2E4FA

Crystal structure of the cytoplasmic domain of g-protein-gated inward rectifier potassium channel kir3.2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
201
structure length
191
Chain Sequence
IQRYVRKDGKCNVHHGNAETLVFSTHAVISMRDGKLCLMFRVGDLRIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLGFYEVDYNSFHETYETSTPSLSAKELAELANRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Diversity in the Cytoplasmic Region of G Protein-Gated Inward Rectifier K+ Channels
pubmed rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords G protein-activated inward rectifier potassium channel 2
total genus 38
structure length 191
sequence length 201
ec nomenclature
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 2e4fA00
1U4EA 3JYCA 3SPGA 2WLIB 3AT8A 1P7BA 3ATFA 2WLLB 3SYCA 4LP8A 3SPCA 1XL4A 3AUWB 3SPJA 3ATAA 3SYPA 2X6BA 5KUKA 3VSQA 1N9PA 2X6AA 3SYAA 3K6NA 1U4FA 2WLKA 2WLHA 2E4FA 3AGWA 3SPHA 2WLJA 3SYQA 3AT9A 3ATBA 1XL6A 3SPIA 3SYOA 3ZRSA 2GIXA 3ATDA 2WLMA 5KUMA 2WLLA 2X6CA 4KFMA 2WLNA 3ATEA 2WLIA 2QKSA
chains in the Genus database with same CATH superfamily
2R4SL 4QDGA 1UH4A 3BVTA 4L8SA 4M8RA 1MHEB 4F8LA 1JZEA 4K4KA 5FHBL 4R7VA 5LUMA 1MQ8A 5I1DB 3OD3A 4X8CA 4LGPB 3WKNA 2IAMD 3UC0L 3K72B 4NI3A 4W9FC 1QO3B 2K3TA 2WP3T 4G71B 3RFZB 4QUOA 4P5KB 3MLVH 4CDHA 1B4JH 4E68A 3ME0A 2GVYA 1A22B 1OCOB 3OR7A 1LMKA 4UNTA 5E2WH 4MA3A 2XQBL 2BY2A 3DHPA 3KJ4C 2Y5EA 4GRMA 1JG9A 3DROB 4WKZB 3O41B 2ICEB 3GMLA 1HCYA 4RGMC 4JANA 5K9QI 1HZKA 3KPOA 1LE5B 5KYWB 1FYTA 1N8ZA 1EVUA 3K2IA 4GXVH 4AIOA 4WFGE 2XN2A 3HUJA 3WTYA 2OZNA 3CZLA 3QDME 1MCWW 5L6YH 2FWOA 5BOJA 1FNHA 4H0GA 5EC2A 3CVIL 1FL6A 2WKGA 2CDEA 5DVLA 4GRWH 1BX2A 5GS0H 4ZODA 5BV7B 4GMTL 1QX1A 4DW2H 1ZLDA 2E7BA 2WLIB 3CZJA 4N8PA 3Q01A 5BUPA 2BNUB 1SN2A 1T1XA 1AZUA 3MRDB 1OKEA 3ZKMD 1ZGLA 4YHKL 4JFPA 1F4XL 3F6JA 4OF0A 1JVOA 1AS8A 1QSED 1KYUA 1XIWC 4HJ0D 3S0PA 4E9XA 4R26L 1FC2D 2QTEA 3BP5B 3SDCA 3PHOB 3QBTB 4XPBH 5FF6B 2CLRA 1NLBL 4Z18A 3V79C 3RYMA 1NAML 3FCUB 1FYTD 1FFRA 5C3LD 2EVIA 5F96L 4GW4A 3WBDA 2P49B 1YYMH 3ZZLA 4LPUA 4A2LA 3O3BA 4GW5A 3FTWA 3MRHA 4XE0A 2AK4A 2YD9A 3OMZA 2PCPA 1G9NL 4MA7H 3CZUB 4U49A 4APXB 2FVNA 1SBSH 4OFVA 2MIZA 3EJZD 5FW6A 2YN3A 4HWZB 4YLBA 1QR4A 4EZJA 3B2MA 2YPLB 1TFPA 3GBLA 1A21A 5BRZA 1RK1B 3F62A 1SYVA 3HZKA 4G5ZL 4X6DB 4NRXB 2NNCA 2IADB 2J8UB 2YUWA 4LSSL 2FEDD 4N22A 3CVDA 4U1HA 1G7PA 4XGZB 2G60L 3RWHB 1AOZA 3EFFB 4ILDA 4L2YA 2ITCA 5HGGS 4U1LB 4DP0X 1P69B 4LHJB 5ITBH 1W8EA 4KY2A 3BC9A 5DUPL 5KUKA 3ILQC 5F1OB 5DJXB 5JXAH 4YOKA 3KGTA 5HHME 1CICC 4ICXA 1RZFH 2ZPKH 3ZTDC 3VAEA 1CD9B 1TQWA 3KPPB 4QLRA 4RGOL 3BO8B 1TMQA 1K8DA 2ZOTA 3MRRA 1GGIH 5DHEA 4GY4A 4X7TA 4N90D 4LGSB 1JWMA 4YK4C 3AY4A 5CZVH 2OI9B 1FGVL 2QSCH 2WNGA 3K2UL 4FQ1L 4UZGA 2WPGA 2JELL 2F68X 3JV5A 4MD5A 4XNAA 4HFUL 4BYHA 3P11L 3DOSB 2EC8A 4ICWA 4LVOC 1ZLSL 4WSKA 3OKNB 1B4JL 5LB1A 5HYSA 2BVPA 2R9HD 2Y69B 4U1NA 5EULV 4H44C 1DCLA 4A6YB 4UTAL 1Z32X 2QLYA 4MA1B 1UM4H 5IJDC 4RGNB 4M6OH 2WLNA 5IJBC 2Y7OA 2VCOA 1YA5A 5ECJE 1MHCA 1J8KA 1NDTA 2DQTH 5LNEA 4PVBA 2PW1B 4D9QE 1ZVNA 4M6ML 2YSTA 1EEUA 2LVEA 2YK1L 4N4YB 5BZDA 2UXFA 2ARWA 3H9SD 1EQWA 5B1CA 4N90E 1IQWL 3PNWB 4TLTA 1D9KB 1LDSA 1TIUA 1CQYA 3FU6A 3VDBA 1J9RA 1QG3A 3CCHB 3K6FA 1X9RA 1U41A 1UZ8B 3VU2A 2Z4TA 3FPXA 5IK3B 3QUMA 3LNDA 1DQTA 2NR6C 1MJUH 3Q8CA 4GT0A 1IIKA 1HQRA 2QQKH 1HWHB 2EE2A 2ZUSA 2XN9D 3BP4A 3VRJB 5AEAA 4JQIH 1GYAA 3RZCB 2WSKA 3QE5A 5D9SB 4N2KA 4QGTA 5F0LB 2B59A 5F0PB 1EGJA 3HNTH 3I50L 1HIML 3VFRA 2AEWA 3K46A 4M03A 5J9PA 1CDBA 1MFDH 2G3XA 3T2NH 3UEZA 3G6JA 1KFGA 2HJFB 1BGXH 3QJUB 4MA8H 5GQBA 4RRPA 3GBNL 2R2HA 3FO2A 1WV7T 4I48A 1CCZA 4KHTL 5JR1H 1EMTL 3KXFA 3QISA 1WAPA 1AFVL 3VMNA 4TMPA 5DVOA 5TE4L 1XF3B 5JLZA 1KBGL 4AT6A 2IBZX 4HT1H 5J1AB 1R5IA 1UD8A 3LKOB 1WD9A 2VABA 2BSTA 3EHBC 3RWCB 3CFEB 5H4YA 2F54D 1GS6X 1X4ZA 3NEOA 1IQWH 2DIAA 3JSSA 2F7IA 3I9GH 3T77B 3LQMA 2IANA 4G8FB 4PJGF 2YN5A 3WFDH 3WUZA 3OB8A 4O51B 1TVBA 1PGRB 5SX4H 6TAAA 1IEHA 4FMFA 4GI6A 3JQOB 4M7LT 4NENA 3X14A 3BPOC 4J12A 1SVBA 3GIZH 1NGXB 4PJCA 4JFYB 1OAZL 3FQXB 5I24A 5TDOA 4ZFGL 4OZ4A 1H3WM 2CAKA 1DQMH 1G0XA 1OTUD 5GGVY 2DWEB 1Z2KA 1ZLUH 1R3HB 3QZLA 4X9FA 4D9LH 2CBQA 12E8H 3AWFA 4Z5RB 2VMFA 1E42A 1CU4H 4OSUL 5F9DC 3STLB 1UTDA 5HYQB 2WLIA 3OG6B 3KLDA 4L8DB 5CZVL 3BVDB 4UAOC 5J13C 5IQOA 4YSCA 4W9LC 1GGIL 2CRMA 1D7BA 2X3BA 1ID5I 4BZ2A 4KI1A 5K69A 4PS4L 4PHXA 4JMXA 3QYCA 4MCZB 4N8CH 5C71A 4A67A 1RP8A 1IAIM 2YD6A 4CC4A 3QRBA 5FR3A 4M62H 4N9GB 4X5XA 4QRRA 2DQEH 1OOWA 2Y36L 3CDFA 3VFOA 1ZCRA 2X44D 3RKDD 3K6DA 1BBJA 1LO0H 3MTXA 1BV8A 1IJNA 3GMLB 3V55A 3FT4B 1JZ8A 3MRGA 3ARRA 4QCIB 4R9HA 1NGQL 3CH1B 1BBDH 2J8HA 1ZV9A 2FWSA 3KLKA 1JTOA 2JJSA 5SWZD 1BVKA 1I1FA 3IMRA 4JFQB 3WKQA 2BW4A 4KDTA 5GPRA 4KJYA 4Z7VE 4X0NA 3D06A 3WN5A 4XP6H 3TFKC 1VZGA 2KDGA 3ALXA 1CFNB 5HYQA 4ZTPL 2J8UE 3ILQD 4L9LA 1RMFL 4W4NA 2YOCA 1NBVL 2NYYD 3Q2WA 4ABQA 5L4JA 1UM4L 2HT3D 2WLYA 4DOHE 4I0KA 5EO0B 4PJ7B 2DEWX 5JIMA 3KPNA 4F58H 4PWHA 4FFWD 3NIGB 4QHMB 5DJ2B 2IPKB 3GGWB 4K55A 5BMFH 4HMCA 2CGRH 3BKCH 4JDTH 5CBAA 2K6YA 1JPSH 3FQTA 2HVKA 4O02B 1HN1A 1EHNA 5DVKA 1I7UA 1KEGH 4P4KC 3FO9B 3CMGA 3L45A 4N2BA 3HE6D 2KZKA 5SWZA 1Q9OB 4TNWK 2QT6A 5CWSA 1J05B 3DI3B 2AV7B 2OYMA 2VDRL 3RLSA 3W1ZA 3WFCH 4KRLB 3UYPA 3VE0A 3OMIB 3QRGL 3EO0B 5DHDA 4FTVD 3KEDA 5J56B 5IVNA 2OMVA 3V7AE 1OP3H 5DSCB 3OR6A 4U2YA 2X89D 4QY8A 5IM7B 4RGNC 3VB9A 2B8OT 4KXDA 1DQQA 1NC4D 1VKXA 1YDPB 5FOBA 4NUGL 4NQUA 4U3XA 2XT1B 4BSWB 2VDNB 3UDWA 3T9WA 4AYID 1LVEA 4GP4B 3EDEA 5AL8A 4OCYH 4UM8B 3WEXA 2HTLC 4XPHH 5DEFB 4AEFA 3DETC 3GS0A 3MYJA 3MFFB 3Q6FB 2X41A 1TJXA 3FN3A 4NQCB 4XP4H 1S9WB 2DEYX 2ZPKL 4OFQA 2ZYIA 3K5RA 3IDGA 1X3DA 2AS5M 4X80H 1G7IB 2YFNA 1O5DT 3BUPA 3MLRL 1IU1A 4FZEH 3TA3D 5KAQG 5K9OB 1SFDA 2WTOA 3K74B 3VRLF 4IKJA 1PLGL 4K3JL 1K3IA 5AAWC 5KBLA 1HWWA 5EO9A 3RGVA 3QIBD 4C56A 5TDNB 3EO0A 1I8MA 4XBEL 3HG1D 3ARFD 1YEDB 4DJMA 4KQ4L 4K23H 3POCA 4YFLF 5K9OA 1NC4A 4UQ3B 5DGQA 2EH8H 4IRSD 3VX1A 4JO2H 4IK7A 1PJ9A 2NLJB 4FG6D 4ZPTB 3NCYP 2OL3H 4ZX4A 3T2OA 4CRPA 1OK8A 1NEZA 1LHZA 1QPXA 2NRDA 2NY2B 1WCQA 2E46A 3P0YL 4Q8BA 5H35B 3VGAC 1E8ZA 3ARDD 2NY0D 1OANA 4PGZA 4LCWA 4MBOA 5I9QC 2BC4B 1NCCH 3FT1A 3D33A 2Q1EA 4X98A 4XMXA 3ARUA 3RTQB 1XF4B 4CSPA 1ES0A 3GSWB 4DWHA 1JGUH 1TLMA 2HG5B 3LXCA 4HS3A 3U4EA 1BDYA 1SLVA 3LZLA 3V0DA 3CFCH 4ODHH 3QIBB 4CGUB 2I7SA 1VFBB 4P2YA 1B4TA 3IDNB 1U93B 1MCOH 2E7MA 2WZPD 1MDTA 3E8UH 3K8KA 3A0OA 4L8BB 5GGTL 5D1ZI 3ZE2B 2Z35B 2YMOA 2WGNB 4A7SA 1EBAA 4IBYA 3LRMA 4CW1A 5CWSB 2VN6A 3H3KA 1PQZA 3DPBA 1GY1A 3QNXA 3FU7A 4LHUG 1SQ2N 4LLDB 2CHNA 2MQGA 1UENA 1MFCL 1VFOA 1TQCC 2F58H 1MIEL 3P9MB 2WP3O 4LIQE 1TSRA 5F3HA 4UIMB 1QAWA 1EO7A 1W8NA 4XWGH 1CE6B 2RJMA 4RISH 1WCBA 4ZDHB 1V3KA 5HHVL 4F2FA 5KVMC 1DJSA 3DJTA 3V4LA 2F5BH 3DRTB 3MREA 3CHXA 2VERN 3C2AL 3EYQD 3KCPA 4JUTA 5CU5A 1GGCH 2GBUA 4YO0B 1SYVB 2FECI 32C2B 4JLRA 3VFPA 1UQSB 4I77L 5EU5A 5A43C 3RWGA 5C3IA 3O6KL 4XT1C 2C1OB 4LCYA 4K73A 1EPFA 2Y0SA 1ZHLB 4QXUL 2JNZA 1A0QH 3F8UB 4HWZA 5I6NA 4Y4HD 3ZR5A 4N2CA 4WEUD 2J73A 4ZOCA 3CH1A 1DQIA 3TH2T 4LCCA 5I1JH 3NT0A 3EZ8A 1KLGB 1N59B 1IBDA 2VRQA 5AL0A 2XN0A 3OJMB 5GGQH 4A7QA 4ZMZA 2P8PA 1YPZA 3NFNB 2ZP8A 3GWJA 3CPLB 4M9PA 5DJYB 3EGSB 5FUOH 3S5ZA 4JVWA 4H8VA 3X3FH 3EDJA 5I16B 2IQAA 2R27A 5DFVC 3MV9B 4OLXL 3U7YH 5LDUA 8PAZA 3BQVA 1BF8A 3K71B 4PG2A 2FJUB 3PHOA 1RAMA 4G8AC 4RSYA 5ANME 2YBRA 2GIYA 3L5XH 5FYLL 5C08D 4YFEA 1BFOB 4BDVB 3FTUA 2F54A 1JZHA 3OKOB 4JJHA 4FXGB 2NUPB 4LCUA 4UMSA 1ZRUA 1JNLL 4RZCA 1KXHA 1OARL 2HTKC 5IQNA 4DAGL 1U3HB 4E42A 5SV3A 4BA8A 1T0OA 4PVMA 3L6FA 4NQEA 3MRNA 2VKXA 1FPTH 4LCWB 1SZNA 4NIYE 1CLZL 1M71B 2V9QA 1MCKA 3VXQB 4DKEL 2C8NA 3EYFA 1KSRA 4PGCB 1UH2A 3LIUA 3DK2A 3NABH 3V4VL 2BSSA 2D7MA 5DUBB 2WNWA 1SHXA 1UT1A 1J9SA 2VR3A 1ZDQA 4H20H 4O00A 3EDDA 4WWKC 4MJIE 4KBPA 3UZQA 1AAJA 5DZ9A 3VFTA 3KPLA 1QWHA 1LO2L 2ZAHA 3DVNA 7PAZA 1UHVA 2OM5A 4ZD3L 2WZ6A 3T8MA 3CFEA 4G9DA 5T33H 4FCHA 2VM9A 1RHFA 2BDNL 5EFIA 3NCJL 4TXVB 2IWFA 5F7WC 2ADFH 3RTQD 3L4XA 2DWSA 1G9MC 3PP4H 4H25A 5E1GA 4ELMF 1D9KA 5HHOB 2XG4B 3QIWA 1EAQA 2E5EA 3ISWA 4X9YA 5F3BA 4YHML 1NMAH 4ZO8A 4GBXB 2X89A 2R8SH 4P4RA 4KDTC 5EEUA 1CDIA 1KNOB 2IPTL 1S7WB 5SWSA 3KHQA 1BHGA 4L18A 2DWXA 4WFGD 1K8IA 2G5UA 3FYIB 3QNFA 4W9GC 3UPCA 1I9JH 3G08A 4AL8H 3LD8B 3EOYG 1ZJAA 4JM2D 2B3RA 2OS7A 5LGHL 1A6ZA 3MLRH 3THMH 1DVFD 1E4XI 1YO4A 2J6EH 5AYQA 3EG9B 2V5SA 5T5FL 4NO0B 5IMLA 2VQ1B 2NY2C 2W9EH 1KB5H 4Z0BH 1GL4B 1MAMH 4FKHA 2F53B 3LKRB 1BVNP 2JKRM 2ZKHH 5CLXA 5TF1L 2VL5B 1FGVH 4HD5A 4UTCA 4X7EC 2XIBA 4LCVA 3UTQA 3FOLA 3L3KB 3D9AL 3DV6B 4BUGA 2NYKA 4QEGA 1FNGB 3NIDF 3VFGL 5F1NA 3CZFA 1MCNA 2ZOKB 5F89B 2XTJE 4IMKC 3BLKA 2KDYA 2VDOL 5BXFB 4ZFOL 4XMTA 1PYWA 1JCVA 2QADB 1IC1A 3RVUD 1CLCA 1BZOA 1G5GA 1P7BA 4OZHB 5CCHE 5AB9A 4F7TA 1LGVA 1NEZB 2B20A 3IJ7A 3TBSB 5A1AA 5ESAA 3KH4A 4GMSH 4GKNA 2V8LA 2NLJA 4NZUH 3RWHA 3LYRA 3VFNB 4GRWF 1A66A 1U6AL 3L3DB 5CU9A 3EBIA 4JZOB 4L3EA 4R7NA 4CVWA 4D8OA 2QLVB 3JTSA 3BESR 1L7IH 4L1HA 4L9LB 5ISZB 2F19L 1MUJB 1CFTA 4NC0B 4ISVA 3TONA 4MWFB 1FH5H 2OZ4L 4JFHE 3V5KB 4XNMB 1CXHA 2ICWB 2YXVA 3OGCA 4TVUA 43C9B 5EEXA 2JIXB 5TPWL 5DJZA 3KPRE 4HPHA 2GY7B 2PCPB 4YAQB 1JXDA 1PZ3A 5DLML 4ZS7L 3BKYL 5AAWA 3NZ8A 3WG7B 1B3JA 4JQVA 3RVXC 1PX3A 1S7QA 2V17L 3ZTNH 1K4CB 4MB4A 1LYQA 5IMKB 3D07A 5L9DL 1A1OA 4BKTC 1A02N 4A2MA 3LPPA 4YXHH 1LD9A 4PRID 1JGEA 4K15A 2R1WA 3T0WA 4G9FD 5I0DA 3F3HA 1CMOA 5HYJE 5F72S 2OJZH 2EP6A 3GEWB 1A2YA 2UZYA 1JERA 3V0WL 1HEZA 3TIDA 1KPUB 4Z5RA 4Z7NF 5IM7A 4V2BA 3NSDA 3BHBB 1OPOA 3RWDB 3RVXD 3ZHFA 5F7DB 3G9AB 5ICXB 3U83A 3O2VH 1BZDA 2FECL 5DRWA 1TJHL 1T83A 1KIRB 2P4AB 4LSRL 1KJ3L 1SMOA 4HUUA 2X7LA 4Y19E 3BQUA 1MZZA 4OU3A 3CLEH 2OR9H 3SKUD 3ARGB 1P84J 3MCG1 2V7NA 1KIQB 4GKOA 3X3GH 4EPSA 4YDLC 3MU3A 1WLHA 2CCVA 2N0MA 2MHAB 2YD5A 4F7EB 5I0WA 4YHMH 5AZEL 3ISRA 1HQ4B 2F74A 3RL2A 1O7DC 2VN3A 3TL5A 1AZZC 4F7MA 2YA1A 5CBAB 5I1AA 4ZS7H 1CI5A 2EXTA 3KWWA 4F58L 4J28A 2WQXA 5GISH 1OB1B 1ZHLA 4PTUB 3L3OC 1EGJL 5I74C 4RFOH 4XVSH 2ERJB 4PGDB 2A77L 2YPLD 5FEBA 3S34L 5ES4B 1KTLA 3EBGA 4G2AA 3KDMB 2QKIC 4WI9A 3ESPA 2VDPB 3WIIH 5E6SB 4PB0H 2X2JA 2Y06L 5EWIL 1HVXA 1KPVB 1I7RA 5DO8A 4LAJH 1JSYA 2C3WA 1AZBA 4UIMA 1RJLB 4Y4HC 1IL1A 4NO5A 1XSIA 2EYSA 4HOZA 4Y7OC 5BV7H 1SMAA 2LGNA 3R7QA 1SJEB 1CFSB 3FT2A 3T0EC 3IXAB 4EF3A 1G7JB 3HE7A 1FYTB 3TA4D 3CFIC 4G43B 3T4YB 1UZ6F 1A3RL 1A4CA 3RIAK 5GS1A 4G8EA 3BDBA 4ZD3H 4HU2A 4LF3B 4QXVA 5EO1A 3FJTA 2D03L 1GMEA 4MA8L 2VB5A 4ZMWA 2HT4D 1S3KH 4HHGA 4MXQD 4WI0A 1U93A 3H1ZA 3N1QC 3QQ3A 1F90L 4K7PY 4N86A 2V2XA 3NDYE 2XCMC 4JZJC 2GTZA 3N5AA 3NJGA 4JKLA 2YEQA 3PWJB 3B6SB 1V7MH 1JFHA 4HWBA 2FD6L 4AYDC 4UT6H 4O2EB 1JMXA 1R3HA 2JI1A 3QEQB 2VLLA 4QKXB 2GB2A 4U3SA 5CZXC 2X4OB 5IOKA 2J6EL 4PJ7F 4HJUA 1AHKA 4MBRA 3V0VB 3M1BB 4PRDB 2VMEA 3Q43A 3LZRA 1SXNA 1QFWH 2X87A 3EH5B 2CA4A 4OBSA 5C09D 4XVOA 1OTSD 3D4GA 4KRPC 1ZTXH 5LBVA 1N2RA 1PD1A 3MLYL 2J57A 2X2HA 3MUGB 1T3FB 1I8IB 3DHMA 4DF9A 1U3HD 4X7CC 4I3RH 1SDAB 5CGMA 3WIIL 4XO3A 1V5JA 5GHWL 4B7IA 1L0PA 2AMGA 1FE8L 5JPNA 4GEJA 3ZHNA 4DPRA 3RWCA 3BMWA 3NCJH 2APBA 4ODVL 1Z9OA 2XG5A 1AFVH 2ORBL 2R56H 4NXSA 1EMTH 3VUAA 2BVQB 3T6VA 5MEQA 5DMKA 3KWVA 4G42B 5C6TH 4DP5X 5MI0C 3HUJE 5IT2L 1W72A 3OC8A 3OSKA 3KVQA 4LNVA 2R0WH 4LLQA 4BZ1H 4PV9A 4F7KA 4FNLL 1WHOA 4L4VB 4BZYA 4XPFH 4MYPA 1G9NC 3ARZA 4P2RD 3DHUA 3WJMA 3VG9B 4OD2B 3AG2B 2ZYSA 3NYKA 1ZEAL 2B9BA 2APWA 3CIAA 3CVHH 3HMWH 4FDWA 4Y4HB 4OIFA 2HJLB 4QXTB 3BWAA 3PS6A 1F41A 2YPVL 3GI9L 3ULVD 4IRZH 3WIFA 2HFFA 5D6DA 4YX2L 1DBJH 5C07B 2YAMA 2J4WL 3EJJX 3QAZC 2DI8A 1RUPH 2VLKA 1U92A 5G5DA 4Y1AA 2XV2A 4NZDA 5BVJA 2NTSP 2JSFA 2VQTA 4AJVA 1RFDH 4LLVB 4K7PH 3A6BH 3VXUA 3MRHB 4LLMB 4CVZA 1H6FA 1VFUA 1SXZA 5GRJH 4GRLC 1PS3A 2UUDK 1Z5LB 2AJYH 4YXHL 2OJZL 1NM9A 2ED8A 4I89A 3AABA 5CUSH 5BJTB 1IC4L 1E9QB 2O61B 3WD5H 2CLRB 2QSVA 4NOBA 1OSEA 3K6NA 3N9GL 4WF7A 3IXTA 1UD3A 3I6KB 4JRXA 1G9NH 4U05A 3UXFA 3NA9L 2ZXWB 1JGDB 4MX7A 3U6RA 5F6HI 1FNEB 1KBKA 2BHUA 3VFVA 2FK9A 1KIUA 3CVHA 4W4OA 3RILA 1KGXA 3B56A 4WFFE 1E27A 5DJ8A 5C0AA 2J7LA 4AC2A 3BJLA 5JOFB 2KLRA 4FQPA 3TV3L 1RIUH 2H2SD 2XWDA 4JL2A 5DMYA 1S7XB 1KZYA 1XB6A 5FB8A 2F8XC 2FO8A 4OCYL 2BHZA 3Q9QA 3CFKB 4KTYA 3HRZC 1FZMB 4R7LA 4U33A 3OWRA 5AW9B 4BQBA 2O30A 1J9CT 3ATBA 3QXAA 4KY1H 2K1MA 1AR1B 1ZS8A 1U3JA 1FFQA 4HUMB 4NLHA 4UINH 2ICEA 5INCA 5DD0L 1Q1JL 4GRMB 4MCZA 4OF6A 5HDBB 3SQOL 3A67H 3T8XB 3RIFF 3GMQA 2EKJA 2XPYA 2XA8L 1BXUA 2QELA 3VTMA 4NN7B 4NRZB 2BNQE 3ARPA 3VXSB 5FXCH 3ARFB 2NTFB 5MHSD 2BP8B 4U1HB 1Z7JA 1ZKAA 2GTWA 2QFRA 2VDRH 2P5EA 4IKNA 3STLA 2JKTM 5DJAA 2X88A 3DPDA 5FLUA 5GJSL 3R7RA 2L7UA 2V7HB 2CHDA 3H9HB 4XX1G 1DTUA 2VISB 2JK5B 3UTTD 1XH3B 4PR5A 4CVXA 3GMNB 2NR6D 2PXYC 1JAEA 4YMPA 4LE8A 4YXKL 4RRPM 1UGKA 3CZKA 3PWUA 4M61A 5AQ0A 1EDHA 1PNCA 4OZ4B 3ZKXB 2UY6B 5CCJA 1AZNA 2YMXH 4R2GB 3PGFH 5GRZA 4BFIB 1V10A 3EO9L 3HAEG 3GJEB 3TYFB 3DMMC 1WK0A 3MJ7A 4JDZA 2AW2A 2R56L 4R7XA 3TYGL 4BH7B 4MD4A 1D5BB 3I9PA 2Z7WA 3KPSD 4JFFA 3LS4H 4MAYD 3PWPA 2XSKA 5E4AA 5HP5A 3JTBA 2LHAA 4KXZI 1NCIA 5KS9B 1AO7A 2O6CA 2Q7YA 2VWEE 4MJHA 1P4BH 4N25A 5DHYB 2EVHA 3WNKA 4L37A 3CVBA 4YQXL 5E5LA 5CLWA 1F58H 3MBXL 5T33L 4ZG1A 4MRCA 1CDJA 3M88A 5GGSB 1U8MA 1PLGH 1HSAB 3MN8A 1QTSA 4XTRC 4GUQA 4TVPE 4LAQL 5JPMC 4DN4L 4RMQA 2VDRB 1E2ZA 4LPWA 3TT1H 4AQEB 2H3XC 4KKAC 3SJVB 1K5WA 5JTWA 4FKKA 1H8NA 3PWLA 1EZUA 2WLZA 2HJFA 3H85A 4K5MA 5ADOH 1SN5A 4N26A 1VESA 3W9EA 2FWOB 4TNEA 3FFDA 4EOWL 2YA0A 1L0QA 2OMWB 4YHLH 4MMYB 4Q7DA 3GJFH 4AYMC 3E6FB 1JF5A 2FJFA 4Y16B 2CO7B 1FP5A 4N68A 5GRJL 3ULUC 3D12B 3EGDB 1TTFA 2ZNWA 4E36A 5I5MA 4ANVA 3VNZA 5F7NC 3DUSB 1AQHA 2VMDA 1CLZH 1M05A 5J12B 2FO4A 1FO0L 1QBML 2IMNA 1IARB 2X4RA 3C08H 4YR6B 3SQBA 5CN3A 4UV4L 5EF3A 3FYEB 1I8AA 2BHFA 1HXYA 3IFOA 5FUZL 3VFSB 1G0YR 2AJXH 2BOCB 2AC0A 1CE1H 1K85A 2P47B 1RLBA 3K4ZA 1AOHA 2XY2A 4V33A 1EX0A 2DQGL 5FA4B 4OLXH 3U7YL 5I5IA 1S8DB 4PJCE 2Z7UA 4DNLA 4HJGA 3SPJA 1KBVA 4KUZL 1MHCB 4MVBC 3VFSA 3F7VB 3VJ6B 5EZOH 1IAKA 4YR6A 2AEQH 4EZLA 5CCKH 4PJ7E 4C47A 2Z1KA 4KJWC 4OKVB 3PWVB 4X5WB 5D6CB 2D73A 1UH3A 2IWKA 3SGKA 3V52H 3LKQB 4S2SA 1J7VR 4P07A 1BMGA 3GUFA 3MJ9L 3C5SB 5T1DH 3FQRA 1R0AL 4GQQA 4ZFGH 2VXSL 3P77A 5CR1A 3D18A 1KT2B 4LDOB 1E3FA 1RMFH 4GS7C 4GLRI 4XXWC 3QXDB 3SYCA 3C5ZD 3GIZL 4AIZA 3RWFB 4RMVA 4GAJH 1AY1L 1TZIB 1JWMB 4X6CE 1LEIB 3D34A 3TF7C 5I1LB 5E23A 1WTLA 2DLTA 4QRPE 3RUGA 1R47A 3NCYS 2PTTA 4V1DD 4YDKH 2NY6B 4JUSA 4EN3B 1L7TL 4PJ8C 1A7QH 2HLFD 4UAHA 4YEFA 5DQJB 3SPIA 2A74B 4IRZA 4H0IA 5JW4Q 5F6IC 1OGSA 5I1HH 5EUOF 3LEXA 2ODIA 4CN6A 1CTMA 4G6AD 5D1XD 1TVHA 4YWGH 4IOSA 3UTPE 1AR2A 2Y72A 3LTVA 3HTLX 4J3OH 4NUMA 4R8WL 2YKKA 4Z7QF 4DP1X 3ZDWA 1R3KA 2YFOA 1OAXH 1K4DB 1EAJA 3MLXH 1JPFA 5KSBE 3FTSA 5GSVA 3T0EE 3V95A 4NLAA 2OX5B 5ICZA 3QIWD 4FQIH 5GIRA 5T8IA 1BJ1H 4ZPVA 1I3UA 1JIBA 5IJKC 2OSLA 3MRJB 4JFDB 4PRDA 3EADA 3S35H 3RHWK 3NSJA 5GRUH 5E2UH 4BQ9A 2EUVA 1D2OA 2VJXA 2EDBA 3BI9X 5JQHC 1DQML 1ETZB 3U0TA 4YHOH 2PF6A 5LNGA 1EXHA 1PEWA 3X1BA 1MHHA 1HI6B 3T1FB 2GI7A 3B2VH 5C0ND 1CI3M 4XXWA 1EXGA 1YG9A 2E7DA 5SWZE 4XPAH 2K6ZA 1AD0A 1ECZA 3ENEA 3V0FA 4FLQA 5J4MA 1V3LA 3KHOA 2DWDB 4JPVH 4HEPA 3AACA 4PM1A 4EEEA 3MLWL 2NY3B 1KWGA 2VN4A 1Q9LA 2C9SA 4MJ5B 5HI3C 2CU9A 4GAYB 1QSEE 4KFMA 1ZLWK 4H8QA 2DD8L 3GMQB 5JIHA 3FUMA 3AC0A 3AU0A 1MW0A 2FB4L 4JFPB 2Y5TB 3ORJA 4HC1H 1TEYA 4KWUA 3BVUA 4KMTH 4Y1TA 1AXTL 1D5IH 4KJQD 2BNUA 2Z91B 5I0XA 3GDBA 3HCVB 4OH2A 5EUOB 4FL4B 3WS6A 2VDNH 3GI8H 4LSQH 4M6NH 4LU5H 1BX2B 2H1PL 2E75C 1EZVX 3U79A 2H7WA 1JPGB 1AHMA 2UZPA 2BS71 5KVFL 5CGTA 2AKRA 3VFGH 4P2CG 1J5CA 3JTTA 1N70A 4KK8D 1TSHA 5DEGA 4ZYKA 3KDMA 1S78D 1EEZA 4P2QB 2G2NA 2Z91A 4FYTA 2XX1A 2E86A 1JGDA 4MX7B 4PH8A 1MWAB 5LDSA 1QSFB 4PTUA 2YD7A 1CGVA 1TEFA 2CK0H 4XTRD 5K1NA 1E7VA 4D0BA 3EXLA 4HLZH 5IP4A 2EADA 2D2OA 4C56E 1E30A 1TJGL 4H1LG 1FIGH 4JRYE 2RMNA 4BWWA 2JI3A 4JRWA 3F65A 1T6VN 2F7OA 3G5ZB 4QNPF 3QO1B 2QPEB 2NR6A 3D2TA 2YKLH 3KM2A 3PNRB 3RTLA 4U1KA 1UEMA 4N8VB 5D1QC 3PXJA 1BFVH 4WTQA 5JORA 3TYFA 1I82A 1M6UA 3U0TB 4H8PA 2CIKB 1L0XA 1U8JB 3H7BA 1ORSA 3BGAA 3W9DA 5E6ZA 4WHCA 1NGZA 4D3CL 3FU9A 3ISYA 1NDMB 2L0DA 3CX5K 4RGNE 1EANA 3WSQH 3FUEA 2ZF8A 5F7DA 4BFJA 3WS6C 1ZV2A 4KKQA 5FYKE 1Y6MR 1A7PL 1ADQA 4F8OA 4OZFA 3LXUX 1BLNA 3BWAB 1D5RA 3HI6L 3SY6A 3RKDC 1AQKL 5BQDA 3BAYA 2COVD 2AANA 3KNBB 2WC7A 3VH8A 4ERSL 5IB5A 2OV0A 3IU4H 2X53A 3P02A 1V7NL 1T1ZB 1F4YL 4Q6IB 2AZUA 1KC5H 2CUAA 5FECB 4OGXL 3VD4A 2XZCH 2WTPA 4E9QA 3MBEA 1T22A 4HHAB 2F19H 5C6PB 1ONQB 1MSPA 2YOAA 2GJJA 3VRIB 1HDMB 5GSRA 1ZVSB 1JI1A 1I1AA 2YUXA 5EF2A 2YEZB 4O2CB 5F7AA 2OW7A 3TF4A 2DKSA 3WEBA 2ZXGA 4YHKH 2KERA 3KPSA 3UTSA 1UD2A 1OCCB 2F5AH 5AOZA 2ADJB 3ULVF 2N56A 4LL1A 3C6LB 3QXDA 5CJ8A 1DBBH 1OP9A 3P77B 2CO6B 4PBWD 5AALA 3F7RA 2APTA 2I26N 4XVUC 1PAMA 5C0IA 4RZKA 4XMWA 1BWWA 1I8IA 1JWUA 2C9AA 1S2EA 2GY5A 4DZ8A 4R7NB 4U0RB 5F7KC 5D6CA 5FUCE 3IS1X 1MFEH 2VW6A 3CFBB 4MAZA 1OP5H 1S7VB 1WVZA 3U1SL 1BD2D 2BSRA 5FX3A 1KTBA 1TZGL 4TSCL 2H41A 3A23A 3BP7B 5ABAA 3VI3B 1EA9C 3T2PA 4IM8A 4DGVH 2C9QA 4P3WA 4OM0H 2VXQH 3F7VA 3TIEB 4Y2OA 3CAFA 4ONGH 4YIQA 1HYSC 1DN0A 1R3LA 1MVUB 2GFBA 1SM3L 1I1AB 2QMJA 5AFAA 2ZOKA 4ZUSA 1YMHA 5F6HJ 3VRIA 3QARA 4KO9A 4M6NL 3CPUA 1GKEA 3QUXC 3SODB 4CC4C 1XO8A 3EHBB 2JJTC 4OJEH 4EMZA 2IOMA 5L2KA 3Q8EA 4UIKH 1G9MH 3WJJA 3B5HA 1TYRA 1U58A 2CCLA 2MKLC 2YHGA 3GPSA 2GSIA 3O6KH 3RIAF 5BW7C 1AZCA 1HZHH 3JWNC 5LN8A 4AM0A 4JFZL 1A8JH 5DT1H 3VXOB 1IB5A 2XUWA 2J2ZA 4M6MH 4PG2C 3FO0L 3RRQA 1I7TB 3DGCR 3H3PH 2QL1A 4HZLA 4BINA 2Q3AA 1A6WL 3C5ZA 3DK0A 4XWGL 3I9GL 3X13A 1D9KD 3N06B 4RVBA 2JJUA 5F71A 4LLWB 4W9KC 1WGOA 4NQEE 4P2OB 4G7YL 5JO5B 1DVTA 4N0CC 4L0PB 5IW6B 5KTEL 2PN5A 4ACPA 5SWSD 1D6EA 3L81A 4KOCA 2RCSH 3IDIA 3RZCC 3QORB 1KPVA 1TENA 3W2DL 3G5WA 1HHKA 4JPIB 1A0QL 4RMRA 4A7GA 1PJWA 1JE6A 1FHGA 1T0MB 2YD4A 2BOLA 4KTEL 4N8VA 4Z7UB 4B9IA 2QVMA 5KW9L 3TJHD 1KDIA 2WCSA 5DDHA 2WBJD 3PWNA 3TN0A 4RSVA 1BQRA 2F18A 5E1IA 5I66A 5KSAB 2XVLA 1QFWM 3BPOB 5JHDB 4MB5A 4NM4H 1T66D 4OJDH 1H3PH 1IBYA 4YUEL 1AO7B 3JZYA 2YAFA 5HGAA 1Q1PA 1MWAA 5B1JC 4WUKL 1S9KC 1BZ8A 2F58L 1UACL 1BM3L 2ADIA 3FAXA 4WHTB 2C9RA 5IQ9B 1KFAL 4UOJA 5FYJL 3JTTB 1EHLL 2MOGA 3EO1A 2DMKA 3ROOA 3TNNA 4L05A 2AKRB 3T09A 5SWSE 2MKWA 5CEXA 2R15A 4HUKB 1DBKL 2UY6A 4JN1L 4NPKA 2X2YA 4ZFZA 4XI5C 3C8DA 4NQEB 3C5ZC 3DX8A 4S1DC 3GDCA 4AV0A 3GMNA 3AFLA 3ZTCC 2IXQA 1BW8A 2VE6B 4HIHA 3UTOA 2NNXA 3HNSL 5IGXL 1WC7A 3O3DB 3SIKA 5AYUL 2X40A 4NZTH 2G30A 5FK9A 4P5TB 3D05A 1P53A 4ZO6A 4Q52A 3TNMA 2D0FA 1HESA 4GYBA 4QHUA 3ATFA 3PAZA 1AGCB 1HILB 4I87A 2A0LC 3NFPA 5B1AB 3HR5B 3A6CH 3GMOA 5AVUB 1FCCA 1FVEB 5JA9A 2HFGH 4YHYC 4ABVA 2DQHL 1O6SB 2F7PA 2ZUTA 1SUJA 5EO1B 1I53A 4UT9H 2XWXA 1A7RL 1WC7B 1R4XA 2CGYA 2HKHH 3QDMD 4KTDH 1OZTG 3AQZA 3N1MC 1B4RA 2ADGA 1HX0A 1N3NB 2MCPH 4U1SB 3OKLB 1ICTA 1NL0L 2EKSA 2Y24A 4YHPA 4HCGA 3HMXL 4JHWL 3MMEB 2P5PA 2VN5A 3PUCA 1QI3A 5TE7L 3MOAH 3KD4A 4PLKD 4WNSA 5GS0C 1Z9SA 1ET7A 3BP6A 2VNCA 3QHTC 1FCGA 1ZOXA 2C1OA 4NQVA 3U4AA 5FO8A 4N0FB 4WJG3 4XPGL 5IFAL 5KBNC 3BYYA 1N5AB 4E9RA 2WQRA 1ZV5A 1FFTB 5IIEA 5L8LB 4Y89A 1Y1DA 3ARBC 3FHQA 3QUYD 3JV6A 3U46A 4GXUN 4UOQA 4E9YA 1CZ8L 3GSNB 2DQFB 3BLPX 3L08A 5IVXA 1XSJA 4PJHF 4CDGC 4ETQA 3PAYA 1AGFA 3GMMB 4PD4J 1J5DA 4X7DC 4U3HA 4BHUA 2AMUA 3CG8A 3FUDA 2XRAH 4UDTB 2X6VA 2NZ9C 5F7BA 2YUZA 4U31A 3GTTA 4X7SH 2WY3B 4W9EC 3ZE1E 4BKLB 4C58B 2BWDA 3QG7L 4DGIL 3FOLB 1GSKA 3L3KA 3X1FA 5AVXB 3VXRD 2ZKXA 4R7DB 2FJGB 3P2BA 3MRCB 4QO1B 4KXBA 2DH2A 1E28B 5AKRA 3FRUA 3PG2A 2EO1A 5ICUA 2Q8AL 1KCVH 3GXDA 4NBYB 4CGTA 5HYJA 5AVWB 4UU9A 1FG2A 4LLUA 4BFGA 3VXNB 3S2CA 1JTTA 4ENZA 4GRWB 3GINA 4WWOA 4G6KH 3IAPA 4DGUA 1QBBA 1INQA 1NLBH 2DD8H 2J8UF 3KCWA 4XP9H 5C0CE 5BS0A 4R0LB 3VG0H 1AZVA 1R24A 3DKHA 1UD6A 2ENYA 3C6SA 3TXAA 4NHCH 4QTFA 2Q10A 3PP4L 1TZOA 2CGRL 3B8YA 1YUKB 2WWNA 1DEDA 2IG2L 2OTWB 2BDNH 1DO5A 4OZFG 4HBCL 5FLVA 3QPQD 3U0WL 3DUUA 4G70B 4X5LA 3GNML 3B2UC 1HHGA 4YE0A 1RP9A 2PYED 4HKJA 5K33A 3BUYB 4Z7OE 1KN2L 1FF5A 2GG1A 3ASOB 4XVTH 3TIEA 2Q6WB 1ZEAH 3H0TB 5IHWA 2PPCA 5T1LA 5E1QA 2X1WL 5HVWA 1GYWA 2WVVA 3BP7A 5L2KD 5EZIH 4BSVB 2XXGA 1J11A 3D85B 3TBBA 2YD8A 3LZFL 2P52A 2LLLA 1UYWH 3SDDA 1BQHA 5EU6E 1ZDSA 5KSBF 5J3HC 5KYXB 1XIWB 5E9AA 2NQCA 2XYCA 4FFYA 1T6BX 2B1HH 3FH7A 2W0KA 3GZQA 4X6FA 3VWJC 2LW3A 5K9KA 1NANH 1ZE3H 2JTDA 1ZY9A 3QWRA 2KMWA 1UWGH 2GUYA 1RZGB 4UT9A 1OT4A 4HEPG 4IGBD 4TL4A 1MPAH 4ADIA 3T3MF 5EU4B 2H2PC 2PYEE 3BD3A 1HYSD 4FRWA 4D8PA 1WYJA 5I30H 2UZIH 5EUOE 2X1OA 5CZXD 2NXYC 3MA9L 3FQWA 3PV6A 3U6XA 1GC1L 4JQXC 4YDZA 5D7LA 3V8CA 5JPNC 4PJ5E 4AENA 2KUTA 1JPSL 4LLUB 3VSTA 1AY1H 2H1LM 3FQNB 4YVUA 4G80A 5D1QE 1QSFD 1BF2A 1ZIBA 4WEBH 3MBWA 1X44A 3RL1B 4KKBC 5DYFA 3VSQA 3PU7A 2VZ1A 4OR1A 4R4FH 3F7YB 4Q0XL 1FVCB 1PZAA 1KEML 1GJIA 4AUYA 3AROA 1OAZH 5GRUL 3LKSB 5AKTA 4BH7A 4CILA 4N28A 2NZ1A 5TH2B 4IOFD 1EHAA 5TDPA 3GTVA 5C0JA 2PYEB 5ADPL 3RFZC 3V6OE 1JV5A 2HVKB 3AXLA 4LCCB 4HPYH 5HYFA 5A2KH 4BQ8A 4OCSH 2YD3A 1K5NB 4KUZH 4UV7L 5ELIA 5CM1A 4HW6A 5IZ7A 2KYIA 4AE0A 1PZSA 3ES6B 4DP6X 2EEFA 1EAPB 2LE9A 4CVXB 1DQKA 3MROA 5AZUA 4UB0L 1UQSA 5EU5B 3BSZL 2MQCA 1KPRA 5EU6B 4PUBH 1QLEH 3U36A 1SVZA 4WO4D 2AJSL 3BPCB 1O7SA 3AAZB 1AGDA 1Z6JT 3WN5B 4DEPB 4ZDHA 2G2PA 1NLDH 4I3SL 3RKPA 3TWYA 1BG1A 1EZVY 2AJVL 3QDHA 3CLWA 1GR7A 4IYKA 1B90A 4JPQA 5K9JH 2EKSB 4W1TA 1MXGA 1BIIA 1YPZF 2F8OA 4CJ0A 1CU4L 1ERNA 3F01A 3S36X 2H3KA 5DD3H 3CUPB 4GG6E 2ATAA 4LBEB 5I18H 2PNDA 1ORQB 1GMIA 2EZ0C 2XFGB 3NZHL 2Q76A 1H3TA 3IVKA 4MB1A 1MCLA 4K94H 3VXQA 2B9AA 3CFJB 3QJFA 5DWUH 2CE6A 1JPGA 4U7SA 4MD0B 5I1IL 5J6HA 2DLGA 4I88A 1AGCA 4H1LB 2EAEA 4F7PB 5D2NB 3KBFA 3TEWA 4PJ9C 2H32H 4XRCB 5D7JC 5DA4A 2BWQA 1OAYL 4WTWA 1ETB1 2PTUA 1RUQL 1A7NL 3MGOA 3ZKXC 1HHJA 1HEZB 4OQTH 4GO8A 5HSFA 1C9SA 5KSUB 3GMRB 4PY8J 1T89C 4JO4L 1Z9MA 5T5NF 3FO0H 3I6KA 4JRXB 2APVA 1AP2B 3KPMB 3AITA 5DJ6A 5BZXA 4AEIL 2FIKA 4KDVA 4HJTA 4L1SA 1T21A 1UATA 4JHUA 3HNVL 3O2DA 1I3RB 2QQLH 4YH6A 1VAHA 4ZS6D 2DI7A 1LNUA 4EBQH 4C55A 1QBLH 4LBEA 4PYGA 2DBLL 4WHTA 1RUMH 2YKLL 1JXKA 2W81C 4HH9A 4MB3A 3WLWD 3IGLA 4FLRA 2AEIT 4HX1A 4NKDA 2JIXA 4KV5F 5T3XD 3V5KA 1OTTD 4FG4A 4L2LA 2QKIA 3HNTL 3LVEA 4PREB 4X50A 1ZPUA 3MDJA 4I18A 3E0GA 3N85H 5L4IA 2MOQA 3H42L 4XH2A 3RBSA 3W11D 4IRJC 3F58L 5ETUB 3JTSB 3RPIB 5CBEA 3NJXA 3B37A 2V9RA 1JRHL 3O6FB 4XMZA 3IDIB 1UOLA 4J3BA 3HC2A 1FJ1A 3PABB 4KV5E 3X2QB 2WHVA 1T6WA 4FNTA 3IJYB 5JHLL 3BGMB 4JY5L 1AXTH 5ACLA 5F89A 2AVFA 1B6UA 2VW7A 1AGEB 5BZWB 3TFBA 5ESVA 1KCSL 1AC6A 5F1NB 2PTTB 1EEQA 1J10A 1CLOL 3EH3B 3G5XA 1LDPL 3R06B 5E9DE 3U4BL 1W16A 4YXLL 1JZ4A 3IWVA 3K81A 3II3A 4NZUL 4K5PA 4NN6B 5T3XE 1Q72H 4KZCA 1P7KA 2VL5A 1F4YH 1QHPA 5HHXH 1IO4C 1TPXC 2BY1A 3L16A 5C07D 5SWQA 4ODUB 1F11B 4LSPH 2QDWA 5D2LF 2P5EE 4M1GL 3TC9A 4L5FE 5EDXA 3VXPB 3K6OA 3SE9H 1LWRA 2H2PD 3OLEA 3QIUB 3GSXA 3NP3A 3WU1A 4LKCB 5B8CA 1OALA 1GC1C 4JQIA 4YBLB 4YIQB 1ZE3C 3UJTH 5F21B 3RA7L 1CGXA 4JY6A 4X4KA 3SCMA 1S7WA 1CBJA 5DD3L 5SWSB 3NFSH 3UJIL 1A9BB 3PREA 3QULB 1K72A 2K70A 1C5CL 4JFOB 3RWEB 4Z3GA 4JFFE 3EOAB 4ZMXA 2VT0A 4TVSa 2PW2A 4BH8A 4JRYD 4CMMA 4R8WH 4XBGA 5FYJH 3B1UA 2DMCA 2W88A 4WWPA 1AO7E 4EZMA 1J1OL 2JCCF 4IMKA 5EOCH 3RGVB 3ABLB 3B9DA 4G8GD 3SDDD 1XCQB 4JB9H 4FMVA 1OF0A 1U4EA 1WFJA 1XHHA 5HDBE 2FATH 1IEBB 3C09C 2QPSA 1J8HB 4UB0H 3Q2NA 15C8L 3HHMA 4YUEH 4AMXA 3FU8A 3GS4A 5JIDA 3CVHL 1SEBB 3HMWL 4CKVX 4EAEA 3UPRB 2OCJA 3UG4A 1X5FA 1CGSH 1X6LA 1G7JA 1LXMA 1IT9L 3LH2L 2HRLA 4J6RL 4K7FB 5J3HD 1EUTA 4MYWB 4QT5A 4M5ZL 3OJDA 5AB1A 3IJYA 1KXQA 1I1AD 3FB5B 4J23A 3LEVH 1YQVL 2ED6A 3C6SB 3SGKC 2GJ6A 1SHSA 1BQHG 5TF0A 2VXTL 4NGHH 2ICWI 5E2VH 4PBXA 1HSBB 4LHUA 1RUML 5D5MB 3MRKA 1YDPA 4Y2NA 2AABH 5EBMB 1MY7A 1JZ6A 3T04D 3GF8A 1PY4A 1FLRH 1YLBB 4Y4KB 1MFBH 1A6AA 4G83A 2XWBB 4ZXBD 3B2UD 4G8GA 1G5AA 3QJRB 1OB1A 3WE6A 3WEOA 1IC4H 2GJPA 5IBTH 4ZUUB 2DLFL 2YBRB 4I13B 3OLGA 4UM9D 3WFEH 1GHFL 4J3OD 1NFIA 3FAWA 2IQAB 2XZZA 3PHSA 4YHYB 5HY9A 1M7XA 2I32A 3QHZH 5F9AC 3TBWA 2PETA 5LBSL 5IR1B 3N42B 3SDXE 2JCWA 3O3BB 5ANHA 4Z7AA 3KR3H 3LQZA 4PJEA 4EDXA 3FUHA 4HYTB 3KYNB 1KLGA 3L4YA 4YE4H 3AUWB 3DYMA 2FGZA 3UOAB 1LILA 1V8HA 5I1EH 1HOEA 3SKOB 1IVTA 2Y7MA 1AMYA 2ZUXA 4XCCH 43CAB 4X6CF 3W0WE 1JZIA 2ZP0T 4J3OC 5D93C 2HWZL 4ZUTA 2VABB 1XH3A 4PR5B 4PJ7A 4MMXA 2DYPD 3ET9F 1A6AB 2HKFL 2W59A 4HCIA 3MRDA 4IGBC 3OTTA 3B7YA 3NIFF 3ZRFC 4G6AC 5D1XC 1OSPL 2V37A 3TESA 2VMCA 5A7BA 2K45A 3LAFA 4YDIH 5DEGB 4LNRB 2BP8A 5I6PA 1VSCA 3FB8A 3OX8A 1AQ8A 4H1LA 3ZSTA 2Y23A 1WAAA 2NQDA 2R1WB 3QUKA 1CE6A 2CGZA 3LNHA 4ODWA 4Y4FB 5F7LB 5I2IA 1J5OH 1QLFA 5EC2B 4X6CA 4UQDA 3B8SA 4N87A 1VGKA 3T65A 2G9HA 4N5ED 2QV2A 1E4XH 2AJSH 2XJKA 1IBGH 3OSVA 3OKLA 4Z78A 3HCVA 1ECYA 3VACA 1NCGA 2EH7L 1OAUL 3QXAB 3QFJA 4UTBA 2QZQA 4GQ9L 1JVLA 2BNRA 3WNIA 1QWUA 3O9WD 1UM6L 1O6SA 3MGAA 5MERB 2WCPA 1UT2A 1HHIB 1P4LA 4ZAKC 2ADFL 4RFNC 4QTIL 1NGPH 2XX0A 2XA3A 1MCEA 1BREA 3ZPDA 2IGTA 4BH8B 1MUJA 4Z8FH 3LS4L 3RWEA 3L54A 1KCWA 2V3EA 5C92A 3VFNA 5KSBA 3S37L 2FBRA 3E3QC 2XPZA 3Q8AA 2C3GA 3DVGB 3E80A 4K3DH 2P45B 5JYMA 5E1HB 4U4BA 4FA7B 5GS1C 4PP2A 2XTSA 2YMXL 4NUJB 2DIEA 1NSNH 4BZ2L 3HAEB 3ARWA 3GXTA 4TUKH 4LOUD 2EXWD 5BXFA 4M3KB 5FM5M 2AXJA 4M4RA 2NPLX 3PFQA 1U2HA 1YY8A 3SGJC 2ZWYA 1KJ2L 4CU7A 4B95C 5DJCA 4BFFA 1FRGH 1SXCA 4CMHB 4WU5A 5FUZH 3S97C 3WLWC 2B0SL 1E5UI 4FNQA 2BIOA 3VGHA 3T0DA 4F9LA 3VFMB 1MG2C 1CE1L 1O75A 2WXGA 4KKAD 3WY3A 4X8XA 4N9OB 1JL8A 2R29L 1ITBB 4DPBX 2GJZA 4J1UA 3NCXA 2JCCA 1T2XA 2E3VA 4RMWA 5JHDA 2BVOA 3Q1SH 5CR8A 2D7PA 3P3RA 6FABL 5HI5D 2X9XA 3QR0A 4CNIB 2E6QA 1G43A 2O93L 3ZVVA 3WFEL 4EI6A 5JMOC 5DS8A 1THAA 1IM3A 3KXFB 3WMPA 3LZFH 3VXUD 4FQHA 2DLFH 3NK3A 3RUGB 5F9JA 4QD2E 1PZCA 4DETA 3WEMA 5C0BE 1R3IH 5FO9B 3M8OL 4KVNH 4TQEL 4M7ZB 3QEQD 4YHIA 5H37H 3S3CB 4XAKE 1BVLB 1F6AB 2DWYA 2BH0A 5DEZA 4XVTL 4BSWA 4AIZB 3E38A 1A7RH 2WXIA 2FJHA 3WGVB 3EYSL 4M7KH 4NUQA 3KLHD 4TUJA 5DMKB 4GBXA 3CSFA 5D7SL 5EEWA 4JE4B 5KYXA 1F4WL 4DVRH 3DXAD 2DQ6A 4EI6B 4FLOA 3TO4B 2XG4A 3QIWB 2ZJSL 1UZGA 3M6DA 1J0IA 4OY9A 4I18B 5EEVA 5FKPB 4AJ0A 3BIKB 5JW3L 3DGGB 1GYVA 1IT9H 2W07B 3LH2H 5JUEL 1FBIL 4L4JA 4GFTB 4XBPA 5AW8B 4JRYA 5T1MB 2DTMH 4F37K 4UNUA 4Z23A 4JG0L 3WKMH 3ABKB 1UT9A 3BUYA 4PYHA 4XCFL 4BRJA 2OYPA 5DJCB 2WYTA 3LZNA 1GA2A 5HDQH 4H2AA 4OTXH 5F7HA 1I7UB 2VDKB 5HXMA 2Z92B 3CQFA 3X11A 5HGHB 1P1ZA 3ERXA 1JFQH 3E2HB 3TVMB 1MVFA 4V1DB 3CFDB 4UF7C 4JFDE 2LAAA 4PRHE 4Y19B 1OOAA 2XKNB 3GT6A 4GBXD 3UBXI 4JN2A 3W38A 3GYRA 1G1KA 3FQUA 1OT1A 4M7LL 1SQMA 4Z7OF 1S9YA 3HS0B 4OF3A 2ILLA 3T3PB 1NFDA 2GKIA 5BZZA 5HYJD 5I28A 2YPVH 4KK6D 4DEWA 1H3PL 3BWUF 1I1CA 3O8XC 2V2XB 3QEUA 5FO7B 3DVIA 1E0OB 3MNWB 1ZK9A 3WNMA 2VC2B 1EFXD 1N7MH 3CNKA 4EI5A 2CH8A 1XH0A 3SDYH 1GGUA 4GBXC 5KANG 1BVKB 4XE5B 1MCHA 3VMPA 2ID5A 1NWOA 5A2IH 4QOKE 3LQAC 3VFWB 4KI5F 1K8DB 4ZQKB 2N59A 4O2CA 7FABH 4CU8A 2FH6A 2YRPA 1ORQA 3F12B 5IQMA 5ESVB 4EVNA 3ARGD 3HZYB 1ZVSA 4U6XB 2R69L 2ZCHL 3LZPA 3SSGA 2VL4A 4N9GA 2WZAA 1A4KA 1FG9C 1NUNB 2XWRA 5KBDA 2X0VA 4KRMB 1FL3A 3UTSE 3KPSE 5T3ZE 1A14H 1DQDH 3MYZA 1RIVH 3GKWL 4K5NA 3RY4A 5GZOD 2E6JA 5ALCH 1L7IL 1EZSA 5C7ZA 2XV3A 2J5LB 1GS7A 3GSNA 3RGBA 1RSYA 1PSKL 1V27A 2WXOA 3BPCA 3PWPB 4XX5A 5ISZE 1QUNB 3U36B 1CD0A 1QO3A 2NY5L 2XXMB 3IMVA 1QRNE 5FYKL 5AAPA 1XX9C 4L29A 3DRTA 5DK0A 1TOXA 4HIIB 2H5UA 3D25B 4NQVB 2HFGL 2R29H 3MV9D 4KOBA 2CKBL 2X1PA 4LVEA 2AF2A 5FYJU 4M8UA 3KWWB 1U3HC 3BRFA 2IO5A 3HUJF 4XCYB 5C7XL 1U8JA 3H7BB 3T4AA 3DX2A 5I0YA 1XGRB 5JORB 1L9MA 2AJYL 4ODBD 5E99H 5B7FA 1M1XA 1U8LA 2A2QT 5FGRA 1N64L 3J27A 2K78A 3OXRA 8CGTA 5CUSL 3TBWB 1H3VA 3QO1A 1PKOA 5T1KD 3G5ZA 5L2KE 2F1AA 2WMPA 4U6HB 1VGEL 4WY7H 3WIHA 3WAKA 3Q05A 3PGCA 3GMOB 1CL7L 4PRPA 5D7LD 2ZOOA 2FYYA 4JJ5B 3QUXA 1IVLA 1RZ7L 4K3DL 3HZMA 3B9KB 3QW9A 2BP0B 1O9ZA 1QSFA 3IK2A 4Y9EA 3WJJC 2OMXA 4AT6B 1CO1A 4O58H 4KK8C 4AEIH 4BZ1A 2VDPL 3AS0A 2ESVA 5ID1B 2FAUA 1FRGL 4QYOA 2FL5A 2UY7A 4TYUA 4D8PB 1KIPB 1USQA 1FZMA 4ZOEA 1HEHC 1NMBH 4ZFZB 1I4FA 4XOEA 1F3DH 4WV1A 3HJEA 3CQPA 2OMZB 3ZE2F 1D5XB 3S5LB 3WFZA 1WP6A 2R0WL 5TE4H 4NN5B 4C4KT 3OMAB 3PRZA 2ODHA 2HLFC 1EAOA 2PWGA 4JANB 4FQXA 5HHOE 1FNEA 3GSUB 3KWXA 4HXAL 1ZTMA 4BK8A 1PG7W 5DHVH 3RVTC 1X6NA 1KJMA 4PJ8B 3BE1L 3OPUA 4PW3A 5AYTA 2WLHA 1L9RA 4ZSOA 1DVFC 1HH9B 5E2TL 4ZAKD 3WIHL 3S36H 1RD6A 4R97B 2Q8BH 3PDGA 2E9GA 1Z9NA 2A5UA 2R23A 3M07A 1DVFB 4HWEH 5A2BA 5JMRA 4HKJB 2Y7QA 3WXVH 3PQYE 3S3PA 5CS7A 2HPOA 1H5BA 5CHNA 1FVDB 4PJGA 1UZ6E 1I31A 2M8XA 2W0FB 4JFZH 4DKTA 4HLZG 5BOPA 1F4AA 2A6DA 4YHNB 1EK3A 5HVHB 2EEXA 5E1AB 5LXGH 4PRAB 3QIBC 2WUCH 5J57B 4N8CL 4UIKL 2K4WA 5I15H 4PLOB 1OM3L 2NY4B 1KN4H 3HHSA 1QBMH 2DOCA 5F88B 5HHOD 4UQ2A 1D6VH 1RZKC 5AW4B 4PGBB 1DQVA 2BFVL 2DICA 1IAOB 2MMXA 2WQVA 1E40A 1DDHA 3DOSA 3E9UA 3ETBF 3G5VA 1GCFA 4LCIL 5B3JF 4ONGL 3UCRA 2F9BT 1WSST 3A4FA 4UMGA 2FD6H 1PDKA 2ITDA 2BNQB 1J18A 3TA3B 4OLVH 4R3SA 3WV0A 1NFKA 1MW1A 2JKNA 1OCZB 1UA7A 3PL6C 1NCOA 3G9VA 4WEMB 2C3HA 4NCC2 2Z4QB 1VFAB 4XZ4A 4C57C 4B3EA 5DLMH 3FMGL 5EZLA 1EEYA 3PV6B 1XL6A 2WINA 3GPEA 3TPUB 1JN6A 1A1NB 2AV1A 1WEJL 3NRFA 5CD3B 1KXVA 2OCCB 3A67L 4PMFA 3IEAA 3MCKA 3AS3A 5B21A 1SRDA 1DN0B 1R3LB 2UWEB 1ZANL 3QHFH 3OBAA 3C5XA 1DJXA 1T1WB 2QVKA 3QH3A 4ONOA 4YQXH 1DSFL 2VM4A 4HU8A 2ETWA 1NUFA 4K8RC 3CSGA 3CDGA 3IETA 1EJ8A 3O6FA 4M02A 2BINA 5FYJD 3KPNB 2NX5D 2CNYA 3LPWA 1H5BC 3C60C 3T08A 2CHXA 5I6XB 1T4KB 1LLAA 1W8OA 1WH0A 2CDGA 3GXFA 3WS3A 3MNMA 2XFXA 2H3NB 3EJUA 4NRXA 2HAZA 5K5YA 4N20A 4L8CA 4FTVB 2FQDA 3BD4A 5E95B 5JPMB 5D1ZC 2Y2YA 1YECL 3NACH 4OB5H 3IDXL 5MP6L 2QFPA 1U33A 3SO3B 1F4HA 1DBML 1PLCA 4NNXB 3M1BA 1WBYB 5CGBA 3UYOD 5BS0D 1S9VA 3FNKA 2MNUA 2VO8A 1P5VA 4G1MB 4PJFF 1IE4A 2Z8SA 3ULUE 3JBG7 2C7UA 5GXBB 3HS9A 4GW5B 2DW5A 1JHTB 4MQ7B 2NUTA 3D3VB 5IQLA 1C5DA 2O5ZH 3P0GB 5CEZH 1I1YB 3PPEA 2CXKA 1MIMH 3S35X 1Q0XH 3N41F 4QHNB 2MQ3A 1CXLA 1XCWA 1JZFA 1S7TA 4FHBD 4Q6IA 5CJ5A 4PJFA 3BP5A 4JO8A 3SDCB 3KPMA 3MV7D 3BFWA 3NPSC 3EYOB 1LEKA 3D51A 5CCGE 3T71A 3UCQA 1KXVC 3SE9L 4DZBB 1RURL 5IMMB 3ZIMA 4KO7A 1QBLL 2NUPA 4QGYA 5E8PB 2D3LA 4MAYB 1BOGA 5I1KH 3Q1EA 3QRFM 3ZDYF 3N0PB 2R0KL 3FT2B 4N6RB 4TOYL 4N3TA 4XP9L 4QRAA 4G3YL 3QCTL 1AKJA 1NGZB 2VDQH 4L4VE 4C83A 2ARJB 1BEXA 4AVJA 2N7BA 4E0RB 4K23L 4B60A 2NY7L 4PLJC 4WW1A 4R5TA 3W81A 1ZAGA 4QIRA 4TTGA 4Y5XA 4BGLA 3FONB 4F8PA 5D2LE 4TULH 3TTYA 1LP9E 2H0JA 3PAUA 1ZLUK 2OQJB 3GZPA 2L4OA 4WKZA 4UZUA 4YFDB 1RERA 2F8VA 2FCBA 5CSBA 1QMUA 5ID0B 4PJXA 3SBQA 3IDXH 3CHPA 3HRZB 4LSQL 5G4NA 2YD0A 1TT6A 5J7CC 4NZ8A 4XAWL 4AG4H 5L6YL 1FNFA 3QEGH 2QSCL 2JJSC 5DFTA 3UP1A 3KAAA 3WTWA 3CXDL 1U2YA 5EU6A 3B43A 1SJHA 5B38B 1JOIA 3ZO0A 3V6ZB 4NPYA 4KJWD 1I9RH 1U8HB 1T0MA 2WJ7A 3C12A 4N0FA 1AKJD 3L9RB 2ZUQC 4ABUA 4PGJA 4E2OA 2WLLB 5EZOL 5JIQA 3VD2A 1WCBB 3TJHC 3L9EA 1IAIH 4OCXL 4XMVA 3G6JB 4XC1H 3P4NB 4QPEA 5LO7A 2DPKA 3S3SA 4DAGH 2IVFC 1ZHNA 5DRWB 1DJYA 3QCUL 3GRWA 5EUOA 4OGAC 5E8PA 2VISA 4TQHA 2O72A 4B97A 3OHXA 4P49A 4FC3E 3FUKA 5DJAB 1NDGB 3QT2A 3NH7H 4CW1B 5JZ7C 5L4MA 4W6YB 4QRQA 5JQ6L 4YZWA 4WO4A 2Y7SA 3N85L 2IDTA 3QQNA 2GSIB 3LVTA 4OJFL 1XF5A 2H6PA 4ALAL 2Q8BL 4TRPL 4ONHA 4PN6A 1VEOA 1ZT4B 3TZVC 2BFVH 4DN3H 2A7BA 4PI0A 3EJQA 5E5RB 2VE6A 3QAZB 5GS2D 1ETZA 3GSNL 4XWOD 4EUPB 5I15L 3NPZB 5AVTB 3VTTA 4JFEE 4HHWA 5DJZB 1R6VA 4B5ZA 3D48R 4J7RA 3HC3L 1MJ7H 5D96C 4ZPVB 1SYSB 2FLMA 5IGXH 3I2CH 4HIPA 4X6FB 4N5UA 1F13A 5LBSA 3RZCD 3GMPA 3QJTB 1O6VA 2YSSB 1N6VA 4ZI8A 2BVPB 4P46A 3HAEH 3OB0K 2H9GB 4AOFA 4P9HC 1P4BL 4ACTA 2WYIA 3ROLA 3FF8A 3UADA 1ILSA 3ZL2A 5EDSA 5I17A 5MI0B 5A16A 1OAYH 1WUNT 3IKKA 3HE6C 3C6LA 3CSYB 3FUIA 5F9WB 2Y4SA 1OAUH 1AACA 1HCFX 1QWNA 4NHUA 4EQ2A 3DHJA 4M56A 2KQNA 4FERA 4K5LA 3LNIA 2NW3A 2EDOA 4L0ZA 3BLBA 4HXAH 2PABA 4LPXA 4RBPK 3FB6B 1UVQA 4RFNB 1DJHA 3M17A 4K8RD 2P9RA 3IDJB 5EIQA 1ADQL 3IJ8A 3FO1B 2OXHB 4TNGA 4WJ5A 3S96B 3BKMH 4LOFA 5LCVH 4QRSA 3L1FA 3ZJAA 1X7QB 4P8QA 2WXRA 1QYGL 2B2XL 4POZD 1D6EB 3TN0D 1J5HA 4RAUB 1RULH 4RMUA 3LPOA 4CC1A 3LKRA 2WXNA 1R24B 3E1ZA 4U1LA 1PDKB 4MKTA 5DHXB 4HIEA 1FAIH 5FM5O 1U91A 3LNFA 1F56A 4S1DD 1G9EA 1F8TL 1GXEA 5I8EA 4BM7A 1OARH 5I1GL 4W9IC 4Y4FC 1JYNA 3SPVB 5IFJA 2AITA 1XMEB 2PXYD 2DQUL 1X5KA 1DHKA 3U6XS 5DD6B 3C75A 3R4RA 4PRHB 5ERWB 3RU8H 5CD5C 4Z7WF 3FKUS 3GO1H 2EEDA 3ZKQD 5TQ0L 4NYLB 3JWNH 2WAHA 5DCCA 3ZRSA 4KKLD 5GZNA 1KNOA 4QRSB 4MHHI 3WKML 3FOMB 1H8SA 3JYCA 3FO1A 3S96A 2Y7QB 1XGUA 2GBTA 1NBCA 4JS7A 2UUDH 3CZNA 4B7LA 3ILPA 1RU9L 4CAGA 5A2JH 3CDZB 1H3XA 4Q56A 4RH4A 2BOBB 2IPKA 3GGWA 4FG6C 3SDDC 1P7HL 1FNLA 2CKBH 1P2CB 4NM8L 4H13C 1KTRL 2DQFA 3BDXA 4D0BB 3ECUA 1A4BA 5IV2A 4NDMB 1S7VA 2QQNL 3PHAA 2OQJA 2WM0A 5C2BH 3L5WB 3NA9H 4IBQA 1X5ZA 1BGXL 4PB9H 3DJRA 3T6QC 3MUGA 2NXYD 2EDRA 3E1F1 2K7PA 1IEAA 4TULL 4WU7B 1MW2A 2WV3A 3ARBD 4JHAL 1MFDL 3WNLA 1Q0YH 1TZGH 4KZEL 3SCMC 5IB1B 4OJFH 5GS3A 2R29A 4P05A 2OFQA 1OB0A 1DYZA 2F5BL 3SY0A 3ULVL 5H2BA 5G4OA 3VD9A 1ET8A 4JQXA 2E4FA 5DJDB 4MNGB 1MCJA 3L6FB 4WIQA 2X10A 5ACMA 2M2DA 1TJHH 1PY9A 1R9FA 3BKJL 3X17A 2ESVB 4X5QA 5I1EL 1MF2L 5AUMA 5DUMH 3BXNA 5E9DA 3WKYA 5IREA 3WNNA 4ZXBC 3BQUC 1NC2D 2BHYA 1BFOA 2MJWA 3DXAA 2ZOUA 4F15B 5CAYB 3A24A 2VDMH 3FRPG 4GP8B 1ZSDB 4PRPB 1MEXL 2GHWB 3HA0A 1YNKH 3KNBA 4NKIH 1S7TB 4PV8A 3QPKA 1TU2B 1LE9B 3OPZH 3T6ZA 2HMIC 4BA0A 1MHPL 4HV8A 2X9YA 2XI9A 3RFZA 1AD0B 5EIIG 1PX8A 3BAWA 2FX7L 4G8EB 2NSXA 1QRKA 1MWAH 5JW3H 4WI4A 2HTKD 2ZKMX 4FS0A 4F8NA 3ULUF 4WCYH 1MJ8H 1P4UA 3P30L 5FCUH 1MNUH 3CHRA 2KS0A 4KUCF 4NO5B 5AWNH 4A2EA 4F33A 3Q06A 1UFGA 1HH6B 1UJ3C 1YEIH 3L3JB 4I4WA 1JGVH 5ABZA 1A7PH 4XXDB 2CIKA 2RD0A 2FHCA 4XOAA 1KXTB 4GKSB 4PRHD 1JPFB 4OV6F 4WUUD 2X0UA 3HKZA 4JFWA 3UO8B 5LQBH 3CBKB 2WB1A 4AWJC 2XFXB 1YNLL 1FN4A 4M1CD 2GPZA 1UKQA 2IPUG 1KB9J 3BWZA 3D2UB 3H8NA 4MJ4A 1G7LB 1GZQA 4P4KA 4PV8B 3BFQG 5E8NB 2AJ3B 4PY7A 4AQAA 4J3VA 3K6SA 1RJZA 4XCEB 1TTUA 1N6QL 3APCA 3P9MA 4Z7IA 4DGWC 2CJSA 3H9SB 2DQEL 2LU7A 5C08B 4RGMB 3LKNB 4G72B 4PRIB 4JY5H 1E65A 1LO0L 2B5IC 1QASA 2YMTA 2ISDA 3FCSA 1IGJB 5E4EC 1SOXA 2FWLB 1AZRA 2VAJA 3NSXA 4NP9A 3T1WA 3NAAH 5HHMB 1UACH 3HG0A 3IJHB 1JRHH 4ZQKA 1K2DB 4P0DA 1G0DA 3WEAA 1M7IA 3QORA 3ARGA 5DFAA 4AGLA 2EYTA 5KYUB 4PMEA 1JDDA 5H8DA 5FB8B 4QRBA 1YRKA 3IE4A 2P43B 4BSJA 2GT9B 3C60B 4U4IA 2HN7A 2KPWA 4N2DA 2CG9X 2DL2A 1DVXA 4KVCH 4NWTL 5T1JA 3WIAA 3ILEA 5ICXA 1I8LC 5D2NC 1SOSA 3V4UL 1DDHB 4HGWB 3DTXB 2ATKB 4X5WA 2DBLH 1G6RH 5LJYH 3QUGA 5ISZD 4G8GE 1U91B 4HUCA 4WW2F 3HB3D 2BC4A 2KLTA 4RLDA 2V3DA 3OF6A 1NQBA 3ZOAA 1DQJB 5C0RH 3EDFA 1A6VH 3SBWC 2OK0L 5KG9A 3MV9E 3UL4A 3BVNB 3PL6B 2GC4C 2ZXCA 4K8RH 2E9BA 1PZDA 3CN4A 2AZAA 4IDJL 4JY4A 5E00B 3ZDXE 2ZXBA 2K9FB 3RNKB 1I1YA 2QADD 1TQBB 3LPFA 1E5AA 3SDXA 4X4YB 3EAKA 2WO2B 4GSQA 2R39A 3DTUB 4NX0A 2Z65C 2F0CA 3US9A 1A25A 5GZOA 3QXWA 2X12A 2RA1A 2HKHL 4KTDL 3BVNA 1HXYB 2EIZB 4F1ZA 1EO5A 4NNXA 5H94B 2EO9A 4IRJA 3W0WA 2DQUH 5DD6A 3CSYA 5IT2H 1SNRA 4ISVB 4FF9A 4GSDL 2X6MA 4N6QA 3K1KC 1R17A 5FUCC 3V7MA 1F2XK 4M93B 1G7IA 1K4DA 4HGWA 3HJ0A 2GCYB 1N26A 4L3EB 5I8EB 3NIFE 3QUZB 5DYOA 5I76B 1WJ3A 3WJMB 1A47A 1DUZB 4YDIL 5C0GB 1DVUA 1G1OA 3ZZ1A 2YZ8A 4XZUA 2M26A 5MENA 2Y22A 1EDYA 2X4TB 4R97C 2Y3NA 3JZ7A 2V2TA 1E5BA 4NQDD 1K2DA 2WLJA 3IJEA 1CYWA 4XMKL 1KGJA 4P57A 2X70A 3KPPA 1ADQH 4QRRE 1NBZB 3BOVA 1IM3B 1AYOA 1SHMA 4LP5A 1HSAA 1DL7H 4TVPL 3NIDB 3BIAX 2WAQA 3OMNB 4PJEF 5FA3B 5I1LA 4Q9RL 1NCUA 2P5WA 1JNLH 1P9MA 2OMXB 3ATEA 3IFPB 4L4TB 4ANXA 1LEIA 2XG5B 4MLSA 1QFWL 5DVNA 5FECA 4K0OA 1UOVA 3FT9A 3P3SA 5IVZA 3F7QA 4F57L 3D52A 4PUBL 4WUKH 4HDIA 1HNGA 5KS9A 3MLSL 4Z7VA 4FQ2H 3KS0J 3D18B 4HGMA 2OYLA 1C5CH 1KG0B 4U6HA 5DD5L 5C86A 4WTXA 5LNDA 4MGXA 3KBHE 4XP1H 4IHBA 4OZIB 4JFXB 1KENL 3I84A 1IM9A 3MODL 3O9WC 3N40F 3VQLA 1T2QL 1OAKH 1JWSB 3AB0B 5LGJB 3LV3B 3NJHA 2O5YL 2R1XB 3C8KA 3UAEA 1FLTX 1WFOA 3HAEA 4P9HL 1SJXA 1ZD6A 5GJTL 3CU1A 1T0NB 1D7DA 4TUOA 5F0JB 1S5IL 5LGKA 3MZGB 1KCKA 2P8MB 4L29B 1TKWB 5DK0B 5AVZB 4Y5YC 4LCCC 1K3ZA 4QJ4B 3O8XD 4IHOB 1E3ZA 2A4ZA 2XXFA 3QS3A 3UBXB 1I8UA 2FLRT 3ULVE 4N2IA 2FQEA 1SLXA 4YSTA 1NC2A 4JFQA 4WO4B 3ZHLA 2VZUA 4X6EA 1ZMYA 4MZRA 2H32B 5C0EA 3DMMD 1F42A 3ZT6A 1U8PA 4F9LC 5INCB 1CYXA 1NDGA 2ZOLB 2Y2WA 3B2XA 4UT7H 1MFCH 1TMCB 3M1CA 3VFOB 5T1KB 4ZZFA 3F12A 2Q9OA 5DUJA 1URZA 2OJEB 4QHKI 1E2WA 3NGBB 1B0RA 4OF7A 5C0FA 2XXCB 4L1TA 5DA0B 3ARTA 3QP3A 1BCIA 3QIUD 4MDRA 4AQ1C 4KI5D 3VDAA 2IAAC 3OX8B 3IRCA 4J5VA 1ZWIA 3V6ZA 5J6GB 5A2CA 3HI1B 5ID1A 2WKOA 2ED9A 1HE8A 4HWNA 1ETJA 1TTRA 2PWFA 1A1MB 1X9LA 1TEGA 3II2A 4KKPA 3KL5A 3L2NA 4OI9A 1KGIA 3L17A 2DWDA 2LTQC 5E9NA 4WEBL 5BJTA 2P28B 2VDNL 3GI8L 5HGHA 2Y25A 3RJOA 4X4ZA 2B1OA 3OXRB 3MX0B 3L1EA 4IEFA 4NHCL 3K0YA 5E7BA 3T1FA 4PJ9A 1WA2X 3RVWC 1X9QA 2BCMA 4LLMA 4CVZB 1M7DB 4G8FA 4KKCC 5KOVC 3S5YA 2UV3A 3O6FD 4JO4H 5E9DD 4L8SB 3FZUD 3BQUB 4LT7A 3RTQC 4JFDA 1MLCA 3SE6A 1CFTB 1T5XB 3MRQB 2DQTL 3QSKB 5EZPA 4OGXH 5GIRB 4BD4A 2D0GA 5JUEH 1R5IB 1BOGB 2JK5A 3CX5J 2VERA 4HIIA 4PJAF 2Y3AA 5C07A 2E7CA 5IHZA 3D85D 5G4MA 4X42A 2Z8WC 4OJCA 3UABA 1EBPA 4QXTA 4FE9A 1IJ9A 4DZBA 3B3BA 1T4KA 1YSOA 4P9MH 4TQ8A 4TUJB 5D2NE 5DS1A 5FW7A 2NTFA 4O02H 3QQ9C 4OVVA 5F70A 1INDH 1WWBX 4ES9A 1CDUA 1NBVH 3QWOA 2H4EA 3CTTA 4LIQL 4U6YB 2QMKA 3NRQA 3U2IA 2TRYA 3M8OH 2JELH 5DC9B 1U4FA 4N0UB 1W72B 2J8OA 3V2AR 4D3CH 4Y19D 4A7UA 3ARDB 3GIVB 1E50A 1BAGA 2IOIA 4R96B 5DQJA 1B0IA 3UPRA 4FFWC 4LHQB 2WINB 3IMSA 4NUPA 3ETBJ 4GMSL 1A9VA 5E4IA 3VB8A 1VFAA 3MV7E 3L4UA 5E5MA 1HQRB 3CHOA 1HXMB 3T0BA 3S3DB 5K93A 1BFTA 2HRGA 2YXFA 1C12A 4HBCH 2DB8A 2YAEA 3RWFA 5BRZD 5C0GA 2BVEA 1JFQL 1I3GH 1UZ8A 4NNYA 4S10A 5DYOB 4ZUWA 3QUXD 1RZKH 3RPKA 3U1QA 1C08A 1E9PB 2R1YB 3I6GA 4N2GA 2DLIA 3EOAA 5DJ8B 4Q2ZA 1ZPLA 4TQPA 5ISZA 4FXKB 4ELKA 1QRNA 4JFOA 2AI0L 4LDEB 3RDJA 3U4KA 3VFVB 2EVFA 4PGBA 1YY8B 5B1KA 5IB3B 4ATWA 3RVUC 1HOCA 1MI5A 2GQHA 4GKNB 4HALA 1FL5A 1WFIA 4NB7A 2HVJB 1B88A 3TBSA 2ZNXA 2G0KA 3L4VA 3GRGA 3CSPA 4KO6A 4AUJA 1UC6A 2EIZA 1E2VA 4NUJA 3A5VA 4P23C 2FQFA 1BVZA 2JKXA 4IJ3C 3I6SA 3OKEA 5JHBA 1UUSA 4KX8A 4OI7A 4HG4J 4O2EA 1UB5B 4ANKA 1EEYB 4KJQC 4DGYH 2OR7A 3Q5TA 5EZLB 3V52L 4NZTL 2R2BA 4OLZH 2GSGA 4GIAA 5CP7B 3TJEL 3IFOB 3GB7B 2VLJB 2V5MA 4FQXD 4PRPE 2XN9B 3UTZB 4WI0B 2LU5A 4ZSOB 2ITDB 1GOGA 1Q0EA 2XWZA 4Z7WE 4HOXA 4P06A 2CXGA 1J0KA 3NCEB 4CL7A 2J1KA 5T5NG 2VQ1A 5DD5H 1PZ2A 2F54E 3O45A 4KPHL 1BBDL 4ZAKA 1N4XL 1N67A 4HUVA 2C4FU 3JWNE 3O2DH 4HXBL 4N0RA 4S1RH 1U8NB 1XD1A 1MLBA 1YYLH 2ESVE 5CJXC 5IOPA 1EHLH 1I85C 1EXUB 4LRNH 2FJHB 4MNGE 1BM3H 3HE6B 5DUML 3O6ML 2ZF9A 3HFML 4I2XA 3MYJB 2EIEA 5CLZA 4XC3H 2B77A 4PS4H 6PCYA 3GZKA 1HE7A 4KHTH 5BPPA 4Y2DA 4XMKH 4P48A 2ZCZA 4D7BA 1T5WA 3MR9A 4QYOB 4HD9A 5DVMA 4KC3B 2VSMB 3V4PH 1AVAA 5E8EA 3NOIA 3KYMA 1QI5A 4HPYL 5HHOA 4PGDA 4KITB 2GBAA 2V5YA 2EE6A 2VDLH 1DFBH 5ENWB 5DHYA 2VUOA 3HZMB 3LSOB 4YSEA 1L3NA 2WIMA 4FABH 43CAA 3BIBX 4FI7A 2RCSL 3DETD 4NKMA 1M2VB 2AEOA 3QC5X 3NA4A 3KPLB 3SE3C 5FM8A 1GTFA 3MFGB 1IGFH 2WMPB 1FFPB 4FGMA 5CGYD 4YS4A 1QW9A 5DTFA 3TZVB 1QLEL 2WLMA 3FSVA 3MUHL 3DJZA 4IJ3B 4LARL 1AD9B 1Q9OA 1QLEB 1QD0A 4HIJA 4JG9A 4MDIA 3WY1A 1S7RB 5DHVA 4AV5A 1ODUA 1B2WH 3ZGIA 3GM0A 5CJOL 1XGRA 3U9UB 4RWYL 3CXFA 4OKDA 1HH6A 5G55A 3MA9H 2DJ4A 1PZUB 5FHBH 2ZSVA 5C3TA 3O8XA 2E7HA 2EH8L 2IALA 4KNUA 4MMZB 4K71C 4H7VA 3KL0A 1JD7A 1NGWB 1P84K 2VXSH 1E4WH 3PWJA 4A37A 3G5YB 4O2FA 2BSCA 4UV4H 3O3AA 2D4DA 1RHHA 1LE9A 3QZNA 3KWUA 1UWYA 1FO0H 2IAND 1XSOA 2WKLA 1EZLA 2VLME 3NSCA 2A9BA 4X80L 1JRHI 5D7IF 5SV4A 2AEQL 4XHJD 4XCNA 2PWDA 2DBJA 2J88H 2BX5A 2E7LC 1NAMA 2IV8A 2XHNA 3QQDA 3ABGA 3U30C 1FSKC 2DIJA 4J6RH 2CLZA 1IGYB 2P1YA 3GHEH 2R83A 4MDJA 1WRFA 4LVHC 5IB2A 3V0IA 3L95A 1LK2B 2CKNA 4F9PC 4N24A 3UERA 2D8KA 3LX9A 1IUZA 1MCCA 4NWUL 2WVSA 2HLAB 2QGBA 5E7FA 4H88H 4OZGB 4WGVB 1LO3L 4AKQA 2E27L 3V4PB 4H8WL 5IJVA 1F1DA 3D25A 3FB8B 4MCYA 1VCBC 2J21A 4HP5A 3SQOH 4PRBA 2Q86B 3B2DC 4JPWL 2CK2A 32C2A 3VFPB 1O6TA 4L3EE 2DTSA 2YXMA 4W9CC 1TITA 2H3NA 5EBGA 5AW1B 3TJPA 2CO1A 2VITA 3MI6A 2VYRE 1A6TB 3EOTH 4GUOA 3QZWB 1FZJB 3QRGH 4DTGL 1CGTA 1CB4A 1A9BA 3QULA 2GAZB 5EOCJ 5EWIH 4G6KL 1NKRA 5L7XL 5JOEA 3OZ9H 2YD2A 1JV2A 5EOTA 1CC3A 2H6UA 5FW8A 1QLRB 4ODSH 1HQ4A 3MCKB 3AY4C 3VRLE 5LQBL 2EACA 1FDLL 3V0GA 5BVPL 1A4JA 1Q9WB 1LP9F 3VXPA 5AAMC 3TV8A 3PGFL 2RR3A 1U8KB 5KVDE 4JDEA 1MN4A 1AHWA 3MVSA 1P7QD 3RDTC 2KT6A 1J8HD 1VCAA 3MNWA 1KF9B 4GFXA 1IC0A 5G5DB 1U3NA 3ZKSD 4B0MB 2XTJC 3HNSH 4G8GB 5A2LH 1C8PA 4P04A 4Q6IC 5FKPA 2K6WA 4YSQA 1RZ8A 5E8EB 2A4EA 4MS8C 3GHBL 4HQQH 4BK4A 3AUVA 2WYZA 2C9UA 4JKKA 2WVUA 1RZFL 1KV3A 5EU4A 4FLSA 3W39B 4J3TA 1BJ1J 2IAMB 5FHAH 5I5JA 2RB8A 1BVLA 3GJFA 3QQ9D 5I1KL 1KJVA 4LEEA 1SF3A 2N7AA 1PG7L 2JE8A 1U8CB 3JT0A 4HVBA 1NOAA 1TJGH 4YPJA 2W9LA 3QDMB 2Z92A 4G42A 4IIQC 1S7SA 4ZJ9A 4L8SC 3VXMD 3LB6C 1RV6X 3VXRE 4XO9A 3GUTB 3IDJA 1DLHB 4WO4C 1UASA 1E7UA 5D2LA 4Z76B 1LP9A 2W5PA 2H0FA 1J8HA 4PRIE 3BAEL 4BFRA 5KJRL 2NYZA 3BSGA 4BSVA 2AAAA 3TCTA 4NHUB 1W0YT 43C9A 3JUYA 2N1TE 2A83B 1ZA3A 4MNQE 4DO4A 5BQ7A 4IS6A 3TV3H 3K5SA 4I0PB 4XBGB 2Q6WA 3D69B 3FTGA 3UZQB 1ZANH 2VXVH 1MI5D 4PP1C 3V4VB 1MCWM 2X6CA 3UFIA 4WGKA 5DU7A 3GUTA 1C16A 3L3DA 3CLFL 2WOYA 3P4LA 2FIRT 3G6AB 5JW4R 3HI6H 1XXDC 2DIBA 3EYFB 4P5MB 4Z7QE 1IMHC 3N9GH 4ZNCD 4IBUA 1UG9A 4F92B 2OPCA 1UOWA 4ODVH 4B9ZA 1IBBA 5EIVA 3NVQA 2FX7H 4H4NA 2X4SA 3VXME 4Z9KB 2Z1PA 1OZUA 2LVCA 3NN8B 2Y6TE 1MHPH 3QJSB 1QFUL 2ALWA 4G3YH 4U1NB