4XI5D

Ghgl of varicella-zoster virus in complex with human neutralizing antibodies
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
225
structure length
208
Chain Sequence
EVQLVESGGGVVQPGRSLRLSCGASGFTFNTYAMHWVRQAPGKGVEWVAVVSDGGGNRYYAASVKGRFTISRDNSKNTLFLQLNTLRPEDTAVYYCARSRGNHYYYGMDVWGRGTTVTVSSASTKGPSVFPLAPALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPTYICNVNHKPSNTKVDKRVEPKSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein H
publication title A site of varicella-zoster virus vulnerability identified by structural studies of neutralizing antibodies bound to the glycoprotein complex gHgL.
pubmed doi rcsb
source organism Human herpesvirus 3 strain oka vaccine
molecule tags Viral protein/immune system
total genus 21
structure length 208
sequence length 225
ec nomenclature
pdb deposition date 2015-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xi5D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xi5D01
3ARBD 1QFWI 4A6YB 4JFOB 3L3GA 2VXVH 5GRWA 3AS1A 4C56A 5F7UA 5CGMA 5J9PB 1U2CA 3IETA 4CW1B 5F7KC 4PJCF 5I8EA 2Y06L 4ONGH 4ELMF 3UBXB 3U6RA 3O6LH 3DUUB 3O3UN 3SO5A 3KPRD 3O6KH 3ZSSA 4G8FB 5J6GA 5DRWA 3HTLX 2BDNH 2XA3A 2APWA 4NIKB 4ZO6A 4KMTH 4NM8H 3O4LA 2JTDA 1A6ZB 5D96B 1T0NA 3MNZA 4CADB 2PYFA 4HXBH 4K3JH 4KRNA 5J06A 3B9AA 4DGVH 4FXGB 5C9KA 1BVLB 4F7MA 3ZDZE 2IF7A 3P9LA 3KDMB 1JTPA 4JO2H 4PJ8B 2XFXB 1EEZA 5C6TH 3O3EA 4U3HA 3VWJD 3T0DA 5F6IC 3HMWH 4UIMB 3QDJD 5DO2C 2FR4B 1LWRA 1KELL 4HUWB 3SDAA 3QG7L 3WIHH 4YGVA 4YO0A 2VAJA 4LASL 4QHKJ 5KVGL 3S34L 1GZPB 1VEMA 3CVIL 4WEBL 3QHZH 1P6AB 2W9DL 3IRPX 2Y5TA 4PJDB 3VRLE 1QHPA 2GKIA 5GRJL 1RUQL 4JRYD 4WEUD 4WTXA 4ZUTB 1T2XA 3G5XB 1A1OB 2ADJB 2BXZA 3C5ZA 4MS8D 1AE6L 4J3UA 5EO0B 1HH6A 2C3VB 1QBBA 3GSWB 1MY7A 3VJ6A 1TQBB 5CMAA 3EOTL 3C6LC 3VXRA 3T0WA 3IJSB 3BGFC 2XKNB 3BIBX 3QEGH 1OGTB 4M7LH 3VFOA 3E3QC 4C56E 4W6YB 2GITA 3H3PL 1C5BH 2VN7A 3X3GL 1H15B 3OAUH 1F97A 5DD5H 3VFWA 5KBNC 3I6LD 4KQ3L 5IESL 5GZOC 3BPCB 3WJJA 4KK8D 3TNMB 2YUXA 3TIDB 2VYRE 1XGYH 1OAUH 1NL0H 3C9NB 4JDTH 4F15B 3LKQB 3O4LE 1LO2H 3QAZC 2Q87A 4QHMB 2DQTH 3DTXB 3WLWC 1BREA 2AXGB 5I75B 4FQIL 4QHLA 5FGCE 5EB9A 2EDRA 3RWJB 5FA4B 3V4PL 2E7HA 4JY4B 3NCEB 4YDJA 2VLMD 1YEGL 1DFBH 2QTEA 5KSAB 2EZ0D 2CUIA 4HJJL 1MRDH 1FLRH 2FGWH 3I3EA 1K8DB 1L7IH 4XMKL 4X5WB 3S37L 3NCYS 3VMOA 3ARDA 3FO2B 3MRFB 1JF1B 4J4PA 1DL7L 5CJ8A 1MUJB 3AROA 4MB4A 4BQCA 2NY6C 3B9KB 5JZ7D 1TJGL 1EFQA 1OTUD 3FO0L 4NQDB 1FNGB 4NQEB 5DD1H 1CFNA 2OI9C 3EYVA 3G5VB 3KYNA 4QRUA 1BEYL 1HHIB 1RULH 3IGAB 1P4IH 4OKVB 1OCWL 1B4JL 1FZMA 5HYSB 1RD6A 1CL7L 1BX2B 1VSCA 3VXRE 3B2UC 1JZ8A 3EYSH 3GUTA 5FUZL 1YY9D 3EO1B 2C3HA 2FB4L 1FL5B 4BSVB 4LLUB 2W91A 5FK9A 1R3IL 4LVEA 1LVEA 2ICEB 1AGCA 2Z4QA 3RWEB 4R4FH 1GVIA 1J1PH 3DIFA 1OW0A 3TBSB 2XTJC 3I84A 4PJFA 4CJ0A 5E08H 5C8JA 3REWA 3IU3B 2X1OA 2WUCH 5L2KB 2UUDK 2EKSA 5FB8B 3N1MC 2PXYC 2XOTA 1ZHNA 1YEHL 5C0EB 1UCBL 1X6LA 1UWEL 1F90H 2FBJH 4OAWA 2XI9A 5A1AA 4OBSA 5DEFA 3T09A 4IEFB 1OGAA 3V6FB 5L6YH 2A6JB 5EORH 4YIQB 2ZUQC 1H9VA 4G6FD 4UV4H 1OAKH 1S7WB 4X6DB 1X5FA 2ADGB 3QIUD 5HVGB 4C59B 1MHCA 5CHNB 2ORBH 1CICC 1KFAL 5CBAA 3VFSB 4CVZA 4L8CB 4AEHH 1KC5L 5JW3L 2AJSH 1NGYA 2Z31D 2YPKA 2YBRB 1MI5B 3O8XA 2VIRA 2V17H 1A6UH 2DI9A 2R1YB 3IDJA 4OCYH 1CG9B 3ZYOA 1KENH 1REIA 4NYLA 4F58L 2XZZA 5JHDB 3LKOB 3OB8A 4PV8B 3I50H 4NGHH 2XKSA 2L0DA 2XICA 5F1SA 2PF6A 2YPVH 4LAQH 2A6DB 1U8LB 3EDJA 3O3AA 1NBYA 4HK3J 4Z0BH 1MVUB 1OSPH 1S7SA 4QTIL 3T8XA 3JVGA 4OF5A 2HVJA 5CZXC 4S1DD 2GJZA 3HE6C 1FP5A 1MJ7H 1MELA 3QIBC 5H8DA 3AREC 4W4NA 3VGFA 3UTPD 2P42B 7FABL 5I1DA 4PJFE 1MAMH 4ALAH 5GRUL 4Y5YC 1JNLH 2P8PA 3ARBC 3PGDA 1Q0YH 4JR9H 1CXKA 3EZJB 1MCIA 1VA9A 3OKDA 3DX7B 3EGSA 4G80B 1KPUA 3KYMB 4OFKA 3VGGA 1U8JA 4TQEH 1DQLH 1TQCC 3TVMB 1QLRA 3H7BB 4H1LG 1EO8H 4UT6L 3GJFB 4EIGB 5ENWB 4UB0L 3VXOB 1UZ6F 3NN8B 1JPTL 1GPOH 2YRLA 4LSSL 1OWRM 1YEKL 1IQWH 5ALBH 5E8OB 1OGAE 3LOWA 3CLEH 4PRID 5CWSB 4QT5B 1LEGA 2YHGA 4FQCL 3E8UH 5E8PA 2XWTA 4HS8L 5DSCB 1QSFA 5JPMA 4RFEB 2IQAA 4L3EA 3NFPA 4RAVB 3SE9H 1CN4A 5IV2A 4YGAB 3MCKB 1DEEB 3LN4B 3SDCB 4X8JB 3T0BA 5DEGB 5L0QC 4OZ4A 1SM3H 3RDTD 4XHQA 3VWJC 2B2XL 4CL7A 1KB5A 3L5XL 4NZRL 3MCLL 1QACA 1RUAH 4N90E 5E6IB 4NKIH 2NR6D 1JTTA 3MO1A 3KJ4C 3O3BA 4UDUB 1H0DB 3QSKB 1K4CA 2Y23A 4NKOA 3LIZL 4PGBB 4OIBA 5AZEH 4GXVL 4GRMB 4NC1C 3C6SA 5D1XA 2CMRH 4P57A 4GG8A 1T1ZB 2E8YA 3BHBA 3MV9D 4RMQA 4S1RH 1D5BA 2X4RB 3MRRA 5DRXB 4FQHA 4PRHB 1ZSDA 1NMAL 1QVOA 5J8OA 5GS0L 4U1JA 1FGNH 3LKRA 4L4VD 1MIML 3D9AH 1U8QA 4X7DC 2PYED 4ZOBA 3T3ME 3MC0A 4RWYH 1JWUA 1U3ZA 4BFBD 4LHUD 2O5ZH 4RWHA 5D7IF 1P84J 3OG4B 5I8OH 5C6WH 5FO7B 3VH8A 2MKLC 2A6KA 2F54B 2CIIA 2MNUA 1NFDA 5IBTH 4UOJA 2A73B 3IB4A 4I18B 3ZKSD 3B5HA 4WW2C 1AGEB 4PJXA 4KK8C 2ERJC 5E5MB 1II4E 5IFHH 3SEPA 3D2UB 1KB5L 1FV1A 1QSFE 5FYKL 1JP5A 3QDMB 4L3EE 4WENB 3QUXA 1Q9LA 4TOYL 3HPLA 1N0XL 2CKBA 5MHSE 4GLRH 4X5XA 2KBGA 1CXEA 2JF1A 1RUPL 3TWCH 3TV3L 1GCFA 4NN6C 4X4XB 4LCWD 2EDYA 3ZYJA 1MRFH 3OKMB 1OWWA 3TBVA 3CMOH 3MRHB 2VLRB 1HDMA 1QO3B 4P49A 5FYKE 3SGKA 2EZ0C 4Z8FH 5E6YA 1MFBL 3GBLA 2ICCA 4P2RD 2Q1EA 2VR9A 4KY1H 3TBTA 5F7YC 4HD9A 4V1DA 1PEWA 2XZAL 2IMMA 2EDDA 2MCPL 1FVDB 3D39B 3MA7B 3RPIB 3RUGA 3VFTA 3CAFA 3M1BA 5BV7B 1NANH 2DQEH 2FBOJ 4GAGL 4NOBA 5JZ7C 1IM9D 1CI5A 3QCTL 3CIQA 1OTUC 4M03A 4CN1A 1F3RB 3Q3GA 3D0LA 1N64L 5HTSA 1WBYA 3RIAK 4ZPTB 3B8SA 1A7OH 1X4XA 3GSNH 4UINL 3W5MA 4YHPA 5SX4I 2EC9U 1T22A 1AJ7H 4ZFFB 2AERT 4LQ1A 2HN7B 1R5VA 2A1WH 4F7EB 2YWZA 1FYTA 1B4RA 2PO6A 2IBGA 3KS0H 3E6HA 2WWKT 1YZZA 5DQDH 1YY9C 4JKPH 5EC2B 1I8LA 3LAFA 1JGEA 1S5IL 4OD3H 1JK8A 1LD9A 5CJXC 2CKBL 3KYOB 4OGYL 1GGUA 1NFDE 1YC8A 4FQ1H 1A6VH 4S1QH 1KBGH 3VWKB 4ZUUB 1BZ9A 4C83B 5I1CH 3GSQA 4XBEH 4PJXE 3E3QE 3NFNB 5ICXB 4E9LA 4UOW0 4G42B 4PJEE 3CUPB 5BRZA 3U0WH 4Y1AB 5DUML 3HG1B 2W60A 2W1NA 4H88H 4HIJB 3NIFF 4L3CA 2BRRH 2VNCA 3UPCA 5C0FA 5FAAA 5IKCB 3NCYP 1RIUH 4NUJB 2GHWB 2I25N 1V7ML 4YHKL 1HKLL 2IFFH 1C8PA 1J0IA 3OF6D 1X5JA 1FNHA 3HZVA 2EDFA 4YDLB 3WMSA 1A3QA 3QIUC 3IDIA 1F6LL 3KLDA 4JZJB 1QFWH 2EC8A 3HUJF 3IFOA 4V1DE 4V2BA 5IIEA 3NIGF 1ZV5A 3MLZH 2Z31C 2HJLA 4JN2A 2ZUUA 2NY1D 2VLJB 5JO5A 3ZKXB 3RUGE 1XF2A 3FB5B 1J12A 25C8L 3WKMH 4YE4H 3CU1A 3T0ED 1CICA 1UZ8B 3CGTA 7CGTA 4ELMB 4XCFH 5IVZA 4D9LL 2AI0H 1XGUA 4NBXB 3FTGA 1QBAA 4NBYB 1JZ5A 3VFPA 5C0GB 2CLZB 1YMMA 1YY8A 4KDTA 4OCMC 5IR1A 4N8CH 5IMMA 4MCYA 1E4KC 1V8HA 1ADQA 1JZ6A 1JPSL 1FZOA 5SV4A 5FYJL 5EH1A 1TCMA 4YHYC 4S1DC 1QP1A 2YK1H 3ET9F 2EICA 1DQQB 3UX9B 1XCTB 1FFNA 1JF6A 1T4KA 1ZA6A 3QIWD 5KSBA 4JE4B 2X40A 4PFEA 4O2CA 1QYGH 2DIBA 1IAIH 3W9DB 5DS8B 3UDWC 1FPTL 4O9HL 4LPXA 4XB7A 2HJFB 3HE7B 4PG2C 5DJXB 2ZPKH 3SGDI 4XMPL 4HWUA 1KN2H 4JLRB 1BFOB 2QL1A 1WV7T 4XP9H 2W0FA 3HR5B 4OF8A 4MNQD 2A2QT 1OD7A 1YYLL 2IH3A 1YPZF 5T3XH 2AABL 2ID5A 2EDTA 5KSVB 3ARBA 4Y2DB 2IQ9H 1OB1A 2DQJH 1IEAB 1KJ2H 2YMXH 1LDSA 1I1CA 4M7ZC 4HSQA 1T6VN 2DQCL 5KN5A 1JYWA 1RJLA 4WHDA 1S7RA 4WI5A 3V8CA 2WBJD 3MRPB 3HKFA 3QXWA 3KPRA 1RIHL 3SY0A 1IT9H 1MCRA 1O0VA 1S8DA 3MBED 1ADQL 4HKBB 2AJ3A 1INDL 5AZ2L 2OP4L 3LN9A 4ZS7H 2I9LB 1AO7D 2H26A 1KF9B 4CBPA 2APBA 5GGTH 1P7HL 4Z7NF 3LKPA 1EO5A 4M6OH 4MQTB 5HDLA 2NR6C 5JIKA 5A3ID 1NMBH 4GFTB 1RUKL 5EZIL 4JPVL 4OJFH 5E2UL 4WCYL 3VWJA 3GIVB 3SOBH 4Z5RB 5MERA 2LE9A 2CQVA 3HI5L 5KANI 1A21A 4CUCA 3TH4T 2I9TB 3O9WB 4PJAF 3F7VA 4KRLB 2ARJA 4Y89A 4M1CD 4OF6A 1DBML 4LEXH 3KPNB 3CDYA 2AW2A 2DQUH 1I7RA 5JLZB 1FNSL 1IGMH 3WNKA 4JFYB 5GRXG 1FC1A 5KSBE 2WUBH 2UZXB 3R0NA 2VITB 5I2IA 4JRYA 4A2MA 3ISWA 3BH9A 5DZNA 4MHHI 5DQJA 1PKQA 3VFUB 2PNDA 5C07A 3ECBB 3V79C 3EYUH 1N5YH 4JJHA 1L4IA 1ZT4B 3AAZA 2AVGA 3E6FB 4ZUVA 4PJBF 1RFDH 4I0PA 4XPTL 2VXUH 1KJ3H 1F6AA 1A1MA 3MNVA 4IRZH 4O2EB 1G9NC 3L95A 3VI4F 1QLEL 1CQYA 3KPRE 1E27B 4HG4J 5ABDE 1K5NB 1XGRA 4DZ8B 3GMMA 4M62H 1RURL 3MRKB 5E9DD 5CJ5A 4IMKC 2FJFA 3WXWH 5JA9A 4XWOC 5D7KD 2ESVB 4HXAH 1CU4H 1MOEA 2CJUL 2FIKB 3TO4D 4XB8A 1EVTC 3CU7A 5BXFA 1P7KA 1Q72H 4GJTB 2D4DA 3RHWF 4OQTA 3IXTB 3F5WB 2D7TH 2AJXL 3D25A 4MAYA 3P4OA 1LNUB 1R24A 4JQVC 2IFGA 2MJWA 1W0YT 4P5TB 4XXCC 4JFFD 4QHUB 1UEMA 1BQLH 2DQIH 4PLOB 1FH5L 1I9IH 4NRXB 1TLKA 1P4BL 4HKJA 3UJTL 2EDNA 5C0BB 1NLBL 2Z92B 1N8ZB 5K9JH 4HIIB 4JRYE 5IOPB 2IANB 4ORGB 5IVOA 4U33A 2VLLB 4UAOC 3NPSC 3KYKH 2R4RH 1SVZA 5ICYB 2X4PA 4FZ8L 1ZA3A 1N2RB 4PIRF 1KCRL 3W82A 4MLIA 4RMWA 1ZHKA 3PXJA 1MH5A 1OQXA 1CFVH 1IQDA 2DWDB 3LSOB 3RWHA 5FYLD 4H8WC 4P4KB 3I75B 3NIDF 1WF5A 5IUSA 1FHGA 5DYOA 2DKSA 1OVZA 2ZCLH 4JG1H 5I9QC 3H42H 4KKNA 3MLVH 2J1KA 1EFXA 3BRGC 4OZIB 4GG6A 1FFOA 3I6LE 1D7FA 1I85A 4XH2B 3U2SA 3FRUA 3MRLA 1L7TL 1ONQA 4H8WH 2F5AH 4P59L 2W0PA 4CJ1A 1NUDA 4R8WL 3RU8L 4LLQA 5D2LF 1WISA 1MHHB 3SKJL 3BSZH 3CFDB 3TCLB 1OAZH 5I1GL 4R0LC 4G6MH 4XX1E 3BP5B 2JB6A 4MA1B 4QXUL 5CUSL 4XNZB 3OR7B 1G7HB 3CFKB 3IJYA 2MKWA 2VLKA 3PV7A 4FQ2H 3ROLA 4Z7QE 4MD0B 1NUGA 3S96B 4AL8L 4TULL 4QRRB 3BVNA 3RVTD 3SGJC 1FL3B 3G6DH 1RVFL 2NY1C 3BKYL 1HN1A 4RBPK 4UTAH 1HHKA 3T0EC 1H3TA 3QQNA 3S5LB 1JPFA 1SBSH 4NQVA 3BDBA 4AT6B 1ZMYA 3CCHA 3CVHB 3DXAB 2WBKA 1A6AB 3T3PE 4JANA 3A6CH 1UWGH 4FG6D 1ODAA 2OTUB 4DTGL 4WY7L 2OQJA 5D7JB 1VGEH 4G5ZH 1MLBA 4E5XB 4MQ7B 1MCPL 5D6CB 4U1KA 4LMQI 3JUZA 4XNMA 3N85L 5E2VL 4EI5B 2Y7QB 1IC4L 5GHWL 4JM4L 5HHOD 4DKFL 3MRQA 4HCRL 2V5MA 4EBQL 2PR4H 2F53D 4FQJH 3QIWC 2X09A 3MLRH 4AEIL 2CUMA 1HH9A 4L8BA 1MIEH 2R2HA 2O93L 2D7NA 5JHLL 1N7MH 4UUJB 4BH7A 3MOBH 3PABB 5DRNB 5FECB 2AQ3A 5DJ2B 5IB4A 5IT2H 1YDPB 2BVUA 2GJ6B 2YS4A 1RZGA 5DDHB 3HAEG 1W72A 3ILPA 4ZMAT 4K2UL 4GG6E 5K9OA 4B0MM 1P53A 1NEZA 3STLA 4QKXB 4APQD 1PQZA 3UDWA 1FLTX 4Q6IC 2C4XA 4GS7C 3VXPB 3MRIA 4PG2A 1BJ1H 4NFDA 2DJUA 4U49A 1W0WA 5GSVB 3QFJB 1GAFH 1NGZA 2LTQB 4KVCH 5BO1L 2VDNH 5FGBC 2X4SB 3LHPL 4MQSB 3M8OL 3TT1H 1CBVL 2DICA 3BKML 1F4WH 3PGFL 3S35H 4Z6AT 2WBJC 3V4UL 3LEYL 1R5IB 1Z0NA 5C08B 2VL5A 1BJMA 1WZ1L 1Z9MA 1V3LA 3MBEC 2H6PA 2HLFD 5JXAH 5E8EA 4TVPH 3OX8B 5D7IB 1LP9F 1U8MB 4HWBL 4U6YA 1G6RA 2X6MA 4K9EC 3ES6B 4Q9QL 3UJIL 3IDYB 3I3BA 3MV7B 1FBIL 5F9WC 5T33L 4Y16D 2GUOA 3FOMB 4G9FD 1PZUB 4Q9RH 2NCMA 3IAQA 5I19L 3X14A 1NMCC 5A3IC 3RDTA 2D03H 3UYRL 3FHAA 4L1DA 5INCB 1CXIA 5HVHC 5IGXH 3FMGH 5D71L 4RQQB 1MCQA 2YD6A 4NWTH 4NRZB 3MLTA 2NY7H 4J3OC 4MXVE 5BS0A 3BZ4A 4MZ2A 4NQCD 4U2YA 1DSFH 5FUOL 4XVJH 3EO9H 5F21B 5C2UB 3U0PA 1CWVA 4M1CC 5H94A 3JTTA 2P8LA 3ZE0F 2R2EA 1JPST 1V3KA 1IAKA 5IK3B 4F8QA 2BC4A 3HNSL 5IP4A 4BM7A 5MI0B 3MV9A 1A7PL 3BZDA 2FECI 1T5WA 4C57C 2VDPH 3WFDH 5B3NA 4KJPD 2BJMH 3PDOB 4L4VA 3KLHD 3G9VA 3ULSB 2A83A 2H32B 3CX5J 1YMHB 1RU9L 1IGYA 3MROA 3U4BH 1KEGL 3SO3B 1NC4D 2JKXA 1J5OL 5EU6D 1N26A 3WXVL 4PJHA 5F6HJ 1O5DT 3L3OA 1M7DA 2X70A 1R0AL 4BSWB 1G6RL 2Y36H 4PRAB 4LPWA 1U6AH 5SX4H 4I48A 4G3YL 2N7AA 1Q9WA 3UTTB 5ADOH 4XWGH 2XWBB 1RZFL 3H9HA 2E6PA 2VISB 3U30C 2HG5A 4P9HC 3KPPB 1ZT7B 5LCVH 3PWNA 4EXPX 1YEDA 3DX8A 4PRIE 4P99A 5EOTA 3MRJA 3OJ2C 5ACZB 5EIIA 1JHTA 4YHOH 2CD0A 3TO4C 4U1HB 1EBPA 4JCLA 4P9HH 1IKNA 2CH8A 2UWEA 1TNMA 4YC2C 4CNIA 4OCXL 4OM0H 1I8MB 1U8KB 4LCWA 2WBWB 5ESVA 5J0BA 4LCIH 5JDSB 3INUL 5J89A 4OM1L 2GIYA 1NJ9B 3EDDA 3VGEA 4OLUH 1N3NB 1AP2A 1FNFA 3HB3D 4BKLB 3P73A 4ODSL 3WHE1 4DK3A 3UYOD 1AGDA 3V5DA 2E9JA 3RNQA 5CEXB 4WTZA 4H1LB 5B39A 4XXCA 1E4WH 1P2CB 1TJHH 2XY1A 4HKXB 4JFDD 1MREL 3MV9E 4NJAH 1A7NH 1CLOH 2NXZB 3DWTA 5AUMB 1YECL 3AS2A 5BVPL 3H7LA 4QTHA 4L4VE 3HUJB 5K93A 5I0DA 3OKOB 3DI3B 4J3XA 3AB0C 2DM4A 1HE7A 4FQXD 4OZHA 5IEHB 3QDAA 4I5BA 1BQUA 1KCSH 1BVKB 4PJHE 3GB7A 4FP8L 1MJ8L 1PJ9A 5HVWA 3GBMH 3NAAH 2W9EH 1YNLL 3GDBA 4AY0A 3K81A 4ZXBA 3D48R 2YD2A 1NBVH 4ZDHB 2ZJSL 4HUVB 5C92A 4HGWB 1A7QH 2DQFA 1S5HB 3WLBA 2V2TA 3VA2C 1RJYB 1T3FB 4KUCF 1NGQL 3NCBB 4X9GA 5F72S 4N1EA 2G5BA 3CFBB 5H37G 3T77A 2BVTA 4G9DA 2H1PL 5JXED 4IDLA 5HHPB 5KOVC 3U0TB 5B38A 2ZKHL 5C9JB 2UWEE 2WIIB 5ALCH 2HRLA 2GFBA 3HNVH 4KDVA 4OIIH 4U1MB 3OF6A 4RNRB 1VDGA 4LCWE 3RVTC 1OAYH 2J4WH 2PTTB 3G08B 2OTWB 5FV1L 4JCMA 1MCHA 5SWZB 5T1LB 3CX2A 3LQZB 2UZYB 1YPZB 3GIZL 3LH2H 3V5KB 3BPLB 4ZS6D 3JWDH 4K3GA 4NM4H 5DF0A 1KTKE 3FQUA 4LSUH 3WNMA 5MEND 1HYRC 5DFWH 4FG6C 1MCJA 3L3JB 2HLAA 1EO7A 2LQRA 2CDEB 4FTVD 2D3VA 3RL2B 3KNBB 3BP4B 1EHAA 4W6XB 4XP1L 1G84A 4ODVH 3NCJL 4PLKD 4IRJB 2ADFH 1H8OA 2AK1L 2AK4B 2DI8A 2W0LA 4NQTA 4P2QB 4YK4B 2VDOH 1MEXH 1ZANL 3VFMB 3DLQR 2OK0L 1LK2A 1KTDB 2YN5A 4OF0A 4NKMA 1X3DA 2HFFA 3O11B 2EEDA 2R29L 2O61A 3PL6B 4YHLL 1G7MB 3C5SA 2HT3D 3WO3B 1SJEA 3QIWA 4GMTH 1UG9A 2DD8H 4ZFZA 4M1GH 4Y4FD 3C08H 4APQC 1I1FB 1IGCL 2J88L 3UTQA 1MFAL 1JHKH 4YDIH 2J7LA 3GMLA 1C7TA 3RX5A 4M5YH 4PJAB 5B4MD 4Z95L 3FN9A 3QG6A 2HRPH 5I76A 4PRPA 5AYUH 1IC1A 2C3GA 3NTCH 3VCLA 1T66D 4Q6IA 2X4QA 2HTKD 5F71A 2VABB 4OKDA 4HDIB 4NN7B 3EFDL 1KB9J 1WAAA 4TSCL 5EUOF 4JREC 3OJDA 2HLFC 4ODWB 5IMLA 3TZVA 4B41A 3GMRA 4XBPB 4S0TD 3CFEB 1JN6A 2P8MA 5DHVB 2Y5EA 2J8UF 4FQQB 2JJVA 3FN0H 1J1XL 3T65B 3FQXB 3RGVA 4Y16C 3BUYA 3TYGL 3MBEA 4PJBB 2MPAL 3L3IB 3QEUA 2HWZH 2QKIB 4U1IB 4K23H 4G6JL 1ZLUK 4WHCA 4O58L 5EULV 1W8OA 1GGBH 2BVQB 1AO7A 1ZLWH 3GMNA 3P40A 4MB3A 1T1XB 4LLDB 1NAKH 1CGSL 2XA8H 4PJ9B 3TYFA 5MEPA 3ULUH 3K3QA 3LVEA 3QDGD 1JHLL 3TBWA 5TQ0L 5HHXL 3BN3B 3VGAB 4TUOA 4YX2H 1F4XH 2BSSB 1PSKH 3C8KA 4UTBL 2DM3A 3L6FB 4IJ3B 4F80A 5J6HA 5DMYA 5I18H 1RY7B 5E00A 4ZFGL 2K7PA 4KJPC 2DWEA 5DMIL 2ZSVB 1M7IB 3KLHC 4BZ2H 4EI6B 4QGYA 2XTLA 1CK0H 2X44D 1YYML 3BZEB 2X7LB 4YQXL 4XCYA 3W11D 2CRZA 2FEEI 1EMTL 3WV0A 5ADPH 5H2BB 1X5AA 3AVEA 4NQSA 5CINH 4NO5B 4J7RA 4KU1A 1IGFL 4X7CC 3S3SA 3BYTA 5I6XC 1R5WA 2N1KA 5BV7H 4L3AA 4RRPG 1I8KB 1LO4H 5I66B 4KFZC 5DD0L 5K9QG 2JELH 5ID1B 1WAAE 5T1MA 2RQ8A 4YHIA 1MNUL 1A9EB 5KSUB 5E4EB 2G75B 3VG0L 2Y72A 1F11B 3P4MA 3QEQB 1N6QL 5E03A 1PDKA 3G6AA 1A1NB 3T1FA 5BZWA 2EYSB 1E28B 4MJ5A 3DV4B 4HULB 2B5IC 3VDCA 1U8PA 3ULVF 1N6UA 4HS6B 2WV3A 2R23B 1AO7E 2H8PA 3MX0A 5I1AA 1LO3H 1L9MA 1WT5C 4XVSH 3CH1A 3KPQB 3TO4A 3MV11 5F7EH 3ABZA 3HB3C 4O2FB 4W68A 4Q97A 3DBXB 1HIMH 4KROD 1IMHC 4D9QE 3SDDD 4DZBB 3RZCD 3RPKA 3DUSB 3GMPB 4IOIA 4MWFA 1JRHI 3BE1L 3W5NA 4HZAA 3QXAB 2MOVA 3QQ4A 1ROWA 5TQ2L 1A6TA 3WFCH 5J12C 2E9BA 3IDNA 5DJZB 1CIUA 3VXUA 4U1SA 5F1NA 2YWYA 5EBMB 2VXTL 3HRPA 4QLRA 1IAOB 1TZHA 2ED8A 3MFFB 3VFNB 1RZIB 4BH8A 4FQXC 4PJIB 3WNNA 2I24N 5EIQA 3VXNA 3E2HC 4WJ5B 4U1GC 1QNZH 2QHRH 4UMGA 4MNHA 3WUWG 3MRBA 2E7CA 5ESAB 1AKJD 1NFIB 4JRXB 1Q94B 4GQ9H 1L0YA 3ORJA 3VFGL 4G6KL 1I4FA 4ETQA 1PZ5A 1WWWX 4GBXD 4F9PA 3Q48A 3RL1A 5D7LB 3UBXI 1DQML 1WWCA 1B9ZA 5JXEC 2VDKH 3RWDB 3FCTB 4O5LH 2WANA 2ICWB 4M9OA 5HGBB 1ES0A 3NH7H 4G8EB 4E41D 3ESVF 4MDIA 4TPRL 3S36L 4TN9A 5AD0A 1MFDL 3MMEB 3FO1A 3FT2B 1UM5H 3V8OA 3SE4A 3LY6A 5IB3A 3I2CL 4PP2B 1ZTXH 4YWGH 4X4YA 2WZPD 1DBAH 3TT3H 5DA4A 4LIQE 3A6BH 5LGJA 5IROC 3AY4A 3CZJA 4PRDB 2AJZB 2IH1B 1FN4B 3AS0A 5D7KE 2GCYB 4R97B 1AXSB 3FONA 1NBQA 1UEYA 3P9WB 4K3DH 5H35A 2VXVL 4FOMA 4JFEB 4FFVD 4QXGH 5CBEB 1D9KA 4ZS6C 4HLZH 4ONGL 3D1MC 3LN5B 4LPUA 3O6LL 2CXGA 4JHWH 4W81A 2K3TA 4GOSA 5FDWB 1DBKH 1RSFA 4PB9H 4CU7A 1F8TH 4PJEF 1D5IH 2BDNL 4PLKC 5AAWA 3LQMA 3Q5TA 4HWNA 4NM8L 4OLYL 1U3JA 4L8SC 1NCBH 2BY1A 4JHBA 4NO0D 1ZHBB 4HXBL 4K3JL 3UTSD 5KG9B 1A3LH 15C8H 5KW9L 4DGVL 5I1IH 2VC2H 3GSUA 4WUUD 1TZGH 3W0WD 4JO2L 2NY5C 4K7FA 2DQGH 5F7DA 3GHBH 2JCCA 5C6TL 5B8CA 1EEQA 3U48A 3O6FD 3HMWL 4JVUA 4JGJA 5DVMA 3GSRA 2HT3C 2F53A 1I75A 4HWEH 1NCDH 3CDCA 3O2WL 4Y4FC 2GY5A 1HSBB 2MHAB 4HPYH 1BZQK 2X89A 5INDB 3JZ7A 4NPYB 1D5ZB 4NQUA 5B4MC 5HDQL 4NC0B 3LRHA 3LZFL 3QPXL 5IWLC 4APQA 1EHNA 4E42B 1U93B 4X6BA 3LKNB 1J0JA 1T66C 4HKZB 1QHOA 2HTKC 5CJOL 1MY5A 2XQYG 4GKSA 4QF1A 4P0DA 3SJVD 3TN0A 1DLFH 4BA8A 5ICZA 4Q9BA 5BVJA 4GKNB 3PHOA 1LE9A 3QEGL 3TH2T 5CIPB 3DMMD 3TBYB 3GI8H 3QFDB 4LEOA 1C5BL 5ESQA 3OAUL 5DD5L 1D6VH 1RZ8A 4L9LA 5KAQG 4HHAB 3T4AB 4R7NB 3AU1A 1RUMH 1I7UA 3RY5A 3VFVB 4YR6B 3GBNH 3MGTB 5F1IB 5TDOA 4XCEA 5EUKB 2NW3B 2D4FA 3STBA 4F8TA 1XGYL 1XFPA 1P7QB 2EH7H 1NL0L 4JDTL 4EN3D 3I6GA 4LF3A 5I8CB 1LO2L 5LXGH 1WCQA 4P23D 3QJFA 1NAMA 2DQTL 3QB7C 3P9MB 5JNYB 4JFHD 4Z18A 3DVNB 1ETZB 4RZCA 5KVFH 1J7VR 3GKWL 2SEBB 2QLVB 1R3KA 3N9GH 4ACPA 2OJEA 3KPLB 4XNYH 2JCCE 4YXKH 1WVZA 4OCSH 5C0IB 5KVMC 3B3IA 3LB6D 2HFEA 1DFBL 2F53E 3WDJA 1EXUA 4LRIC 1MRDL 3X3FH 3MACH 1FLRL 4YXLH 1KPVA 1L7IL 2V5SA 3BMVA 3MJ9H 3K74B 1A7BA 3WS6C 3JV5A 2IAMD 3W11C 4ELKB 3A67H 1KCVH 5ISZB 5IW1A 2D7OA 1HXMB 4Y8AA 1UWXK 4LCCB 2QSVA 3VXTA 3IFPA 5DD1L 5TDPA 1QEWA 3O2VH 1P4IL 4XC3L 3JWOC 4QRTA 2DJ4A 4LVHB 1WSST 1K8IB 1BOGA 2R2BA 1FO0H 5I1LB 3EYSL 2VH5H 5TF1H 2FLBT 3KPSD 5EZLA 5BZDA 5EPMA 2P5WD 1B0GB 1NAML 1UKTA 1XF5A 3F7YA 1E4JA 4NWUL 2WWMD 4R4FL 2YEZA 4WHTA 2PN5A 3IS0X 3JWOH 4M61B 5E08L 4DOHB 1KYOJ 1A02N 1RHHB 4KROC 2WUCL 1CE6A 4WDIB 3SDDC 3RZCC 1FVEB 1F5WA 5DVOA 5FO8A 5K9KA 5M95B 3BPOC 3CSGA 3HAEB 1I1YB 4JQXC 1F90L 2AKRB 2FBJL 4Y4HD 3ZSTA 4Z0XA 2A77H 3OGCB 4N68A 4P3WA 1KLUB 4J6RH 4PGDA 1MHEA 1K4DB 5EORL 3PIQB 2QQLH 1XT5A 1OAKL 4NO3B 1D5XB 2ORBL 2IJ0C 4TRPL 4LHJB 1QBLH 1OF2A 4AEHL 4Y7MA 4EDXB 4NKQB 4DVBA 2AJSL 4Y5XC 1BBJB 4YDVA 3HC0B 4NSKB 4F7TA 2AGJH 3V4VH 1HSAA 2V17L 2XN9B 1DANT 2PUQT 1A6UL 1MAKA 3S88H 4OZFA 1J0YA 1D5MB 4RAHA 1J8HD 4XAWH 1MJUH 2XACC 4GBXC 4NKDA 3I50L 4ONFH 5ECJE 2IG2H 1HI6B 4NGHL 5CEZH 2VB5A 4WNQA 5GGSB 3VA6A 5T1DH 2YPVL 3F12B 4LAQL 5F9JB 3ZLQC 1AQKH 1KNOA 4Z0BL 4D0BB 1OSPL 5LBSH 3LD8C 1GOGA 5B3JE 1JWMB 3MBXH 4IMLB 5ELIA 5SWSD 1PG7X 1QLFB 2EDEA 4G7YH 4JDVA 1U8IB 3MXWL 1I3VA 5DVKA 5TGBA 3OKKA 1MJ7L 1HWHB 4K94H 5D5MF 2NXYD 4LGSB 2FSEA 1CE1H 4ODUA 3TLRA 4H0IA 5HYJB 43C9A 1MAML 3MFGB 4ALAL 4YPJA 1FSKC 1Q0YL 2F58H 2FEDD 4JR9L 1F3DH 3QWRA 1DQLL 1FZJA 4FFVC 1A4KB 3I9GH 4HC1H 3V95A 4H25B 2Q7NA 3ZDYE 5I0ZA 1EO8L 1VERA 3X11B 5IROA 4LKXB 3SKOB 5F88A 5GZNC 5DMGD 4UNVA 1GPOL 4UT9L 1KT2A 1IQWL 1C08B 2L7UA 4JPIB 1ORQA 3CLEL 4NT6B 4XPGL 2AXFA 1FG2A 2GTWB 3P0VL 4YEEA 3HMXA 2OYPA 3C60D 3E8UL 2VQTA 5KSAD 3U4EA 2JIXA 3U79A 4CN4A 3WD5H 5KAQF 5MENA 1HQRB 5EUOB 3LRSA 3SE9L 3Q5OA 3NCCB 3RVVD 4WW2F 5GRVK 1XGQA 4QHNB 4G8GB 4DWHA 4JFDE 1NC2A 2J8UB 3C5JB 4LKCA 2PW2B 1M6OA 3U1SH 3OKEB 2PETA 4HQQH 4M7KH 3B9KD 1HOCA 3CK0H 1SJHA 3QNZA 4PB0H 5C0AB 3O6FC 1AGCB 4Z7WF 1R3JA 1VGKA 4NQDD 2EDHA 1YUHA 3DIFB 1WBXB 3Q6FB 2F74A 4HZLB 4NKIL 1TFHA 4Y4KB 4MJID 5L2JB 3LPWA 2DRUA 3HZMB 3I85A 5I1JL 3EHBD 1TIUA 2NZ9C 2XZCH 2AQ2A 1NKOA 5AZEL 2CMRL 4LHQB 3TJEL 1UM6H 3IVKB 4S1RL 4L8DA 1BHGA 5JQHC 5IM7B 3U36B 1FGNL 3HZYA 5DJCB 2A9NL 4X7TB 4MMZC 1GSMA 2V7NA 4HUXA 4Y19A 1MFCH 2YPLA 4LHUG 5L2KD 1I3GH 2DAVA 2O5ZL 3ZL4L 3DMMC 4KK6D 4LQFH 3OAZK 5JQ6H 5EZOH 3B5TA 4LBEB 3FT3A 3UP1A 1F3DJ 5IBTL 4WTWA 5JR1L 4F3FB 3T2NH 4QOKD 3S37X 4PUBH 4JKLA 5C09A 4LRNH 1GL4B 5DK2A 1TENA 5IFHL 5L88H 1JGUH 5IB1B 5MENE 1W0VB 2YXFA 4K8RD 4J23A 4P23C 2ZSWA 4KUZL 3RJDA 1UVQB 4ETYA 3BH8B 1BLNB 3TO2B 3D3VB 4KI5E 1MHPH 3QISA 1MI5D 5GIRA 1C5DA 3K2MC 3T8XB 3ZYZA 3TWCL 3MRDB 3KPOA 3QDGA 1PBYA 1JPGA 5HGAB 3CMOL 4IHOA 3R8QA 4QY8A 4U6XB 4X4ZA 4L4TD 5IQ9A 3LB6C 1M05A 1K3ZA 2KL6A 1MCKA 4Z8FL 1KIRA 5B21A 2V7HB 3IAPA 1CGTA 1UH4A 2FJHB 2VAAA 2X2YA 4P46A 5D93C 1U95B 2JJSA 3QA3B 5SWQB 2IAMC 1JRHH 3KAAA 3KXFB 1A6WH 5D6DC 1OAQH 4PGZA 1A9BA 1U41A 4BUHA 3M17A 2VXQH 4GRWF 5TPWH 4B5EA 5T1KD 3L9RA 1A7OL 3GSNL 2AAVA 1ZHLA 4QGTA 3WS6A 4OFVA 1SYVA 2XYCA 3QULB 1AJ7L 1TXKA 4WWKB 3WEXA 2E7BA 3IFNH 4OLVH 1UQSB 1IBGH 2A1WL 1I1RA 3FZUD 3NFPB 4XC1H 4Y19E 2YPLE 3RY6C 2YA1A 3TVMD 2OZ4A 4UU9A 5DUPH 4UOW1 4DN4H 5DQDL 4WVRA 3FO9B 4AIZB 5FOJA 4YPGB 4QRPB 3FRPG 3SCMB 1C1EH 1CFQA 5MEOA 1HK6A 4HT1H 2WWMC 5IEKA 2JK5B 4FQ1L 1A6VL 3EJJX 4S1QL 1KBGL 4JZOA 4RFNB 1ZVHA 2Q8BH 5I1CL 2WAHA 3BWAB 5EOCJ 1QRND 1A8JH 1PW3A 5D96C 4L29A 3REVA 1ZGLP 1JZ2A 5EN2B 2J8OA 3LEVH 5F70A 4H88L 1J8KA 2OR8A 5F6IB 4ZO7A 2ED7A 5DJDB 1XF3B 1HZHH 2BY0A 4HUUB 4KJYA 2WINA 1CVSC 4NNXB 1RIUL 5GGUA 1N59A 4I4WB 4HBCH 4Y4HC 1PLGL 2IFFL 2O5XL 2BOCA 5IQ7H 4ZYKB 1INEL 3QDGE 3SDDA 1XZ0A 3DRTA 5EOQH 5BOPA 4DEPB 4KKLD 3CNKA 3WE6B 4M6NL 2D0FA 5E6ID 3HLAB 2AXHA 2AEWA 1FJ1B 4OLEA 3ARFD 5I17B 3U83A 3G6JA 3L7EA 3MLZL 1I1AC 3F6LA 3FAXA 4IIQA 1CIDA 1KJ2A 5HJ3A 3WKML 1T5XB 1CFTA 1SEQH 2VSCA 2OZ4L 4NN5C 1NFDB 5IHUH 4XCFL 5IB2A 2AI0L 3C6LB 3OKNA 5CSZB 4Y5XA 5DA0B 3BGFB 4N8CL 4OZGF 1NUNB 4PJEB 5T5FH 4ERSL 1AKJA 3T4YB 2DJSA 5IHZA 3D85B 4OD2A 5D72L 4NZTH 5J1TC 5DK3A 3EJZD 2PW1B 3VW3H 1NLDH 4GBXA 5IF0B 1FIGH 1IVLA 1JNHA 3ZKND 5GGTA 2YK1L 2RCSH 4OD1H 2J6EH 2NXYC 1CL7I 4P48A 2JB5H 3N0PB 3QAZB 3TA3A 2DQDH 1FFPA 1IAIL 2IGFL 4JO4H 1XIWD 1CR9H 3MRNA 3NZHL 3QUKA 4ZUSA 2FEDC 1Y0LB 1TVBA 4E41A 3PWLB 3D2UD 2ZPKL 3OPZH 4F15C 2QJDA 3TBTB 2ZOKA 3C87A 2CDGA 1C16A 4XP9L 2OL3H 1NGXA 1RIVH 1TZIA 4HFWA 3STZA 5HI4D 4D0CA 3MYJA 1CTNA 5T3XL 1ZT1A 1ZS8A 4LL9A 5DMGC 2IQ9L 1Z0MA 6FABH 3RI5K 1KJ2L 1AD9A 1QR4A 2YMXL 4DVRH 3I02B 1RZKC 2VE6A 2VLRD 3CLFH 1S9KC 2DIJA 3CPLB 5EO9B 3C60C 3VRJB 5KSAC 1VADA 3QQ3B 1F3JA 3HN3A 3LQAH 4EKXA 3RVVC 1TVHB 2GT9A 2P5EA 3CDFA 4NNYB 1U3YA 2NY6B 1IT9L 4S2SA 4ZPVA 3ZTJG 4KV5F 3IDGA 5C3TA 3D39D 3G6JE 1P1ZB 3L5JA 2OI9B 5FGRA 4ZS7L 3B9KC 3W39A 1KJVA 4Z7VA 4NO0A 4X5LA 3UTSA 2P45B 1KN4H 5K59E 1HHHB 1FIEA 3DROA 5GGTL 4NP4H 5ETUA 4YFLI 1DEDA 5DHVH 4M6OL 3GMOB 3SQOH 2QQQA 4LLYB 1XGTA 3U46A 1NMBL 1FCGA 3W0WA 3OKLB 3EHBC 4OJFL 4MA3A 4PJGF 1AFVH 3SOBL 3L3HA 3O6FA 1Q9OB 1F58L 5LWYH 1BECA 5DC0A 2IADB 2XTJB 4UNUA 1MWAH 3AXLA 2CRMA 3FB7A 3T0VA 3MJ8A 3UYPA 3NABH 1JUFB 5EU7E 4LEXL 3AM8C 5F7NC 5FKPA 2DQUL 3HI6H 1D3CA 1EH9A 1B90A 4LLVA 3PWJA 4DUVA 1IGML 1U92A 3MUGB 2DI7A 2BCKB 2PXYB 4E0RB 2WUBL 1QG3A 1RZJH 2X9XA 3KGRA 3QI9A 5DI8A 2A74B 1HILA 4I77H 4E41E 3SDXA 5E2JA 5BQ7A 3FJTA 4KK6C 3RWGA 1KCUH 1MAJA 3EYUL 1N5YL 3BZFB 2ZCHH 4RMTA 1YNTB 2ZUQB 3QHFL 4XBGB 5L9DH 4WU7B 4AENA 5CP3H 1RFDL 3PP3H 3ZE2F 2CLVA 1X4ZA 2VXUL 1KJ3L 3DMMA 3FAWA 4WO4B 1IZJA 2R2CA 3DNKA 3S4SA 4OTXH 1FVCB 1D6EB 2Q86A 3VMPA 3LEXB 5KVEL 3BKCH 4K8RC 3WUWB 1YJDC 3IKCB 3K1DA 4R90H 5BMFL 4F7CA 3VXQA 5GSRB 2CIKB 2NLJB 1JGVL 3O4LD 5HYSG 2YD5A 4PGEB 1FC2D 2EIBA 3MA9H 5J56B 1TPXC 1ULVA 4R7DB 5A16A 5HSFA 4EN3A 4OFDA 5IVXF 4Z78B 3KLSA 4Z7VE 1AHWC 3UTSE 4HXAL 4M7JH 4PGCA 5E0QA 2EYTB 1CU4L 1ZA6B 1G7JA 5DD6A 3DYPA 5DHXB 3V0WH 1HQ4B 4M6MH 3LS4H 3SHSA 2GK0A 3W0WE 4ODBD 3HE6B 1MF2H 4PTTB 5LGHH 3QIBB 3QUYA 4NCC2 3AREB 1T7ZA 3T0AA 5GQBA 4L5FH 4HFUH 2BNQB 4Y5YB 3ROOB 4XNUH 1BQLL 1EEYA 2DQIL 3ARBB 1OB1B 2OSLA 1EHLH 4RGNE 3QUMH 3L1OH 2IAMA 4AIXA 2VUOA 2XNAB 3QCVH 4OFYD 1U58A 3JV0A 3FQWB 5F8QC 2LU3A 3C5ZD 3HE7D 1S9WB 2JJTC 2F5BL 3FZUC 3V5HA 5K9JL 2VQ1A 2YOCA 3TVMC 1VACA 2ICES 3KYKL 3SDXE 2R4RL 1S8DB 2IPKB 2F15A 5E94A 2G9HA 3VXRD 1WCBB 5A40E 3NGBC 3EAKA 4PJ5B 2XIDA 3SJVE 4A6YA 5HGHB 1K2DB 2BMKA 1CFVL 4JFOA 4MSWB 5TDNB 1F6FB 5J9PA 4CW1A 1XGPB 5CGTA 5C7XH 2NPLX 3B8YA 3UBXA 4JG1L 3H42L 3DUUA 1KTLB 4YLQT 4UV7L 4DUXA 2A6IB 3MLVL 4G8FA 4S0SD 2DL9A 1H3WM 4JAMB 3VWJB 4N8PA 1VPOH 3QDJB 2F5AL 2FZ3B 2ZCKH 1DLHB 5JW5B 3DV6B 1A6ZA 3BSZL 4LPYA 1I9JH 4CADA 3KJ4B 1T83A 4WI8A 4KKLC 4FXGA 1CZ8H 2GSIB 5E6IC 5D5MB 1F02I 1BAFL 4JFHE 4RMUA 1J05B 4FQ2L 5DUBB 1QA9B 3KDMA 1WITA 4PJ8A 1OSZB 4KZDH 3ARFC 2XFXA 4LLMB 3PE9A 5IB5B 4YBQD 3G6DL 2EDJA 4UIMA 2FR4A 4UNTA 4X83A 4HUWA 2BSTB 3O9WD 3ARDD 5LVEA 4NFCA 3MLUH 1SBSL 4F57H 1GZPA 1VFAB 4GRLB 1S7XB 1UADC 1I7TB 5TE4L 1EEUA 3MCG1 3QXTA 3CC5A 5D2NC 1ZGLB 4PJDA 4ZUTA 3A6CL 1UWGL 1XH3B 2KQMA 5ANMB 3HS0B 1NDMB 2R0WH 3G5XA 1P69B 1A1OA 1VGEL 4Y88A 2ZUWA 2ADJA 4GXUN 5EBLB 3EJZC 4XZUB 4WW2B 5EO0A 3VXSB 2C3VA 2COQA 1FGVH 3ZKNC 4ODHH 2ERJB 3GSWA 4KPHL 5JIHA 4Z7UF 2FJFB 4MJ6B 3QEHB 5D4QA 5CSGA 3PP3K 3MODH 5KANG 3IJSA 2PR4L 4FQJL 1J9CT 2XKNA 1OGTA 2M1KA 4BSJA 1MIEL 1XIWC 4Z7WB 4M8QB 1HHGB 1H15A 3MOBL 5IMOB 2X9YA 1UH3A 5IT2L 1BZ7A 3ZT5A 4NN6B 3JV6B 3DRQB 4I3SL 3TNMA 5HI4C 1P5UA 3TIDA 3T08A 2W65B 1DN2A 4TUKL 1CYGA 3C9NA 5J57B 3LKQA 3GSNB 4KMQA 5EWIH 1GAFL 1H5BC 2ESVD 5E1HB 2VDNL 4QHMA 1I9EA 3DTXA 1MCFA 2DDQH 3B5GA 1OGAD 3TT1L 1F4WL 2AXGA 3S35L 3DECA 1UXWB 3MZGB 1CF8H 4KVNH 3RWJA 5FA4A 4JY4A 5JXAL 1J0HA 1JCKA 4IS6B 1JFQH 4P5TD 4TVPL 5KSAA 1DUYB 3IDXH 3P30L 1PD6A 4GSDL 1K8DA 1VENA 2D7MA 4LSQH 4X5WA 2ICWJ 3FO2A 3MRFA 4YBHA 1JF1A 1MUJA 4PJDE 4N5ED 3B9KA 5IGXL 3FMGL 2IAND 5EIVA 5HDBF 4NWTL 5DC9B 1RK0B 4TVPE 4NQDA 5GS3A 2NY7L 4NQEA 4XP4H 3G5VA 1J8HE 1PG7H 4XVJL 1HHIA 3EO9L 3IGAA 4GKZB 4OKVA 4POYA 2Z35B 1CDBA 5HYSA 1NDGB 1WZKA 1BX2A 4P4KD 4XNQB 4Y5VC 4JM2F 5JOFB 4K71C 1R3LB 2UV3A 3EO1A 4BSVA 3TF7C 5SWSE 3IJYB 2ICEA 2X4TA 4O4YL 2VDPL 3AM8A 3P0YH 3N06B 3WFDL 1Q38A 2BJML 3TBSA 4YNYB 4U3CA 4OLXL 1U2HA 4IRSD 3IU3A 2ITCA 4G6FB 3K4ZA 1KELH 4Q0XH 3QIUB 4QYOB 1KJMB 3U4BL 5L2KA 4WFGD 5F44A 5FB8A 5LKNA 2B4CH 5C0EA 4WEBH 4GRWB 2Y36L 3UXFA 1U6AL 2Z31B 4S10A 5ADOL 4XWGL 1AXTH 4JRWA 3HCVB 3V6FA 3IXAB 2FJGB 4QRRD 1MCOH 3U82B 5J1SC 2A6JA 4YIQA 5LCVL 3ZKXC 4X6DA 1S7WA 2ADGA 3MQIA 1BQHG 5CHNA 3EOAB 3NBNA 5ID0B 4PJ7A 2E8ZA 3VFSA 3D69B 4L8CA 2C7UB 2DN7A 4KKAD 3BDXA 1MJJB 3QQ9D 1GIGH 4YHOL 2YBRA 1MI5A 1FZKB 1S7VA 2WIMA 5FYKD 3O3DB 4OM0L 4YHYB 1YQVH 4LCIL 1CG9A 5D7JD 1AHWA 4O51B 3DVIA 4NUGL 4YHMH 5JHDA 1WWAX 3LKOA 4NQDE 5IESH 4OLUL 4NQEE 4PV8A 2VKWA 2OMBA 4EI5D 1PQZB 2G2RB 4JO3H 5D1XD 3CSPA 4ZSOB 2A6DA 1U8LA 2JE8A 1MVUA 2VMFA 3DYMA 1NCTA 1E4XL 1RJZB 1E4WL 3GK8H 3C5ZC 3HE7C 1KXVC 2ZG2A 4FQIH 4NJAL 3H9SB 1CLOL 3N1PC 3HAEH 5TE7L 2WM0A 3EYQC 5F7MC 3HZKB 4HGMA 2MCG1 4PRIB 4TUJB 1YEGH 4IDJL 2C1PB 4HJJH 2EDOA 2JJTA 3DX7A 4G80A 3KYMA 4F33B 3GSXB 3QFJD 3TVMA 4XMKH 5L2KE 3H7BA 3BMWA 2C3WA 1KCSL 4K8RL 2CK0L 4OLWH 2EO1A 3NAAL 3GJFA 5JIPA 3P77B 5ENWA 3VD3A 3VXOA 1X5LA 2YR3A 5C08D 4CVUA 2P7TB 1NBVL 4XGZB 4OZGB 5E8OA 1A7QL 3G04B 1UYWH 5CWSA 1T1YB 4QT5A 1GC1H 1GOFA 5E99H 1QRNA 4KJWD 3S3PA 5DSCA 1EAJA 4RFEA 4X6DE 5AAMA 4RAVA 3D18B 4WI6A 5H94B 4JJ5B 3P4NB 3MCKA 1DEEA 3LN4A 4PJ7E 3SDCA 4X8JA 5DEGA 5LG1A 1CL7H 4NNPH 5EC1B 3HHRB 1IAKB 2FO1A 2ZZUT 1G9MH 5CEYB 1MI5E 3MV9B 3BRFA 5ALCL 3NCMA 5J4MA 1XF4B 3HNVL 4OIIL 4GW4B 4KK5C 4U6HB 1QR1B 3K8MA 2J4WL 4YBQC 3VI3E 2LABA 4L4TE 5JHDE 1IGIH 3O9WC 5E6IA 3ARDC 2PYEB 1G9EA 1Q0XH 4J4PC 1TETH 1IGYB 4G7VH 3T0XA 4UDUA 4JN1L 4U1NB 3LH2L 1H0DA 4LHUB 4EJ1C 1H8NA 4CAGA 3JWDL 4PGBA 4GRMA 4K7PH 4NM4L 4LSUL 1YEHH 1T1ZA 1N4XH 2X4RA 3KG5A 5DRXA 3SE3C 4PRHA 2YZ8A 3ULUF 1QBMH 3UZQA 1OP3K 4PD4K 4JGMA 4NHUB 4ODVL 3G5YA 1FYTD 1YQ2A 5FXCH 2PO6D 3WO4C 3DO7A 1U8NB 4LP5A 4X99B 2Z93B 2OJZH 3EDKA 2VDOL 1PKOA 5FO7A 2F54A 1XEDA 2ZUVA 5FYJD 2A73A 4I18A 1IEHA 4OCRL 1AGEA 2E27H 4GMTL 1WEJH 3K4AA 5BRZD 4M1GL 4PJGB 5E5MA 1QPPA 5DJ8B 4XPAH 1QRNE 1JHKL 4YDIL 3D2UA 3QRGH 4P2RB 3QDMA 1VEPA 4QEGA 2R0KH 4M5YL 3D87B 1IZKA 3FB8B 2VJXA 3V5DB 3WIFB 2IPUK 1CDCA 4EVNB 2HRPL 5I30H 4WUKH 3PWVB 4LLWB 5AYUL 4MNGB 3EZ8A 1ZWIB 5F89B 4IOSD 4X4XA 1LEKB 1SJVA 4ZUWB 1IM9B 4HUKB 3OKMA 5D9SB 1I3RB 3BP6B 1FNAA 2X1WL 3C09C 2VLRA 4P5TC 5I8KH 5B3JF 1X5XA 1BWMA 3FN0L 4X6CF 5D1QB 2XWJB 5C0CB 4XNXH 1FVDA 3D39A 3MA7A 4UAOB 3RPIA 2HWZL 3NPSB 1RK1B 4K23L 3PV6B 4N5EC 4NCC1 1GGBL 1B0RB 2FHFA 4N0FA 1QUNA 4OUOA 4N0YH 4UB0H 1YMMD 4PRHE 5DVNA 1YEKH 3R1GH 5F3BB 4JG0H 5TFSL 3ULUL 4ZFFA 5D2NE 2HN7A 3JVGC 4F7EA 5FDYA 5I9QB 1A0QH 2E9IA 4YX2L 1PSKL 5EC2A 5IVXB 3WBDA 1QKZH 2V5RA 5I18L 2OM5A 3S98A 3MUY1 1NCCH 1SYSB 3KYOA 3QZWG 2VDMH 5GS1B 3RWCB 3VWKA 1SEBB 4R0LB 4ZUUA 4C83A 4ENED 4BZ2L 3L5XH 4IRSC 3LDBC 1NSNL 2FH8A 1FE8L 3NFNA 2I60L 4UT7L 5ICXA 4CRPA 2CUHA 1INQB 4G42A 3ZDXE 1BM3L 3CUPA 4Y1AA 3QDME 3HG1A 5EU3B 4HIJA 2D2OA 5ADPL 5AG9A 3FQUB 2NY1B 5IKCA 5CINL 4NUJA 3T0EB 3MOAH 5BV7L 1LO4L 3K46A 1T7YA 5GS0H 2VOTA 1IC7H 5J11C 2VLRE 5T1LD 4MB5A 1OT1A 4JZJA 2GYSA 2IPTH 4KKAC 2OLDA 3QQ9C 4U1LB 1FG9C 4N0CD 1EDQA 2R9HD 2UUDH 3D39E 1UJTA 4FFYL 3FB5A 4HK0B 3FT4B 4PJCA 3KHOA 5BJTB 1LO0H 1JMZA 3CFCL 5D7JC 4ELMA 1LO3L 4XVSL 2NTFB 4YFDB 1W8NA 4ISVB 5DJAB 5C0GA 3Q1SL 1UXSB 2CLZA 4IRJD 4ZFZB 4EI5C 1HIML 2AK4D 5D1XC 3UTQB 12E8H 1DCLA 2FLRT 3VGBA 1KB5H 5FYKH 1J1OL 1A22B 5D1ZB 4PR5B 4TOYH 5HYFA 4G43B 4QCIB 4MNQB 43CAB 3WFCL 5HHQB 3PL6D 4HUNB 1QSEB 1FNEB 1KXTB 1DQQA 35C8H 1XCTA 3UAJD 3HPJB 1B3JA 3EBAA 1YN7B 5F3HB 1UM4H 3OJDB 2RAMA 3W9DA 5DS8A 5AEAA 4OFYA 5C07D 3GMRB 5DHYB 4JO1H 2HJFA 3HE7A 5DJXA 5FKAB 2P8MB 2WBJB 3KPMB 2Q6WB 4JLRA 3S5LG 1BFOA 2LTQC 4O02H 1G7QB 3HG1E 3QH3A 1QNZL 1YA5A 2MCPH 2OBGA 4I0PD 5KSVA 4Y2DA 4GAGH 4PREB 5F97E 4RA0C 3T2PA 3V0AC 1IEAA 2GI7A 4NOFA 1N64H 4LNVA 5HPOA 3QUXC 1UGNA 4KJWC 4FZEH 4UINH 4X4MA 3TYFB 1NMCB 3MRPA 5E4IA 1M71B 3O41B 1B2WH 2VDKL 4PBVC 4CMHC 4O5LL 3EJYD 4Z7UB 3RFZC 1IC5H 4HKBA 5FYKU 4GO6B 3NH7L 2I07B 4PRNB 2WP3O 2I9LA 1T7VA 4OV5B 2BHUA 2M2DA 3SGKC 4PBWD 4M3KB 1UM5L 4PJCE 2CKBH 3ARUA 1ZTXL 2GY7B 3OQ3B 4YWGL 1DBAL 3TT3L 3DX9A 2A0LD 2PTUA 4ELME 3OAYK 4OGZA 3UTZB 2ED9A 4S11A 2XKUA 4MAYD 3BDYH 4JPWH 2X1XR 4D2NA 3ME0A 4K3DL 3SBWC 3MRCA 1OD9A 4QXGL 3FFDB 4R3SB 3GIVA 5F9OH 4Z5RA 3VG9C 2I9TA 3K1KC 2X10A 3O9WA 1GGTA 1EIBA 3KPNA 2VDRH 1HKLH 2GQHA 3I6KB 5JLZA 3FHQA 1F8TL 4JFYA 1T6WA 3QO1B 2PO6C 3B2VH 1ZVYA 2VITA 1NCBL 1PY4A 3SO3C 3SE3A 1I8LC 2EECA 3MUHL 1DN0A 3G6AB 3VFUA 15C8L 1CDJA 3ECBA 3BISA 5I1IL 3U30B 3QXVA 4FQPA 1ZT4A 1TZGL 3U7YH 5E9DB 3E6FA 3K8KA 3GHBL 4W4OA 2BNUB 4GUPB 4OGXH 2AEQH 3C8DA 5KTEH 4HWEL 1NCDL 4D9LH 3HI1B 1ZOXA 1EFXD 4X4ME 1V5JA 4YC2B 1KCLA 1CGXA 2R56H 4O2EA 4POZD 1E27A 1K5NA 1KLFA 4DZ8A 2G60L 3MRKA 4ZNEA 1GGIH 4JM2B 4JFFB 1C7SA 3ARGB 4MX7B 2VLKD 4B53A 2ESVA 1YEJH 2FIKA 5GS2H 1Y6NR 1DLFL 1FPTH 4O9HH 3IXTA 5HY9B 3F5WA 1MLCB 3EOBB 3OR6B 3SKNB 4K55A 4XMPH 2DMCA 1GHFL 3GI8L 2ZUTA 1LNUA 4YHNB 4P5TA 4C4KT 2B1HH 3BP7B 5E1AB 4QHUA 1RUML 1MPAH 4KDTC 3OB0K 3AB0B 2W0KA 3M45A 1CS6A 1YEEH 4NRXA 3GBNL 4JY6B 1ZGLM 1XAUA 5AWNL 5C0BA 4YUEL 2DQCH 4KAQH 2D31B 4PV9B 2Z92A 2EH7L 2GAZB 4QXTB 1N8ZA 3RL1B 2Y07H 4HIIA 5IOPA 2IANA 4ORGA 3PJSA 2VLLA 4OZIF 5ICYA 4P5KA 1BBDL 3CDGB 1ADQH 1N2RA 5KVFL 4AYFA 5FYJU 3N9GL 4EQ2A 4JRXD 5IBUG 1IEBB 5ITFB 4FN0A 2DWDA 4XNYL 4YXKL 4DCQB 3LSOA 1K9TA 1WZMA 2BNRB 4OCSL 1WJ3A 4P4KA 5IB3B 3I75A 4X4YB 5LGJB 4HEPG 2J12B 4ENEC 4P2OD 1KG0B 5KZCD 3MACL 3QWQB 4YXLL 5GRVL 1DDHB 6CGTA 3SE8H 2Q20A 4JPVH 1AGFB 2FWOB 2EDWA 5E6ZA 3HI5H 2HJKB 3A67L 1KCVL 4IRSA 2FD6H 3QR2A 3X12B 1MHHA 3D0VB 4ZNEE 3CFDA 3TCLA 2BOBB 3BP5A 4J3TA 5ITBH 1FNSH 2ESVE 5J13B 2RIKA 2XT1B 3O2VL 3OR7A 4QNPF 1G7HA 3CFKA 3MLSH 1C12B 5JW4M 1S7UB 5E5UB 2N56A 2IBZY 4MDJA 1HKFA 4MD0A 5E95B 4WRLA 3S96A 4QRRA 1AY1H 4GW1B 3MSPA 1FL3A 1U8OB 4N0CC 5TF1L 2R9HC 5DR5H 1L6ZA 3QUZB 1BMGA 4RX4A 3LS5H 4KHTH 3NPZB 3BESR 3CFJB 3IAGC 3EYOB 5HHOB 4CVXB 3VGDA 2NY0D 3H3KA 4HK3N 4XPTH 3N1FC 4AT6A 4IRJC 2XPGB 3MPCA 4WI2A 3CVHA 3DXAA 1NCWH 1A6AA 4LSPH 1IAMA 5C0BE 5BS0D 1A6PA 3I3DA 1A3RL 1QFUH 2OTUA 5D7JA 2IANE 5LGKA 1MCSA 4MQ7A 5D6CA 3GRWH 1QFHA 4YBLC 2Z9TA 4EI5A 4DUWA 2Y7QA 3PL6C 2A77L 3PNWB 1TTGA 1UENA 3JV4B 3RGHA 4KC3B 2QQLL 3FN3A 4HC1A 1QFWM 4I3RH 4GAYB 4UUJA 4KRPD 4MS8C 5FECA 3PABA 5DRNA 5DJ2A 1QBLL 1YN6B 1YDPA 2GJ6A 5DDHA 2DIAA 5C0DB 3OTTA 1AD0A 4JREB 4I0PC 3V4VL 4WHYH 5E7BA 5BOZG 3BPNB 4WI9A 1VKXB 3HC4H 3VXPA 3MV8B 3FOLB 3S88L 1JGDB 3QXDB 5FOBB 5GSVA 4XAWL 3QFJA 1MJUL 2HFGH 2X5PA 4WFGE 3AFLA 3JXAA 4ONFL 3TIEB 2X4SA 5CEZL 3N1QC 4Y16B 4G9FB 3RBGA 5T1DL 1R5IA 1AQKL 5C08A 4QRSB 2VR4A 5LBSL 3CVHL 4PTUB 3MBXL 3EJYC 4RAUB 3V7AG 4QRRE 2Q76B 1CLZH 3OX8A 5D7IA 4NQCB 1LGVA 4WWID 1U8MA 4K94L 1MVFA 4OQ1A 3CSYB 3ES6A 1IAIM 2HMID 2A0LC 3MV7A 3MXVH 1S9XB 4ZFOL 3IF1B 4X6EB 3FOMA 3IDUA 4MAYC 2NNAB 1UZ6E 2F58L 2ZNWA 1P7QD 3SGEH 2HH0H 3DXAE 3KLAB 1EERB 5INCA 1MQKH 3MREB 3OXRA 4HC1L 3I9GL 4RQQA 4KKCD 4NRZA 4ZODA 5DWUH 5HHVH 2WLYA 3RJQB 4OQTH 1GYAA 3JTSB 4Z77B 2QQKH 3SBWA 2F8VA 4U4BA 2NY2D 1NC4B 5EU6B 5IK3A 5EZJB 3WD5L 5CUSH 5CJQH 5L8KB 1SY6A 2ARWA 2FCBA 2GJ6E 3PDOA 4H26B 5I6XB 3P4LA 4AL8H 4TULH 2PTVA 3RI5F 4PY8J 5JIIA 4X6CB 3ULSA 1EAPB 2H32A 4MD4B 3BKYH 4M7KL 4HQQL 1YMHA 3PHQB 5EPMB 3CK0L 4PB0L 3CXHK 1BQHB 3MLPA 1NKRA 2CDFB 2YEZB 4ZXBD 4AMKH 2I27N 5GGRB 3TC9A 3QFJE 5IMKA 4BSWA 2B5IB 4PRAA 3WHXA 3UTTA 3FFCB 1I85C 3MLWH 2XWBA 4QHKI 2XZCL 2VISA 1ORSB 4POZC 5C08E 3KPPA 3ARQA 3RKPA 1ZT7A 1BFVH 1UM6L 5FHBL 5C3LD 4ZQKB 2YA2A 3N85H 3VD7A 5D7IE 1IC4H 1N5AB 4W70A 1HWGB 3P0GB 5ACZA 3S8WA 3P3YA 1LE5B 3J8F7 4JFQB 2QR0B 4U1HA 4WGVB 1WGOA 1MFCL 3BOVA 2F19H 1I8MA 1I3GL 4JFDB 5A2FA 3UPRB 1BP3B 5J12B 4KUCD 2BY3A 4LQFL 4ONHB 5JDSA 5JMRA 5EOCL 5JQ6L 1NJ9A 1SY6L 5EZOL 1ZVSA 1N3NA 2IWGA 1EJOL 2QHLA 4BKLA 5T3ZL 1KLGA 4HF5H 5EG6C 4FQXB 2ILLA 4TSAL 3T2NL 2Z91B 1CXFA 2KDGA 4PUBL 4EOWH 3E2HB 1F00I 5CEXA 4H1LA 3PXHA 1LO5B 1JGUL 4KI1A 4U1GB 1P2CA 2Q8AL 4HKXA 4FHBD 2VERN 5IW6B 4WU5B 2EH8L 3BKMH 1KXQE 3PGFH 4U0QB 3WS3B 3ALWA 4AH2A 4GRWH 4J3SA 2V9TA 4JEGB 4I13B 1MHPL 5AUMA 5TE6L 5T3ZE 3HUJA 1FYTE 3G5ZB 3OKOA 2XN9D 3DX6B 5IEHA 1AR1D 3OKKB 5ERWB 4Q9QH 2FSEB 4CMMB 4P2OC 1CGYA 1BVKA 1QQDB 2H45A 4JKMA 4N8VG 3OBAA 5FA3B 4XRCB 3KS0J 4DW2H 3PQYB 3UTTE 2R0LL 3ZMRA 3B83A 4ZDHA 4HUVA 5FYJE 1HEZB 4HGWA 4YAQB 3ARSA 1S5HA 1RJYA 2RFXB 5BRZE 1IGTB 1QSZA 5FUOH 4FXKB 1W72H 4RIRA 3UROR 2YRPA 4PRPD 3CFBA 2EIDA 3MR9A 3BRDA 4JPKH 5HHPA 4R97C 1NPUA 3IFNL 3U0TA 1CT8B 1E6OL 4OLVL 1KIPB 5C9JA 3Q6GH 4CU8A 4XC1L 4U6VH 2WIIA 2QQNH 3TZVD 5I1EH 4FTVB 4U1MA 4RNRA 3DURB 4JKKA 5DUPL 4DN4L 2PTTA 3G08A 1R3HB 1EGJH 1CVRA 4RFOH 4HT1L 4OFPA 4TNVK 3RGVD 5SWZA 1CDHA 5T1LA 1J18A 5E70A 3V2AR 3LQZA 4L8SB 2DTSA 3NIFE 5FF6B 5IG7B 3RDTC 1YPZA 2P47B 1EBAA 2NY0C 4POUB 1VGKB 3V5KA 1YUHB 2OR9L 3WXVH 4MCZA 2FHBA 2Z8VC 1T04B 3T04D 3QWOB 1M4KA 3GMQB 3L3JA 4BQ8A 2CDEA 3RL2A 2QSQA 4D9QD 3LEVL 3KNBA 3BFOA 3BP4A 1YMME 4L1HA 5JW4N 1HZHL 4IRJA 4D0DB 2BVPB 4Y4FB 4HBCL 2PCPB 3HUJE 2DLEA 2AK4A 5IQ7L 4HX1B 3NIGE 4GAFB 4RBPH 2FL5B 2AV7B 5L8JB 3GSOB 4P2QA 5JMOC 1GRWA 2DM2A 3VFMA 2E7LA 1KTDA 4KRPC 3NACH 1L0QA 3M07A 3NMEA 1BF8A 3O11A 4PBXA 4BELD 3PL6A 1XR8B 1G7MA 1DTUA 2HKHL 1I1FA 1SEQL 3H9YA 2BSRB 3QNYB 5IHUL 1MRCH 3U9PH 3OG6B 4PJAA 1OP5H 1HHJB 2Q3AA 3T2QA 3MUZ1 5KOMC 2NX5B 3WNPA 4AK1A 5HYQB 2V2XB 5T5FL 3Q0HA 3JWNC 3WN5B 2VABA 4HDIA 2UYLA 3FQRB 4NZTL 3R06B 1TTUA 1FDLH 2NY3D 4ODWA 1NLDL 3VW3L 4EUPG 4FFZH 4LK4A 3LKSB 3CFEA 1LEIA 4OD1L 4XCCL 5DHVA 3VRIB 3LCYA 4FQQA 5SWZE 4D9RD 1IKNC 1L0XA 2HMIC 3T65A 3FQXA 2JB5L 2LAAA 1U3HB 1YPZE 1JZ3A 4PJBA 3L3IA 4JO4L 1M05B 2QKIA 1CR9L 4U1IA 4HIEB 5K9QI 2AV1B 4PRBB 1T03L 2BVQA 3V9FA 1G9NH 4KKCC 4JFXB 2YA0A 3RX8A 2OL3L 3QZWB 4PGJA 2R1XB 1T1XA 4RA3A 1RIVL 4LNRB 2ZJSH 4LLDA 3C2AH 2ZOLB 4PJ9A 1WBZB 5C0JB 3U7AA 3ULVD 2NY2C 2AK4E 4DVRL 2NMSA 4NQXB 1DBJH 1T20B 3CLFL 2BSSA 1P6FA 2HVKB 1QD0A 3O81A 4P2QE 3VXUD 1AC6A 2H1PH 3L6FA 1F4YH 1I7ZB 4XCNB 4JQIH 3LQAL 3X13B 2HTLD 1TNNA 5F1KC 2ZKHH 1UC6A 1YNKH 3MRMB 4R26L 1FO0B 1F4AA 1AGBB 4GW5B 4EXKA 4Z7NE 1Z5LB 2DB8A 2ZSVA 4UU9B 1M7IA 3LPGA 4EI6A 3DARA 1PKQE 1UKSA 4NBZB 4D8PB 5C07E 1NBZB 1J10A 1Z6JT 1KN4L 2B7DT 3BZEA 2O5YH 1JVKA 2X7LA 4ZXBC 3UC0H 4HGKC 3BYYA 4PJAE 1WFOA 3BW9B 3SQOL 4WWKD 4MXWH 5H2BA 4DGYH 4NO5A 3VI3F 1AFVL 1J87A 5FHAH 1MCEA 1I8KA 5I66A 5LWYL 3BN9D 5I71C 5ID1A 3GHEH 1MWAL 1RV6X 4Q2ZA 4QRPD 3SCMD 1JWSB 1A9EA 5KSUA 2G75A 2Y4SA 1F11A 4HCRA 1A1NA 2Q3ZA 3ZE1F 1X5IA 5DTFB 2ENSA 2EYSA 3RZCB 1E28A 3Q2CA 3DV4A 1WLHA 1PYWB 1X5GA 4XAKD 5DURD 4HS6A 1YEIH 4PJBE 1RZJL 2R23A 2NY4D 3FKUS 3BGAA 3WFHA 1EHXA 2R29H 5LAXA 3EIFA 4YHLH 1T1WA 3L7EB 5D70H 1KCUL 5EU4B 1OARH 2QV2A 1D9KD 4O2FA 3MJ7B 5L9DL 1HCFX 3DBXA 2R0ZH 2HFTA 3VI4E 4PJIF 2J88H 3L3DB 4DZBA 3DUSA 1TJIH 1XCQB 5IB2B 3GMPA 5D2LA 4Y5XB 2NZIA 3BQUB 4UQ3B 4N0UB 4OTXL 3QXAA 2ITDB 3BKCL 2ZUXA 3RZWA 4P3DB 2OXGA 4R90L 3O4OC 5DJZA 4DQOH 5C2BH 2YN3A 5E8NB 5JORB 1BD2B 5EBMA 4J8RB 1DQJB 5KS9F 1IAOA 3GKZA 4YDKH 3BUTA 3MA9L 3MFFA 2M26A 4GBXB 3VFNA 1RZIA 2ATKA 3U9UB 4HWBA 2X9WA 3WL9B 4AM0B 5FO9B 1AR1C 4UZGA 1J1XH 1I8IB 4ZFOB 1OP5K 4WJ5A 3SKMB 3VDBA 3LD8B 1JIBA 1T0PB 3TYGH 4M6ML 3LS4L 1NFIA 4JRXA 3D85D 1A5FL 4O58H 2GSGB 4YEFA 1MF2L 1Q94A 1G7IB 2X89D 5LGHL 1CD0A 1C16B 2IALB 1UB6A 2DKUA 1V3MA 4P2OA 1TZIB 4L5FL 4HFUL 4DAGH 3MGAA 4DKAA 1CDUA 2LVCA 4R96B 3DVGB 1FSKB 5D7LA 1WUNT 1JHLH 1Z3GH 1X44A 3MRGB 5HHXH 3WIIL 5GGVL 3HNTL 3RWDA 3L1OL 1JNNL 3WJLA 4XMLH 4OI9A 5I73B 3VD9A 3QCVL 4Q58C 2G5RA 2ICWA 2BERA 5HGBA 4LP4A 4G8EA 3VXMB 4KTEH 3TZVC 5E8DH 3FT2A 4I0KA 3TN0D 4PP2A 3GM0A 3IDGB 3RQ3A 2VLKE 32C2B 2AJZA 2IH1A 1FN4A 4PRDA 2GCYA 2X4UB 4X9IA 3RGVC 3EUUA 1AXSA 1T21A 4YZFF 4JFEA 2D9QB 2YSSB 1JE6A 5CBEA 3UTSB 5C7XL 2X42A 5ETUB 1FRGH 4LFHG 4YQXH 3V0VB 1XR9B 3S6CA 5D2LE 3LN5A 1EZVY 2AJUL 2VO5A 3U46B 4WUUB 2KZ1B 3ZTJH 5FDWA 1JI1A 4MA3B 5MEQB 1VPOL 2MWCA 5DFVD 2YUVA 2ZCKL 1TDQA 2X4OB 2CLRB 5DLMH 3MJ8B 1I9JL 4K9EH 1ZHBA 5KG9A 3GO1H 2YKLL 4HJGB 4J1UB 1LP9A 3OJVC 1CZ8L 4J3WA 4GLRI 3BGMB 3IU4L 3UO1L 1X6NA 4KZDL 2C1OB 5CS7A 3VD5A 4JRXE 5E2WH 2VN4A 2C3XA 2AJYH 2MQCA 2X4NB 2VUYA 1HSBA 2MHAA 4F9LA 3SJVB 2E5EA 5INDA 3TH3T 3MLUL 1N0LA 1D5ZA 4M1DL 4NPYA 4R4BB 5D7LE 4AEEA 5ILTH 2UZIH 1DANU 2LFGA 3ZDZF 1NANI 2GTZB 4ZOEA 4E42A 1U93A 3LKNA 4G6AD 2HP4A 4HKZA 4M48L 5IHLB 1JZ4A 2R0WL 5TQ2H 2HKFH 2VDQH 5IFAH 4LPVA 2ATPB 4HAFA 2NY3C 2VXTH 1DP0A 3L7FB 2P4AB 1BJ1J 1FGVL 1S9VB 3BXNB 1Y18B 2V5YA 1ZE3C 3S9DB 1HCVA 5HHMB 4GKNA 3BD3A 4MD5B 4P23B 5CIPA 4JFEE 4WO4D 5SX5H 3TBYA 1P4LB 3QFDA 4WGWB 3VRLF 5IVNA 1A4JB 3BT2H 3B6SB 2H9GB 3UPAA 4HHAA 3T4AA 5JPNB 4R7NA 5CILH 3VFVA 4YR6A 1CD1B 5IBUB 3OHXB 3MGTA 5F1IA 4P5MB 4X80H 3H2WA 1GXEA 5EUKA 2NW3A 1P7QA 4LIQH 3ULVC 5I8CA 1CFSB 5EWIL 5BS0E 3RVUD 2E6QA 5DQ9B 5D93B 4ESKA 2VXSH 2DDQL 3P9MA 1LP9E 5JNYA 5GGVY 3WNLA 3DVNA 1ETZA 2SEBA 5DMJB 3HRZB 1F42A 1FORH 4QRQB 2VQ1B 1ZLUH 1V7NH 4KVNL 1MFDH 5C0IA 2OCFD 1U91B 3BEVB 2Y25A 2QBWA 3VFRB 2UVFA 3IDXL 1NGWB 4F2MB 4XPHL 1I9RL 1EK3A 4LSQL 2BMKB 2P24B 3DPBA 4X6FB 5I16B 2W07A 4ELKA 2ZG3A 3DHJA 4WWKC 3KPSB 5ISZA 2DQHL 1HXMA 3ZE0E 2DTMH 2P5WB 4LCCA 1OHQA 4F9PC 1T89A 4WI3A 3O0RL 3GGWB 5HD8D 3BN9C 1JGLH 4XP4L 3WDIA 5JOPE 1PG7L 3SCMC 4PJ5D 1IILE 4KHXH 1F2QA 4OLYH 5FYLH 4CGTA 3PWPB 1K8IA 4RFNC 2FX8H 5I1LA 2C4FT 1DUZB 1MFEH 5KW9H 4J2XA 1S3KL 3SE4C 1B0GA 3AY4C 1ED3B 2NY4C 2XRAH 3P0YL 3P2TA 4Y4HB 1F2XK 3O6ML 3QWRD 4M61A 3H0TB 1H3GA 3CZFB 3SGDH 4ZTOH 3K8LA 1RHHA 4HWZB 5DJYB 5FV2A 1D9KC 1IAII 4Q0XL 3O2WH 3NCFB 5DVLA 4WDIA 5TH2B 4UQ2B 5DT1H 1B6UA 1FVEA 1LQSR 4DEPC 4HH9B 4OCWH 4LSTL 2VZTA 3GNML 2B4CL 5HDQH 3HAEA 1I1YA 1G0XA 1I1AB 4LVOB 2EYRB 3CC5B 3MJGX 3U7WH 3LZFH 2AKRA 3QPXH 1AXTL 5GJSH 1ERNA 3H8NA 2JIXD 1OAXH 3OGCA 5EBWB 4BYHA 4NN5B 1MCOL 5HBBA 1KLUA 1K4DA 3NFSH 3PIQA 1J8HB 3FB6B 3EYFB 5CJOH 2B0SH 4H0GA 4KI5D 4NO3A 1D5XA 1UA6H 1NC2D 1DZBA 2NW2B 3RWIB 4EDXA 4GRLD 5DJ0B 2ADIB 1GIGL 1BBJA 3UZEA 5B8CC 3HC0A 3MLXH 4NSKA 1NUFA 4OZHE 2YUWA 1OM3H 5SWSB 3BD5A 4UILH 2X1PA 2XN9A 5ISZE 1YQVL 2DOCA 2XG5A 1BZ7B 2OL3B 1D5MA 3NZ8B 5BCAA 3F7PC 1AQDB 4YHML 2NXYB 3L3KB 4LVNB 3LV3B 1GGCL 3VXSD 1HI6A 3PGCA 5GGSA 1S7TB 5JOEA 3C8HA 3K0WA 1A2YB 4JO3L 1J0KA 3F12A 5F9JA 4HV8B 3PG2A 3WFZA 4D0BA 2YD4A 1QFPA 4KKBD 5SX5K 2YZ1A 1JWMA 4IMLA 3DUHA 3ARWA 3OXSA 1QLFA 3GK8L 2FHCA 1IM3B 1U8IA 5HI3D 3OV6A 3GKWH 1VFMA 3WSQL 1T0MA 3TN0C 1NCAH 1G0DA 1FNLA 2YD9A 2ARJQ 4HS3B 3MLYH 4Y19D 2YPLD 5HYJA 1IL1B 3PDGA 5HPMB 3C60B 4DOHE 2FYYB 1ACYL 4YFLF 2ZUSA 3VH8G 3N50A 1S9YB 1GOHA 1A4KA 4L9LC 2DYPB 1NGPH 4JFZL 4H25A 4EEEA 1IGJB 5CZVL 1PX3A 4OLWL 3X11A 1EV2E 3ALPA 4LKXA 2ENYA 5DRZB 3SKOA 3MGOB 3MUJA 5C09D 5KJRH 1C08A 4JPIA 1UYWL 4NT6A 1Q8MA 2GTWA 1MWAB 5JUEH 1GC1L 2NQCA 4ODXB 4PJFF 4Q7DA 5E99L 5DFVC 4NO2B 4WW1B 4UDTB 1HQRA 2MTPA 5EUOA 4NRYB 4MJIB 3RA7H 4XC3H 4URTB 4QHNA 4G8GA 1KGCD 4Z76B 3LMJH 1F4HA 2GEEA 2R69H 4NNPL 2J8UA 2D0HA 1NQBA 1G9ML 3C5JA 1BIIB 3RTQB 2PW2A 2MFNA 3OKEA 3MNWB 1YEFH 2X41A 1NAMH 5C0AA 4NWUH 2XN9E 3QDHA 2X4TB 4I2XB 3CH8A 3W9EB 5K33A 2AEPL 4P46D 1WBXA 3Q6FA 1VCAA 5DK0B 1IGIL 1GZQB 4HZLA 4Y4KA 1Q0XL 4P4RB 4EIZC 2ITCB 4LARL 5L2JA 1TETL 3HZMA 4G7VL 1Z2KA 1FAIH 2XG4A 5GRYA 4F7PB 1Z9SA 4K7PL 4R4ND 2LU7A 1S7QB 2EXWD 3O45B 1N4XL 3IVKA 1IFHH 4G6AC 4X98B 5IM7A 3U36A 3BEWB 1QBML 2Q7YB 5CP7B 3UAJC 4WEMB 5EU5B 3V6OC 4PRPE 4OGAD 5D7SH 3BO8B 4BJLA 4QOKB 5DJCA 5HYJE 1UKQA 4X7TA 3S35X 2OJZL 4TRPH 4U0RB 3F7QA 1IRAY 2VZUA 4PJ7B 2H3NB 4WO4C 1SQ2N 2W59A 5LJYH 4H5SB 3HC3H 4LBEA 2X1QA 3BX7C 4Q9CA 5DMKB 1S7VB 2F8OA 2VZSA 1TPXB 3NVQA 3V52H 4F3FA 2E27L 1WEJL 1AHWB 5EO1B 4L4TB 4XPAL 1UT9A 2Z8WC 3T3MF 5IB1A 1UB5B 1Q1JH 3QRGL 1W0VA 2QADD 4N8VB 5EUOE 2R0KL 3BAEH 1JBJA 4YHZH 5HHNA 1UVQA 3RVUC 3QUMB 3BH8A 1BLNA 4G8GE 2BVEA 3D3VA 3TO2A 5I30L 4WUKL 4NJ9H 1WIUA 4X7SH 4NZJA 2J8UE 4NDMB 4WFED 3MRDA 5EA0H 1RI8A 3MXWH 5HGAA 5KVDH 5AYQA 5HYIA 3R0MA 5C0AE 4JZNB 2K7QA 4U6XA 5T1KB 3RIFK 5E5RB 5I8KL 3B43A 5T3XD 1KPRB 4N9GB 2V7HA 2FJHA 3RNKB 1CD9B 4ZAKB 3QJHA 4TTGA 3QBTB 3DYOA 4WV1B 3GI9H 1U95A 2YC1B 4XNXL 4WI4A 3QA3A 5SWQA 1DVFB 1MFNA 3KXFA 5CD3B 4UI2A 1U42A 1ND0B 3GM8A 3NGBB 3H9SD 4LSVH 4N0YL 2XV6B 4UT9H 5HD8C 1AI1H 5F7LB 1T2QH 3QO0B 3R1GL 3KWWB 4XPGH 3P0VH 4JG0L 4C58B 5DGQA 2J5LC 3QULA 4WWKA 1QRNB 3WFBH 5KS9B 1UQSA 2LVEA 3BD4A 4OZFH 4LCYB 2BRQA 1A0QL 4JY5L 3DETD 4OUUB 1BPVA 4R2GD 4I9WD 3UZVB 3FO9A 5GGSY 4AIZA 4YPGA 1QKZL 4JB9L 4QRPA 3SCMA 1Q9KB 1NCCL 3TA3D 2VDML 1RPQA 2JK5A 2R39A 4D9RE 1UWXH 3BWAA 2FATL 3WIHA 3IJHB 5CLTA 3EDEA 5DFTA 5EN2A 2E6JA 2VDLL 3ARFB 5I1JH 3RWFB 5F6HI 2HA1A 4YH6A 3ZO0A 1OL0A 4HIHB 3D3VE 1XF3A 5DJDA 4HUUA 3DGGB 1FL6A 1A14H 2R4SH 4K7PY 4NNXA 3ZTNH 4DFHA 4MGXA 3TJEH 3GFUA 4I4WA 3ZT6A 4XVUD 1SMOA 1NFDF 3MOAL 4ZYKA 4PY7B 1J11A 3ULVE 5J1AB 1IC7L 3CXDH 2P5ED 3O6KL 4G8IA 4PJXF 4KI5C 3G5YB 4RGOH 3WE6A 3VE0B 3HLAA 3VXUE 5D2NB 2XQBH 2A9NH 3DO7B 1FJ1A 2CKNA 3L5WB 2IPTL 5I17A 4GRLC 3IT8D 1KIQB 3HMXH 3CFIC 4KMTL 4M93B 2BY2A 3ZL4H 1T5XA 3KXFE 5CD5D 1YC7A 4EUPB 1LO0L 4FNLH 5JR1H 3C6LA 4LDOB 5CSZA 2DM7A 4BQ6A 1XIWB 12E8L 4PJEA 4CDGC 3AUVA 3T4YA 3TPKA 3D85A 1WC7B 2W9LA 1UJ3B