4XI5D

Ghgl of varicella-zoster virus in complex with human neutralizing antibodies
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
225
structure length
208
Chain Sequence
EVQLVESGGGVVQPGRSLRLSCGASGFTFNTYAMHWVRQAPGKGVEWVAVVSDGGGNRYYAASVKGRFTISRDNSKNTLFLQLNTLRPEDTAVYYCARSRGNHYYYGMDVWGRGTTVTVSSASTKGPSVFPLAPALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPTYICNVNHKPSNTKVDKRVEPKSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein H
publication title A site of varicella-zoster virus vulnerability identified by structural studies of neutralizing antibodies bound to the glycoprotein complex gHgL.
pubmed doi rcsb
source organism Human herpesvirus 3 strain oka vaccine
total genus 21
structure length 208
sequence length 225
ec nomenclature
pdb deposition date 2015-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xi5D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xi5D01
4WUUD 4HULB 3A67L 4EUPG 2LE9A 1I8IB 1ZEAL 4FMKA 3RDTB 4Q9RH 4P46C 2FR4B 3T0VA 1J0HA 1A7PL 3EO9H 2C3GA 2IALB 1KULA 1NBYA 4Z95H 5LVEA 4KJPD 1KIQA 2G5BB 4NNPH 4PJDE 5D7IE 4LIQE 5B3JE 1ZT1B 1RJZA 4RGND 2G2RB 3UTPD 3VXMD 5KVEH 2F19H 1CGYA 1R3IH 3HFMH 1DDHB 3GEWB 2Y36L 1CL7I 4FXKB 3TEUA 1KSRA 1HIML 4G5ZL 4PJ8C 2OL3H 4GW4A 3QFDB 2KDGA 2AJYL 3PGFL 1XF2A 5I8EB 3NACL 1U8LB 3C9NB 4NO3A 5HDQL 4O5LL 4PBVC 2A6JB 4JFQA 2EXWD 4XBEL 5ETUA 1YEJL 1Q9KB 4PJ7E 1DBBL 1MHCA 5CGTA 1G7JA 3N9GH 4WEBH 2Y72A 2ERJB 5GSRB 2AJ3A 4N8VB 2P8MB 1MVUB 3L3DA 5JOEA 1TTFA 2NX5D 1LEGA 2IAND 1FFQA 1O0VA 1IILE 4G42B 4BM7A 3RL1B 1FO0A 2DS4A 5HTSA 3P77B 4WI5A 1DBMH 1MREL 5L2JB 5F96H 4CVWA 5IFAH 3CXHK 4WCYH 5D72H 3VRLE 2YD2A 1H3XA 4LSQL 4OCRH 1LQSR 1IGCH 3LEYL 3NIDE 4JVWA 4LLYB 5EZOL 5FA3B 1EO5A 2W0FA 5EFIB 2Z35A 3BDYH 2ADIA 1FZJB 2IAMC 1E6OL 1GGCL 4URTB 1TQBB 4EXKA 2P5EB 3VGAB 5AAWA 3ESUF 1F3JB 4QRTB 3G6DH 4FQJH 4UIMA 3WO4B 2D0GA 1Q9WB 3QDGA 2I07B 1S7TA 1BIIA 1MIEH 4AENB 3WMSA 3QDJE 5CMAA 5KS9A 1QSEB 2X4UB 5F1NA 3WFEH 5FFLA 3QISA 4LMQE 4LVOC 4RMQA 5GGSY 5CEZH 1TTUA 1VGEH 1CFVH 1AXSA 3D39B 2O61A 3ZL4H 4A6YH 4G43B 1LHZA 2GIYA 5IVXA 4Y19E 2OL3A 4OCSL 1S8DA 3VWKC 5FV1L 3FQWA 4LQ1A 4HUXA 4YX2H 3DVIA 4RAUB 4X99B 5HHNB 5JHDA 3T3ME 2MPAL 4OF6A 3VWJB 3QZWA 3DUSA 3FO0L 3QIUD 1YN7B 4KU1A 4LSPL 1WWAX 1U8NA 3OKNB 3U7WH 3NAAL 1JZ7A 1ITCA 3LIZL 3RY4A 3T77B 3U7AA 5KS9F 4KQ4H 4PJXB 5A3IC 2QKIA 5DMIH 3SDDB 4DCQB 2OSLA 4Z18A 1G1YA 3U7YH 3LVEA 5F21B 5KANI 3C08H 4FG6C 2IQ9H 3HG1D 3TA3D 2FO1A 3GSUA 2OR7A 4Y4FA 5HI3D 4PS4L 4YZFE 1IBGH 4LVNB 5ICZA 2BXYA 5H2BB 5F7WC 1DUYB 4H5SA 3QFJB 4P2RE 2DDQH 5TDOA 1GAFL 4X9GA 3RBSA 5J6HB 1FO0L 3EDDA 1IL1A 3QEQD 4IOFC 1T5XB 4OGZA 3KPLA 2DJUA 4OI8A 3DI3B 1NAMH 2UV3A 4JY6B 5IROC 4KTDH 4HBCL 1TMCB 3F12B 3OKLB 4ZOCA 4PJAB 3N85L 1WCQA 3FTGB 1BFTA 4M6AA 1OP3K 1X5AA 1S9KC 5GJSH 3WNMA 1F4XH 5I66A 3RWJA 4X5XA 5K9OA 4P5TC 2XTJD 2R0WH 3WHE0 5BZDB 4XPTH 3B4NA 3QUYB 5C08E 5C71A 1CD0A 2UZXB 1LO5B 5DC9B 1NCDL 3HZMB 3W0WB 3OXSB 4LNRB 3WFCH 5EZIL 3IDJA 1AI1L 3BP7B 2I9TA 1A4JB 2GSGB 3MLSL 3EHBC 4C56A 2PYFB 3QQ9D 4BFGA 4A6YA 2YMXH 5FDWB 3FT2A 4U1KB 3QXVA 5I1AA 1YEHH 3ARFB 5IHLB 3PABB 2XNAB 2DKSA 4R2GD 1NGZB 4RWYL 5DSCB 3RWGB 4OQTH 1KG0A 2BOBB 3ZHKA 2CUIA 4HKBA 1JZ8A 4I48B 4KTYA 3KPSE 1SMOA 3K4AA 1BPVA 1UKSA 3TJEH 3ZTNL 1WTLA 3LV3B 2JF1A 5JXEC 3IDYC 3MCKA 4K2UH 1WWBX 4F9PC 2LAGB 5EU6E 4LLUA 4P2OD 3S7GA 3H9SB 2OYPA 4X6BB 1I3VA 1DBAL 5T3ZD 3HC3L 4JDTL 5EBMB 2VN7A 2EDDA 5I1DA 2FZ3B 4HJGA 4K55A 2CDGB 4NJ9L 2BVPB 4UQ3B 1QP1A 1PLGH 1LEIB 4GS7B 5MEQB 3W2DH 2NY4B 2AEIT 2YEZA 4POZD 4WEUD 5FYLH 3WN5C 4JFXB 3MV9E 5K33A 1T21A 5JW4N 1BAFH 5I75C 5TGBB 4JREB 5DLML 3KPQB 1U8HA 3QPQC 3CX5J 5B8CA 2YR3A 1AGEA 2UWEA 4RRPA 3HI5L 1G7IB 5I1IL 1JPFA 2PW1A 5EC2B 1FZOB 3BRGC 2VDPH 3QIBB 4QHKI 5I8OH 3TZVD 3C09C 2DTMH 4JCMA 3ARDB 1T83C 3O4LB 1OPGL 2CLZA 4TUOA 1XF4B 2CUMA 4C55A 5IBUG 5LXGH 4JZNA 1EV2E 2DQJL 2Y5TA 2DI9A 3M8OL 3ALPA 3G6DL 3GJFH 5TH2A 3NIGE 2EKSB 4PJBB 1JHLH 1I1AA 1K2DB 2G60H 2J8UB 4WUUB 3CXHJ 4BUGA 3ULUC 1H3UA 1ND0B 1FAIL 4PRBA 2Y7QB 2UWEF 3VFRB 5F7NC 1MNUL 3MFGB 4ZSOE 1N64L 4NM8L 4J12A 5IJKC 4X6DB 4YQXH 4OQTA 3U0TB 3GSVB 4YHYC 3BD5A 4PGBB 5HPMA 3D3VE 3VXMB 1D3CA 2A9NL 5C6TH 5J11C 2XIDA 1KPUB 1WLHA 2VDKH 3MOQA 3AGVA 1U6AL 4ZQKB 1B2WL 4OFYA 3TJHD 1JGUL 4MHHI 4IRJB 5F9JB 3WFBH 1RHHA 1SM3H 3U7WL 4PRAB 4JG1L 1XGRB 1I8MA 4XZUB 5A2IH 1RIUH 3INUH 5C9JB 1QFUL 1S7RA 4YBLC 2FLBT 5E8OA 1Z0NA 3E1F1 3DIFA 4HIJA 2XPGA 4N0UA 4RX4A 1X4XA 2AEQL 4DN3H 1CI5A 1RIHH 1G6RB 5DYOA 2NX5B 1GGIH 1EJ6A 3RTQC 3BUYA 4KZEH 1NC2D 3KPNA 1WC7A 2IANB 4PLKC 4ZUVA 1V7ML 4LASH 1K8DB 1KB5H 1IC4H 1FZMA 1MJUH 3QDJD 4N90E 4Y5YB 2DN7A 3DMMB 4OZHE 3HKFA 4XAWL 3K2UL 3LPGA 3L7EA 2AW2A 4JKWA 3RGVA 1U93B 2DWEA 4M43L 1CT8B 4LBEA 4ZUUA 4NHCL 2P8PB 2V17L 3FCTB 1IKFL 5E6ZA 5BVJA 2F5AH 5M7QA 3GJFA 2GITA 3KPPA 4R4BB 5TQ0H 1NCTA 1RZJC 1UENA 1T6VN 2CIKA 4KPHH 3MLRL 5E99L 4ENED 2IH3B 1LEKB 5EBGA 4Z8FL 3PP3H 1NL0L 4G3YL 4FTVA 4XNZC 4D0DB 4YHNB 1EHLH 4PJDF 4HQQH 1CLYH 1OGAE 5B3JF 3BAEL 1JNNH 3IXTB 3VXUA 2C1OA 4DK6A 1BX2A 1BVKA 3GNML 4UQ2B 3T65B 3NTCL 5DQDH 4LAQL 2YOCA 2YMXL 5ALCH 3OKOA 5I15H 1ORQA 3E6FB 1U8IA 4X8JA 1GZPB 1E6JL 3H3KA 3O11A 2R1XB 1OTTD 2VQ1A 4NT6A 3HE7B 5KSUA 4KMQA 3V5DB 1S9YA 4AT6B 5DJ0A 3EYUL 4KRNA 4PJ7F 2EECA 5IB1B 1XEDA 5I1JL 3QIUB 1K5NB 5IUSA 5D93C 2ITCA 3RVVC 4F7MA 1QEWA 2OTUA 1ZA3B 3L5XH 3K1KC 3LRSB 3IVKA 1J8HE 1RV6X 4MCZA 4ODUA 4XMLH 4LLWB 4U1SA 3TV3L 1EZVX 1X9QA 4Y4HA 5EOQH 3TBTB 32C2B 1RURH 4BUHA 3HG1B 4G6FB 4ZUTA 3TA3B 5DR5L 1A4KA 4U6XA 3VRLF 4GKSA 2QL1A 1KB5A 2QQNL 3TVMC 4I2XE 3KPOB 3NIDF 4M6MH 2P1YA 1G7HA 1S7QB 1DVFC 4YHML 4V2BA 3RAJL 3TO4D 2AJZB 4KROD 3SKJH 3VG9C 1A9BB 4LIQL 4Y19A 5JW3L 4Q9QL 3P4OA 5T5FL 3ROLA 5I16A 3AFLA 2ZUTA 2ZOKB 1J87A 4Z7NE 4NUJA 1VSCA 4HXAL 3QP3A 4HWEL 5ERWA 3C60A 5DJ6B 1RZGA 4YO0B 1CR9H 1H8NA 3KVQA 3PIQA 4YPGB 4LCIL 3CCHA 4ZOAA 1Q9OB 4KK8D 2XTJB 1JHLL 2JK5A 2G60L 3RZWA 1TZGL 2X1QA 2MQ0A 2IFGA 3TLRA 4GQPH 4QOKD 1FG9C 4FQ2L 5INDA 4MNQE 3N1GC 3TT3H 5KSVB 1H9VA 1UB5B 5DJCB 2COQA 4JY4B 2V2TA 1GIGH 4RMTA 4P2RA 5LWYH 3SDAC 5C7XH 5HI5C 5J13C 2XFXA 3T3MF 3X14A 5J7CC 3T1FA 1OD9A 2VIRB 4KVNL 4XNUL 5ANME 1DJSA 2FD6H 4ONHA 4R2GB 1LO2H 5EC1B 1A3RL 5A16B 4NCC1 4MA7H 4PJ9D 3D85D 2MSPA 3GSWA 1A0QL 3RA7L 1ZT4A 3BQUC 3S37L 2AI0H 3WFDL 4U0RB 1B88A 2I60H 3OKDB 4TVPD 1IM3B 3AAZB 1UEMA 1CDJA 4ODVH 1X5JA 1D6EA 1IGYA 4P2OB 1WCBB 3CMOH 1CGUA 1IAKA 2DQDL 4YZFF 7FABH 3QDHA 1AGDB 5C08A 4G6AC 3TBVB 5CD5D 3DVGA 1MCLA 1MCEA 5FYKD 4JVUA 5I18L 1YNLH 4EEEA 3EGSB 3HTLX 1H3PH 1PX4A 3QIWD 1T7WA 2H1PH 5AEAA 1CYGA 5SV4A 5CLWA 2MCPL 4OLYH 4KZEL 5IBTH 5HJ3B 4C57C 4BFBD 3S5LA 2AJUL 4DQOL 2Z92B 5HGHA 4EUPB 1J0IA 2CK0H 1RIVL 5DK2B 2ARJQ 3MUJA 1DSFL 1HE7A 3DUUA 4HK3J 1FC2D 1P53A 4J2XA 1UQSB 1KCUL 2PR4H 5A2KH 3CFCH 1OAQL 5GS0L 1BIHA 1HH6A 4ISVB 1CCZA 2F5AL 3D3VD 3UTTE 1VKXB 4M5ZL 2D9CA 3TZVB 3UJTH 4M1DL 5D2NC 4OB5H 3OJDB 5GGRB 4JFFE 5KOVC 4U1HB 1AKJA 5DD6A 1G7MB 1EAJA 3B5GA 5E08H 4LPUA 1VADA 3HMWL 4QXWA 1ZLSH 5CJXA 1DBJL 2VITB 3KHQA 4KTEH 3U46B 4OFKA 4OGXL 5EWIL 2HYMA 3P9WB 3QI9A 4ZTOH 3WYRA 2DWDA 2Z4QB 2VH5H 4NN5B 2IC2A 3R06A 1Q72L 2YPLD 4O58L 2NY0B 3MV9A 4MS8D 4JPVH 5LQBH 1F42A 2LVCA 4Z7QE 1NFIA 4HT1H 1HHKB 3G04B 5AZEL 1CFTA 5IOPA 3PUCA 4Z0BH 2R39A 3PHOA 5EUKB 1GL4B 4N90D 4X7SL 2I27N 2RBLA 1FFNB 5C0NC 4PJGE 5D2LB 5KBNC 1N2RB 4F7TB 1F4YL 5JW4Q 2A77H 5JQ6H 2XA8H 2BVUA 5F44A 3MRRB 5I1KL 1CL7H 1T22B 5D1QA 5DWUH 4KMLB 1CD8A 5TJWK 3BPCB 3LRGA 1NJ9B 5I8CA 3O45A 1A6WL 1FIGH 1NC2B 2AAVA 5IT2L 2PO6C 3X3FL 1AO7E 1XCQB 3AS3A 1LK3L 3GSOA 1Z3GH 3SKJL 1PBYA 1Z9OA 4QHNA 2Y23A 2XN9A 2X89D 3LZFH 5DJXA 3FB7B 3NCFB 1HWHB 4L4JA 4L3EA 4P46D 4XCEA 1FVCB 2VZ1A 2P47B 4XAKE 3EJZC 1M7DA 2K9UA 3NIGF 3CD4A 4H0HB 4NCDA 3TCLB 1GPOH 1PX3A 1YZZA 4PGDB 3KG5A 1KPRB 4LKCA 3WIIL 1EAPB 1CR9L 1G9MC 1MCPH 5T3XH 4Y5XC 1N8ZA 3MLUL 5L6YL 1TLKA 2VQUA 4N0YL 1FFOA 3KYKL 4JKLA 5CSZB 4WV1C 3D18B 3ZSTA 3VXTA 4MB5A 3ARGA 4PJ8D 3O3UN 5FV2A 3DX7B 5C9KA 4WI2A 3MMEA 4LVEA 1FCCA 2ESVA 4JM4H 1JWMA 1GYAA 3ULUE 4F8QA 4XP1H 3V8CA 3Q6GH 3UPRA 1A6AA 2QQKH 1FGNH 3FB6B 4U1IA 4HLZG 5C0RH 4PV8B 3B2VL 3HB3D 2FJFB 2CDFB 1LO2L 2UYLA 4UT6H 4M9PA 4NC0B 4K7PH 4KAQH 5C2BH 4KMTH 4MA7L 4JFED 3BVNB 4P23C 4XCFH 2J2ZA 1W72H 2XWJA 3X3GL 4OLVL 2PYEE 1FGVH 3MA9H 3WIFA 4XVTH 1I7ZB 1R6VA 3T2PA 2VABA 3FOMB 2V7NA 3IF1A 3PP4H 7FABL 4LQFH 4K3GA 1B0GB 1DBKH 5LGKA 2OQJB 4DEPC 2WSKA 3WSQH 3FN0H 5MERA 1OGAA 1OAZH 3FB8A 5J1TC 5FCUH 4JPWH 1TPXB 4OZHF 2IAMD 1KJ3H 2FYYB 2NY3C 2JJUA 3TNNB 5E5MA 2Q86B 3V6OC 3ZHLA 1FYTE 3TO4B 2OJEA 4FQXC 3EYSH 5C0CB 2HVKB 5F9OL 3GMOA 3Q5TA 1CE6A 1KEGL 5ITBL 1WZLA 3FQRA 3JTSB 4OBSA 5D6DC 5FB8B 4KJQD 4XVUD 1KLGB 1T0NB 3Q1SH 4CMMB 3UJTL 4OB5L 1CD9B 4GSDH 1OP5K 1F4AA 3MRHB 3RWHA 4IIQA 1LP9B 5JA8B 5EU3B 4U1NA 1MUJA 1N59A 8FABB 1S5IH 5HHXL 1FDLH 4MNGA 5CBEA 4K8RH 5EBLA 5T33L 5C0DB 3RIAF 4P5KA 3QUMA 1DQDL 4WWID 4QOKB 1UCBL 1JF5A 1NCBL 4MGXA 1DR9A 4NZRL 1PEWA 3T8XB 5IV2A 4LHQB 3WE6B 2Y07H 5E6IA 4RA0C 3TH3T 1UH2A 1UEYA 5C07D 4AL8H 1N4XH 5FO9B 5A3ID 5DEGA 1RUPH 1T4KA 4FG6D 1JTTA 1W72A 2YD3A 2IGFL 4HC1A 4PJ9B 1I9IH 4Q0XH 5IMKA 3JWOL 1R3JB 4H8WH 3IDXH 1I8IA 3RDTA 3ARBD 1FRGL 3O2DL 4HUUA 5ENWB 1UG9A 1BECA 2PXYB 2IALA 4FFVC 4GUPB 1FLTX 2G5BA 1WZMA 4YWGL 5DJZB 4JFFD 1JN6B 4JFDE 2M1KA 2P24B 1ZT1A 5CHNB 1F3DJ 1MCOL 2G2RA 1NBVL 4TTDC 5BO1L 5IBUB 1H3TA 1X44A 3U48A 1DDHA 3IJHB 2L7UA 4FXKA 4PY8J 2X9WA 1AJ7L 1FORL 4G6MH 1VDGA 2IBZX 4HK3N 4P5TD 3DNKA 3L3JB 3OF6D 2E9IA 5I1EH 4RBPK 1V3JA 2F53D 3QFDA 4MNHB 1YQ2A 4NPYB 4Z7NF 1T7XA 1AP2B 2VLKE 4UNUA 5I8EA 1U8LA 2H32B 3C9NA 4M93C 4YBQC 3QUKB 1MQKH 2WLZA 2A6JA 5DC0A 1RPQA 4MB4A 5ADOH 4QRUA 4RGMC 3IT8D 3BIAX 3EHBD 3LPFA 5C0GA 1AD9A 1MCKA 5GSRA 4N8VA 3X11A 1MVUA 3EOYG 5BV7C 2KBGA 4O4YH 3K81A 1TETH 2NXYD 3QEHA 5FUOH 3RL1A 3CPLB 3P77A 1JV5B 1OB1B 2BRRL 4OGAC 1OVZA 1QUNA 2AQ3A 3HNSL 1S78C 3P0YL 1TQCB 3O9WD 3QUML 4UV4L 2X05A 3SE3C 5JXED 3L5WB 2YPLB 4LLYA 4JGMA 2QQKL 5FA3A 5EFIA 4C54A 1EFXD 1FZJA 4NKMB 1LMKA 1XF1A 3NCBB 5HYSB 4WNQB 4OJFH 1S7UA 3JV5A 5FF6B 5JZ7D 1F3JA 5DURB 1AO7D 4YHOL 4ZODA 3CDYA 3LCYA 2Q87A 4HC1L 3UTTA 1FNSL 4OAWB 4KKCC 1Q9WA 4ZS7H 3S3SA 1HCVA 3SDXB 4D3CH 5FYJD 1HYRC 4AENA 1YQVH 3O41B 1JRHI 4O51B 3PHQB 2W59A 1QSEA 2X4UA 3QPQD 5C0BB 3W11C 3MLXH 3HI6H 4CADB 1DP0A 3EOTL 3PXJA 5F8QC 3GM8A 3LN5B 1KGCE 3D39A 4S1RL 3DXAD 4ESKA 2FLRT 4G43A 3BISA 3FT4B 2EO9A 3L95B 4JQXA 4GAJH 3GBNH 5T1MB 5DVLA 4IS6B 4F2MB 4RAUA 4GW1B 4X99A 5HHNA 3T2NL 4E0RB 3P30L 3QYCA 3CSBA 1I3GH 3H9YA 1YN7A 3EYSL 4QT5A 1LD9A 1R5IA 3OKNA 4HF5H 1DN2A 1REIA 2EH8L 3T77A 3SDDA 2H8PA 4GXVL 5TE4L 4DCQA 1NAKH 5I1CH 1F11B 3IAQA 2ZUSA 3RX8A 4ZAKB 5FAAA 4XC3H 5GGSB 1RMFL 4YH6A 2WIMA 2FX9H 4QEGA 3L7FA 1I3UA 5SX5K 4D9RD 5HHQB 5D2NE 4MJ5B 5H2BA 3LHPL 1DUYA 5DFWH 3QFJA 5IESH 3FMGH 4DW2H 2A74B 1I7UB 3VFUB 2E6QA 3IDMB 3RKDD 4ZFFB 1T5XA 1O7VA 5CP3A 2EICA 4PLJD 3CK0L 1XGTA 3OKLA 4Y5VC 2WP3T 4FQPA 4PJAA 5DD0L 4PJGF 1CD1B 3O6LL 4Q6IA 3JXAA 1MRCH 4FNLH 3U6RB 2R2EB 4LRNH 2P43B 4WW2C 3GHEH 1T04B 3K4DA 2G9HB 1FYTD 1NFDE 4JFEB 2M2DA 1MY5A 3QUYA 3RTQD 1FVDA 1KELL 4PLKD 1U3ZA 1LO5A 3WNPA 3GMNB 3HZMA 3W0WA 3OXSA 3OR6B 4LNRA 4OUUB 4M7LL 3VFNB 4E41E 3BP7A 3CLEL 1A4JA 2GSGA 2PYFA 4X6EB 1RZFH 3MA7A 2VQTA 5D7SL 3GMLB 1WZ1L 4OZIB 4JG0L 4IDJH 3ARFA 1I8LC 3PABA 2XNAA 3PQYE 3PWJB 3BP6A 4PJAF 5GRWA 4DTGH 1NGZA 3RWGA 4LSUL 4MXWH 3RBGA 1RSFA 4CN6A 3ZKNC 1NANH 4I48A 1MLCB 1QTYT 5AG9A 5I19L 4RMSA 3LV3A 3QHFL 1Q38A 4FQCL 3IU4H 5DHVA 3W39B 35C8L 5EZJB 2LABA 5DQ9B 3FL7A 3D1MC 5GRVL 2O5XH 1UYWH 5C0FB 5EBMA 4YDIL 3RVUC 4WI7A 2CDGA 2BVPA 4NFDA 4YFDB 3SE4C 1EEZB 5GHWH 5GS2D 3RWDB 5MEQA 2BSRB 4JFXA 3ULUF 5GJTH 5H37H 4LLDB 4NP4L 5TGBA 3ALWA 4M7ZC 1WZKA 3SBWC 1TVDA 3CGTA 4XWGL 3MV7E 4J7RA 1KFAL 4TSBH 4D0BB 2YXMA 2EDKA 3RVVD 5EC2A 1FZOA 3GUTB 3QIBA 4HUWB 5DEZA 1SEBB 5C07B 4JRYE 3I6LE 3ARDA 2QSVA 3O4LA 3S97C 5D7LE 4L8BB 3AY4C 3L1OH 4XX1G 2FX8L 3HUJB 2OM5A 1NGQH 2PTUA 3ARXA 4I3GA 1G7LB 3NABL 1MHHB 2EKSA 4PJBA 3TVMD 1K2DA 2VLKD 4JZJB 3M17A 2IH1B 1H5BC 1JNHB 4OM1H 3S8WA 4PB0H 3ARBB 4OZFA 2XG5A 4JE4B 2F5BL 2Y7QA 3VFRA 2ADGB 4JLRB 3CFDA 1BM3L 2GW5A 2VLJD 4AEIH 4G7VH 4AQ1B 4X6DA 1C5BH 4C58B 3QO0B 3GSVA 2OBGA 3V7AE 4CAGA 3AS0A 1VGKB 3N50A 5EUOB 1F02I 3VXMA 4BKLA 3FFCD 4Q7DA 1ZHLB 1KPUA 1PG7W 3G5YB 4TOYH 1D5BB 4DGYH 2MHAB 4ZQKA 5DMJB 5F3BB 3HPJA 3MACH 5ILTL 4IRJA 3ULUL 1KPVB 1G9NH 1HOCA 2F53B 1J1OL 4QHMA 5F9JA 3MBED 3SKOB 4U1GC 5CJ5A 3UXFA 3UTSD 3C5SB 5JQHC 2NNAB 3V6OE 4XZUA 1KUMA 4FZ8H 3OZ9H 4WFFD 1BF8A 2VN4A 5C9JA 4MDIB 5JHLL 2X4NB 1I1RA 3PWPE 5DMKA 2HJFB 2VJXA 4XC3L 4U6HB 3SDAD 5A43C 3LQZA 3MODL 1WV7T 1G6RA 4NZTL 2NX5A 4UTAL 4KKLD 4PREB 4OM0H 4BZYA 2X10A 2IANA 2NXYB 3FQNB 4PR5B 1K8DA 3BHBB 4IOSD 2VC2L 4F15C 3BQUD 1MI5E 3FO9B 1FIEA 4Y5YA 5ESQB 3DMMA 3PJSA 4O9HL 2WBJC 1U3HC 3O9WB 3I85A 4PJIE 4X9HA 5KSBE 1U93A 3PL6B 3BKCH 1CT8A 4JHWH 1R5WB 2P8PA 3FCTA 4K94C 2FATH 3MROB 3UTZB 1JFQL 4G6AD 1EFXB 1EX0A 1QSFE 3S35L 4R4BA 4F37K 1JGDB 4LGPB 3M1BB 4Y2DC 3HC4L 2IH3A 5D71H 3NGBB 1LEKA 3GO1L 3UBXI 3MRBA 3IFLH 4QNPE 4YHNA 2VZUA 3QR2A 3P11H 5MP6L 3IXTA 5DGRA 4YDVA 4WJ5B 4Z5RB 1G0YR 4D9LL 1S7VB 1INEL 3LKQB 3NZHH 3I84A 5B38B 3T65A 2HT4C 4XNYH 1AIFB 5KAQF 1NLBH 1UM4H 1P7KB 3LN4B 4LSVH 3O0RH 4ZG1A 2ZCKH 3E6FA 2UZIH 1U2CA 1GZPA 2AXFB 2QSTA 5E8DL 5L9DL 2B1HH 2R1XA 3DI2B 1IAIL 3DXAB 5EORL 3C09B 1M6OB 1VPOH 2OLDA 4NRXB 2NY5H 3HE7A 2PCPB 3RNKB 1TJIL 3K74B 3V5DA 4GAGH 4AT6A 2ED7A 4X80H 3ARUA 4OCMC 1JP5A 2AVGA 5IB1A 1MHEB 4LSDA 5EA0H 3QIUA 1K5NA 5EN2B 3S3PA 5KW9L 5ICXB 3K3QA 1QBML 2C5DC 4JO3H 4UILL 2EXYC 1E4XI 4XT1C 1BFVL 2X70A 4PD4K 4CN4A 1ZA3A 3BEWA 1UKQA 2X4QB 2DQGH 1RZ7L 3LRSA 2IADB 5FOBA 2VLMD 4OIAA 1XR9B 2RR3A 1JHKL 5DD1L 3TBTA 1S7XB 4KJWD 1CGTA 1FJ1B 32C2A 4POYA 1YNKL 1VFOA 5T3ZH 3TA3A 4YHYB 1D9KD 3EZJB 4L3CB 3P40A 3QNYB 3OWEA 3KPOA 3TPUB 4GOSA 3MRKA 2C4XA 1G6RL 1S7QA 3H6JA 2P5WB 4WU5B 2HVJB 4E41D 2AJZA 3Q6FB 1RK0A 1T3FA 4DVRL 5IQ7L 1G0DA 2XKUA 4R96B 2QSQA 1C5CL 4EUPH 3O3EB 1LDPH 1YY8B 2VDNL 5HYEA 3RP1A 2HKFH 3H0TB 3LMJH 5DDHA 3IDIB 4RFEB 5KTEL 2YUXA 1AXTH 3OB0K 4NRYB 4QCIA 5E1AB 4YBLB 1DFBH 3L1OL 5DJ6A 12E8L 4YO0A 4ONGL 4YPGA 1Q9OA 1VFMA 4KKBD 1D5XB 3VI3E 3B9VA 3CLFL 1OTUC 5FOJA 5IB5B 3GMQB 1LO0H 4OM1L 4UAOC 5HHVL 1GVIA 5BCAA 1ETZB 3PV7A 1A1NB 5KVMC 3O6KH 1VENA 5KSVA 1UB5A 4JY4A 3ZLQC 1B3JA 2OP4H 4QY8B 4TRPH 4N1HB 3CFEB 3OAYK 1RUMH 4KK5D 3I6KB 3DYMA 3EJZD 4ELMB 4YC2C 3ARTA 3C6LC 4S10A 4LSRL 5A16A 1YY9C 1YEKH 3D2UD 3VFWA 3GI8H 3OKDA 4KQ3H 3AAZA 1G9NL 2APFA 4XCNB 4X5WB 3V52L 3F7PC 1NBZB 1L7IH 5CFHA 2KL6A 1WCBA 1TJGH 2ZSVB 1G0XA 1AGDA 3DV6A 5D7LD 3SO3C 3TBVA 1INDL 4MMZC 1FNHA 4I0PA 3G5ZB 2XZQL 4W4NA 4X9BA 3EGSA 3G6JB 1UZ6E 1FPTL 1CDIA 5HJ3A 5HHMB 4QHUB 2Z92A 2V2WB 5E7BA 5FHBL 2R69L 2DQFA 5DK2A 2HLAB 1CLOL 3MJ8B 2B2XL 3ZSSA 2CJUL 2Z31A 1UQSA 4O02L 3RI5K 4MMXC 5HHOE 4WWKA 2YA2A 1KF9B 3EJJX 4ISVA 1NFDF 4P4KC 3VGDA 1I7RB 1XGYL 4WENB 3TZVA 5DGQA 3EIFA 5M94B 5GGRA 4U1HA 2R56L 2QBWA 4KDTC 1G7MA 3MR9B 4NUGH 3GB7B 1JF1A 1O5DT 2BNUB 4I3RL 2I26N 1ZLWH 1YEEL 2HRPL 2K1MA 3TVMB 3FHQA 2VITA 3PGCB 2NY3D 1A7NH 2VXVH 5EO0B 3SY0B 3K4ZA 1YMME 3QXDA 4X4YB 5F7EH 4HIEA 2Z4QA 1BFOB 3C8DA 4FQXD 4QRPD 3ES6B 1AC6A 3PWPD 3VG9B 5I6XB 3HNTH 3Q0HA 2VLJB 1N5YL 3IGAB 3ULVC 1BJMA 2A6IB 3FQUA 3M45A 2B1HL 2FIRT 4KUCF 3VXSE 1UM5H 2HKHH 4Z9KB 3WFHB 1EO8H 1HHKA 3G04A 3FFCB 3RY6A 3MZGB 5IW1B 4MD4B 4HWZA 5BQ7A 3QA3B 1KLUB 1MRDH 5EUKA 2JB6B 3K8KA 1FFNA 4LCYB 5D2LA 1N2RA 4F7TA 3MBEB 1CFQA 5K9JH 4YR6B 4XHQA 3UTSB 1ROWA 1OL0A 3MRRA 4IM8A 4JY5H 3HE6A 1V3MA 1CGWA 1RULL 3D9AL 3QJFB 4JRXE 3UO1L 5HGDB 1QSFD 1IAII 3TT1L 3RRQA 2X7LB 2VR4A 3SDAB 4R7NB 3V95A 5J13B 2DMKA 3MXWH 4G80A 4EBQH 4L4TE 2IQAB 2D31B 1NJ9A 1FHGA 1NCAL 2RCSL 1HK6A 2ARJB 4OLWL 5DQJB 2XRAH 1NC2A 4RZCB 1I7TB 3LQAH 5FA4B 5F6IC 4JHAH 3QBTB 1UXWA 4J3UA 1HI6A 4IRSB 3FB7A 4I8DA 4PD4J 4PGCA 2HKFL 1FVCA 5SX4I 1DUZB 4IJ3C 1R5VB 3KPMB 3EO1B 4FFVD 5KVFH 4MLSA 1KPRA 1C7TA 1Q1JH 1FN4B 1EAPA 4TTDD 3KLHC 3OXRB 2J88H 2IEPA 1L7TL 2J3SA 2DQIH 1ONQB 4XPGL 5CSZA 1F97A 3D18A 1RJLB 4JFZL 4HPOL 3B2UC 3WHE1 1WQVT 1A6VL 1FNEB 4NN6B 4YBQD 4M5YH 1ACYL 5FGRA 3UZQA 3R0MA 4ODWB 4DVBA 1PKQE 1RUML 3DSFH 3BYTA 4PV8A 4ZMAT 2FJFA 4YAQB 5JPMB 4WO4B 4QTHA 1KCKA 5KSBA 4TULH 5BVPH 1JRHH 5D1XA 3I6GB 3BVNA 4TUJA 2QR0B 4EDWH 2UZYB 2NW3B 3OTTA 3TFKC 2DRUA 2A6DB 3BGMB 4JHZA 4I9WE 4OGAD 1I7ZA 3EFDH 1XGQB 3GBML 4U7KA 4OD3H 5TE6H 1QACA 4TVPH 1S78D 4G8FB 1DQML 4RIRA 1ZLUK 1VEPA 4MJIE 3F8UB 4F33A 2OQJA 1AR2A 1UVQA 4X6FB 5EBWB 4UIKH 1DL7L 4F57H 3F6IA 4QYOB 1D9KB 4OT1H 4XI5C 5KSBF 2IPUK 5FYKH 1WBYA 4LSSL 1KBGL 3SCMC 1T1WB 2HN7B 1KENL 3S6CA 3WXWL 4IMKA 3TO4A 5JO5B 5I73C 1F6AA 5C0CA 2HVKA 4NNXB 4KKCD 3T0DA 3AREA 1U42A 3JTSA 2DQTH 4Y1AE 5FB8A 2H32H 4PJEE 1KLGA 5E2WL 5F7MC 3W11D 1QLFB 2YD4A 4QNPF 1HEZB 3ET9F 1LP9A 2CO6B 5EU3A 2F74B 1V8HA 3LKRB 1KXTB 2HFGH 1OTSC 1NQBA 2N7AA 2LTQB 3LEVH 1AE6H 4OGYH 4GRLC 1M4KA 5C0DA 3DHMA 4XH2B 1OLLA 4QOKA 1BF2A 2FIKB 1IVLA 3T8XA 1L4IA 3WE6A 3DVNA 2DMCA 1YC8A 4CVUA 5F7LB 1X5YA 4HIIB 2BMKB 1QRNE 5CJOH 2G75B 5FO9A 3VU2A 1IEAB 2FJHA 3LN9A 1ZWIB 1IC7H 4M7LT 5GGUB 3JWDC 4NFCA 1JJUA 3HAEG 2C3XA 4X5LA 1JYNA 2GTWB 1Q8MA 1MHPH 5AZ2H 1ZAGA 4PJ5D 1FH5L 1NCWL 3MOAH 2X40A 4DKAA 3D2UB 1GC1C 1KN4H 4NKOB 4MDJB 4YGVB 1R3JA 3P0VL 5IGXL 4NKDB 3MUY1 4P9MH 1NDMB 1UACL 1IGJB 4ZXBC 5HHOD 1SJEA 2X44D 1U8OB 5E94B 2PXYA 1CZ8L 4CVZB 3MRJA 4GUPA 2ZCHL 4M6OL 3GK8H 1JNLL 3I3DA 3QH3B 5DJZA 3VD3A 4AK1A 4LP5A 2NCMA 2P24A 2Q1EA 3NA9H 4LEXL 1MFDL 6FABH 3OKKA 2Q7YB 3UJIL 3DWTA 3IJHA 5HI4C 4N5EC 1UXSB 4RMVA 3UC0L 1EHAA 1ZLVK 5JA9A 3LQAL 1T03H 1OLZA 2YRPA 4R4FL 1WEJL 4UOJA 2DIBA 5FUCC 4B41A 4MNHA 4NPYA 1Y0LB 4PJFB 5EIIB 1IGTB 1AP2A 4PBWD 5LG1A 1JI2A 2GEEA 1S9WB 3QUKA 4GRMB 5F7YC 4P9HC 3RVTD 1EJOL 3MLVH 3CMGA 1FV1A 4P0DA 2VXQL 3VI3F 1JHTB 4GMTH 1N0XH 3H8NA 1MFEH 1S3KH 3TIDB 4AQOA 4LLMB 1MFAL 1ULVA 3MNWA 4NN7C 3CVHL 3NZ8B 1GSMA 3K8MA 3CPLA 5DMYA 5DJDB 15C8H 1JV5A 1OB1A 2NY3B 1OGTB 1GGBH 4UT7L 3R8QA 3MUGB 4WY7L 2X42A 5D1ZC 3O6FC 4FQXB 4JRXD 4ODHL 3UAJC 1XGUB 4QRPB 5JIHA 4JO4H 4UB0L 5DI8B 1F3RB 4RMUA 4HPYL 2VDQH 1HDMB 3RVUD 3F58H 4PGEB 5FM5O 4WNQA 4N0CC 3U4BL 5FO8A 5C8JB 3DPBA 1INQB 2DLEA 3QUZC 3ETBF 1P4LB 2NY1D 3SE8H 4OAWA 3BT2H 1UKTA 4X7TB 4MQXD 3SDXA 4K9EH 4FA8A 4QXUL 1ZANH 3O41A 4R7DB 2A1WL 3PHQA 4O51A 3OAZH 2R0ZH 5C0BA 1UZ6F 2A2QT 3CXDH 1R24B 2DLTA 4CADA 3LQMA 4XP9H 5D5ME 4U7SA 1RVFH 2VDML 4FZEH 1FSKC 3LN5A 2HT3C 3KJ6H 3RWIB 1YMMA 4I1NB 1CQKA 1P2CB 2X4SB 3SDYH 3FT4A 3L95A 5T1MA 4IS6A 1XF5B 3V6FB 4F2MA 5IB4B 4GW1A 3REVB 1Z9MA 5E8PA 1KYOK 5I2IB 4E0RA 2YBRB 3SKMB 3AM8C 3VXSA 2DM4A 1CDCA 3AUVA 2X89A 1JZ4A 2IPUG 5DVNA 3RPKA 3O8XC 3BE1H 4DGVL 4XPBH 1Y18B 4RCAA 1F8TL 1F11A 3U4EB 1MJJA 3LB6C 2CXKA 4ZAKA 5MEPA 5GGSA 5A2JH 2D4DA 2DL2A 4LARL 3EBAA 4LPVA 4R26H 1B4JL 1YECH 1IC5L 3I50L 1QBLL 4NM4H 5HHQA 4K3DL 3MRLB 1Z5LB 1KLFA 4MJ5A 3CSPA 4JZOB 4PY7B 2E3VA 5EG6C 2P44B 4GRWB 1ADQA 1BQUA 3TH4T 2VB5A 1I7UA 4OZGE 5BMFH 3VFUA 2AK4D 3ZKMC 2H26B 3IDMA 4ZFFA 4M93B 1FNGB 1GHFL 4XWOC 5C2UB 4RAHA 1CDHA 3B9EA 1HSBB 2DICA 4RGMB 5EU5B 1CD1A 3CSGA 5IF0B 3HZVB 3U1SH 3N1PC 2MWCA 4AEEA 1CU4H 4FABH 3CUPA 1T04A 2DIAA 4JFEA 5GIRB 5I74C 1CICA 3RWCA 5BV7B 2DYPA 2CR6A 4ZPVB 2MKWA 4YHPA 2VAAB 3GMNA 1GOFA 2PUQT 1NMBL 3OR6A 4YPJA 4OUUA 4OTXL 5GGVY 4CU6A 4JJ5B 1IKNA 3WLBB 1U3HD 4TYUA 3VRJB 3B9KC 4X6EA 5K93A 1AHWC 4DK3A 3V4PH 4OZIA 4AZ8A 4LLAA 5IIEA 1RFDH 3PWJA 3MCLL 2E7CA 5DUPL 2V5RA 4MVBD 4OF7A 4UDUA 5IW6B 1A8JH 2WQRA 5D7JA 2ZCLL 4Y2DD 1MLCA 4DGIL 4HFUL 1CF8L 5T1DH 3BH8B 1I1YB 4CJ0A 5E9DE 2FEDD 5I1HL 4APQD 1QR1A 1H3WM 1KT2B 1MCJA 3W39A 3WS3A 4PJCE 1OD7A 4XCYA 2Q6WB 1QFWI 2NTFB 4KHTL 1U8JB 3QRGL 4NDMB 2IG2H 2M8XA 5C0EA 1S7WB 1P7QD 1UB6A 2B4CH 4OZIF 5JR1L 1YEFH 3OGOE 3VDAA 1QHPA 2YD9A 3MLTB 5C0AE 1EEZA 2XZAL 3RWDA 2BSRA 4MJIA 1A21A 2E27L 3QCTL 1MH5B 1NMAH 2WIIA 4LLDA 1K3ZA 4K3EL 4WFGD 5GZNC 3FAWA 4GMSH 4D0BA 1OM3H 3BI9X 1ADQL 2OR9L 2EXYD 2ITDA 3B83A 3MJ9H 4IOIB 1F58L 3RL2B 3GUTA 4HUWA 4J8RB 1SEBA 4LLQB 4U05A 2AJXH 1WAAE 4GG6B 1H0DB 4NQCD 4OZ4B 1JI1A 4HXBL 4MQTB 4NKIH 4AEFA 2BNRD 4PJ5B 1E28B 1IGFL 4Y1AA 3IFPA 4KV5E 1MHHA 5B21A 3THML 3E2HC 4JZJA 3F5WB 1QR4A 2E6PA 2IH1A 5HDBF 1JNHA 5SWZD 1N6QH 5C92A 4PB9H 4DN4H 2VLRE 3ARBA 4P59L 5D96C 4RAVB 3PDOB 1RUQL 1X5ZA 1K85A 3A6CH 2ADGA 4XP9L 4WI9A 1DEEB 1L0XA 5HVWA 1MEXL 5FYJH 5K9KB 3T08A 4Q58C 3QO0A 5E2UL 1HXYB 1VGKA 1NC4D 1XIWB 3GSNB 5EUOA 5IEHB 3V4VH 5HHPA 5TPWH 1ZHLA 2OX5A 3EKCA 3G5YA 2FJGB 1QRNA 1KJ2B 4NQEE 1A6UL 4PJEF 4F8TA 5TQ2L 3OF6A 3H9HB 4JQVA 3FJTA 2F8OA 1KPVA 2F53A 3SKOA 3MV8D 2IBBA 1GZQB 4M7JL 3D48R 1A7OL 2ORBH 3C5SA 5A1AA 4LGSB 2NNAA 4XPFH 3H42H 4MDIA 2X4NA 2HJFA 4F58H 2C26A 4R3SA 4JFOB 5FGCE 3MRFB 3VE0A 5TF0A 3NN8B 1EFQA 4U6HA 2RJMA 3RQ3A 5EULV 2ICEA 1A7RH 3B3IA 5GRJH 4KUZH 4MA8L 4PREA 4YDLC 2X1PA 3C6LD 5KVGL 4M7KH 4HSQA 1T1ZA 4FN0A 3CFJA 2D4FA 2IF7A 2CDEB 5IEKA 3FQNA 4JDVB 4PR5A 4HEPG 1ZT7B 3BHBA 3FO9A 2EIBA 4BYHA 3O9WA 4HH8A 5TE7L 4R90H 3HNVH 3PL6A 1YEDB 3QDMD 3QAZC 2YKLH 3FAXA 3GI9H 5E2VL 1R5WA 1ITBB 2AV7B 2FECL 1E4WL 3MROA 5LGHH 3UTZA 1EFXA 3U82B 1CDUA 5IG7B 3X12A 4Y4FC 1V7NH 2J5LC 3NVQA 1JGDA 3M1BA 2DF3A 2WWKT 4ZYKB 1PG7L 4NRZB 3ARQA 5T1KD 4HKJB 4FQ1L 3RPIA 1OOAA 2NY1B 3KLAB 4DKFL 4OD1L 4PRNB 4RGOL 4M7ZB 3ESVF 4WHCA 5EOTB 4WJ5A 2K7PA 1R0AL 5F72S 3ARZA 2A83B 1RK1A 1HKLL 2OXHA 4XVSL 1AIFA 1KCSL 4K94L 3BJLA 1P7KA 4KRLB 4S1DC 4P4KD 3AS2A 2AXFA 1MRFH 4U1MB 5JIIA 2CRZA 5F93C 4JM2A 2NZ9C 1I9RL 2J8OA 4NRXA 4QHLB 4R8WL 4XPHH 4YHKH 2C3HA 5IMMB 2PCPA 1SEQH 5B39G 1Q94B 3VFTA 3P4NB 4NQSB 2HWZH 1CE1L 1MHEA 4J3OC 5EN2A 5HYJB 4FFZH 5ICXA 1AY1L 1BOGB 1RZJH 3UPAA 3FT3B 1H5BB 1X5GA 3QWQB 2IPTL 5DVMA 1OAUH 4JO2H 4IDLA 4UINH 3B6SB 2Y5EA 1MF2H 1XR9A 4HJJH 4OD2B 5C0JB 2F54B 5KANG 4V1DE 3ULVD 2W9EH 4ALAH 1FJ1A 2P42B 3HZYB 2IJ0C 3KPTA 1TJHL 3QSKB 1FL6B 3V0VB 4JM2F 4L3CA 3SJVD 3QNYA 1ZSDB 1VB9A 3T4YB 3TPUA 4YHLL 2O5YH 3MNVB 2P5WA 5GS2H 4WU5A 1DQLL 2HVJA 3U30B 4J1UB 4XXCA 5IR1B 3VD4A 4R96A 2FHBA 3VCLB 2AK4B 1YDPB 4XCCH 3GZKA 2WM0A 3O3EA 1YY8A 4U1GB 1TIUA 2OCFD 3V9FA 1J5OH 1TVBB 3H0TA 2PNDA 4RDQG 5FUZL 1OSZB 3IDIA 3BN9D 1FNAA 4RFEA 5F6HI 2AJXL 2Z8RA 3RFZC 4NRYA 5E1AA 4DKEL 4NO0B 2VDOL 2YS4A 3BD3A 4X0KA 1D5XA 1Z9SA 3GIZL 2GUOB 3CDGB 5IB5A 3GMQA 1FE8H 1IT9H 4QRRE 5CSBA 5B8CC 4F15B 5IFHL 5DD5L 3RJQB 1A7BA 3CFEA 2BY1A 3I2CH 3BZ4B 2ED8A 3G5VB 3I6KA 5F3HB 4FP8L 4OZGA 4NWTL 1A1MB 2JCCB 4XNXH 2ATPB 5L0QC 2V9QA 4YBHA 5TPWL 2R0LH 3DETC 4Y89A 3WXVH 5BS0E 1MPAH 4UMGA 3BWUC 5FKPB 1J88A 2H9GA 3JUZA 3KLHD 3LSOB 5L8KB 1A47A 5BRZD 2WZPD 3QQ4B 2NY7L 4MX7B 2CUHA 1IEBB 2NR6C 3KPRD 1MJ7H 4APQB 3CAFA 1T0MB 4XPFL 3B2UD 5L8JB 1RUAH 4JR9L 1AD0B 3O3AB 4H88L 2AABL 1AFVH 4N9OB 2GY7B 3G5ZA 5CZVH 3SOBL 2H6PB 4GAFB 2ZPKL 1P7QB 3MC0A 3OKMA 4M62H 3IXAB 3HAEB 4OZGF 1A7RL 4IMLB 3JV4B 3KXFE 4ORGB 5CINL 4ZO8A 5C3LD 4QHUA 2V2WA 2B8OT 2VDRH 1CTOA 1F4HA 2EIEA 5FGSA 2HLAA 1OAYH 1JIBA 3MJ8A 3TFKD 4ZTPH 4E5XA 5I8KH 1Z9LA 3QHZL 5L2KE 1JGEA 3Q5YA 4PRHD 4Z7VB 5GGTH 2YKLL 4PRIB 1W0WB 3CFBA 4NZJA 4JO1H 5LGHL 2RGSA 2OMBA 4CBPA 1I7RA 3PV6B 4U6VH 1I4FB 1HZHH 3DARA 3IFNL 4LSTH 3NH7H 4HS8H 4NQCB 3MR9A 3RU8H 1BEYL 3GB7A 5FHAH 2BNRB 2X41A 5E0QA 3CIQA 3V6ZB 5E5RB 4RFNB 3PGCA 5I30H 5SWZB 3SCMD 4LEOB 4R97C 3SY0A 2JTDA 4X4YA 3QNXB 1EHNA 3RGVC 1BFOA 5HD8C 1S7SB 2FECI 3ES6A 5D8JH 2D7OA 3BSZH 1NMCB 2VLJA 3IGAA 1NSNH 3LOWA 1OARH 2A6IA 3ZE0F 4WUKL 5FEBA 3VW3H 3STLB 1CBVH 2HRLA 3IETB 3UEZA 2YZ8A 1NC4B 3WFHA 4QXTB 3FFCA 5IW1A 4MD4A 4CKVX 4I18B 2CR3A 1SEQL 3QA3A 1BP3B 4PJCF 4HZAA 3MLWL 2WQ8A 1IM9B 5IK3B 4LCYA 1OTSD 2HLFD 1KTLB 4GRLD 4E9LA 4MHHG 3WIHH 3MBEA 3MV8B 1QYGH 2ZKHH 3OR7A 2DQEH 2A0LC 4YR6A 1OP5H 3UTSA 1ZKAA 3WEXB 2YC1B 4FHBD 1S5HA 3BPOC 2GCYB 1KB9J 5KSAA 1JWUB 3QJFA 2X7LA 3LS5H 4XTRC 5J4MA 3ZDXE 2ICWB 2GJZB 2X6MA 2Z8VC 5IHUL 1G1CA 2IQAA 3AB0B 4RNRB 1S9XB 2ZJSH 4YC2B 1BQLH 1RQ5A 2D7NA 2EDEA 3C6LB 1MWAH 1QBBA 2DQUH 5BXFB 1ACZA 1J1XH 2O5YL 4RZCA 1I7TA 5FA4A 4OKDA 2Q8AL 5GGTA 4R6UA 1WAAF 4IRSA 3T1WA 3UTQB 3L3GB 5DT1H 2X09A 1T2QH 2VNCA 1GJIA 4ZXBD 3MRNB 3VGEA 3QDMB 3OGCB 1R5VA 1T66D 1TCRB 3KPMA 2CRMA 1DEDA 1N7ML 1OAKL 4Y4HC 1A7QH 1YEIL 4G9FD 1EUTA 1FN4A 1SVCP 5DD3H 5HY9B 3C5ZA 1X7QA 3OPZH 3VGHA 3OAUH 1JZ6A 1BD2E 1H8OA 2YD1A 2N1KA 3BPNB 3P9MB 5T1KB 5ISZD 3E8UH 5EU7C 25C8H 5HI4D 5CWSB 3E6HB 3VXRE 1JPGB 3O2WH 5F7FA 1RJLA 5GS0C 4AG4H 1HNGA 4ZFGL 3L3HB 2EDWA 4LDOB 1FNEA 5HVHC 3VI4E 5CD3B 2DQHL 1IGIL 4ODWA 5I71C 1U8PB 2LU4A 2EDRA 3B43A 4P4KB 4RBPH 3KDMB 1DE4B 3C60C 1NBQA 4WO4A 1JPTH 5A40E 4OQ1A 2IPKB 4FQLL 4Q74A 1C16B 4TTGA 3I6GA 2HH0H 2QR0A 4L9LB 2ZUQC 1B6UA 2NW3A 5IMLA 2XKSA 2A6DA 5FECB 3BZFB 1HH9B 3BGMA 4X6CB 1G9MH 1WT5A 1F2QA 2E9BA 1XR8B 2ZOLB 5D70H 1RUAL 3QDGE 5D1ZD 4DUVA 3O6FD 2D9QB 4M1CC 2QSCH 5EBWA 2EEDA 3AMLA 1A5FL 3RZCA 2BC4B 2V7HB 4XVJL 1D9KA 3SJVB 4DWHA 1MFNA 4KRPC 4S1SL 4HKXB 4PJHB 4N0CD 4QRRD 1T1WA 5IVXE 4W81A 5F1KC 2HN7A 2WUCL 4ZD3L 1Z2KA 4GXUM 5GS1B 3UX9B 5C09E 2EDOA 1U9KA 3QUZD 4G9DB 4RA3A 5DRZA 3WKML 2Y06L 4BH8A 4D2NA 5JO5A 4Z7UE 5JHDE 2JIXD 3K8LA 4KKAC 3UYRH 4M1GH 4M4RA 1PSKL 3ARVA 4DAGH 4JO1L 5H35B 4JN2A 5JW5B 5H37G 5JPNB 3WJLA 4HWBH 3VGBA 1HEZA 1EXUB 5LBSH 4LKXB 2HT3D 5DF0A 2PW2A 2F74A 2WUBL 4G8GD 3LKRA 1MCIA 1FNFA 4Y2OA 3BXNB 1FAKT 5KJRH 5TFSL 4XH2A 2WNGA 1YA5A 3IDUA 3R1GL 4B50A 1T5WB 2FIKA 1MCQA 1SYVB 3SDCD 1ZV5A 1I3RB 4JPKL 2B7DT 4HIIA 3RUGB 2BMKA 1C5DA 2JB5H 1IEAA 1KNOB 1U58B 2EC8A 3LH2H 3PDGA 1ZWIA 2J6EH 5GGUA 1QLEH 1K8IB 1GOHA 2R2BB 3KXFD 4NJAH 1CWVA 2GTWA 1HINH 2DJ4A 3EOBA 4Y16A 1YPZB 5E03A 2I5YH 5CJXC 3D2UA 3QRFM 1LE9B 1W8OA 4MDJA 2DBJA 1ZTXH 5BRZB 2BRQA 5JORB 2NY6C 4NKDA 5DO2C 5EZLA 2F58H 4GO6B 1A6ZB 2R8SL 1EH9A 3KPRB 2VL5B 1U8OA 2BFVH 1FBIH 4GG8B 5E94A 3DRTB 3TYGH 4CVZA 3C6SB 1OAXL 3NBNA 1J10A 5CEZE 5SX5H 3QH3A 4GQ9H 43C9B 4RISH 5EOCH 5HGAB 2IMMA 4L29A 1BVLA 2AJVH 4C56E 3BESR 3P9LA 2Q7YA 3GRWA 4O2FA 2YN5A 2P7TB 4KVCH 3TH2T 3CFKB 3A6BH 1UXSA 4J6RL 4YEEA 1QFWH 1Y0LA 4J3XA 4PJFA 1JTOA 5EIIA 1IGTA 5SWQA 3MFFB 1F13A 1BWMA 4S1QH 5BS0A 5CJQH 1IFHH 4PRHB 3MRDB 1QVOB 2GK2A 5CCKL 4KZDH 1ZVHA 2I25N 3TN0D 1JYVA 5D1QC 5ID1B 3B9KD 4ZPTB 4KWUA 4HKZB 1JHTA 5EDXA 4KK6D 3C5JB 1FZKB 1MCDA 4M8QB 4XRCB 1IRAY 4Q2ZA 4LLMA 1CGSL 1YYLL 1SBSL 3E0GA 2XA3A 25C8L 3FZUC 5DJDA 1ZHKB 1OGTA 2EIDA 3T0WA 5ALBL 4NBZB 1FLRH 4XP6H 3SCMB 3MUGA 4PJFF 2DQCL 2IFFH 5CUSL 4YDKH 4GRWH 3DX8B 5D7KE 5ELIA 5I73B 4ZFZB 1VACB 1XGUA 4QRPA 2XTLA 4HWUA 1NUDA 3NCJH 3QXWA 5DI8A 3KLSA 4BSWB 4P2QE 4W68A 5F9DC 2AEPH 1X6LA 5JXAH 1KN2H 5INCA 2UUDH 4PGEA 3MSPA 4QF1B 2O5ZH 3FFDB 2E7LA 1UT9A 4XC1L 4TUKH 5C8JA 3U36B 1AQDA 1OSPL 1K6QL 2Z8SA 4M48L 5AWNH 4LCUB 4X7TA 1WVZA 3ARGC 4G6KL 3SE9H 4GRLB 1MY7A 4H20L 4Z78B 5BV7H 4L4VE 4HGMA 4R7DA 3BW9B 2XQBL 3D87B 1R24A 1VFUA 5IVZB 2W0LA 1F2XK 1BBJB 2GAZB 1UJ3A 3NIFF 3SPVB 5FGBA 1VEOA 3QCUH 3JWNC 1UWEH 5IWLA 3RWIA 5E4EB 3G9VA 2NY2B 2C3VB 1ZHNB 3KYNA 4N8CL 1U8QB 5IB4A 1I75A 3REVA 3GRWL 1QNZL 5I2IA 5DZOA 2YBRA 5TF1L 3BD4A 3SKMA 3VH8G 2W91A 3MYJA 3QUXD 2I24N 4HX1B 1IGML 3STZB 1FL5B 3WLWC 1JPSH 5J1AB 3VFVB 4TSAH 1Y18A 1K9TA 5DK0B 3FB5B 5CILL 4AMKH 3HS0B 5DFVC 4X83A 2R23B 2VAJA 4JQIL 5SWSE 4G9FB 1FQ9C 4Z7OF 2FBJH 3DHJA 3MRLA 4N0UE 1Z5LA 5B39B 5FYLE 1JTPA 4JZOA 5ISZB 2DLGA 3BKJL 4OLZH 1NGPH 1AGCB 4GBXD 2DD8H 2KQMA 5DEFB 1FP5A 1I8KB 4YHZH 5DRXB 4ODSL 3UTOA 5JOPD 2RAMA 1HSBA 4JDZB 3GHBL 3GGWB 4ZDHA 3LD8C 4IIQC 4BELD 3HZVA 3MRQA 4ONFL 2R0KL 3ILPA 3ZTJG 2YN3A 2ADFH 2F9BT 2I5YL 1I85A 2C1PA 2Z93B 1UM6H 5DA4A 5GIRA 4YE4H 1I1FB 2HG5B 4ERSH 4ZPVA 3U9PH 3BIKB 2VAAA 2CKNA 2BXZA 2Q8BH 3ZDXF 4FTVE 4JJ5A 3TBWB 5E6IC 3WLBA 5I1LA 2DBLL 2AXGB 3HMXL 5D1ZB 1BD2A 1YYMH 3O6FB 3VXUE 3IDGB 3GMRB 5F89B 3VXRA 2GY5A 1D5IH 5JLZB 4MZ3A 3CFIC 2VE6A 5CEXA 2AJVL 3NCMA 2QQLH 4U1LB 5K59E 4K23H 5D4QA 4NQXA 2OJZH 1U91A 1ZGLP 3FQXA 4Z7WB 4LCWD 3BKML 4Y4FD 2YK1H 3SKNB 5IW6A 3KNBB 3GSNH 4ETQB 3TF7C 3FONB 3CC5B 4M02A 4EI5D 4S0TD 5JIPA 5FYKU 1A9EA 3BH8A 1EEYB 3S98A 3RDTC 3AU1A 3QUZB 5AUMB 1LE5A 4AIOA 1KJ2H 1ZHBA 2JIXB 4XMKL 1KT2A 5I1GL 4GAYA 2R4RL 2Q6WA 3O2VH 4XHJD 1U8JA 3MOBL 1CLZL 1EUUA 1X3DA 1S7WA 4NZUL 4OCXH 1FSKB 3MLTA 3ZYIA 4S1DD 1HHIA 2AGJH 4G8GB 3VI4F 3ZT5A 3KR3H 2EC9T 4NQDD 3GDBA 2ZUUA 3MBXL 3SGDI 2W65B 3SDCB 1C12B 4R0LB 1T1YB 2N7BA 5EU7E 3O3BB 4IOIA 3RL2A 3GMMA 4LLQA 5MENE 1J11A 4JEGB 4C56D 1JGVH 5IKCB 5C09A 1J12A 2ERJC 4JB9L 3F7YB 4Z7UA 1KC5H 1H0DA 4OZ4A 1M05A 2FL5B 3MRMB 4AEHL 1F45A 1I9JH 2X9YA 1NGXA 1E28A 2YUWA 1N6VA 3MLZL 3T0EB 4UT9H 4G6JL 1UWGL 3L9RB 2HAZA 2XICA 4OFVA 4YXKL 1WGOA 4RAVA 2CGRL 3V0AC 5IMOA 2VR5A 4M3KB 4OCWH 2V5TA 2EDXA 5CP7A 4WFEE 4B53A 1UH4A 5IVXF 1HXYA 2NMSA 1U3JA 1XIWA 3GSNA 5IEHA 4WTZG 3KHOA 2BNQE 1MJ8L 3C2SA 4Z7UF 4ZFOA 5ACZB 2OK0H 1H3VA 1F90L 4EOWH 2FJGA 5JW4M 2A73B 1ES0A 4JKPL 1G6VK 1A3LL 3H9HA 3TM6A 4MAYB 5D7KD 3S36L 1GGUA 3OB0H 5C0IA 2D7QA 4U6YA 3WD5H 4BZ2H 4OLUL 5FM5M 4ZNCD 2XKNA 1U8KB 3PWLB 4KFZC 4AMKL 3TN0B 4JFOA 4LHUG 3NN8A 4MCYB 2IMNA 5DJAA 2AXHA 3I02B 4JQXC 1P4BH 3W5MA 4LF3B 2NW2B 1I9EA 3ARYA 3IU3B 4Q9RL 3I9GH 1AGFA 2CIIB 4JDVA 3EO9L 1ZT7A 3LKOA 4OLZL 5IB2B 3OAYH 4Z95L 4MQSB 5HVFB 4NNPL 2D7MA 2BJMH 4EXPX 3MRIB 1YMHB 2J8HA 2NR6D 4NGHH 5KVEL 1YEDA 3ARSA 3SDDC 2F19L 1YEGH 2AV7A 1R3IL 3HFML 4OLXH 5IG7A 3BFOA 3ORJA 1RZKH 2JJTA 1N3NB 2QTEA 3PXHA 5GXBB 2OL3L 5AYUH 1AQKH 4LVNC 3C2AH 3SE4A 4ZYKA 2XY2A 4NRZA 3GSXB 1RAMA 4HKJA 1A1OB 3ZE1F 4YDJB 4GKNB 4OFYD 4PRNA 1PFCA 3QCVH 3QG7H 5JIKA 3F6LA 3N9GL 4GW4B 4WEBL 4EN3B 4EVNB 5EOTA 5E6YA 1NGYB 3G5XB 3OAZK 1U95B 4Q6IC 3VFGH 4U1MA 4ODXB 1A14H 5F9AC 4RX4D 3BYYA 1DBML 3S88H 4D8PB 5F96L 4YK4C 5IFAL 5D72L 1NAMA 4WCYL 1RUKH 4X4ZA 5IMMA 3IDNB 3LDBB 4ZOEA 1Q94A 3QUYC 2VXTH 4OCRL 4ZFOL 4P2QA 1IGCL 1U0QA 5HYJA 1FO0B 3E2HB 2E6JA 1BOGA 3QUXB 4N9GB 4F9LA 3FT3A 3BDYL 4L5FH 4DZBB 5J06A 1HHGA 5D96B 5HD8D 1JYWA 2EE9A 3B6SA 4OD2A 2PF6A 4NHUB 4NC1C 2F54A 3PWUA 4L8CB 3ARFC 1IEHA 5E2TH 4LVHC 3KYAA 4TPRH 3DLQR 4FQJL 2ADIB 3HZYA 4PRPB 2XWTA 4L4VA 1FL6A 3V0VA 2OTWB 1CG9A 3BP4B 1MIEL 1ZSDA 3T4YA 3MREB 3HAEH 4DFIA 1NLDH 3EDFA 1ZA6B 1FFRA 3WFEL 3RVXC 4UIMB 4J1UA 5IR1A 1H3GA 5CEZL 3VCLA 1VGEL 4HUMB 3WUWG 2AK4A 4GBXB 3ZE2E 1YDPA 4OF0A 1CFVL 3ZL4L 2J1KA 4RGNB 1TVBA 2XN9E 4A6YL 4OV6F 5KS9B 1OSZA 1E0OB 3H3PH 3KAAA 2L7JA 1A3QA 4L3EE 4YX2L 2VLLB 3T0AA 4XTRD 2BVQB 2CKBH 4NO0A 4QTIH 1Q0YH 5IBLC 2DIJA 2EH7H 2R2HB 4NO2B 4M00A 4UT9L 4ZUWB 4U31A 3CDGA 4KQ4L 1NCCH 2QHRH 5DMIL 5KVDH 5LGJA 5SWSA 3U7YL 3EDJA 3ZT7A 1D5MB 3C08L 4X8XA 2IQ9L 8CGTA 2BX5A 4UUJB 1BQHG 2GJ6E 3QIBC 5HYSG 4MA3B 3EAKA 1OCWH 1IBGL 3ARDC 3BZ4A 3G5VA 4LCCB 2ESVE 1TZIB 1A1MA 2JCCA 2ATPA 3MNZB 2Y25A 2EIZB 2DDQL 4Y4HD 1ZK9A 2OXGA 4LCWB 4TNWF 5FKPA 3GSUB 4Y4FB 2J5LB 2X5PA 3LSOA 4J23A 1IQWH 2BSTB 4EI5B 1LO3H 3QQ4A 2X4TA 1NAML 4MX7A 4KTDL 3CSYB 1IEBA 5TDOB 1JUFB 1MAMH 5GS0D 4K7FB 3BWAB 4APQA 1T0MA 4Y19D 1IL1B 5GJSL 4KC3B 2GI7A 5GISH 3DUHA 4KJPC 2HP4A 1F4XL 3KYOA 4HEME 3PWNB 5HDLA 2R0WL 1P7QA 4XPTL 3VDCA 1CK0H 1UGNA 2X1OA 3HAEA 1BVZA 4IMLA 4FFWC 3JV4A 3C60D 3GIVA 4ORGA 3WFCL 1W0VA 4L8SB 1D5ZA 3WNNA 4OCYH 4BSVB 4NQDB 5E56A 4IRJC 1DTUA 5IM7A 1EBAA 2FX7H 3RX7A 4MB3A 3D25B 4NGHL 3NCYS 1YEHL 2FGWH 4Z7VA 2I9TB 4PRIA 4OQTL 5CSGA 2WWMC 2CLRB 4M1CD 4P2RD 3RIFF 4OLXL 1KCVH 1KXQE 3FT2B 2EC9U 5IP4A 4QRSB 4NQCA 5LAXB 2W38A 3HA0A 5T3XE 3TJEL 3P4MB 4Y4KA 4NWUH 3EO0B 3IRPX 4K2UL 1EMTH 1KG0B 1LO4H 3V6ZA 4KRPD 1ZLUH 4WI4A 2YWYA 4Z76B 2R9HD 4LPTA 4Y5YC 4LEOA 3DMMC 4MNGE 3V7MA 5K59F 3QNXA 1S7SA 3MCKB 2M26A 5F70A 4KKAD 4CVXB 4LU5H 1PLGL 4LHUD 3W2DL 5I0ZA 1BGXH 5C08D 5FYJU 5FYLL 2ZWLT 3IETA 1MFBH 4DOHE 4HJGB 1BAFL 4QXTA 2C7UB 1TENA 1B4RA 4I18A 1WIUA 1ODAA 2YPVH 4U49A 1MFCH 3MX0A 5MENA 1IM9A 1GOGA 5IK3A 3QEQB 4L1HA 43CAB 1T21B 1CDGA 2VDPL 5I8OL 2DTML 2YC1A 1U8HB 4Y0GA 5EPMB 1DANT 2GCYA 3IYLW 3S9DB 2UWEB 4HCRH 1V3LA 1JWUA 3F7RA 1JWSA 4YIQA 5LXGL 4PGJA 3KPSD 3GSRB 2NXZD 2ICWA 2GJZA 2DLFH 2RQ8A 4WTXA 4RNRA 4LL9A 3HE7C 1G9NC 1S9XA 3HLAB 5EU6D 3C6LA 5EIQA 5BXFA 3ULVH 2Y5TB 1J1PH 2GTZA 2D2OA 2J4WH 1L0YA 1ZVSB 2J7LA 3V79C 2BNQA 4I4WB 5F7DB 4YQXL 3L3GA 5DO2D 1A6PA 3MRNA 3MXVH 3OGCA 3S34H 3QEGH 1TCRA 3LY6A 5C6TL 4YLQT 1PG7X 3MV9D 3RVWC 1JE6A 1NPUA 1FFPA 2VDKL 1EEUA 1PD6A 2H2SC 3TA3C 2R4SH 2VUOA 1RU9H 1UADC 3RJDA 5HPMB 5HY9A 3WDJA 1L6ZA 2EH7L 3WFBL 1HQ4B 1OY3B 1SM3L 4HLJA 3U0PA 4NIKB 3P9MA 5T1KA 5ADPH 2X4PB 4JPIB 5CWSA 3UBXG 1RIUL 3INUL 1QQDB 3VH8B 3BGFB 2B1AH 4MJ4A 5F1IB 4KY1H 4WHTA 2WINA 1RHHB 3EOAA 3MYZA 4BQCA 5HSFA 2BERA 2K7QA 5CD3A 4DN3L 1OHQA 3IAPA 1I8MB 1RIHL 1U8PA 1GGIL 1ZLVH 2WV3A 1MCBA 1XCTB 1MELA 4OV5A 1S7RB 4P4KA 5D1QD 3KDMA 4KXZH 4WGVB 1DE4A 4LASL 1KB5L 3DIFB 1NGWA 1IC4L 2W9DH 1MJUL 3TWCH 2IPKA 1C16A 5DS8B 2XTJC 4L9LA 4WFHE 1KTRL 1XGPA 2P5EE 3S96B 3KPNB 4PJDB 1BHGA 5D7IB 4HCRA 3FZUD 2R2CA 2XN9D 5FO7B 2ZOLA 3J8F7 4PBXA 4R97B 4UTBH 3QQ9C 5TQ0L 1XF3B 4KPHL 1G7QB 4WGWB 4ZUUB 1LILA 1QSEE 4UU9A 5FIEA 4YJZL 2BC4A 1Y6KR 1YN6B 5BVJB 2V7HA 4R2GC 4KHXH 4CW1B 3DV4A 4UNVA 1EHLL 4OF8A 4HQQL 1CLYL 4BH7A 3SJVA 3D39E 1JNNL 4HKXA 4PJHA 4U0RC 4PJ7B 2V2XA 5GS1A 5DQDL 2EYRA 4G9DA 4HV8B 4QWWC 5ALCL 5I15L 3ARGD 1QFPA 1BOYA 1KEMH 2BCKB 1CIUA 2Y9RT 3N1MC 4DUWA 3BPOB 4JAMB 5H35A 4I0PC 5JW5A 2A9MH 4NKQB 3LAFA 2OZ4H 2B0SH 4HK0B 4UZGA 3U79A 4FXGB 4PJXE 4LLVB 3BDBA 4IRZH 2XACC 1U8IB 4X8JB 2LAAA 1UA6H 4YUEH 1Q9LB 2W1NA 2FSEB 1KCRH 2QJDA 2FB4H 3BXNA 3DO7A 2VISB 3P2TA 3HI1A 4G8EB 1S9YB 5J89A 2HMID 5GRUH 3L5XL 1PZ5B 1XZ0B 1IAOA 1P84K 1SYVA 3QFJE 2Z31C 1I3RA 4XMLL 5EOQL 1RURL 4WWKC 3QDAA 4F7MB 2FNBA 1QSVA 3RUGA 3WLWD 2Z91A 3VA6A 5MEOA 4M61B 5FCSH 1QEWB 1U58A 5DA0B 3TZVC 4B0MM 1K8IA 2EDNA 4M6ML 2VWEC 1IAMA 1OGAD 2R2BA 3OHXB 5DFVD 4J4PA 4Y4HB 4PJAE 4PUBH 3QDJB 1YPZA 3NFSH 2WANA 2WAHA 5DJYB 1D6VH 4XP4H 5BRZA 1GCFA 5J8OA 2Y6SC 5B38G 2HT2C 3BKYH 5JUEH 1S9VB 1WF5A 2WWKO 3KPRA 2VL5A 4NN5C 1MIMH 2GSIB 4GG8A 3W0WE 2NY0C 3DRTA 3C6SA 4Y19B 2UY7A 3P4OB 1J0YA 3VXQB 4EI6A 43C9A 2VZVA 3G6AB 3ROLB 5CLTA 5HGAA 1EHXA 5JNYB 1RI8A 4NUJB 4X4MA 1X5KA 2XZCH 1X5IA 3RY6C 3ZE2F 2P7TA 4NC1E 3CFKA 5ERWB 3C60B 2XXMB 4D9QE 1RZGB 3UJJH 2GJ6A 3ROOB 1K3IA 2AV1B 3MCG1 3TT3L 3CCHB 1MCWW 4HH9A 2APTA 1QFHA 3JWDH 4X9FA 1J8HD 1GIGL 2JK5B 2ZUQB 5LWYL 5C7XL 2RB8A 4XMPH 2AK1H 4HG4K 5INDB 2OZ4A 1GC1H 2FD6L 4PRHA 1QVOA 3HE6C 4Y88A 3BZEA 2H2PC 2V2TB 3VXNB 5DJ2B 4ZPTA 5ID1A 4HKZA 4P2RB 3H9SE 3C5JA 2AQ1A 2E8YA 4FQIH 3X14B 2XY1A 3G08B 2AI0L 3SGDH 4M8QA 3DSNA 2I60L 1P9MA 4EDXA 4OFDA 3SQOH 4ETYA 5DHXB 3V5KA 4ODVL 4KRPB 3GSWB 1ZHKA 4H0IA 3NMEA 2BDNH 3CMOL 3U0WH 5GGQH 4MA1C 2DI7A 1UFUA 5T5NF 3RDTD 1VACA 1YNLL 4GLRI 1IGYB 4RFOH 5GPRA 1H3PL 4PLOB 2H1PL 4BSWA 4DFHA 1IAKB 4LHUB 4OLYL 5IBTL 3V4UH 5C08B 2EYSA 3DVGB 2HFEB 4I77H 4OIIH 5J12B 5L7XH 1FCGA 4P9HH 4QF1A 4H25A 2CK0L 4MNQD 3WHXA 3CH1B 3DECA 3R8BB 3O4LE 4KROB 3ILQC 1JMXA 2PR4L 3CFCL 3S5LB 2E9JA 1HILB 4GW5B 5HGHB 3IFOB 2ADJB 3WCYA 4Z6AT 2ENYA 4GRLA 4PJBE 4Z78A 3DUUB 4UTBL 3BW9A 2J8UE 4WUUE 3RNQB 1BBDH 4OZFG 2DKMA 1OF2B 1BBJA 2GAZA 5E08L 3SPVA 4OSUH 3E3QC 4XP5H 3KPSB 1ZLSL 2NXZB 4LMQI 4C83A 3VWKD 2C3VA 2DM2A 4KTEL 4X6DE 3X13A 1WWWX 1KXVC 1U8QA 5D1XC 2D0HA 4ZTOL 5EU6B 3VXME 4HAFA 4I3SH 1VADB 2VH5L 3MJ6A 3WS6A 5DHYB 3WJJA 1DANU 1V05A 4JPVL 5LQBL 1L6XA 2VXSH 3STZA 4UV7H 1CFNA 2HJLB 5J1AA 1LWRA 5DRNB 3VFVA 4HT1L 2W92A 4U1JA 1L9MA 4JFPB 3R06B 2NLJB 4XGZB 3FB5A 3MV9B 4Z0BL 3HS0A 3PDDA 2R23A 3D85B 5GGVH 1DLFH 2D03H 3PNWA 3LQAC 4G9FA 4QXGH 1IJ9A 1NFIB 1UC6A 3Q48A 5LCVH 2A77L 5B39A 2RFXB 2HJKB 5JQ6L 2XA8L 5E1HB 3RHWK 2FR4A 3PHOB 2NX5E 4IMKC 3TO4C 1UCTA 3UTTD 4IOFD 3BH9B 3VMPA 1CL7L 2IANE 3A67H 3IAGC 1ZEAH 3AREC 5DWUL 1IE5A 1CLCA 1JZ3A 4IHOB 5DRXA 4LPCA 1A7PH 1J9CT 1K4CB 4JDZA 3GGWA 3QIWB 5KAQG 2E9WA 4P3CH 2YZ1A 4UBDC 1FIGL 5D1QB 3DGCR 3D39D 3QG6B 2PETA 4NC2B 5C3TA 4D94A 4U33A 1Z3GL 1W8NA 2Z93A 2MQCA 3JVGA 3LZFL 3O81A 1I1FA 1ZGLB 2HG5A 2KQNA 4XP4L 1P5UA 2Y36H 4ZSOB 4XB8A 3BIKA 2GK0B 1Q9KA 1P84J 1HIMH 3BKYL 4DZ8B 4G5ZH 2JJVA 3WUWB 4JJHA 1GPOL 1MIML 2AJYH 3D3VB 3NACH 5HDQH 2AXGA 2P8MA 4O5LH 1MCPL 3IDGA 3GMRA 5T3XL 4XBEH 5F89A 1YEJH 4XCEB 5JLZA 1BZ7B 4HS6B 1XH3B 2YUVA 1DBBH 4U1LA 3M07A 4G42A 4OI9A 5L2JA 3SKNA 3QQNA 2ID5A 5JTWA 3CC5A 3FRUB 3QFJD 4JM4L 1EEYA 4XP1L 3Q6GL 1XT5A 1MREH 1FGNL 2JIXA 2PXYC 5C0RL 3LKSB 1E4KA 4MQ7B 1BQHB 4LSQH 3FO2B 3QT2A 4UT6L 3TIEB 2FDBP 3MMEB 2P5EA 4K7PL 4KAQL 3LEYH 3VA2C 5C2BL 4KMTL 4P3DB 2BOCB 5EZOH 1A6AB 4QRTA 2NZIA 4XCFL 3UZEA 4U1IB 3CDCA 1W72L 1D7FA 4OZHB 4GT7A 1GGCH 2I07A 1FGVL 3MA9L 4XVTL 3TBSB 3HG1E 3WNOA 3SEPA 2JJSA 4KGJA 4XAKD 3PP4L 5F9WC 4LQFL 1DBKL 1E27B 4L1DA 1UWXK 3W0WD 3SDCA 3WSQL 2Y4SA 3FN0L 3BDXA 4R0LA 1OAZL 1T1YA 2UY6A 3O3BA 4ZO6A 5FCUL 4JPWL 1NUGA 4OKVB 2ILLA 4P2YA 1U3YA 1KJ3L 4CL7A 5IKCA 4S2SB 2VMFA 3F7YA 4L8DB 5MERB 1OGAB 3ARFD 3VWJA 3GMPB 3TNMB 3T0EA 3ULUD 4OCSH 4FXLA 3L9RA 3DRQB 9CGTA 4P46B 4PJXA 2MPAH 1TQCC 2XTJE 4MJ6B 3RVXD 2DM3A 3Q1SL 3FO0H 4LSPH 4QRQB 4GSDL 3NAAH 2ENSA 3LIZH 1S5IL 1FDLL 4K8RL 3PE9A 4FS0A 3AMKA 2PYED 3EYQC 5J6HA 4PJ8B 1MUJB 2A73A 4I3SL 4PS4H 2Y07L 1J8HB 4JY6A 4MAYA 4PYGA 4P5KB 4AL8L 1N4XL 4PJXF 3F12A 1GAFH 1JZ5A 5DUMH 1RUPL 3FTGA 1FO0H 1TNMA 1HQRB 4I2XB 4RQQB 1BREA 3TN0A 5ACMA 4MCYA 2W0PA 4HBCH 1I9IL 1FC1A 5DVOA 5BZDA 4Q0XL 5DEGB 5T3ZE 3I02A 3O4LD 2ATKB 4PFEA 4H8WL 3IDXL 3EYVB 2AEWA 1Z0MA 1T4KB 2CIIA 4BK5A 1VFBB 5IB2A 2MMXA 4N5UA 1NCDH 5FDWA 1ZE3C 3MRIA 1TVHB 5E24E 1CDBA 1YMHA 4U1KA 5EZIH 4ZNEE 3MZTA 1AI1H 4XB7A 3VD5A 4HUUB 5DSCA 4U6TA 2BOBA 2IAMB 3MLSH 4P3CL 2SEBB 4ZAKC 4LRIA 1B0RB 4MD0B 4G6ML 5I1EL 1N3NA 4MNQB 2UUDK 4RWYH 4FFWD 1OWWA 4N0FB 3GSXA 4HUKB 2VWEE 1MQKL 1A1OA 1P4IH 3LEXB 5ADOL 3H9SA 4YDJA 4X6BA 1II4E 4GKNA 3AROA 1XAUA 4IRJD 3S4SG 4EN3A 5ANMB 1JMZA 4HBQA 4EVNA 1B9ZA 3ZTNH 4DJMA 2FZ3A 2YHGA 4LVOB 4PRDB 1NGYA 3G5XA 3JSSA 5DTFB 3CX5K 4UQ3A 3U9UB 5IB3B 1QG3A 4K3JH 1LEIA 1U95A 4QRUB 4M03A 1DBAH 3HC3H 4O4YL 5C1MB 1TETL 2WWMD 5C0GB 3HB3C 4JDTH 4ODXA 5FUOL 1AD9B 2XV6B 3VWKB 2FBOJ 4NJ9H 3X11B 4D8PA 4NBXB 3ABZA 3KPQA 3GKZA 4K9EC 5HXMA 4U2YA 1CICC 3IDNA 4K3HA 2QV2A 4JFHE 3UBXB 1G7IA 1TZHB 3QEHB 4JFDD 3QUXA 4N9GA 5DLMH 4DZBA 3DMMD 2WK2A 1IKNC 5D2LE 2C9AA 4Y7MA 2DI8A 3H9ZA 3IS0X 1OW0A 3HI5H 1XF4A 3OG4B 4OJFL 1BZ9B 5I1IH 4NHUA 3ZDYE 4L8CA 4OF3A 4X4XB 4PRPA 1LK2B 2J8UA 4WUUA 3RGHA 4ZS7L 2OTWA 3BP4A 1OPGH 4D3CL 1DVFD 4LDLB 1YQVL 1ND0A 1S7UB 3CX2A 3MREA 5D7JC 5BZWB 4YFEA 1DN0B 2DQJH 3M8OH 3OBAA 1QPPA 1ZA6A 1W2KT 3HI6L 3MLXL 3UTTB 4Q9BA 1QFOA 1X5FA 3G9AB 3V7AG 4GBXA 3U0TA 4JFFB 4PGBA 1ORSB 1FAIH 3OL2A 1RD6A 3DX6B 4KJQC 4XVUC 4NQVB 1MNUH 2DTSA 3O3DB 1U8MB 3GBNL 4GAJL 1N64H 4NM8H 2H3NB 2CPCA 2VLLA 1FG2B 2BVQA 1FYHB 4P5TB 4PJBF 4HUVB 1I3GL 2J8UF 2R2HA 4NO2A 2A9NH 5E8NB 4ZUWA 3HE7D 1DLHB 4HF5L 4PRAA 5DZLA 1XGRA 2BSED 1U6AH 1B2WH 4HD9A 1VCAA 1NAKL 5I1CL 1AH1A 5HYFA 1JGUH 3ME0A 5HDOA 1D5MA 4QT5B 1LD9B 1R5IB 4X6DF 4UUJA 5HI5D 2FX9L 4JG1H 4MA3A 4LCCA 2H8PB 1TZIA 2BVEA 1QFUH 4PJGB 3MNZA 3RVWD 1SQ2N 5IESL 2EIZA 3FMGL 3QNZB 2H2SD 4DW2L 4G6FD 4LCWA 1RJYB 2AEQH 3VFOB 3E3QE 4NQTA 3L7FB 4JZJC 2BSTA 4EI5A 2HTKC 5GZOC 3IDYB 1V7MH 3CSYA 3ARBC 1KGCD 5K9QI 1JUFA 5DUML 2Q76B 4K7FA 3BWAA 3KLDA 4XAWH 3K2UH 1MRCL 1EZVY 1WWCA 4FNLL 3KGRA 4C4KT 4LRNL 4M43H 3PWNA 3GHEL 4NHCH 1XGTB 1AO7B 1IKFH 2V17H 5EOCJ 2APVA 4D0DA 5B3NA 4Q6IB 3RWEB 5AD0B 3WN5B 4P4RB 5I75B 4L8SA 5E99H 3MLRH 4YK4B 3KYMB 3FRPG 4JQVC 4BSVA 4NQDA 2W9LA 4Z8FH 1NL0H 4UQ2A 4G3YH 1FVDB 5F88B 1RZFL 3ARRA 3D25A 4IDJL 3BAEH 2B4CC 4LPYA 4LAJH 4DTGL 1AGBB 5C0CE 3MJGX 3GNMH 1OQXA 4MXWL 4XBPB 3NTCH 2CLRA 5F7KC 4LAQH 3MA7B 2VZOA 1CXFA 4QRSA 1HHHB 2DJSA 4V2CB 5LAXA 3BP6B 1E6JH 4LVHB 3P4MA 3DTXB 3EO0A 3N1FC 1VESA 2BVTA 3IU4L 1LP9E 2NXYC 5H8DA 1P4IL 4Z76A 3EYUH 3GSQB 2O5XL 5E00B 1UYWL 5I1JH 3O9WC 4QWWD 4XNQB 3B9AA 4LLWA 3PL6C 1T7YA 4QOKE 4CVXA 3HG1A 5DHVB 4K3JL 5GHWL 2Q7NA 4TNVK 4I0PD 5GJTL 5BJTB 5J11B 2C7UA 2PYEB 3TV3H 3S36X 5JZ7C 1PDKA 3NGBC 2VXUH 1KACB 4O2CB 5DR5H 5C0ND 1A9BA 2EKJA 4TSBL 2QQNH 5C70A 3QEQA 3STBA 4OIBA 43CAA 1LVEA 4YHMH 3T2OA 3PQYD 3RAJH 2ZOKA 2CD0A 2ICCA 5CZXC 4TVPE 5EPMA 2Z31D 4LIQH 5JW3H 1WITA 4Q9QH 4WWKD 3LS4H 1NGQL 3GSRA 1EK3A 5T5FH 5F71A 2E7BA 3T04D 4JM2C 1FYTB 4KUCD 5TDPB 1KJMB 4HXAH 3RTQB 4U3HA 2PO6D 4PB0L 1UH3A 3F7VB 3HLAA 4HWEH 5FYKE 4PP2B 3CH8A 3ZTJH 4LCIH 2LU3A 5DJCA 3A6OA 2YRZA 1ZVSA 4AEIL 3M17B 1TZGH 4G7VL 1C5BL 4I4WA 5F7DA 2Y6SD 1R3HB 2HT2D 2K3TA 2VZ3A 1G9EA 2VIRA 4OZFB 4FQ2H 4ELKB 2VDLH 2NY0D 3CFDB 5EC1A 3OX8B 4TOYL 4DGYL 3TC9A 1EBPA 3MACL 3HRPA 4KVNH 4XNUH 3MV7D 1IM3A 3MGOB 3IJYB 4BKLB 4JFHD 5CKAA 1HQ4A 4XNZB 3RWFB 4GLRH 4HMCA 1A3RH 3V2AR 3NPSC 4MYWB 2X4PA 4JPIA 4U4BA 1FL3B 4FZ8L 1A0QH 1QQDA 3OZ9L 2LQRA 4JRYD 3I6LD 4P2OA 4XXCC 3RA7H 3S37H 3HPJB 3VH8A 3WFDH 5F1IA 2CMRH 4QHMB 1HOCB 3RKDC 4JN1H 3VFSB 1NCNA 1CDYA 4PLJC 3W5NA 1TTGA 3HE6D 3FO1B 4B7LA 2FEEL 2DQDH 1XCTA 4OM0L 2H2PD 4PGZA 2Y1VA 5DMKB 2YPLE 2ZNWA 4P23D 4EUPA 5I18H 3LQZB 4ZNEA 5DS8A 2FGZA 2MFNA 3S96A 1X4YA 2MCPH 4LPWA 2VUYA 5D93B 1IZJA 2AJUH 3BKCL 4PJDA 4DQOH 4JFDB 5D7IA 4JHWL 3RKPA 5I76B 1U2HA 2FATL 1RIVH 5EIVA 3VXOB 1DSFH 5FO7A 1KJVB 1VKXA 3PJSB 2KZWA 4LFHG 3OJDA 3SDXE 1KCUH 1XF3A 1OAQH 5GS0H 1G7QA 3LPWA 5D71L 4UI2A 5C0BE 1YN6A 1AXIB 3IFLL 4M5ZH 4CW1A 5EO1B 4M1DH 2VLKB 1EDQA 3P11L 1F6FB 3U46A 3WL9B 3UZVB 1SHMA 1DVFB 1TCMA 1B0WA 3AVEA 3HMWH 4PJ7A 5ID0B 3ILQD 4MJ2A 3NZHL 1CFSB 3MRBB 4HV8A 1F6LL 4XNYL 1M1SA 4PG2C 1DBJH 1W0YT 1J05B 1NLBL 1UM4L 2Z8WC 4FFYH 5D7IF 4LSVL 3O0RL 2ZCKL 2UZIL 2BCKA 4OGXH 5EWIH 2VRAA 4YDVB 2EDBA 3SGKA 1VPOL 4JAMA 1Q72H 3LKPB 4O58H 2NY5L 3GJEB