NKIH 5EZJB 3ZKNC 4LRNH 1AXTL 1HHGB 2FGWL 1JGUL 3MRJB 5GRVK 4WEUD 1HH9A 1BQHG 5SWZE 1YQ2A 3CMGA 5JA9A 3VH8B 3RUGE 2FJGA 1U0QA 1E6OL 5KN5B 2I9TA 2IANA 3ABZA 4RMWA 2VH5L 5DZNA 2YC1B 1M7IB 3MYZA 4WEBH 1S5HB 3SDAD 2VDNH 3C5ZC 4LFHD 3EO9H 4I0CC 2ZOKB 3G5YB 3ARVA 2JJTA 3LRGA 4Q74A 1PLGH 2OR9H 3EHBC 4WHCA 3TWCL 1AD9B 1I85A 5F3HB 3RI5K 4JFEA 4JO1L 4NN7C 1F6AB 3MUZ1 3R0MA 3RAJL 4MSWA 5L88L 4KI5D 5CHNB 5EUOE 4GG8A 2DDQH 1KJMB 2P8LA 2R9HD 3HRPA 2DM7A 4G8FB 4CJ0A 3S5LG 3GMPB 5B4MD 2Q8BH 1R3KB 5J57B 5DJ0B 1YNTB 1S7VA 2KL6A 4HHAB 2YZ1A 4L5FL 3VWKA 2E27H 5FOJA 4MA7H 5I1GH 5J6HB 3TIEA 5JIPA 3W5NA 4AMKH 3PG2A 4KK6D 25C8H 2E6PA 5DEGB 4Z7WE 1E28A 1G9NH 4BQ6A 5DWUH 3N1QC 2EH7L 4Z5RA 1JNLH 3QJHA 2C3XA 3LN5B 3HC0B 4C57C 3CSYB 5I6XC 1GGTA 5TJWK 1F6LL 1GGBH 1BJ8A 2BVOA 4HUXB 5I8EB 2VLRB 5IVZB 3IXAB 4CDHA 4NIKB 2JELL 3BX7C 3FO1A 1MHEA 2MQCA 5JDSB 1D6VH 2H32A 5IFHH 2DS4A 5GZNC 2HT4D 3MR9B 3AS0A 3D3VA 5LCVH 2E9WA 2KUTA 4UDUB 5DLML 1S9WA 1OARH 5B38A 3IYLW 4NUGH 4NNPL 4K9EL 3B9DA 3ORJA 4NZDA 3D69A 4XP1H 2GFBB 4G9FA 4MVBC 1QVOA 1SY6H 3L3GB 4RGOH 1I4FB 2IQ9H 2WUBH 2HA1A 4Y1AE 4XPTH 2A73A 1LVEA 2NY2C 2GY5A 2EEBA 4MAUL 4CADB 5HI4C 5ANMA 1OGTA 4LVNC 2FDBP 4TNVK 4XAWL 3U36B 5MEQA 3RNKB 5HI5C 1K5NA 1T22B 3D9AH 3L3IB 5LKNA 3ES6B 3JSSA 5CBAA 1JWMB 2YHGA 4HFWA 5A2IH 1T1ZB 2DI8A 2APBA 1IBGH 3P4MA 2X89A 4OTXH 5CGMA 3PABB 3TH4T 5D7IF 4P3DA 5HHMB 4BK5A 1YPZB 4C59B 3K4AA 1G7HA 3AU1B 5MEND 1JYNA 4GW4A 1FO0L 1FNSL 3SJVB 2DIAA 4UILH 5DK3A 3GMOB 2C1OB 5DJXA 1RHHB 5TPWH 4H0GA 5HYSG 4NRZB 2E3VA 5L0QB 5KSAA 1AFVH 1IL1B 4TPRH 1Q9KA 3O8XB 3CJJA 4OI9A 1BVKA 1CBVH 1YNLH 2ZG2A 1CLZH 5T3XL 1EPFA 4YHYB 4LCUA 1SJHA 3MXVH 4HIXL 3G6JF 2ZNWA 3H3KA 3MUY1 5CJQL 3GMQA 3OG6B 4WHYH 1U3HB 1O7SA 2VXUL 1X7QA 4U05A 4XPFL 3NOIA 1J18A 4F33B 4GMTL 5CZKA 1C12B 5C9JB 5IQ7L 5BZDA 3MRKB 5GS0C 2Y6SC 1CFVL 4KFZC 4KY1H 3NFSL 5F7EL 4BQ8A 4MQXC 4N5EC 3BP6A 1A7NH 1WWAX 1XFPA 4MGXA 3RIAK 3EOAB 4L4TB 3VFNA 1KEMH 2ADJA 1CT8B 4RFNB 5F7KC 3QBTB 3V5KB 4LSVL 4YZFE 3MREA 1MFBL 2AJ3A 5C2UB 4MCYA 4OM0L 1TETL 1YPZF 5EU4A 5EG6C 3ARFC 4O9HH 1P6AB 4HK0B 3TZVB 3C08H 5HD8C 1FRGL 2WWKT 3IFPB 4HJJH 2FGZA 1YMMD 3H9HA 1T1XA 1F4XH 3HZMA 3CMOH 1G1YA 4DGYL 1K4DB 3JV4B 2CKNA 1K3ZA 3U7AA 5IFJB 3UPRA 4JY5L 2Z8VC 3QDMD 2HJLB 4B41A 1B4RA 1NFDE 3DVNB 2PO6B 4R90L 4O5LL 3D5OF 5FKPA 3CU1A 1ADQA 4NKMB 4AEFA 3ZSTA 4PRNA 4MJ6A 1ORSB 5KSVB 3AM8A 1NDMA 4R0LC 5C09A 1WGOA 3E8UL 5TGBA 1WJ3A 5D1ZC 5CJXC 1T0PB 3GO1L 3LS4H 2I60L 4Y4HD 4W68A 3IFNH 3KNBA 1J0ZA 3CNKA 1QFHA 4G6KH 2OR8A 4ETYA 1K8DB 2Y36L 3FFCA 1TCRB 1L6XA 1L7IH 2DQJH 4N8PA 3V5DA 1QSFD 2IAMB 3U2SB 4OF6A 3AXLB 2VDML 1KC5H 1PY4A 4F7MA 4YHZL 4I4WA 3ALPA 3UJTL 4KKCC 3VWJB 3T3PF 5KSBE 4LSPH 1S7QA 5GJTL 4PJ9D 3PWPD 1CL7I 3DX7A 1WFNA 3NCYS 1GGYA 3LHPH 4FQQA 1UYWL 3PWJB 5E9DD 4M8QB 3VFTB 5MI0C 4JFQA 1WEJL 3GFUA 5DHXB 2D7TL 1V7ML 3WUWG 2PXYA 1U8KA 4LP4A 4YDIH 4R4ND 2I9LB 3MRLA 5I30L 1PSKH 1RZ8A 3ARSA 3V6BR 4POYA 5EH1A 2P47B 4E42A 3DO7A 1UM4L 3HI6L 1YEFL 1EH9A 1UA6H 1I9EA 2XZQH 5ADOL 1SBBA 2FH8A 1UADC 4P2OC 4HXAL 2VISA 1T2QH 3OAZH 1C1EH 4XVSH 4MNQB 5T1LD 5FUCE 2A1WL 4KPHL 4A6YL 2VABA 2MOVA 3M17B 1UCBH 3L1OL 3OAZK 3U0PB 2JB5H 2ZG3A 3QEGL 4ZXBA 1U58B 5I17A 3VXQB 5J9PA 1OF2A 3GIZH 1ZLSL 2FEDD 4ZSOE 1RFDL 1FAIH 3JV6A 1IAIM 1HHKA 4JG1H 1TITA 4OGAC 5EZJA 5F6HJ 3H9ZA 1HHGA 2RBLA 3MRJA 4GS7C 1T80A 1XAUA 2AI0L 2ILLA 1D9KB 3X13B 3DRQB 1FPTH 5DRXB 2FX7H 1E6JH 4K8RD 1DDHB 5FIEA 3VH8A 4MJIA 3BPOB 4F15C 4XCEB 2YC1A 5MERB 1S5HA 4WI3A 5KOMC 4JO3L 4XPGH 1EDQA 4TUJA 3BISA 4RWYL 1T5WB 3SDCD 4H26B 5MHSD 3Q5OA 4HH9B 1WT5A 5D7SL 1T21B 2VLJD 1AD9A 3QG7H 5F21B 5F3HA 5GRWA 4JCMA 2X5PA 1A6UH 3SDAB 3W5MA 1V3KA 3KPLB 1F6AA 4XMKH 1IGCH 1TZGL 5CJ8A 3T0VA 2OI9B 5CHNA 1HHHA 1KJMA 1V7NL 2Y4SA 1JYVA 3OPZH 4Y2DB 1XF4B 3RWCB 1MI5D 2YS4A 4F8QA 4G8FA 5FYJU 2P4AB 1INEH 1F4YH 1CTNA 1JV5B 3VFGH 1XR8B 2DQFB 3GMPA 4QTIH 4RISL 1UWXH 4JB9H 1NCAH 1R3KA 4K3EL 3HB3D 5GRUH 5DJ0A 1YNTA 1SVZA 1FC2D 4LL9A 1G7MB 4PFEA 2H1PL 2I5YH 1MCWM 4HHAA 4FZ8L 3BVNB 3EGSB 1UXWB 5J6HA 4PRHD 3LB6D 4YXHL 1UWXK 1IGML 3RX7A 5DEGA 1LD9B 1A14H 2BVTA 3LMJL 3UROR 3RVXC 5GS0H 4LIQH 1IAIL 2XNAB 1ACYH 2PF6A 1F3RB 2KDGA 1NLBH 1FQ9C 3LN5A 2ADGB 3DO3A 3HC0A 5D7IA 1JNJA 5CBEB 4GRLC 1TVDA 3CSYA 3QH3B 4EI5C 4HUXA 5I8EA 2VLRA 5IVZA 4U1SB 2C3HA 2DLEA 5DJZA 4R7DB 5JDSA 1MJJB 3MFFB 1CFBA 4U0RB 4N8CH 3RIFF 4Y89A 5TE6H 3HHRB 4O58L 4UDUA 1YQVH 3T04D 2GK0B 3SHSA 2OTPA 1MELA 2CUMA 2KKQA 2APTA 5AZEH 4W4NA 2NY1C 2Q7YB 2IFGA 4CKVX 1QPXA 3B8SA 3WIFB 3U9UB 2CLRB 3N06B 2H2PC 3KYMB 2GFBA 3O4LB 2BNUB 3CXHK 2O26U 4HGKC 2BVYA 4PJ8D 1FG2B 3L3GA 1I4FA 4C58B 5IW3A 2D4FA 2YA0A 4KI5F 4OB5H 2B7DT 2VZTA 4CADA 3U36A 3GNML 2P5WA 3RNKA 4LAQL 1T22A 3L3IA 4HCRA 2YK1H 3ES6A 5I73C 2R0ZL 2HT2C 1JPTL 3MFGB 3CK0H 1QLEH 3C9NB 1JWMA 1T1ZA 3NAAL 4XVTL 3U83A 3PABA 3MLZL 1P84J 1YPZA 1FZMB 5JW5B 3QZWB 4MA3B 1RUAL 1I7UA 5T3ZE 3LKSB 1BFTA 1CXEA 3SE8L 2EH8L 3PF2A 3SJVA 2F19L 3TCXA 4PJDB 1LDPL 5DQJB 3GMOA 1LO4H 2C1OA 4BFBD 4ODBD 1RHHA 1INQA 1NCCL 3U4BL 4NRZA 4XHJC 1IL1A 5IM7B 2O93L 3G5ZB 1S7WB 1PZ5A 2OMBA 1UJ3B 3NACL 2QTEA 3O8XA 5MENB 4N9GB 1QR1B 3CUPB 3TYFB 4D0CB 1KIQB 3P4OB 4R2GC 4RNRB 1KCRL 1YN6B 1OY3B 2N1KA 4LGSB 4JREB 4KK9C 1A9EB 1HSBB 1U3HA 4NJAL 1KXVC 1RIUL 3BOVA 2NXYC 3ESVF 4PYHA 1BOYA 4F33A 5C9JA 1C12A 5I0ZA 4IMKA 4LHQB 4CU7A 3S37H 2Q6WB 3RQ3A 4ALAL 3MRNB 1X5KA 4QHMB 3HE7C 1N4XL 4PJGB 1UH2A 5C9KA 1CT8A 4F9PC 3X3FH 1NCBL 2NR6D 4WO4D 3CXDH 3V5KA 3DRTB 4TSBH 2B0SH 1MCSA 5DURD 3B9KD 1Q72H 3OSKA 7FABL 2BDNH 4HK0A 1DN0B 3TZVA 3PE9A 5IQ9B 3IFPA 3QUML 2DWDB 4OFDA 3S4SG 4PJDF 4K7PH 2R2HB 5B8CA 4XC1H 1UWEH 1DQQA 1K4DA 3JV4A 4LQFH 4OBSA 5D6DC 5CGTA 4KDTC 5IFJA 2GYSA 2VZVA 3EDJA 3GSRB 5GGQH 3V5HA 2HJLA 4QLRA 4DKFH 1YMMB 3DVNA 1CDJA 2PO6A 3ULVL 4UB0L 3WIHA 3MLYL 3SQBA 3M45A 4NN6C 4NKMA 2HFGH 5C7XL 1H3TA 4MNGB 3KYOB 3QDMB 1YYML 3PP3K 5ABDE 1ORSA 5KSVA 3RVWD 1E4XL 3IAGC 5FYLL 4F9LC 5DD0L 4C4KO 4NM8H 1DJSA 4AEIL 4OGYH 4OF8A 1LGVA 5ESQB 4M61B 4PJGF 4X8XA 3AMLA 4GRWH 5CP7B 2CKBL 2FD6L 2KPNA 4JZOA 3VD3A 4HC1L 4JRYD 1K8DA 3VFRB 2ADIB 3VFSB 3U2SA 3QUYD 1VHPA 4XNXL 1LEIB 1AC6A 5K93A 1HEZB 1JRHH 1K2DB 1OQXA 3IJYB 1T5XB 4NQVB 1LK3L 4Y4HB 3EYUH 3PDOB 3VWJA 5GSVB 4Y8AA 2YPLE 4QXUH 3GIVB 5SV4A 1CZ8L 4XNUH 4Q9CA 2VDPL 1QSFB 1T83A 3PWJA 4JKPH 4M8QA 3REWB 3UC0H 1BJMA 1YYLL 4M7LL 3KJ4C 4HS3B 1U2HA 3QPQC 5CSGA 3HAEB 2GITA 4LGRB 1UACH 2I9LA 1GAFL 1MJ8H 4PJ9B 3PWPB 3MLUL 3MODL 4N0CC 1MLBB 3OXSB 5E9DB 3ZTJG 3OWEA 2XTJB 4WRLA 5L8KB 4NWTH 2GUOB 3W11D 2EDRA 3SDDD 1DL7L 3HZKB 4JPKH 3LD8B 2VE6B 3HMXA 1MCOL 5FUOH 5KANI 2CRZA 4HT1L 1ZEAL 4MNQA 5A2LH 4HF5H 3MZGB 4NC2B 2AJUL 5I8KH 2BVQB 3M17A 1BM3H 4W4OC 2BVEA 4Y19E 3SBWC 5J3HD 3U0PA 4MAYC 4JFOB 5CLTA 3ZSSA 4P2QD 1U58A 5T1LB 3VXQA 5GISL 1A7QH 3V4PH 5E8OB 5ALCH 1BQLH 2ZKHH 4FQ2L 4CNIB 1L7TH 3O11B 2GW5A 5EU6D 3BMVA 3STBA 4Y5YB 1DQDH 2B4CL 4H5SB 1S7SB 4I9WD 5A2FA 5HHPB 3TPKA 2CDEB 3DRQA 3X13A 4KJQC 1M1SA 4O02L 3EYQD 4XMPH 4CVXB 5C3TA 2XZCH 3OKMB 3MBXL 5C0JB 4XCEA 3K4ZA 3P0VH 5MERA 2ZCLH 3GSNH 5GRYA 1T5WA 4H26A 3MA9L 4WEMB 3MRPB 3PDDA 4HH9A 1T21A 5MEOB 1S9VB 3SDAA 3GMMB 4WIQA 3MOBH 4XP9H 3KPLA 3RZCC 3SDCB 3ZTNL 3MV9D 2GJZB 4KTDL 2PW1B 4FZEH 4OT1L 1SJXA 2DQIH 4M4PA 1INDH 4U1KB 1XF4A 5D8JL 3RWCA 3QEUB 2VLJB 1QRNE 1J8HE 1JV5A 4WTZG 4KDWA 4NC0B 1XR8A 2DQFA 2BRRL 3MLWH 1N8ZB 1G7MA 3W9DB 2YZ8A 3BVNA 3EGSA 3VRIB 3BIAX 1MI5B 1UXWA 3Q48A 4S2SB 2NY3B 2DQHL 2EXWC 2HMIC 1TNMA 1G6RH 2DMKA 1LD9A 1W72B 2AJSL 1DP0A 1CLOH 3KG5A 1J1XL 2XNAA 5CBEA 4JHAL 3RPIB 3VXPB 1MRCL 5I71B 1KXTB 3QH3A 2VXVL 1FL3A 4LMQE 3FB6B 1ZLWH 4GKNA 4U1SA 4JRXE 1FSKC 4R7DA 2VL5B 3T4AB 1MJJA 3MFFA 4AEHL 5IVOA 5KVDL 3K8KA 1NGQL 3P4LA 1ZLWK 4RBPH 4M93C 3VD5A 1NJ9B 2W60B 4FFZH 2GK0A 5I18H 4R8WL 3UTZB 4H0HB 3SKNB 3UZVB 4FP8H 3WFCL 2Q7YA 1TJHL 3LOWA 5T5NG 3L7EA 3WIFA 3U9UA 2CLRA 3AS1A 4Q6YA 4RBPK 3KPRE 3KYMA 4LHUG 2BNUA 5TH2A 1FG2A 1FDLH 5HYIA 4X80L 3MJ9A 1WBZB 3EJZD 2R4RL 5KBNC 2ZPKH 5FM8A 4GBXC 1QSED 3C6SA 5E8PB 1V3JA 4PBWD 4PJ8B 1NSNH 4P5TB 5IMKB 1JBJA 2J5LB 3C9NA 2VXQL 2EC8A 4PUBH 4QRRB 4ZUTB 4X9GA 4YFLI 3ARED 5I66B 1QO3B 1XGYH 1AD0B 3P9LB 2YPLB 4NP4H 5JW5A 1FZMA 3VXUE 5DMYA 4M1CC 1E4WL 1NAKH 4U6YB 2FSEB 2BOCB 3LKSA 1CLYL 2W1NA 3AB0B 2ZUSA 3BKJL 5DMJB 4PJDA 4K3JH 3KPSD 4UT6L 5DQJA 1IMHC 2H8PB 4LCIL 4X9IA 1KTDA 4K3HA 5IM7A 1S7WA 2M8XA 5C2BL 5CKAA 1UJ3A 5MENA 3I6KB 4N9GA 1TJIL 3CUPA 3TYFA 4D0CA 1KIQA 1CE1L 4HJGB 3P4OA 4RNRA 3ZKMD 2C1PB 2Y23A 3UMTA 3WXWH 1P9MA 1YN6A 5EZOH 3ULUE 2ZSVB 1A9EA 2CH8A 4J6RH 4NZJA 1JZ5A 1HSBA 4FTVE 2RB8A 4OZIB 1KLUB 1ORQB 3OXRB 4B53A 1MAJA 2X05A 3BPLB 2D4DA 4HG4K 3IF1B 2W0LA 4MXQD 2Q6WA 3VRLF 1H3GA 3MRNA 2VL4A 4QHMA 2OP4L 1GH7A 4IRJB 4RMUA 4PJGA 1RMFL 5DD1L 4PGCB 3MLVL 1A6TB 3Q6GL 2FBOJ 4ZFOL 4ZNEA 2X1QA 5D7LD 4Y5VC 1YECL 1IC5H 4Q9QL 3T0ED 3H42H 3DRTA 5E6ID 12E8L 1BHGA 1YEEL 4JFHD 5DO2D 3NZ8B 5HTSA 4X6DE 1DN0A 4I18C 3T2NH 4MHHI 3QAZC 2DWDA 2R2HA 3QUXD 4CMHC 4HWUA 4JR9L 3O2DA 1BD2D 3B9KB 5HJ3B 5EIIB 1TJGL 4G9DB 4PYGA 1RZKC 3TT1L 2FX9L 3C60D 1YMMA 2OL3H 4W70A 5JA8B 1KCSH 2DQGH 4R4FH 5E70A 4WHTB 1OB1B 5EBWA 5F9OH 1IEHA 3TEUA 1MJUL 4BZ2L 4OZIF 1IGYB 1QFUL 3KYOA 3QDMA 3B4NA 2B20A 4DQOH 1A0QH 1KYOJ 3N1MC 4O00A 1Z6JT 5C08D 4XXCA 3E6HB 1H5BB 4AT6A 3S36L 3NA9H 3ARDD 2X4SB 1QRNB 2EIZB 2HVJB 2VNCA 4RMTA 5ESQA 4M61A 4YAQB 1VPOL 5CP7A 2ARJQ 3VFRA 2ADIA 4LCCC 5D5ME 5F7FA 3VFSA 2WMPA 1BVLB 4ODUA 1WZKA 3CX2A 1LEIA 1LK2A 1K2DA 3IJYA 1T66D 3ESUF 4HIJB 2D7PA 3OMZA 4Y4HA 1A47A 3PDOA 5GSVA 5L6YH 4JRYB 1UM6H 5HHXL 4V2BA 4ONOA 2IWGA 3GIVA 4XTRC 4OZ4B 1OWRM 1NAMH 4RCAA 1QSFA 4OQTH 2EO9A 2HKHH 2O5ZL 3QUYB 1J05B 4K2UH 4S1RH 3REWA 4HS3A 5EOCH 3HC4L 3HAEA 7CGTA 1KCVL 4RDQF 3F6LA 1JUFA 4PJ9A 3PWPA 4JRXB 1CGSL 32C2B 4Z7UE 1MLBA 3OXSA 5F7YC 1PX3A 2NLJA 5E9DA 5KW9L 4NRXA 1BOGB 1QD0A 4PRIE 1MCWW 5FHBL 4YC2B 3HZKA 4KU1A 2MPAL 5SX4H 2Z91B 1HYRC 2GY7B 3DURB 5CGYC 2WIMA 5GGVL 1H15B 5A3ID 2EE9A 2VERN 4PJCB 2NCMA 2BVQA 4EQ2A 4F7PB 1REIA 4LDEB 3SDDB 4TVPE 1PY9A 2BSRB 5T1LA 4PLKD 4JN1L 1L0YA 2O5YL 5E8OA 3I3EA 4CNIA 5LQBH 4JDZB 3O11A 4OJFH 8FABB 4LSQH 1ETZB 4Y5YA 3W39B 1KT2B 3IDJB 1S7SA 4PJAE 1IGJB 2GJJA 3IDIB 5HHPA 4JKKA 2A6DB 2CDEA 5IB5B 2A6IB 5F1IA 4CVXA 1B4JL 3CIQA 3QIBC 1MFNA 4WCYH 3BDBA 2AK1L 3RBGA 1A7PH 4PG2C 3V95A 3O3DB 3QP3A 4ZS6D 3MRPA 1R3JB 1LEGB 1D5BB 3P40A 3MQIA 5IBTL 3V8OA 4ZFFA 4HKZB 5MEOA 1FH5L 1R6VA 4XBPB 3GMMA 1J7VR 1JGVL 3NTCH 1D3CA 3SDCA 4TSCH 5H37G 4BH7B 2MKWA 2GJZA 2X9WA 2PW1A 1C5BH 4PRPE 3NN8B 4G80B 1GGIH 1RUQL 1E4KA 3QEUA 2VLJA 3MRDB 3SOBH 2HFEA 2C5DC 5EA0H 2JIXD 1A6VL 3UTTB 3MRGB 1Z9SA 2XA8H 3TYGH 5HGBB 1DBMH 4QRUB 1A6WL 1EZVX 5KSUB 3HZYB 1N8ZA 3IXTB 3MV9B 4ZUWB 3R8QA 5DZLA 3W9DA 2GKIA 1D7FA 4JZJC 3VRIA 1MI5A 4JKMA 2OJZH 1S7XB 1PEWA 1WBXB 5ALBL 1A2YB 1NCDL 1W72A 3U30B 1GPOL 1N7ML 3UXFA 3AS2A 4KVCL 3OQ3B 4PRHA 1BIIB 3RPIA 3VXPA 4YHOH 3FB6A 4YDLB 4P9HL 5KS9B 5IWLA 2VL5A 3T4AA 2P5ED 2FWOB 1NFIB 2Z4QB 2OTWB 2YEZB 3GSXB 1NJ9A 2W60A 1QBLH 2EDYA 5E94B 2QV2A 4M7LT 5J11B 1WITA 3UTZA 4C56E 3SKNA 4EOWH 1TVHB 3CLFH 2J8UE 3MO1B 5I1IH 1DBJH 5E4EC 4FG6C 1N5YL 4HS6A 4PGBB 3KPMB 1RZKH 2E8ZA 4PGDB 2ENYA 3TA3D 1BF2A 1RV6X 4ONHB 1WBZA 5CD5D 2OTUB 1DTUA 1TQCC 1IQDB 5D5MB 1I9JH 5E8PA 3T77B 3BHBB 4V1DD 1GC1L 4PJ8A 2CGRH 3MV7E 2EKJA 5IMKA 4WW2B 1N26A 1KJ2A 3MRIB 4ZUTA 1QSEB 2V5RA 3G9AB 1NEZB 3RL2B 5I66A 1QO3A 5EBLB 4HMDA 3P9LA 1CD1B 2ZG1A 4X6CE 4CN4A 4NJ9H 1ROWA 4U6YA 4PGZA 1EVUA 2FSEA 5BV7L 2BOCA 3SGKC 2UY7A 5KS9F 4ZUSB 4JY4B 3CFIC 4CVUA 1X44A 3AREB 5DMIL 5SWSD 4DAGL 3ULVF 3MGOB 4XHQA 4IS6B 3SDXB 2H8PA 5E99L 1RZFH 4HFUL 3OR6B 4X8JB 2IH3B 5C0DB 2H32H 5EC2A 4HD9A 3ZKND 3GMRB 2C1PA 5K9KB 1YEDB 4ODHL 5T5FL 4OZIA 1KLUA 1ORQA 3OXRA 5FO7B 3CSGA 1S78C 4NHUB 3CH1B 3BPCB 1BQSA 2E9JA 3IF1A 2ZUQB 2P24B 4I3SL 3MBEC 2HT3C 5DVNA 1EEZB 1PQZB 4PGCA 3ARBD 1A6TA 2QBWA 1OCWL 3EHBD 3VI4E 1MFCL 1VGEH 4GG6B 5KVGL 1F90L 3NZ8A 4J3TA 1WT5C 4PJXB 5IW1B 1V5JA 1KTRL 5T3ZL 5HHOE 2EYTB 4WO4A 4Q6IB 3UP1A 3BGFC 3T0EB 1UKQA 1U8QB 3F7VB 5E6IB 3S36X 3B9KA 5HJ3A 5EIIA 4G9DA 3D48R 3QNYB 3HRZB 4QOKB 3FN0L 5CUSH 4AG4H 4NM4H 1DFBH 3V7MA 1F6FB 2JK5B 1T6VN 2CDFB 2NY7L 4WHTA 1BD2B 1OB1A 3BUYB 2DLIA 4QRTB 1IGYA 1KBGH 5D71L 4PJIE 4DTGH 4NFCA 3C60B 2DLFL 2QQKH 3ALXA 3A6BH 4PRPB 3VU2A 1CN4A 1KACB 3E6HA 4NBYB 1H5BA 4YGAB 3WS6A 2EIZA 2HVJA 4JFXB 4YAQA 3H9SE 1RULL 5AAWA 3IDMB 5I15H 4KI1A 5GZND 1GIGL 3MACL 5C08B 3C8HA 4GG6F 1BVLA 2BNQD 5H37H 4BQCA 3ARDB 3FQXB 4HIJA 4K94C 1GZQA 4M1DH 1P6FA 3WHXB 3VXOB 5JQHC 2F8VA 4JRYA 2NY6C 4DK6A 5TQ2H 2X4UB 3MJ6A 4MWFA 2J4WL 3DETC 5CFHA 5KG9B 4OZ4A 4D2NA 2JJVA 3QUYA 4NCC2 4RRPA 1J05A 4LPYA 4MVBD 5IT2L 3ZE2F 3D1MC 32C2A 5IIEB 4L8SC 2W9EH 3EYFB 2ICEA 5HI5D 2ZJSL 2EDLA 5CJOH 2Z91A 2ZWLT 4HUUB 1IFHH 1NGWB 5I19L 3DURA 5KZCD 3PXJA 2X1PA 1ADQH 1H15A 4JGMA 3M8OH 4OBRA 1FC1A 4O51B 2P8MA 4PJCA 3C5SB 2IBBA 5IMLA 1A7BA 2L0DA 1RK0B 2H9GB 1FFQA 3CC5B 3WJLA 4F7PA 3SDDA 4LSSL 5JW4Q 1HWGB 3T09A 2BSRA 2YD4A 2R4SL 4JG0H 1KJ3L 3V52H 4UOW1 4ZMAT 1OTSC 1JHKL 1MLCA 1IGFL 4OUOA 5T33L 4JDZA 3CFDB 3QSKB 8FABA 1VACB 1KG0B 3T0XA 1YY8A 2XG5A 1ETZA 4P2QA 5BVJB 3CLEH 3DECA 2CO6B 3QO1B 1KT2A 3HNSL 3OHXB 3W39A 3IDJA 2ZSWA 4XBEL 1IGJA 3IDIA 2PYEB 2Y7QB 3NH7H 2A6DA 1I3GL 5IB5A 5DK2B 2G75B 2QADC 5DC4B 1KJVB 1LQSR 2B39A 5EU6A 4I0PB 4EDWL 1FYTD 3T4YB 2Y6SD 4WWID 3RA7L 5E7BA 3FRUA 4MQXD 4N5ED 3O3DA 3DX6B 4LLVA 3O6FC 1OGAB 1R3JA 1RU9H 1LEGA 1D5BA 5GGRB 5GSRB 3D85D 4XB7A 2D9CA 2HLFC 4FQIH 1JTPA 4NHCL 4XBPA 4MS8C 4LLMB 5DUPL 3ARFD 3LKPB 3RI5F 4BH7A 3BAEL 4UNVA 3NN8A 3HNVH 4G80A 4U1JB 3BXNB 2VXSH 3MRDA 3HR5B 4I13B 4KVNH 3ZE0F 2JJWA 3UO1H 4I48B 3MRGA 4NN5B 5HGBA 1RJZB 4B50A 5HVHB 1CIUA 3HZYA 3IXTA 3MV9A 5KSUA 5FO9B 3IFLH 3VXME 1EBAA 3K0WA 3LEYL 5B8CC 1NCTA 1SYVB 1MCKA 2FATL 5L9DH 4CL7A 2JIXB 1WBXA 4GMSH 2VDRL 1A2YA 4J3SA 1T04B 3DROB 4YDKL 1BBJA 1RI8A 3OJDB 1K6QH 2R15A 2VLKD 5AEAA 2HP4A 3QCTH 1BIIA 2UWEE 1MIML 4XP4L 1BX2B 3N0PB 1GGCH 2P44B 3W2DL 1T7VA 1LO0L 1QKZH 5E5MB 5KS9A 3LN4A 2FCBA 3FMGH 5DRZB 2FWOA 1DBKL 3UJIH 1FJ1B 4AZ8A 1NFIA 1F58L 2Z4QA 5D7JB 3OKDB 2OTWA 2YEZA 3VCLB 3GSXA 1RZ7H 5E94A 2C4FU 3BW9B 4YFLF 2AS5M 2FIRT 1CQYA 4KKCD 4UINH 5DSCA 3K2UH 5DUML 2P5EB 3MO1A 3P0YH 1EHNA 2K1MA 4PGBA 3TN0C 4D9LL 4QXGL 4PGDA 3NIGE 4Y7MA 1RVFL 4MB4A 4CMMA 4UV7L 4ONHA 5FECB 1WUNT 2PN5A 2OTUA 5EO0B 1G84A 1IQDA 1QOKA 3VMPA 3P30L 1KIPB 3T77A 3G5VB 4RFEB 2F5BL 3BHBA 4U1GC 2V5MA 1CU4H 2BC4B 4WW2A 3OAUL 5IB4B 4P2OD 2FLBT 3MRIA 1QSEA 5GGVY 1NEZA 4GXUN 5EBLA 3PHQB 3QXTA 3OV6A 1CD1A 1HIML 4FQHB 2BHZA 4V1DB 3G9VA 3C09B 1CTOA 3CFBB 3S35H 1VB9A 1T4KB 4JY4A 5FA3B 3AREA 2V7NA 3FQNB 3MGOA 3SDXA 4IS6A 4ZTOH 1X5IA 2DLHA 4RA3A 3EAKA 3OR6A 4K94H 4X8JA 2IH3A 4OGAD 5C0DA 2N7BA 3SKMA 3GMRA 2CR6A 3Q5YA 5SWSB 4DGIL 1I1YB 4PB0L 4JFFE 5TF0A 2HLAB 1VFOA 1BLNB 2HG5B 2Q7NA 1NC4D 2W38A 4KJPC 3FB8B 5JOPE 2BJML 1I9IH 5FO7A 5I1JH 1GRWA 1MPAL 2MQ3A 4NHUA 3CH1A 3G6DL 3BPCA 4NYLB 2LVEA 3SPVB 4M5YL 4XPHL 3F12B 2VDOH 4TULL 2DKUA 1BQHB 2R1WB 3BIBX 2P24A 4YZFF 4X0KB 3BJ91 1EEZA 3A6CL 3KS0H 2Z93B 4HS8H 4I3RH 2F53E 4BKLB 4D3CH 2R29L 2YOCA 5EORL 1EGJH 4F57L 1OOAA 4GG6A 1G0XA 1DQLH 3C5ZB 2RIKA 1AXSB 4PJXA 3HFMH 1UT9A 4XX1G 4KH2A 3W0WE 1FN4B 2C3GA 2EYTA 4FNLH 4CAGA 5D7LA 4Q6IA 3OR7B 3T0EA 1U8QA 3F7VA 4LFHG 1NGPH 4Y4KC 5E6IA 1OAQL 2G60H 4NN7B 3S3PA 1KN4H 3HZVB 3HRZA 2BFVL 3LH2L 4D0BB 4Q0XL 2GSGB 2Y5TB 2O5XH 3QUXA 3HE6C 2JK5A 2R56L 2CDFA 2EE2A 4ZOCA 3U7YL 3S5LB 1CS6A 1OTUD 1BD2A 2WANA 4JQIH 3BUYA 1S9XB 1YJDC 4QRTA 3ULUL 4JJ5B 2R9HC 5FHAL 5EB9A 4M03A 4P99A 3RVXD 3C60A 1FFNB 3O0RH 3HKFA 3A67H 4NOBA 5L2KD 4GRLD 4JFXA 4XBGB 3SGEH 5SX5H 3H6JA 4EI5D 4G8GD 3IDMA 3EJJX 4MMXC 5HDQH 5BVPH 5KSBF 4Y16C 5C08A 5DJ8B 2OS7A 3ARDA 3FQXA 5I6XB 4HW6A 2V17L 5IHUH 3WHXA 3VXOA 5K59E 3DJ9A 4Z95H 1CWVA 2X4UA 2DIBA 5KG9A 4K7PX 2H2PD 2BNQB 3TJEL 1WVZA 1QR4A 4Z7VB 4X99A 4DGVH 1NQBA 5D2NE 2CMRH 4HSQA 1IQWL 1UZ6E 2HN7B 5IIEA 3EYFA 2DLGA 1NC2D 4X7FC 2EDDA 2HT2D 4TTDC 3ZDZE 1JI2A 1AE6L 4HUUA 2NY2B 1NGWA 3TBTB 2IPTH 2X4RA 5ILTH 4LVNB 1U41A 3LV3A 4O51A 3OKNB 3BD3A 3C5SA 4JDTL 3V4UH 3SKJH 3THMH 5LWYL 1RK0A 3PGFL 3CC5A 2XZAL 4NGHH 4GAGH 3C2AL 2XKUA 5KZCB 2A74B 4OI8A 3BP4B 3FONA 4YBHA 4AJ0A 1HINH 4OZGE 1A22B 4XHJD 3VD9A 2A9ML 3CFDA 1VACA 1KG0A 5BW7C 2OX5A 5TE4H 1NCWH 4IHOB 5BVJA 4Y88A 3QO1A 4PJFB 3QQ4A 3OHXA 4NQDE 1WV7T 2PYEA 5J56B 2Y7QA 4IOIB 5D1QC 4KK9D 1QYGL 3GI8L 4Z7VF 2G75A 4OLVH 3GM0A 4HXBH 4KK5C 1KJVA 3S6CA 2NXYD 5CCKH 3FTGB 1BGXH 1IC7L 3T4YA 2DD8L 4QY8B 1R3LB 1OAUH 2HH0H 2X7LB 3DX6A 5CLWA 4JHWL 2FB4L 3HE7D 4YX2H 5GGRA 1OAZL 5GSRA 3O6ML 4OAWB 3KYKH 1B6UA 3PQYE 4JGJA 1FYTB 5F88B 1JZ3A 4KHTH 5IMMB 1A3LL 3FO2B 2R2EB 2Y25A 4LLMA 1W2KT 1IEBB 3BP7B 3LKPA 3OKEB 4OFIA 4H88L 1IM9D 4MLSA 4U1JA 4UNTA 3BXNA 4PS4L 1DBBH 3HR5A 4TVPL 4I48A 4ZPTA 4YBQC 2VN7A 3STZB 2R2BB 1FBIL 2RCSL 3ARFB 4YDVB 3BE1H 5FO9A 3VXUD 3WD5L 1N5AB 3OF6D 5FCUH 1FGNH 1P7QB 1QSZA 2XN9D 1SYVA 3L3HB 5J7CC 4N0UE 4L4VE 4OLWH 4LVEA 4PJFF 1TENA 2JF1A 2ORBL 5IHZB 2JIXA 4IIQC 3T0WA 4B0MM 2GT9B 3MNWA 3S97C 1FLRL 4MXVE 1N6QL 1T04A 2VJXA 2DBLL 3DROA 1SY6A 2W92A 1DBAH 3L3KB 3OJDA 5IJVB 1YA5A 5I8OH 3TNNB 5LBSH 3RY5A 2NY5L 4JQXA 1BX2A 4RWHA 4NZUH 1KCUH 5I0DA 2NX5E 3DOSA 4DKEL 3ULUD 5E5MA 5E95B 3I50L 4G6AC 2ZCKL 3GK8L 2VLKB 1J12A 1FJ1A 3V6OE 1QFPA 1LEKB 2BXZA 5DQDL 5D1ZB 3MLRH 1P7HL 4AIXA 1PG7L 3VCLA 2MCG1 1BBDH 4CW1B 3BW9A 4P4KD 3IJHB 1DSFL 5HGHB 4QCIB 3DHJA 3DX9A 1UH3A 4G43B 4OV6F 1MCDA 4M62L 2P5EA 5HYJE 4M7KL 4M4RA 4UTBL 4X7DC 3QPQD 4WFHE 5FECA 2FEEL 1IT9L 5HVWA 4RSVA 1LP9E 1BZQK 3KPTA 3MV11 5C1MB 4M43L 4N0CD 2O61A 3G5VA 4RFEA 5MI0B 1H9VA 2XXMB 1YJDH 4S1SH 3UJJH 3WUWB 1JL8A 4UT7H 2BC4A 1MCIA 3QEQE 2XQBH 2CK0L 1SM3H 2CUIA 4V1DA 1OSPH 4LEOB 1AHWC 4UT9L 5C0GB 1NFKA 4TOYH 2J6EH 4K9EC 3QULB 5ACLA 4NKIL 5I1KH 1T4KA 4MAYD 4LPVA 4P2OB 2NTSP 3O9WC 5FA3A 4FHBD 1FZOB 3FQNA 3ZDYF 3BI9X 3FQTB 3U48A 5E1AA 4U2YA 1CI5A 1JNNL 2N56A 4I0KA 4XVJL 3ZYOA 1VESA 4KQ3L 4Q9BA 1PBYA 4G8IB 2I27N 5SWSA 1I1YA 1RUMH 1BLNA 2HG5A 1H3PH 2ZUUA 3FB8A 1MHHA 4KJQD 3TC9A 4A2LA 4HIIB 1NH6A 1JVKA 4NYLA 4YUEL 3SPVA 1PLGL 4G8EB 4PY8I 3F12A 4GS7B 2R1WA 4X0KA 3FAWA 3SY0B 1A7OL 4WU5B 4MJ2A 4BKLA 1Q0YH 1NUGA 3CAFA 4J12A 4NO2B 3BO8B 4F15B 4Z6AT 3C5ZA 2W9DH 2Z8SA 5FYKE 4PBXA 2C26A 2PCPB 4NC1E 4K8RC 3RZCD 5DRWB 1AXSA 3RWHB 4QNPE 5F7HA 4Z7OF 1FN4A 3ARBA 4PRID 2ZCHL 4GRWB 3IB4A 1OM3H 4MQSB 4DN3L 4YPJA 1URLA 4M6OH 5F71A 4P3CH 2WBJC 2YXFA 3HZVA 2DQUH 1MJ7H 3TBWB 3UTSD 3IDGB 4D0BA 1AGBB 1CQKA 2GSGA 2EDTA 2Y5TA 1YC7A 4TVPD 2M26A 1XGRB 2OBGA 4PRAA 3S5LA 2EXWD 2HMID 1XCTB 1S9XA 4OUUB 4P2RE 5F7MC 5HGGS 4JJ5A 4KUZL 4Z18A 1FFNA 3WE6B 1D6VL 4F2MB 4HULB 4FN0A 5GPRA 5LCVL 1MCPH 5A16B 2AABH 3K1DA 1OARL 3U46B 2AGJH 3RGVC 3RRQA 5DJ8A 5L2KB 3S8WA 4GRLB 3AVEA 5CD3B 1AY1L 2FGWH 1V3LA 1AR2A 1JGUH 4EI5B 4IMLB 2MNUA 1FFPB 2CPCA 4G8GB 3FQRB 3FQWB 4YQXL 4KDVA 3RY6C 4LHUD 1A6PA 1TFHA 2BNQA 5ID1B 3VE0A 1E6OH 4L9DA 5D7KE 4Z7VA 4RGNC 1KNOB 2VH5H 4U1IA 3QJFB 3FO9B 5HDBE 4U6TA 2D03L 4S1DC 1AGFA 3O2DH 4GBXD 1PYWB 2NY1B 2HN7A 1FNLA 4G6FD 4RMRA 4BSVB 1T1WB 1ZHLB 2AK4D 3E2HC 3TWCH 3ARXA 3V2AR 4XNZC 5GGSB 3TF7C 4OZHE 4JO1H 3TBTA 2A38A 5EUKB 4WUUD 5JIHA 4YHLH 1ZE3C 5C0CE 2YWZA 2DB8A 3OKNA 1IC4L 5L88H 4UILL 4HGWB 3GSNB 3ILPB 4M1CD 5TPWL 1A8JH 2Q87A 3WHE0 1NC2B 5I73B 5GQBA 2NTFB 3LKOB 2XKNB 4U0QB 3NIFE 3QDJE 3BP4A 2EDKA 4BA8A 2V2TB 3ROOA 4FMFA 4JEGB 4OFYD 1AKJD 3KPPB 5C0AD 1C8PA 3D39D 2EYRB 4NWUL 1VFUA 1KGCE 2VZ1A 4IHOA 4PJFA 2ESVE 3EYSL 4IOIA 4D9RD 4KY1L 2EH7H 4I3GA 1A7NL 1N0XL 5IEHB 1BMGA 1KEML 3FTGA 2FH6A 5D1XD 1EERB 2CD0A 3P9WB 5F9DC 4QY8A 4R2GB 1R3LA 3ZE1F 4EXKA 2MHAB 4DUVA 4FXGA 2JELH 2HTLC 2OCFD 1OTTD 3Q2CA 5FB8B 1G6RB 2XV6B 5DS8B 4OAWA 4I2XB 2NXYB 1MFEH 5CMAB 3C08L 3BWAA 1FYTA 5F88A 1YY9D 5DLMH 2QKIB 4HWEL 3FO2A 4NUJB 5IMMA 4E41E 2R2EA 2UZIH 3H2WA 5EOCJ 3BP7A 3CDGB 4S0TD 3OKEA 1NMAL 3HE7B 4OLXL 3ARTA 1OAYL 5DGQA 3EO1B 3VXRD 3D85A 1ZMYA 3DARA 4QXWA 1MOEA 5F9WB 2G5BB 4GFTB 5BS0E 3STZA 1JN6B 2R2BA 1B2WL 4MAUH 4YDVA 3P0GB 3ARFA 3V4VL 5JR1H 5ISZD 1N5AA 4NO5A 3RVVD 4XAWH 5CEXB 3N9GL 3MV8E 1IM9B 3IDYC 4WO4C 3S4SB 1MHCB 4NQED 1FP5A 3UTPE 4P4RB 5IHZA 2GT9A 2WNGA 2WLZA 2ZUXA 2NY4C 5INDA 3L3KA 3WSQL 4PJHE 5IJVA 3BDYL 4LPWA 5HYQB 2XN9B 2AJVH 3ZHLA 3DLQR 4G6KL 3TNNA 5EFIB 1L7IL 2EECA 3UBXG 4NN6B 1FNFA 1ZLVH 1FO0H 1FNSH 1XF2B 5J89A 5IBUB 3IETB 2EIBA 2VLKA 1ITBB 1M7DB 4LSPL 1LEKA 5EWIL 4XMLL 1ZLVK 5CJXA 4K8RH 4OIBA 4WENB 5T3XH 2AV7A 3T3ME 4CW1A 5IOPA 4HIXH 5HGHA 2DWEB 3EZJB 4G43A 5CJQH 2D3VA 4XTRD 1CDIA 2VXUH 4F8TA 4XPFH 5IQ7H 4GMTH 5JUEL 3MA7B 1CFVH 3TCLB 5F7EH 2JCCB 1HSAB 4RRPG 2KZWA 4XVSL 3KJ4B 1FG9C 4JGUA 4LSVH 1MFBH 2C9AA 3V6FB 1DCLA 2PTVA 4OM0H 1TETH 4FMKA 3MJ7B 4X5XB 3QDGE 1FRGH 1OW0C 4LARL 4LEOA 5C0GA 4Z7QE 2AQ3A 1M7XA 4DGYH 2ERJC 4R7NB 3QWOB 4P2OA 1ITCA 5C6TL 2YRLA 1FZOA 1AP2B 1RUKL 3CDCA 2IPUG 4LNRB 4JY5H 3ARGC 5EBGA 3FQTA 5DMKB 3WJLC 1V3MA 3ULUF 3BPNC 4PLOB 2FX7L 2NY0C 5BRZD 4O5LH 1RJYB 4MAYB 2H6PB 3H9SD 4G8IA 1VFBB 5JZ7C 4HJ0C 4KV5E 1F4AA 4QKXB 2DIJA 1FNGB 2OMNA 2IANE 4PTUB 5C70A 2OXHA 4UIKL 1L9NA 4GQ9L 3VI3F 3E8UH 4HIIA 1CDCA 2QQNL 4P48A 3GO1H 2I60H 4OLUL 4G8EA 1H3XA 3CVHL 3HUJB 3BZEB 3LKNB 3NCYP 2OL3B 1AQKL 4JKWA 2A77L 1NMBL 3SY0A 2Y36H 3S34L 3K3QA 4WU5A 4JFEE 1UFUA 4NO2A 2VDMH 3BO8A 4YHZH 1PKQA 2EDEA 1A6ZB 4WGWB 1KJ2H 3UJTH 5D4QA 2PCPA 2H3NA 1WCBB 4XWGL 5GJTH 3RWHA 3H3BC 3VGBA 5C6PB 2BRQA 5ICYA 1UYWH 5DJCB 1WEJH 1OD9A 2I5YL 4QRPD 2RR3A 5DHVH 3VD7A 2D7TH 1JMZA 1KB9J 5ITBH 5I76B 3RU8L 5I30H 3RZCB 4LPTA 3TBWA 1UM4H 2P49B 3HI6H 2K9UA 3IDGA 1AGBA 1YEFH 5D6CB 5IF0B 4Y2OA 2OK0L 4K23L 4FFYL 1XGRA 5GS0L 2EDQA 3U1SH 1DR9A 1NAMB 3LSOA 1XCTA 3K8MA 1UXSB 4HXAH 5IB1B 4OUUA 2WQ8A 1IZJA 3AY4C 4XNQB 3UTSB 4KPHH 4A6YH 3WE6A 3I9GL 3HUJF 3HI5L 3PHOB 2IH1B 3L1OH 4L4JA 1CR9L 4K7FB 4YLQT 1ZANL 2HKFL 3K8LA 5JORB 1Z9LA 3QEGH 3BFOA 5A16A 1PG7W 3RL1B 3RTQC 1ZLSH 3D3VE 4YHKL 1MVFA 1RFDH 1EEYB 5FGRA 5L2KA 1A3RL 4GRLA 5CD3A 1ZGLM 2Q1EA 1PZUB 4WFGD 4DZ8B 4EI5A 5E2VL 4IMLA 3ULVC 4PD4K 1FSKB 2AI0H 1FFPA 4G8GA 3DYMA 1OVZA 3FQRA 4G9FE 3FQWA 2X9XA 4GW1B 4NCDA 4FG6D 1F2QA 4RX4D 4LLQB 1OT2A 4X6BB 5ID1A 1FLTX 4Z7UF 4M93B 5ANME 1KNOA 5F7LB 4TTGA 3L5XL 3QJFA 3HG1D 2YK1L 3FO9A 1YDPB 4JO3H 4W6WB 3X11B 4RWYH 5K9QI 4I77L 5LVEA 3QXAB 4LHUB 4BSVA 1T1WA 1WIOA 1ZHLA 3H9YA 5D7SH 1FL5B 5GGSA 1CICC 3O41B 1U36A 3VXMD 4GBXB 1AXIB 2WIIB 3SGEI 4DOHE 5EUKA 1TZGH 1AIFB 3MRHB 1LO2L 4G6FB 4HGWA 1Q38A 3GSNA 3ILPA 3H7BB 1V7NH 3D25B 5ADPH 3PJSB 3EJZC 1KENL 1NC2A 2NTFA 4DUXA 1NEZG 2XKNA 5E8DL 2P43B 3WKML 4RISH 3QCUH 2EIEA 4K3EH 4WUUB 5EOQL 4OLYL 2V2TA 2H1PH 1JZ6A 3LPFA 4PJAF 3KPPA 1QQDB 1KEGL 2OZ4L 1QACA 4FZ8H 4YR6B 4ZO8A 3GSWB 2EYRA 5T1DH 4YXHH 5DD6B 1IGMH 3N1PC 2XWJB 1WWCA 1H0DB 3LMJH 3WL9B 4WFFE 1OAKL 1AI1L 5C0AB 3QDGB 5E7FA 2JJSC 2EC9U 5FF6B 3D39B 1KCKA 2V5TA 1TCMA 4AM0B 4M02A 4ORZC 1LILA 1DLFL 4R3SB 3QXDB 2W59A 2DTMH 5EO1B 3RJQB 3MBED 2DN7A 5FB8A 5J1TC 1JYWA 4K3DL 1G6RA 2HT3D 5DS8A 4I2XA 5CMAA 3SEPA 4O58H 2QKIA 3U7WL 4NUJA 1G9ML 2VZ3A 5A2KH 3HE7A 2CDGA 3EO1A 4LDOB 1L9MA 2B4CC 4F9PA 3CX5K 5D70L 4Y5VB 4YDJA 2GAZB 1IE5A 2G5BA 4UBDC 1R0AL 5M94B 2X4PB 5CZVL 5KANG 1JN6A 2IPUK 5CEXA 4I18B 3GNMH 1IM9A 1WFOA 3MRRB 1T89C 3QAZB 4LAQH 3VXRB 4JFEB 4PRBA 4P4RA 5FK9B 1A1OB 2R0ZH 4CMHB 3I6LD 4PJBB 1ZS8B 5D6DA 4NM8L 4KDTA 4EBQL 4HBCL 4C55A 1IM3B 4XVTH 1HKFA 5C09E 1VEMA 3ZKXC 5ISZB 3OF6A 3MYJB 3QUXC 3MLZH 1R5WB 2XN9A 3P3YA 4XCYB 4NQEB 1Y6NR 3BH9B 4E5XB 1RUAH 2R0WL 5CIPH 3IVKB 3SE8H 2EH8H 1S7VB 3FFCE 2F19H 1XF2A 1LDPH 4WFEE 3D0LB 3IETA 1LWRA 1NCCH 3U4BH 4YWGL 4JPVL 1M7DA 1R24B 4F9LA 1BAFL 1U3ZA 4XNUL 2J8UF 5DT1L 1U95B 2ATPB 1KCRH 4Z5RB 2DWEA 1Z0MA 2NY6D 4OCLC 1L0XA 4LCCB 1A9BB 1UACL 3DETD 4NJAH 3VJ6A 1RIUH 3LQAC 2XRAL 3JV0A 2F5AL 3MA7A 3PXHA 3QCVH 1MHEB 4P4KA 3TCLA 2IF7A 2R23A 3TO4C 4ALAH 1D5IL 1C08B 3EFFB 2ICES 3NFPB 1HSAA 4X4MA 3GJFH 4PPTA 1N4XH 5B21A 5JOFA 4PJBF 5AYUL 1NCBH 4IJ3C 2IG2L 3GRWL 1BM3L 1B6DA 3V6FA 3GJFK 7FABH 3MJ7A 4X5XA 3L5JA 2BNRD 3O6KL 3QUMH 1C7SA 3BN3B 4EQ3A 3V4PL 4I5BB 4R7NA 3NCFB 1L7TL 4BK4A 1AP2A 1K5NB 4LNRA 2YD7A 5IESH 5DMKA 3CZFB 1J1OL 3O4OC 3UYPA 3MZTA 3BKMH 1BVZA 1OTSD 3SBWA 3ULVH 4UB0H 2VAJA 1HNFA 3MLYH 5IUSA 1RJYA 4MAYA 5FM4A 2H6PA 1BJ1J 2I07B 1VFBA 1Y0LB 2D0GA 3HTLX 4KRMB 5C7XH 5TDPA 4FFVC 1FNGA 4HUNB 5DVLA 4MJIE 3DBXB 4WY7L 1S7TA 1QFWI 3PDGA 1E4XH 5FYLH 3T08A 4PJ5D 5DD0H 5DZOA 1I9RL 5BRZB 1F42A 5HSFA 3H8NA 4AEIH 4PLKC 1I3UA 3HUJA 3BZEA 5ESVA 3LKNA 2HRPL 2OL3A 4LSUL 2CKBH 2FD6H 2K3TA 4HC1H 1R3IH 3O6FD 3MOBL 1Q9KB 5DEZA 3IU4L 3WN5C 4KWUA 1ZGLP 3QISA 2HLFD 3QIBB 3CDFA 1IAKB 2QR0B 3ETBF 1LK3H 2RHEA 1A6ZA 2LU3A 4MS8D 1NBYB 4W6XB 5DFVC 3VXSD 1X7QB 1MF2H 1WCBA 5DVKA 4RFOL 1SEQL 2YPKB 2ENSA 3V0WL 2RGSA 2VDPH 3MLWL 3O45A 3WDIA 4N90D 1UJTA 5DJCA 1YYLH 3J8F7 4M7LH 2VZSA 5HDLA 4QGTA 4MJ4A 4EUPB 3PIQB 1J0JA 4ZS6C 3VMNA 3LDBC 3RZCA 1GAFH 4PV8B 4D8PB 4X6FB 2NZ9D 3MODH 5I1CL 5D6CA 1IJ9A 5IF0A 3T0AA 3QHFH 2FHFA 4HLJA 1P4LB 4QRPB 4R97C 1IAMA 4L9LC 5L2JB 1OPGL 4WTZA 1MAMH 4N8VB 1DL7H 1NAMA 4TUKH 5DI8B 1UXSA 2YN5A 4OQTA 5IB1A 1MCOH 4HT1H 2QQQA 3H9HB 4ODTL 3UTSA 2DLTA 3HZMB 4X7CC 2AJUH 1EK3A 4JZJB 5FUZH 5BMFL 2VLRE 2IH1A 4K7FA 1F97A 5DD5L 5LG1A 2APFA 5JORA 4PIRF 3RKDC 2YD3A 1T03L 3RL1A 2L7UA 5GISH 1Z2KA 4OKVB 4GAYB 1EEYA 4JQXC 4PLJD 4FQ2H 1DUZB 1KB5L 4MJ6B 4DZ8A 4HEME 3GZKA 4ZS7L 5FYKL 3VDAA 2B4CH 1FDLL 1TQBC 2F54D 3I3DA 5HDOA 4GW1A 4CVZA 4O02H 4P49A 5CS7A 3DYOA 4LLQA 4X6BA 3Q5TA 3TN0D 1MHPL 3KNBB 1Z3GH 3MBXH 4DW2L 3EOBB 5I8CB 3V5DB 3X11A 3MA9H 4ZODA 5E4EB 1ND0B 3QXAA 4LHUA 4F7MB 4QWWD 1OAXL 4MHHG 3RP1A 1O5DT 4NP4L 3MLXL 1FL5A 1NAKL 3HG1B 5C92A 1P53A 5HHME 4GBXA 1YPZE 1HOCB 2WIIA 4MNHB 3ZTNH 1TQCB 3LKRB 2PTUA 4L4VD 1AIFA 3MRHA 4KTDH 3TA3C 3H7BA 3SJVE 3D25A 3PJSA 2AK4A 5D8JH 4L3AA 3TV3L 1V8HA 1JWSB 1J5OL 3HA0A 1J88A 2QHRH 5I1HH 1JWUB 3DO7B 2E7CA 3O6LL 2BRRH 3Q1SL 4WUUA 1TTFA 1BECA 4K71C 3P2TA 3BWUC 5ETUB 3WXWL 1QQDA 4YR6A 3GSWA 2VISB 4TNWK 1H8NA 1CK0L 2DQHH 4UNUA 2XWJA 1U8JA 2X1XR 1H0DA 3LQAH 2AJSH 1P5UA 2DQCL 3WL9A 4KJPD 3AFLA 5JW3L 1J1XH 4OFYA 1AKJA 5EU3B 5C0AA 4M3JA 5FF6A 3D39A 1BQUA 4JHAH 3BT2H 3FZUC 4AM0A 4L4TE 5I17B 1MRCH 3T2PA 2VXVH 2P1YA 4GLRI 4LBEB 1F11B 4R3SA 1CDUA 1UWGL 3QXDA 1HHKB 5EO1A 5F7UA 1LE9B 4AEHH 5KVDH 4N1CA 1NGQH 4OD3L 4OF3A 5J1SC 3BEWB 3QFDA 3DSFL 1QP1A 3GGWB 4M3KB 5SWQB 4R8WH 1I1FB 1HK6A 3WFCH 1RIHH 1TJHH 3MBEB 3DX8A 5GGTL 3BN9C 4MJIB 1JPGB 4D94A 1FORL 2OLDA 4ERSL 4Y5VA 2W0FB 2GAZA 1KTKE 3FB7B 4TUJB 4Y4KD 4X80H 2IPKA 3K74B 1KCSL 2R4RH 2X4PA 4R4FL 3ARBC 3EYVB 1PFCA 1KPVB 4I18A 3MRRA 3VXRA 5JW4M 2MSPA 3VGEA 5FK9A 3HE6D 1A1OA 1NBZB 3BMWA 3BGFB 4PJBA 1ZS8A 2VXQH 3B5HA 1YNKL 2UWEF 1IM3A 1HHHB 2EDNA 5ISZA 3BRDA 1EFXD 4D0DA 3MYJA 1R5WA 2DM3A 4XCYA 3HLAB 5DC0A 4NQEA 1E4WH 3BH9A 4E5XA 1KPUB 1LO3H 1CLYH 4HZLB 3VA6A 3L3OA 3IVKA 1JMXA 4U6XB 5FFLA 5E8EB 5DTFA 4V2CB 2A2QT 3DV4B 3QIUC 3ARPA 3D0LA 2WUCL 4LCIH 1KLFA 1R24A 3FN3A 3HNTL 3KXFD 4Y16D 5ICZB 1U95A 2ATPA 1TJIH 5E5UB 5GRJL 3DMMD 2HKHL 1VENA 5C0BB 4HKJB 5EOCL 4LCCA 1A9BA 5D7IB 4JO2L 1QTYT 3EO0B 3MUJA 3VGAC 4P5KB 5DJZB 1MRDL 2CIKB 1C08A 3EFFA 3NFPA 2NY6B 2OP4H 2AW2A 1RMFH 5DD1H 3KLHD 1X9QA 3MLVH 2HWZL 3Q6GH 4P9HC 3H0TA 5MEPA 4YXKL 4MNQE 4TTDD 4Q9QH 3MPCA 1YEEH 1O0VA 3G6JB 4YEFA 5FM5M 4L8SB 4PJEB 5IK3B 3MRMB 4AQ1B 4U6VL 3WJJC 4I5BA 4JR9H 2HFFB 4DKAA 1NGYB 5LQBL 2P5WB 1TJGH 4OF5A 4TSAL 4DVRL 3TT1H 1U8LB 1JZ2A 3CZFA 4L1HA 2FX9H 2FL5B 1MWAL 4QHKI 3D6GA 2B2XH 4MA1C 2I07A 1Y0LA 1F4WL 4N0YH 2PTTB 1MJUH 1GC1C 4BZ2H 1FIGH 1QFUH 5D1QD 5HYEA 1FZKB 1I7UB 3DBXA 2YUXA 1A7PL 2P45B 2R39A 4HUKB 4KK5D 2R1XB 3VGHA 4ENEC 5BRZA 4Y4FC 3S36H 3WNOA 4FABL 3H9SA 2LVCA 4LLAA 5F72S 4EN3C 1INQB 1XH3B 4CUCA 2IFFL 5BV7C 1VPOH 4XX1E 3WDHA 3A0OA 1ZA6B 4CDGC 4WTWA 1PZ5B 3NTCL 2EXYD 3S88L 3QWRD 1GVIA 2QADB 4PJ5B 4Q2ZA 5IVXB 1II4E 2Y9RT 3F58L 3QIBA 4O4YL 1IAKA 2QR0A 1J0YA 5EN2B 4PJEF 1NBYA 3X3GL 4PG2A 4LK4A 1KTLB 2XQYG 2V2XB 5HHXH 3O6FB 2YPKA 1JIBA 1ZHBB 4JHBA 4OF0A 2O5ZH 3RGHA 2VLMD 3HC4H 2RFXB 4EUPA 3PIQA 4FFWC 4KI5E 1TMCB 2OJZL 1KCVH 3I85A 4YBQD 5LGJB 3DXAD 3SGJC 4PV8A 4D8PA 4X6FA 1CGSH 2XOTA 3O81A 5FDYA 1TTGA 5KW9H 5JIIA 2D31A 1B90A 4X7TB 2NYYC 1P4LA 4QRPA 5L2JA 3BUTA 5FHBH 5C07D 4N8VA 2ATKB 2MPAH 5DI8A 3KAAA 1WAAF 1BFSA 1KULA 4YHOL 2X4TA 4M7JH 5B8CB 2KH2B 1DQQB 4QTHB 4JZJA 4HKXB 3V5HB 1MAKA 1NUDA 5F93C 5F1KC 1M71B 1ZVYA 5EDXA 4JN1H 5IVXF 1QSVA 5T1KD 2FO1A 2O5YH 4G6AD 2D7OA 2XYCA 4OKVA 4GAYA 1VGKB 3RNQB 1YC8A 1DUZA 4NFBA 3FT2B 3O4LE 4Z0XB 4J4PD 1TPXC 3QXUA 1TZHB 1A64A 5ESAB 1EO8L 1B4JH 4JZOB 1T2XA 2AK1H 2CGRL 2F54B 3EOBA 3IDNB 1Q9OB 3JWNC 5I8CA 1OL0A 1MCRA 2VSDA 3ZDZF 1ND0A 4RX4A 3LQMA 3MGTB 5IBTH 1XEDA 3TH3T 2COQA 5HHVL 3TN0B 3IAQA 3IGAA 4LSTL 5CJBA 1FH5H 1TLKA 4NJ9L 3HG1A 2AKRB 2B1AL 1JHLL 3CH8A 1HCFX 1JGVH 1HOCA 4MNHA 2DL9A 1K4CB 3LKRA 3BSZL 3SQOL 1RUQH 2GITB 4PJDE 5FO8A 4U1GB 3EJYD 3U0WH 1MH5B 1A6VH 1WWBX 1JWSA 4U6HB 3O9WD 1JWUA 1I3RB 1A6WH 2V7HB 4JFDD 5ETUA 5MENE 4BQ9A 1HQ4A 1I1AD 1XF3B 4UU9B 3SGKA 5ALBH 2OYPA 1NCDH 3TBYB 1GPOH 5BZWB 3O2WL 5FYJE 3WO4C 3FQUA 5EU3A 3EBAA 3P11L 4KVCH 4ZAKC 2OM5A 3BKYL 1P4IL 5CWSB 2E9IA 3W9EB 4LBEA 4PJGE 4OV5B 5DEFB 5HHQA 4P9HH 1F11A 1VGEL 4ZNEE 5DFTA 3SGDH 2BVUA 2UY6A 3UBXI 1LE9A 4WI4A 4WU7A 3BEWA 4YE4H 3GGWA 1RD6A 5SWQA 1I1FA 1PW3A 3WXVH 4OI7A 2XG4A 1DEEB 4XWOC 3MBEA 3MCKB 4OD2B 1PDKA 5T3XD 1N5YH 3T2QA 2NZIA 4U4BA 1JPGA 5KAQF 3C8DA 4ZFGH 2W0FA 1CFTB 3FB7A 4EVNB 1A4JB 3FRPG 2WBJD 1YMME 3EYVA 4HWZB 5D9SB 1KPVA 1JGLL 5C86A 5ACZB 3MLSL 5D2LB 1IAII 4X98B 3WFHB 1GC1H 1KSRA 3GHEL 3TBVB 1NBZA 4QXTB 1ACZA 3JWDC 4MNGE 1Q0XL 3QDME 2YD9A 4XVUC 4Y4KB 1U6AL 2BP3A 3MRCB 4ODSL 3DTXB 5H2BB 3HLAA 1ZTXH 2DYPD 1EO7A 2UZXB 5BV7H 1UZ8B 3HE6B 5I15L 1KPUA 1CFQA 3QQ3B 1MREL 4QHLB 4HZLA 5IROC 4U6XA 5E8EA 5DMIH 4DAGH 2EEAA 5GZOD 3DV4A 3TJHC 2XTLA 1KN2L 1EFXB 5E99H 2VWEE 4HFUH 4L3CB 3RGVD 1OTUC 5ICZA 1NUFA 5DUBB 3MCG1 1FCGA 5D72L 5B3JE 5C0BA 2Q86B 2LV4A 1T7XA 1UVQB 4OGXL 4UTAL 4HKJA 1QSFE 5DRNB 2FX8L 5J0BA 1MY5A 2LE9A 4MB3A 4XP5H 3SE4C 1EHXA 4ODHH 2XQYK 3KXFB 4JDVB 4Y16B 4Z7NF 3EOTL 1FL3B 1B88A 3EO0A 5DR5L 4GKNB 4X4XA 3GHBL 4P5KA 4RGND 3PWPE 1Z9OA 3DMMB 4M6ML 2CIKA 3SE9L 4S1DD 3VRJB 5E9DE 2XTJE 5D2LF 4I3SH 5K9JL 1T7YA 3QFJD 3AAZB 2X40A 1OCWH 1MFCH 2P8PA 5KVGH 3L7EB 1F90H 3L5WB 3G6JA 4L3ED 3P77B 5TH2B 4L8SA 3L3DB 4PJEA 2ICWI 3KDMB 4MXWL 5IK3A 1YEGL 2PETA 3DUSB 3MRMA 1NBVH 5JHLL 5T3ZH 1GSMA 1BWWA 4NKDB 2HFFA 3C6SB 4XB8A 1NGYA 1LE5B 1P84K 1EGJA 1U8LA 2BNRA 3FN0H 2FL5A 4MDIA 4JLRB 2NY7H 2PTTA 1UQSB 3QO0B 2H2SC 5D71H 1FZKA 4U1MB 3B2UD 2DLFH 1WAAA 4DEPC 5DA0B 2W65B 2R1XA 1Y6MR 3LKQB 4YHIA 1RU9L 5DMGC 2XWBB 5C8JA 1XH3A 1KTDB 4JE4B 3EDEA 1UC6A 1RULH 4URTB 5D1QB 1ZA6A 2HTLD 4PJ5A 1GIGH 3MACH 1AGCB 4ODXB 5IVXA 2XACC 4PP1C 2PUQT 1UB6B 4ONFL 1HXMB 2CRMA 4M6AA 5MHSE 5ELIA 5GS2D 2ADFL 4KVNL 5EN2A 4H1LG 4LKCB 3UO1L 4G6JL 4YGVB 5TF1L 1KTLA 2V2XA 2CLZB 2VLJE 3O6FA 2F15A 2J4WH 4HK3N 4J3UA 1ZHBA 4WWKC 2Y07L 4Y0GA 4CN6A 2GJ6D 3KHQA 2ID5A 3SDCC 3BIKB 2RFXA 5IT2H 5L9DL 1MCFA 9CGTA 3CSPA 5LGJA 3VXSA 1MI5E 4HPOL 3WCYA 5F9WC 3DPBA 1E4XI 4X7TA 2QHLA 5E2TL 4ORGB 5DVOA 5JXAH 2ATKA 4KROC 3T2OA 2NY4D 5I19H 3DXAB 2J7LA 2Z92B 1UB5B 3L9RB 4QTHA 4BUHA 5B39G 3FMGL 4LEXH 4R96B 1L0QA 4IIQB 2YD5A 5C07B 4HKXA 3R1GH 2Z35B 4LSSH 4WFFD 3NGBC 1P2CA 1XT5A 1M71A 2V5YA 1QNZH 3PP3H 4HWBL 3QUKB 1KJ3H 4DZBB 3OGCB 3U9PL 5DYOB 1VGKA 3K2UL 3RNQA 1JHKH 5EBWB 1IGFH 5T33H 5TFSL 3R4DA 4LCWD 1IARB 5IBUG 3PGDB 3FT2A 3HNSH 4XBEH 5EU7E 5E1HB 4Z0XA 4HMCA 5T1KB 5D93C 3N1GC 2IBZX 1I3GH 1I7RB 1U93A 4LASL 3HI1B 3Q3GB 4AT6B 1RHFA 1TZHA 2VDKL 3KVQA 5ESAA 3ULUC 2BZDA 4EDWH 4Z0BL 1EEQA 4X4YB 3STLB 3RA7H 1CU4L 2F54A 3IDNA 1Q9OA 3M07A 3JWDH 3NFNB 5LGHL 1B0GB 3OZ9L 3I6GB 4ODUB 1LK2B 4WI9A 3LRSB 3MGTA 4QRRE 3TN0A 4P4KC 3VG0L 3JV5A 3WFZA 4NHCH 2EDOA 2AKRA 1QEWB 3C8KB 1YMHB 2KBGA 1DQJA 1K4CA 3QHTC 5DUPH 3BAEH 3GMLB 3NIFF 3B2VL 2QQLL 1HKLL 4JPWH 5B22A 3WFBH 2CR3A 2V6HA 1MH5A 1FAKT 1CDGA 1JUFB 4U6HA 3OKOA 1I3RA 2AXGB 2V7HA 2NLJB 4NQCD 3ARGD 4IBLT 4NRXB 3GJEB 4YK4C 1AHWB 3V8CA 1B0WA 1JPFB 1XF3A 1EJ6A 2FATH 4UU9A 2NY0D 2Y06H 5ID0B 2VDRH 4P23C 3O9WB 4MZ2A 1RURL 4GSDL 5JZ7D 1EBPA 4HJ0D 4OZIE 3TBYA 3G04B 4JFDB 4YDKH 5BZWA 5CZXC 4LRIC 1HYSD 1RY7B 2YXMA 4PD4J 4K07A 1MIMH 4QHUB 4XP4H 4HS8L 5CWSA 4PJ7B 2MCPL 1RJLB 3W9EA 2ZUVA 4OV5A 4QEGA 4HCRL 1WBYB 5DEFA 3E0GA 4OKDA 5ENWB 4XPAL 5CEZE 3QA3B 2E7HA 1DBKH 1CFSB 3B5TA 1F58H 5ECJE 2UVFA 3HC3L 3KR3L 4OQ1A 4XI5C 5CSZB 3UCRA 5CINH 1OHQA 5F1IB 1DEEA 3MCKA 4G7YL 5DUMH 4OD2A 1YEHL 1FO0B 1CD8A 3QIWC 4QXGH 1CFTA 4EVNA 1A4JA 4UV7H 4ZUUB 2O5XL 4X7SH 2ITCB 1IAOB 2L4OA 4HWZA 4ZFFB 5D9SA 3PWLB 1A6AB 1WISA 4LVHC 3WNMA 5ACZA 2F5BH 3OL2A 5D2LA 4X98A 4OGZA 3WFHA 3GBML 3CD4A 3DWTA 3TBVA 4KTYA 4QXTA 2DAVA 3OAUH 4Y4KA 3RWJB 1S7RB 2GTWB 2WBJB 3MRCA 1FVCB 4EDXB 1RIVL 3DTXA 3PV7A 1HIMH 5H2BA 2HFEB 4P0DA 3PUCA 4PJ7F 3T0BA 3VW3H 4KKLC 1UZ8A 3HE6A 2AXHA 3QQ3A 2CXKA 5HDQL 5BVPL 4JANB 4QHLA 3K2MC 3O3AB 4TYUA