2I85A

Nmr solution structure of human ephrinb2 ectodomain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
142
structure length
142
Chain Sequence
b'SKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin-B2
publication title NMR solution structure of Human ephrinB2 ectodomain
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 17
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2006-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2i85A00
2AVFA 2WO3B 3FSWA 1PLCA 1OE3A 5B7FA 2XLLA 4W1TA 1W6LA 3NSDA 4A2DA 1A3ZA 1A65A 3AW5A 4W9ZA 2W88A 4GYBA 4DP8X 2XXGA 3C75A 1L9TA 4HALA 4BXVA 2IDFA 1RKRA 4M3HA 1AIZA 7PCYA 3D12B 4HAKA 1X9UA 4ZK8A 5IY5B 4DP9X 1PZCA 1OCZB 4UAHA 1GW0A 4DP0X 4E9VA 4E9XA 3NJIA 2RACA 5I5MA 1KV7A 3QJTB 2UXVA 1E5ZA 2JKWA 2XVBA 2VSKB 4KO9A 1AZBA 5AFAA 5B1JA 3EF4A 1ET8A 2DY2A 1SNRA 2IWEA 4E9SA 1FWXA 1TKWA 4CSPA 2TSBA 1KDJA 5B1KA 2X88A 1GYCA 1XMEB 3AG2B 3S3DB 3SQRA 4E9YA 1NIBA 2H47C 2R7EB 1NIAA 2PPEA 1JXDA 2GC7C 2BZ7A 3X1NA 2DYRB 3IBOA 3ZX1A 3FQYA 3FT0A 4DP2X 3ASNB 3PAUA 4DP6X 2FQFA 3PAVA 4YSDA 4KNTA 2FQEA 2HRGA 2QT6A 4GP5B 4NERA 1ZIAA 3WI9A 1XB3A 3AG1B 1HFUA 3OMIB 4HCGA 4DP1X 1FA4A 2FT6A 3NSYA 3DIVA 2GHZA 1AZUA 9PCYA 1GS7A 3WG7B 1TU2A 1AQ8A 3T6WA 2XV3A 1NPNA 2HX8A 1CC3A 3AG3B 1ILSA 1V10A 1JZEA 1A4CA 1NIDA 2B3IA 2DWSA 2Y1AA 1AAJA 1J9QA 1NZRA 1E5YA 2HLEB 3BQVA 4DPCX 1QHQA 3FYIB 3IN2A 1JVOA 3UGEA 2QDVA 2A3TA 2JXMA 3CDZB 3PPSA 5I6NA 6PAZA 4P5RA 1OCCB 1AG6A 3NYKA 3EHBB 3PCYA 3GYRA 1PZBA 2FJSA 2YAOA 2Q5BA 1WA0X 4G70B 2IH8A 1KBWA 1PNDA 3S8GB 3EH3B 1GS8A 2ZWNA 2I7SA 3MX0B 3TA4D 2FTAA 2NRDA 1WAEA 3RYMA 1SHWA 1I53A 5FC9A 4KOBA 4YSRA 1ASOA 5ANHA 4TXVB 4YSUA 4A2EA 1L9OA 3IN0A 4HHWA 1BEXA 4YSTA 1GSKA 4FA7B 4HIPA 4KO7A 2GB2A 1AZCA 2QPDB 3ABGA 1YLBB 3N55A 2CJ3A 3U25A 5B3SB 2XYBA 2X87A 1KGYE 1OE1A 5B1JC 2HZHA 2J5WA 2AZAA 3ZDWA 3SBRA 4BWWA 4GP4B 1M57B 3WNJA 5E9NA 4BDVA 1BAWA 1V55B 2XWZA 2EIMB 2YAMA 3NSCA 3WIAA 2BP0A 1JVLA 1KCWA 4BXSV 1CURA 2BW5A 1JZGA 1AANA 1UATA 2YAHA 3X1GA 1SDDB 2J57A 2FQGA 5F7BA 3FYEB 4HZ1A 2BO0A 4AZUA 5I6OA 2IDSA 1W8EA 3UABA 3FSVA 1J9RA 1NIFA 4RH4A 1PNCA 2PPCA 3GXUB 5D4JA 1AS8A 2UXTA 4G72B 1BQKA 2GI0A 2GIMA 4E9RA 1MG2C 5EHFA 1IBYA 2YAPA 3X1BA 1KDIA 2VSMB 2H5UA 1GY2A 1A8ZA 1BYPA 1JZIA 2AFNA 1RZPA 1CYXA 5D4HA 2ZXWB 1PCSA 3MBWB 4X4KA 2LLNA 5I6PA 2ZONA 1QLEB 2BZCA 2ZOOA 3TBCA 1BXVA 3FU7B 2PLTA 1NPJA 4K9JA 3HB3B 3S3BB 2IAAC 1E65A 2PP8A 4G71B 4WKXA 5LDUA 3NP3A 2AANA 1OOWA 3UAEA 2EILB 4Q8BA 3T9WA 1WA2X 1ID2A 4N4YB 2IH9A 2FQDA 3FQ2A 2DYSB 3UACA 1N68A 4YSCA 1XB8A 2UX6A 2IWKA 3T6XA 2EIJB 3JTBA 1L9QA 2YAFA 1J5CA 1E30A 1KCBA 2P80A 1IUZA 4HCIA 4HHGA 3FU8A 3G5WA 1AG0A 3V9EA 1ET7A 1KYAA 3PAZA 2R7EA 4DP4X 3FU7A 4KOCA 1JXFA 1BQ5A 2XX1A 1QNIA 2TSAA 3N2JA 4KNSA 1AR1B 4JHUA 1T5KA 2HXAA 2BW4A 5B1BB 1N70A 2GC4C 1PZAA 3NJGA 2PP9A 3QPKA 5D4IA 2VW6A 2PCYA 1ET5A 2W8CA 1MZZA 2WO2B 3NJJA 1MG3C 4L0PB 3FS9A 2FT8A 3KW8A 2YXVA 3OD3A 3OM3B 3CG8A 4JHVA 4KO5A 1L9PA 1EHKB 1NWOA 3FSAA 2YXWA 5PAZA 4HCFA 3FSZA 4YVUA 4F2FA 4NAJA 1IC0A 4KO6A 3WKQA 3SBQA 1NINA 1PF3A 1OV8A 2HRHA 4YSEA 4YSOA 5I5IA 1KBVA 2H3XC 4DPAX 1OE2A 1ZPUA 1SFHA 3OMAB 4QLWA 1RZQA 4GXFA 2XUWA 1F56A 5A7EA 3CDZA 1PLBA 1GY1A 3NJHA 4G7SB 4DPBX 1MDAA 3IE9A 1J9TA 2BP8B 4QKTA 4E9QA 1SF5A 1V54B 2IDQA 2QPEB 3ASOB 3CZUB 4AX3A 1NDTA 1SHXA 2HX7A 1BXUA 2EINB 1E67A 1PLAA 1JZFA 4P5SA 4AKQA 2UX7A 2BWDA 4N8UA 1M9WA 5TK4A 3QQXA 2DV6A 4AI7A 1AZNA 2UXGA 1X9RA 3QJVB 4YSQA 1BQRA 1CYWA 4WTQA 3WNIA 2VM3A 3BVDB 3QJSB 3T6VA 3AY2A 1M56B 3H4FA 5PCYA 1ADWA 2FNWA 7PAZA 1ZDQA 1ZV2A 2YQBA 2XXFA 1TEFA 4GP8B 1J5DA 4JKNA 4AKOA 2XV2A 3T71A 2OV0A 1IBZA 2XU9A 4YVNA 3CVCA 2XV0A 1EZLA 4MFHA 3UAAA 2JFCA 3IEAA 3JT2A 3X2QB 3QJUB 1NWPA 1WA1X 3CVDA 1AOZA 2VMJA 5I5JA 3HEIB 1GS6X 4E9TA 3FPYA 1SDDA 2B08A 2HX9A 8PAZA 1ZDSA 1WS7A 2CAKA 1IKOP 1JERA 1NIEA 2N0MA 2YARA 2PPFA 3NSFA 1B3IA 2CUAA 2PPAA 2IDUA 4AKPA 3EH4B 2PP7A 3NJNA 4CSZA 3FU9A 1L9RA 2CCWA 2I7OA 3H4HA 1RCYA 4Q89A 3OQRA 3ZIYA 3NP4A 3V9CA 2BWIA 1ETJA 1XB6A 2CALA 3PLYA 1FFTB 3ZBMA 3DTUB 3OMNB 3S8FB 1SF3A 4UANA 1ILUA 2WSDA 3X1EA 3ABKB 5B1AB 4A68A 4PAZA 3SBPA 4A2GA 2PPDA 4A2HA 5B7MA 2AZUA 3PXLA 4NB7A 2MTAA 2J56A 5F7AA 3L45A 2FT7A 2VW7A 4ENZA 2XX0A 1GR7A 1R1CA 1OCOB 2EIKB 3NJMA 1ZIBA 2I85A 2GSMB 3NT0A 2VN3A 6PCYA 2VW4A 1JZHA 4BWUA 1PAZA 1HAUA 4A67A 2YAEA 3NJLA 1WS8A 5I6KA 4E9WA 3S3CB 1AS6A 3DKHA 3AG4B 3H56A 2BHFA 1BXAA 4FAAB 2J55A 1AACA 4BK5C 3TASA 5I28A 2UXFA 1ASQA 1CUOA 2PCFA 3TBBA 4YSPA 1PMYA 3ERXA 3FPXA 5I26A 1VLXA 3NJKA 1MZYA 3QJQB 4UF7C 1DYZA 2VM4A 3KW7A 3UADA 4F2EA 3WKPA 3TU6A 5I6LA 2DWTA 3NJFA 5I6MA 1NTDA 1SFDA 4KNUA 5B7EA 3T6ZA 4DP5X 3EH5B 4F7KA 3GDCA 2OCCB 1TEGA 4G7QB 5TK2A 1HAWA 2E86A 1PY0A 4BDVB 3ABLB 1NICA 2QDWA 4YL4A 4YSAA 2IDTA 4A66A 5AZUA 1OF0A 2BP0B 3QJRB 2MRYA 1AS7A 2CBPA 4G7RB 2GBAA 2IWFA 4GY4A 1J9SA 1URIA 4EF3A 1OCRB 2P80D 5AKRA 3AZUA 1JOIA 2FWLB 1JZJA 2BP8A 4BWTA 2Q9OA 1W6WA 4A2FA 2Y69B 4M4RB 4YSSA 1ASPA 3FQ1A 1A4BA 1L9SA 1A4AA 3ABMB 4DP7X 3X1FA 2YAQA 1JXGA 4PCYA 1DZ0A 2OJ1A 1SJMA 1BYOA 3CVBA 1AZRA
chains in the Genus database with same CATH superfamily
3DX8A 3K6IA 1JHTA 1PLCA 3M17A 2XLLA 2VQ4A 3WMSA 1A3ZA 4EOWH 2CJUL 1K4DA 1CQKA 1D5BB 2J43A 2A83B 3RVTC 2YOAA 4H0HB 2PR9A 3O2DH 4XPGH 5F7NC 3V0VB 2F8IA 2R1YA 1FE8H 4JFOA 1G4MA 4BA0A 3MGAA 4P9MH 1RJLB 1WFOA 3HR6A 2XQYA 1IO4C 4WUUB 1IBFA 1U8LB 5DR5L 1RZKH 1JGVH 3FN9A 4YDJA 3EO9H 3WLWC 1A5FH 1ACCA 5L2JA 2CBMA 5J8OA 2G9HA 1U3JA 3UO8B 2D4DA 2ICEA 3LS4L 3NZHH 3LRGA 1TXKA 2YD9A 1N0XL 3QIBA 3CHOA 2J1KA 4PJFA 1OM9A 5TQ2H 1FBIH 5J3HC 5LCVL 2OMNA 5DD5L 4CSPA 1ADQL 1T6WA 3QUYD 3O81A 5C0RL 1JGUL 2IQAB 2ZT9C 4HEMA 4KRPB 3IK2A 2H2SD 2R7EB 4NQEA 1D5MA 3V52H 4WGWB 4XBGB 1R3JA 2DEYX 1O9WA 3JWOC 4GXUN 5D7SH 1NBQA 1Z1WA 3FXIC 4IJ3B 5DYOA 4R7LA 5GZNC 2DEXX 1FDLL 1WDAA 1IFHH 5A2BA 2FQFA 2A2QT 2OQJA 4PG9A 4IM8A 2X4OB 2HRGA 5KVFL 1GGUA 2E7LA 2L4OA 5EIIA 3TF4A 5EFIB 1BD2E 3B9AA 3OMIB 5HHQB 4DP1X 1RUKH 4O4YH 1U41A 4GIAA 1NGWB 3ML9A 3TV3H 3H9ZA 4WW1A 5DURD 3EFDH 3KCPA 3QAZC 4PCSA 1RK1B 3L5XH 3HHSA 4WKZA 3WJMA 2IH1B 1ILSA 1DLHA 1V10A 3ARDB 3V5DA 2DMCA 3F3HA 3ZMRA 5B3JF 2WUBL 4UTAA 4NNPH 2WW8A 3ZHKA 1QUPA 3CHXA 3D9AH 4C59B 4BKSC 3RZCA 2SEBA 2G5BB 3SGDI 1UH2A 4DGYL 5I18H 5DUBA 5MERB 4U6HA 4MMYB 2P8PB 3RKPA 1HXMB 4CVXB 4F5CE 2CDFA 3PDOA 3TBTA 5E2UL 5JXEA 1UH3A 3FF8A 4FQQA 3F84A 1HI6A 4CU7A 5T3ZD 5KVDE 2MSPA 2W0FA 3T4YA 4HIHB 2P26A 5C0JA 3A0OA 1A4KB 1WA0X 4RMWA 3WE1A 1KBWA 1P4LA 1T0MA 2AQNA 2WXIA 5DEFB 2RCSL 3MLPA 3I9GL 3EOAA 1E3ZA 1SOKA 2WN2A 3HFFA 4PJ8C 1PZ5A 2NRDA 4PJXF 5DJAB 5F3BA 4ODSL 1D9KA 2G0LA 4PVMA 5FC9A 3RWCA 1Z9PA 5INDA 3ULVC 1CGUA 3QUKB 4PSRA 1L9OA 3DVFA 5D1QB 1WLHA 5C0BB 1M53A 1LGVA 3CFMA 3TESA 3MLSH 2ATPA 5D96C 3UZEA 3IDGA 2PTUA 5KWYC 1N0LB 3OJ2C 1AKJD 5BUPA 3RWGB 4HZLA 3A6CL 1NBYB 1Z9SB 3P1VA 4PJBA 4X8GA 2HKAA 2CJ3A 4MD0B 5DK2A 3NPSB 3U25A 1WG3A 1P7BA 3L4CA 1KFAH 3NEXA 4YIQA 4M6NL 3ZE2B 5BXFA 4GBXD 4N28A 4J2XA 2J5WA 1CXLA 2BIQA 3VFUA 4F9LC 4MCZA 1WZMA 1P7QA 5E9NA 3BAXA 4FFWD 5GGTH 2QQNL 1BAWA 4WCYH 1BZ7B 4AYDC 4ICWA 1WFIA 3STZB 2WBWB 4MA7H 1BVLA 1XEDA 2WYZA 3ABZA 3V0HA 3ZTNL 2X3AA 3L9EA 1U93B 3OPUA 1G5AA 3DROA 2AJ3A 4FABH 3QCTH 2YHGA 2OXHA 3SY6A 2JJWA 5FGCE 2D73A 1CG9A 3SBWC 1J1XH 1AS8A 5DCCA 5C3LD 3U0WH 1SM3H 5KS9F 3PL6B 4K4KA 2ZXEB 2H9GB 4UZUA 4NO5B 1LO3L 3QI9B 5FM5O 3TEWA 3L7EB 1QG3A 2Q3ZA 4J6IA 1L7IH 1KDIA 1VHPA 3OSKA 2QADD 1NAMB 3EFOA 1JE6A 1X6NA 2GK2A 4TUKL 3QWOA 1CYXA 3BEWB 4PYGA 1ZGLM 2J21A 1WFNA 5D7JA 3CJJA 3UBGA 4ZFOA 3BPOC 4BHUI 5C2BL 1AGBB 1CZ8L 2K6WA 5IHUH 2AXWA 2ZAGA 3FTWA 5I6PA 3MJ8B 1BXVA 2KZWA 2CU9A 3KWWB 4MJ5A 4W9DC 4ES8A 4YS4A 4H88L 2PLTA 1T83C 2GJ6D 3UJTL 4XO9A 3HB3B 4MJ6A 4K2UH 5E0FA 3E2HB 5EWIL 4A2MA 4N2AA 2ATKA 1GC1L 4ENED 2ZTBA 3FTVA 5CKAA 1IV8A 1BECA 5D1XD 2IH9A 2I26N 4OZGF 1FGNL 1R24A 4PJ9C 5H4ZA 1XB8A 3OPZL 2XA8H 3CC5A 5ICXA 1XEUA 4DERA 3H85A 2F19H 1KY6A 1T22A 4HS6A 4P23A 1LE5A 3B2VL 4KZ0A 4QCIB 3KXFD 4Z78B 1IEAA 2BSRA 1NPUA 2AQ1A 3PP4H 3NK3A 3SQOH 2GY7B 3FHAA 2WXRA 2KC0A 4XO3A 5TF1H 3NBNA 2IOMA 4AV0A 3L3IA 1BPLB 2OW6A 1P1VA 5DO2C 3ZMNA 4YHYB 2ED7A 2NCEA 3GS0A 5C08A 1K2DA 1NGQH 4U1SB 1F8TH 1LK2B 2OSYA 4LGRB 3RWDB 1HOEA 2WO2B 4JHAH 3HUJA 1KT2A 3HRZA 2YXVA 2AXHA 4KO5A 4D9LL 2RB8A 3CFDB 1AD9B 3BIBX 3Q2VA 3ARZA 2O6DA 4MD4A 1T21B 1JPFA 5ADPL 4I3GA 2CLRB 2WZAA 4HIEA 2X70A 3NVQA 1RIVH 2X4UA 3C09B 1UM6H 1ED3A 4JG1H 1I9IH 1NINA 3D39B 2J6EH 4XE5B 5C08E 2O5NA 3ZDXF 1B9ZA 3FBQA 1FZMB 1YJDL 4YGVB 3CQQA 3ZKQD 1Z5LA 2BSED 1F56A 3HUJE 4K8RC 3WLBB 3WN6A 5BV7C 2D8KA 4NRYA 3VXPB 4BZYA 3CBJB 1J5OL 1R3KA 4JFWA 3QUYA 4OZHA 5C0ND 2EUZA 1B88A 2E56A 3FB8B 1QSFD 3DO7B 3VFSA 1F4AA 1M2VB 2WXFA 1DBKL 3BCFA 4NRZA 1O6SB 3PNRB 1U8MB 1T4WA 2Q7YA 4QNPF 4JFPB 3ZLQC 1DDHA 4FFYA 2NT1A 1CF8H 1GOGA 5ENWA 4XNXH 3ETSA 3ZO0A 3S48A 2QFRA 2CPUA 5EZJB 3L3OA 3TYFB 3T6VA 1ZXQA 2HRPL 3MJGX 4RDQG 3QH3A 5J3HD 4OZHE 2IXQB 1BVZA 4U0QB 3SE4C 3ZYIA 1G7HB 4NN5C 3C2AH 1J5DA 1X5GA 4NN6C 3NCBB 1FNLA 5H94A 2QFPA 1DBAH 2JMRA 1HNYA 2NY2C 3S96A 4U1MB 3LKPB 3QBTB 2D3JA 4A2LA 3BSZH 3CVDA 5IMLB 5GZND 3SOTA 3G5YB 4PGBB 2C7UA 2VMJA 4NJ9H 3SKNB 1JRHL 1R9FA 2Z1KA 1X44A 2HFEA 4WRLA 2W07B 3FPYA 2C3VB 2H32H 4X99A 4E5XB 1EEQA 4RMTA 2ZOTA 1NIEA 3OKNA 5MP6H 3FUFA 2YARA 4L18A 2W9LA 4XVJH 9CGTA 4KXAA 4G80B 2V2WA 4FLQA 3OB0H 3UH8A 1QA9B 3NCWA 5HDBB 2YQ2A 3TIEB 3VI4A 1KYUA 3K6OA 1ACYL 1KJMA 3PV6B 1XF3B 1L9RA 3PWPD 4Z7WF 3D1MC 1IJ9A 3ARRA 3O2VH 2GITB 1M71B 2QTVA 1OY3B 4JQXC 1E8ZA 4Y4HA 3AXIA 4M1DL 3NIDB 1QFUL 4N25A 4NN7B 2GY5A 3TT1H 4JKPH 1G1CA 1RY7B 5F1OB 4PRHD 5L4FA 5GGSA 2WXJA 4UANA 1KPRB 5I6XB 3X1EA 4IBUA 1EUUA 2YC1A 4HWZA 2VLMD 1KXQE 2XZZA 4PWFA 1I1YB 2WIMA 1QRKA 2X2IA 5F7UA 4HVBA 4JO3L 1HESA 2IGFL 4O2CA 3MLVH 3JUYA 4GBXA 2Q87A 3U0TA 2O1AA 1FORL 2AQTA 4QTIH 4NWUL 4PS4L 1I75A 4PJ8D 2PWHA 3DYMA 2WLJA 1NDMA 3K72B 3ULVD 4KPHH 3F7YB 4QDGA 3UYPB 3T1FA 3NT0A 1MHEB 3O11A 1AQDB 1G1KA 4PJDB 3QZBA 2WXKA 4A67A 2VDRH 2YAEA 5EN2A 5FLVA 4JFDD 3RWEB 1QACA 3I6GB 3FU6A 2IO5A 3IPBA 5HDQL 3MRDA 4L3EB 3BKCH 1ZEAL 3VD3A 2VZVA 3MRGA 5HYJA 2X0VA 4NENB 3AXHA 2G9KA 3TBBA 5IW6B 1XQ4A 4M6OH 5ECJE 2N3JA 3JTSA 5EC1A 1ZGLP 1PCXA 3HZYA 3IFPB 3NAAL 3NJKA 4WWKB 3MRLA 1W16A 3QIWA 3L08A 4HS3B 1PEWA 2GTQA 4N24A 2FX7H 5CSZB 4LDEB 1NTDA 1P4UA 5DO8A 3MYZA 3US1A 3P30H 1GKEA 1AMYA 2F7RA 5T1DL 4G7QB 1WBYA 5AVQB 1L0QA 2VDQB 3FB6B 4HKJB 1NGZB 4FG4A 4V33A 1MFCH 2QDWA 5EF2A 2UUDK 1ZA6B 4FOMA 3U82B 4FYQA 2A9DA 4YPGB 5J12C 2BVYA 1FZOA 3QFJD 2GCYB 5FF6B 3P0YH 3VRLF 1TITA 3SDDB 2VRQA 4NNXB 5D1XA 4PGEA 1I9JL 5BOZG 5HD8C 2R23B 2HWZH 4X6CB 4DAGH 2JI3A 2NY4C 1RVFL 4BH7B 2UZXB 1WTGT 3AZUA 3LRKA 4ZS7H 3NIGE 3C5SA 3Q5OA 4MXQC 2E6JA 3CFEB 5CLXA 3SODB 5EEVA 5CJQH 4HT1H 3KXFA 1ML0A 1ZLVH 2AXFB 2UY6A 3AB0B 3QUXA 1BBJB 3GUFA 3HE7A 2AEQH 1Z0MA 1HSAA 1I1FA 3MLZH 1JFQH 2BY3A 4X5RA 4B95C 3U2JA 3WS6C 5EUKA 3NSDA 1B9KA 4IRJC 1KJ3H 4KJQD 2C9RA 4XBPA 1QPXA 4LLMA 4NC2B 3SE8H 4H26B 2GFBB 5E5LA 4PJ9D 1ZHNB 5T33H 3QA3A 4I4WA 1ODAA 2W9DH 4IU2A 3ZHLA 4DZBB 4LPUA 5I1JH 3KHOA 4EN3C 4L1DA 4MJ4A 2G2PA 3SZ6A 5EU4B 2IEPA 3L3GA 5DS8B 2MPAL 1JGIA 2BINA 1OAJA 3N44F 4E9XA 1HH9B 1E9QA 3N3EA 3SGJA 4FYTA 1DDTA 5DJ2A 1F2QA 2A6KB 3SJVE 4I77L 3WY2A 2VDKB 3HHMA 1G9NC 3RWJB 1ET8A 5FIEA 3CZLA 3K6SB 1CDCA 1FCGA 4HF5L 5I8CA 5K59E 1WEJL 4OLVH 4D0CA 5DO2D 4FJYA 3BKMH 1DQMH 2LU5A 4L0ZA 4BUGA 1OF2B 4G9DB 5F7EL 2BSEA 2XPGB 3HNTL 3O6LH 1CJYA 4QHNB 2PPEA 4HAFA 5ESAB 1NCBL 5LBSA 4NZTH 5ACMA 3MBED 1HVXA 2QVIA 1VJSA 4U1LB 1H5BA 4UDTB 5GZOD 1FLRH 2GAZA 1E5BA 2FWUA 4HEPA 4QF1A 2MCG1 4FF9A 3FT0A 4MDJB 4U0RB 3PREA 5AG8A 3VI3B 2BVTA 1S9XA 4RGMB 3ORJA 2RALA 2VDMH 4PMFA 1XGUB 1KENH 4Y9FA 4OFDA 2KZ1B 3ZKXC 3LPGA 5EU7E 1ZT4B 1HHGB 1C16A 2G3ZA 3UTSA 4JK0D 3CTTA 1GGCL 3WG7B 2PTVA 4XCYA 4K8RD 1NPNA 1JNLL 1CC3A 4GSDL 5CFAA 2E27L 4NQCB 2BHZA 3JZ7A 1RPQA 5HGAA 1NL0H 3TBSA 1QEXA 3JWNE 4KITB 5IWLA 1A7NL 4AYFA 3IDIA 1B0RB 4ZUUA 3AJ7A 4FADA 1HL4A 5J1SC 1U30A 1ZS2A 3P3YA 2B20A 5FAAA 3FYIB 3VXMD 4OI7A 5F6IB 1FFOB 1I9RL 3QYCA 5F9JA 4HULB 4GT7A 1JYNA 1JMZA 3UTSE 4DEPC 4UTBL 2VIRB 4Y1AD 4J8RB 4AMXA 2Q5BA 3HBZA 4YHZL 5E1IA 4ODWB 4FGMA 5CHNB 5D7KD 3N5AA 3C8KB 3H2QA 4Z7VB 3ULSB 3QDGB 3B1UA 5A1AA 5D2NC 1WO2A 2NTFA 3MRBB 4O02B 2IPUK 4LSUL 1QFWM 1DSFL 1VSCA 5E94A 2OYLA 1KLGB 2NY2D 1RZIA 4F7PB 3PWPA 1UEYA 2JIXB 2FB4H 4OGAC 5C0EB 1TIUA 5CD3A 2ICWA 2GB2A 3AQZA 1IGCH 4I18C 2WTRB 5L2KA 4TQEH 2LHAA 4XNQA 1PX3A 4KHXL 3WFHA 3VWKC 3RDTA 4JFXB 3VYNA 5KSBB 3N0AA 4J5VA 4PGDB 1JI1A 3BUDA 3CFJB 3X3GL 1JZ3A 1NAMH 3L7FA 3V4VB 3T65B 3S35H 3TZVA 4KFMA 5AOKA 2ZE0A 3KLHC 4TNGA 3FCTB 4KV5E 1TCRB 3NIFB 4HIIB 1S7UB 5SWSD 2BP0A 2AK4A 2ID5A 2VC2L 4Z3GA 2FJFA 3ZTDC 4N2NA 3ROLB 2CGZA 1XBRA 5TE4L 4N2BA 5L2KE 2DM3A 4UT6L 5I1EL 1QEWB 1KV3A 2QVFB 4R4BB 4IW4C 3IPFA 5LBVA 5E08L 2XACC 3H1ZA 4PREA 1JF5A 1DCEA 2UXTA 3KLKA 2F58H 4M5SA 1BQKA 4XNYH 1M6OA 1AGCA 2GIMA 4KK9C 2BOCA 4Y16D 4WFHE 4X9IA 1T20B 1N5AA 3ALXA 1BOGB 3SCMB 2FH8A 1XZ0B 2PCPA 3H42H 2BH0A 4PJEF 3SDXB 1I3UA 2AK4E 3P9LB 1T5WA 1DQKA 3T8MA 1UWXK 5IOPA 1MFVA 4L29B 3QIUB 2MHAB 1CGWA 3A47A 4K55A 4LMQE 1Z2KA 3V4UH 2CK0L 2Q20A 4LHUD 5DD6A 3WKNA 2VJXA 3LVTA 4LRNL 2H7WA 3JBG7 1Q9KA 2QSCH 3P4OA 5C0GB 3UZQB 3KPQA 5B3JE 3TO4D 4J3WA 2JJTA 4ODTH 4PJ7A 4TTDC 3ESUF 3EGSB 3NP3A 3RAJH 4PG2C 4TULL 2XZQL 3T9WA 3K0YA 1J0KA 3VFRB 2HVKB 4PRAA 3QDMA 4ATTA 2DYSB 3TJEH 3RIKA 4WSGA 4A38A 3C8HA 3D52A 2WBJD 1IM9A 3ZL4H 1A3RL 2X38A 1IKFH 3QEHA 4UU9A 3WL9B 4F2MB 1DE4A 1ETZB 5I1HH 3FH7A 1J0HA 3UYRH 1ZWIA 1UZ8A 1Q0YL 1U8QA 2GABA 4DP4X 1SOXA 1CWVA 3S37X 2VDPL 3LB6C 4L37A 4PJ7E 3FCSA 4FZEH 2FIKA 2QELA 3KVQA 3SDCB 3O6KL 3BGMA 3GJEB 2V8LA 3C6LC 2DKUA 4GKNB 5AW2B 5HGGS 3PJLA 3A23A 4XB7A 3VO0A 2BK8A 3LZFH 1JPSL 5E8NB 2BMKA 3FCBA 4MASA 1J8SA 4F7CB 1R0AH 2NUTA 1VA9A 3ETBF 3D69A 5I66A 3OM3B 4IBQA 4NPJA 1KIPA 4X2UA 1L9PA 1SYVA 5HD8D 1WIOA 2NY4D 3OKOB 3P2DA 3JTTB 3JV4B 2ENYA 3RTQB 2M26A 2H6UA 3I6KA 2XN2A 1IQWH 1TSHA 4GSQA 4MXQD 4YVUA 4A6YL 5AENA 1T7VA 2ZG3A 4FZ8L 4WF7A 1TETL 3WE6B 1PG7H 1YEJL 3DIFA 2NZ1A 2WXNA 4BEIA 1ZPLA 1E28A 1S7RA 4ETYA 4LESA 2ENSA 4XN7A 5E56A 4B9YA 3SPIA 2G75A 1GYUA 1XF1A 2CM6A 2V7HB 4GXFA 4JDEA 5FYKH 1F6LL 3IE9A 4AGOA 4Y4KC 4IRJD 4CC0A 3S37L 1FZJB 1XF2B 3CBKB 1F2XK 5KN5A 1SUJA 3VA2C 1H3WM 5KS9E 1ANUA 1I8LC 3QPQD 3MBEA 1N9PA 3FQNA 5GZOA 4ODVH 5J11B 5HVFB 1UA7A 3T3MF 5KUMA 5HHPA 3EJUA 4MNQD 1AI1L 4LSQL 3MUGA 4OZGA 5H2BB 4E0RA 2V5RA 1XR8A 2E7MA 1PFOA 3E9UA 1N6VA 3RUGF 4X98B 5HHME 2D03L 4JKWA 3MQIA 1OAQH 5C7XL 4Q52A 4RQQA 5PCYA 2VUOA 4KUCF 1LEGA 1CGTA 1ORSB 2Y36H 4MA3A 1TEFA 2JE8A 2NNFA 1CXEA 5LHDA 4RMRA 2QSTA 4JNXA 1P1ZB 2C9VA 4X8JA 2IAMD 3T71A 4XX5A 4YBQD 4W9HC 1MI5B 1QW8A 5DQJB 1IRAY 2X1QA 3I3BA 3OKDB 1EUTA 4OZGE 3ARVA 1NC4B 1F90L 5EUOF 1JN6B 1RUAL 2Y1ZA 4D3CL 3DECA 4FCAA 2ZSVB 3BVWA 4FFVC 3L3HA 1LO4H 1ZVSA 3DTXA 1GS6X 2VO5A 3IDYB 4F58L 1PZSA 4LOVA 4LP4A 8PAZA 2JTYA 4PRDB 3LZPA 2ADYA 2CAKA 4JN1H 3MA7B 3KDPB 5IT2H 4I1RA 2J8UB 2Z34A 3DO3A 1JNHB 4G3YL 1XH2A 3QUZB 3W0WD 3SPGA 1KCLA 1JK9A 3OBAA 1AO7A 3K1DA 4GQ9H 2N7AA 2CCWA 2E9GA 3L1OH 3L16A 4G1MB 4HPYH 3REWB 2J5LB 1VACB 3ARED 4NQQA 4U6XA 1KTJA 4GIPD 4PBDA 2DM4A 4G7VL 4W6YB 4JM0A 2O6FA 1SN2A 3VDCA 2AV7A 2UWEA 2YA2A 2AJYH 1HHKB 5CS7A 3HG0A 4JDTL 1CE6B 3MUZ1 4XZ4A 2NY1C 2JV6A 1THCA 3H6AA 3G04B 4PLJC 1RJZB 4JFED 4P2QA 1HZHH 2N7SA 4Y9BA 1XGQA 3SYAA 1FL5B 2Q76A 3RG1C 2MTAA 1AO7E 5BS0D 2OMUA 5F7AA 4XCNB 3ZDXE 4L9LA 1KN4L 2XX0A 4QAMB 2LFEA 2CNYA 3VQLA 5KJ7E 1JPGA 4F91B 5JMRA 1BZQK 4LGPB 3NJMA 4HWUA 4R0LA 2D0FA 4ADIA 3CE1A 1NBVL 3PPEA 4OF3A 4KTGA 4HYTB 4WV1C 4PJCF 4XMWA 1PAZA 4E42B 3RGVC 3FQ4A 4PJ6A 2CWRA 1FG2B 2X4PA 4OCRL 4P3CH 5AEAA 1EMTL 3VH8B 1I7RA 4LLDA 4ONHA 4GUQA 4Y1TA 3AITA 3NRQA 4LQ1A 4FMKA 3HN8A 4P2QE 4Y16A 2H1PL 1BXAA 4JPIB 4TPRL 4L3CB 5FUOL 4QNPE 1BLIA 1YMHA 4TL4A 4ZW8A 4GSUA 1OB1B 3LS5L 1OPGH 4LSVL 4OGYH 1A7RL 4PLNC 5JQ6H 3H0TA 3R06B 4XRCA 5BO1H 1CD1B 4RWHA 4ZFFA 1YECL 2DWTA 3NFPA 2NY0C 4N2OA 4I48A 5A16B 5ICZA 1WTLA 2AEPH 2W38A 3OZKA 1LE9A 5D7IB 5HGBB 5ICUA 2RAMA 2CG9X 4MCYA 2E86A 4LEXL 1LO0H 1CTNA 4TM9A 3SY0A 2IDTA 4FNPA 3BAEH 3TO4A 4Z7NB 4KK9D 5EBLB 3HS8A 4Z7WA 3DX7A 4AQ1C 3RILA 2MEJB 3WELA 3GSNA 1EVUA 2BSSA 4JZNA 2JB6B 3RP1A 5EO1B 2WBJA 3VD5A 1S78C 2E9IA 1L6ZA 2Q6WA 2XN9E 1KPUA 4Y2DA 4R83A 4N2IA 5F1NB 1X9QA 4G8GB 4IRZH 3VWJD 1MCHA 4LCWB 3RVUC 2B4CL 4JM4L 4M4RB 3LHAA 3F62A 3GBNL 2VDKH 3ZUNC 3OLEA 4IMLB 2AW2A 4BQ6A 5IROA 1JCVA 3D85B 4YUEL 1CE1L 3EDKA 5BVPH 4H1LB 4U1HB 1WJ3A 4AVKA 3EBGA 5DHVA 4IHBA 4Z7WE 5CLYA 2CUIA 2XQYG 4FEIA 5E9DD 1JGEB 3IGKA 5DJ0A 5K9QI 1FNGA 1NCHA 3UPCA 4GYBA 2WVVB 2KH2B 1U2YA 3MUY1 3HNVH 2F18A 4OZFB 5GS0H 2JI1A 4G8IB 5C8JB 2DQTH 4Z5RA 2EVJA 4OUUB 2WUCL 4RGOH 4LEEA 2WM0A 4OZIB 2D0GA 2YOCA 4JM2F 5JTWA 5CU5A 1XT5A 4LASL 3N43F 1P2CA 4IEFB 4JG0L 1S7TA 3UJJH 3U0PA 1KV7A 2GUYA 3QJTB 4FYRA 1GTFA 4WHTB 2VSKB 1HCFX 1OP3H 1LEIB 2H0FA 2WC7A 2A9NH 2ZUWA 3CK0L 3C6LD 3WAJA 4WDIA 1UUNA 5DRWB 2NNAA 1XCWA 3IGAB 4GMSL 3BDXA 4JFSA 1WCBA 2Q10A 4NIYE 1NIBA 3IPEA 3GSWA 4GS7B 2CQVA 1E4WH 5CEZL 1INDH 1EAPA 1K4CA 4BJLA 1ZS8B 3QC5X 3U6RB 4FQ1L 2YMTA 1G9MH 2YA0A 5EIIG 1YN7A 1JP5A 5CSGA 5E6YA 4FG0A 4KTDH 3HE6A 1F4XH 4B7IA 2D7QA 4TSBH 1MVFA 1QD0A 4OV5B 3UPRB 4MNQA 4WFFE 5LDSA 1GIGL 1KCUH 1FPTL 4GP5B 1ZIAA 3QQ3B 5CZRA 3AG1B 3G5ZA 4KXBA 3FULA 3KDMA 3VG9C 4L1HA 2X3BA 4KVCL 9PCYA 1A7PL 3LRMA 1HILA 3LZNA 2XV3A 5EOTA 3RZWA 4NCC2 1N2RA 4O02H 3QISA 4Y4KD 4OQTL 4NQSA 1E4KC 3OKLA 3T0EA 4UOW0 5IVXF 2APBA 3S5LA 4KI5E 4CRPA 5FA3A 1BVNT 2IAMA 4M7LT 3N0PB 4KJWC 1O6TA 2ADFH 2F2HA 1N59A 4Q74A 3VRLE 2Y4SA 2DLTA 1BD2D 4ZW3A 5JOPE 3MRRA 2A3TA 5FA4A 3V0IA 1VKXA 3MV9D 4JANB 4NC0B 2OM5A 1N67A 2DQDH 3GYRA 1MW1A 2FJSA 3V4VH 2NPLX 3GZQA 4H13C 4X6BB 4KK8C 4V1DA 5TPWH 4AEHH 1DJXA 5ID0A 5FM8A 4QGYA 2EE6A 1GHFL 1NBZA 5IFAL 2HVBA 2XA3A 4FHJA 5K9QG 4Z3JA 3EDEA 1KXTA 1SDAB 1L7TH 4RAUA 1UXWA 2OMVA 5GGUA 3N1GC 4W4OA 5L8LB 4R7DB 3B9KC 3OMZA 4X5XB 1S7QA 5DJDA 3AREA 3D0VA 2PW1A 1PKQA 2AC0A 2EDLA 4HGWB 5DD0L 1U8HA 4FFVD 1MQKL 4J3OC 4V1DE 1VPOL 3KPRE 1IC7L 5ALBH 3F04A 5J9PA 5JHLL 4PWIA 5LQBH 2VERN 5AG9A 3J2PA 4HMEA 3O6FC 1J7VR 2H0PA 2H41A 4O2FA 1XR9B 4H0IA 1PDKB 1Q9WB 3LMJH 4JY4A 3OHXC 5KYYA 2ITFA 3RFZC 3MACL 4GO6B 4J3BA 5FKPB 1SDDB 4F8PA 2EYTA 4KK6C 2QSQA 1M3JA 2IANB 3WCYA 4J4PA 4A39A 2HN7B 4MMZA 3IMTA 2VOTA 3IWUA 1TFHA 1KBPA 4PCTA 1N4XL 4TLSA 4N3UA 4XNAA 1IIKA 2X9ZA 1BAFL 3OKMA 1B6DA 1A8ZA 4DGIL 5JW4R 4K07A 1XGYH 4DW2L 4JCMA 1E7UA 1MJ8L 3T3PB 4FTVD 4KMTL 5ID1A 2KLSA 4ODXB 5CUSH 5FWQA 2LW3A 5AZ2H 1ICTA 5CBAB 2VERA 4PVLA 4FXKC 5DWUL 1NKGA 5C0IA 1FL6B 1QTPA 4U1GB 4KKPA 2A6DA 4X9GA 3D51A 3EF7A 3RGVD 4IIQC 2ZYIA 5FXCH 5EN3A 1WCQA 3FFCB 4JHWL 4K7PX 1EAJA 3OC5A 3OXSA 3VXNA 1EWHA 2P24B 1K3ZA 1KB5A 4NRXA 2XG4B 4NO3B 1E5UI 3WXWL 3KJ6H 3PGCB 5BRZB 3SD5A 4HK3N 4MDIA 4NYLB 2BNQB 5FDWB 4ZUSB 2IBGA 3DRQB 2XWJA 1J5CA 1I1AB 2OR7A 4PU2A 1E8WA 5DU7A 5GRUH 3FU8A 1M7XA 4AMKH 2HT4C 2ZWKA 5IGXH 5EF3A 3P73B 1MCWM 3DOSB 3IDJA 3VWJA 2NY0D 3NMEA 1H8OA 4ELMB 4H5SB 3HLAA 2B5IC 3FT9A 4I3SH 3FRPB 1MAKA 2J1ZA 3ML8A 2YK1H 2BWQA 1IC1A 2GC4C 4JPWH 3TT3L 4L4VD 5T3XE 2CDEB 4JB9H 1TZHB 2AS5M 1Q4NX 4F15B 1TJGL 5CP7A 2GQHA 4OF8A 5CN3A 1YEFL 4BQBA 3BWUF 1KCRH 1DBJH 4M6AA 3GMQA 1Q9OB 5JIKA 3S34H 4K7PL 1OSYA 4LCCA 3S5YA 1SXSA 1JMXA 2E75C 3LNIA 3QRGH 4NAJA 2D2OA 5HDLA 3RVUD 3Q6FA 3VG0H 3V4PL 1D5ZA 3MBXL 1OV8A 2HRHA 4S1RL 4Z7UF 3VFNB 3HZMA 2ZWLT 4PS7A 1VEOA 5FKAB 1SFHA 1EEUA 3SPHA 4EVNB 5I1GL 4XXDB 4PGCA 4QRRD 4XWOC 1XV8A 4XXCC 1O5PA 3PWUA 3DGGA 1ZT1B 3AM8C 5DA0B 4AGNA 2OTWA 3IJYB 2X1XR 3QJFB 3WU1A 1RMFH 2DMGA 4GPVA 4RAHA 5TFSH 2XBTA 4PWGA 1KTKE 4OQ1A 3PABA 2WP3T 5D7LB 4HWBH 4EJ1C 3MJ9H 3A4EA 4XHJC 2Y1YA 2BWDA 2XTLA 3ISWA 4P2OC 4M00A 3L1EA 1CLYH 4PJEE 5EU7C 1QVOA 2XKNA 3QULB 2DH2A 4RVBA 3LKOB 3NGBC 3NFNB 4OLZH 3WNIA 1XGPB 4YHKL 3LKRB 1A4JA 2Y7NA 1FHNA 1FYTB 1IBDA 4YNYA 4LSRH 3VJ6A 1NCCH 2CXKA 5IQLA 5FCUL 1RL1A 3CU1A 3FUIA 2FNWA 3CSYB 3PHOB 4FNLH 4S2SB 4PY8I 2NX5D 2IH3A 1T1WB 4C4KO 3G6JF 4QHUB 4XX1G 4N8VA 3IS0X 2EDFA 4HKBA 4HWEL 1E8XA 1L4IA 2NYZA 3OKEA 3DWTA 4GH7B 1G6RL 4EI5C 3BPCB 3ZKNC 5I5JA 3B6SA 2ENPA 1SOQA 4TYUA 3ISRA 5JORA 1XSIA 2QPSA 2NCMA 3JV6B 1H0DA 4IDJL 1KELH 4OJFH 3ZDYF 4KJYA 3FAXA 1NUDA 1NM4A 1CFSA 5HDWA 2J8HA 2JJUA 1DFBH 1X7SA 5KVGH 3IFOB 3TJHC 2F7IA 1IM3A 3K8LA 4DQAA 3TBYB 5K9KA 2EDNA 3QO1B 2IDUA 2NY6C 3JVGA 2PYEA 3VGAC 5BMFH 1IT9L 3TP4A 2DJMA 3RY6C 2DTML 3LRSB 3EW3B 5DFTA 4NHCH 1UFGA 1T4KA 4N6RA 3TOPA 1JWSB 2WPGA 5AOJA 5FO9B 2BWIA 2CALA 2XWDA 3L6FA 3EFFA 2R4RH 3ECBA 5D6CA 3T8XB 5C6TH 2PWFA 3FO9A 5DTFB 1F1AA 3CPUA 2EEBA 1YY8B 4MNGB 1HWWA 2WSDA 3FFDA 3BUBA 3GNML 2K0RA 4A68A 2LAGB 4YZFF 4OLEA 4GW1A 4F1SA 2XWTA 4KK8D 1PGRB 5I0YA 1KOAA 2PYEE 1EXHA 2ZUUA 4PJHB 2BNRB 5ACZB 1E9OA 1IC4L 2XIDA 3BLPX 3BVNB 1JZ4A 5A40E 1J0ZA 3SDAC 1DVQA 3D0LA 1AH1A 5TE7H 2CHXA 3HC4H 3LEXB 2FR4A 3NDYE 2BSTB 3B9KD 4GRLA 1YEIH 3FNKA 3ARBD 1GYWA 1XIWC 2FYYA 5MEQB 2L8AA 2ZYSA 2VXSL 5CGYC 2QBWA 2YJLA 1XSOA 3GIZH 4JL1A 4M62H 5C71A 5AB1A 2IADB 3LHPH 2J8OA 1UT1A 3T3ME 1SXCA 2ARJA 2VR8A 3SE9H 1TEYA 3O6FD 7TAAA 2LVCA 3W9EB 4MZ3A 2R2BB 2A6IB 5IFHH 1DN0B 3HG5A 5C07B 3E1ZA 3RUGE 4YX2H 5CM1A 3JWDH 5F89B 5GGSY 5CZKA 2CR0A 3WKML 1XF5A 5GGRY 4FTVA 1UZGA 4L1BA 3K4DA 5KUKA 2A9CA 3MC0A 4H1LH 4UQDA 4H8VA 5GHWH 4XPFH 4GLRH 4NM4L 4Y8DC 2EXYC 2KHAA 3CAFA 1TJMA 2XWRA 4HFUH 4X5QA 2OJEA 1L6PA 1C08B 5FYLL 1INEH 3I02A 4ZD3L 4QRFA 5EU5B 5C6WH 1ZK9A 5EUOE 4J39A 3AU1A 3OXRA 3LN4A 4UMGA 4W9FC 2WB7A 3T0AA 1FSKC 4ZUVA 1PFCA 4JFZH 1NOFA 1NDGB 3N1FC 1QFWH 1FVCA 2BP8A 3EYOB 5CCGE 5ILTH 4JN2A 5DURB 1SGKA 3CX5K 3HS0A 4X4MA 4HIQA 5CF3A 4UQ2B 2GTWB 4WI5A 2F54D 3POCA 5FGBA 3WIFB 3MSPA 3EOBB 4S0TD 2Z65C 4IGBD 2W9EH 1USZA 4UTAL 4L2LA 3ULUL 4FQHB 4EQ2A 4LDLB 1JWMA 3CPLA 1W6LA 4A2DA 5B38A 1MREL 4IHOB 4L4VA 4U1NB 3W39B 5IMMB 2DLFL 1QWUA 5C86A 4X6EB 2WLZA 2FBJH 1MDTA 4Z95L 2B1AH 3RQ3A 4BFKA 5D71L 3HPJA 1RU9H 4YXHL 2FBRA 1CK0H 4LVHB 5IY5B 1AOHA 1PZCA 1OCZB 2AJVL 3HAEB 4YDLC 4AJWA 1AHWC 4RGNE 2HT4D 2VUKA 2B59B 4NDMB 2H3KA 3TA3C 1V7ML 1CFVL 1P7KB 1SQMA 3IJ9A 3CHQA 1FF5A 4LMQI 4NLAA 4DFIA 2XFXA 2OW7A 4NIKB 1J05A 4LF3B 5DR5H 4GG6F 3KBEA 4I5BB 2DYPD 2HVJA 3IKCB 4U6VL 1XD1A 3CSGA 1XMEB 2IV8A 4HEPG 1AKJB 2FSEA 4TOYL 5I76B 3LS4H 3JWNG 5DRXA 1KTLA 1A6WL 3MNVA 4GOSA 1WFJA 2WZ6A 2JQMA 5J06A 2BERA 3P54A 1N0XH 4JRYD 1D6EA 1NMCB 1QO3B 2APTA 4YLCA 5DC0A 3SPCA 5LCVH 1FRGH 4N85A 3X1NA 5DD5H 4IKKA 2EVIA 2PXYC 4GAJL 3UTTB 1ADQH 3ZX1A 4BM7A 3P40A 3SJVD 5C0RH 1JGUH 4UQEA 3EYSL 1NCUA 1USQA 3T4AB 4OVVA 3BT2L 4KVNH 2HT2C 1ES0A 2I9LB 4LLQA 4P2RE 1XB3A 4PTTA 4UQBA 3TV8A 1F18A 3GZKA 2ERJB 5IOKA 2X2UA 3ZT7A 1OSEA 4I0PC 3US9A 5C09A 1FDLH 1TU2A 4ZDHB 4RWYL 5I2IB 4XWOD 1AQ8A 1FIEA 2HX8A 5C0AB 3RIAF 4P3DA 4FQXB 3FTSA 3KPOA 5KVFH 2QTEA 5JDJA 5FW8A 4TVPE 1HXYA 4OLWL 2J7LA 3IXTA 1TPXC 5EO9A 3LEVL 3QUMB 3IXAB 1KCVL 3P2BA 4MJJA 3VXRE 5FUZL 2EE2A 4Y5VA 3E6FA 4AJYV 2WUBH 3DYOA 2WYTA 3KYOA 4JR9H 1FJ1B 3PCYA 4MHHG 1MCBA 4ZFOL 5FYJE 4MXWL 2YPLD 4NKIL 5C09E 4DGYH 4BH8A 2IGTA 1I8MA 1W0WB 3CXDL 4A63A 2O26U 4QHLB 3O4LB 4JM2A 1VADA 5AYTA 1YAZA 3GSRB 5E2UH 2VQUA 3BZ4A 5GRVL 1NMAL 4JGMA 3RYMA 5JQHC 3VRIA 1BVKA 4YSRA 4UBDD 2FATH 1UD5A 2GIYA 2WKOF 5FYJU 1CCZA 3IN0A 4X7DC 3UG3A 4NSKB 3MA9L 4G5AA 2RCSH 1UWYA 4Q9RL 3PWLB 3QQ9C 4NCDA 4Q7DA 4U6YA 2DICA 3D87B 2IBBA 2QPDB 2R0LL 4Q6IC 3VFTA 4EI5D 4NLHA 5AB0A 4KRLB 2Y25A 4ODSH 3ZKND 3T2PA 3QNZB 3UMTA 4NM8L 5I15L 3OJDB 1BQLL 1MIML 2OMWB 4FQPA 2OMTB 4YAQB 3QNYA 3AT9A 3NQIA 3TJHD 3QFGA 2YAMA 2V33A 2DQFA 2NY6D 4NQXB 3DBXA 3LKNB 3VXOB 5CEYA 4OTXL 3MV11 1IC5L 2J57A 5DFAA 1X7QB 4F7MB 3RE0A 1IL1B 4JW3A 2QQNH 5B4MC 4F33B 2ZUXA 2J1XA 2Y07L 4F3FA 3ARBA 1VFAA 2JKLA 1IX2A 1YAIA 3CCHA 1ETB1 5IVXA 5F97E 4M8QA 3ZTNH 5IJBC 1Y18A 2YAPA 4WW2F 1X5MA 2VSMB 4H4NA 5CLTA 2H6PB 3PS6A 3GSQB 3WKYA 4URKA 5KJRL 3OLGA 4XZUB 2Q86B 4KZEL 1WT5A 3SO5A 2LOEA 1UWEH 3U79A 1RSFA 3MYJB 2W60A 1LO3H 1UB6A 3TIDB 4IJ3C 1JL8A 2NNXA 2ZONA 5DQ9B 3SDAD 4G6AC 5AD0A 3ARWA 4YE4L 2HLAA 2MIZA 1SY6A 2FECI 4R26L 2CK2A 3P2TA 1RUPL 3DJRA 4TUKH 1UOKA 1WQVT 1QSFB 3W9DB 4HV8B 2MNUA 5TJWK 5IVXE 5IB3A 1XIWD 3N1QC 2CJTA 3V5KB 1CZ8H 1NFIA 2VC2B 3FTZA 2CBQA 3C12A 4U4BA 5CGYD 1D7DA 1CR9L 4NQUA 4PJGB 3MI6A 2P5WA 4PV9B 4ZQKA 1P6FA 4H88H 2E59A 3UJTH 1ZHLA 2Q2LA 4FFYL 1L0PA 2ZX9A 1TQBC 3MBWA 3IJ8A 1ACXA 4X6FB 1J48A 3A6BL 1FGNH 3L3JA 1J0JA 5ANME 2PO6D 1A1OA 3A4AA 3L4ZA 3O2DA 1QNIA 3OPZH 4PRBB 1T89C 1YSOA 2F54A 4IMKA 1AR1B 1F4WH 1INQA 1CDGA 2YPKB 3LNHA 4IGBA 3OG6B 5EU6D 2P5WE 1FGVL 3THML 2VW6A 2EXYD 4N9GA 2YEZA 4AC4A 5ERWA 4OM1L 1ZLWH 35C8L 4NOFA 1LO5A 12E8L 1WGVA 4D9QD 2XVGA 3WNPA 2EXWC 4JY6A 5HY9A 4AYEC 2VLKA 1NWOA 3M45A 1F58H 4AQEA 3KPLA 1Q94A 1ZA3A 4PJ5A 4M5ZL 3TH3T 1TZIB 2VAAA 3AY4C 3QAZB 4BCXA 2D7PA 3ZR5A 3QR0A 3C60C 4YSEA 4D9LH 4G6FD 4JRXB 2HG5A 4AT6A 1XF4B 1AC0A 4QRAA 4L5FE 5ADPH 3L5HA 3FQWB 4AQ8C 2F8OA 2GJZA 4JRLA 1ND0B 4EKJA 4TV3A 3KBFA 2I07B 4QKTA 5EOCJ 1EZSA 4PRHB 2VLKE 4HC1A 5D9SA 5DF0A 2A6JA 3GHEL 3NN8A 2VDPB 1QOKA 4ESKA 1DUZA 2EDRA 3LIZA 4FQCL 1YJDH 3RBSA 1QLFA 4XGZB 5LWYL 2OK0L 3MX0A 3K7UA 1EEYB 4NHUB 1TVBB 1NGXB 5LXGH 1AIFA 3PY9A 5AOZA 1J5OH 1AGDB 1M9WA 1NLBL 4RMUA 2E4TA 5EG6C 4PJ8B 1PZ2A 4DVBA 1Z32X 4UWQB 3TA3D 4B0MM 4GUPA 4XN9A 4LKXB 5IMOB 1DBKH 4ORGA 4BK5A 1E2ZA 1PS3A 3SKJL 5BOJA 3PL6C 3SQBB 4UOW1 3ARFA 2OL3B 5D96B 1TZAA 2DWEA 3A3YB 1ZDQA 4W9IC 2DQUL 3VXUD 4B3VA 3LNGA 4HJSA 4KBPA 5FO8B 4JKNA 3UBXB 4PJIA 2NNRA 4QXGL 5AWNH 3B7RL 3GSOB 5KSVA 2OTUA 2DMHA 2Y7LA 2XV0A 1HINL 3KYMB 2HRPH 3OLDA 4WAFA 2Y5TA 3DGCR 4HLEA 1W91A 5CGBA 5AQ0A 4DKEL 5JW5B 1FH5L 2PXYD 5FUCC 1BF8A 3MJ6A 1QHOA 3MR9A 5AL0A 3GKWL 3E2HC 2HT2D 2ZPKL 4D7PA 3MCYA 4GQPH 3OAYK 4UM8B 5DVLA 2O5YL 1KSRA 5F8QC 5BQ7A 2BCKB 2F7PA 2OS7A 2PPFA 1A7OL 3DMMC 1JRHH 3D4GA 3VGEA 2YD0A 1CFQA 2EYRB 1G7MA 4ANKA 5E5MA 5IJDC 5JPMC 5ISZB 3GSXB 4P3WA 4Q89A 5CR8A 3QFJB 5ADOH 2C4FT 1CICA 1X5XA 1TYEB 3Q2NA 4J23A 1I7UA 1SF3A 3FUEA 3GRGA 1P53A 1ACYH 3TS8A 1HNGA 3DRTB 4FL4C 4EMZA 3EO0A 2E5EA 2P5EB 5HGHB 1JPTL 4YHYC 3FOMB 2DM7A 4K94H 5K5YA 1JZ6A 2ADJA 4QRPB 4Z9KB 3V10A 4M1DH 1QFUH 3RNQA 3CX5J 2GYSA 4QRSB 4LFHD 4X4ZA 5JDSB 2AQSA 4PWHA 4BFOA 3OR6B 2R4SL 2BVUA 3IDMB 4JO3H 2IGFH 3AABA 4G43B 4PJ9B 4YL9A 5DI8B 1FORH 3QQ9D 4NWUH 3CN0A 4E68A 2F1AA 1HAUA 4PS4H 4W6XB 4YQXL 1XL4A 3CH1B 3BYTA 1TENA 3ZGIA 3AT0A 1JG9A 5LNEA 1HS6A 3EDDA 3NQKA 2NLJB 3FQUB 4PJAB 5IW1B 1U42A 2PKDA 3STLB 3QZMA 3DVGA 3OL2A 2VDOB 3LDBC 1CXIA 4PWKA 1CDJA 1MEXL 4RRPA 3LZRA 4YSPA 5IV2B 1A8JH 4R5VA 4X4YA 2VM4A 5A2CA 4F2EA 5MEOA 3TU6A 4K5NA 4RAVB 4WUKL 5HDQH 5CZVL 3RRQA 1OEZW 1ZEAH 5HHOE 4WUUD 1QQDA 2KL6A 5BVJA 4NUJB 1NSNL 3CHSA 3FJTA 1BX2A 4ONGL 3IGFA 1XFPA 1PL3A 1FQ9C 1UG9A 2N4IA 2LAAA 5DJCB 5LBSL 4OCYL 1KIRB 5B4MD 1OM3L 4YSAA 3P4LA 5D93C 2ARJQ 3KL5A 4XXWC 2ZG2A 3N41B 5T1DH 1V5JA 5DK0A 1VFBA 3SKOB 1UB5B 3K5SA 2IVFC 1J8HA 3V4LA 2FL5A 4GB9A 4KRPD 2AQQA 4RSVA 1DLFL 3VGFA 4D7BA 4JDZA 3ZDYE 3H3BC 5E0QA 3CN4A 3FB5B 2OKMA 3X1FA 2PO6A 1WUZA 2CO7A 2VUYA 3KD4A 2GK0B 2OMYA 1NFDB 1IVLA 5SWZD 3ESPA 4CVZB 1W0VB 4W1TA 1TNMA 2OAAA 3M1CA 5HJGA 1VESA 5TD4A 4APXB 4N2GA 1J8HE 2E76C 2XXGA 2J6EA 1XZWA 3PHAA 5DXWA 1NANH 3LXAA 4HAKA 2QKIC 3EO1B 3BHBA 4Y1AB 3GSUB 2DWDB 1LK3L 3V0DA 1S5HB 1K3IA 4YZFE 3F7QA 3QZWB 1FFNB 4KKAC 2YUXA 2VDLL 4IS6A 1F41A 3UDWC 1E3XA 4NN7C 1S7VB 4X50A 4ZS6C 1X5AA 3OZ9L 4G7YL 1XAKA 4NN5B 4NN6B 4JVPA 3LZLA 4N0FA 4RIRB 4FA6A 5DUPL 3CSBA 2MPAH 2NY2B 3HVNA 3M8OL 4BFGA 3T77B 2MKLC 2WWKO 3IE4A 3MV8A 3WUWB 1EEZB 1P6WA 3SQRA 4WJ5A 4Z7OE 4C56E 2CKBA 4I77H 1WH0A 5B8CC 1UGNA 2JK5B 3A24A 4GNKB 2EXWD 4LAJH 1ZANL 2A77L 3DURA 1WEJH 1BQHA 2K78A 5AW8B 1UM4L 4BZ2L 2BJML 4ONOA 4J3XA 1MRDL 4Q4IA 5D1QD 5F7EH 1S9YA 3HNTH 3GHPA 2BHYA 4KNTA 1NCBH 4NPKA 3P11L 2VITB 1W2KT 4NERA 5DD1L 3DVNB 1ORQA 1ZLDA 3C60D 4QRTA 2P49B 1FA4A 4WGVB 3QAQA 3S5LG 3BSZA 3VRJB 5HPOA 1U21A 3KYNA 1KZQA 2DD8L 3T6WA 2QZ5A 4NKQB 4F7EB 4X5LA 4R7NA 4RX4A 2FVNA 4Y19B 5C0CB 3UAFA 4BK8A 1BBDL 2A1WH 4XMTA 3BZDA 2H32A 3VXUA 5GRYA 4N1EA 4RDQF 1KY7A 5EC2A 4KK5D 1C8PA 2APSA 1TJHL 1GGCH 5IB4A 2OSXA 1EAQA 3UTZB 1GZPA 5ICYB 3L4YA 1JNLH 1SMDA 4WFFD 3DLQR 2E27H 2WSPA 3WUZA 1JVOA 1S8DA 1JHKL 4GRWF 3CDZB 4LCYA 2F53A 2FX8L 2E8ZA 4LHUB 1NUGA 1KIQA 4U6TA 1A7NH 4OVUA 3LKSA 3ETTA 5I19L 5KVMC 1MH5B 3PL6D 2BY0A 3S8GB 2VXUH 1UKTA 3Q13A 5JNYA 1TG8A 3VFOA 4M3JA 1WBZB 3SDDC 1I9RH 1GOFA 5IF0B 4DVRH 2A74A 4WWOA 4UTBH 5B3NA 1H8LA 1KB9K 3HG1B 3LAFA 4YHZH 4TMPA 2WJ7A 1GSKA 3D09A 5D8JL 3LRHA 2RD0A 4MAUL 4I1PA 4GG6A 1UQSB 5DQDL 2B0SL 3B5TA 1XSJA 4DQOL 4OU3A 5F7DA 4D94A 5I1IL 4JQVC 1MIEL 4KKQA 4LSUH 1B4RA 3D6GA 1DSFH 3M88A 1P5UA 3AU0A 4KKZA 2FWOA 3PWVA 2AZAA 1YN6B 1H3XA 3MOAL 2HFFB 3SGDH 2ZCLL 1IQDB 3H7BB 3UC0L 3X14A 3AGVA 4DUVA 1E90A 4LVOC 3H2WA 2FUQA 1GJUA 2XWZA 3DMMD 4KHXH 1MVUB 5J57B 1CFNB 3IGUA 4H25B 4GG6E 4BFJA 1R34A 3W1ZA 5J12B 4HZ1A 2QQKL 3IETA 2Q7NA 3ZE0B 5DRNB 3APNA 3WO3B 4ZPVB 3KPRD 4UQ3A 4K7FB 5TTRA 1MKFA 3PJNA 3P69A 1OALA 2B1HL 2VC2H 2VABA 2VL5A 5D4JA 5ALCH 1OPOA 5TE4H 4XMLL 2WKGA 3QNXB 4E9RA 1AHMA 1OTTD 3TN0A 1RJYB 5I1EH 3ZUCA 2FIRT 1MHCB 2H5UA 3BP4A 5CN2A 5I9QC 5E08H 1OT1A 3CX2A 2JSFA 1XWVA 1DEDA 3MRNB 1FO0B 2YRLA 4BFNA 1XCTB 1D5BA 4HOMA 5GS0C 2A83A 2JWYA 5F6HI 5A3IC 2Z4QA 4WNQB 1SLXA 1E42A 3VE0B 4IRJB 2HT3D 2V5SA 1J9CT 4U0RC 3V55A 4WUUA 1K8IB 1U8LA 3D2UA 4X5WB 4ETQB 5IVNA 2FRGP 4DETA 1KYFA 1V3LA 2CK0H 4POZC 2EZ0C 3D39D 5LDUA 4EN3B 1MQ8A 4B0MB 2YD3A 4L4TB 1ID2A 4KMLB 4LRNH 5F3HB 3HNSL 4HLZG 4D8PA 1DJYA 2WKOA 2PWEA 1OP5K 2OZ4A 4NJAL 3TFBA 1A9EA 3GK8L 4I89A 3L3DB 2KDYA 1E6JL 2YAFA 2UZPA 1N12A 4X83A 4F20A 1U4EA 5JQIB 2IQAA 4TULH 2XZQH 4LIQE 4QRUB 1HXKA 4AK1A 2R7EA 3BI9X 1IZJA 4XBGA 3F8UB 5E9AA 3VYOA 3J27A 1R5VB 1A3RH 1S6NA 4OF7A 1OXYA 2CO6B 1K9TA 5E8PB 2FECL 5E2VL 5B1BB 1N70A 1KLUA 4DPRA 1Q0YH 1NCDL 2X4OA 2ZOWA 1CF1A 2DH3A 4NAQA 5HYSG 3NCCB 5EFIA 5HHQA 2VDPH 4P04A 3H9SD 1GAFL 5IUCA 1FZKB 2VH5L 5MENB 2JCCF 2DQ6A 1NGWA 3H3PH 3O6KH 1EHKB 1R3LB 4RGNC 5FYKD 1RK1A 3ZKXB 4DCQA 2IH1A 3ARDA 5DEJA 1JPSH 2PR4H 2UYLB 2HJFB 1RQ5A 1MCOL 2Z31B 4UZSA 3QXDB 5EMYA 4TNFA 2H1XA 2G5BA 4WW2A 4GW5A 1VCAA 1YUKB 3OX8B 4MMYA 2P8PA 2DDQL 1HXMA 3CFCL 4CVXA 1AQHA 2OL3H 1ZLSL 3BFOA 4QLWA 4AOFA 4Z1PA 1NC2B 1MDAA 2HSIA 1J9TA 2Y6SC 4JUTA 5CJXC 4HIHA 4FZ8H 4AVJA 4BUHA 3TCLB 3GFUA 1YEJH 1A4KA 5BNXD 1UWFA 5TE6L 5DEFA 5IBUB 1SEQL 4NFBA 1I9EA 2EICA 3QHZH 4DEPB 1BXUA 1PLAA 2NXZC 5D2LB 5DJAA 3BIKB 3F5WA 4ZSOE 4N8UA 5TK4A 4HXAL 3S37H 5BS0B 3QQXA 3QUKA 1OB0A 4KKAD 5D1QA 5C0BA 1AZNA 2UXGA 5D2NB 4YSQA 2VM3A 3KJ4C 3QJSB 4F92B 2NR6C 3AMKA 5FO2A 3RWGA 1TVDA 2Z93B 4N8VG 2VYRE 1NBYA 1Z9SA 4S0SD 4TQIA 1T2JA 3VQ2C 1ADWA 4LLYB 4P46B 2EH8L 3FT4B 3I84A 4N2LA 4WFEE 4BCYA 1U8KB 2Z7WA 4LSQH 3RVWC 3BDYL 1CT8B 4I18B 1TVHB 2K3HA 4IYKA 4UIMB 4JFHD 4E41D 3GWJA 4HCRH 3QIUC 3VWKB 2D03H 4V2BA 2G5RA 43CAA 5C7XH 3CFBB 3HN5A 4DOHB 1PX4A 4KGJA 1E9PB 1G1YA 1R75A 5AL8A 1I31A 3K74B 1BZ7A 3O41B 4NOBA 5C0BE 3S3SA 2VLJB 1YNTB 3STZA 1UH4A 2EEDA 1N26A 3FK3A 3LYRA 1UD8A 1V3KA 3ECVA 4HJUA 4N2CA 1U93A 1Q9LB 4OFVA 5T5NG 1TQSA 4R96A 4AIXA 1BZ9B 3HI6L 4G82A 3QS3A 2FE0A 4DKTA 3CUPB 1F90H 1RUAH 3B5HA 4HLJA 4D3CH 1EH9A 4L3ED 3RWIA 3MKGA 2WVUA 5F9OL 2H9GA 4F58H 2ZIDA 3QI9A 4L8SC 4AKPA 3L7EA 1MCKA 2FHCA 3NJNA 4MJID 1EFXD 3V9CA 2X6AA 2WQ8A 3BEWA 4X7TB 2D3NA 4YDKL 3AUVA 4G3YH 3OWRA 4Z76B 1QNZH 4GT0A 1JYXA 3GSNL 4PP2A 1AGBA 1E5AA 1PIFA 3EADA 3MJ8A 2DQCL 1LEKA 3KWWA 4M93C 3T04D 4M1GL 1VAHA 3MJ7B 4LNRA 2YSSB 5DS2A 3BH9B 1W8NA 1IVTA 2VDOH 4EUPB 2DF3A 3FU5A 2AMUA 3W82A 4G7VH 4I88A 2AZUA 1G6RB 3SDDD 4B9ZA 1EO8L 3L45A 1BWMA 1SBSL 2VW7A 4JDTH 3PAYA 1OQXA 3GJFB 3VFMA 3F6JA 5E9DB 2JXMB 1IGTB 1GRWA 3WHXB 3C5XA 3E7JA 2BPBA 3U1SL 4K3EL 1K72A 2VN3A 2IOIA 2VW4A 4ADGA 3BLKA 4QCIA 3ZN6A 3C87A 2QQLH 4Z78A 4WK4B 3Q05A 2HMIC 4M02A 2JKNA 3KE0A 4JX0A 1KN4H 4K9EC 1NAKL 1WS8A 1KN2H 3BAKA 5JPNC 3CZSA 1OW0A 1V8HA 2QPUA 1OK0A 3AG4B 5LLIC 2AJUL 1MNNA 2ZSWB 4Z0XB 3LH8A 1NBVH 2PCFA 4QPEA 2C9QA 4PTUB 3E1F1 3WJLA 3D18B 2YWYA 3EZ8A 4PPTA 5GGQL 4OCRH 1LK2A 2YEQA 2ZYRA 3C6LB 4HETA 1DYZA 1NA8A 1OAXL 3WKPA 1T66C 3MXVL 4HMDA 3SGEI 1YRKA 5I6MA 2W1NA 4TPRH 3CFDA 1AD9A 3S6CA 4DGWC 1MNUL 1T21A 1TEGA 3LS5H 3WIHA 1A7RH 2I24N 2CLRA 3BUTA 4H8UA 5I0VA 2EO9A 4W9GC 4YL4A 1HL5A 3RJOA 1GCFA 3A21A 1G7JB 3UCRA 3D39A 2Z35B 1TNNA 2RIKA 2MNWA 1JHTB 3H9YA 3O3EA 4KHTH 1FZMA 4YGVA 1N64L 4ERSH 3NCJL 3RHWK 5M94B 5F0LB 4LEXH 4RBPH 4CC4A 4ILDA 3WLBA 4OIFA 2E8YA 4JFOB 3VXPA 1RPUA 2CNZA 2PETA 1S46A 4G6KL 3UP6A 2E9JA 4HJGA 5AAWA 5GS0D 3V6OA 1PD6A 1A1MB 4YSSA 4OJAA 3FB8A 5A3ID 2WQVA 3ZJAA 3BGFC 5B38G 5JLZA 3DO7A 3S97C 1M2VA 4Y4KB 4YDJB 4RZKA 4M7JL 1O6SA 4UNUA 4DNLA 5L2JB 2G9HB 2Y5QA 1U8MA 3WDHA 1CFTB 1T1YA 1FIGL 4JFPA 5EULV 4POZD 2EZ0D 4OGQC 4JM4H 4QTHB 1PKOA 1XGRB 2VJ0A 1NCJA 3GBNH 4UM9B 3NACL 1BD2B 4FFTA 3WDIA 4JZJA 5EZJA 4AQAB 3TYFA 4EDWL 5LGHL 1CE1H 2VLRD 1MJUL 3KPSA 3MV9B 2OSWA 1HX0A 2FD6H 1TTCA 4HP5A 4NQCD 2IXQA 2P9RA 3V6OE 4UAHA 1GW0A 1OP4A 1FNFA 1G7HA 3W57A 3T2OA 4CNIA 1E6OL 2DW5A 1DQQB 2WTPA 3RWFB 2YMXH 2MH4A 3HC0B 1E5ZA 3LKPA 5BW7C 4U05A 5AFAA 3N6YA 2DY2A 3S36X 2YQ3A 5CU9A 4H0GA 3REVB 2N1TE 2IFFL 3DDFA 5IMLA 2JLPA 3FT3A 2B1OA 3G5YA 4LASH 4PGBA 3LD8C 4JG0H 5IW3A 2O6CA 2C3VA 3KPSE 4HJJL 1KB9J 3H8NA 2VZOA 4F37K 4UT9L 1T7XA 3QDGD 3E8UL 2J2ZB 4XHQA 4DSYA 2GC7C 4G80A 3CK0H 4RGND 4KQ0A 3DX9B 2KYIA 3BGAA 1QA9A 3TIEA 3QNFA 1OTSD 3RZCB 1DJWA 4GMSH 4DP2X 4P06A 3PAUA 3TPKA 5CEZH 3PV6A 3RX8A 4YSDA 4XN5A 4LDOB 2QT6A 5DJXB 3IFLL 2R83A 5TH2B 1PJ9A 2GITA 1M71A 3TEUA 4FQ1H 5LJYH 2UZYB 1HI6B 1IEBA 1IKNC 2GG1A 4HJIA 4P4KC 2W0FB 4S1QH 2XCMC 1KPRA 3GB7A 5KTEL 2DQGH 4PMEA 1T0MB 3ROOA 4ZG1A 2XTJE 2Y6SD 4ZX6A 1EDHA 5J89A 1GIGH 1I1YA 1FPTH 1V3JA 2EDQA 5E70A 5E1AB 1BG9A 1L3WA 3S36L 3U83A 2D9CA 5JHDE 3B83A 3QWRD 4H8HA 4KVCH 2HLEB 2NY1B 1DQLH 4U4IA 4ZNEA 2NXZD 2DQEL 4DPCX 2CR3A 4B97A 4OQTH 2QDVA 3K72A 1P9MA 4UCFA 4X6DF 1OK8A 3F7YA 3RY5A 3UYPA 3DC0A 4O58L 4WY7L 3II1A 1MHEA 5GJTL 5B21A 2HH0L 1AQDA 4PJDA 5FGCB 1V3MA 2UV3A 2A9ML 2NR6D 3CNKA 4UYQA 1ZSDB 2BVPB 3RWEA 5MEPA 2QJDA 4QAWA 3OZLA 3SCMD 4WV1B 3I6GA 1P7QB 1SHWA 3RGVB 1BZ8A 4KJPD 4L3EA 1I53A 4ZPTB 4KOBA 5T1JA 3ILQC 4ZNEE 2J12B 3FU0A 3QIUD 4NENA 5IW6A 1S9KC 3D0AA 4WWKA 1KB5L 5T3XL 4HS3A 1GHFH 5IFAH 3BP7B 3GC3A 2X12A 5CSZA 1DVTA 2KERA 3APFA 3OAWA 3ZOAA 4ELKB 2AJ3B 2XETA 1ZE3C 1AD0B 2HFGL 1U8PA 3A22A 4MQXD 5B1JC 3IU3B 1FFRA 1G9HA 3FB6A 4HKJA 3ZDWA 4Q97A 1NGZA 4CJ1A 1TTGA 1D3CA 2Y9RT 3PQYE 2K70A 1NKOA 2BXYA 1OZTG 4Q9CA 1ZA6A 2YGNA 4YPGA 1EDQA 3DXAE 1VPOH 1IC7H 5A2IH 2GCYA 3D4YA 4HJ0C 4ANWA 4ES9A 5JHLH 2BIPA 4NNXA 4JO5A 4G5ZL 1CDBA 2WYHA 4ZFOB 3L5IA 4X6CA 2WKLA 3F58L 3ARSA 4AQ1B 4HQQL 2IPKB 4Q14A 4AZUA 8FABB 1SDYA 3H9HA 2IDSA 3TWCH 3UABA 3LN9A 3CFEA 2V17L 1NIFA 4RH4A 4XNMB 1ITBB 2EKJA 4OR1A 3PP3K 4UNVA 2YD1A 3QUGA 2AXFA 3MACH 1BMWA 4GRMB 3SDCD 1BBJA 1SVCP 1DVFA 1N8OE 1Q0XL 2J6WA 3R7QA 3SPJA 2YN5A 4FMVA 4Z8FH 2WQRA 1QW9A 4GS7C 1SHMA 1JZIA 1R24B 1RZPA 3KWVA 3KWTA 3GS4A 4KVPA 5DEGB 3MJWA 4KKLC 4MMXA 4X6CE 2Z8VC 4ADJA 2V9RA 2Q1EA 3HS9A 4H26A 4FP8L 4C47A 4ONFL 4X4KA 1ZHNA 3UOAB 5KSUB 5EV7A 2LLNA 4P23B 3ESVF 2BZCA 4JMXA 1BAFH 4LSPL 4DZBA 2UVEA 5AVYB 2C9SA 4DGIH 5DS8A 1E65A 1HH9A 4Y7OC 3RJQB 1HCYA 4IRZA 1A7QL 4WU7A 3RKDC 2HMID 1CXFA 2A6KA 2AANA 2EILB 2NSMA 3GDBA 1LL1A 4GFTB 5E5RB 3IB4A 5C08B 3BAIA 5DWUH 5ESVB 2XZCL 4JFFA 4M48L 2YD2A 3K6SA 4GXVL 1AGEB 3ECWA 4GRWE 4RMSA 1KXVA 3HUJB 5AVXB 4CDGC 1OF2A 4G9DA 4JHWH 3Q5TA 2XPGA 4QHNA 2VLLB 5BUAA 3MRIB 5ESAA 2NT0A 5A43C 4MD4B 2XX1A 1JPFB 3WXWH 4UDTA 1QATA 4E2OA 2NX5B 3ZRSA 3QEQE 4KWUA 5A2JH 3BVUA 4TVUA 2HJLB 5AAMA 3F64A 4MDJA 3OWEA 3VI3A 2F1EA 1X5JA 3BT0A 4JFFE 2QEJA 1QLRA 4GKSB 3GT6A 1XGUA 4U3SB 1UURA 3PUUA 5GIRB 1ZT4A 1T0OA 4N0YL 1HHGA 3N85L 1QYGL 3SHSA 2ITDB 3M6DA 4KH9A 1A14L 3TT3H 2ESVE 4HIJA 1QX1A 2CUHA 4HJ1A 4NQCA 3VG9B 2Z7UA 4QOKE 4Z77A 3S9DB 3FSZA 1KIUB 1TJGH 2FDBP 5EOQL 4ZXBC 4G9FA 3DNKA 4BELD 1NC4D 1B0RA 4PJFF 4QXTA 1YEFH 1B0GB 5KYWB 1VRSA 5ENWB 4ZO8A 3OF6A 4K7PH 3NRPA 1FFOA 1RZQA 2DI7A 4Q58C 1MCPL 3K6FA 1TTRA 2LTQB 2WMPB 2ZXDA 1MUJB 4ZFQA 2VIRA 3CDCA 3QH3B 3MBXH 4S1RH 1FAIL 5L88H 3LSOA 1SF5A 3MROB 1JNNL 3AXLB 4BRJA 4AX3A 4ODWA 5CHNA 4XODA 4B96A 1RIHL 2HX7A 2DMBA 3C8KA 4Z7VA 3ULSA 5I1GH 3QDGA 2NUPA 4UI2A 4MWFB 5H94B 4G9FE 1CD9B 1ZHBB 1URZA 3MRBA 4PRIE 4WHYH 1B4TA 1F3DH 3HC2A 4EZLA 1KLGA 1XGTA 3KPNB 3Q7JA 4M8VA 2JIXA 4NEHB 3MRKB 2HFEB 2X5PA 3DHUA 1T7YA 2WTRA 3WTSA 2EIDA 4DO4A 3B9KB 2GEQA 4JFXA 5LGKA 5KSBA 4LP5A 1BJ8A 4PVNA 5FPIA 3ULUF 4PGDA 1A1NA 4X9FA 3CFJA 4AKOA 4YHKH 3T65A 2KDGA 3LH2L 3R18A 4NNYA 5HHNA 5HVWA 3FCTA 1KJMB 1NJ9B 2DI8A 4N0UE 4X42A 3MNDA 1LNUB 3HRPA 3ROLA 3CFKB 3EH2A 4Y5XA 2ICCA 4ACPA 4RMQA 4WK0B 1I3VA 3OHXB 4NKDB 3NFSL 4R4BA 4HWEH 3RFZB 2ZOUA 1URLA 4P4KD 1G6RH 1RZGA 1MCSA 3IDXH 1J1PL 1YPZB 1T2XA 2PPAA 3T0XA 3E9TA 1HIML 2P45B 3D50A 3GJFH 5EU3B 1T20A 4LB8A 5SX4H 2EUVA 1U6AL 1BOGA 3SCMA 3ZPDA 1ERNA 1XZ0A 1FL3B 1AKPA 1G7IB 3SDXA 1CYGA 3VTMA 3P9LA 4MXVE 4TLTA 4WHCA 4EPSA 1P4BL 3QCUL 4HUVB 2CRMA 1OGAD 4L29A 2MHAA 4WI0B 3MZGB 2XWCA 3X12B 1E27B 2IBZX 4PJBF 4LPCA 4PV1C 2JCCE 1IT9H 2BY1A 2DTMH 4WJKB 1Q72H 3TCXA 2ATAA 1AQKL 4S1DC 5C0GA 4A2GA 5ABZA 2VE6B 3IJHB 1FAKT 4HJEA 4WZ9A 2ZCHH 2J56A 2WOYA 4LBAA 5I8OL 5GRXG 3EHBC 2FT7A 5CKGA 3HJ0A 4ZZKA 1EBPA 2C34A 5EC1B 3N40P 4JZOB 3QHFL 1UWGL 3B2UC 3ILQD 5DZ9A 4I0CC 1GC1C 1OCOB 3II2A 4PRPA 4R3SB 5DHMC 1ETZA 3WL9A 4F2MA 5JZ7D 3NIGB 5I8KL 4IOIA 2OP4H 2HFTA 4RRPG 1IC4H 1L3NA 1KEGL 4Z0BL 3ARGC 1WP6A 1KJ2L 3DKHA 3LEYH 3BP5A 4TQPA 3H56A 2ZXBA 3SDCA 1BM7A 2X10A 1YYLL 4MA1C 4GKNA 2FHFA 1J11A 2X2YA 5D1ZC 3DUSB 2B5IB 2OTPA 4AK2A 5E8NA 1S3KH 1MCDA 2VXSH 3G5XB 1ZHKA 1FP5A 4F7CA 4DKFL 4PRPE 1I3GL 3W81A 3K6NA 3D2TA 4HJ0D 3VFWB 3C5SB 3BPLC 5AZEL 2V4LA 5TDPB 5J13B 2ZWSA 1CLZL 3MLUH 1T6VN 3JTTA 3JV4A 3OTTA 4OIIL 1TQCB 4HS8L 3RTQA 3VXQA 5T1KD 2UY7A 3WAKA 5IEKB 3BD3A 1CBVL 1MHHB 1HSAB 3WKMH 2PN5A 4TVPL 3SJVB 1MCJA 4FEMA 1KUMA 1GZHA 4XCEB 5EUKB 1AZVA 3I75B 4MYWB 2V7HA 1E40A 3GZPA 4NM4H 3QA3B 2DLHA 4Q6KA 4UINL 4HD5A 5T5FL 3ZRCC 4TNWK 4KKLD 1FZJA 3HMWL 3LH9A 4N0CD 1ASPA 1YJDC 5FYJL 3L2NA 4JEGB 4ZD3H 2JJSA 3GMPA 1CDHA 1SJMA 4F57L 3WMPA 5EA0L 3V6FB 3IJSB 2WO3B 5KVDH 3WIIL 5HI3C 4JO8A 5GSRB 5K93A 5AKTA 4P2OB 3CZJA 4OM0L 4G1EB 2YBRB 3H53A 1HJBC 1MRCL 1LD9B 1PJWA 1H9DA 5B39G 1ORSA 3CZGA 3UJIL 1HL8A 1VGKB 3BN3B 1MFDL 1MREH 3NJIA 1P1ZA 1A64A 1SVBA 1W9XA 1YVLA 2DLFH 4TSAL 2ZKXA 3WTTA 4Z95H 3P4NB 1S4IA 2VAJA 5D71H 4M9OA 5DMYA 1MI5A 3ZZLA 3KR3L 2NZ9C 3EF4A 4X7SL 1NC4A 2AJVH 1DO5A 4HWBA 3MJ9A 3CSFA 2ZSVA 5D1ZI 2HKHL 2C3HA 5IB2B 1I82A 1BQHG 2NY7L 3VW3L 1GYCA 4B60A 3UTSB 4OZHF 1SN0A 4AGMA 4PRDA 1V7MH 3EJZC 2P44B 1CFVH 3D3VE 1U8IB 2AJSL 3NJVA 4HPHA 3MA7A 3SKMB 2OR9L 3R8QA 1QTSA 2J8UA 3MTRA 1JD9A 1KTRL 1TJIL 3NH7L 1JNHA 3OGCB 5EBWA 3CZNA 1HZLA 4TTGA 5L4JA 3QEUB 3QUZA 4U6VH 3U4KA 3KCWA 4TOYH 3U7WL 2IMMA 3U2SB 2O5XH 2ZAHA 3UAJD 3PAVA 4G1MA 4NQDE 3L9BA 2FQEA 4ZXBD 4K9EL 2NY6B 4YHOL 3RWHA 3IRZA 3SO3B 3CMOH 1VACA 3VGAB 5C97A 2R0KL 5F9JB 4OT1L 3U36B 2AK1L 3QG6A 4BE6A 1QWNA 5L4MA 4GAJH 4ZMWA 1JZDC 3CZFA 2JH2A 4Q0XL 1QSEA 3EYSH 3PWNB 1HKLL 1TOXA 1WUNT 3BT2H 2CJSA 5IQNA 3HZKB 4UQAA 2NY5L 3G04A 3VGHA 2Y1AA 4GSRA 4LCUB 3WS3B 1RJZA 4OF0A 2G3XA 1EGJA 1FL5A 2WXPA 4MS8C 5E4EC 4LZKA 4G8EA 4RWYH 1XGZA 1N7ML 4ZAKC 2UZIL 3T0WA 1CMOA 4R90L 5EEXA 3WGUB 4MS6A 2VR3A 4OLWH 5L2KB 4NZRL 3LEVH 4I9WE 4XNQB 4E42A 2R1XB 1QSEE 4G70B 3WFHB 1WZAA 5AVTB 1KCVH 2XDHA 4V2CB 3WEMA 4DWHA 1GS8A 1UM5L 4H0LC 4HK0B 5FUZH 3VI4F 3ZTJH 4ZMLA 1SY6L 4OIBA 3VH8A 3EZJB 3TA4D 1IBHA 3WD5L 1D5IL 2MOVA 2KPWA 4JPIA 4QRQB 4MXWH 4L3CA 4NKIH 4XI5D 5F7FA 5C3TA 1BEXA 2AK4B 2FUTA 4C54A 3CXDH 1OB1A 1WPCA 2B8OT 2P7TA 3LQZB 3MNZB 5HJBA 4B9PA 3R06A 3LPPA 1CD1A 1DZBA 2F1BA 1DANU 2BIMA 5A16A 3LOWA 4XR8C 3FB7B 3Q1SL 1TTUA 4DUXA 1IU1A 5HGBA 3MA9H 4RSYA 3U9UB 3NDZE 4Q9RH 5SX5K 1M6OB 1AGCB 3UZVB 3SBRA 2R0LH 3RX5A 1N5AB 3FTGB 2Y1VA 2WVSA 5EBLA 4MAYC 5BRZD 4NM8H 4BXSV 5I15H 1BQLH 2BNQD 1MIMH 2ICWJ 4H8QA 5IOPB 1MAML 1QRNE 3EO9L 1A5FL 2JB6A 5EO1A 4OBSA 1XMWA 2WNKA 4L5FL 1EHXA 1I7TB 2VL4A 4G8GA 1Q9KB 4LCWA 4M4RA 5AVVB 1FSKB 4DESA 3K1KC 4M7KL 5TQ2L 4LL9A 3EJRA 1E4HA 2OMXB 2RFXB 1MFMA 4IMLA 5JW4M 3N1MC 1R4XA 3D85A 4OTXH 4HG4K 1IC5H 4S1DD 4PJXB 1NQBA 1M3IA 4U1HA 3GUTB 1MWAL 4F37F 4ZNCD 3DJZA 4PRAB 3FZUD 4GW4B 4OD1H 2Y07H 4Y9GA 1JGEA 1OHQA 1IM9B 1JWUA 5J1TC 1TQVA 3VX0A 5D4HA 1NMCC 4OFYD 4HA1A 3UTQB 3EHBD 2W95A 5FO7B 3KBPA 4BSWB 4OZFA 4O5LL 5C8JA 1H6UA 1UZ8B 3B2UD 4KX7A 4OUUA 4LCWE 3H2PA 2J20A 4FFZA 4HC1L 5KVEE 4KZEH 3QARA 1YQ2A 2VXQL 4L37B 3FCSB 2AJZB 2HB0A 3LIZL 2FIKB 3HR5B 5HYFA 4U7MA 4YDLB 1U8JB 3BGMB 4WHTA 3FQ2A 1AHWB 3HKFA 4LNVA 5DFVD 2IDCA 4R26H 5DVNA 5D7EA 4CADB 4EZKA 2KKQA 1RUPH 2OBGA 3T6XA 2JJVA 3KEHA 4N20A 1L9QA 2DPKA 3MV7D 5I1AB 2ADGB 1B0IA 3APDA 3D9AL 3IGAA 3O9WC 5DRWA 5I66B 3ECUA 3EJCA 2CGYA 3PAZA 5IEHA 3FU7A 1CR9H 5MHSE 1B4LA 3L4TA 2YZ8A 1ZS8A 3VM5A 3U6RA 4QY8B 5KS9B 4FFYH 1E2VA 1BGXL 1MOEA 1UA3A 2WIIB 3PU7A 4BZ1A 2XFGB 1PZAA 3I50L 3A6BH 3IDNB 5F0JB 4OV5A 1UUSA 5D4IA 3UPRA 1E28B 2PXYB 5J4MA 1EK3A 4P5TC 3JYCA 3QQ3A