2E4FA

Crystal structure of the cytoplasmic domain of g-protein-gated inward rectifier potassium channel kir3.2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
201
structure length
191
Chain Sequence
IQRYVRKDGKCNVHHGNAETLVFSTHAVISMRDGKLCLMFRVGDLRIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLGFYEVDYNSFHETYETSTPSLSAKELAELANRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords G protein-activated inward rectifier potassium channel 2
publication title Structural Diversity in the Cytoplasmic Region of G Protein-Gated Inward Rectifier K+ Channels
pubmed rcsb
source organism Mus musculus
total genus 38
structure length 191
sequence length 201
ec nomenclature
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 2e4fA00
3SPIA 2WLLA 5KUMA 3SPGA 2X6CA 3ZRSA 2E4FA 3ATEA 2WLIA 5KUKA 3AT8A 3AUWB 3K6NA 1XL6A 1N9PA 3SPHA 2WLNA 2QKSA 3SYOA 3AGWA 3SYQA 2WLMA 2X6BA 1P7BA 2WLLB 3VSQA 3ATAA 2WLJA 2WLIB 1XL4A 1U4EA 4LP8A 3SYPA 3JYCA 3ATFA 3SYCA 3SPJA 3SPCA 2X6AA 1U4FA 2GIXA 2WLKA 3ATDA 3ATBA 4KFMA 2WLHA 3AT9A 3SYAA
chains in the Genus database with same CATH superfamily
3ZT6A 3H9SE 4X5XB 5DJ2B 3KCPB 1FVDB 1T5XB 2BIHA 5E03A 3N43B 3TFBA 5GRJL 2I60L 1IIKA 4X5PA 3LD8B 3SGDH 1UWYA 5CEZL 2J55A 3T3PE 4D0BB 1FFTB 2IFFH 2Q3ZA 1RHFA 2VC2B 3ZZSA 1MFDH 5CWSA 3N1QC 5HXMA 1SHWA 1CDYA 1IGIH 3UDWA 2KLSA 3S3PA 4BHUI 3MU3A 3ABKB 1NIAA 3ZIYA 3P11L 2Q6WB 1IBZA 5KYXB 3PCYA 3P30L 3QRGH 1MI5E 4FDWA 1E9OB 2FR4A 1CC3A 4IKJA 3IMUA 3VXTA 3KH3A 3DRTA 4PW4A 2VAAB 5ILTL 1CFTA 5EBMB 4KDTC 2P9RA 5DTFA 1TTRA 3QUXD 3B56A 4EIZC 1SFHA 1CL7L 43CAA 4AIOA 4YDVB 1S7XA 4TF4A 4AX3A 5AW9B 5TQ0L 1UOKA 3PPSA 4ZUTB 1H5BA 3E1ZA 3RZWA 4YSTA 4XNUL 1I1FB 2R69A 1EFXA 3K80A 3LEVH 4NJ9H 1I85C 3QUGA 4M5YL 4XO5A 1PY4A 3IJYB 2YJLA 1PAMA 3KR3H 5ENWB 3SDAD 4IU3B 4B6ZA 2E7LC 2R2BB 2DQIL 3M1BB 5E1AA 1KXHA 4JFOB 3P77B 3U9UA 3K74B 1OOAA 3KBPA 3NJNA 1INQB 3GI9L 3MRLA 2XFXA 4HBCL 1ORSA 5GGTH 4HK3J 1X7QB 4RAHA 4XPHH 1AXSA 2VE6B 2WW8A 1V10A 5F7FA 2A6IA 1SYVB 3L3KB 5A7BA 1F4HA 4C56D 2JV6A 2X4UB 3S98A 4A1RA 2AQQA 4ISVA 1PKQB 3DVNA 1BFVL 1G84A 2DI9A 3TF4A 4G9FD 4NN7C 1FV1A 5BRPA 1BHGA 3RB7A 1Y0LB 4PJ8C 2R8SL 4H13C 5F89B 4OJAA 3UBXA 4Z7AA 3HZYB 5C1MB 3T4AB 1TSRA 1DL7H 3RL1B 5EUOE 1ZKAA 2DMBA 4Q89A 3RI5F 5AW2B 2OMWA 3JWDL 4JPQA 3VGHA 3CQQA 1W0WB 4JFZL 3FUNA 3L1OL 3ISYA 2BXYA 4MMZB 1X4XA 3QUMA 2QJDA 2FYYB 4XVSH 1NC2A 3IDMB 2ENJA 4RSYA 4FXGB 3RDTA 3ZRCC 1VADA 1KYOK 2DI7A 2EC9T 4HISA 4RGOL 4KTEL 4WWNA 4FADA 2VDLH 5I6LA 1JBJA 2NDGA 2EDWA 4B9CA 2H2PD 3UIYA 2NT0A 5MEPB 3U48A 2GUOA 5K93A 3WGVB 1TCRA 2NNRA 4UT6H 1IC4H 1F1DA 5FYKH 5CAYB 3M07A 4U4IA 4PY7A 4BFEA 1DP0A 4OLYL 4H26A 1I7ZB 4UU9A 25C8L 1OE2A 1B90A 1AI1H 5D72H 5EU7E 5J1AB 1U8JA 2LABA 4NO5A 2EJ1A 4L1SA 3BSZA 4LPUA 3N1MC 4YBQC 4GFTB 3FMGH 3F64A 4FG0A 4NKDA 1EANA 3V0JA 3FT4B 2FWOB 1Z5LA 1LWJA 5AUMA 1HL4A 4DPRA 1EVUA 5CGYD 3QDHA 4OZHE 1JZHA 4R26L 1WWCA 3PNRB 3WUZA 2YGQA 1SXBA 2Z9TA 1I8KB 1RD6A 4V2BA 4P5KB 3ARDC 4JRXB 1W6LA 1CICD 1LJMA 1DQLL 1KYDA 4Y1TA 3FQRA 4IOFC 3TEUA 2WMPB 4M5TA 2NY0B 4GG6B 4EUPA 1U8LB 3L9BA 1UWGH 4BSJA 4GSDL 3HJEA 5KBMA 2ADFH 3C08H 4AT6A 4K73A 2AEWA 3T0WA 1IEHA 4JFED 3RZCC 1LD9A 1OCRB 2AMUA 3LXUX 4N2HA 4OLXH 5C71A 3CFBA 2A77H 4OLVH 1A1NA 1VZIA 1VIWA 4UOW1 3WEXB 5D1XC 4RDQF 2AVGA 4DTGH 2A6KA 4MCZA 5CHNA 3WV0A 5D1XE 5SX5H 5LQBH 1LE9B 3HEIB 4AQ8C 2CMRH 5JHDB 1A7BA 2YRBA 2UWEB 1EPFA 2OJZL 3QZWA 1A5FH 5ICZA 4H8QA 3GSVB 5D7KD 4ZNEA 3HMXA 4LHJB 1AZVA 1D7CA 4M5ZL 3ZT5A 4XC1L 2X6UA 4HUWA 5GGSB 3WKQA 3QR0A 3IJ8A 1I1AD 3H9SA 3Q9PA 4O9HL 5DHYA 3BLKA 1WEJL 2H2SC 3QDMA 5G5DA 4FFWC 1NGWA 4RIRB 3ZL4H 2ILLA 3UYRH 3DTDA 3II2A 3QIWB 4JFFA 1PVHA 3HTLX 1AIFB 3MACH 4IOSA 4KK9C 5CU5A 4JFHE 5DFWH 5K1JA 4XX5A 1R3JB 4LU5H 4AKQA 3MXVH 3GUTB 2RGSA 2PTVA 3MA7B 4HPYH 5AWNL 1OVZA 4PS4H 3RJDA 1U8KB 4WTXA 1QASA 3ZTJH 3QO1A 1MI5A 3F7PC 4FQCH 3UJTL 3VM5A 4Z23A 3RTLA 1ZS8A 2CLRA 3JTTA 4YSAA 3TIEB 3HZMB 2KLRA 4Y19D 3LZNA 4B50A 3ZGIA 5KSAA 3ELQA 3VXMD 3VH8A 1OO2A 5AAWA 2W9LA 3K6SA 1BVZA 2IDTA 3PAUA 1DDTA 2YPVA 1PX8A 2W60A 3IKCB 4FQIL 4E5XG 2FQFA 3O3EB 5GRUL 5KYYA 1ZGLB 4GRWB 2JIXD 1B0GA 2IPUK 2OR9H 4RGNB 3KBFA 4WDIA 5ITBL 1HZHH 1UB6A 4P3WA 1CT8B 1HESA 1SMOA 3HC4H 1K2DB 3TPUB 4H44C 5FLUA 3UX9B 5PCYA 4N2DA 1WQVT 3DJRA 4NERA 1KTDB 5E6IC 3SSGA 3WELA 3IU4H 1NMAL 3VXUD 1D7BA 1E4WH 2OMZB 2OL3H 5HYJB 1GYUA 1UJ3B 2NLJA 2VQ4A 3DX7B 1TTCA 1PZ5B 3JTSB 2XIBA 4AQZA 4YPGB 1G9MH 1LP9A 3KLLA 2D2OA 5FO9A 1ES0A 1NMCB 3IN0A 3FTGB 4W93A 5FUZL 4V11A 5AW6B 5K9OB 4N2IA 5FAAA 3MO1B 3WMSA 1AXTL 1Z5HA 4DWHA 1AFVL 2EVJA 3L3JB 1G94A 4IU2A 1UEMA 5I73B 1UWEH 1LP9F 1KELH 3LPWA 5J6GA 4QXTB 5A2KH 4F2EA 2VERN 4L3EA 3OL2A 4BKTC 4GKNB 1TUPA 3LZQA 4LLYA 3FB7B 4DSYA 1QFWM 5E4IA 2DQHL 1FNEA 4JO4H 3LRHA 3D07A 1QABA 5EUOA 4DKDC 4LLDB 1N3NB 1LQBC 2VKWA 4LO9A 4LDLB 1UQSA 2APXA 5ALBH 2YA2A 1XF3B 1ULVA 3V55A 2H6PA 3COOA 3IFNL 3ZR6A 1DQQA 4BWTA 1C9SA 5IUSA 3NYKA 4JO2H 5EUOF 1U0QA 4M6ML 6PAZA 3KPQA 5C0BA 4E42B 3VDCA 4OZIB 2BSCA 3VGFA 5DJ6A 1A7NH 3ULVF 2GK2A 3VCLA 4EKJA 3BD5A 4MJ6A 1AD9B 4QY8B 3S5YA 2LR4A 1KGYE 2NT1A 2VXUH 2DY2A 1NCTA 3HC0B 1S7VA 1ETA1 4KVCH 2CE6A 1NGYA 1OCWL 1KIRB 3SDDB 3ULUH 2ADIA 4JZOB 3NQIA 4XCEB 5KVGL 3BUDA 4BBWA 5DD6A 1JFQH 1EAQA 1D5BA 3BSHA 5EUKB 1UA6H 4HDIA 4AEIH 2VITB 2ZF9A 3H3KA 1BSIA 3CPLB 3NCXA 4KMTL 3V0EA 1Q9LB 2R1XB 3KPOB 1JF1B 3VE0B 3ZTNH 3V9CA 2B14A 3I3EA 4HMEA 2HJLB 3ALPA 3IGAB 4J3UA 2AKRA 2KKQA 1QP1A 3UYOD 1FPTH 3QR1A 5HSFA 4YC2C 1T0MA 4WHDA 3DPBA 3P02A 4PVMA 3HC3L 4WU5A 3GHEH 1RI8A 3MLRH 5KTEH 1O5PA 2F58L 4I0PB 5FYKD 3BRFA 4BXSV 3MRIB 2HG0A 3FSVA 3ROOA 1F1AA 4M43H 4P05A 4W9EC 2VN6A 3U30B 4PRAB 3PREA 1U3HC 2L8AA 4AEHH 1KPRB 2JH2A 2EH7H 1JYNA 2VXTH 2Z64C 4AVIA 3X1FA 3QI9D 4G6MH 4ZSOA 4A63A 2UYLB 1Z0NA 3OLDA 2BY0A 3T0ED 2V3FA 5JHLL 4G2AA 4FL4B 4H4NA 2N1TE 4AIZA 4E5XB 4HJ1A 1NBZA 1YEFL 1XGRB 4FQ2H 1CTOA 2KH2B 1H3VA 1OIOA 2C4FU 3HAEA 5E2TL 1KXVC 1UC6A 4MYPA 3O3AA 3BDYL 5D1QC 2EZ0D 3DI2B 3ZE2F 3OHXC 3HI5L 3ROLB 3TBTB 5D1QE 3NJFA 4UM9B 1N2RA 3RPIB 2E5EA 4RFNC 3R1GH 3VO0A 5FDWA 2V9UA 5C92A 4M1DH 2H32B 4TV3A 2Q86B 4HF5L 4LLWA 4YSSA 2AJYL 2YEVB 4PHZA 2R69H 3O6FA 4RMVA 1T7WA 4YFDB 1DEDA 5F72S 2W59A 1BD2D 1KV7A 4XB7A 3SKJH 2F54A 5HY9B 2HJFB 1JHKH 4HWBH 3TVMB 3BKMH 3G6AA 1QSFE 4XN5A 2D0GA 4QAWA 2QSTA 1TQCB 1M7XA 3ZYZA 2XX1A 4YE4L 5H37H 2IDUA 2V7NB 3DARA 3OKNB 1OHZA 1RLBA 4KK5D 1NLDL 2VLKA 4U33A 4DZBB 4HOWA 3MV8E 4BGDA 2ARJB 5T1LA 4F2ME 3BQUD 2BZCA 2QPSA 5L4IA 2BK8A 3HE7D 4RMWA 3TEWA 3CC5B 1YYMH 4BDVA 3KNBA 3CVDA 1TZIB 4H88L 1NPJA 4HFWA 1FFPA 5F7LB 1ORQA 2DH2A 4WU7B 5B7FA 4U1HB 1DFBH 1F5WA 4P07A 3MJ8A 3T8VA 1G7QB 2GY7B 2EUWA 1KYAA 2E4TA 2Y07L 1VCBC 2DM4A 1ZGLM 4GS7B 1SLVA 5JPNB 1T2XA 4XRCA 2VZVA 5EDXA 4HHWA 4R4ND 3T08A 4QAMB 4IIQC 4X4MA 2I9LA 2EUVA 2ZUWA 3AJ7A 3QQNA 2WUBH 4NN6C 4G7SB 5HYIA 4KU1A 1AS6A 3PDOB 5AVQB 4C8XA 1A6WH 3HI6L 2AERT 4UQ3A 4FMKA 3B34A 3HPJA 3DSNB 2FZ3B 3KXFA 4S1QH 3RIAF 4RFEA 4ERSH 2X7LA 4JRYB 4H8VA 1A7PL 4PBVC 5LGJA 2B1HL 2R0LH 4HH9B 4W9ZA 5HJ3B 3U4AA 2Z31D 3DDGA 2NUPB 2P24B 3BWAB 4NQDA 2WXNA 3NZHL 3L2MA 3WGUB 4N0YL 1JTTA 2DYSB 1C1EL 3MREB 2GG1A 4NRZA 3U36B 4PJDE 4DN4H 4FCAA 1DJWA 5AVUB 1R5IB 3SGEH 1HI6A 5A2FA 3OJDB 3HKZA 3QISA 2BNRB 3C60C 5CP7A 5DWPA 2WQVA 3BAYA 4EVNA 2BFVL 1JV2B 4KVPA 3QIBA 4R7NB 3U46A 4L29A 2ZTBA 3ATEA 4ZPTB 3BSZH 3D69B 2V33A 1L4IA 3L7EB 5E0QA 4WEEA 4CSZA 2E76C 2PXYB 5JW4N 3LXCA 4EI5C 2O4EA 3WIHA 4XO3A 4PMEA 3ZTDC 1MW2A 1YPZA 3NFPB 3UTZB 3DXAA 4R3SA 1YUKB 5CD3A 5JOPE 3KHOA 2YEQA 3VI3E 1KIUA 1OAXH 1G7LA 3PHOB 2WVVA 4KH9A 1YPZF 4DKEH 1V5JA 4HBQA 3NZUA 1YQ2A 3ESPA 4X6BB 1GC1H 3C6SA 2EO1A 3MRNB 4FJZA 5IWLC 4UTBL 4FFYA 1Q9WB 4EBQH 4J3SA 2CBQA 3V5KB 4AITA 4GAJH 3IMSA 1CQYA 3NEXA 4JY5H 5I9QC 4HIHA 3U82B 4WFFE 1FSKC 5GRWA 5IOKA 3ETBJ 1OLZA 2VL4A 3RUGB 2NX5B 1H15A 1J5CA 5EIIA 1TO5A 5IB1B 3OB8A 2J8UE 4NQEA 1ET7A 4ZUVB 1IEBA 3C6LC 1QRNB 2BSED 5KAQF 5HHXL 3E8UL 4M7JL 1D5MA 2AABH 2YAFA 4KJPC 4PMFA 4Y1SA 3ULUD 2NNFA 4PTUA 3IJSB 3SBWC 4AOFA 3VWKD 1S7TA 5DQ9B 5ETUB 2BSTB 4KX9A 1YEDB 2IAMD 3IF1B 4IMKC 2IPTL 2XBDA 1FZOB 1I8AA 1IAMA 3PQYE 1CLCA 4NBYB 1E2WA 4PCTA 2QGEA 1PZAA 3KYNA 5D7HA 4X5WA 1N67A 4Z7WE 3SDXE 3TX4A 4PJ9A 3VFSA 4L5FE 1U58B 3T77A 2YXMA 3CWGA 3PWUA 2Y25A 1ZV5A 2BJML 1UT9A 3QUZA 4MS8D 4AGOA 3TTSA 2MOVA 1RUAL 1LILA 2YBRA 5I1AA 1NDTA 1HCFX 2PYEE 3Q8AA 4N9GB 1YC8A 5CLYA 2AC0A 5F88B 5HDBB 3VWJB 1JI1A 1MCHA 3ABZA 4KKQA 2DDQL 2C9VA 3N3EA 5ERWB 2G5RA 3QZPA 3QARA 2XRAH 3PIQA 2Q2EB 3Q1EA 1AGDB 1AYOA 2NW2A 3SE8L 4PEEA 3NABH 4ZOAA 1Z9MA 3D39B 5DD5H 2ZG1A 4LVOB 1G4RA 4DF9A 4XVOA 1NA8A 1Q1JH 2WZ6A 1OGAA 3LY6A 3A47A 2YPVH 4BCYA 3MSPA 3M45A 2WKOA 4P46B 5FOJA 1GS7A 3C09B 2YMXL 5KBDA 1YYLH 4AYEC 1DDHA 1CFBA 4E9TA 1H9DA 1YEWA 2R1YB 1J05B 2X4TB 3GINA 4JGMA 1XQ4A 2WKOF 4QHMB 3FH5A 3I6GB 3QHZL 4LSPH 1RQ5A 4JM2D 1OY3B 4APQC 3EFOB 1J7VR 3VXSD 3JZ7A 1TU2B 1E2VA 1A9BB 4U6HB 4H0GA 2HG5A 2EYSA 4BFIA 2YAOA 3D6GA 5CIPA 4HLEA 1J9RA 2WZ0A 3A4AA 4MDJA 2IO5A 1TQSA 5DU7A 4HJJH 4FEMA 3CFEB 1UACL 1WZ1H 2OJEB 3DX2A 1B88A 1FH5L 1Z9SB 2YD2A 3S96B 3C2AH 5BRZE 1EFXD 5FDYA 5IK3A 2WC7A 2CRMA 1JWMA 3QAQA 4IRJB 4DH2A 3V4LA 3U0WL 1JPGB 2FJGA 5ABZA 1ZCRA 1K4DB 5HTSA 1ZLVH 3UROR 1EZLA 4E9QA 2W80C 6FABH 3B43A 1GW0A 5JW4Q 3CCHB 4XX1G 2YKLL 1S5IL 1SLWA 4IJ3B 4XNDA 4HOZA 3QDJA 3A0OA 1CTMA 3K7UA 1DQVA 2E46A 4B3VA 3QAZB 1JXJA 4Y4HB 4ODSH 2H47C 4GIPD 4LSSL 3RWHA 2NY4B 2A4ZA 5EOCJ 5I8KL 5I19H 1J8RA 4PJDA 1BYNA 4Z77A 3EOAA 4NHCL 4Y5YA 1E4HA 2DWEB 5KSBA 3IFLH 3H6JA 2NQ3A 1TKWA 4FJYA 3BXNB 1CGUA 4NRXB 3ZTJG 1E6OH 5BQDA 3TV3H 4PJDF 3OR7B 1GYVA 5F6IB 5AVVB 1WGVA 2WBXA 1CLYL 2ODIA 4UT9A 1HHJA 1D9KD 3GSRA 5T5NF 1P4BL 5EC1A 4CKVX 5KSBF 3LS4H 5HGAB 5FFOA 3L1GA 5IOPB 4JKPH 5SWSD 1OCZB 1I8MB 1NBYA 2P52A 3H3BC 2QGDA 3W82A 1F18A 3D2UB 3RDTD 3AG3B 1X4YA 1MCKA 1I9IH 1DBKH 2BY2A 1KCUL 1P5VA 4UNIA 1CF8L 3LD8C 1YEGH 3RWJA 1ZVSB 4E68A 5E7FA 2HH0H 2PPEA 1ITBB 1NQBA 3DX9B 3MNWA 4HK0B 3FRPB 3VGDA 3Q1SH 4M7KL 1M3JA 4YX2H 5I6XC 4A6YA 2MEJB 4OGAC 2XVBA 1BQHB 1IGJB 5CSGA 1H6EA 3GMQB 2JFCA 3MRJB 1HXYA 2B2XH 4GAYB 3P9WB 4GBXB 2PW1A 2BSBA 2CA3A 4GW4B 4AIXA 4DN3L 4XP5H 4LARH 4KKCC 1DANU 3CZGA 2DMKA 4HIJA 3BHBB 2VIRA 1DEEB 5I8OH 1CE6A 1IBGH 1UD2A 3MPCA 4FTVE 5BXFB 4JQVA 1PL3A 3H9YA 3OKLB 4E0RA 5DC2A 2FT7A 2GVYA 5EFIB 4HKXB 3UTSB 3HVDA 5ISZE 5D7JA 1R3HB 4GI8A 2DB8A 3TZVA 2XNAA 3PFUA 3FB8A 4UQIM 4X7SL 3BVNA 3NCBB 4YSUA 4PJEB 5JIHA 3QBTB 3G6JA 3U9PH 4MZ2A 5T1DL 1HQRA 5GGRB 4GKZA 2G75A 3TIDB 1S3KH 2XPGA 1J5HA 2XICA 3KPTA 3D18A 2Z92B 5H94B 5BZDA 1E28A 3BP7A 3G6JF 4YZFE 3ATAA 3WLWC 3KYAA 4QRRA 2QSCL 2JK5A 3KEHA 3PQYA 1EO7A 1JUFA 3RY4A 2DQDH 3AT0A 4Z7WA 4AMKL 1PJ9A 3DTXB 5HVHB 2X2JA 4WO4C 3SQBA 4XPFH 3TA3A 1KIQB 5B39A 4UB0H 4ZMWA 5F1NA 2QGCA 2DBLL 3X2QB 4PI0A 1ZXKA 1PKQE 1ZTMA 3G6DL 3N42F 5FWQA 3AXIA 4LHUG 4QRAA 1WBXB 3JUYA 4W9FC 3SDXF 4BIKA 5HYSG 4DGIL 3AY4C 4LSVH 3UTTB 3EGDB 1JAEA 3ARYA 1BBJA 4X6CB 1UT1A 1ZA6A 3P73A 4FQQA 3GIZL 5PAZA 3ZE1E 2AK4D 4A2DA 1GVIA 1WC7A 4EZJA 4JE4B 1D5RA 1JIBA 1P7QA 5AB9A 1OT4A 2AF2A 2NYZA 1U8MA 1A21A 4JK0D 2OTUA 1RPQA 4L0PB 1G1OA 4XTRC 4HUUA 4ZG1A 2HKAA 2X3BA 3QDMD 2BOLA 2J4WH 1ADQA 2DD8H 3H2PA 5DO2D 5L6YL 2GTQA 1MUJB 3APCA 5HDLA 2FH8A 3FQ1A 3I6KB 1XGPB 1AR1D 1EZVX 3VXOA 2YEZA 2PWEA 4IOSD 3PWPA 4WW2A 2DQUL 3H3PL 1WD9A 4XHJD 5DEFA 3LNHA 1X5MA 5G4OA 2VERA 4NT6A 3GSNL 2R0ZL 5JXEC 2NZ9D 2DQGL 4QTIL 5IMMB 4L8DB 2PO6D 2CJUL 3EOBA 3L4XA 4WW2F 1CG9B 1JYVA 2FT6A 4KTDL 4P3CH 3AROA 3O2VH 4D2NA 4CC4C 2DYPA 2QKIB 3UJIH 2YXWA 4F1SA 3I2CL 3MBEA 5F7WC 4LCWA 1JV5A 2X4RB 5KSAD 3U7YH 1QO3B 1KB5A 2XXGA 4HC1A 1O6TA 3M8OH 2HUHA 3UGXA 3VMNA 1GYCA 4ODXA 3L5IA 1D5ZA 5BRZA 3RPBA 4BRVA 5LB1A 3FTXA 1JRHL 3B9KA 4OJEH 4X8JA 5DURD 3SGJA 4AM0B 2A6DB 1QPXA 2R29L 1D2OA 1KV3A 3QZNA 2VWEC 1JL8A 3OSKA 1EJ8A 4FC3E 3ZHLA 1MXDA 4U1KA 3OM3B 2P8MA 2IH9A 1RZGA 2DWTA 2Q1EA 4XXWC 2ZQKA 5C7ZA 4MA8H 3ERXA 3P3TA 3VYOA 3PU7A 2ZKYA 2NY0C 2ODHA 4D9QD 3FRUA 1RU9L 5I30H 1IQWH 5CEYA 3TT3L 1V3KA 1PIFA 3I75B 3WS3A 2GI7A 4GG6E 4Q9RL 1R3KB 2CPCA 5DEGB 1NCCL 2JI3A 3UERA 2QQLH 5AW1B 2A9MH 1HKLH 3QXAA 1RZ8A 2VDRH 2R4SH 4HS8L 43C9A 4DHLA 2YD9A 4ZI8A 4JUSA 3BJLA 2Y6SD 2E7DA 3GTVA 5ANHA 1YJDL 4L3ED 4RAUA 3LQAC 5I16B 4OTXL 5H37G 5T3ZH 3H55A 1MPAH 4IRSA 4DVBA 3T8XB 4FFYH 1LL1A 1R47A 2P5EA 3MC0A 3MMEA 5GS1A 5EU4B 4U3SA 1EA9C 1PQZA 3NESA 1IUZA 4Y88A 3D4ZA 4DETA 1CD9B 3VW3H 2ZX9A 2WBKA 1Q0XL 3VXNB 3ZDZE 1WA1X 3KPMB 4HHAB 5C0JB 3ULVD 1J1XH 4N22A 4MAYB 1TTGA 2EKJA 5C0BD 4Y4FB 4ZO8A 3SDCD 4LBEA 3I9GL 1X4ZA 4FG6D 3KGRA 3NBNA 2GJZB 1HINH 2Q3XA 3O4LA 4LVNB 1UATA 1J9CT 4JGUA 5F7HA 3NCJL 5EIQA 3QIWC 4R7LA 1S8DB 4PRIA 5SWZD 4G83A 3W39A 5DRZA 2Y06L 4YDLB 5JZ7C 2X40A 1OGSA 4CW1B 1OPGL 1TLKA 4LHUB 5L8LB 3T1WA 2BRQA 2WYHA 4G7YH 5E5UB 4HAGA 4JX0A 4IBSA 1WTGT 2KUTA 1L9OA 3EGXA 1RJLA 1A9EB 1BFTA 1JHTA 2JLPA 4EI6B 3KPSE 4L4JA 2NNAB 3HG1E 4TSAH 4YR6B 3KYMA 5FYLH 1UENA 2W0FB 3L3HA 2C9AA 5LGHH 3JT2A 3X17A 2F5BH 4F33B 1FFNA 4HIIA 4LDEB 5IESH 1XCWA 1LE5A 4ZUUA 3TBWB 2AXFB 2N01B 1DZBA 1N18A 1E3ZA 5B38A 5L4FA 3MOQA 1OE1A 3RTQA 3N5AA 1BQLL 5ID1B 1UZGA 3CMOL 1WE5A 4WWKA 4TOYH 5BS0E 3FAXA 4JFXA 1IVTA 5IROA 3AXLB 4G7VH 5CN3A 4OGZA 3BKCH 4EEEA 4MWFA 5C07E 4RGNC 2IC2A 4GRWE 3AT8A 2ADGB 1N59A 3DO4A 4P9HC 4RGNE 4CL7A 4OB5L 1TG8A 4UDUA 2VUYA 5J0BA 1ILSA 4XCNB 3CG8A 1NKGA 3MLTB 1LEGA 3WTVA 5GRYA 3LB6C 3QIUC 1E5CA 5EU5B 3N85L 3ARQA 1CVRA 4AEFA 4F1ZA 5J12B 1U8NB 4ZUWA 5I1LB 4FXKA 4I5BA 1NMCC 3HS0A 3PY9A 2JCWA 3JV0A 4XPTL 4AMWA 1IL1A 2VM4A 1FG2A 1VACA 1Q90A 3VG0H 1GGTA 3UYPA 3IDXL 4P99A 3C5ZA 5I73C 2PW2A 3R18A 3HR6A 5CJXA 1FGNL 3D34A 2ENYA 3BAEH 5JIPA 1WBYB 3LIZA 4J8RA 2HLFC 4MCYA 4F7TB 4JG9A 4P59L 4ZMLA 5IY5B 2G2RA 2EC9U 1OW0A 5GSVA 3FU9A 1SJXA 5AVRB 3NIDE 3ZSTA 1HIMH 3VFNA 2CLVA 5MENB 1GIGL 2NDFA 3MX0A 3ZYIA 4CILA 2AXHA 1CF1A 1C08B 1AO7E 3TC9A 1T1WA 3UFIA 2FK9A 2VR4A 3OF6A 5E2UL 4Z3GA 4BH8A 3O6FD 5EU6B 4DW2H 2A9BA 2AJXL 2X3AA 2XQYA 3U7WH 4ZMVA 3AUVA 4S0HA 2DQMA 4A2MA 5D4QA 3AB0B 3ZHDA 2F54D 2D2CC 4OZIE 3FQUA 1J8SA 2BP8B 1SDYA 1IV8A 4B9FA 4FABL 1IT9H 2CM6A 4E41A 1NSNL 4WV1A 2J3SA 1NAKL 3EOTH 1HWHB 1BBDH 3NH7H 2VLKD 1CI5A 1P5UB 1PX3A 2Q76B 5T1LD 3ZKMD 2RACA 1A4AA 1F6LL 4OZ4A 3SDDC 3TBSB 3BUYA 4ZMNA 7PAZA 4G8GE 4K8RC 1QQDB 4AK2A 3SYCA 1MEXL 3B5TA 1VKXA 1U33A 1DHKA 2A5UA 1UYWH 5CCGE 1I3UA 2NY6D 1TZHB 3BVDB 4BZ1L 3FCSA 3ZDYF 4YHYB 4YBLB 3AQXA 5FA4A 2XY1A 3MV9E 1MCPH 4XO9A 1T1XA 1UWXH 2FO4B 3MRHA 3POCA 4LSRH 2HVBA 1KJVA 4RDBA 3NAAH 1WICA 4XOCA 1CBVL 1Z6JT 3KPRB 3EJYD 2W9DL 4EN3D 2A2QT 1A6PA 2O72A 3D05A 4XAWH 3CFTA 1IKFH 4WFGD 4BWWA 4UT9H 1SYSA 3OKOB 4AI7A 2P8PA 1YY9D 5FYJH 3DROB 2YARA 1FLRH 2LV4A 1OARH 4L2YA 3BW9A 1KPVB 3K8LA 4WUKL 1ZT1B 2CM5A 4PRHB 4QO1B 5IG7B 4XN9A 3T9WA 1QWUA 3D0VA 3W56A 5JQIB 4MB3A 3TPKA 4ZJ9A 5E70A 4HUVA 5CBAA 4D9LH 1F6AA 2WBJB 5I1DB 1FZKA 5L9DH 1A1MA 4OUUA 1SBSL 2VL5B 4BK5C 2WLZA 4FL4C 2W07B 4Q6IC 1QX1A 5E8EB 4ATTA 4A6YH 4AXWA 3WDHA 2ITFA 3GSNB 4NN5B 4YDIH 1MHHB 3T6ZA 4WKXA 2VUKA 1T83C 1SVCP 1KC5L 2ZCKH 5SX4I 2JSFA 3QIBD 2E27H 2ZUYA 3IAQA 1JF5A 5CEXB 2X4NB 3T2NL 2MCG1 2VDQL 4LEXL 4NNPL 4LOFA 2F7IA 4V1DE 4HCGA 2XIDA 2R56H 2OA9A 4M1GL 3DXAD 2Z34A 1IBHA 5E4EB 3TH4T 4FAAB 3L6FB 2WSKA 3GIVA 4J3OH 2AS5M 4RQQB 3WTXA 1ZHBB 1B2YA 4ZS6C 7TAAA 2CO6A 1SXCA 3DV4B 3OZ9H 3TVMC 2AGJH 4WHYH 1AJ7L 1RJYB 2J88L 2BCKB 4K7FB 4K5LA 1GZPA 5HJBA 5T3ZD 3IS0X 4YK4C 1BLNA 1ETB1 4UUJB 5L7XH 1HSBA 1FL6B 3KPSA 5D93B 1XIWA 1W2KT 3QDGA 3HG1A 5I26A 3NIGF 4WUUB 1AQMA 5DMKB 2QHLA 4JE0A 4PJ7A 4C4BA 1GGCH 3KDMB 4OZFH 4GUCA 3ZHKA 4YAQA 3PFQA 3AS3A 4I9WE 5ESQA 1N64L 5FXCH 3MRQB 3WEBA 4UNUA 3BFQG 4XBEL 3BLPX 4ZUSB 4PJ7F 4NQED 4CNIB 1V7NH 3U4EA 3J8F7 5BQ7B 3CSTA 3HC2A 3ARZA 3IU3A 5E9DE 1SJVA 4GS7C 4Z7VE 1N6VA 4F8PA 5JPNC 3GTTA 4JJ5B 2FO1A 3UL4A 1S7UB 4HJSA 2YWZA 4IBTA 1FVEA 4TLKA 1UM4H 1PD6A 4QI3A 4NRYA 1G9EA 3B2XA 4KUCD 3BRGC 2XCMC 2XN2A 5HI4C 1TMCB 4QHUA 1G43A 2RCSH 3MFFA 1WZKA 1YY8A 1R1CA 1I7RB 3IDIA 5FYLD 1ADQH 5DZNA 1Z9NA 1OXYA 5GGQL 4JRYE 3WOVA 1CPUA 1UZ8B 5EO0A 2GEEA 1HOCB 3VFRA 2CH8A 4FF9A 1U91B 3N06B 4XVTH 4QXGH 1FFOA 2P26A 3KLQA 2X4PB 2JTDA 1VRSA 5IMOA 1CR9L 1J9TA 4NO0A 1OGTB 2EILB 4KNQA 3G5ZB 5DJYB 1YMME 4K9EC 1KEMH 4JO1L 4MXVE 3S5LG 2RJMA 2FSEA 5IHBA 2NYYC 2C9RA 5CJQH 4IS6A 1QBLH 1SEQL 2CDEB 1YAIA 4HSAC 4HC1H 2VXQA 2PXYC 4QRPB 2GJ6D 5AVSB 5CFHA 1OGAD 3L3GB 4MQSB 1M1XA 2EDOA 1KY7A 2AK1L 3NDZE 3NIDF 3P9MA 4U1IA 3V5HB 3LH2L 3F7VA 1NEPA 3A24A 5CZKA 4UDTB 4ETQB 5AYUL 2R27A 1PDKB 5C08E 3GZQA 2IEPA 3PWNA 4GKSB 3A6CL 3FO1B 1YN6B 2YWYA 3FN9A 3OX8A 5D96B 3OMZA 4X7TA 5C0EA 1D6EA 1N12A 1TVBA 1ZTXH 4G8GA 4X8GA 4EZMA 2APSA 4AJWA 2MJWA 1JK8A 4NUMA 1P6WA 1SF5A 3T2QA 2KT6A 3WAKA 4O2FA 5F9WC 2WNKA 4GP5B 4TQ8A 4M62L 3SIKA 4K71B 4HSCX 5BO1H 4JHAH 3PXJA 3AREB 5DLLA 4M9OA 4F8TA 3RUGE 3G5WA 2RD0A 1XD1A 3DJTA 4U1LA 4X9GA 4Q97A 4B97A 1IMHC 1J86A 1AHMA 2X38A 1JOIA 1MCDA 4YDZA 1EGJL 4LPCA 3B2DC 1MJJB 4EOWL 3FU6A 3I3BA 3PAYA 5CCHE 4U1JA 1CVSC 4W6XB 4MX7A 4ANVA 3TO4A 4J27A 3V52L 3WTUA 5D1ZB 1FNHA 1QLFA 3O6MH 4B96A 2FJFB 4DAGL 3EO9H 4GXFA 3V6OC 2JCCB 4MJIB 4OD3H 2VO5A 5JUEL 3V6OE 1TYEB 1OL0A 1USQA 4Z7OB 5AENA 5KG9A 4FNTA 4JM4H 2FLRT 3MCKA 5H2BA 1WP6A 1K85A 1TVDA 1L9MA 4TUJB 4CRPA 1G7MA 5IB3A 1BXAA 3LPOA 4N9OB 1NCIA 2F8OA 1SM3H 1RZJH 3CZFB 2VW7A 3VWJC 4ZZKA 1MNUH 3GMPB 5ESVA 1P84K 2G9HA 4TM9A 5CZRA 3RKDC 4N3TA 4LKXB 3MGTA 4H1LA 4D3CH 1EV2E 2B7DT 2W65A 5FYJD 4UTAL 4HIXL 2P42B 5KVGE 3WNNA 1S46A 4V1DA 2C1OA 3PUUA 4P2RE 2AJUL 1NINA 2WN3A 4CU7A 5F3BA 1O0VA 2KBGA 1LO5B 4XZUA 1S9YA 3SY0B 1EXUA 5BW7A 3C09C 1KLUB 1N26A 3CPUA 4MAUL 1VGKA 4HPOL 4TVPH 5A16A 3EUDA 2YRPA 3SJVA 3EO1A 3P54A 4QYOA 1BAWA 2QHRL 3INOA 1UXWA 2FIRT 5DUML 2BVPB 5KEZA 2ZF8A 2NXYB 3Q43A 4JEGB 2E9GA 2YXFA 1YEEL 4Y16D 3FFDB 3D0LA 4FERA 1SJEA 5K1VA 4MBRA 3S7GA 3P3RA 1EHLH 3QORC 4S0TD 1JFHA 2X1XR 1F11B 3L3OB 2VDPH 2KZKA 4JRLA 2VR3A 1LVEA 5KVFL 3WLBB 2E9IA 4KNSA 3HRZB 1BWMA 3FN0L 3OAZH 4PJCA 4AQ1A 1VPOH 1I1YB 2ZPKH 2UXFA 4GSUA 4PJAB 5DHXB 4PSPA 4JPIB 4J3OD 5D7JD 3LZPA 1MCNA 5IVZB 4ENEC 2FLMA 4UTCA 5CJOL 4Z7VA 5IB2B 4AKOA 4QT5B 1CDHA 4PJCF 1CGYA 3VFTA 4KWUA 4APXB 2CNYA 1U8HA 4Q2ZA 4P23C 3F6IA 2IANB 5A3IC 3HE6A 1DSWA 4K3EL 4KXZI 4XODA 3MJGX 5JW5A 1HYSC 4Z7VF 1CTNA 5I28A 4M6OL 4HT1L 3WKMH 4C4KT 4L1HA 1KCVH 4QRRD 1QNZH 1F1GA 1BQSA 4X6EA 5F7EH 2WO3B 2VDQB 2VMEA 1U41A 3EYSH 1PG7W 2EYTB 3DOSB 1WIPA 3LKQA 3OLGA 4H8WC 4JCMA 4X0KB 4NKIH 1D5XB 3DMMB 3VGEA 8PAZA 4GQQA 3QAZC 4Y4HC 4WF7A 5HHME 2FB4H 2CLZA 3MLWH 1F2XK 1G0DA 2HT3C 3L1FA 3SE9H 2NY4C 1VFMA 3MXWH 3IDYB 5HHQA 5B7EA 1IM9D 1P1ZB 1IGFH 2J6EH 2Q7AA 2CR6A 2R2HB 4MZ3A 4D8OA 2B3RA 1JS4A 3GSUB 5D7LB 3B7UX 5F6IC 2HFEA 1MRFH 2PR4H 1P7QD 1RURH 3BE1H 3L3DB 3L5WA 4JQIH 3RWDA 4JGNA 4LAJH 1N0XH 3OZLA 3RRQA 3TNNB 4ANXA 4RWYH 3H56A 2V2WB 1EO8H 4XAKE 2WXGA 4JKMA 4PW3A 2DL2A 1WFJA 3WXWH 3ZBMA 3KLSA 3BEVA 4YBHA 4G8AC 4FQHA 3FQ2A 4KY1L 2FDBP 3PWPD 2XKUA 5JO5A 5J7CC 4QRSB 3UTOA 3LMJH 4Y4KD 4I1NB 4X83A 5DGRA 1X3DA 1V54B 4A39A 1F3JA 4UINH 1JGUH 2OTPA 4LSUL 4WJG3 2OZ4A 5FFLA 2B9AA 2NMSA 3C2SA 4IOIB 4MQ7B 2BPBA 2DYPD 1D6VH 4AJVA 3MBED 3UJJL 1FO0L 4GBXC 3X12A 3CFKB 4CBPA 3I6LE 5TPWL 2WIMA 1I7TB 4DT2A 2FRGP 3N44F 1XF5A 1MZYA 5IEKB 4LGSB 3HOGA 4QKTA 1YNKL 4KZDL 3B9KD 2Y3NA 3S4SG 3HKFA 3STLB 4H25B 4P4KA 4QYAA 3UTSE 3A6BH 3CFDB 3MJ6A 4I18B 1BGXL 2Z4QB 2EEFA 2ZYRA 3L13A 5EZLB 1F8TL 4PJEE 2A99A 2ZWKA 2CCWA 3EO0B 3OWEA 2BNQA 2VLMD 1VGEH 3EF7A 2QPDB 3HNVH 1CFQA 1ASOA 2ITDA 1EAJA 3SPVA 3S6CA 4AYMC 3ARRA 2D03L 2GBVA 1J0KA 1NL0L 4G1MA 5D7IB 3UADA 3ZZQA 3BUTA 1AZRA 4G8IA 5DRNA 3RWEB 1KG0A 4PLJC 1CGWA 2JI1A 3GI8H 2J5LC 3MR9B 2KYIA 3MYZA 2ZOOA 3SKNB 2A9DA 2L3BA 1CQKA 4NC2B 4JPWL 1LMIA 2OMTB 4K94H 5E23A 1C12B 3C6EA 3NMEA 5F0JB 2GK0B 3WHXA 4L4VE 1HQ4A 1E8WA 4GEIA 3NA9L 4GEJA 3UO1H 5ID0B 1DCLA 3KL3A 3MODL 4LEEA 4OGQC 5E94B 5F6HI 4FNUA 2P5ED 3UTTE 4KPHH 1WT5C 3DBXA 4KKNA 4K3DH 4HGWB 2XQBL 2XTJD 4UOQA 2A38A 3VU2A 4DCQA 3F8UB 5C0CB 4YO0A 3TV8A 2QR0A 2X2YA 4PV8B 1P7KA 3GB7B 2XZQL 1K8DB 2YQ3A 1MFCH 3CSGA 4AYFA 1KENL 3DGGB 2G9KA 2R39A 2ZJSH 4NQVB 4PRID 5T3XE 4OF8A 2BOBA 1TEGA 5E8PB 4BSVA 1WWWX 2D7NA 3LV3B 4IEFB 4WEMB 2NY3B 1UVQB 1JPEA 2QQNL 4O02L 3MNZA 1SOQA 2EDFA 5IHLB 3O3BB 3Q5TA 3CSFA 5T1MA 4MDIB 4FHKA 1GPOH 4CMMA 1GAFH 2XG5A 4LSTL 5GGVY 1J8HB 1HCVA 2N1KA 3FF8A 4HKZA 3TNMA 1T7YA 3BKYH 2XT1B 4KXCA 1KGJA 3PV7A 4PR5A 3MRKA 5BOJA 5DT1H 1QYGL 4H0LC 1KYUA 2I9TB 1E0OB 3GEFA 1KN4L 5TE4H 3RTQD 1ZT4A 4WWKD 1T7XA 2CHWA 3ARBA 3VTMA 4V2CB 1H3PH 4NZUL 3RVTC 4X9BA 3HG2A 4TVPD 4OLWH 1NGPH 3AS2A 4A7GA 5JYLA 2AI0L 4DP8X 1MH5A 1OCCB 2QQKH 2F7PA 3IAGC 1S7QB 4XBGA 1TJMA 5C0AA 4P2OA 3LEXB 3RGVA 4B9KC 3WFHB 1I8LA 4A7GF 4Y0GA 5AW4B 4N2LA 1A6TB 3LPFA 4U1SA 1JDDA 2BY1A 2BOCB 3DWTA 4QXUL 4AQAA 1OM9A 1E4XH 4WCYL 2ZUSA 3FT0A 3MRDB 4J3OG 4ZFQA 5AOKA 3WFCL 4Q4EA 5FHAH 2JB5H 3C5ZD 1ZA3A 4PV9B 1XX9C 4TMPA 1MCEA 4FHJA 3S4SB 1Q72L 2DQJH 2QZ5A 3GHBL 1XAUA 4FE9A 1JXFA 3CQFA 5DJCA 1TXKA 3K2MC 1BLIA 4PJHB 4MTMA 3ZY7A 2E7HA 3WDIA 5GSRB 5CN1A 3PHQA 1WZAA 1M53A 4I8DA 1KXQA 2LLLA 2ZOKA 4LQFH 4OZFG 4ZPVB 5IQ9A 2OYKA 4ODBD 2Q7YB 5DUPH 1OM3H 2VZOA 5BV7L 1G9NH 5FFGA 1FFQA 1B9ZA 5EC2B 5F7DB 3OF6D 4XCYA 4QRUA 4MAYC 5AW5B 1WAAA 5LCVL 4NS0A 2C5DC 2ZT9C 3WJLA 4QJ5B 2F7OA 5I1GH 3IFOA 2F53B 3BZ5A 3SOTA 3GO1H 1JE6A 1RIVH 2VW4A 5DMGC 3BWSA 2OMNA 2ARWA 1SBBA 4KKBD 4OKVA 4YDLC 3UZVB 3ILQD 4FI6A 2EE0A 3KYKH 3O2DA 4X99A 1H8NA 4M4RB 1QSEE 3EUUA 4NM4H 2Q87A 3NACL 4FGMA 2XYCA 4GSQA 4TPRL 4JZJB 1J0ZA 4XOEA 1H0DB 4TLSA 1DSFL 3SN6N 4P5MB 1NICA 1WFMA 3WG7B 2B08A 3SO3B 1HAWA 4A2FA 1JZ2A 5J5EA 4EIUA 5IIEA 3FU7A 3E6FB 4U1MA 1YEJL 2YPKB 4X8CA 5ADOL 4GW5B 4F93B 1NAML 1ZVYA 1B0RB 4ELME 4YHOL 2VLLB 5E1GA 4NLHA 3KZ8A 3MRPB 3QHFH 4MD5A 3H85A 1YNLL 4JFDA 1AMYA 1IKNA 1H19A 4PRPA 4F58L 1JK9A 3ILEA 1W72H 4OQTL 4Z7QE 4IK6A 2CUHA 3JQOB 4H1LH 3D50A 1W0YT 3MHZA 1SOKA 2ZZUT 1EAPA 4OLUL 2YGNA 3RPKA 4ZMAT 3DRQA 2C3XA 5D6CB 3RVUC 5JOFA 1NEZG 2YPLD 4HG4K 2QQQA 1JXGA 1F4AA 5J12C 5I74C 2DQCL 1FNLA 1SJHB 1IAII 4J3XA 4JY6A 2B77A 1I9JL 5E8OA 1I75A 2A1WH 4RRPG 5DA4A 2BP0A 3PGDA 1IZJA 4AC2A 1QSZA 2PN5A 2W95A 3WFZA 4OFPA 1I3GL 4WI5A 2HJKB 4WTZA 5I6NA 2XTLA 4NWTH 1U95B 1LO3H 4ZOEA 1RULL 1P9MC 1KT2A 4N8VG 3OXSB 5I6KA 4O4YL 2YN5A 3CFNA 3FFCB 4NBXB 1UEYA 1OQXA 4DO6A 5C9KA 1FO0B 1PIGA 1PNDA 5FM8A 1AP2B 2YIHA 5DGQA 5JW3L 4NM8H 5FUCC 4DK3A 2IF7A 1S78D 4RH4A 5FUCE 3FSZA 4TTGA 4M7ZB 2XA3A 1S7WB 4FQLH 3X1GA 5EU6E 5MP6H 3ZO0A 1DBJL 3BEWB 1AKJD 2OI9C 5IW3A 5TH2A 3DGCR 4ZXBA 3KMDA 4N8PA 3R06B 2VLRE 2C3HA 3Q8CA 3ZE0E 1EDHA 1E6JH 1TZOA 2OSLB 3VRJA 4FFZA 3FO0H 3H4HA 2YA1A 2IVFC 4N2AA 1JN6A 2RB8A 2JKTM 4YGVA 4AGNA 1URLA 1CICB 1NDMB 2Z93A 2JJTA 3NGBB 2OJ1A 2IH3B 1FQ9C 3PXLA 4C4KO 1J5OH 5T5FA 2CQVA 1T80A 4H20L 2AEPH 2IGFL 4L37A 5C2BL 1SY6A 3PRZA 3CZNA 1HHKB 5DJDB 1I9RL 3FO2A 3IJHB 3VSQA 1Y1DA 2BRRH 1JSYA 4NZRL 1YECL 3TESA 1MCLA 1GJIA 5D5MA 3UBGA 4F57L 1R3IH 1DBMH 5IM7B 2CBOA 4L8SA 4IGBA 3GYRA 3JVGC 2HMIC 3KPRE 3QE5A 1QHOA 2HSIA 3ARTA 4L1BA 1PYWA 3OGCA 4TNVF 5D5MF 3VFWA 1UG9A 2HZHA 3SD2A 3CXHK 2RFXA 1D3CA 5DYFA 3Q6GH 1ONQB 2CBMA 3H54A 2EDJA 4DO4A 4ODTL 3VDAA 3ZL1A 1BA9A 1WHOA 3BYYA 4KHTH 4JCLA 4KROD 2XBTA 3BUPA 2ZKHH 3BP5B 3D12B 3E7JA 3OPUA 4Z7NB 1DZ0A 2YZ1A 5D2NB 1WZLA 4KKLC 1HWWA 3O9WC 4JR9H 4ZMXA 4AGLA 3FZUC 2MTAA 3G04A 4ICWA 2WBJC 4HCRL 1R0AL 3G5XA 3SE4C 1TZ8A 5E2VL 3BGMB 5DK2B 4NO0D 1AHKA 4P5TB 1BVKA 2AW2A 3P9LA 2ZKWA 5BJTA 3I3DA 2H9GA 1CGSH 4NN5C 4OFVA 4O02B 1DN2A 5GZOA 4PJXE 4URKA 2Y72A 4C59B 5C0DA 4PGCB 1TEYA 2QMKA 3QT2A 5HDWA 1CYXA 1NANH 2ZAHA 3MLSH 5L88H 1X9RA 1MFBH 2WTPA 4BE5A 1CIDA 3KYOB 3ISRA 1NEZB 1WIUA 3H0TA 1F41A 1IGMH 2VRKA 3QEQE 4OZGB 2A6JA 2EC8A 3N9GL 3WNPA 4Z5RB 1FRGH 5FW6A 3EYVA 4M6NL 4JAMB 5E4EC 4CADA 3SCMC 4ZYKB 3VM7A 4OV6F 5IFJB 2EXYD 3WFEL 3I50L 1KTLB 1I8IA 3QFDB 4TNWF 1LXMA 3QUKB 3BZEB 3VVVA 4BEIA 4JG1H 4MQXC 4NQSB 3WHE0 3MLVL 4JM0A 1N5YH 2CGZA 1T4KB 2G3NA 1RUKH 1EH9A 2F8IA 1QSEA 2DIAA 4YWGH 1FVCA 1EEZA 5HHNA 4NYLB 3E0GA 3NN8B 4FOMA 5J06A 3I02B 1RUPL 4XWGH 1KJ2L 2QZQA 3A5VA 5C0FA 2GSIA 4H8PA 4XP6L 5ALBL 3GKZA 5J89A 5GGVL 4FA8A 1U36A 2IALA 3A23A 3QCVH 1YC7A 5B8CC 1BZQK 5IJVB 2X6VA 2WXIA 4Y8DC 1GCYA 1O6SA 3QULB 2RA1A 3HR5A 4OD2B 5ICUA 4ELMA 3VXRA 5JPMB 35C8L 5BZXA 4MJ2A 4ZFZA 2R2EA 5B22A 3EBIA 5IW1A 5HHPA 3Q05A 1BOGB 5AQ0A 1J9SA 4JDTL 4ELMF 1DYZA 2DQEL 2IJ0C 5C3IA 1CGVA 1HFUA 3RVWC 3MV7B 3FT3A 4CU6A 3TJHC 1YA5A 2WN2A 1E7VA 1SHXA 2C3VB 3SOBL 5EZIL 3ILDA 1ECZA 2NR6A 2HPOA 3V0WL 5BV7B 1QWNA 4OLZH 2XC8A 5D7SL 3VD0A 2FNWA 1WCBB 4KJWC 4LCCA 3JZYA 5FCUH 3D9AL 3UG3A 5A2JH 1S7RA 1ROWA 5AAMC 2YKKA 1MIML 2VDNH 3BDXA 4DP9X 4Z0BL 3Q0HA 2DJMA 4NQXB 3CSPA 4XP4H 1OP4A 1NMBL 1XGTA 2IV8A 3PLYA 4K5PA 3UAJC 3OGOE 2KDGA 4ORGA 4RBPK 1CLVA 4XPAH 1BEXA 2FGZA 2OXGB 4OCYH 1T89C 1XF4B 2CGYA 3HG3A 5D55A 5F0LB 2IQ9H 2VOTA 3FSWA 3QNYB 4R4FL 1JHLH 4XMLH 3U6XA 1QHPA 4X2UA 4R7VA 3UTQB 3F7LA 1XGQA 3QJFB 5TGBA 1Z3RA 4OM0H 4I0KA 4ICXA 4PAZA 3SJVD 5L2KA 4UQ2B 5DHMC 2VLRA 4JDEB 2HRPH 4N0CC 3CVIL 3MLZH 4LLVA 1Q38A 5J6SA 2RR3A 4ZFGL 2ZYSA 3CN0A 3O3DA 4HVBA 2ESVA 3V0AC 1MAML 3OVUB 3APFA 2Y24A 3UTPE 4Z18A 3W11C 4FYRA 4YL4A 2X2HA 4UBDC 3CK0H 5EORL 3RILA 4JL1A 1MLBB 2EIEA 1EEQA 4LCYA 4NUJB 2Z1KA 1G87A 3K1KC 4M61A 4J4PC 1MHCA 3TM6A 2WYIA 4KUZH 2XN9A 2FD6L 4Z95L 3T0EB 1OTTD 4K23H 2ID5A 1T6VN 3HI1B 2PR9A 2UZYB 4WKZB 5ACLA 5IFAL 4P3DA 3OC5A 4Y5XB 4ODWA 1UFUA 2XV6B 5B1BB 4NNYA 5A2LH 3B7RL 4PB9H 1KCSL 4B0MM 1LQSR 2H6OA 3BPOB 1MFAL 2PP8A 2G4GA 3QCTH 3MA9L 3MLXH 4OFYA 1YEHL 3HNTH 1DJGA 3H4FA 4LOUD 4P06A 2OSWA 1DLHA 3OAUL 5D1ZC 4R0LB 3NUKA 4XP9L 5FEBA 3N40P 2NTSP 3E6HA 3D3VE 4PUBL 4EMZA 3TURA 2WNWA 5I15L 5INCB 2YQ2A 5ICXA 2JCCE 3GZKA 5DJZA 2ZOTA 3T3MF 2NSQA 4HXBL 2K7PA 2CO2A 2CDFB 3FU3A 4ORZC 1BD2B 2JE8A 4H2CA 4I85A 2BVEA 1KBBA 4HXAL 5KS9E 4JN2A 2QVFB 2WXLA 1HHGB 4IRZH 2AQ3A 2X10A 4PJXA 4LIQL 4XOAA 1AE6H 4ZAKB 4O5LL 4F15B 3MROB 4UQCA 5CLXA 4DEWA 1SXNA 4LNVA 3WN6A 3QUML 1K6QH 2MCAA 3DO7B 5DVMA 3FCUB 4PJXF 4DKAA 2APWA 3NJXA 3VFGL 4RRPM 4PS8A 3F12B 1NCWL 2FUQA 4F5CE 3QEHA 1UKTA 4RLDA 3AS0A 3DIVA 4WJ5B 5IGXL 1TQWA 5HI3D 1CL7I 4LK4A 2P7TB 1IEAB 3DX8A 4JO3H 1KTCA 5LAPA 4AQEA 4XNYL 4OT1H 1AVAA 4FG4A 4L4TB 4QHKI 1OOWA 1OAKL 4XO8A 4ECNA 1F97A 4GKLA 3BYTA 2ZE0A 1RUQL 4LL1A 4OIIL 2NXYC 3RVVC 4I3RH 3AWGA 1CE1L 1FUNA 2DKMA 3KPLB 1HCZA 3QXDA 4KH2A 2XJLA 5C0RH 4N0UA 4YFLF 3RGBA 3RB5A 1VFAB 2K8QA 3BZ4B 4XMWA 3NZ8B 1EFQA 3LN4B 3K6IA 2MCMA 1CXEA 1MW1A 2KPWA 1SEBA 4LAQL 3ZTEA 4PG2A 3LRGA 1QTSA 3L3OC 1Z9PA 3GMMB 4BKLB 1FORH 2XPZA 3LKPB 4GRLA 1QLEH 2FIKA 3H2QA 3HRZC 2CUMA 4JHUA 2UXGA 1S5HB 3L4ZA 3MJ9L 2GHZA 3QJRB 2P5WE 3KL0A 1RXLA 1QW9A 1BJ8A 1SOSA 4NWUL 5F7BA 1YNTB 2V2TB 2BNQD 4YHMH 5D2LB 4KQ3H 5C0GB 1E27B 1EEYA 2IANE 3NDYE 1JERA 1NCAL 4GINA 1CURA 4D0CA 4JANA 5I2IB 1V7MH 4I0CC 2JQAA 4LQ1A 5EBWB 3BKJL 1T04B 3MJ7A 3DMMC 5F1IA 1CLZH 4CVZA 1N5AB 4G9DB 4S1DC 3THML 1HH6B 5LKNA 3B5HA 2X9XA 3GRBA 3NCMA 3F3HA 1XR9A 3PWLB 4FFZH 1KN2H 3U0PB 4IDLA 2QLVB 5KVDE 4U31A 4YEEA 3X14B 2OP4L 2Y7QB 3APMA 6PCYA 4FNSA 3HMXL 1QA9A 1A6AA 5T5FH 3RFZB 3LNIA 1XMWA 2WINA 1II4E 5BVPH 4OF3A 5D7LE 1SY6H 4PJ8D 1KJ2B 5DFAA 4UM8A 5IFHH 4X80L 1FYTE 3ETTA 5LWYH 2UVFA 1DQMH 2X09A 2OW7A 2ZWNA 1A1OB 1RKRA 3CAFA 3QXVA 2CG9X 2YAMA 4NP9A 4S11A 2GTWB 4XXDA 4R5XA 2CSPA 1B2WH 1RZ7L 5DQJA 1UWFA 3DVGA 3FT2B 3NG5A 4MZRA 2YS4A 3ECQA 1DJHA 1YYCA 4X5XA 4XNXH 1NBCA 1HEZB 1FVDA 1T5XA 2CALA 2HVKB 3KCPA 3QJVB 5DJ2A 5FWRA 4ZMTA 4PG9B 1XCTA 4JDVA 3O2WL 4FG2A 1MVUB 2ORBH 2KQMA 4NB7A 4NUPA 1GJWA 2XWEA 2FYVA 2WLHA 1KB3A 4HUXB 1GH7A 1R46A 1NFDE 3F58L 2B4CH 2IAMB 3LKRA 3O6LH 5KYXA 1GGYA 3JWNC 4P9MH 4EQ2A 5I24A 1RJZB 3AXHA 3JWNE 5I76B 1K72A 2VAAA 2EXTA 4HQQH 4J5VA 3A67H 3ARBD 2DIJA 2VSCA 2R0KL 1T2JA 1INEH 1RY7B 5I1IH 3D51A 2ZUQB 1A25A 3AG1B 4YHIA 3G5YA 3ZN6A 4DFIA 1M2VA 3PL6B 4JFYA 2WO2B 4P49A 1KCWA 1I1FA 5C0AD 2VQ1B 4P2OD 2Y2YA 3RGVD 3T0BA 3L48A 3LEYH 1TEFA 2ZXDA 3IJYA 4Y7OC 5C0NC 4DP6X 2JKJA 1VDGA 4JFQB 1YMHB 1ZVNA 5ENWA 1GSKA 3K71B 3ARDD 3NPSC 1OWRM 4G1EA 1TVHA 5D7IE 4ZNCD 4G8EA 5DHDA 2ARJQ 4R90H 1CZ8H 5IBLC 1ODAA 4JFOA 3TT1H 2M8XA 2Z7YA 4IOFD 3CUPA 5GJSH 1HXMA 3CMGA 1KSRA 2I32A 3QQ3B 3REWA 1BAFH 3ES6B 3SPCA 4DGYL 3VGAB 2BH0A 1IC7H 3QZMA 5CWSB 1X7QA 3PXHA 5AOMA 2FHBA 1FE8H 5A7EA 4N26A 5KS9A 2APTA 4JN1L 4KTGA 3E9UA 4OCWL 1XGUB 1MCBA 2X4UA 4PN6A 5LBSA 4F9PC 2BHZA 4HKBA 3NJIA 4Z3IA 1GGIH 5F3HA 1B0IA 3ZJAA 3UH8A 5KS9F 2E7MA 1CFTB 1XSJA 4QCIA 3AG4B 3NCYP 3ULVL 4NPYB 3GBMH 2VJ0A 43CAB 3HZYA 1S7XB 3T4AA 1ZE3C 1N6QH 3RL1A 4F5CA 5CILH 2FX8L 4PWJA 3VNZA 2J5WA 1VSCA 3EFDL 1H5BB 4OJDH 3CLFH 1G1YA 1EFXB 3CLEH 4MMZA 5IBTL 2A4CA 4YXHH 3AG2B 2FYYA 2NY3C 3EHBD 1TETL 1TJIH 2VH5L 1J9QA 2P80D 1WAPA 3EZ8A 4FXGA 3FUMA 2FJHB 1IC5L 3BZFA 5E1AB 3IFLL 1AZNA 1BYOA 4OF0A 3U9UB 5SV3A 5CLTA 5L0QB 5IQMA 5I1HH 4WVRA 1ORSB 4HIEA 5HHOA 1JNNL 4Y9BA 4BK8A 5FECB 2ICWJ 4EDWH 5CKGA 1AXSB 4LRNL 1QR1A 4EE2A 4PVBA 1RK1A 2CJSA 3PHSA 3W38A 5EZOH 1WH0A 2FEDC 2N7AA 4ISVB 1QHQA 2HWZH 2ALWA 3FJTA 1ZLDA 3DVNB 1DJYA 3PP3H 4JFDD 5A2IH 1HZLA 5E4OA 1FJ1B 2FWSA 3F00A 3HNSH 2I5YH 2EE2A 5FS5A 2VNCA 3ATFA 5DHVB 3QUMB 2I7OA 3C8HA 3OC8A 4JRXA 4P5KA 4YDKH 1NC2B 5E6ID 1DUYB 3VFPA 1GOFA 4DK5A 5BNXD 3NCEB 1VADB 1PMYA 1QKZH 3S3JA 2PWDA 1K3ZA 3NJLA 2GBTA 2WMPA 4UQAA 2ZCHH 1U8LA 3O3UN 1NCGA 4F9LC 4AL8C 2X4OA 4K55A 3RDJA 3ZKQD 3ARXA 2MHAA 1LO0H 2GUOB 5DR5L 1H6TA 4OCMC 1KTJA 1WSST 4X0NA 3AQDA 4KO9A 4D7BA 4U0RC 4PY7B 4YZWA 1CLOH 4H26B 4KQ4L 2X87A 3DNKA 3QUYA 4ZDHA 4IYKA 1BJMA 3GBLA 1A7QH 2GIMA 2CK0H 1SXZA 2F1BA 4F27A 4NO5B 3QUXC 4OGYH 4XPBH 5E5MB 3RFRA 3TCLA 3V5DA 4YDNA 3GSVA 1EHKB 2DF3A 3NCFB 3L1EA 3IWVA 2HFGL 4WY7H 2GEQA 4MCNA 4NKDB 5KVFE 1R19A 1Z5LB 5FO7A 4K07A 1EMTL 3QA3A 4UB0L 3BD4A 3RBGA 4KBPA 5F7MC 4LGPB 2QADB 3DX6A 5C6TL 4XMTA 1IKOP 4XNZB 1AGCB 4I77L 3DHJA 3EOYG 3BH8B 2CUAA 2XWCA 4PJ5D 3SDAC 3MCLH 3O8XB 5TF1H 5CCKH 2VZ1A 1KBVA 4JZJC 3QEGH 2IWKA 3OKKB 1R3JA 5DO8A 3RA7L 3U6RB 2H3XC 3GUTA 4EUPB 3RHWK 3SO3C 1GCFA 1JGVH 1U8KA 3G5VA 4O51A 5FR3A 4N2MA 1LD9B 3VRLF 3TYGL 3CFBB 4C83B 1A1NB 4AGPA 2IBZY 1PG7H 1RZFL 3B7TA 3K2UL 4C56E 2CGRH 4MCZB 1XTLA 5CHNB 5B1JA 2YD0A 4IGBD 5J3HD 4NJAL 3DUUB 2V2XB 1JDAA 5F9JB 2G3ZA 2AQNA 2EH8H 3PGFH 3TN0A 4JY4A 5ICZB 2BWIA 3IKCA 4KXAA 4WGKA 1YG9A 5AG8A 3O3EA 5J6HA 4JRWA 3VYPA 4AZUA 4HUWB 3EH4B 2IBGA 3WN5B 1ZGLA 5MEQA 3II1A 4E9XA 1B4RA 1AY1H 2KQNA 1UXMA 3H9SB 4KK6D 3TPUA 3OQ3B 1J10A 2YGOA 4LSDA 3QDMB 1KTDA 2ZUXA 1AR1B 3HN5A 2BVQB 1UJ3A 1IFHH 2ZNWA 3DX7A 3JTSA 1PZ5A 4LPYA 4JFFB 2FGWH 2EE9A 4YPGA 4ADGA 4QXWA 4KVNH 2ZG3A 3FTGA 3ZDXE 4MS6A 1BF8A 4YHKH 3QC6X 5GZOD 1FAIL 3MO1A 1T22A 1I8UA 2J44A 3LZRA 3QO1B 1MI5B 1IIIA 4K15A 3PP4H 7FABH 4LCIH 3NJJA 1MJ8L 1UTDA 1ZS8B 4UF7C 3JTTB 2X53A 3WIHL 5ACZB 5T33H 2ZP9A 5DMJB 2ZOUA 2NY1B 1P4LA 3B2VL 2EDNA 3BIBX 4Z8FH 3FHAA 5CZXD 3LPGA 4WK2B 4LLDA 1N3NA 1UHVA 5K1NA 4M7ZC 3K6SB 2DKSA 3CX2A 1A3RH 2V9RA 2FQGA 4U6TA 1OSPH 4DESA 3ZQ9A 2ITCA 4F3FA 2NCMA 3OAYK 3V0GA 5DURB 4IKNA 5CGYC 4JKNA 4PGEB 2MNWA 5KYYB 4M03A 4HEPG 1B0GB 1RFDH 1WUZA 4WFED 5FV1L 1L9PA 1UB6B 5T3ZL 4A38A 1BQRA 1FBIL 3CSYB 5I75B 2BSSA 3JWOC 3HG4A 2O5XH 2WWNA 1CICC 5TJWK 3WFBH 1ID2A 1Q4NX 1XH2A 1KJ3H 3NGBC 4DQOH 2WXMA 4N6RB 3EAKA 2CXKA 2Z4TA 5AZEH 4WW1B 3TONA 2GCYB 1Q8MA 3TJEH 4PWGA 1SMAA 5CFAA 1CFVL 3OKEA 4X6FA 4DKFL 1ES0B 2HT4C 3D1MC 3QQ9D 5AOZA 1A0QH 4JZOA 4DZ8B 1FL5B 3DHUA 4XCEA 3B2UD 3K2KA 2JELL 3BH9B 4JFEE 1ZLUH 3VXRD 3FSAA 1Q9LA 2QEJA 2R1XA 1E4KA 1VFBA 2E7CA 4IM8A 4L3EB 4QOKA 5EN2A 4U1GB 3FBQA 4XE0A 1XSKA 3NJGA 4LLYB 5C09A 1MFEH 2HJLA 1IGTA 3IGAA 1M2OA 2WVSA 1FNSL 4L9DA 4UIKL 5EUOB 2X9YA 3H7LA 4PP2B 5EOTB 1XH3B 1UQSB 4BA0A 4A7UA 4HALA 2NR6D 2H6PB 3D7PA 2FX9L 1DQQB 3QQDB 1MFMA 3GFUA 3KCWA 3SBRA 4HSQA 3ULAB 1NPNA 1NBVH 1PSKL 1RZPA 2HFTA 4CVXB 3EYQC 3KPQB 1EJ6A 5IESL 3MRIA 1IAOB 4PJIA 2ZX5A 5J1SC 5DJ6B 3CVHL 4UYPA 1QUNB 1RVFL 2ENQA 4PRAA 3QQXA 2AEQH 1Q9KA 2EEAA 2TRYA 4XH2B 5IKCA 1QBMH 3CD4A 3NCYS 3VCLB 4MJ6B 2GC7C 1U8CA 2AV7B 4ABQA 5I1CH 3WE1A 4I48B 5D6DA 2UYLA 4L2LA 4OCNC 4PJIF 1IGYB 1U6AH 2IH1A 5ITFB 5HDOA 2VC2H 1NGYB 1XEDA 3V4VA 3GRWA 1A64A 3EW3B 4E5XA 1JWUA 2L7JA 3FULA 5AVTB 3S34L 1XGRA 1D5BB 2CBPA 1FC2D 2A83A 4ODHL 4NOFA 4HDIB 2B1AL 2XWRA 1DBAH 3C60D 4TUKH 5FF6A 3K8MA 3R19A 3V8OA 1WGOA 3TBTA 3VI4A 1F58L 5TDPB 4KRLB 1F90L 2FBJL 2QV4A 1E30A 4EI5D 5L2KD 3FL7A 2WB1A 1CFNA 1BX2B 2KERA 5AW0B 2H26B 4OZHB 3ALWA 2VR5A 4PB0L 1T0MB 3VI4F 15C8H 1T5WB 3DPBB 4XP1H 4X4YA 3FXIC 4M7LH 1F56A 2ESVD 5HY9A 1EZSA 4KJQD 2HJFA 5GRZA 4KRPD 4NENB 1Z5YD 2X89D 1XF1A 1CGTA 2FEEI 1GJUA 2VMJA 1R3LA 5AYQA 2UZIL 4ENZA 3VXUE 4XVJL 4J3TA 1ODUA 4QHLA 1WA0X 3ARGA 4ZSOB 3FQ4A 2ARJA 3SPHA 2Y23A 4CDGC 2ICEC 1RERA 2XN9D 2D0HA 4RETB 5TDNA 5JQHC 5DMIL 5HYEA 3QGVA 4WFFD 4AIZB 1MQKH 1TZIA 3NA4A 4ZX4A 3OJVC 3ZE2B 1VLXA 5JPMC 5KVEH 5D1XB 4R8WL 1L7IH 4WSGA 1FGVH 4G5ZL 4MNQD 2XV0A 5LBSH 2CKBL 3SQRA 3HAEB 4ODUB 4G9FA 4Y2DA 4H5SB 1BZ7B 3O3AB 3UEQA 4XMPL 2ZXAA 4EIBA 4OFYD 5DD1L 2BCMA 5MERA 1KTRL 3MRFB 3DIDA 4R96A 4HGMA 5EBGA 5EA0H 1BZ8A 1Y07A 3ZZLA 4Z6AT 1AHWC 1QFWH 1MG3C 2JJSA 3TWCH 5BV7C 2LQRA 4WNQB 5DVPA 2F5AH 2OMBA 4LLWB 3OJMB 1U8IB 5D71L 5KAQG 2XKSA 3APDA 4LSQH 3O6FB 5DUJA 1QNIA 2O5NA 4P2QD 2QPEB 3H42H 1KJMA 2FZ3A 1A4KA 1NCBL 1FDLH 2F54B 4CBZA 2Z0BA 4CAGA 4P5SA 2G3XA 5IB5B 1WWAX 1SN0A 4HH9A 5GZNA 5J13C 5E2WL 1B6UA 1WIOA 2P24A 3L08A 3W5MA 4GMTH 4HMCA 4G70B 1NPUA 5IZ7A 4AM0Q 4OM1L 5J57B 1Y6MR 4F7CA 1COBA 1BV8A 1ZAGA 3KEDA 5DMYA 3ZDXF 4BDVB 4TQIA 3TP4A 4XBMA 4HFWB 1FFPB 1GYWA 4KKAD 4ZW3A 2APVA 2A9NL 1YEIH 1JNLL 5IJCC 5KZCD 2OMVB 1JV2A 4R7NA 1WUNT 2GABA 3D69A 3IRPX 3QSKB 1F4WH 1MJ7L 3EDFA 3WE6B 4KKPA 4XRCB 3W2DL 4YHZL 3U7AA 3VX1A 4A6YL 3NFPA 2I9LB 3UTZA 1FNGA 4YDIL 5TE7L 4PJBE 4I3SL 1Q0YH 5AVXB 1ED3A 2FEJA 2WV3A 2ZCKL 4WI8A 4UQ3B 2HKFH 1ANUA 3CC1A 3QPXL 4RNRA 3Q7JA 2CHDA 5FYKE 3KXFB 4RFEB 4X6BA 5DZ9A 3A22A 3TL5A 1X44A 3GSOB 2A73A 3V4PA 5LGJB 3RX8A 2LE9A 4GRLD 1Q9WA 2MQ3A 3ATBA 4NQDB 4GUQA 2FHCA 2XVLA 3MRRA 5IB4A 4QRQB 1T1YA 4JFEA 1KPUB 3T0EC 1KB9J 3T0EE 4FCHA 4M02A 1HI6B 4MXWL 4Y5XC 3ZGHA 3SE3C 1OF2A 2P43B 5G4MA 1VERA 2NX5A 5ACMA 5TF0A 2M2DA 3IJEB 1X9QA 2EIZA 3LQAH 4DEPB 1T03H 1EXHA 1B0WA 3BPOC 4ZUVA 4EVNB 2EZ0C 2AQ1A 2R59A 3U46B 4OJFH 4L29B 1QRNA 4B9PA 5HDQH 4NKOA 3GMNA 1CDBA 1JPSH 4R0LC 1H8OA 3LVTA 1IFGA 3NRFA 2G60L 4G3YL 4X6DA 4G43B 4L5FL 1ZWIA 1YPZB 3MBWB 1MELA 4OV5B 3TF7C 1I1AA 2GI0A 3ELAT 5TFSL 5CD3B 3IJSA 1KIUB 3WNOA 4WEUD 1G7LB 2OR7A 3KS0H 3WS6C 4JG0L 2LTQB 4F7EA 5FUOH 4X6DF 2WVVB 1BD2E 4B53A 5BO0D 3NSFA 5JR1H 3TS8A 5BUAA 4N6QA 2YN3A 3IDJA 3SB3A 1F13A 1NCDH 4M1CD 4ZAKC 5GGSY 2UUDK 3NRQA 4F15C 1F6FB 2X44D 4GT7A 5LBVA 4TQEL 2NTFA 5AOIA 4BQ9A 1ZRUA 3BQUC 1VEMA 4KMLB 2WLKA 4PWHA 2MKLC 3AT9A 4N9GA 4WHTA 3WFDL 5CD5C 3FW6A 1LO4L 1SHMA 4FKKA 4Y19A 4KKRA 2OULB 3BH4A 5ERWA 2B39A 3UAEA 3VXMA 4AH2A 1I7UB 5HDBF 1IEBB 2WLMA 2GSGA 1GZQA 4J39A 2FATH 1W80A 4MDRA 3PV6B 2DI8A 5T5NG 5GJTL 4R4NC 1YSOA 2AQSA 1MRDL 5AKTA 1D5MB 3B9VA 4Q74A 4P46A 2AEOA 1BMZA 4PRBB 4K5MA 4GRWH 2E6JA 3HFML 1UB5B 1RHHA 4GSRA 2R1YA 2X4TA 4N3UA 1X9LA 3ZSSA 5FIEA 5EF3A 3VXUA 1KB5L 1U3HB 4U7MA 1TJGH 2D9QB 4LEBA 1L0PA 3KYNB 3VFSB 4X5WB 4PYGA 3D08A 1DTUA 4PJ9B 2Z31C 4LESA 3CJJA 5BMFH 4EXPX 3T77B 4KZ0A 3FQXA 1BF5A 4PYHA 3UC0H 2ICEA 3VFMB 1U3YA 1Z0MA 3QUZB 5IHHA 3CVHB 1GTNA 1QPKA 1K5NB 3D25B 5GRJH 3CFEA 5ADPL 4M8QB 5AAPA 2I60H 4Y2LA 5DEJA 2X1QA 5FB8B 3EYUL 1OT1A 5CEZH 5KBKA 1MFVA 4LCVA 4WNSA 5A2AA 3TWYA 4Q58C 5D1QB 4JHWL 1AQDA 1IAIL 1JPGA 3P11H 3PIQB 3FTSA 3L17A 4RFNB 4LGRB 3ZU8A 3DO3A 1UXSB 3P30H 4CSPA 1AHWA 5ILTH 3S88L 2JKLA 2W0KA 1J0IA 2MFNA 1CL7H 1ND0A 4HLZH 1QSFB 3FDWA 5TQ0H 3BN9D 2XU9A 4RMBA 3C9NA 2ED7A 4XNUH 5HGDB 3D87B 3FOLA 4M5YH 4HU8A 3QJSB 4F2MB 1NM9A 2CO7B 3WIIL 4BFIB 2EYSB 5CIPB 1KXTA 2DQIH 4NRXA 1JPFB 3GLEA 1IE5A 3S35L 4HX1B 4NAMA 4ANKA 2IPKB 5GS2H 4D94A 2PCXA 1EUUA 3GI9H 3PGCB 4HBCH 1L0YA 5IK3B 3SO5A 3MRCA 1H3XA 5IOPA 5JIDA 4MJ5A 1I8MA 5IQ7L 1M7DB 4PTTA 3D2UA 4DQAA 1B3IA 1BVNP 2FJGB 2C9XA 5K39B 3R4RA 5EEYA 2B9BA 2CKBB 3AU1A 4WRLA 3WIAA 4PJBA 1BFVH 1ZVSA 4NN6B 1FL3B 1J1PL 5IQOA 3QG7L 4A7SA 1ET8A 5JXED 3WEOA 3GKWH 4NZJA 3ULUC 2R8SH 4TULL 4L9LC 1S2EA 4GUOA 3ULUE 1ETZB 3VWKC 3QDJB 4M4PA 1JTOA 2J1XA 2IAMC 3NK4A 4NQCA 4PJBF 4PJFE 2IMNA 3QPQD 3DGDA 2P4AB 3JWDH 2CWRA 5EMYA 3GMQA 3MRJA 1ZEAL 4JFZH 3QI9A 3O11A 2XZAL 3L1OH 4GPVA 3RWHB 4JW3A 3TEYA 1XT5A 2F74B 4U7SA 2DM7A 4PJDB 4Z77B 3EOAB 2HTLD 5E00A 3BHBA 4MS8C 4Y5YB 1JWSB 1NKOA 4RGOH 5KSBB 4KTEH 2A0LD 4P2CG 3V4VH 1TKWB 5BXFA 3GGWB 4QTHA 3OKLA 2WTOA 5FK9B 3HFFA 1HL8A 1R6VA 3PAVA 1JPTL 1DQDL 1HHJB 2D7TL 1MCOL 3GSRB 2ZYHA 3F01A 2VRAA 3UMTA 5ANME 2Y36L 4JVWA 3WENA 3ECWA 3DPDA 2EDMA 4JRXD 4OLYH 4PS7A 2WXOA 1I9EA 25C8H 4TNEA 3TIDA 1MSPA 1CFMA 1P5VB 3MLYL 1RZKL 5E6UB 5F9DC 5EEVA 2H32H 2OMUA 1UD5A 3RWJB 4GG8A 3MNWB 4ILDA 5DUBA 3LIZL 2NY5L 2D9CA 2EXWC 3UDWC 3US1A 4MGXA 3DTXA 2NW3A 3FT9A 4A6YB 1KIQA 1RIUL 3QUYD 4HCFA 2WLYA 3IN2A 2NZIA 3WNMA 1WO2A 4R26H 1HXYB 5HGHA 4YJZL 4YSOA 3LRSB 3VXSE 4LP5A 2PW1B 5JHDD 3QH3A 3CV5A 4J1UA 3HE7A 2GT9A 3LSOB 2G30A 2V3EA 2WJ5A 4RFOL 12E8L 4HIJB 1L5GB 2VIRB 2XSKA 1DQLH 2KHAA 2J8OA 4JQXA 4X6CA 5DCCA 4U3HA 1CE6B 2ZWLT 4UTBA 4L8BA 1H5BC 2Y6TE 3ALXA 3NCWA 4GSDH 4J7RA 4MHHI 3KWUA 2WWKT 1SNRA 4X6CF 2VM3A 2XNAB 3EDKA 3TZVB 3BVNB 3C6LB 1E4JA 5IMLB 3CFMA 1MUJA 3I6KA 1XGPA 1M4KA 4GKZB 2JKWA 2VZ3A 2CIKA 2G75B 3QIWD 4ZTOL 2EO7A 4AVHA 3D18B 5BZDB 1F4YL 3FOMB 3LKSA 1E28B 3HG0A 3WUWG 3B9AA 1NH6A 4QRRB 3GXFA 2OJZH 5IMMA 4MB4A 3N04A 4L8DA 3BIAX 3PQYB 1JUFB 3N42B 4FNPA 4Z7WB 4M5ZH 3SDXB 2QKIA 5F7UA 4XC1H 3TA3B 3SQBB 1JZ7A 4I1RA 4OCRL 1UH4A 1PS3A 2FTAA 4KMQA 1M9SA 1O75A 2GC4C 5KYWA 3L9RB 4O9HH 2X4RA 4OF7A 4UAHA 1WEJH 2XVKA 4ONFL 3GF8A 3U2SA 2XUWA 5EWIL 2CHXA 3TASA 4L23A 3OLIA 1W6WA 1SVZA 1N6UA 3BISA 5K59F 1QTYT 2VZUA 3ATDA 1ZA6B 2LLNA 3L7FA 4FQQB 1AC6A 4AM0A 2OFQA 4EIGB 2WLLA 7PCYA 1P7QB 3QYCA 4URTB 4X5LA 5H35A 2UVEA 4NPKA 5AWNH 4DK6A 1MRCL 2OTUB 3BO8B 5ESAA 3AGWA 3R0NA 5SWSE 3QYNA 3U4BL 2Y1AA 2F19L 4WFHE 2OL3A 3UJTH 3RDTC 5B38G 3OKDA 4JO8A 5HYJD 2HLAB 2XOTA 1OSZA 3VXOB 1QMUA 2YEZB 5JLZB 3PWPB 2B20A 3DYPA 3BP4B 4WW2B 5DA0B 1YN7A 3I75A 4HUNB 5T1JA 4K3JL 4NT6B 3EDJA 3AWFA 3C75A 4QF1B 4RZCB 1CU4L 3O45A 3IFPA 5AZUA 5KSUB 3W81A 1ZD6A 1SVBA 3EOBB 4FQIH 5I1KL 3T6QC 2E9JA 2Q8BL 5CEZD 5GPRA 4APQB 4W70A 5GRUH 4W6YB 4E9VA 3BD3A 3MBEB 2X9WA 4FQJH 5ITBH 3ZUNC 4GO8A 5CP3H 3CXDL 4LCWB 4MYWB 3VU1A 1G7PB 1KB5B 5HPMB 2NNCA 3EADA 2IG2L 5EU4A 5EB9A 4ODXB 2UV3A 1KFAL 3OR6B 1D5ZB 4MSWA 4QRTB 5B7MA 5CBEA 1E3FA 2AZAA 5BRZB 2HAZA 1NGQH 2ZXBA 4HHAA 2VR9A 3F7KA 1AZBA 5FUZH 2V9QA 5IVXA 4N25A 4XNZC 4N1CA 4Y4FA 1AXTH 2O26U 3EBHA 3E38A 2GJZA 4Z3FA 3L3IA 2P8MB 2I25N 1RZGB 1AZZC 1GC1C 5IVXF 3P2DA 3RL2A 3HS8A 4LHUA 3T09A 5HYSA 3T65B 3FRUB 2DQHH 4JS7A 3WIFB 3WS3B 1U4EA 1A9EA 2VDOL 4PJFA 2EVGA 3HHRB 1QFHA 2NNAA 3SPJA 1P1VA 4U0QB 1RZ8B 3IFNH 5GS2D 4Q56A 4RVBA 3BVXA 3RU8L 5E9AA 3V7AG 4YQXL 5HHVL 2ZYIA 4PJFF 4M6MH 4RAVB 5DWUL 4ADJA 4QOKD 1R34A 5C09D 3NOIA 4ZW8A 4IRSB 2IOMA 3VQ1C 2ZXQA 4P9HL 2IXQA 2J71A 2P5EB 4QJ3B 2J1ZA 5DRXA 4ABUA 1PQZB 1F2QA 4ZNEE 2QVIA 1HEJC 1TSHA 2AK4E 2AITA 2EYRB 1OCWH 4GI9A 4I0PD 1U2HA 2ADGA 3F84A 3HUJE 4FZEL 3V6ZB 5IVNA 1T4WA 3B8YA 5KVGH 5LDSA 4LBEB 5HP5A 5DO2C 5EZPA 3FU5A 3MLTA 3O4LB 3QDME 1OQOA 1AR1C 3VA2C 5EU5A 4KMTH 1C16B 4PRIB 2JMRA 1U8NA 3W39B 4JFFE 4XHJC 1T7ZA 1CXFA 2X2IA 3GSWA 3VSUA 2NZ9C 1NGPL 3CFUA 1P7BA 4MXQD 2HB0A 2ED8A 2X2UA 3EGXB 1JHTB 5I6XB 3FCBA 4BFJA 4JPKL 3NIFF 3WSQL 2JKRM 1DUZB 4BV1A 2DEXX 4JM2A 2VXQL 1UURA 1WBYA 3CIAA 3L3HB 3VXSA 3HC3H 3GUFA 3MI6A 5AB1A 1XZ0B 1FFNB 2F58H 3CQPA 4HIIB 2H8PB 2N3JA 1LE5B 2NY1C 1NGXA 3DSFL 5KSAC 4UM9D 3GXUB 4JM2F 5ALCH 1UD4A 1ZDSA 4FTVB 5B38B 5C97A 1U30A 5AAWC 2CDGA 3KM1A 4HCIA 3W0WA 5MENA 3CU1A 4NZTL 4IQHA 1X5YA 2WQRA 5ISZB 2H41A 5EIVA 4JFXB 4EJ1C 4KO5A 4MWFB 4N90D 2FJSA 3C5JB 1P4IL 5JHLH 3V7MA 3K91A 4HWBA 1A14L 3VJ6A 2DL9A 4UDUB 4ZS6D 5I75C 1YEFH 2BP8A 1EIBA 2CUIA 4K8RL 1KCRL 1LEGB 2QBWA 5H37A 4P48A 4Y5VA 5E2TH 3ARGD 3BDYH 4ZUWB 4D8PB 1P5UA 2Q76A 3HI5H 4FXKB 4I5BB 4D9QE 3HS0B 3L4WA 1LP9E 4KZEL 1IL1B 1R33A 1FG2B 3SZKC 1YEKL 2HCZX 2Z7ZA 1QQDA 4S1RL 3UYPB 3C5ZB 3AMKA 4WO4B 3SEPA 5J56B 2PW2B 3NK3A 3HG5A 4LVHB 4HF5H 1N8OE 2AJYH 2Y6SC 1BXXA 4MCYB 4NI6A 1KBWA 4U1GC 2G2RB 5FM4A 2FO4A 4L3EE 4Y2DD 4NQTA 3ZTCC 4XC3L 5FYKU 3ZE1B 1MY7A 5AD0A 4ZX6A 4YE4H 3O41B 2DOCA 4UT7L 3WEAA 3MX0B 1D9KA 3WHE1 1NLDH 5KSVA 3ULVC 3LH8A 4M48L 1BF2A 1EJFA 5J4MA 3OKOA 4PBXA 5SWSA 5F71A 3ULVE 1C7TA 3WTYA 3DROA 5JQ6L 4GSXA 3ARWA 5C0BE 4LASL 4FG6C 1ZT1A 1ETJA 4H88H 2IH8A 4PRHA 1WITA 2IWGA 3OB0K 3OKYA 5GZND 4ZD3L 4E41B 4L18A 3RAJL 5DD0L 2PPFA 4WV1B 4DOHE 3EYOA 3C5XA 1W0VA 2Y07H 1J12A 2Z1PA 2VL5A 2RAMA 1XWVA 5KJRL 3WXVL 5K9JL 1LMKA 3FONB 5IJKA 4HGKC 4R7DA 5GS3A 1VKXB 4N85A 2ADJB 5TK2A 4UQBA 3FUJA 5JHAA 5EU7C 3FCSB 1KYOJ 1A65A 2BNRD 2GBAA 2NY2B 2I69A 2Y5TA 5FA4B 5FPIA 4AV0A 3HCVB 3HI6H 2C9UA 4I7ZC 1T1XB 2Y9RT 4JZNB 1KJVB 5TK4A 3WNKA 1IM3A 1A7PH 4F37K 2B1HH 5ICYB 3MGAA 4RZKA 3NZHH 4N0YH 2MPAL 5DQDL 4MNGE 4OD1L 1SYSB 2ZCLH 3NFSL 1MLCB 2JXMA 1IAIM 3US9A 3BW9B 5JMRA 5FO8B 5GS0L 2R29A 1DBBL 2QV2A 1QI5A 1RJYA 4K7FA 2DH3A 1QZNA 3KH4A 3KVPA 4X7DC 3IEAA 3L95A 2BFVH 4G6JL 5CBAB 4ZSOE 2YMOA 3BAXA 1FZKB 4RMUA 3LS5L 4NNXB 4WUUA 3BOVA 3TU6A 1ZGLP 4PH8A 4OI8A 4ZQKB 1ZLUK 4HLZG 2WUCL 2K9FB 2XHNA 5GGRY 1FCGA 4J23A 1UA3A