2I85A

Nmr solution structure of human ephrinb2 ectodomain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
142
structure length
142
Chain Sequence
SKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ephrin-B2
publication title NMR solution structure of Human ephrinB2 ectodomain
rcsb
source organism Homo sapiens
total genus 17
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2006-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2i85A00
1OCOB 2XUWA 4G70B 2R7EA 3EH4B 3X1NA 1AACA 4E9TA 3WKQA 1WAEA 2GC7C 1SJMA 3NT0A 2IDTA 3FYIB 2PPDA 2FT8A 1NDTA 2CCWA 1NIAA 2CAKA 2CUAA 3S3DB 2IDFA 4Q89A 3T6ZA 3UABA 1W8EA 1AG6A 2IDSA 3S3CB 5I26A 4K9JA 1NIDA 5I5JA 1WA2X 4L0PB 1ET5A 4DP8X 1VLXA 4BDVB 5B7MA 4WKXA 2WSDA 4F2EA 1OF0A 5I6LA 1SNRA 1HAUA 2H5UA 1V10A 1FFTB 3V9EA 3QJQB 5I5MA 3KW8A 1SDDB 3NJMA 3T6VA 4BXSV 3EHBB 4BXVA 1OCRB 1KBWA 1KCBA 2PP8A 2XXFA 5B1BB 3BQVA 3NYKA 1X9RA 1BEXA 1NINA 1BQKA 3FS9A 1XB3A 2XV0A 3ERXA 4YSDA 2YXWA 2RACA 1E67A 2B08A 2JFCA 2TSAA 3AG1B 3SQRA 2QDVA 2VSKB 3NSDA 4JHVA 1BXAA 4NB7A 4DP6X 4DP5X 3FQ1A 4G7SB 4GP4B 4A2HA 5LDUA 3ASNB 1BYOA 1JVLA 1RKRA 4AKOA 3OQRA 4HCFA 3QJSB 3TBCA 1AZCA 2VMJA 3FSAA 1IKOP 2YAMA 4Q8BA 1MZYA 2HX8A 2XV3A 3QJVB 4G7RB 2B3IA 3CVBA 6PAZA 4A2EA 2YAEA 2EIKB 3DIVA 1KYAA 1J9QA 4A68A 1IBYA 3TBBA 4AKQA 3FU8A 4KOCA 2VW4A 1OE3A 4ZK8A 2CJ3A 2QPDB 4DPCX 3PAZA 2BW5A 2YAOA 1E65A 4A66A 1PNDA 1PCSA 2BP8B 1PLAA 5AZUA 4E9SA 1CUOA 2J57A 3SBQA 1GS7A 1MG2C 1JOIA 1JXGA 4E9XA 1OOWA 4UAHA 3NSCA 1MG3C 4FAAB 2VN3A 1AG0A 1AZNA 2QT6A 1A8ZA 4HHGA 1PMYA 3FQYA 3FQ2A 3WG7B 1A4BA 4M3HA 4PCYA 2FJSA 4G72B 1PZCA 4KO9A 3AZUA 2VW6A 4BDVA 2FTAA 1NTDA 1AQ8A 1J9SA 3QQXA 2IDQA 1R1CA 3NSYA 3V9CA 2YXVA 5AFAA 2P80A 4W1TA 3OMAB 1X9UA 2HZHA 3HB3B 4YSRA 1CYXA 2OCCB 1PNCA 3ZX1A 1SDDA 2DWTA 3WNJA 2OJ1A 1NPJA 2Y69B 1M56B 1RZQA 5A7EA 3IEAA 1ZIAA 1FWXA 1JZIA 4P5SA 1PZAA 4PAZA 5TK4A 2ZWNA 1OV8A 1A3ZA 2BHFA 3UADA 3X2QB 2BZCA 1E30A 3T6WA 3X1BA 4UF7C 3S8FB 4GY4A 3T71A 4CSPA 1E5YA 1ZDQA 4A2DA 4GXFA 2VM4A 4P5RA 1SF5A 1ADWA 2XXGA 3GYRA 4F7KA 1UATA 2EINB 2LLNA 4E9YA 2HX9A 4YL4A 1ZV2A 2ZOOA 1PLCA 1JZFA 2YAQA 4A2GA 3QJRB 2OV0A 9PCYA 4KO7A 1V55B 1B3IA 1N68A 1ET7A 2XV2A 1JZJA 3NSFA 2PLTA 1NWPA 4X4KA 2BP8A 1GS6X 1M57B 2EIJB 4KOBA 3X1FA 4QLWA 2JXMA 1L9TA 2BW4A 4DP0X 1J9RA 1WA1X 1L9SA 2VM3A 2YARA 1JVOA 1NPNA 1NIBA 2PPCA 2CBPA 2PPAA 4HCGA 3ASOB 3MBWB 2YAPA 1OCZB 1PY0A 3G5WA 5I6NA 3QJTB 2UXGA 3GDCA 2H47C 1PF3A 4DPAX 1ASPA 3CDZB 3ZIYA 1IBZA 1L9RA 3NP3A 3SBPA 3WIAA 4DPBX 1L9QA 1ILUA 3NJIA 3AY2A 4A67A 2IH8A 4UANA 1EZLA 5B7EA 3X1GA 3EH3B 3PLYA 1WS7A 2BZ7A 4YVUA 1ILSA 4YSEA 4GYBA 3N55A 3IE9A 4DP7X 3EF4A 4M4RB 3FSWA 2FT7A 1ETJA 1PAZA 2QPEB 4KNSA 3WI9A 1J5DA 2YAHA 5B3SB 3C75A 4YSUA 2UX6A 1CYWA 3ABLB 2PPFA 2GSMB 4MFHA 2IWEA 3WNIA 4AI7A 1AS6A 2Q5BA 4YSSA 1GS8A 3NJGA 2HRGA 1ZPUA 2JKWA 3ABMB 4AX3A 1NIFA 3L45A 2Y1AA 3NJLA 2AFNA 2GI0A 1PLBA 1SHXA 3NJHA 1BYPA 3NJKA 5ANHA 4BWUA 2XX1A 3QPKA 1V54B 4G7QB 3AG4B 3QJUB 2ZONA 3H4FA 4TXVB 2FQDA 2YAFA 2HLEB 1AS7A 2I7SA 2DV6A 1NZRA 1BXUA 3ZDWA 1ZDSA 2XWZA 3SBRA 3TASA 1E5ZA 2AZUA 3BVDB 2GIMA 2FWLB 3PAVA 1WA0X 5TK2A 4E9RA 1AAJA 1L9OA 2I85A 3CVCA 5FC9A 1MDAA 3FU7A 3S3BB 1JERA 1CC3A 3FSVA 1TKWA 1N70A 5B1JA 2P80D 1OCCB 3GXUB 3UAAA 1JXDA 3OMNB 3MX0B 2VW7A 4BK5C 2TSBA 2CALA 4HZ1A 1DZ0A 2PCYA 3PAUA 2GB2A 5I28A 3CDZA 2Q9OA 4CSZA 1AZBA 5D4HA 3AG2B 3ABKB 2GHZA 1SFHA 6PCYA 4E9VA 2MRYA 2EIMB 1TEGA 2FQFA 1XMEB 1JZGA 5F7AA 1AZRA 4AZUA 4E9QA 1GYCA 2UXFA 1T5KA 1AIZA 1ASQA 1AOZA 3U25A 3PCYA 5B1JC 1DYZA 1AS8A 3IN2A 3H4HA 7PCYA 4HIPA 1HFUA 2FQGA 5D4JA 2AANA 1OE1A 2DWSA 3FPYA 4RH4A 4E9WA 3WKPA 5B7FA 4KO5A 3OD3A 1F56A 1W6LA 2XU9A 3X1EA 2UXVA 4YSTA 2YQBA 3T6XA 5B1KA 4BWTA 2BP0B 3FT0A 4EF3A 3FPXA 5AKRA 1NICA 2BWDA 5I6KA 2J55A 3NJJA 2I7OA 4DP1X 4YSAA 1ASOA 1GY1A 3IBOA 3DKHA 3ZBMA 4HAKA 1KDJA 3CG8A 1ET8A 2WO2B 4YSCA 3FU7B 1EHKB 3IN0A 1A4AA 2HX7A 2MTAA 1NWOA 4N8UA 1NIEA 4QKTA 3UACA 5B1AB 5F7BA 2EILB 1JZEA 2IH9A 1KV7A 2DYRB 4F2FA 4WTQA 4FA7B 3JT2A 1BQRA 1SHWA 5PCYA 1KCWA 4A2FA 1GR7A 2FNWA 3NJFA 2W88A 4YSOA 3TU6A 1PZBA 3KW7A 3CZUB 1L9PA 1TU2A 1XB6A 4HALA 3D12B 8PAZA 2AZAA 3AG3B 2PP9A 4GP5B 2IDUA 2R7EB 4N4YB 1BXVA 5PAZA 1OE2A 1AZUA 4YVNA 2X88A 1SF3A 1BQ5A 3TA4D 3DTUB 3NJNA 2X87A 1A65A 7PAZA 2J5WA 1TEFA 3FSZA 4BWWA 1KDIA 2XX0A 3RYMA 5I6OA 5I6PA 2ZXWB 4ENZA 2IWKA 1ID2A 4AKPA 1SFDA 2VSMB 1QHQA 2XLLA 2PCFA 3ABGA 4YSQA 3EH5B 2GBAA 1JXFA 3UGEA 2HXAA 3OM3B 4NERA 1KBVA 1RZPA 2QDWA 2UX7A 1HAWA 2PP7A 1A4CA 1GSKA 2BWIA 3FU9A 4NAJA 5I6MA 2XVBA 3T9WA 2XYBA 1BAWA 3PPSA 3NP4A 4JKNA 4DP2X 2A3TA 2BP0A 2NRDA 1WS8A 3N2JA 2DY2A 2W8CA 3AW5A 1XB8A 2J56A 1RCYA 3CVDA 4KNUA 2IWFA 1MZZA 1W6WA 2WO3B 1ZIBA 3UAEA 1CURA 4HHWA 5IY5B 4G71B 2AVFA 2N0MA 1URIA 4DP4X 4KNTA 1M9WA 4KO6A 4JHUA 2IAAC 4HCIA 5I5IA 3FYEB 2BO0A 2GC4C 1I53A 1J5CA 1YLBB 1IC0A 5D4IA 1AR1B 1J9TA 1FA4A 1IUZA 1GW0A 4YSPA 1KGYE 2PPEA 3JTBA 1QLEB 2H3XC 1AANA 2FQEA 4GP8B 1JZHA 3H56A 1GY2A 3S8GB 4W9ZA 4DP9X 3OMIB 3HEIB 2UXTA 5EHFA 2DYSB 2FT6A 3PXLA 2E86A 2HRHA 1QNIA 5E9NA
chains in the Genus database with same CATH superfamily
3UDWA 5I19L 5F1SA 3FSOA 4NYLA 5L88H 1AACA 4KTGA 1T1XA 4HKBA 2D0HA 1TZHA 5MP6H 1GC1C 1MHPH 4PRPB 5BZZA 2D0GA 1RVFH 4CU7A 2QQLH 3HBPA 5JHDA 1JV5B 1CLZH 1UOVA 1PKOA 3VXUE 5C9KA 1F5WA 2FT8A 2GCYA 1KBKA 2ZJSH 3QEGH 4OLVL 5H2BB 5C0AE 3WFCH 4L4TB 3RWGA 5F9DC 4EOWH 4HGKC 3JVGA 3C9NB 1XF2A 1E9PB 3G5XA 3OAYK 4FNLL 4MGXA 2D8KA 2F53D 4MMXA 4TQ8A 1XIWA 3RWJA 3SPCA 2AXGA 5DFWH 3S35L 3QWRD 4MYPA 1F4XL 4OZFA 2NOYA 4FQXB 1UYWH 5C09E 3MKKA 1Q1PA 2CHWA 3C2AL 1XCXA 3HR5B 5DK3A 4HUUA 3BLBA 1FI8C 1TETH 2G4GA 4G8IA 2CLZA 3EOAB 4EI0A 3C5JA 2VDNL 5EA0H 1H3WM 3NJMA 4Y4FD 3LPFA 4JPVL 4NBXB 2OULB 2E74C 3EBAA 1CDIA 5I1GH 1NINA 3QIWC 5IQLA 1VACB 4AYMC 5KS9B 4FHKA 2DMKA 2W65B 4KMTL 5F7FA 1PY4A 4P2RE 1DN0A 5MEOB 1B9ZA 1MI5E 2NLJB 4X5PA 5DMIH 1BXAA 3AQXA 4Q97A 4KXDA 2B4CL 2NTFB 3MXWH 5JIKA 1BF2A 1GJWA 1RIUH 4PRIB 4AKOA 4Z0XB 3DARA 4NO3B 1E28B 3NN8A 4HJIA 3WAJA 1OW0C 4J1UB 1H0DA 1Y1DA 5FGBC 2AJSH 1EJFA 5DS8A 2VLJA 1BD2D 4Z3JA 4PJCB 1HT6A 2X4PB 4XNYH 1GW6A 1IC5H 1HC1A 4A2EA 2EADA 4LPCA 4HIQA 1S5HB 2RJMA 1VB9A 4QY8B 2QSVA 1A0QH 3QRBA 1AQKH 1I1CA 4XXDB 4NN5C 2RR3A 4PRPA 4HHAB 1JV5A 2YQGA 1UCBL 4OM1L 5H2BA 4E9SA 4K3DH 1XL6A 3SDCD 4LVHC 4XN1A 2JXMB 1KXVA 3FFCE 3C9NA 3POCA 5KSBF 1E9PA 4Y9BA 1WSST 1N7MH 1MFBH 3GMRB 5D72L 3QPXL 5AOZA 2FYYA 5L6YL 3QI9C 4RFNC 1HILB 1KOAA 5F7LB 5HYIA 2YOCA 4PGCB 4QTHB 3QAQA 1S7QB 2YA0A 3KJ4B 4PCSA 2IDQA 2LW3A 3BWZA 4MYWB 4S1DD 3ZO0A 1KXQA 5DC9B 3LB6D 4M6OH 1WRFA 3HR5A 4DEWA 3JWNE 4JVWA 2Z7WA 3MRGB 4G1MA 4QF1A 2GK0B 2X2JA 4S1QL 3WOVA 5CEZD 2X9ZA 2BVOB 1UWGH 1KFAL 3GPEA 3INOA 5DJAA 1DJZA 2AGJH 4O00A 2AVGA 3HE7B 4KJPC 4KVNH 4IBYA 3NABH 3GRWL 2GBTA 2W65A 5TK4A 4OGAD 2VZVA 1OV8A 5MEOA 3EHBD 2NLJA 4YHOL 1G7IB 5DD6A 3MRPA 3V0IA 2NTFA 1BVLB 1FQ9C 2CG9X 3X1BA 1GIGL 3T77B 4Z0XA 2EC9T 4NO3A 1E28A 5HGAB 4A38A 4CSPA 3D1MC 4UM9D 4J1UA 4N90D 1SF5A 1ADWA 2EDBA 1M9SA 1XGYL 3L7EB 2XXGA 3SGKC 4F37K 3O81A 4PJCA 4FFTA 4E9YA 2BVQB 3RZWA 3SCMB 4KKCD 2X4PA 4JRFA 4G59C 5I0ZA 4WU7B 2EXYD 1FZJA 3QORB 1A6TB 2ESVE 4OW6A 1S5HA 4QY8A 4LDOB 1F58L 2BSCA 3D52A 5AW1B 4U6VL 5B8CC 1CMOA 4XXDA 2XACC 4YDJA 1JZJA 1N3NB 1BCIA 4HHAA 5HJDA 5GXBB 1KNOB 1IKFH 4ZMQA 5KJ7E 3O41B 4I18B 2BNQE 2WINB 3NCJL 3IETB 3KAAA 5DWUL 2JXMA 1CXFA 1J9RA 1L9SA 3SGJC 3TTYA 3U7WH 5HGGS 3GMRA 4N2BA 2WN3A 3G6JE 1AO7D 1HILA 4I4WB 4PGCA 4QTHA 3KPRD 2AMGA 1ICTA 2XJKA 4PLKD 1BZEA 1RULH 1WDAA 2WXRA 3ZKND 4S2SA 3NP3A 3BJ91 4YXLH 4N28A 5CS7A 1ILUA 2D7MA 3OGOE 4XNUH 4E2OA 2GK0A 3AY2A 2XVLA 3QIUC 4YBQD 5F96H 4FXLA 5SX5H 1PEZA 2BVOA 2I26N 3GKWH 3EO0A 2I5YL 4AH2B 3HE7A 4HGMA 3ZT6A 3K8KA 2I69A 4NI3A 2Q3XA 3IBEA 4AOFA 3V6BR 1G7IA 1SPDA 4HISA 2CBMA 1BVLA 1MQ8A 5CLTA 4WW2C 3PWPD 4LDCA 3T77A 5F8RC 4YDKH 3N1FC 1VFAB 3KL3A 4NM8L 2K45A 4OCRH 2OXHB 5FHBH 4B60A 3QZOA 3L7EA 2CR3A 2IWEA 4HJTA 3WNIA 2C9XA 3EFDH 4LQFL 1UZ6F 3D07A 3HI6H 3ZRSA 2BVQA 1UT2A 4EBQH 3NJGA 2HRGA 2BINA 3QHZH 4WU7A 3QORA 3K8LA 3GSRB 1A6TA 5H94B 1BYPA 5I1EL 5KSBB 2FX7H 4G8AC 3CQFA 5FEBA 4YNYB 1BECA 4KTEH 3ZIMA 1N3NA 2GBUA 1FF5A 3BVTA 1S3KL 4MJ2A 5JIIA 4O5LL 1KNOA 3IMWA 3O41A 3UTTD 3UGXA 2DL2A 5LWYL 4CGUB 4MA7H 4I18A 2BP3A 2WINA 4P9MH 3IETA 3BKYH 3PAVA 1WA0X 3QUXD 3QRGH 4L3EA 3NIFE 1QATA 4U6TA 1WCQA 2F7OA 5H35B 1SDYA 5DU7A 4D0CB 4BCZA 4NHCH 3OL2A 3MRQB 4X7SL 3CFIC 4GRWH 4I4WA 4I2XE 3VI3F 4DQAA 3CFKB 1LD9B 4KKNA 2V5SA 5DJDB 2XG4B 2BZDA 3PAUA 3PJSA 4L23A 5BUPA 1WWBX 1EEZA 4CSZA 1U8CB 1ZLWH 2CMRH 2X0VA 3ZKMD 4W70A 2QKIB 4Z7VF 3LIZL 4AGQA 4H2CA 4XTRD 4E9VA 2PTTB 4NZRL 3EYQC 4AH2A 1T2JA 2WBJC 4JE4B 2MPAL 3UYPA 4YE4H 3GSNL 2DN7A 4WNQB 2W0PA 2FHCA 3QZLA 2X2IA 3NGBC 1LEGA 4K71C 1HFUA 4HCRL 3TFBA 4JR9L 5JZ7D 3C08H 4KUCD 4G6ML 3BMVA 1FGNH 1N10A 3CFCH 1W6LA 3OD3A 1J8HD 4XBPB 4AYDC 4BWTA 1VFAA 2BP0B 1D5ZB 2OXHA 1TYRA 2COQA 2H9GA 2ZUVA 2C8NA 4JRYE 4PRDA 3AWGA 2FCBA 3V0EA 3ZBMA 5IGXH 4R0LB 3BVXA 2R0ZH 4JN1H 5AW5B 3GQFA 3W9EB 3SDDC 3LS5H 3NEEA 1ES0B 1P4IH 5H94A 2UZPA 5KSBA 1RP8A 4YNYA 5F7BA 1Q72L 1VEPA 1UCTA 4RAVA 4TOYL 4M61B 3EOTH 1OTTD 1AD9B 2MCMA 1W16A 4WHYH 4GQ9H 3H42L 1ITBB 3BGAA 1F3JB 1SEQH 2GHWB 4MB1A 3U82B 1IT9H 1OXYA 5K69A 1X5FA 3KW7A 4AJ0A 4QAWA 4AQZA 3BZ5A 5IV2B 3X13B 5H35A 1NH6A 5K9KB 2ZSVA 4MA1C 4CVXB 4D0CA 2G4EA 2OMBA 2WOBA 3ESOA 4E5XG 3MBEB 2IXQB 4JM2D 3D12B 2WB7A 3EUUA 4MQSB 4ODTH 4XZUB 3MTRA 4IBTA 5AZ2H 2GJZB 2WXPA 4N4YB 3RGVB 5BJTB 3CFKA 1LD9A 5EWIL 2YSSB 4RFEB 5DJDA 2XG4A 2R29H 4AE1A 1MHHB 4R90H 1U8CA 2WD0A 2QKIA 1X7SA 2HLFC 1PJ9A 4R6UA 5C08B 3C6LC 5CBAB 2XX0A 3ZLQC 2Y7LA 1MNUH 2ZXWB 4ZG1A 4BRJA 2PTTA 1XSKA 3OQ3B 2R23A 2B7DT 4MZRA 1B90A 1OP4A 3SE9H 4ZXBB 1F42A 2XLLA 5C0CD 3V0DA 4ZUVB 1XAKA 2GJJA 1NGPH 4WNQA 1RUKL 3TO4D 2HN7A 4KKPA 3WUWG 1VCAA 4XNQB 3QR1A 1HAWA 2HTLC 1JPGB 4HWBH 4APQD 3ZYJA 3AAZB 5K9QI 1VFMA 4LL9A 4WRLA 1NSNL 4XBPA 5J1AB 3NP4A 3BSZL 5EG6C 2BP0A 4GAFB 1D5ZA 1CD9B 3W5NA 3CVDA 5I71C 1MZZA 2Z35B 1EGJH 4LSRH 4R0LA 1OM3H 2E6QA 1RZJH 1M1XA 5E6RB 4E0RB 4XO3A 1ES0A 2N0MA 4O2CB 4GI6A 2WVUA 5SWQB 2Z4TA 4X4ZA 3IDUA 2APFA 3MV8E 4QUOA 3C5ZC 4FI8A 2P8LB 3W81A 1Z32X 2CIKB 1JGUH 3FYEB 5KBNC 1MCWM 4JKMA 4M61A 1VF5C 4GAJL 2C1OA 1AD9A 4CVZA 4WI2A 1HYRC 3DJ9A 3KLAB 3QCTL 4H8WC 3DMMA 2FBJH 2MCAA 3D9AH 2DJ4A 1F3JA 2XZCL 3MLRH 3GO1H 4GS7B 1GY2A 1M42A 5IV2A 3KBFA 3X13A 5K9KA 1TIUA 2B39A 3RU8H 4CVXA 2AEQL 4PLOB 2WLJA 5FECB 1YEGL 1AI1L 2IXQA 3MBEA 2HRHA 2YLHA 4XZUA 4F91B 2GJZA 2V2XB 1WZ1H 5IBTL 3UJTH 5BJTA 4OCXL 4LSSL 1M05B 2YSSA 4RFEA 4X50A 3KMDA 1HYSC 5CD3B 1LO2H 1WLHA 2BVPB 2XG5B 1MHHA 5IHZB 3FRPB 1OGAE 3LQMA 5L9DL 3I75B 2E8ZA 4QXGL 4TTGA 5CBAA 4N20A 1UWYA 2B3RA 2E3VA 3S3DB 3RTQB 3IJ9A 4F24A 2Y6SC 1BW8A 4QHNB 2MKLC 3P0VH 4ZXBA 3SKMB 2XPYA 4ZUVA 1OSPL 4CU8A 1KEGH 3KPTA 1WZLA 2PYED 3IFOA 1RJCA 3JXAA 5T3XE 1TYJA 1WWWX 3SPJA 3W82A 5C70A 5HVGB 4XNQA 3CUPB 35C8H 5IHWA 3GJEA 4MQXD 3VYNA 1JPGA 3UMNA 3FQXB 4PJIB 3AAZA 5E2WL 3VXSE 4ELMB 4Z3EA 5J1AA 4CN4A 1SNRA 4HEPG 3DYMA 3RHWK 3TURA 1FFTB 2ATPB 3MV7D 4G6AC 5KVFE 2Z35A 3D39D 4WU5B 1KBWA 3RILA 3BQVA 3L3HB 5IT2H 3NYKA 3GSQB 2F7QA 2M8XA 3HFMH 3L9RB 4C4KT 4E0RA 1B6UA 3KD4A 4HUCA 2AC0A 2DLFH 5SWQA 1E67A 3VXRA 2GSGB 3KEDA 2P5EB 3LN4B 4PJBF 4S1RH 2P8LA 3U0WL 2IQ9L 1R24B 2CIKA 4LKXA 1BIIB 1UOWA 3BVNA 5CR8A 3KYNA 2DPKA 4A2HA 2VAJA 5AB2A 3KLAA 3DC0A 4LCIL 3TBCA 1MFVA 3QUML 1Q9OB 5CP3H 2ADJB 5E6UB 2NY5H 3JYBA 5FECA 3QJVB 2H1LM 2Q3ZA 1JPTL 3CV5A 2VSCA 2OFQA 3DHJA 1T03L 4I5BB 4MAYC 2H4EA 2V2XA 1U8QB 1RSFA 2X44D 1BWWA 1TFPA 3PP3H 5B39G 4BEIA 1M05A 4DVRL 3M46A 3WTXA 4NUJB 2BVPA 2VW4A 2XG5A 2FJGB 1OE3A 1ZTXH 1RPQA 3FRPA 4AWJC 5IHZA 4Y5YB 3CPLB 3I75A 1K6QH 1RJZB 2YFNA 3ORJA 3HPJB 5AZUA 3V0VA 2EJ1A 3RTQA 3UPAA 5FWQA 3RPBA 4Y4KB 3MRKB 2BVTA 4QHNA 5L0QC 5BVJB 4FAAB 3SDAD 2E27L 3SKMA 1FE8L 4M48L 4ZMVA 5EMYA 4HHGA 4J3OD 5JW3H 3VRLE 4PJFF 1UWEL 3O2DL 3MV9D 2I9TB 3CUPA 5EIQA 4K2UL 1X5AA 2DIJA 3FQXA 5ACMA 3QQXA 4PJIA 4ELMA 5IQOA 2Y36L 2VUKA 4R2GC 3NSYA 3V9CA 5JHBA 2VXQA 2X4NB 2C1PB 1NKOA 4ZMYA 1YCSA 3TBVA 4FQHB 3OKDB 3TEUA 3SHSA 4XZ4A 4WU5A 3W3BA 1ADQA 3AITA 1AKPA 1NPJA 4QHKJ 3L3HA 3WFDL 1DBJH 2WVSA 1M56B 3GSQA 3L9RA 3MU3A 3QEQD 3NRPA 3MRRB 1FWXA 3VFVA 1J86A 2WK2A 3H2PA 4RGMC 4MJIE 3B2VH 2BX5A 5TJWK 3HAEH 2GSGA 3LN4A 3QS3A 3H9SE 3JTTA 1PEWA 3MCLL 3RI5K 3UADA 3X2QB 1R24A 1OP9A 4WNSA 4N1HB 1I7RB 1AQDB 2DLHA 4TVPD 4OJFH 4A2DA 1D9KD 2VDPB 4GXFA 4JY5H 4BKLB 2XN9B 1BSIA 1H3XA 1Q9OA 2ADJA 3CIQA 3KVDD 4HFUH 2EXWC 2EINB 5GGVY 2YGPA 3NJVA 1A9EB 2X1XR 2ZOOA 2OR9L 4HJ0C 1S5IH 1P1ZB 3VMNA 5CSGA 3HMXA 4I5BA 5IVNA 2V33A 1U8QA 2HCZX 2IGFH 2IGTA 2QMKA 3CLFL 3KPLA 5IFJA 2GYSA 4PY7A 1GRWA 5BPPA 2FJGA 4GLRH 4IIQC 4HJJH 4Y5YA 3CPLA 2UY6B 2NR6C 1QSFB 2DDQL 2EC8A 1E6OL 1RJZA 2VDKB 3ILQC 4PLJD 1F4AA 1QBLH 4JHWL 2G3MA 4XVUC 4Y4KA 3MRKA 4PWIA 1IBHA 3UTPD 2QSCL 4FS0A 4KTDH 3HJ0A 5I19H 4TQPA 4GEJA 1TKWB 1DQIA 3GRWA 5I15L 3DTDA 1BMZA 2XTJC 1N64L 2I9TA 2JKXA 5A2JH 2J44A 4JO2L 5HI4C 3RNKB 1GJUA 3C5SB 3EOYG 2V17L 1QRNB 4IRZH 4OLVH 1NOAA 2NZ9C 4WI7A 1LJMA 4RQQA 4FTVB 2X4NA 3MRHB 2VERN 2WWOA 4ZOBA 5A16B 2WQSA 4FQHA 1M2VB 2ODHA 4JHBA 5JPMB 4G6FD 4OQ1A 4UANA 5AW8B 3OKDA 3SB3A 2XKSA 5FIEA 3VFTB 4FNLH 1TJMA 2XDHA 2DQUH 2NSXA 3MJGX 3JBG7 4LLMA 3UROR 4Z76A 3MRRA 3OKNB 2IJ0C 4QLRA 3S35H 3CSFA 4RMVA 1F4XH 4DP7X 3DO7B 4P9HC 2HRPL 5F21B 3MHZA 3C2AH 4J4PC 3MNVB 3T0EC 2JJTA 4KNSA 1I7RA 1AQDA 3ATBA 4KUCF 1GJIA 1DJIA 5DMGC 2VDNH 3BIBX 1SRDA 4BKLA 2XN9A 4MFHA 5D1ZC 2GSIB 2ATKB 2LFGA 3W37A 3BIKB 2NY0D 2X2HA 5HSFA 3TZVB 1Y6NR 4JG5A 2YD8A 4KMTH 4WGKA 2VT0A 3DO4A 1YJDL 4MMZC 4JN2B 3E9UA 1Z9OA 1DE4B 3LZLA 3VGFA 2RBLA 3M88A 4ZMPA 5HDWA 3PJNA 3WXVL 2ZONA 3BPLB 2NY6B 5HDQL 1NCBL 5BNXD 3ZDYB 1CYGA 5I1IH 1AS7A 2UY6A 3WFZA 3RB5A 2Z31C 4EO5A 4JFED 2GFBB 1URLA 4WVRA 5ISZD 3U48A 3QDJB 3WNKA 2BPBA 4TSCL 3OV6A 2HYMA 1P7QA 5KBKA 3CVCA 4DUXA 4M1DL 1MDAA 3VWKC 4UINL 3IXAA 3FT1A 1RHHB 4LPTA 3FSVA 1TKWA 4P5MB 2X05A 1P6AB 3E2HC 2FATL 5DC0A 5C0IB 3UAAA 5GS2D 1LXMA 4JM2F 3KLHD 2QVTA 2ISDA 3RNKA 4IKJA 4RRPG 1UCBH 3DETC 1QRNA 2NX5B 2K4WA 3ZZSA 1TTUA 4FTVA 4JY6B 3MRHA 1CO1A 3QH3B 1ZJBA 5HBBA 1WZMA 2YMTA 4L1TA 4LXFA 1M2VA 3DV6B 5JPMA 4GUCA 2BXZA 5LUMA 4J5VA 1KG0A 5D72H 3MLSH 5E2JA 3S6CA 5L6YH 1AIZA 4Y1AD 3T6QC 3T4AB 4FERA 3AQDA 4FYQA 2EQDA 2NCEA 5FYJD 2YK1L 4GRLC 4GQRA 4LSDA 3VXUB 1OP5K 2H32H 5C0AB 3WCYA 3LKOA 4OIIL 3FPYA 3EOBB 4HIHB 1YZZA 4FRWA 2BDNH 2NT1A 2Z91B 1F56A 3MNVA 1P84J 1JWUB 4S1QH 4NUGL 3ZE1F 3FT0A 25C8L 3AACA 5H37A 2ZKXA 2NY3C 2NZIA 2GSIA 1I82A 1KWGA 2EDKA 2XTSA 3BIKA 2QQNL 3KGUA 3TZVA 4AGPA 1KDJA 4DGYL 3UP6A 3LNDA 3LRLA 2D4FA 5C09B 2Q8BH 4JN2A 1PD6A 4MS6A 5BS0E 4YHOH 1MCNA 1IJ9A 4WHDA 4MXQD 4Z7OF 4EN3B 4DH2A 5L8LB 2P47B 2PXYA 1GIGH 5K1JA 4AYFB 5IM7B 1U9KA 1OLZA 2J2ZB 2X70B 5C9JB 4H1LH 5D7JC 3L4XA 4M7JL 4OT1L 3P3TA 4HVBA 1FG9C 1XGYH 3P3YA 3LIZA 3O6FC 4PY8J 2VJ0A 1KCRH 2GFBA 1NPUA 1Q9KA 3TYGL 5LG6A 3QDJA 1NBVL 3P4OB 4JFFE 4ANWA 4UTBA 4P2RB 2X4SB 2R69L 3STZB 1MI5B 1J18A 4P5MA 1MJ7H 1XB6A 5ICYB 1F58H 4U6VH 2NXZB 2BJML 4YH6A 5F9AC 1WT5C 4ZMWA 1FP5A 2WUCH 4F8OA 1DJWA 3TWCL 2AABL 5DURD 3E8UL 2NX5A 5DVPA 4YUEH 3NCJH 3GD1C 4Y2NA 4JY6A 5DWUH 3QH3A 4JRWA 1XEUA 3MLTB 4QCIB 3DV6A 4BRVA 5SV3A 2JLPA 2Z8WC 4XNAA 2H1PL 1E2VA 3LH8A 4L37B 2Y22A 1I1AC 2CDFB 4N1CA 3RY6A 3WXWH 1ZSDB 5LXGL 3CFEB 4Y5XC 1WHPA 3VXUA 3U30C 1IGYA 1BJ1H 6TAAA 4L8SB 1SZNA 1VERA 4HIHA 2VDRB 1RIVH 2Z91A 3FFCB 4ZFZB 3K1DA 6CGTA 3FUKA 5CKAA 1JWUA 3ALPA 4WHCA 1XGPB 1E2ZA 3OAWA 5AL8A 2I5YH 1V3LA 2FIRT 3T8VA 3Q9PA 3UAEA 1OD9A 2V0AA 4QHMB 5C09A 5HYEA 4OCWL 1I3RB 2E7MA 3IS1X 3OZ9L 4IGBB 2EDTA 4NQUA 4EN3A 2HJFB 5KZCB 2J2ZA 1G5AA 2IC2A 2X70A 4NM8H 4KXZH 4KXBA 4KJWD 3LEXB 2DMHA 4IDJH 2Q76B 4MB4A 1KBGL 3ZE0E 1WZKA 1YYLL 1J0ZA 1FYHB 4P04A 3T2LA 1OL0A 2H3XC 3P4OA 1G7QB 1JZHA 2X4SA 3QB7C 4GB9A 4P2RA 1MI5A 4Y8AA 4ZI8A 1LE5B 2G0KA 5ICYA 1BJ1J 1Y1UA 3QULB 1S3KH 4TUUA 4O5LH 4AIZB 1OY3B 5LWYH 1WAEA 2P3YA 2ICEB 4PJ8B 5A6IA 2YN3A 1U92B 3NFNB 2F68X 3FOLA 2WN2A 3U6XS 4QCIA 1SLXA 2D7PA 3RDTA 2JTYA 3A4DA 1NFIA 3VFSB 4Q89A 1CXLA 3CN1A 3ZE1B 3LXCA 4L37A 5KVMC 4YHKL 4X7SH 2CDFA 1OT4A 3V0FA 4K9JA 1ZVSA 3CFEA 4N2EA 1GZPB 1T4KB 1TSHA 4U3SB 1KULA 1CFNB 3BH8B 1WA2X 2BNQB 4Z95L 4BDVB 2L8AA 4L8SA 4BGDA 2J8UF 4POZD 2BNRD 3FFCA 3NIDF 4ZFZA 4TUJB 4J28A 2C4FT 3GSUB 4I87A 1XGPA 4HJEA 4WWKD 2Y9RT 4XPFL 1GYAA 3G6JB 1DSWA 3VUAA 1SQ2N 1M7UA 2MPAH 4K5MA 3GSNH 5E24E 3OC8A 3SEPA 2WYIA 4ZFOL 1JMZA 4PD4J 4B9KC 4IBZA 4J6IA 4XXCC 1FV1B 3U0PB 1GZHA 3FS9A 1ZVYA 3BUQA 4N25A 4HCRH 5JXEC 2IOMA 4JR9H 4KKLC 2OTPA 3AG1B 4IGBA 4KXAA 5JYLA 1QABA 5EU7C 4FFYL 3KLSA 2HJFA 1IM9D 3CD4A 4KH9A 5DLLA 2W5PA 2WUBL 3RUGF 3OR6B 3VDAA 4J6RL 4XB3A 2JH2A 2QGEA 1EUTA 3LEXA 4PG2A 4PJGE 5CU5A 4BV1A 2Q76A 1CL7I 3V0WH 4JY4B 3FSAA 5FW6A 1G7QA 3SDXB 4QRBA 3PHSA 3ULUD 4CVWA 1LE5A 2B3IA 1KFGA 4NP9A 6PAZA 1NCUA 3L3OC 4Q9RL 4JZJC 4J3WA 2F53E 3ZHLA 3VMOA 3CSPA 4NOFA 4M8UA 1MCEA 2VLRD 3QULA 3CX5J 5K5YA 1Q72H 5GGTL 4AIZA 4TOYH 4FXKB 5E5UB 4MXVF 8CGTA 3L48A 2ICEA 4PJ8A 5A2FA 2QPDB 3NFNA 1U92A 2YAOA 2A9NL 3M8OL 5HI5D 5MEQB 1PLAA 1KBBA 3SBQA 3VFSA 4LCUB 3LH2L 1FG2B 3KR3H 5DD3L 5E8EB 1MG3C 1WE5A 1YQ2A 1E7UA 1OAUL 1N5YL 1A8ZA 3GJFH 3Q6FB 5FOJA 4XC3L 2J8OA 1ZXKA 4M3HA 3PS6A 3WTTA 4U3SA 2NXYD 4G72B 5EWIH 5MEND 3BH8A 3KEHA 2Z6FA 2BNQA 5B22A 4BDVA 4RDBA 4R4ND 2F6AA 1NTDA 4M93C 1AQ8A 4TUJA 2D2CC 3NIFB 1IBGL 1THAA 2X4RA 1BIHA 1WEJL 4Z7UE 1WIOA 3WD5L 3Q1EA 1X9UA 2H3NB 3CXFA 1UD5A 4J3BA 5DD0L 3VFGL 1CYXA 4AEFA 4M62L 2EEXA 3HVDA 1D5MB 3BGFB 1BD2E 4HU8A 1ANUA 5EZLA 4MNGB 3VX0A 1RUKH 1T6WA 2ZICA 4QWWD 4NSKB 2CRYA 3MBWA 3U0PA 1FV1A 3FTVA 1FGVL 3ZSSA 3VW3L 2APXA 1F8TL 4GAGL 3FFOA 3L4CA 1UOKA 1J10A 4JJHA 4Q6KA 4RGNC 4ORGB 3H2WA 1NSNH 5B38B 2QQKL 3BSZH 3OR6A 5HVHB 1E30A 4RZCB 2MIZA 2VE6B 3ARDB 5AAMC 1JUFA 5IF0A 1VGEL 1MRDL 2LABA 4HH9B 4JY4A 3QSKB 3VGGA 4LF3B 2F7PA 3SDXA 4C4KO 4ZUTB 4F33B 4NN6B 4UBDC 4NZTL 3A24A 1RUMH 2OJEB 5K9OB 4CA4A 1G7HB 4JE0A 4W9KC 3U7YH 3A6CL 2PR4L 2G60L 2Z8SA 4U1GB 1CFQB 5D93B 1HEHC 2A6DB 4JRYB 4FXKA 4GAJH 4JK0D 1U8PB 4R5TA 3N1QC 2L7EA 3QCTH 2KT6A 5IUCA 2H8PA 3WAKA 2XZCH 4TTDC 4O02L 1MNNA 1YEDB 4MRBA 4NWUL 5MEQA 3IXTA 2CUHA 2D3JA 5CEZE 4MNHA 4LCUA 4QLWA 1FG2A 2AEQH 3A4AA 3O9WD 1BP3B 1AI1H 2AMUA 1H3GA 1NQBA 4PJ5D 5BV7C 3VCLB 2WQAA 4QRPD 5IBTH 3JWNH 4PJBE 3GTTA 4OCXH 2DIBA 2LVCA 3R8BB 1E0OB 3N9GL 3B9KD 5D5ME 1JMXA 1UD2A 2OA9A 1HQ4B 3TEWA 5I6NA 5L9DH 2UXGA 4QXGH 1CE6B 3ARWA 4ZOCA 4DPAX 3EYOB 1IBZA 3WKYA 1EEYB 1GOGA 2H3NA 4QRAA 2DQJL 1ZKAA 3GTNA 3CQPA 5D96B 1IJNA 4R7XA 4N90E 4QTIL 2B14A 4KFZC 1D5MA 2RB8A 3GBLA 3HVNA 2EKSB 1OSPH 4FEMA 4FE9A 4M1GL 4MNGA 3J07A 4NSKA 2WQVA 2JQAA 2BP5M 1I8LA 2Y3NA 4TNWF 4BFFA 1IMHC 2BHZA 2IV9A 5TF0A 2PO6A 4PRBB 2HUHA 5E2WH 5HY9B 3QIBB 1IFRA 5B38A 4M4RB 1N6VA 4N0CC 4XPHL 3PHAA 2VE6A 3ARDA 3QFJD 4FJ6A 2AJUL 3RZCC 5EIIB 5ICXB 1P2CB 4LF3A 4RLDA 1U91A 4YZWA 4PJFE 3DSFL 4ANUA 4F33A 1BXXA 2QVIA 2HKAA 2BCMA 2DTSA 5G55A 3DURB 2SEBB 4DZBB 5K9OA 1G7HA 1S46A 4HLJA 5LGHL 4JPKH 1LQBC 4HS3B 1AO7E 1CFQA 1QW9A 2IQ9H 3U0WH 3Q8AA 2HT4D 5DVKA 1MEXH 4JRYA 4LNVA 2JB6B 3KPRE 3AY4A 1U8PA 2WY3B 3FUNA 2Y7NA 2V5RA 1OD7A 4D9LH 3TA3C 4LCIH 1YEDA 3O2VL 3QUMH 5D1QD 2E6JA 4Q0XL 3Q2LA 1H5BB 5TK2A 3HN3A 1JPTH 3MV8B 3QZPA 1FH5L 5KYYB 1DBML 4FP8L 1T03H 1JERA 2R56L 2R83A 5TE4L 4JEGB 3GXUB 1JZ5A 3IDIB 1KTDB 2X6UA 5F0LB 3ARVA 1YMMB 4PH8A 2PCYA 1CE6A 3SYQA 4JUSA 3EYOA 3PWPE 1AZBA 1EEYA 3FF7A 5GGRB 2WXQA 3AVEA 4XP9L 2WMPA 1JK8B 3RFZB 5JOFB 1JBJA 2E27H 1FE8H 4M48H 4C56E 4PTTB 2EKSA 3NK3A 1TEGA 2CNZA 4V2BA 2PYFB 4Y89A 4K3GA 3O2DH 4UZGA 2PCFB 3M1BB 1WC7B 3K7UA 2YQ2A 4KKQA 3U25A 1OGAB 1UH4A 3GNMH 3SBWC 5FYKU 2ZCKL 4JVUA 5C0GB 5C0RL 2MNWA 4DSYA 4PRBA 5HY9A 2YWZA 5D4JA 1CFSB 3QIBA 4WWNA 2DWSA 4M4RA 1R75A 3HMWL 3QK0A 4U0RC 3UTTE 1ZOXA 5C0BD 1IE5A 3T6XA 2O6EA 3WY4A 4AG4L 5EIIA 5ICXA 1C8PA 4HBCH 1L0PA 1P2CA 3WFDH 4CN1A 4F9LC 4WDIA 2DWDA 3ARFC 3IBOA 3ME0B 2RALA 1EO8L 3DURA 2SEBA 4WW1A 4DZBA 2WXJA 3FU7B 5GZNA 3VXSB 3OB0K 3MCLH 1ETZB 4HS3A 5HXMA 4MDIB 3UDWC 3KXFD 4KY2A 5JHAA 3ZDXE 3QJFA 1SHWA 5LCVA 2CXKA 4JGJA 1JIBA 2EDMA 2VTFA 1SOSA 1H5BA 3P11L 1K72A 3BISA 4BH7B 3ASWA 3MV8A 2DD8L 2OR9H 1PZBA 5KYYA 2KMWA 1OP3H 1BVZA 1SM3L 2X4OB 3JVGC 3ARQA 2JE8A 3CLFH 3Q8FA 4X9IA 3FU3A 3VWJA 3IJYB 5EOTB 3AG3B 4MMXC 1UT9A 3AMLA 4YHML 4X7TB 2GTQA 1KB5L 1JFQL 1XIWC 2X1OA 1WK0A 1VAHA 4XPAL 3VSVA 1YMMA 2X2YA 2DDQH 1UFUA 1E6OH 2E75C 1OB0A 5L8KB 1J8HE 4JHWH 2ORBL 5GGRA 2J5WA 5EN3A 3RFZA 3QI9D 1JSYA 5JOFA 4MS8C 4ZAKB 4PTTA 3SKJL 4PGBB 1UD3A 1QEXA 1X5YA 1GHFL 1QA9B 2PYFA 1R34A 3KDPB 4MD4B 4U3CA 2PCFA 3M1BA 1MH5B 1N64H 1WC7A 3ZTNL 3PGCB 4JO2H 3ATEA 4WFGD 5C0GA 1N5AB 1UZGA 3IU3B 4BK5A 3AJ7A 2J1KA 1CFSA 2V17H 1UA7A 4XX1G 1VZHA 1O9ZA 3VGAB 1J88A 2NY1D 1L7TL 2M2DA 4IW4C 4RSVA 3C60D 2FD6L 1CIDA 3GFUA 2KH2B 4ATTA 4ONFL 2PCPB 4PJHE 5DQDL 2I25N 5JQIB 5GGSB 2EXTA 1HL5A 3FDWA 2KLRA 2R2CA 2P5WD 3ME0A 5A6MA 1BBDL 4YFEA 4H7VA 4S0TD 3E1ZA 4WJKB 3VXSA 2BFGA 4KKAD 1I8MB 4G71B 5GRWA 3S36X 2E7HA 1ETZA 1TG8A 4MDIA 3A23A 2ICWA 2HRPH 1S6NA 2GBVA 5FK9B 4ODXB 5DK0B 1G4MA 4K94H 2XWDA 5E5RB 4W4OA 1DVZA 3FHEA 4ONOA 4GPVA 3WTSA 4DGWC 2CGZA 4AL8C 1U30A 4TLUA 1E4XL 1I8UA 1CL7L 4GBXD 4MJIB 4BH7A 3JTBA 5B3JE 2DH2A 3H9SB 3H56A 2X4OA 5DEFB 5C0CE 1Z1WA 4DGIL 1DEDA 2VXUL 4LCWD 2O5XL 3WLWC 4B9ZA 3IJYA 5DUJA 4LNRB 5EOTA 3ULUF 5GGRY 3WXVH 1MWOA 1NJ9B 5AZEL 4R4FL 2JI3A 2LU7A 4XVJH 5CNHA 1T22B 3IDGA 4FQXC 4HK0B 1T5XB 1DQML 4YXKL 2YA2A 4N2IA 4KZCA 3ULVF 5CILL 5F9OL 3GC3A 4M1DH 2CAKA 2CUAA 3KE0A 4H13C 4UINH 4ZAKA 1LK2B 4DK5A 4PGBA 1QI4A 32C2B 1QA9A 3VDCA 4NLAA 4YR6A 4MD4A 4N86A 4FHJA 1MH5A 1T7YA 4MASA 3PGCA 1FL5A 4Z7OE 2DQEH 1N5AA 2BOLA 3IU3A 4YAQB 5GHWL 5C07E 3U4BL 1NDGB 2OM5A 4PD4K 4TL5A 4IRSD 1I7UB 3LQAL 5AG9A 1NBCA 3HR6A 2RQEA 2NSQA 2C4XA 1WBXB 1OAZL 5C0DB 4WUKL 4FADA 5AW7B 2PCPA 5GGSA 2VR7A 4XNZB 4C83A 5D9SA 2RAMA 2ITEA 3RL1B 2YK1H 3EDKA 1ONQB 2KYIA 1R3LB 2G5RA 4JRXB 5IROD 1YO4A 5E6ZA 1I8MA 1FJ1B 4M43L 4MJJA 1DUZB 4KHTL 4M7KL 4OIIH 2XWXA 5FK9A 5DK0A 3SQRA 3DX6B 5CEZL 5ES4B 4A04A 4XRCB 4NUGH 2YPVL 1U3YA 4N3TA 4R96A 3ASNB 3IDYB 3EG9B 2FSEA 3MGTB 4BQ9A 4OM0L 1C7TA 5DZOA 2QQNH 5SV4A 2GTZB 5DZ9A 2NY2C 3S5LB 3DXAE 4MJIA 4DGYH 1A4JB 3H9SA 3AGVA 4F3FB 1HEJC 1OSZB 5T5FL 5DEFA 1ACCA 3KPQB 3IKCB 3UAJA 3ARUA 1W91A 3CMOL 2NW3B 2PYEE 4LNRA 3SOTA 3UP1A 3L4ZA 2R51A 4IEFB 4LLWB 3WN5B 4PFEA 1W72B 2BSED 3AS1A 1NJ9A 2F2HA 4ZUSB 1T20B 5MHSD 4HQQL 5K59F 4M7JH 4OT1H 4NN7C 4W68A 1DFBL 3CFUA 4X6CE 2DQMA 2DLGA 1T22A 3KJ4C 4HK0A 5AW3B 1T5XA 3TYGH 1CLOL 4IRJB 1NBVH 3TN0A 3L3JB 1WFIA 4DGVL 2J57A 2R69H 3MV7E 3K74B 1YEJL 1LK2A 3ALXA 5SWSB 3APMA 1U8MB 2Q10A 32C2A 3D39E 2ZOUA 4MBRA 4KMQA 1AGCB 4N6RB 3SJVD 4QYAA 1KIPB 4XI5D 3VG0L 2BJMH 4ALAC 3BD3A 3DTXA 1OGSA 3EH1A 4YAQA 3DDGA 5EULV 5KYUB 3KL5A 2AABH 1NDGA 1E8ZA 3E8UH 4DUVA 1WWAX 4Z7IA 1I7UA 5F93C 2WLYA 4TSBL 4X7FC 1CGYA 4Z7WF 1A6WL 4G11A 1ZEAL 1JD7A 1L0QA 1WBXA 3BIAX 3HB3B 5C0DA 1HI6B 5I18L 4PV9B 2H1PH 4JPQA 4UCFA 4MA8L 3ZX1A 4OIBA 3Q5OA 2CKBB 3IGUA 4RX4A 5EBMB 5LXGH 1RY7B 4JRXA 4NQEB 1ONQA 1R3LA 4WJG3 3SCMC 4GFXA 1FJ1A 1DUZA 2P46B 2K6ZA 2ZWNA 3B9AA 3HS9A 4GMTH 5IVOA 2W59A 5HHVL 5EF3A 4YDLB 1IQWL 3GSVB 2CO7A 4XRCA 1BM3L 5FCSH 2ZCZA 2VYRE 3EG9A 2OW6A 3MGTA 5F7KC 6FABL 3S5LA 2GTZA 4I18C 1HCZA 4QR7A 1JNHB 2W07A 1EDYA 1WG3A 3NACH 5E00B 4ZZKA 4Z5RB 4WGVB 1WFOA 4F3FA 1WBYB 1OSZA 4JJOA 1NL0L 4OCWH 4TQIA 3TJHD 5IJBC 3KPQA 3IKCA 1JZFA 4HS6B 1RAMA 2NW3A 4KQ0A 1IBFA 3OZ9H 1OARL 1FUNA 2WXHA 3ZYOA 1KLUB 3WN5A 2VH5L 4LLWA 1X4XA 3MV9E 1W72A 4B6ZA 1KTBA 4ZUSA 3D8MA 1OSEA 1T20A 3JV0A 3PQYD 5FHAL 3WN6A 4HG4K 3H9ZA 1PFOA 1YNTB 4NXSA 5E0FA 5EEVA 1B4TA 1G0XA 3MRDB 5GRZA 1KBGH 1S7UA 1YYLH 4TULL 4IRJA 4WO4B 4U2YA 4FQJL 3L3JA 4DO5A 5DS1A 5EZJB 4KK9D 5BS0B 2XC8A 5SWSA 1U8MA 4J23A 1K3IA 2HT2C 1AGCA 3MUJA 4N6RA 1KIPA 3QEQE 1SMOA 2YWYA 3U36B 5EF1A 1VFBB 2X9WA 5LVEA 1ERNA 2DL9A 1PL3A 3P77B 4WQOA 1OCZB 3D2UB 3TVMC 2VOTA 3G5WA 1YYML 3U2SB 2H41A 3OLIA 1C9SA 4GXUM 3D2TA 5K39B 1ASPA 3FB8B 4A7GA 4KV5F 4OCNC 5DZJA 1AHMA 2HAZA 4RWYL 5FR3A 4TVPE 2WXGA 4PV9A 5AVVB 5KSUB 4QNPE 4J27A 1WIPA 4YHKH 2CKBA 3D4GA 1M71B 3GPSA 4PJ9D 4NQEA 4X6EB 4HWEL 2P43B 3BPNB 4B0MM 4Z95H 4Z18A 2MQGA 2G5UA 4MHHG 3PV7A 1ORQA 4YSEA 1QP1A 1MCPL 3O45A 5DRNB 1H3PL 3GGWB 3ZMEA 5J12C 1E50A 3GSVA 5C0EB 4ABWA 4KKRA 4XPFH 1DO6A 1PAZA 5B3SB 2QMJA 3ZE2E 3C75A 5FGRA 1JNHA 5EORL 1LP9F 4Z5RA 4YLBA 3UTPE 1WBYA 4ZODA 5E08H 3GLDA 3KBHE 3VE0A 3LHAA 2J1ZA 3MBXL 3QYNA 5LNDA 1KLUA 2Y1AA 4FFYH 2ODIA 2WUBH 3FO1B 1JI1A 2D7NA 2Q87A 4UT6L 2A6JB 1YNTA 2F9BT 4J6RH 1NEZG 1G43A 3MRDA 1HCVA 5JO5B 4I0KA 4FFVD 2X89A 1TJHH 4WO4A 3ZDWA 3ARGB 3B5HA 1BZ8A 2QKIC 5HYSB 1RZFH 1VESA 2WXMA 4P0DA 5EZJA 5BS0A 2IFFL 3FN0L 1IVTA 3CZJA 1L9OA 1ID5I 3NVQA 3TC9A 4Q9RH 1FNAA 4NAQA 5AKSA 4JPIB 3VFNB 1A6ZA 2VLKD 2Z0BA 4FMVA 4NO0D 3U36A 5FW8A 1QVOB 5GGTH 2ED7A 2EDQA 3P77A 1RH8A 4EI6B 3D2UA 2VW7A 4PJAE 3K2UL 1X5IA 3U2SA 4AYEC 5TDOB 2ICWI 5MI0C 3M8OH 1U8KB 3FN3A 5K39A 2F0CA 4O58L 3FB8A 2KS0A 4OZHE 2YGQA 4MD0B 3LH2H 4MVBD 5KSAB 3C8DA 5DD3H 5KSUA 1LM8V 4XPGL 4YEFA 3QS2A 1OAUH 1N5YH 4XOAA 1DBBL 3J7HA 4XC3H 1E9QB 5E0QA 1M71A 4KROD 1MJUL 4R0LC 4X6EA 3ETTA 5AEAA 5HDRA 2OK0L 3JWOL 5AUMB 1S78C 1U36A 1AS8A 3MGOB 4M9OA 1I3VA 1JHTB 4L1DA 2BFVL 4FLSA 5DRNA 4Y2DC 3GGWA 1OZUA 3WFEL 1IBGH 3QWOB 4UYPA 1WEJH 3WD5H 2OSWA 5DD0H 3VFGH 3HRPA 1Z3GH 1XXFC 4YSTA 2R39A 2IDCA 4JFEE 3CBKB 4HUMB 3FN9A 5ISZE 5I6KA 1JTPA 2J55A 4I1PA 1DVUA 2BSSB 2VIRB 3MNMA 1FGVH 4YZFF 5J0BA 1MIEL 3VW3H 4A7UA 1F8TH 2HJLA 1DJXA 3QZNA 3TJEH 5IJDC 5DDHA 3MBEC 4AGNA 3TBTA 3KZ8A 1SY6L 1NIEA 5IP4A 5E70A 4XN8A 2QQKH 3FO1A 3RGVC 4HWNA 2AS5M 4OFDA 2A6JA 1NGXB 4GG6F 2ARJB 3UZVB 1MHCB 1NEZA 1VGEH 2DYRB 2V9RA 4NGHH 5JO5A 4XC1L 3JT2A 3ARGA 4OCMC 4OFYD 4ZS6C 3M7OA 4JFOB 3ZK0A 5HYSA 4MAYD 4PJ7F 4NZTH 1CF8L 2WZAA 4BFKA 2CR0A 2WLMA 1QI3A 4Y5VB 3QP3A 2XKNB 1OPOA 1L9NA 2P4AB 3V4LA 4CRPA 1SBBA 2PR4H 3QG6B 3VFNA 3FCBA 4JPIA 3QE5A 5IQ9A 3W2DH 2LAAA 2YD0A 3F6JA 2NZ1A 4Y1AE 3DHMA 5FYJE 1QI5A 3BPCB 4PJGB 1RERA 2OL3L 2XETA 2YO3A 3F7PC 4PWJA 4EI6A 5DEGA 5PAZA 1AD0B 3B1UA 1J1PL 2G2RB 5TDOA 4O02H 2WZ5A 3QQ4B 1U8KA 4NWUH 4U6XB 4UIKL 4WI0B 4FL4B 4L3AA 2B9BA 4MD0A 1QPPA 7PAZA 5KSAA 3NIGF 2GUOB 2F53B 4MJ4A 4EEEA 1GOFA 2JKSA 4C55A 1XBDA 4NUPA 1E9QA 3VQLA 3U1SH 1C7SA 4QYOB 1LEKB 3N9GH 5CLXA 1QFOA 2JMRA 5DEZA 5AUMA 1CG9B 1HDMB 5CZXC 3AU0A 3MGOA 3T08A 5IHLB 3S88L 4RRPM 1JHTA 5EO9B 2EICA 3VNYA 5CHNA 2QDWA 3Q8BA 5LCVH 1L4IA 2EKJA 1MIML 3L1GA 4OF3A 3D48R 2FJFB 4YGVB 4Y4FB 2NYYD 2V3EA 4QTIH 3STLB 3DECA 2DY2A 4JFWA 3EJZD 1IAII 1J05B 1EO7A 2BSSA 1IRAY 3N06B 4X6DE 2ZXQA 1K8IB 4OCSL 4KXCA 3D0LB 4LOFA 5EUOB 1BMGA 2H2SC 3LRGA 4PB9L 5CUSL 3EAKA 4WW2F 4Z7UB 4P2OD 3HLKA 4KAQL 1RUQL 2EXWD 4NN5B 1XCQB 2ARJA 3UZVA 1MHCA 1BD2B 1RQ5A 2AJUH 4FNUA 2GC4C 1F41A 4M03A 4K5PA 4N0FB 1UD4A 3F8UB 4JFOA 1HZHL 3APFA 1BM7A 1WUZA 1E3FA 5DRXA 5FO2A 3TJPA 1FA4A 2XHNA 1MFEL 3LNHA 4KRPD 4GP8B 3G9VA 4OB5H 2XKNA 4W81A 5LGHH 3JZYA 1OF2A 3H85A 3QG6A 3F5WB 3MQIA 3DOSB 3BPCA 4WKZB 4PJGA 1NCJA 4F93B 1AD0A 3EYVB 4X4XB 2G2RA 3SDCB 4ISVB 3T3PF 3QQ4A 3EYFB 2B4CC 4U6XA 3O2VH 1Y0LB 2GC7C 5FA3B 4Q0XH 4WI0A 2DQFB 3RIAF 4H26B 2YPKB 2XTJD 2GUOA 2F53A 1FH5H 1DBMH 4RFOL 4ZBJA 1BQHB 4FP8H 1DEEB 3H1ZA 5T3ZH 1YY9D 5AVTB 3FZUD 1KYFA 2R56H 3EXJA 4DPRA 1GYVA 5AVYB 4JO3L 5TE4H 4QYOA 1LEKA 3QIWA 1BZ9A 3RX8A 3HJEA 4Q4EA 1HDMA 5IBLD 4ZW7A 2CWRA 3N42B 5EO9A 2AXFB 3LXAA 4Y19D 1BFVL 1V8HA 3OKEB 3MFGB 4G6KL 3SKNB 3V0JA 4N2OA 2FJFA 4YGVA 2D3VA 3V0AC 3CIAA 4WUUD 4XP9H 4FLQA 3GMOB 1OW0A 4QGYA 4GG6B 2WXFA 1AKJD 2ZXCA 4G7VL 4LFHD 1J05A 2NQ3A 5FGBA 2Z3FA 5D5MB 1TZGL 5C0ND 1K8IA 3EHBB 3D0LA 5B1BB 5DJXA 5EUOA 3QZWB 2ZCKH 1EFXA 1RK1B 3T1FB 5C0RH 1XGUB 3HZ3A 1ZLUK 5A3ID 1MLBB 1NMBL 1OTSD 4KI5D 4Z7UA 4JG0L 3TCLB 1INDL 3CC5B 1MN4A 4PJDE 4UM9B 2JQMA 4CJ0A 3HMWH 1XCQA 2QDVA 2EDXA 3F6IA 4G7SB 4GP4B 4AG4H 3D3VD 5FV1L 4Y5YC 4N0FA 2WP3T 3QJSB 4JL1A 3AXLB 1KY6A 4ENEC 2X3CA 3MNDA 1AIFB 1EO8H 3DOIA 4AUUA 1Z5YD 4Y4KC 1QNZH 1MFDH 5L2JA 2HFTA 3K8MA 2MWCA 3F5WA 4NNPH 4UOW1 4RMRA 5JTWA 1AR1D 4C59B 4B9PA 2YAEA 3DOSA 2UVEA 1KN2L 3MJ9L 4OKVB 2FEDC 3AT9A 3O3DB 3EYVA 3MCKB 4X4XA 2M1KA 3SDCA 4ISVA 3TBBA 1HS6A 1U3HC 4ZMTA 4ZX6A 5JMOC 3EYFA 2BNRE 4ZSOE 1GTNA 5FA3A 2KLTA 5DYFA 5AG8A 3N91A 3P11H 1F1GA 2DQFA 3PWJA 4H26A 2YPKA 5I9QC 5IKCB 3HG2A 2DD8H 2ENPA 3HS0C 4LHUG 1Z3RA 4OAWB 1F4WL 1I1RA 1MG2C 1T0PB 1BQHA 1AO7B 1DEEA 1SM3H 2UZIL 3B2MA 4JQIA 5GIRB 5KSVA 4YHZL 4JZNB 3NSCA 4OZGE 4DFHA 2WB1A 2WWNA 2X6VA 1KIUB 3DETD 2QT6A 4BE5A 3J2PA 3ROLB 1JNLL 2GUYA 3FQ2A 4YHMH 5JIHA 2JV6A 4XPAH 1KB5H 1JFQH 1D5XB 1FC2D 1NCTA 1TJXA 3VRIA 1RXLA 2AXFA 3AZUA 3LMJL 3OKEA 4NC0B 5IJCC 1AVAA 1S8DB 3SKNA 2J1YA 3HZYB 4GW1B 5C1MB 2ITFA 2ORBH 4WW2B 2ICCA 4S0HA 2XV6B 5ADPL 2JJTC 2FDBP 4GG6A 1C5CL 3GRBA 4I13B 3D25A 1LGVA 3SGKA 1GHFH 2WBXA 2CM5A 4HS8L 5D5MA 5I74C 3VXMD 3U9PL 5IB3B 3DJRA 4NQDD 3D05A 1PYWB 4ZDHB 2IMNA 4C58B 3ZTNH 4CW1A 4S0SD 4MAUL 3QZWA 1RK1A 5FUOL 3T1FA 1XGUA 5LGJB 4RMQA 1EBAA 4JQXA 1MLBA 3PWPB 2R1WB 1OAYL 5HTSA 3TCLA 2MOVA 3CC5A 4J39A 2NY3D 2VLRE 1MUJA 2ZG1A 1GGCL 2Q86A 1L7TH 5I8KH 4UQDA 4ONGL 1XZWA 3BO8B 4C56B 1DQJB 2EVGA 1A2YB 1SVZA 4ONFH 5DQDH 3ECVA 4QXTB 3AXLA 1DVYA 3C5XA 3U9UB 1BBDH 1AIFA 2OSLB 2KPNA 3TFKC 4CC0A 1PY9A 2X1QA 3OKLB 5D7JD 1PLCA 4OLUL 4JFTA 1A1NB 2V8MA 2AJ3A 4HKJB 3D87B 5I8EB 5MENE 2AJVL 3OPUA 4OKVA 4ILDA 3O3DA 4F2ME 2VWEE 3MCKA 5AB1A 1UT1A 4RZKA 2J72A 4KRMB 3D85A 2XV2A 3QUXB 1YEKL 4NJAL 1OTUC 2OMTB 1CL7H 2FNBA 4WEBL 3L1EA 4X4KA 3QIUA 2LLGA 5ECGA 1AO7A 3NQIA 4QRRD 4JZNA 4DGIH 3IYLW 3BZEB 5IJKA 1OO2A 2VXUH 2IBGA 2O5XH 2WBJB 3ETSA 3MOAL 2ZUTA 1KIUA 3ROLA 3ZDXB 1XEDA 2A4CA 5HI3D 1FORL 1RJLB 1D5XA 4HXBL 3NGBB 4R4FH 2J6EA 5AZEH 3SIKA 2VXVH 1PY0A 5KWYC 1DQMH 1T7WA 4WW2A 3MSPA 3DGCR 5CILH 5F9OH 5G4MA 1BHGA 4UM8B 5BUAA 2H0JA 2OR7A 4FG4A 4Y16D 4FNRA 2D7QA 5IB3A 1INQB 1PYWA 4ZDHA 1VPOL 3TZVC 2W94A 3SDDB 5GHWH 3PWPA 5JW4N 1J8HB 5E6ID 1K9TA 3U4BH 1G7JB 4HLEA 4YVUA 1WPCA 3BN9D 1R17A 3B5TA 3LQAH 1GZQB 3BO8A 3WE1A 4XCFH 4Q6IB 4C56A 1DQJA 5J6GA 3BPLC 3PJLA 2NY6C 3MACH 2FT7A 1OAZH 4YHPB 1A2YA 4WUKH 4I0PB 2EDEA 3MMEB 3N40F 2GEQA 3MV11 5JORB 5EO0B 4DP4X 5BCAA 3U9UA 4YSUA 2FX9L 3ZDZF 5FYJL 2OSLA 2V2TB 3GSXB 3KPSD 2X9XA 3OKLA 3LRHA 4J3VA 1FH2A 4PJ5E 4M43H 5F0JB 4OZIF 2VZOA 3PHQB 4M7KH 1A1NA 4QRPE 4J7RA 5I8EA 4HKJA 4OV5B 2A83B 2UZXB 2ZT9C 1IGIH 2VN5A 3BLKA 4Y0GA 2O93L 4LP5A 5CEZH 1ZS8B 3GZOA 2YPVH 4Z7WE 4PJHB 3WDJA 4PW9A 4H4NA 3LX9A 3QUXA 1A14H 5A2BA 4OM0H 2XA3A 2B5IB 2OMTA 1F1DA 3HLAB 4XMPL 5E2VL 1E8WA 1JDAA 1VZIA 3PXJA 4LRNL 4P05A 4F5CE 5T5FH 4JO1L 3BZEA 4FC3E 1WZAA 3VAEA 4OQTA 2WBJA 5D2LB 1CTMA 2XZZA 4LMQI 1MXDA 2PW1A 3T4AC 3VNZA 4P46D 3BW9B 4HQQH 1TF4A 3MX0B 1AHKA 1DFBH 2BRRL 1G7MB 2R1YB 5BQ7B 4W9GC 4JL2A 1CLOH 1ODUA 1KT2B 2E4TA 2NMSA 4UM8A 4DGVH 3D4ZA 1YEJH 3DSNB 4I48B 5C0CB 4NQXB 1KXTA 3TO4B 4DK3A 2YBRB 4N2FA 1BJ8A 4RMUA 3EUDA 1INQA 3VG0H 4AZUA 5G4NA 1U2CA 4H8HA 3SDDA 4UB0L 1CE1L 1J8HA 4Z7NF 2PETA 3BVWA 1EHXA 1G7JA 4ZT1A 5A43C 3UPRB 1J1XL 4OFIA 1GZQA 4TSBH 3C5ZB 5IEKB 1XH2A 1A6WH 4X5RA 1ZEAH 1IC4L 2YPLD 1XSJA 4K8RC 4YHPA 4LSQL 3TBSA 3CQQA 4I0PA 4LQ1A 5I18H 2YRPA 3MMEA 5FA4B 4BZ2A 5D1QE 5F1IB 1CICD 1KF9B 4X7EC 5EO0A 3ETBF 3V4VL 4DAGL 4KKLD 3GXIA 5JORA 2V2TA 4EI5D 5DD1H 3GSXA 5C07B 4DESA 3V52L 1FBIL 3GXNA 3ZMRA 5FGSA 3II2A 4QKXB 4N26A 2JK5B 4ZW6A 3PHQA 3EJQA 4EIGB 3FT4B 4OV5A 1RD6A 1U58B 4FFWC 5HHVH 5LLIC 1ZS8A 1IQWH 2OS7A 2NXZC 2WWMD 3L5WB 4JCMA 5DHVA 1BM3H 2QV4A 3IDJB 4PJHA 1YC8A 1G1OA 5HHMD 2A0LC 3TWYA 2P42B 2ADYA 6FABH 2FK9A 4NPYB 3HLAA 1U33A 1BQRA 4Q9CA 1TQTA 3T3ME 5BOPA 5AOKA 3W0WD 4OV6F 1GR7A 2O72A 2AKRB 3GLAA 3K5SA 4OY9A 5D2LA 4ZOEA 4AVIA 4FHBD 2ZX9A 2B1OA 3BP4B 2VH5H 3P9LB 1W15A 1J9CT 1MWAB 3MJ7B 4N2CA 3T0XA 5FHAH 3MX0A 1BEYL 1G7MA 2R1YA 4BFGA 3DXAB 4K07A 5BQ7A 5CWSB 4TULH 5LBSA 3CDCA 1SF3A 5C7ZA 2CR6A 3RWCA 1P6FA 5I23A 1KT2A 1SOQA 3HKFA 2IPTL 4FQJH 1JDDA 4NRXB 3WNLA 2EDJA 3DSNA 5C0BE 5C0CA 2NW2B 1LP9E 1WP6A 4PN6A 1MCDA 1TEFA 1D7DA 4BWWA 2YBRA 3RYMA 1G7LB 2IWKA 5DJYB 3UZEC 4ANVA 2D3LA 2F7IA 5CCHE 4UQ9A 1MRFL 3EH5B 1VGKB 3DK0A 2ZTBA 1YYMH 1CFTB 3UGUA 1RZPA 3KXFE 3JWNC 4X6FB 3C5ZA 2UX7A 3MR9B 3MV7B 2L3BA 3E3QE 3EBHA 4DFIA 5IEKA 1GSKA 3RX9A 2UV3A 2XQYG 3D39B 4RWYH 4QPEA 4XO5A 2F8IA 2HVKB 3PPSA 5FA4A 5F1IA 4CL7A 1WS8A 4PG2C 3QUYD 5DMJB 1PTZA 2W8CA 1TDQA 1K85A 5C07A 5DWPA 4KNUA 4HWEH 1HXKA 1ZIBA 4R83A 3L8QA 3FT4A 1MCPH 4GXVL 1U58A 1H3PH 4P3WA 4R7NB 1O7VA 1URIA 1BPVA 3L5WA 5IJVB 2Q1EA 3IDJA 1M9WA 3KDMA 1HEZB 4HFWB 3GK8L 3BT0A 3P54A 3SODB 3EJYC 3QR0A 3UL4A 5CJ5A 1R3IL 1ECYA 2AK1L 1YUHB 3QARA 4UUJB 4PRNA 3U6RB 2ICEC 4NPYA 4PJ8C 2ADIB 5EORH 4RBPH 4R84A 2OCJA 3W39A 1BF5A 3ARYA 4CSSA 2AKRA 4KX9A 4MJ6B 5JDSB 3L1FA 1NANH 3FT2B 3PXLA 3P9LA 4FKKA 3E0GA 4TTDD 1MWAA 1BVKB 1OZTG 3MJ7A 5CGMA 2IAND 4AM0B 4WFGE 2IPKB 4A6YL 1VKXB 1WHOA 1DCEA 4UT6H 1L3NA 1VSCA 4YDIL 3DXAA 5CWSA 1K2DB 3IFNL 2OSYA 3CNKA 4HC1A 2LE9A 2NDFA 2VDML 2WCSA 3HG1A 1DZBA 4L9DA 4NRXA 5IG7B 1E7VA 1PX4A 2DAVA 2IFFH 3FN0H 3FYIB 3P30L 3QWNA 3ULUL 3IMTA 5I0DA 1SBSL 1XR8A 4G8EB 1G7LA 1TEYA 2IDFA 3KH3A 2P5WE 3AS3A 3PYCA 5DJYA 4KQ3L 2Z34A 2R1XB 5TDNB 2DWYA 4N8VA 1JGLL 4Q56A 3ULVL 3D50A 1VGKA 1NIDA 3K2UH 4FEIA 1CFTA 4ZD3L 5DZPA 4AQEB 3MR9A 3PU7A 2F19L 3MV7A 1IVLA 4O58H 4HZAA 1TZOA 5HD8D 4H20H 2WZPD 4DGUA 3D39A 4HLZG 1XTMA 5D7IF 3RURA 2HVKA 3AMKA 3UBHA 4XPGH 3II1A 3M45A 3QEQB 1HAUA 4BQ8A 3MLZL 1DBBH 1BQUA 1WV7T 1MJUH 2X0WA 3B1TA 4B5ZA 5GS0H 4ZTOL 2E56A 2DM2A 3BKJL 2OK0H 5CN1A 3JWOH 2FEEI 4UT7L 5GGUB 4LCWE 3V2AR 3V8OA 4ODBD 4R7NA 2BOBB 3WFEH 4A7SA 2AJZB 4HD9A 5I0YA 1FAKT 4YSDA 3OKOA 5IJVA 3BI9X 2JFCA 1HEZA 4LB8A 5GS0L 3V4PL 4UQAA 4F37F 5BOZG 1YUHA 4UUJA 3FUDA 3NIGE 2ZSWA 1TTBA 3QAZC 1SXCA 1BYOA 3U6RA 1KPRA 2ADIA 4DO6A 3PG2A 1YEEH 3O2WL 3A6BL 1NAKL 1PZSA 3LPWA 4KKBD 1N0XL 2DIEA 4GRWE 3CN3A 3QBTB 1MIEH 1RP9A 4MJ6A 5DUML 5JDSA 3EDEA 2YAMA 3FT2A 4NKIL 1WFUA 2XZAH 4KUZL 2LU4A 3RVXC 4M1CC 2CXGA 4EXPX 4AM0A 1VKXA 2IPKA 2GKIA 1KYAA 1QLRA 3Q01A 4BELD 3ZE2B 5E8PA 4L8CB 4KY1L 3JTSB 3T2OA 1MCWW 4XC1H 5JHLA 3WO3B 3O3UN 1K2DA 2HKFH 3WS6C 2H0EA 5D71H 1ZK5A 2DWXA 4TMPA 3SDAA 5IG7A 1CF8H 4IOFD 2A9AA 2HA1A 1OQOA 4U1JB 2WKOF 2PF6A 4G8EA 4QEGA 2VGLM 1B4JL 3TH3T 1IEHA 2EYSB 5TDNA 5CEYB 3H2QA 1AQMA 3T2NL 1CD1A 2OL3H 4JFDB 4PRAB 4LFHG 5ITBL 1J1PH 4YEEA 3F65A 1XX9C 1IAIM 2C3HA 3RKDC 3L5IA 3SDAB 4UIKH 1N12A 3ESPA 1R3HB 3T0EB 4NQCA 4ABVA 4EXKA 3EZJB 1CXKA 3JSSA 2ZWLT 3ARDC 3QEQA 2ALWA 3OMAB 5K9JL 1B88A 2UUDK 4TVUA 4JO5A 5AYUH 3FTUA 3PAYA 1FN4B 4PJAB 4UOJA 3D7PA 2UWEF 4XNMB 2Y69B 5FPIA 4XAWL 4P4KC 3S88H 2MQ3A 2BOBA 2NPLX 2AJZA 2D7OA 4OZHB 1MIMH 1NMCB 2J1WA 3NMEA 5D93C 5LBVA 4XMZA 1T2QL 3KG5A 3KYAA 4K5NA 5F7DA 5MHSE 4C4UA 5CZKA 4IIQA 1RUAH 3QQ9C 2EACA 2LQRA 2NR6A 2L04A 1AP2A 1UHVA 2Z31B 3T71A 1UYWL 1L0YA 1I7TB 5ELIA 2K6YA 3VH8G 4OCSH 5HGBB 3GYRA 3VWKB 2Y7MA 1R4XA 5EA0L 4ZMLA 4PB9H 3LDBB 4R97C 4XVTL 5FAAA 3SJVE 5FO9B 3RWDB 2XNAA 4UTAL 3E2HB 4XMLL 3FHAA 2BY0A 4GI8A 1N0LB 1RUQH 2FGWL 4KAQH 4XVSL 3CDYA 2F74B 4GT7A 5CO1A 5A2KH 5I1GL 4L8CA 3B7UX 3AWEA 3VD0A 2YHGA 5ISZB 3NDYE 4YFLI 2WO4A 5EBWB 4ZX5A 3FT9A 3ECBB 3PRZA 2WP3O 4KMLB 1PX8A 1EZVX 5E1HB 4GUPB 1HZHH 4RA3A 3AGWA 3JV4B 3NSFA 4AJVA 2FR4B 3O8XB 2PLTA 3PV6A 1HE8A 1EMTL 5AYTA 4KNQA 4ZPTB 1ML0A 2V4LA 4K15A 5LXVA 3AWFA 4N2LA 4ZMAT 4HSQA 4OGXH 2KZ1B 2EYSA 5C6PB 1SEBB 3REVB 3FH7A 5DK2B 3N41B 3HUJF 1HL8A 4JFDA 4W9DC 4NI6A 3T4YB 3VD3A 2JCWA 4PRAA 2R2HB 1YJDC 3B7SA 3CHOA 4H44C 1VZGA 4KJYB 5GJTL 1GKEA 3QIBC 1R3HA 3T0EA 1PPIA 2AQTA 2N56A 2VMCA 4NNYB 1AGFB 1AQKL 5D2NE 4RFOH 3SBPA 4Y1AB 2K3TA 4A63A 4Q4IA 1HXYB 5FDWA 2OCFD 2OMWB 5D8JL 4JO3H 4PJAA 1P7BA 3VXTB 3QW9A 3JWDC 2VABB 3OC5A 4YC2B 4B7IA 4AUJA 3CU1A 3MYZA 4XWGL 4MMZA 2BZ7A 1JJUA 5TTRA 1BFVH 1EV2E 2ZUUA 3DX7B 4OZHA 4B97A 4L1HA 1TVBA 2C9AA 4G6KH 3Q3GB 1YNKL 3IE9A 1TJIL 3PQYE 1RLWA 4PJXF 3RVTD 4A2LA 1USZA 3NFSL 3I2CL 3EF4A 4NKOA 2BC4B 2VLJD 4J3OH 2OXGB 5ERWB 2EXSA 4XHJD 2Z31A 2VJ8A 1J5DA 2IBZX 4BINA 4R26H 1I7TA 1X5GA 3L4UA 1CYWA 2E46A 2E4FA 5LN4A 3ZZLA 5HGBA 3ZZ1A 2GSMB 2EVHA 3B6SB 3DVIA 3VWKA 1QRKA 5E8NA 2YXMA 3QDGD 1NMBH 2AEIT 3B43A 1BLNB 2F08A 3NCYS 4PRPD 5FO9A 1INDH 4TLTA 3RWDA 4NRZB 1Z9PA 1ZPUA 2GABA 2E5EA 4YK4C 4K5OA 2F74A 4PSRA 5DQ9B 1HH9A 4G8GD 5EBWA 2DEWX 3ECBA 1J7VR 4X6DB 2Y7QB 3WNOA 3FU0A 5LGKA 2FQDA 3JV4A 3O8XA 1KACB 5A7BA 4G43B 4P3DB 4AQ1C 4X9FA 1ZDSA 3TCXA 4MA3B 3VB9A 3RFZC 5JW4R 2CLVB 4OLWL 1PD1A 1SEBA 5AL0A 3REVA 3FNKA 5DK2A 1HKFA 2YXFA 1CC3A 5C2BL 3MJ9H 4FMKA 2ZWSA 3T4YA 2R2HA 3KHQA 3BT2H 4Y5XB 1MY7A 1WFMA 4DN3L 4ANKA 4KJYA 4BK5C 3WTYA 3PNRB 1QSED 4S10A 1AGEB 1UWXH 2Y25A 3FH5A 2GB2A 5DHYB 4FG6C 1F4WH 1FO0B 2R2EA 3CAFA 2UZIH 5D4HA 3V4VB 4A39A 5HHXH 4Y1AA 1E4JA 3OG6B 1ZLVK 5A2CA 2CM6A 5JIQA 2OMWA 2OYPA 1KGXA 4MKTA 1JNLH 3VXTA 2MRYA 5BO1L 1W0WA 2VABA 5KAQF 1KTJA 2WC7A 3TGXA 4C47A 1GYCA 4DJMA 3DX7A 3LMJH 5KW9L 1DYZA 3SPVB 1HH6B 3AREC 3Q3GA 4XXWC 2X5PA 2ZKHL 3H0TB 5J56B 1UG9A 2WNGA 1MHEA 3CN2A 5ADPH 2BC4A 4RH4A 2YGNA 3RWFA 5B7FA 2IBBA 2OXGA 1C5CH 3N85L 3SQOL 4NC1E 4UDUB 4YS4A 4JBSA 4HS8H 4U1NB 5F6HJ 1SOXA 1B4RA 4YXLL 4LBEA 4MAUH 3B6SA 4XNUL 5DFVD 2VL5B 3ZGIA 1GGIL 5BOJA 1BLNA 2JJSC 2JI1A 5EUKB 3JVFC 3O6LL 4LL1A 4NRZA 2W81C 2VLKE 1GGCH 4FXGB 5DVOA 1H15B 4ONGH 1G6RL 3BKML 3UO8B 4XE5B 2DI7A 1A6VL 5DQ9A 4HUNB 4X5XB 4X6DA 2Y7QA 2XFXA 3E8VA 3FQUB 4GO6B 2ZYSA 4EUPG 3QCUH 4G43A 4P3DA 3MOQA 4MA3A 1WD9A 2AITA 2ERJB 4JDEB 1X44A 2CLVA 5J13B 1J8SA 4OCRL 4PJDB 1HSBB 4OLUH 1NCIA 4UZSA 2XIBA 4YIQB 1I1AA 3OWRA 4U1HB 1EQWA 1KJ2L 1A6AB 2AJVH 2QADC 5F7YC 4Y5XA 2BSDA 1S9YB 1UACH 4EBQL 4Z3IA 1LMKA 3QHZL 3VTAA 2P24B 1YEKH 1IQDA 4NJAH 4BZ1L 4H0LC 1OE2A 4YVNA 1AGEA 4IJ3B 3A67L 3VGAC 1IO4C 1QTYT 1MDTA 1FO0A 3HE7D 1YDPA 4Z7QB 1E40A 4L4JA 4LCCB 3FSZA 3MOAH 4UV4L 4OZIE 3EGXB 4P9ML 5HDBF 5ETUB 4AKPA 1FORH 1TVDA 4PG9B 4HXBH 3QRGL 4MZ3A 1CZ8H 2BNRB 4XO9A 1O6TA 3GS7A 2GBAA 2WSKA 4PP2A 4M00A 1HH6A 4WWKB 3AQYA 3H0TA 3DRTB 4YDMA 3RHWF 4DUWA 1MCSA 3DVGB 1L5GB 2BWIA 4AIEA 3DJSA 3C8KB 4OZGB 4UDUA 1BAWA 2VISB 2XRAH 3P4NB 1HWGB 3CXHK 4U1NA 3QORD 1J48A 2J6WA 3N2JA 4PV8B 5GS2H 1VPOH 4AXWB 3AB0C 3HRZB 4N1EA 5IMOA 4UZUA 5IBUB 5SX4I 1YAIA 1IM9B 4UYQA 1WF5A 5EUKA 1CBVL 4N0YL 3UIYA 3L3OB 4ODUA 4FXGA 4B9IA 1H15A 4I8DA 4UMSA 2HLAB 4KH2A 1GAFL 5BZWB 4X5XA 4KO6A 1M7XA 5EBGA 4L3ED 5DYOB 2VDMB 1Q0YL 3ARRA 3OF6A 3W11C 1C5DB 2FX9H 3HHRB 4Y7OC 1IC0A 4P48A 2PUQT 4QOKD 4JDEA 5A2IH 5CAYB 1K8DB 4FYTA 2F5BL 1J12A 4JX0A 1UJ3B 4PJDA 1HSBA 1WO2A 3L1OL 4RIRB 4WEUD 4YIQA 4Z7NE 3HEIB 4U1HA 4XNDA 2Y24A 1A6AA 1MFNA 3ZKSD 2ITDB 8FABB 5KAQG 1S9YA 5EH1A 3IJHB 1JRHL 2J88H 5GS1B 5ACZB 1I3UA 3CFQA 4QO1A 2X4TB 5DFTA 1HOEA 5E2VH 4ONHB 3TONA 4LRNH 1XDTT 2JIXA 3Q6GH 3G5ZB 4JO1H 4FQ1H 5FX3A 5CGYD 4POUB 1DDTA 4XWOD 2GY7B 3EGXA 4OLXL 1F11B 4XNZC 4F2MB 5ETUA 4D94A 1LEIB 4PG9A 3IFLH 2IBZY 2BNRA 4XXCA 1NAML 1B6DA 2BRRH 3CXDL 2EH8L 3BESR 1A7BA 4WI4A 2ZOWA 3DRTA 3AU1B 4ODTL 4H2AA 1L5GA 4P2QD 5KBLA 3UH8A 3C8KA 3NSJA 3THMH 4DVBA 2VISA 3NEXA 3P4NA 4FFZA 4IQHA 4YQXL 4BZYA 3SKOB 1DLHB 4PV8A 3HE6C 2WXKA 4AXWA 1A7OL 3QJQB 3HRZA 1ROCA 5K33A 4UB0H 4BXSV 3RI5F 1A66A 1IM9A 1CE1H 2QHRL 2XXFA 4TNFA 5F89B 4FI7A 1T66C 2PWDA 3L3OA 3G04B 2RGSA 4JZJA 1X9RA 3ZR6A 1J1XH 2CHDA 3MUY1 3QYMA 3WHXA 2HLAA 4R3SA 4E41B 1IC4H 4WSGA 1N2RB 5BZWA 4AVJA 4EKXA 4LSQH 2AQQA 2VC2B 4JHVA 4HIEB 4HWBL 3AT8A 4DAGH 4DW2L 1RKRA 1IAIH 4PHXA 4HCFA 2KL6A 4IRJC 4NZDA 3HHSB 3V52H 2XVKA 2ZXBA 1FBIH 1ZSHA 2HFEB 2FWUA 1K8DA 4XP4H 5AAWA 1HZLA 2YD4A 5DQJB 4D2NA 1UJ3A 4BM7A 4LBAA 2PN5A 4BD4A 2AHIA 3KM1A 4X80L 5D1ZI 2BY1A 3VMPA 2ITCB 3OAZK 4YLQT 8FABA 1RZJL 3IJHA 3DIVA 4O2FB 5ACZA 4FNQA 1KGJA 1MCKA 1IAMA 5B21A 3E1F1 4JHZA 4KOCA 3S3JA 4L2LA 4ONHA 1EWHA 5EZIH 5JA9A 4ZK8A 2CJ3A 3GKZA 4WUUE 3WMQA 3FC8A 4XE0A 1EPFA 2V7NB 3G5ZA 5EC1B 3FO2B 4QRPB 1FVDB 4HT1L 1ULVA 4XOEA 3HB3C 3QXWA 3I9PA 2P5PA 3B9KB 1AYRA 1F11A 4F2MA 3QEHA 5HHOA 4WV1B 1F3RB 4YGAB 3FQYA 3NA4A 1TO4A 3RAJL 1BEYH 2WQWA 4KI5E 4NZFA 3R06B 3AU1A 4CBPA 1KPVA 2IPTH 4N0UE 2FTAA 4YDLC 1WZ1L 4OR1A 5GZOC 5CP7B 3D3VE 4F7CB 2ZAHA 1O5DT 1G5GA 2P80A 3K6OA 5ESAB 1DLHA 3SKOA 4BHUA 1YMHB 5I0WA 1YN7B 4A7QA 1F02I 2P45B 3GBEA 5F89A 1AGBB 3AADB 3G04A 5FUZL 2FHFA 2ALAA 2Y2WA 1PZAA 4PAZA 1ZLDA 3DMMD 1KEGL 2IH3B 3CVIL 4E41A 4HSAC 1N2RA 1QWHA 2Q8AL 2YKLL 4M5TA 1PZUB 5FM8A 3TA3B 3I6LD 4HIEA 4BQBA 2VR3A 4WO4C 5F6IC 2X6MA 3HHSA 2HFEA 1HE7A 1QFWM 1ACXA 2I24N 5DQJA 2ADFL 2E7LA 4D8OA 5HJGA 2FLRT 4GXVH 2VL4A 1QR1B 5DO8A 1D7BA 3GMMA 3O3AB 5DFAA 2ITCA 1MAJA 2H0FA 4PJEE 3SE3A 5IT2L 1U6AL 1VENA 3GK8H 3HFML 4O2FA 5D1QB 1S7VA 2HPTA 1MJJA 1RV6X 1R3IH 2AK1H 1V55B 3QZMA 2KPWA 2FO8A 4S1RL 5M95B 1V3MA 2CPUA 1Q94B 4ZXBD 2APSA 4N6QA 4W9EC 4WSKA 1CD8A 3FO2A 4FJYA 4N8CL 4QRPA 1FVDA 4NNXA 5C3IA 2D3NA 2EE2A 4L1LA 4L3CB 3LKRB 3B9KA 3TNMB 3VXME 4NQDE 4ZX4A 4WV1A 5D7KD 2P48B 1PS3A 4C54A 4J8QA 4HWUA 4A6YH 2NY5L 2ZD0A 3GM8A 4YDIH 1B9KA 3QXVA 3R06A 1DUYB 3IFNH 4QMEA 1DVFD 5T3ZD 2VDMH 3GTVA 4OVVA 3SDYH 1MW2A 3P30H 2Q2LA 5CP7A 4PJ6A 3ULUH 4U0RB 2H47C 5DGQ