2E4FA

Crystal structure of the cytoplasmic domain of g-protein-gated inward rectifier potassium channel kir3.2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
201
structure length
191
Chain Sequence
IQRYVRKDGKCNVHHGNAETLVFSTHAVISMRDGKLCLMFRVGDLRIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLGFYEVDYNSFHETYETSTPSLSAKELAELANRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G protein-activated inward rectifier potassium channel 2
publication title Structural Diversity in the Cytoplasmic Region of G Protein-Gated Inward Rectifier K+ Channels
pubmed rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 38
structure length 191
sequence length 201
ec nomenclature
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 2e4fA00
3ATAA 2QKSA 2X6AA 3SPIA 2WLKA 3ATEA 3ATDA 1XL4A 1U4FA 3SYCA 2WLIB 2WLLA 4KFMA 4LP8A 3K6NA 2X6CA 3AT8A 3SPCA 3AGWA 3SPHA 1P7BA 3SYQA 2X6BA 3JYCA 3SYOA 3ZRSA 2WLLB 2GIXA 2WLHA 1N9PA 3AUWB 1U4EA 2E4FA 5KUKA 1XL6A 3SPGA 5KUMA 3VSQA 2WLMA 2WLJA 3SPJA 3SYAA 3ATBA 3AT9A 2WLNA 2WLIA 3ATFA 3SYPA
chains in the Genus database with same CATH superfamily
3VI4B 1L3NA 3K81A 1YHPA 3KBEA 1JPST 3M6DA 5IVZA 3KEHA 3TBCA 3QORC 5AOLA 4ZX3A 5F9JB 2YBGA 1TMCB 5DHXB 2BM3A 3L4ZA 3MODH 2EE3A 1F2XK 5DEFA 2BY0A 1OTUC 5LLIC 5DQDL 5DJZA 1E6OL 5I8OL 32C2B 4Z7QB 1HWGB 2VLJD 5D4IA 1KT2A 1VFBB 4KKBC 5FF6B 1DEEA 4DO5A 4C4UA 1TMQA 2AEPL 2WCSA 4KK6C 3WIFA 2ZIDA 3HFFA 1IGIH 3G5YA 3DPDA 4PRIB 2ATKA 1CYXA 3WDIA 5KTEH 2P5WE 5IMMB 1Z3GL 1UD5A 3GMQB 1AZZC 1BZ7A 3FQRB 4QYOB 2EVFA 1A6TB 1IBZA 5KBLA 3A21A 4PYHA 2N0KA 3CSPA 3GMLA 4AITA 4ABVA 4B9GA 2YK1L 2PTTB 1R5WA 3HC2A 2XZQL 2UWEB 2K4WA 4FFVD 4HUWA 3VM7A 4CSTA 3QNFA 3SQBA 2IWEA 3F58L 1WYJA 1G0DA 1YEIH 2CAKA 5IR1B 4I5BB 3OKNA 1KJ3L 3DUUB 5J6SA 1Y6KR 5JIPA 4X6BB 5K9OA 4M6MH 5F21B 1WH0A 3SY0B 2P47B 2BK8A 2NY4C 4MB5A 5GGUA 2OMWB 5ELIA 1INQB 4PWIA 5I8CA 4QXTB 4GG6A 3L95B 4GMTL 2D7MA 4N0YH 3FMGL 2BZ7A 4N2NA 2YPLE 2DQHH 4FG0A 4LKXA 6CGTA 2WXLA 2A74B 3ZHKA 2VM9A 4Y1AE 5DURD 1FG2B 1YNLH 3QULA 1GOFA 2QR0B 2DH3A 1SZNA 3CHPA 4YSOA 3SPVB 3IJSB 3CD4A 3E6FA 3L2LA 1SYSB 3GJEB 1LL1A 1V3KA 5ANMB 2MTAA 1SBSL 2DYRB 1JK8B 1E9OA 4JRXE 3TBVB 4A7GA 1QEWA 1UWFA 3QZPA 4O51A 3RDTA 4D2NA 1IEHA 3TNMA 4G8AC 5DT1L 5IFJB 3IU4L 1FSKC 4JQVA 4AVHA 5K9QG 1OVZA 7PCYA 4JREC 3P0YH 1I9RH 4BKLA 4ILDA 1ZSDA 5AB2A 1OAKL 4ELKA 2PXYB 4GSUA 2YEVB 4N2GA 3GGWA 3MRPB 1UACL 1KB5A 1EZUA 2VDMB 1HJCA 3E8UL 5GGRY 4GW1B 4L37A 1SF3A 2NW3B 1BYNA 4G43B 4GMSH 5HDWA 1CICD 2GEQA 3HAEB 3HHMA 2BY2A 1IV8A 1MJJA 3HMWL 3UZEC 4ATTA 2G3ZA 4QD2E 4JN1L 1AKPA 1BXXA 2P43B 2ADYA 4QRPD 4FGMA 3O6ML 5I76B 3OGOE 5AAWC 4ZFZA 1SN5A 4JGUA 4EUPH 4XOAA 3IGFA 3RNQA 3U7WH 1J9RA 5BMFH 3QXUA 1G0XA 1E8XA 3GMNA 3MUUA 3VJ6B 2WZ0A 5KBKA 3VI4A 3FH8A 1R5VB 2C3VB 2P8MB 3VNZA 1JXJA 4C59B 1IRAY 1GYVA 2H4EA 4X4ME 1XF3A 3PS6A 3CLFH 1BM3L 4E9TA 2LTQC 2XIBA 3TN0D 4XTRD 4E5XG 3OMNB 1NICA 4FKKA 4PS4L 4F5CA 1CFNB 4MQSB 3VFSA 5BS0D 8CGTA 2NYYD 1DCLA 1F58H 2A9MH 5AYQA 1CXKA 1M9SA 1VFBA 3HG5A 1RJYA 4PIBA 3VSUA 3WUWA 4UNTA 3SDAB 1F8TH 3L8QA 5CKAA 4JZNB 3BMVA 5CINL 2YAFA 2A4EA 3VB9A 4PRIA 4W1TA 1A3ZA 1SOKA 5IMMA 3GMQA 2BY3A 2FLRT 3QNYA 5KZCD 3FQRA 1MQ8A 4AQ1A 1BZOA 1A6TA 3DOIA 4LNRA 3WTUA 1SF5A 4NKIL 3FAWA 4MCYB 1U3HB 1D5IL 4QWWD 1JFQL 4WFGE 3LKOB 4ZW7A 1QSEB 2DBJA 2UWEA 2QHRL 2MCG1 3N42F 5BUGA 1D2PA 4HJ1A 3SDXA 2CM5A 4HOZA 1KYOJ 4AMKH 2MRYA 4I5BA 4P5KA 1U8HB 3F7LA 2K3TA 4X6BA 2ENYA 2P8PB 3D07A 4JFEE 4NN5C 4ZFOB 5L2KD 2ZCLL 1TFPA 5DHEA 3FT2A 2X9YA 2JI3A 4P5SA 2LOEA 4G59C 4PUBH 5I1EH 2E6QA 5KVEH 4KKCC 1KYOK 4U0RC 3X1NA 1DBKH 2DN7A 2CLRA 4JDVB 1U8NB 1IM9D 3ARDC 4FQCH 4UQ9A 4I9XA 1C7TA 5I5JA 3E2HB 2XXFA 2ZP0T 3I50H 3I02B 2J20A 4FQ2H 5ABZA 3OB0H 2ZOOA 3AREA 3MLRL 2NNCA 4Y5VB 4R97B 4EBQL 3IAGC 1AGCA 3IJSA 1SYSA 4YBQD 3GJEA 3O3AB 3T0EC 1JK8A 5EF3A 1NCDL 4FZ8H 5C09D 4N9GB 4Z7UA 5HHXH 3PU7A 5IFJA 5IVXF 1JGIA 2DJUA 5IFHL 1MXDA 1VJSA 5A1AA 2P1YA 4TXVB 3B9EA 3D34A 4KI5D 1GY2A 1NDMA 1YMMA 1FH5L 2OZ4L 5AZEH 5IV2B 2PXYA 1INDH 5DQ9A 1YY9C 4DGIL 4Q89A 5D1QC 4OLYH 5D9SA 4EDXA 1EAOA 4MLSA 4PV1C 2BCKB 2IBZX 1AKJB 4GW1A 2QPDB 5C0AD 1SVCP 3HA0A 2NW3A 1HXMB 3MLTA 5DEGB 4AJ0A 4EN2A 5JXAH 5CMAA 5IQ7H 4IIQC 2ZKYA 1DQQA 1S9VB 3HVDA 2BSDA 3CU7A 1ZAGA 1SHMA 3IKKA 5B8CB 3MV7A 5DD3H 2IAMC 1K4DB 1CVRA 1X9LA 5ECGA 4Z3EA 5FYJE 2QPUA 1DQLH 4X7SL 4XH2B 3DHPA 3KLLA 4DPRA 1FVCB 1WZ1H 3MJ8A 1G0YR 2CGZA 1PKQE 2BY1A 3RVWC 5T3ZL 1UYWH 4GSQA 3IKCB 1JVKA 3PHOB 5IP4A 2FECL 4NKQB 5G4NA 4W6WB 3BWSA 2GC4C 1OKEA 2VZUA 2WWOA 1R5VA 2C3VA 4QEGA 5EZIH 3WFHB 6PAZA 3T71A 5AFAA 3I6SA 1PFCA 2F8XC 2FZ3B 1IBYA 5AB1A 1CFNA 2TSBA 4XE0A 4CSSA 1JPGA 3LNFA 5ADPH 4XVOA 5J6GB 2PMZA 3L5IA 4G1EB 1JCKA 1XGQA 3D0AA 2AQ2A 3SDAA 4OI8A 1J18A 1YUHA 3QNZB 4JX0A 4TQIA 5C97A 1Q9KA 4G8GB 5ETUB 3RJOA 2C34A 3ULSB 1KGCD 5LWYH 2EKSB 4NQTA 3VXSD 2L4OA 2AK4E 3GI8H 3MUGA 3OWEA 5H4ZA 2EC9T 3ABKB 5CIPH 3FTUA 4GXUM 5EC1B 4G7SB 5HDOA 4XC3H 2DYPD 4DCQB 4HSAC 4DEUA 1I8KB 3VVWA 1KGJA 3L4VA 3NSXA 2KDYA 1BFOB 1DLFH 1YJDC 4UV4L 3RWEA 4ZFOA 4XNXL 3M88A 2F5AL 1OAUL 3BKCH 4WI0A 2QQQA 3MO1B 1E5CA 1AMYA 2D4FA 3LXBA 3TX4A 1UH3A 2I60H 4AZUA 1U8NA 3LPFA 1G5AA 2P5WA 5KSAC 2VDKL 1TTCA 3VXUD 5LCVH 1ACXA 4MGXA 2W0KA 2BP5M 2XU9A 4Y5VA 1OAXH 3DVGA 1MAML 3LZLA 4FXTA 3VA6A 5L8KB 2IMNA 3BFOA 3TLRA 1XGUB 2EE9A 1RIHL 5F70A 5LGHL 3O3AA 4MQTB 1T1YB 4UWQB 3S5LA 2VNCA 5FCUH 3D39D 1PDKA 2R7EB 1A6PA 3W0WD 2F54B 5L4FA 3RWFB 4XMPL 2J71A 2W65A 3LZFL 1MEXH 5A6MA 3GT6A 1HYSD 3ZHDA 2H45A 4PJHB 5IV2A 4DVBB 4LVOC 4DPCX 2H6PA 2XIDA 3TPKA 2YPLA 1BF8A 4FQHB 1LO2H 2V37A 3RBSA 1XH2A 2WW8A 2ITCA 2BCKA 4OZFH 1AKJA 4Y1AA 1U2CA 5I1GL 4F3FA 1AO7B 3WE1A 4XVUD 1MCHA 5SWSD 1Q9WB 5DMKB 2YSSA 3MBWB 3EYFB 4I9WD 4MFHA 1MCKA 3PDOB 1YNKH 1OAZH 4AW7A 3M8OL 3SBRA 5B8CA 3T08A 4G6JL 4W9DC 4Z23A 5T33L 3WEAA 1JVOA 4PJHF 3C60D 4ZMLA 1ZCRA 2J4WL 1KBBA 4JMNA 3BO8A 3HNVL 4XH2A 1N2RB 1UT9A 3ABMB 3DYMA 1FVCA 1PLGH 5F7YC 3IMRA 5IG7B 1WVZA 1B2YA 3VXMB 4DH2A 4YSSA 1BIIA 3PGCA 4XPFL 4ZUWB 1R34A 2ZP9A 3W5NA 2VXSH 4TSCL 1ZTXL 1TPXC 1F1GA 2HKHH 1KCWA 1Z5LA 4ODVL 3WNKA 1IM3B 5AL0A 1CICC 2PYFA 2PPDA 2X4RB 3MJ9L 3JVGC 3H4HA 3MRCA 4V2BA 1P4BH 1WFIA 1J5OL 3ML8A 1PG7L 1YC8A 2FZ3A 4KHTL 2QDWA 3B3BA 1X4XA 2E7DA 1QWHA 2VABB 3T65B 5E6YA 1I8MA 4U6YB 3CPLA 1A6UH 3E7JA 4MMXA 1CE1H 3FUJA 1WCBB 1CYGA 3BGFC 3DX7B 1GZPB 4JHUA 5CJ8A 2A9AA 5J6GA 1OLLA 3DDFA 4G1EA 5KANG 1IKFL 2OYPA 4GO8A 3TPUA 3HC3L 1U8PB 4G8GA 4PWHA 1PKQB 5LGYA 1K4CB 5T3ZD 3FBKA 4M48L 1U4FA 2HX7A 5CNHA 5DJ6A 1EJFA 1FQ9C 1JWMB 4IMKA 4XCEB 3RWGB 4GRWB 2BWQA 4NQCE 3O2WL 1BMGA 4YGAB 4AYFB 3TN0C 3L5XH 4X4MA 1COBA 4XTRC 3S2CA 4U1MA 4EKJA 4Q97A 4ORGB 1S5HB 1TZAA 2NYYC 3KDMB 3RB5A 3CZUB 2DKMA 1CK0H 2CXKA 2DEXX 4OVUA 2YN3A 4TSAL 1YVLA 3WIHH 4B9KC 2KPWA 4L4VE 2CO3A 2NZ1A 2AABH 4M5TA 4XWGL 4HGMA 2CBOA 4QLRA 4L3EE 3F7QA 1UD3A 4F7TB 2MEJB 1HCZA 4BE5A 4S10A 4LU5H 1IC7L 3V6OE 1R33A 2BVYA 1ZV5A 2IH8A 4OR1A 1ID5I 4U49A 1PZ5B 5DDHA 1SUHA 2OR9H 4QWWC 4PLJC 5E6IB 1MIML 1FYTE 4P05A 3DMMD 3QFJE 1WUNT 2D7OA 2HT3C 4XXWA 1QBML 3FYIB 4OCSL 5AZ2L 1A7QH 1XGUA 3VUAA 3CVDA 1SOXA 2JI1A 3LPGA 3GI9L 2IDUA 4P4KC 1W91A 3EOBB 2TAAA 3G6JB 4JFZH 4P57B 1RK0B 2C9RA 2X9ZA 4JZJB 5J8OA 4EI5D 5KAQG 1KIRA 4RWYH 3IGAB 1IAII 2NMSA 3QJHB 1HSAA 4A2FA 3QRBA 4FQHA 4H8WH 4HC1H 5BZDB 4G8FB 1IJNA 3KCPA 1H5BC 2ZX8A 3IRCA 4L18A 2R4SH 2AMGA 3NN8A 4KUCD 4FJZA 5DRZA 4QF1A 1Q0XL 1Q9WA 4J3VA 3GHBH 2Z7ZA 1DQTA 4JE4B 5GQBA 2X40A 3PDOA 2CNZA 5EOQH 3RX8A 1VFMA 1F6AA 2WXOA 3QFDB 3MRKB 3MOBL 4H7VA 4YHZL 2CMRL 3VH8B 1E2VA 5IROA 1CFBA 4KI5C 3TV3L 1GCFA 1F1DA 2C9QA 4J23A 3RTQC 3VXMA 4B9FA 2AERT 1I1YB 1A3RL 4YFEA 4F8NA 4PJGB 3O8XC 4L2YA 5KVMC 2XUWA 3NCJL 3RPIB 4BK8A 2CHDA 4WU7B 5J56B 1CDUA 4DTGH 4U1JB 1AGEB 2X4RA 4ELME 2GT9A 2D2OA 4ZS6D 4Q0XL 2VABA 1RZQA 3K74B 5HHQB 2XKSA 3PP3K 4HF5L 4U6YA 4HA1A 3IGKA 2TRYA 4NUPA 1BWWA 2VJ8A 4UM8A 4NEHB 4PJGF 3QDJB 3NIFB 4JO3L 4KKRA 4XPHH 4X7DC 2IXQB 3S8FB 2YD1A 4WVRA 2LVCA 2X6VA 5DVOA 1PKQA 5BJTA 2B39A 1WITA 1P4IH 2DOCA 4WTZA 4ONGL 3PYCA 1KLUB 5GRWA 2Z91B 5H37H 3F65A 2Y3NA 4HZ1A 4JPKL 1S7WB 2R0ZH 2G75B 1S5HA 3KDMA 2VW6A 1I3VA 3CFUA 1RUKL 4XOEA 1KC5L 4FFZH 4RA0C 3J8F7 4AC2A 1ZA6B 1XZ0A 5BRZB 1JF1A 1NMBH 3PQYE 4TVPE 1C5CL 1CT8B 3BKJH 4HUVB 3MLVL 2XQYK 1HIML 4X5PA 2OI9B 5HHOD 3HS8A 1QPXA 4ZMNA 1A66A 1E2ZA 1X5KA 5CGBA 1Y07A 1ZOXA 3MA9H 3EJRA 3N06B 3OZLA 2Z65C 4Z3GA 3RIAK 3QXDA 1U3YA 2IALB 4YAQA 2CKBH 3BDYH 2AK4A 4JPVL 3J07A 3V6ZB 4BFOA 3CFEA 4P46D 4A37A 2K9FB 4GIPD 3UO1H 5JXED 4KRPC 3FDWA 1F5WA 1XR8A 3D06A 3KL3A 3UTSE 5J4MA 4AT6A 4DVRL 5C0JB 3T0EE 3PABB 3CLEH 2CO4A 5I1IL 3KPPB 2YLKA 4JM4H 2JNZA 4LSSH 4WEBH 4CN4A 4GKLA 5DK0B 4N2LA 3W11D 4J3OH 2BW4A 3H6AA 4AYID 1O7DC 3FT4A 1BVOA 5I1KH 4OZHB 3IJEB 1K6QL 4J6RL 1B0RA 4P9HH 1S5IL 1LK3H 4PJIE 5E0QA 3FSVA 2ODIA 1ZT7B 5ICXA 3FRPB 1KN4L 1SM3L 5C7ZA 4O9HL 4APQD 4NN6B 4UM9B 4UIKL 5C08D 3KVQA 2XXMB 3VRJA 3AXLB 3MOQA 3BI9X 4HFWB 3EGXA 4LHUD 2DJ4A 3OKDA 1NPNA 4PY8I 3UPRA 2AVGA 4MJ2A 3X13B 4BFBD 1U8JA 4LSUH 1KFAH 3BCDA 3G5WA 3V0VA 1PEZA 3QQDA 5B1BB 5EZOL 1YY8B 3BFQG 3B37A 1HYSC 1K8IB 4JM2D 5K9JL 1X7TA 5AG8A 5E5MA 4WJ5A 1EX0A 1I1YA 2J56A 1MCBA 5JOPE 2V7NB 3CFBB 3RPIA 3STLB 3MFFB 4WU7A 4XVUC 2ALWA 3FHQA 3FQXB 4GT0A 1Q72L 4CAGA 1BMWA 1AGEA 4X8CA 1M9WA 4ODSL 2G5UA 1AGFB 1G6RA 3NTCL 1RZ7L 3PGDA 4CN6A 4ONFL 1JNHB 3HI6H 4FZEH 1E3XA 3B34A 1KEGL 1OF2B 3KYMA 1PZUB 4W9JC 2MPVA 4GRMA 2P52A 4FG6D 4NERA 5D71L 4PJ9D 2C1OB 5IHWA 4TOYL 2XG4B 3QDJA 1D3CA 2CJUL 2EEBA 1FIEA 1QPPA 1UKTA 2LU5A 4L8SB 4WUKL 2O6CA 3AU1B 5I16B 1YEGL 1JUFB 2VIRB 3E6HB 2N3JA 2F8OA 2PP7A 1JGLL 4GW5B 2WVVB 1KLUA 3SPJA 3VFUB 3QIWD 1ZLDA 2DQCL 1NAKL 3QCTL 1F90L 4KX8A 4KROD 4N8CH 2ADFH 2FQFA 2NNRA 1DE4B 5FYLH 1A4KA 1E27B 2BH0A 2G75A 1KBKA 2JB6B 4UT6A 5HVGB 1G7MA 4ZX5A 5BW7A 43CAB 2XNAA 2VLJE 2YRZA 3C6LB 4HIEA 3ARQA 4O4YH 1V7NL 1MCNA 2LFEA 1T6BX 2XYBA 3HOGA 3HN3A 2LU3A 1PQZB 5BRZA 5T3XH 2I85A 3RWHB 4AENB 1NGYA 2YRLA 3W9DA 2WAQA 2QMKA 3L17A 4OCYH 4JQIA 4U33A 4LARH 2A0LC 1T4KB 3JUZA 2IBZY 3HI1B 1FGVL 2K1MA 2WWKT 3J7HA 2WUCL 3P30L 3Q01A 2GY7B 1PIFA 4MRCA 4XPBL 3V6ZA 4NQCA 2ZX5A 4J3XA 1IKOP 5E8EB 3PWUB 1HDMA 2E9IA 4XBEH 2WP3O 1EBPA 3NCXA 4M1CD 4OLZH 1X5IA 2AAAA 3DVIA 3K0YA 3EYSH 1CXFA 4PVNA 5J3HD 4O58L 2WWMD 1MW1A 4LLYB 1M7IB 1A6AB 2BOLA 1L7IL 3IT8D 5A2KH 3H9YA 1GA2A 3PQYB 4K94L 4TQEL 2G4EA 4OCXH 1RV6X 4L3EA 2G5BA 3GSWB 4QT5B 4PSRA 4OZHA 1QFUH 3BP7B 3IJEA 3QA3B 3X11B 3MLSH 3VSTA 1ZT7A 3MA7B 4JO2H 3IPFA 1CD0A 3FQNB 3FRPA 3V6OA 3NSDA 3C5JB 2R23B 2V9TA 1YEKH 4JKKA 3GPSA 5C8JB 4EE2A 1N12A 1FYTA 3AXLA 5F9AC 4TS6A 5DUPL 3QFJA 1UH4A 2UVFA 3A0OA 5EO1B 4HOWA 1JRHH 1JPFB 4QTHB 4UYQA 4YDNA 3GSRB 4LLQB 3OAYK 4X0NA 4CDHA 4ZOAA 4YDKH 4PBWD 5AW3B 1T83A 4EI5C 2HKFH 1OK0A 1K8IA 2ICWB 1IKNC 2YS4A 5DC0A 2HSIA 2VZ1A 3HN5A 1XD0A 4UBDD 1RURL 4HEPG 1DCEA 3ZTJH 4PWKA 2YFOA 3CFBA 4DWHA 3IF1B 5JHBA 1N5YH 5AOJA 5AQ0A 1W72L 1L0QA 1P2CB 4K7PH 1X7SA 4JCLA 4HAGA 1YSOA 4LASL 3WN5C 3NZ8A 1D6VL 3FTYA 4I18A 3D52A 1JNHA 1M3IA 3MBED 3HTLX 1KBGL 3QIUB 4M43H 4QRPE 5F7LB 3JQOB 4PGBB 3OB0K 3N1QC 4YHYC 1BZ8A 4ABWA 4RMRA 5EF0A 5JDJA 3FSOA 1AZRA 3ZQXA 2XG4A 1FVDA 5AAMA 1E4HA 4WQOA 5TE6L 3VD0A 4L8SA 2QSQA 1KWGA 1I8AA 2OX5B 5IMLB 1FA4A 1TR7A 3AU1A 3V4VH 1ZHKA 1JUFA 2VIRA 3TWCL 2GK2A 2DIBA 4F1ZA 4DKTA 3K6SB 2FE0A 4LSTL 4QMEA 3WEOA 3VFUA 1JP5A 4MBOA 3O45A 3N40F 4OCWL 2VSMB 4ZS6C 3N41B 5BS0E 4DUWA 3SYAA 5CEZL 2XQBL 4X83A 3C6LA 4E9VA 5DRNA 5IWLC 1DQMH 3MODL 3O6KH 4Q9BA 4RLDA 1NCCH 1R3HA 4N26A 3RKDC 5DEZA 1PQZA 3RWHA 2H32H 3OLEA 4LO9A 3DX6B 4BRJA 4ZZFA 4W6YB 1HXYA 4FG2A 2B5IC 3KMDA 4PJFE 3WKQA 5C86A 4L05A 3QR1A 3NA4A 4AWJC 2OMVA 3HZMB 4RMWA 3N41F 4I48A 4Z0XA 1UENA 3RY6A 4YGVA 4I4WB 4NZDA 2YHGA 1EPFA 3O41A 2HRGA 3DVNB 4P04A 4D0DA 2H2PD 3HE6B 4NAMA 1IGIL 5B3JF 2F74A 1BJMA 4PMFA 1F3RB 5E8EA 5KTEL 3BQUA 1F3DH 2ZYSA 3PWUA 3UIZA 3OAWA 1Z66A 3HG1E 4DOHE 2WLKA 3UEQA 5L2KE 2Z93A 1V05A 1FH2A 4KKLD 4S0SD 4L0ZA 5I0XA 1YN6B 4MZRA 4GKNB 2BINA 1A6AA 1RU9H 3QO1B 4GBXB 3PQYA 1YEIL 2GHZA 2WUBL 1WA2X 2A6JB 4FNSA 4ODBD 1VB9A 4WDIA 4KHXH 2J1YA 4WO4B 3X11A 3IJ8A 4KK8C 1HFUA 3H2WA 1OT2A 3RIKA 5HP5A 5JXEC 1ZK9A 3FO9B 3C5JA 1H3PH 3I2CH 4ZDHA 4LOFA 1I85A 1IQDB 2AJXH 2VSCA 4N0YL 3SQOH 5IQ9A 4LHUG 4Q2ZA 3WO4C 1LWJA 2NX5B 2DQHL 1HC1A 3QC6X 4YQXH 3UTSA 3JWDC 4MMZC 4QY8A 1JPFA 1OK8A 5C09E 3R7QA 1N19A 5BNXD 1J11A 1M6UA 1YNLL 4LLQA 2WV3A 1QATA 4G42A 5B4MC 3BVUA 1YEJH 2APWA 2X2HA 1DTUA 1FNEB 1RUPH 4FQXD 4XBPA 4NIKB 4A67A 4Q6IB 5DHDA 3MZGB 2XWBB 2OFQA 4KI5E 2A4ZA 1M7DB 2ICWA 4IU2B 3RA7H 4X6DE 3GSQA 1N68A 4F58H 2VR8A 3TJHC 4TUOA 3S35X 2VO5A 4PJIA 4JUSA 2VJXA 3LXUX 1H3WM 5C0AE 5JUEH 2XWZA 3BVXA 1I9RL 1WIUA 3P0YL 4B9JA 4IBZA 2A2QT 3LRSA 4U2YA 5IB4A 1TOXA 2VISB 1J1PH 3LXAA 4A7UA 4CGTA 4PJ5B 2YZ8A 2E8ZA 4G9DB 3MRMB 2VL5B 2UXTA 4GKSA 2RALA 3TH3T 1CXEA 1ICTA 2DICA 3QIUA 3T2OA 4ATWA 1UCTA 1DJGA 3AS0A 4GMSL 3I3BA 4Y16B 1D5MA 3ZE0E 3WLBB 1D9KC 4OLUH 4Z9KB 2IPTH 1IFHH 4W4OC 5IMLA 5D5MF 2LAGB 1TO4A 2G2RB 4GI9A 2WXMA 5TQ2H 5KW9L 5IF0B 1YG9A 1AQ8A 3VX0A 4M7LH 4G70B 5I24A 3U7WL 1T1XB 2PCFB 5FO7B 5BMFL 3MLUH 4PGCB 2E75C 5D7JC 2XIIA 5HDBB 4W4NA 5DA0B 4KDWA 3ZDYE 2WXJA 1XT5A 2QLYA 2ZUWA 1L0XA 3WNJA 4FG6C 3EF7A 4U1KA 4PJ9C 1NGZB 2VDPH 3FF7A 2GBTA 4AMWA 3CLFL 2X70A 1BGXH 2BZDA 3KPSD 2B59B 4NHUB 4YHIB 3TO4D 2XTJB 2YLHA 3U4KA 2IH9A 2VH5H 3B5GA 4UDUB 1F58L 2A9ML 5F9OH 4FNPA 1KGCE 3VRIA 3CSBA 1IAIM 5K59E 2DM7A 2CUMA 3BIKB 4Y9GA 3D18B 1W0WA 2CXGA 5BZWA 1QEXA 4RIRB 3QIWC 4ZXBD 1F8TL 1MQKH 2YC1B 1CXLA 3QI9D 4KROC 3BD4A 5F1SA 4E0RB 1ZHLA 4R4BB 2WIMA 1WSST 5IW1A 4M4PA 2VL4A 2YQ2A 2DI8A 4RGMC 5CEZD 4I3SH 2FT8A 4M9OA 3DX8A 2PO6D 1MELA 2P5EB 5D7IE 5C0IB 4UV7L 1PD6A 1NCOA 4GKNA 2EZ0D 4DFIA 2HH0H 3GB7A 3QO1A 4MJID 1O7DE 3JV4B 2NY5H 3DTDA 4WV1A 3VXUE 2ED7A 5KSBE 5C0DB 4LVHC 1GMIA 1KBVA 1LWHA 3DO4A 4UZGA 4PYGA 4PUBL 5KVEL 1IFRA 4UDTB 3MRGA 2QELA 4U6VH 3KZ8A 2QZQA 4PREA 4QHKI 1KTLA 1GTFA 2IH3B 2NX5A 4FQCL 4EVNB 3SN6N 2WXPA 1OPGH 3UH8A 3I50L 4HUUA 4LKCB 3D39E 4F2ME 1INEH 1TZ8A 3H4FA 4FQ2L 3W0WE 5LKNA 5F7WC 1QLEB 2OZNA 4YC2C 4PRAA 4HBCH 1HJBC 3F6IA 1DJSA 4Q6IA 2OAAA 4R84A 4WK0B 3I9PA 4IU2A 1PS3A 2F5BH 3UG3A 4FZ8L 1XWVA 3TIDA 2HLEB 5HHXL 3VFMA 1B9KA 1ZMYA 3GBNH 2QADB 3AG3B 4Y88A 5K1JA 3RGVB 3GZPA 4AIEA 2WXNA 2NLJB 5SWSE 3D9AH 5AZEL 3QB7C 1DO5A 1INDL 1T1ZA 4PJ5A 1KGWA 3L9RA 3CLWA 4G9DA 5C0CB 1OP5H 4OLYL 2VL5A 4OI9A 4FLHA 4Z7WB 1ROWA 1E67A 1QNZH 2NYKA 5K1VA 4X4XB 2BFVH 2H0FA 3ARFB 4MKMA 3NQIA 1A21A 4LEXH 5IQ7L 4P0DA 4ENED 1PAMA 2A73A 4Y16A 4ZMVA 5JW5B 4UBDC 1MCIA 3KLKA 4XXCA 5DD3L 1CD1A 1NEZB 1KG0B 4FEMA 4IHOB 4GH7B 2Y0SA 5ALBH 1AHKA 2JCCE 1DQLL 1JI1A 2GC7C 1HILB 3VQ2C 1WZ1L 4M5SA 1U2HA 2EDBA 5E6SB 2B1AH 4PGCA 1XX9C 1LO0H 1JSYA 1KB5H 2E7HA 2EDHA 4HJIA 4QRPA 1NGZA 1QSZA 5C3IA 5EZLA 3EXJA 2OCJA 1UB6B 1J10A 3ROLA 3M17B 1U95B 4GAGH 4MJ4A 3B6SB 3CDZA 5F7AA 5T3ZE 4XN5A 3PJLA 1R5IB 4UDUA 2XPGB 5C6WH 1KPVA 1QO3B 2F8IA 2EYRB 2PNDA 2NYZA 3CSGA 1XSOA 2BIPA 3A5VA 3BIKA 2PCPA 2WBKA 5F0JB 1U8OB 3TA3D 4RIRA 5JIMA 2AXFB 3REVA 3GUTB 2VKWA 2YC1A 3NIGB 4OZGE 4E0RA 1NC2B 4OCMC 3QUYA 5E4AA 5AWNH 3IXAB 4HJGA 5SWZB 1KLGA 1FBIH 1UJTA 5LWYL 3ZTDC 2CLZA 3GI8L 4NPKA 1AY1L 3H7BA 3EDFA 4PWEA 3O4LB 2L7QA 4IRSD 1KV3A 3G9VA 4XC3L 1ZLVH 4LAJH 3JTSB 3FU7B 2V3FA 3NIGF 2ZOUA 3EH5B 5IK3B 1CG9B 4AQ8A 1S7RA 3PP4L 4R2GC 5JHDB 3HI5L 3HMXH 4PJFA 1DLFL 1UURA 4DW2H 2KLSA 5C0DA 3QDHA 3RVTD 3EOYG 4AGOA 3VD4A 1IU1A 4XZUA 2R1WB 1GYAA 2RH0A 4X5XA 1RZKH 4UDTA 2OMYB 1E4XI 4DIXA 1Z9SA 1RY7B 2I60L 2IH3A 1RLBA 3DXAD 2PF6A 2Q5BA 2WBJC 1GYUA 3D3VD 4OFVA 3GMOB 5E7FA 3V6FB 1JPTH 4KKLC 4EVNA 3ZKQD 1BBJA 3ZKNC 3B9KD 3QWOB 3HG1A 1BM7A 3RZCC 1LQBC 3MJGX 1OLZA 2XBDA 2WKGA 2OTUB 1X3DA 4H8QA 4P2OB 4YDJA 5G4OA 5LCVL 3U83A 3ZW3A 5JHAA 1OAXL 4H8PA 5DJ8A 2DQTH 3ARBB 4A7VA 3PAUA 2UXFA 4XAWH 3WXVH 1IM9A 3ARGD 1M05A 3TESA 2YXWA 4LFHG 3U6XA 4LMQE 5FCUL 5HHPA 4GUCA 3SYOA 5IJKA 1TZGL 4RISH 5JZ7C 1CGYA 2UY6B 1FO0B 4S1QH 1S9XB 2ESVD 1SMOA 1IC1A 3GBDA 5JMOC 2DKUA 2ICWI 2E59A 4X5WB 3AT9A 1LO2L 5J89A 4Z7WA 1DQVA 1XR9B 5CN1A 4KWUA 5C09A 5BO1H 4FQXC 3B7TA 1EHKB 1IBDA 2QPFA 3CZGA 2YD7A 1N4XH 4H25A 4BQ6A 3QQ9C 3WKNA 1NFIB 1X9UA 1XCTB 1Q9LB 3DRTB 2EYTA 3GXIA 3IETB 3O9WD 4WFHD 1YNKL 1OAZL 1RZGB 3SDYH 3ECBB 4KZDH 3TH4T 3QHFH 1M7UA 2P48B 5MEQB 1KG0A 4IHOA 3RVXC 4KMTH 1QUPA 4ES9A 4LXFA 5AG9A 1QBAA 3DO3A 1NL0H 3BPNC 1HILA 4WI5A 1MN4A 5C0AA 2CDGA 1EZLA 3N91A 5HGDB 1PLGL 2FUQA 5FO8A 3KYAA 2UZXB 3CFMA 2BS71 3EGDA 2VXSL 4NNXB 4DKDC 5IMKA 4UIMB 1OARH 2HKHL 1KLFB 1WZMA 2VDMH 3H42H 5EZPA 3UTQA 4NJ9H 1JZ4A 4EI6A 2BS8A 3D4YA 1UB6A 4NENB 2XQYG 3M17A 3HAEH 1SLUA 3B6SA 4U3CA 3BPLB 4YX2H 3S7GA 3DOSB 4IS6B 2ZYHA 2FO4B 4PJCB 1R5IA 1A6UL 1LEGA 4Z77A 2XPGA 1ZTXE 1CE1L 4FNRA 5GRVL 2MQGA 2UZYB 2FIKA 1MY7A 4YSUA 2ZX9A 1DP0A 3CBJB 2GAZB 3G7TA 2AJZB 3KW8A 4NZ8A 4UOQA 1P9MC 1DQJA 4H8VA 3RURA 1N0XH 5G55A 2BJMH 3P77B 3D2TA 3GLEA 3MRDB 4OVVA 3C09B 2A6IB 4HPOH 3IRZA 3RFZC 3L5XL 4M4RB 3GXNA 4N8VA 5DI8B 1OGAB 1M71B 5CCJA 3GMRA 5HHOE 2XLLA 3KWTA 5GGRA 4J3SA 5IK3A 1CK0L 3VFVA 1CG9A 4B9CA 5EBMB 1CDYA 3WIHL 3DV6B 3GDCA 4ZXBC 4YSRA 1TO5A 2AABL 4NBYB 4F7PB 5FA3B 1HCFX 1NDGB 3CC5B 2X7LB 2R1WA 3NZSA 4AEEA 1BZ9B 2IAND 2NNAA 2YD6A 5SX4H 4LU5L 3PNRB 4RH4A 1CL7H 3U0PA 2OR9L 4WENB 2RAMA 2EZ0C 1X5ZA 1HYRC 3TCLA 3GSNB 1NWPA 2VWEC 1VKXA 2VRAA 1HS6A 4KFZC 3S4SB 3D85B 3E8VA 4N2OA 4P99A 3I3EA 1WPCA 3WTXA 1A7QL 5CJBA 4PLOB 4GY4A 2F1BA 3QXAB 2FO8A 4HMCA 4MB3A 5B3SB 4M5YH 4YZWA 4BQBA 3LVEA 4RFNB 2HCZX 4K8RH 5KSBA 5C08E 2UY7A 2YRPA 4JFZL 1I8LC 3B2DC 2J2ZB 2UY6A 4G6FD 4RWYL 2VQ4A 2DH2A 3H54A 1FGNH 2Y22A 5BV7B 1J5CA 4M61A 4OBRA 1N5AB 1QRNB 1NFDF 5HHMD 4HC1L 4L3AA 4X4KA 4BIKA 4YUEH 2YO3A 1KPUA 5MEND 4F2MA 3ZY7A 4OJAA 2R4SL 3MRLB 3LV3A 4MNHA 2JJVA 2X89D 1NFIA 1ZHNA 3HG4A 3V5DB 3GHBL 4R5TA 5ID0A 4WI9A 4Y2NA 5EOQL 1RZGA 3OKOB 4MVBC 3ECBA 2ISDA 4ANXA 4CKVX 2J43A 5A2JH 4UAOB 4IBVA 4TNVF 2PWHA 1F3JB 1HQ4B 4MA7H 3UL4A 3VD3A 5T1LD 2DQDH 2EH8L 4NRXA 4F37K 3PWJA 1VPOL 2PYED 1X44A 4LCVA 1AG6A 3FJTA 5F8RC 4G8IB 2UZXA 5SWSA 4E68A 3S5YA 3FPYA 3SDDB 3R4RA 3T0VA 2X3AA 1PL3A 1SOQA 5IB2B 2ROYA 3CFQA 3GNMH 4MAYD 1FI8C 3MXVH 1W9XA 3TWYA 3C60A 4DP2X 4DTGL 5C07B 1TQTA 4RX4D 4TYUA 4ENEC 5E1IA 4J3WA 3T1FA 2PW2B 4XNQA 3DYPA 2Z3FA 3MRFA 3CFIC 2OZ4A 1M1XA 3D8MA 12E8H 3FQWB 4RFEB 4WWOA 1R3KA 3QDGD 5FK9A 3U30B 5I5RA 2I32A 3BAYA 4P5MB 4J28A 4MS8C 4TUJB 2JCCA 3MRBB 4EUPG 3FYEB 4XPHL 2AJZA 3K72B 3OZ9H 4NQXA 4LLDB 4QHNA 4U1LB 1G5GA 3UAJD 4OCRH 2MJWA 4OLWH 1HAWA 5EU5B 1P4IL 3P77A 5SV3A 3CSYB 1T0NB 3L54A 4KKPA 3O81A 3MRDA 1WA0X 3MLZL 3OG6B 3JV5A 5E5UB 3PWLA 3UABA 5DI8A 2R0ZL 1I75A 5CJXC 1MRFH 1I3UA 4LLVA 1HKFA 5E23A 5TGBB 3CHRA 1VFAB 5EBMA 5E1HB 3WMSA 4FFZL 1IVLA 4LRNH 1OANA 2IV9A 3M07A 4J1UA 2NTFA 3N04A 1NMBL 4JG9A 4X8XA 4MBRA 3TFBA 5FA3A 1U2YA 2BNQE 4I0PD 3BKJL 3IDYB 3CC5A 2LW3A 3DIVA 4Y8AA 3BWUF 3MA9L 4GQZA 4IK6A 1M2OA 5HVHC 3SPIA 1A1OB 4AUYA 4RFOH 2CKBL 3FUFA 4IRSC 3BDYL 4Y5YB 3T2NL 3FOLB 1L3WA 3DNKA 3L3IA 3GSNA 3UO1L 5DS1A 2B4CH 4G5ZH 2O30A 2CHZA 3S4SA 3L9EA 3D85A 5EULV 2R1XA 3W2DH 3IFOB 4K2UH 1ILUA 4A68A 3RLSA 1ZA3B 2IQ9H 4NZRH 2XYCA 1ZVYA 1U58A 2Z8SA 2EUXA 2DY2A 4JM4L 5GGQH 4LSSL 1NCBL 1YEFH 4WEBL 5I8EA 3CSTA 1UZ6E 8FABB 4OZIE 4P59H 4ACPA 4NZTH 5I1KL 1CYWA 1CJYA 3DMMA 2AKRB 4PR5B 1TQCC 4P9HL 2OMZB 1LK3L 5HGHA 4NP4H 4F9LC 3B9KC 1NUDA 4ZUSB 4AGPA 4HU8A 1F3DJ 1QRNA 4WSJA 5AKRA 3B2PA 2P46B 5D93C 1IFGA 4N2HA 2RA1A 3P9LB 4P3CH 1CFTB 3WFCH 3V5DA 4Y1TA 4HUXA 2HUHA 2JIXD 3ARGC 4JRYD 4LSUL 4ZMWA 1KFAL 4QAMB 2J8OA 4U1HB 1L9QA 1KSRA 4HJSA 4AEIH 2UX6A 1FNHA 2D3VA 3IFPB 4PJEE 4ZNEE 3H56A 1JZ3A 4ANVA 1RQ5A 1BVNT 3SGDI 2GUYA 1NUFA 3OR6A 1T7YA 4DAGH 3OHXB 3DIDA 3LXCA 4HWZA 4GAAA 3G3LA 3KLDA 1FFOA 3SDDA 1J9SA 2EDFA 1KTDB 1G7PB 3D0VB 3QW9A 4BSWB 2O6DA 1TQBB 4QTIH 3KPRB 4ODHL 1UKSA 2I07A 3L3KB 4UMSA 1HWWA 5B1JA 3W39B 5C07A 3BAWA 4F91B 3MV8D 5KVFH 1NKRA 3MRJB 4Z7NB 3O9WC 1DBJH 2VSDA 3HI6L 4P2AA 4FZEL 4GT7A 4QGYA 4RFEA 4CMMB 1URIA 4P5MA 3DROB 3PWVB 5H94A 2X4PA 4F7KA 4Z76B 4OM1H 3K72A 4C55A 4LLDA 1ZVNA 2Z0UA 4U1LA 1MH5A 3GQFA 2CDFB 1BEYH 5JR1H 2JB5H 3KVPA 4Y9EA 5I8KH 3DJZA 2OK0L 2PWDA 2HUEA 1KWKA 4YL9A 2RD0A 1E5ZA 2QSVA 1E8WA 1N8ZB 2WTRA 1IMHC 4N8CL 5FYLL 3SKOB 4H0HB 3MGAA 4TVSa 3HRPA 5I1CH 3SKNB 4R83A 5D1ZB 5TGBA 4E9YA 5JA8B 4AG4H 1TTUA 1VFAA 4OGQC 1AD9A 2DMHA 4O4YL 5C0FB 3KPTA 5T3XL 5TH2A 4APXB 1HOEA 2AV7B 4OTXH 5FYJH 3X1FA 4X9YA 2JTYA 3NJNA 3MJ9A 4ISVB 4OCYL 4LARL 1EA9C 4N2IA 3UMNA 4K9EH 2FWOA 2HFTA 2N0MA 4Y4FD 4DZ8A 2H26B 1AC6A 1A6VH 1O9VA 4ZUUB 3NIDE 3WIAA 3UDWA 1T3FA 2WO2B 5J9PA 4GRWH 1ZSHA 4N0FB 2VAAB 5HHVL 2R2CA 1OP4A 4LVNC 4U7SA 3CZFB 3AG2B 3QJFB 1PZAA 1QSFB 4XBEL 3IFOA 5D6DC 1R0AH 5HHOA 5AVWB 4OLZL 5HGBB 2HVKB 3U2SB 3P2BA 2EXWD 3EYSL 2P45B 3BZ5A 4W81A 1F4YL 5BUAA 2X44D 8FABA 2VQ1A 1ADWA 1SMAA 4P46A 2BNQB 3KGSA 1QFUL 4ZTOH 2X0UA 2OMZA 3MLSL 3VXRD 2Z4QB 3MYJB 3OB8A 4JO2L 4ZUSA 4Z3HA 3REWA 1N6VA 3TYFB 5C0EB 1ZE3C 1YEKL 2O5XH 3L1GA 3P9LA 4N87A 1CC3A 1CFTA 3VCLA 1XQ4A 3WNIA 4KKZA 2Y36H 1ZDSA 4J2XA 2Y5TA 4KNSA 1CMOA 1JRHL 5F97E 3NDYE 4JY4A 2COVD 5D6CB 5DHVB 4ODXB 1T7WA 3VFWB 5I1AB 3MGTB 1BMZA 4YDKL 3IFPA 4APQA 3CFJB 4J3OD 3SCMD 3KJ4B 3UAEA 4OZIB 2HKFL 3K46A 3LRKA 3H55A 2NR6A 3HLAB 4HK3J 5DFTA 1ETJA 3ECVA 2J5LB 4KJWC 3V0HA 5E6RB 3QHTC 4LCYA 3NCWA 3L6FB 1NEPA 3FU6A 5L9DH 4BSWA 1G7PA 3CVHB 3D0VA 5IBLD 1ACYH 3KPRA 3WS6C 3E3QE 4NI6A 3CIQA 4OZFG 1U93B 3L3KA 4UOJA 3W39A 3MCLH 3X3GH 1C7SA 4PVLA 5JO5B 3QG6A 3MRJA 4JFOB 1EBAA 4JM2A 3TJPA 4PP1C 4KBPA 1E6JH 1JV2A 2IH1A 2Y23A 3A4DA 4M43L 4UQDA 3R0NA 3V5KB 2XN9B 4BWTA 1HHIB 1H8NA 2NY1D 5LDSA 1GC1L 4KDTA 3ABZA 3AM8A 3QEQB 2PR9A 3CE1A 5L6YH 1THCA 5DZPA 3WFBH 3V4VL 3Q8FA 4LP8A 4MAYC 3MKKA 1TCMA 4AJWA 3CG8A 1AMXA 1UEYA 4J8RB 2JKTM 2TRHA 5DUJA 3KPSE 2D7TH 4OD3H 1N8ZA 3BLPX 2B1HH 1GTNA 3SKOA 2BCMA 2Z8WC 2ITDA 2ZWNA 3U7YH 1L4IA 2PR4H 3SKNA 3G08B 1ZV2A 2K6WA 3QBTB 4NUGH 3QPQD 4UTBH 4HLEA 3EHBC 3DSNB 1G9NH 3K2IA 4HDIB 5F1OB 4L1TA 1DQML 3O6KL 1NCCL 5C2BH 4APXA 4YNYB 2FGWH 4X98B 5LAXB 4HKBB 1RVFH 3B2VH 3G6AA 5EU7E 4ISVA 4FJYA 4CADB 1MKFA 2Q3AA 1K5NB 4IGBD 4PLKD 4V2CB 3R7RA 4QJ4B 5CEZE 4GQRA 2APBA 1RERA 2Y6TE 5IBTL 5E8PB 4ZUUA 1OW0A 1QFWH 1UATA 4MA3A 2VAAA 3TCTA 3U4AA 2EDTA 4MJIE 4R3SB 1L9PA 1UZGA 2VWEE 3QJFA 2J55A 2X42A 5IEHB 5FYLD 4NM4H 4IDJH 3RP1A 3HC4H 5I6MA 5HGBA 4MDRA 1OQXA 2V9RA 3DSFH 3SE3C 3HBGA 5T3XD 1VGKB 4WHYG 4WZ9A 1H6FA 1RU9L 3RDJA 2X4UB 2FH8A 5J11B 2BNQA 4HCFA 4R0LC 1JG9A 4MNQD 1R3LB 1A2YB 4JQIH 5HJ3B 4KHXL 5I17A 1KIUA 3QUXD 1LE9B 3N6YA 5D7LB 1SN0A 1GGCH 4PJBB 2BHYA 4CRPA 1VADB 1S7XA 1H3PL 2JJTA 3I2CL 2LGNA 5LG1A 4HCRL 3EYUH 2AJXL 4Z7IA 3SQOL 4ZO6A 2ETWA 1QI5A 1TTFA 2EYSB 3RUGB 5EEVA 3QJZA 4YQXL 3VG9C 3FH5A 1LILA 1JZ6A 4ZZKA 4JG0H 2GITB 3NFNA 4GAFB 4D3CH 1YEJL 4JKNA 3VFWA 2YKLH 3MGTA 5FX3A 1RUPL 3CFJA 3GJFB 2WAHA 4OZIA 1KENH 2VMEA 1P4UA 2UZIH 3Q5YA 2K8QA 3RA7L 2QDVA 4M6NH 4F58L 2LAAA 2EEFA 3HVNA 3WHE1 2X4OA 1PNCA 1JVLA 5GHWH 1Y1UA 2XBTA 4L3FA 1GL4B 3CVHA 5GS1A 5JUEL 2VJ0A 1A7OH 1LP9E 1OP3H 4LMQI 1AACA 1J1PL 2NCMA 3FSAA 3MVSA 2MFNA 1XCWA 3S36H 4AE0A 1EO5A 4UZUA 1CDHA 1XH1A 4JFOA 2A1WH 4NUJB 1U21A 3P1VA 5BQDA 2IAAC 4HS8H 4W6XB 2VW7A 3L4UA 4YSDA 4R26H 1YEHH 4LPUA 4PRNA 2XN9A 4ZNEA 4PJEA 4YHNB 1L7TL 1EWHA 3KH3A 2CRZA 4OLUL 3ILQD 2IPTL 1IFHL 5GS3A 2V4LA 3BJLA 5E8OB 3KWUA 3ZIYA 2YEZA 3STBA 5CBAB 2CRYA 4H8WC 1IBGH 3VTMA 5KYYA 1BZQK 5TQ2L 1FJ1B 4GXUN 1BF2A 2LABA 3MBEA 4F9PC 4M7LL 1URZA 4J8RA 3MLUL 2VZ3A 2E7LC 4K07A 2DTMH 1DN0A 5CZKA 3SGKA 5GIRA 3LZOA 3AY4A 2CRIA 1E4WH 3QC5X 4HDIA 2VDPL 1EMTH 1WCQA 1BGXL 2Y7SA 3JSSA 1U8LB 5EOCH 4AQAA 4YNYA 1PZ2A 4CU6A 3QS3A 5LAXA 3VFTB 4HKBA 2VH5L 4DK6A 1KYFA 4P23A 3I6GA 3MCKA 1K5NA 3V9EA 1I9JH 2BSSA 4JREB 4S1DD 3DI3B 1MQKL 5KBMA 2AV1A 2FK9A 2ZKXA 1FL5A 2EJ1A 5H37G 1MJ7H 1QRKA 3NCYP 1T5WB 2AQSA 1CLCA 4TQHA 3WCYA 1N9PA 1W0VB 1OP9A 5KJRH 5ACLA 3BRDA 5CSZB 4KMQA 2V5TA 5D2NE 2H6OA 2HPOA 2ZD0A 1H15A 1DBAH 3G5ZA 4LSVH 1BHGA 3T09A 4HZAA 5CR8A 1VGKA 2HT4C 4JPSA 5F3FA 4IMLA 5CN3A 5FOBB 1NCTA 1I1AD 5D1XC 4Y4FC 5KBNC 2AC0A 1R3LA 4BRVA 2ROXA 3DXAE 3IJHA 2JQMA 3D3VE 5AVUB 5FUCE 5CD3A 1ZT1B 2NY5L 3BZFB 5L88H 2HRLA 4PJBA 2IG2H 2DWDB 4OW6A 4MXQD 3FT3B 4U6VL 3L5JA 2DMCA 3CCHA 1EEQA 4OSUH 2ATAA 2OMUB 4AMXA 1JAEA 5TK2A 3WBDA 4FS0A 3RUGA 2FD6H 2KQNA 4GO9A 5HD8D 4EDWH 2F2HA 4PVBA 2R1YA 3OSKA 3RI5K 1BBDL 2OJZH 2PWFA 4HX1A 4U1SB 2PCYA 4XMKH 4BJLA 3T0DA 4KXCA 4HBCL 4J3OG 4NQSB 5G5DB 5KVEE 2LFGA 2WQVA 3H3BC 3U0WH 1KXTA 3Q48A 3QIBD 4FQ1L 1MLBB 2F5BL 5FO9B 3S2AA 5I6PA 3VGAB 2DQIH 2HJFB 3VE0B 4P2QB 5HY9B 4HETA 4AL8C 3F12A 5CEYA 4MS6A 1O9ZA 3P4MB 4RRPA 4FQXA 3D9AL 1EH9A 5JPMC 2MTPA 4OD2A 3MR9B 1REIA 4WFHE 3GIVB 3FO1A 4ELMF 5JHLA 1LD9B 2J8UB 1B0GB 2DWXA 3IPEA 1FPTH 2BFVL 4J3OC 3VWKB 1ILSA 2E9JA 4G7RB 5ITFB 2WSPA 4LEXL 4E5XB 2AJVH 2PCXA 4H8UA 1IEBB 3VFRB 4P9HC 1PGRB 2HLFD 4BCXA 5E8OA 1LE5B 3MLWH 5CBAA 1RSFA 3PXLA 2VQUA 5ALBL 4I7ZC 2J8UF 1HK6A 3F7VA 5CF3A 2F58H 5FEBA 2KDGA 3ZDZE 3O6FD 3B5HA 2B1AL 1CF8H 1M57B 1UJ3A 2IPUK 1LO0L 3NPSB 2QGEA 5DJXB 4WI4A 5F96L 1KB5L 1MI5D 3Q0HA 3KHQA 1NIDA 5JHMA 1GS6X 2NY1C 2MIZA 4V1DD 4GAGL 1XV8A 1EJOH 2QV2A 2QFPA 3QAZC 1DN2A 1G4RA 3LH2H 4PY8J 4E9QA 1W72A 2E9GA 2K0RA 2XCMC 2Q86B 3NRFA 3VQLA 4XN9A 5HYEA 1ORQB 1U92A 2CR6A 5F7EH 4HKZB 5DK2A 1G9EA 3D6GA 4GRLC 4QLWA 1PF3A 3BW9B 1AXTH 3ZYIA 4WW2B 2M83A 5AWNL 1ZLUH 3TO4A 4F7EA 2BSEA 2O5YH 2XQYA 5DHYA 4UQEA 2APFA 1FBIL 4FKHA 3ARVA 4Y7MA 3LNIA 5D1QB 1OY3B 3MV9D 5FA4B 4HIPA 2D31B 3K4DA 4KQ3H 2V5RA 1CVSC 3X3FH 3MRNB 4N1EA 4PJ8B 4IIQB 3RX9A 3U6RA 2GTWB 3QI9A 4TM9A 3TJEH 4IGBC 2IANE 4PLKC 4MYWB 3VFOB 5IMOA 3RWIB 3UGEA 4MJ5B 5E00B 1VEOA 1BSIA 3HMXL 1ZT1A 3BZFA 4FLOA 4DW2L 2IAMB 6TAAA 4MA8L 2PO6A 1MAKA 4Z78A 1P5UA 2PW1A 3L3GA 2DWDA 1RZKL 2ADIA 5JDSA 3AXIA 1K5WA 2XTLA 5KYXB 2OMUA 4XODA 1Y18B 5E2JA 4IBWA 3QQ4B 5IUCA 1JPTL 4EKXA 3LKNA 5D2NB 5GS2D 5FHBH 3ZZ1A 2H7WA 2OMXB 3GBMH 2KZBA 2WINB 3EFOB 4FL4C 3MCG1 1YAIA 4U1SA 4CNIA 1A25A 1T5XB 1YQVL 1AXSB 2N1KA 4NQSA 4WFFE 4PFEA 2DQTL 3HBQA 3TTSA 2ENPA 4XAWL 3WXVL 3QUXC 2ED6A 3MUJA 1IC5L 1A9BB 4IBLT 4P06A 5HHME 3T6XA 5C9JA 3KYNB 4ZPVB 3BT2L 2W0PA 5MENE 4AM0Q 2MPAL 3ULUC 4JFYB 3ILDA 4BBWA 2VDLB 2HMIC 5IUSA 3IDJA 4NKMB 4RISL 5I66B 4IEFB 3WDHA 4CC4A 3MRIA 5IJVA 1G1KA 4S1QL 4RAHA 2XWDA 4JFDB 5I75C 5IHUH 5AVYB 1P6FA 3ZSSA 1GZQB 3OMIB 1GIGH 4ONOA 2WGXA 1X5JA 1BFVH 4FX5A 4N0RA 1QQDB 4JDZA 5BO1L 4O2FB 3VWKA 2YGVA 4ZMYA 2AQ1A 2ICEA 3LPWA 1N4XL 4UQ3B 3ZE2B 3I6KB 2C3HA 2PYEE 3DWTA 2GIMA 2J6EA 4JO4H 4A6YB 2JQAA 5ESVB 3EYVB 3T2PA 3SDYL 4JJHA 4RETB 1LE5A 1SFHA 3QHFL 2YUZA 4BWUA 3ZTJG 1UFGA 1ET7A 1U8IB 3JTTA 3NZUA 4KMTL 1XB3A 1RHHB 1NL0L 2HFEA 1BOGB 4JVPA 1LP9A 4GPVA 1AP2B 4YHKH 3FT0A 5JMRA 25C8H 1FV1B 3ZE2F 1MHHA 2ZICA 1MFAH 3E1F1 4E9XA 4Z8FH 5KSAB 2G9HA 1T22B 5E4EC 2B7DT 4NQUA 4D7BA 35C8L 3QDGE 1OARL 2VDML 5F89A 3H42L 4QRFA 2BVPB 3L48A 4NJ9L 1DVTA 1E8YA 5GGTA 4GG8B 4S1SH 3ILQC 1OTTD 4UB0H 1A0QH 4KJPC 2FNBA 4YX2L 2VR4A 4XRCB 2ZWYA 3FOMA 5F1NB 3B1UA 4YSPA 3T3PF 4JUTA 4N4YB 1Q94A 3RDTD 1LEIB 4AC4A 1ZGLB 3LS4H 4B6ZA 1MHEA 4PBXA 4YXHH 1AJ7H 1KPRA 3H9ZA 3I85A 1Y6MR 3S36X 4BSJA 3BW9A 1RZ8A 1RZIB 4WW2A 3VMOA 1PX3A 1I3RB 1MSPA 2ZWSA 4LVOB 1N0XL 5B38G 4XP4H 3WY4A 2BJML 4PV8A 5EIIG 2MOVA 4JFTA 1JHLH 4PG9A 5FA4A 1ES0A 2VZTA 3QJUB 3X14A 2D31A 3UIYA 1TNMA 1ZRUA 5I18H 4HPOL 2XZZA 3LPPA 4L29B 2EUVA 3TA3A 1MFDH 3IDNA 4QHMA 3RNKA 4NX0A 4IQHA 2ZUTA 1M56B 4BGDA 3OBAA 3R18A 4LCWB 3VFOA 1KULA 2VC2B 4M03A 3ABGA 1QD0A 5E00A 1IUZA 3BAIA 4PW3A 4S1DC 1L6ZA 1S7QB 1XIWB 3FTGB 3TXAA 2X4QB 1SLXA 3ZU8A 1H19A 1RUQH 4G11A 4HS3B 2H3XC 1FFNB 2APXA 2JXMB 1LGVA 3BVTA 4WLCA 4BDVB 3AS2A 3PG2A 3CDGB 3V4PB 4AW4A 4JMXA 4LPVA 5KYXA 5AOKA 5ICYB 3MRRB 2GEEA 4U6HB 1EZSA 1CL7L 2VITA 1OALA 5D2NA 5FW8A 1UB5A 4GG6B 4WK2B 2WINA 1EHLL 5GZOA 3QEHA 3BX7C 1CICB 1OZUA 1WUZA 2XFXA 3P4OB 4RMBA 3HR5B 3PXJA 5K9KA 3SBQA 1XTMA 3RWJB 3RKPA 2WXKA 3GZKA 5DUML 4GKZA 1LO4H 2ZOLB 3D3VA 4M5YL 5AVVB 2BP8B 1BZDA 3BGFB 1A9BA 4ZFOL 1NKOA 4K8RL 4MXQC 4ZPVA 3LN5B 5TDNB 4D8OA 3FTVA 4KKAC 3EDKA 4NCDA 4GG6F 2O61B 5AVTB 4MA1C 5TDPB 2BOCB 4PRID 4JFDA 4YHMH 5EFIA 4JRYE 1FGNL 2AJ3B 4H40A 1GW0A 3F7YB 3KDPB 4OJEH 4NBZB 1Z5HA 2JKRM 4YUEL 1GMEA 4A55A 2W07B 1V10A 4O2FA 3WFEH 3X1EA 3IM1A 4HV8B 1NGXB 3W56A 1HWHB 4B5ZA 3RVUC 3I6KA 1X7QB 1BLNA 1ERNA 4A6YA 6FABH 3HE7B 1JTPA 3VXTB 3IS1X 5ESVA 3EYVA 4NWTL 3VXNA 1A02N 4QXWA 1M1SA 1QACA 5I6KA 4OCLC 2WLIB 1XGTB 1ITCA 3VGDA 4MA7L 1BOGA 2DQDL 2EC8A 5DQJB 3UJIL 3MV8E 2FATH 3QAQA 2XZQH 4P4RB 3WLWC 4N0UB 3PJSB 1NBYB 1QA9B 3D4GA 4I77H 2JMRA 2KLTA 3GNML 2A3TA 3MXVL 3HUJF 1TZHB 3F62A 3RIFK 3ZL4H 1KJVB 3LSOB 3QXVA 2AQNA 2FL5B 3CBKB 4FHKA 4GG8A 2WB7A 4OGAD 2CRMA 3EGSA 3K1DA 5FS5A 5HYQB 4QRRB 3LMJH 2YUWA 2YUVA 4BKSC 12E8L 3Q3GB 3GBLA 5KG9B 1XSIA 3KCWA 3KWWA 4NNYA 3PF2A 1ZGLA 3KM2A 4P4KB 2A9BA 4Z3IA 1OHQA 2D0HA 3OKEA 3OZ9L 1OD7A 2WQ8A 2G9KA 2EEXA 2PXYD 1MW3A 4OCRL 1I3RA 4OLWL 4F80A 4U3HA 1J9QA 5EBWA 1AS8A 1HHKB 2WQSA 1F45A 1H5BB 2A6KB 1B2WH 3JVFC 3BKMH 4L29A 3WL9B 4ZSOE 4OT1L 5BRQA 3DURA 4XXDA 1MRFL 1B4RA 4X7FC 2DZEA 2M1KA 3K6IA 2FT7A 3JZYA 5DRXB 1T6WA 2Z7YA 2GSMB 1FZOB 1XF2B 2MCPH 4XBGB 4LRNL 2P49B 3P3UA 1XIWA 3FTGA 1U4EA 4CKQA 1U33A 2X4QA 3WN6A 4HIXH 4UQCA 4ALAH 4B27A 5E0FA 2DEYX 4HS3A 3RTQB 1UCBH 2JXMA 4JY5H 3CDGA 3V4PA 4L1DA 3O8XB 3T2LA 4U6HA 1T5KA 4RFOL 2ZWKA 4RCAA 3EDEA 4H0IA 4UTAA 1HNFA 2EVHA 3GIZH 4HJ0D 3K2MC 4PRBA 2E74C 2XICA 2B4CL 3CDCA 3O6MH 2B9AA 2QV4A 4G5ZL 4LEBA 3W2DL 5C7XH 4C54A 3DVFA 4K2UL 2VKXA 3T3MB 4KI5F 3L9BA 2VDRB 3V5HB 2IANA 3QR2A 3VXRE 1PVHA 2IQ9L 4NZRL 3HB3C 4X6DF 4PGJA 1NCHA 3GSXA 1VLXA 3QNXB 1P7KA 1CQKA 5GGQL 1YEFL 2EIZA 2QPEB 4QR7A 1NPJA 5BXFA 4PWJA 3LN5A 4U7KA 4P59L 3WFDH 2XV0A 4OQ1A 3SDAD 3CMOL 4G3YH 3P54A 5CP7B 5TDPA 2BOCA 3WXWL 2AJYH 2JJSA 4NP4L 2AJ3A 3VI3E 2OTWB 3T3MF 3RZWA 5K5YA 5FFLA 4ICWA 2YIHA 1OSPH 3MRQA 2W07A 2CJTA 4P3CL 1NGXA 1U3HD 2Z8RA 4U6XA 2W59A 1QSED 1X7QA 4MXVE 2LLGA 3WFCL 1YEEH 1SMDA 4L3CA 1T0OA 2NY5C 3HE7A 4HLJA 3VXTA 3OLIA 4FXGA 5KJ4A 5EF1A 4AK2A 5CZXD 1T1WB 3IXTA 4BQCA 3ZR6A 4AEIL 2FR4A 4K8RD 1DDHA 5MENA 3II2A 4JFSA 4OB5H 5LCVA 4JFPB 4DAGL 2EO9A 1D5IH 3FTZA 2UXGA 4P4RA 3SE6A 1FO0H 4NQEB 3PJSA 3CHQA 5ACMA 2HT2D 4PJXB 3VXSB 1UEMA 2IPKA 5F72S 2WNKA 2XDHA 3HS0A 4R5XA 5AB0A 4WW1A 3MX0B 1OZTG 1KJVA 3LSOA 5KVFL 3DPBA 1NDTA 4KRPB 4HAFA 2BMKA 1DBJL 2PYEA 3IFNL 3H9SB 1OAYH 4HIHA 3VTTA 3LRGA 4LSQH 4NO3B 2WVSA 5KG9A 3UBHA 1B9ZA 1SJMA 4HOXA 5DZAA 2HRPH 4PJXF 2NUPB 5K59F 5AW0B 2BC4A 1DJYA 3FULA 4EQ2A 4LDOB 2IOMA 3MLRH 4HLZH 1BIHA 2FX9H 4FFWC 1RJZA 1YYCA 2AXGB 5LN8A 1BEYL 2C9VA 5JR1L 2JB5L 1SYVA 1RJCA 2J73A 5KYUB 3KD4A 4KQ4H 5I8KL 2BERA 2DWTA 1AKJD 2A6KA 1OP3K 3KLHC 5D7IF 1KACB 1ZLSH 5IFHH 1MCOH 3VWJB 5HYJE 1CZ8H 1ZIBA 1W8OA 4U1GC 5I1CL 3RDTC 2QQLH 3UAJA 3VFNA 3ERXA 5DRXA 4ZQKB 4JQVC 4KV5E 1FZOA 3VA2C 3EO9H 2GW5A 4HISA 1Z32X 5TJWK 1DQIA 1OAJA 4NB7A 1CGSL 3SKMB 4HXBH 3L7FA 3O3DB 3PNWA 1IC4H 5KS9E 5FYLE 1P5VA 4XBMA 4K9EL 4OKDA 3HC0B 1XCXA 1IGYB 3KNBB 4L8BB 2NW2A 2Q8AL 1KXVA 4U4IA 1U8KA 3IN2A 5F3HB 1A6VL 3RB7A 3IDXH 4K3JH 1C08B 5C0GB 1UG9A 5T3XE 4G9FE 2BP0B 4AV4A 1CUOA 1ZHBA 2O72A 1FNGB 4I0PA 5J6HB 1R0AL 4NYLB 3QO0A 2GUOB 2LV4A 3DYOA 4S2SA 3V5HA 4XCYB 1JMZA 1Z7JA 4JO8A 1KZYA 1U8QA 2Y5EA 3QNXA 3OJDA 3WUWG 4FFYH 1XF5B 2AEWA 3QDMB 1A9EB 1SXAA 3KPLB 2IIJA 3LZQA 4BFJA 2XJLA 4ZTOL 3EBIA 1MXGA 1I1RA 1WT5A 2E76C 3QZWB 4G8GD 3MACH 3US1A 2ZYIA 5FFGA 3RHWF 3F3HA 2EP6A 1IGFH 2OTWA 2XT1B 3VQMA 4CL7A 5IJBC 3ECWA 4M93B 3DKHA 3T4YB 3GSNH 2O5ZH 1CDCA 3BHBA 2Y36L 1CF1A 3P0GB 1H6TA 3ZTCC 1BFTA 2JLPA 4ZFGH 3AABA 4PJDB 2ZF8A 1ITBB 3P4NA 2V8MA 3FO2B 2Z31B 2EE2A 4S1RH 1AR2A 1CDGA 2OA9A 2EKJA 2EDKA 3TNNB 1UASA 1ML0A 1G1YA 2D03L 2XZAH 5DD6B 4JFXA 4OM0H 5IB3B 3AJ7A 3V79C 3GTNA 4L4TB 2WQWA 4L9DA 5BV7H 5INDB 1NBQA 1YYLH 4JRYA 4OKVB 5L9DL 1ACYL 3G04A 5L8JB 1W8EA 1H3VA 3FFOA 3F00A 3ZMRA 1NKGA 3ULAB 3BZEA 5MP6H 4Q4EA 1ECYA 1F6LL 2VR3A 3MCLL 4Z3TA 3X3GL 4RGNB 4FHJA 4WFGD 2WQRA 1OAUH 1WJ3A 2R83A 4B5EA 5CN2A 5AENA 5GSRA 1E6JL 4M1DH 4B9ZA 4BE6A 3NCFB 4ZK8A 5CFHA 1UQSB 4HC1A 5HDQH 2F54D 3ZZSA 5TQ0L 3HZVB 5H2BA 4OZGF 3MV8A 5TD4A 1G7QA 1A4JB 4UQBA 3K2UH 4H8HA 4PTUB 5DJDB 5DC9B 3UYOD 5L6YL 1MAMH 3WFBL 4I85A 1KJ2B 5KN5B 2AXGA 4LCCB 2DIJA 1QWUA 4QCIB 1WZLA 5KYUA 1KYUA 3AREC 3QZOA 2HJKB 2WKOF 4X99B 2D7TL 4OD3L 2OMNA 1AO7D 2B1HL 4XMPH 3LZFH 5CO1A 2A6DB 5K39B 1SGKA 2XV2A 5SX5H 3HAEG 3VWJA 3BWZA 3U7YL 1Q4NX 2PR4L 4OGXH 4UQ2A 4NUGL 2ICWJ 4MDIB 4UTBL 1QASA 2DWEB 1G9NL 3TO2B 1KB9J 2AEQH 5C2BL 1JPEA 2FGWL 3UG5A 4WY7H 4WRLA 4BINA 4LPTA 4XPGH 1RVFL 3B2VL 2PXYC 3VXMD 2A9DA 2NY3C 3HNSH 4AM0B 4PGEB 1AFVL 2NNFA 3HC0A 3BQVA 1KB9K 2IO5A 1W8NA 2R2EA 2P26A 5F3HA 1I1FB 5T33H 1QFWL 2YN5A 4D0CB 1C08A 4ACTA 1GGYA 3HZ3A 1AIFA 3MNVA 1IM3D 4KAQH 3O2DA 4NM8H 2YD9A 2BP0A 5B39B 4ZSOA 3GKWH 1FNGA 4NM4L 5JOFB 2XWTA 4JJ5A 5DWUH 5HYJB 2GTZA 4NPYB 3BT0A 3HC4L 3PDGA 3WHXA 4JHVA 4NYLA 1SDDA 3DSFL 1IAMA 4YDVA 1M4KA 1MZYA 3ALWA 1V3JA 4YHYB 3BVWA 2G0LA 5K69A 4ZMQA 1WBYA 4UCFA 3VW3H 4KUCF 2VN3A 2X9WA 5SV4A 1CIDA 1E8ZA 3QZWA 3ZZQA 3S3SA 4G8EB 1T66C 3FRUB 1JYVA 4NKOA 4R4NC 5KUKA 3B2UC 1GGCL 2DWSA 4S11A 4HJ0C 2YAQA 1X4YA 1SNRA 4FFZA 4Z5RB 4QUOA 2YOCA 5AYUL 1XXDC 3EYUL 3PHSA 2BS9A 4X6EA 4IYKA 4KVCH 5ACZA 1ZLUK 2I9TA 1YUKB 1CBVH 5KYWA 1HEZB 1G87A 1R46A 1ETZB 4PJDA 4P5TB 3DX3A 5DJ2B 2MCAA 2E7MA 1FC2D 3VXRA 3FO2A 5ES4B 5ENWA 4D3CL 1WWWX 4WK4B 3DBSA 1BXUA 2YKLL 3SDAC 1AANA 2CKBA 1F11A 4N2DA 1A5FH 1KGIA 3DI2B 2I9LB 2UZIL 4KZEH 5DD6A 4FQIH 2B5IB 2IPUG 2Y72A 4M6NL 2VERN 4L4TA 1PSKH 2VB5A 3KW7A 2BVEA 5INDA 2ZF9A 3C5ZB 3S3JA 4JO1H 3VI3A 1A7OL 3QHZH 1PBYA 1U3HC 4N85A 5E6ID 1VGEH 1UUNA 3SCMA 4N2FA 3S36L 4FA8A 3VDBA 2A1WL 2EIEA 5DUBA 5KSVA 3KG5A 2C3WA 5CZXC 1J0HA 3KS0J 5IEKB 4LSPH 4HS8L 3SPCA 4E9RA 4K8RC 4R7DA 3UAFA 3ZDXE 2XBZA 1YEHL 4R26L 4XWOD 1M53A 2E47A 2EDRA 3QXWA 3VGEA 3LIZA 4PJ7B 3VFPA 4DESA 1RP9A 3P4LA 3HZVA 3S97C 2HT2C 1J05B 2WP3T 2RIKA 2ICCA 1OGSA 3Q8CA 4LEEA 3E2HC 4YO0B 2CLVB 3IMSA 3OR7A 4HH9B 1MI5E 3F04A 3GHPA 4LCCA 1NJ9A 5F1KC 4QCIA 2AJUH 2PN5A 3ATAA 4Z7VE 2XV3A 1E4JA 3CHOA 4U1NA 2BVOB 4Y5VC 4R97C 1YDPB 4NKDB 2W38A 4X99A 2CA4A 4J3TA 4V1DE 3WO4B 2A6DA 2FQEA 2MWCA 2DTML 3OKYA 4FKEA 5EIQA 5K39A 4PJ7F 3L3OB 1VDGA 4MDIA 2X88A 3LKSA 2YD4A 1E4WL 3TO2A 4K7FB 5CGMA 2VDNB 4QKXB 5EOCL 3NDZE 2EICA 2O6FA 3FQ4A 4R9HA 3UO8B 3DV4B 4AM0A 1Q0XH 1FZJB 5MEPA 2KBGA 1I9JL 4QOKB 2V5MA 3MV9E 3D1MC 4NQDB 5DSCB 4XMUA 4OFIA 4EOWH 3WG7B 4NAJA 3QUMB 5DRWA 5GSVB 4D0CA 4Z7OB 1LJMA 1MJ7L 4LHUB 3UPAA 2RR3A 4YHZH 3WOVA 1K8DB 2ZOKB 5LNEA 3C87A 3EFFA 3O2VL 4PB0H 3TV3H 5B39A 5JOFA 5KJRL 3SE9H 4RRPM 3GWJA 4NPYA 5HYJA 5B8CC 1VZIA 3NJXA 4B50A 3ARYA 3MNZA 3O3UN 1A6WL 1DBAL 1AS6A 1YPZB 4LSVL 3NJIA 4X7CC 1HQRA 3GUFA 4OUUA 1TUPA 4UUJB 1MFCH 3G5VA 4FMVA 1GHFH 3MLXH 3QDJD 3BP5B 5ESAB 2HJLB 3WNPA 4BSVA 1D9KB 4BELD 1HL9A 4Z7OF 1NM9A 3OX8A 2FBJH 5L88L 1JDCA 3WELA 3N1MC 5LJYH 3GSUB 4G8EA 3FRUA 5GS0H 2NY0C 4ZI8A 1AHMA 3HCVB 2IG2L 1L9MA 4TNEA 4NC2B 3SO5A 4Z5RA 4WI3A 1GYWA 3T2QA 4WEUD 4G9FA 4OSUL 5D7EA 3V7AG 3A4EA 5D7JB 3RU8L 3S34H 4BQ8A 2FYVA 1WO2A 4MMXC 4EDWL 4P5TA 3S3BB 3UPCA 1IGJB 3MPCA 4OIIH 5DJ2A 4AQZA 3PUCA 4UNIA 2OJZL 1AG0A 4YIQA 2ZXBA 4XMKL 3OXRA 5BRZD 3U0WL 4J7RA 2IQAA 3EYQD 4TUUA 5HI5D 2I9LA 2PKDA 2NQ3A 3K3QA 4LAQL 1SY6A 2ZTBA 4XP5L 4QNPE 5EDXA 4Z3FA 2DQIL 2QSTA 3FT9A 4IMKC 3MYZA 3RRQA 3C5ZA 3JV6B 1RUKH 2HYMA 3HKFA 5E2WH 2B4CC 4KROB 1PZCA 4EZKA 2JFCA 3OWRA 5LNGA 1MAJA 3TBSB 1U3NA 1PAZA 2F0CA 2WZAA 4YSCA 3CUPA 4RGMB 5M7QA 1CQYA 5EBLB 1L9TA 3GO1H 3QCVH 4MCZB 2GI0A 1FPTL 4XAKE 4JZOA 1C5DB 4X6CE 4XVSH 5DHVH 4PW4A 3RQ3A 3BCFA 4LEOB 4MX7B 4BFIA 1E43A 4DKEH 3KPNB 4FD0A 4AYSA 1MDAA 1I53A 5FDWB 4E2OA 3IDMB 5DFWH 3H85A 1J05A 3QRGH 1I9EA 5IB1A 3PY9A 1DVUA 3NFPA 4HH9A 3CVHH 2E27H 3GPEA 2F58L 4UM9D 3NA9H 5EUOB 3P9MB 4NKDA 3LEXB 3WD5L 1CDBA 1FYTD 4JFFE 1CF8L 4XXWC 2Y9RT 4N5UA 4MQ7A 1F18A 2H3KA 3DTXA 3L3OA 3ZKMD 3FB7B 3GSVB 5EOTB 4DGVH 2CO6B 1OTSD 2YD5A 4K7FA 3ZDXB 1WV7T 4YC2B 3FU3A 4O9HH 1BDYA 1UH2A 2VR6A 1AS7A 2FEDD 1EJOL 2V2TB 4LF3A 4L1BA 1QFHA 3LH2L 1I7UA 2WXIA 1FZJA 2DMBA 2BXZA 2UYLB 4XO8A 5F7EL 4JLRB 5GGVH 3QUMA 2DTSA 2W1NA 1AXTL 2CIIA 5CUSH 4ONHB 4ZBJA 1AQKH 3KXFE 3L4YA 2O5YL 1D5BA 5ANHA 3LN4A 5TDOA 4N28A 3V4VA 3WS3A 4H4NA 5J57B 1WFOA 4KQ3L 1YPZA 1TYJA 5HI4D 5IROC 2J1WA 4UUJA 3MUHL 4L9LB 1BAGA 1NGQH 4H26B 2NZIA 4YPJA 3TJEL 4LGRB 3BP5A 3LHAA 3Q43A 2HJLA 4HXAH 3BUIA 1NBZB 2HN7B 4CMHB 2OP4H 1MHCA 1JZEA 2ADJA 1EHXA 4LPCA 3MRHA 1RK1A 3VI4E 5F1IA 1BD2B 4GSDH 5EIIA 3HCVA 1BJ1H 4WTZG 1KEGH 2WN3A 3EOTH 1J1XH 5J1AB 5DZNA 2CIKA 3AS3A 3C12A 4F5CE 1I1AA 2CJUH 1TVHA 4YEEA 3U2JA 5FHBL 1D7CA 3G6DH 3C6LD 1YEGH 3GBML 4FYSA 4G7YH 5GRYA 3C8KB 3WY3A 3FO0H 2OXHB 3F01A 5H35B 3H9HB 4PRIE 3QCTH 4LVEA 2WNXA 3BP4B 5SWQB 2F53B 5BPPA 1SXNA 2ZWZA 2BOBB 2P24B 4OUOA 4LLWB 5D4JA 1TSHA 3PV6A 5F93C 5IM7A 3T0BA 2AI0H 3A6OA 5T5NG 5AL8A 3RVVD 3OXSB 4YWGH 3TC9A 4B41A 5IHUL 3TBSA 4AEFA 3QIBA 1AHWB 1GIGL 4X0KA 1JZ2A 5EBLA 1BFVL 4MCZA 2DL9A 4LQ1A 1CE6A 2BXYA 2LVEA 4NC0B 3U36A 1XMWA 3VVVA 5IZ7A 4RAUA 3DBXB 3UYRL 2IBBA 2X4SA 3KPNA 3GJFH 3PE9A 5AALA 4EN3B 3PQYD 3CVCA 4JO4L 2GBVA 4YR6A 2E6JA 5FDWA 5JORA 3ATDA 4HCRA 4A2DA 4R2GB 1X5GA 5CZVH 4KH9A 4N1CA 1X5AA 3EG9A 2OL3B 2XN1A 3KPMB 3P11L 2NY2D 1CLVA 5D72H 1YEDA 4YHKL 1T04B 25C8L 4PRDA 5BUPA 1P6AB 1AI1H 4K94H 4TQEH 1MFAL 2ZUVA 3NEXA 5ANME 4UOW0 2WBJB 3ZT7A 5JHLH 5E24E 3E0GA 3R0MA 4NO2B 3RZCB 3GSVA 4JAMA 2BDNH 4KVNH 3FNKA 3OMZA 2FDBP 4S1SL 4KX9A 4UB0L 1FL6A 1A0QL 4MD5A 4GLRH 1DYZA 2V2TA 1HEJC 3O6FA 5HGGS 2HVJA 3Q05A 3A6BH 3UCQA 1BZEA 1ET5A 3CN0A 3LS4L 5JPNA 4YXHL 1A14H 4MRBA 1RFDH 4JLRA 1AJ7L 2P4AB 4XMXA 2OLDA 1CI3M 5FLUA 4V1DA 2QHLA 4ONHA 3GHEH 3VYOA 2VMFA 4XP4L 2WIIA 3RILA 3FONB 4BKTC 3TOPA 4ANWA 3L4WA 2CUAA 1BX2B 2WJ5A 2E9WA 3A23A 2N1TE 4HG4J 4YSQA 3GLZA 5JA9A 5L4MA 3QIUD 4OJDH 1QHOA 2P8LA 3BGMA 3KE0A 1MFDL 4L9LA 2WSKA 5E6ZA 1RI8A 4H26A 4UNUA 3SPHA 4JKPL 4BZ2H 5CEXB 3C8DA 1KBWA 1W72H 4K5MA 2YGOA 4HG4K 1NCJA 1S9YB 2EXYD 2FAUA 1RZPA 1RUQL 5DVPA 3ALXA 1KEMH 2OYMA 4JFQA 4J2QA 4KJYB 5D7HA 2W5PA 3CH8A 4K73A 2BNRB 1P53A 1C12A 1ZS8B 2F15A 2CCWA 5DK3A 2OXGB 5D4HA 4EXKA 1DVQA 3NCMA 3ECQA 3C8KA 1X5YA 1XD1A 2AMUA 3APDA 4BXVA 5H35A 5A7EA 1U8MB 3H9HA 1HT6A 3VNYA 5JQHC 2N56A 1LO4L 3DGGB 4DEWA 1FCCA 4IOFD 1NFKA 2F7OA 1LMKA 3ARXA 2BOBA 4FFTA 4P3DB 5IQNA 4LLWA 1QSEE 4XNAA 5LHDA 3HE6D 3TYGH 1SDAB 4OF3A 3OXSA 4R7NB 4YHML 4WUUE 5EU4B 5BW7C 3IMBA 1AHWA 4WWKB 3UYPA 4I89A 5GRJL 4YSTA 2ZCKH 2XG5A 2ZSWB 5G2NA 3WFEL 1SEQH 1ZLWK 1QLEL 1JWUA 5HI5C 4L1HA 4XB8A 2BZCA 2MOQA 1T0MA 2AEOA 2EC9U 3BE1H 2X1XR 4GBXD 4KTDH 2OI9C 4X4ZA 4EN3A 2WLJA 5GGSB 6FABL 5JLZB 1E5BA 3LQZB 1NCIA 3AG4B 3AMLA 4WO4D 2MHAB 1JBJA 2HG5A 4Y4HB 4KJQD 3FRPG 2OL3A 4MJHA 4AZ8A 4KFMA 3FQYA 2V5YA 4XMTA 4JGNA 3O6LH 2FATL 2FLBT 4C47A 1T04A 3ZDWA 2JV6A 4I77L 3AADB 2FX7L 4DGUA 2NX5D 2F8VA 1MLCA 2WUBH 2IFFH 2DDQH 1FLRH 4AQEA 1P6WA 3RIAF 3NGBB 1JRHI 4X6CA 3ZL4L 3FUIA 2WMPB 4MSWA 2ZXAA 3TBYB 2C5DC 2B14A 1QSVA 2J6EH 3ILPB 3LMJL 1W15A 5FOJA 3QUZB 1XF1A 1WG3A 3MNMA 1J5HA 3V6OC 4LRIA 4RMSA 4NN6C 1QR4A 5F9DC 4PY7A 2CPUA 4LOEA 3F7KA 4NAQA 5DS8B 2WN2A 4HJUA 4W9LC 3U36B 1Z9MA 4PJ5D 5E1AB 4JFFA 2JWYA 3ZQWA 4HWBA 4NRZB 5EU6B 3FONA 5I5IA 1OTSC 5I73C 1Z2KA 4MQXD 4ETQA 1XB6A 1CTMA 3HPJA 4HIJA 1B2WL 3JYBA 3BKML 1T83C 4ZNCD 2R59A 5GGTH 1CIUA 5CEXA 4Y16D 5EEZA 1PCSA 1WQVT 3Q8BA 3VRLF 3VAEA 2KERA 3L2NA 3FTSA 4JRLA 2QGBA 3WEMA 1ORSB 2MCPL 1OAQH 2YA0A 3NAAH 5EV7A 2HTKD 2G0KA 3BXNB 1S9YA 4EJ1C 4HIXL 1LLAA 4ALAL 5TF1H 4GI6A 1MF2L 4M8QA 1UCBL 4JY5L 1DHKA 4CVZB 5DO8A 2VLLB 3T77B 2X2UA 3NJMA 5C9KA 4A38A 4C83B 3KXFA 4I18C 1NLBH 4FOMA 4Z1PA 1ZS8A 1AZUA 1M6OB 1H6EA 2PPEA 3CDFA 5HI4C 3T1WA 2VMDA 1XGPA 3GIZL 5KW9H 1IAKB 4BFGA 1XFPA 1ZPUA 4H2AA 5AAMC 5C7XL 2VR5A 2RQ8A 4K5LA 2O5NA 4L8SC 5SX5K 2XTJD 3BSGA 4G8GE 4HIIB 5TK4A 4ZD3H 3MUZ1 3C5SB 2NDGA 3HW7A 1FIGH 5F6HJ 2G60H 2GIXA 2CH8A 3DGGA 1NC4B 2WSDA 1U41A 3COOA 4XO9A 5T1KB 1N64H 1OE2A 4P3DA 3WFDL 5F9JA 2XKUA 4XB3A 1AQDB 1JL8A 4G3YL 3V7AE 3QUYD 1PZBA 5I9QB 2AJYL 3LRHA 4R7NA 5EU4A 2Q76B 1KNOB 3C6LC 4WWKA 3M86A 3P2TA 4BFEA 4KH2A 4ES8A 2WANA 3HMXA 3HBPA 32C2A 4JHAH 1OSPL 1BQSA 2P5ED 5FF6A 1QNIA 2B3IA 3JWNE 2CR0A 3N42B 3B56A 3CFDB 5EDSA 5E99L 1YEEL 3HBZA 3Q7JA 2LHAA 3M1OA 3KGRA 2FJGB 5JLZA 2VR7A 3TTYA 3VMPA 4FABH 3RY6C 2XXCB 2X38A 2GJ6B 4Y4HA 4QYOA 1D7FA 2FRGP 4XVJH 2X2YA 3S88H 1GGBH 1JGEB 1A7NH 4OB5L 1NOFA 4N6RB 1ID2A 1ZEAH 4UV7H 1A1NB 2F1EA 2PTTA 3BQUC 1FO0L 3ZPDA 1U3JA 3BPCB 1H0DB 3ORJA 1Z3RA 4WUUB 3X17A 3WUZA 5IR1A 4C8XA 3DUUA 3HG1D 1KUMA 3BN3B 3SY0A 4WKXA 2F54E 1UM5H 2OMWA 1INQA 3LKPB 3CPUA 2K4AA 4QXTA 3HR6A 2A9CA 3TBYA 1OAYL 4OD1L 4A6YH 4LSQL 3L95A 4PJHE 4Q8BA 3WEXB 3QUZA 1A7PH 3HS9A 5IVXB 3UTZB 1YJDH 2HRPL 2NY2C 3RX7A 2A74A 3EKCA 1J12A 2WYTA 3NACH 5E2VH 2QADD 3WI9A 1FG2A 1I85C 1QW9A 3BESR 5KVFE 3WFZA 3EJPA 1AO7E 2VO8A 3C08H 1PTZA 2QR0A 2FX9L 3RGVD 5TE7H 4L8CB 5JIKA 3SPVA 2YGQA 2XA8H 5DS2A 5ANMA 4NRZA 4OAWB 4KQ4L 5EU6A 5C0CD 3TBVA 5CHNB 5D93B 1T7XA 1JPSH 1QYGH 3ARFD 3F5WB 1ZLSL 2MOGA 1MCOL 1GOGA 5HYSB 3WY1A 2ZQKA 1CZ8L 3P69A 4ZOBA 5E03A 3VXME 2OBGA 4A2LA 2QQLL 2UVEA 1U8CB 5F0MB 3MNDA 3LJ3A 1AGBB 3GSOB 4D8PB 1QBLH 1Q1JH 3EO9L 3MRPA 4ZFFB 1KDIA 1FHGA 3BEVB 3LH9A 5PCYA 2YARA 4HXBL 4CUCA 1IC4L 1A4AA 4G43A 4CVZA 3T77A 2ZAIA 4CU7A 2MCMA 1U91B 1E50A 3HAEA 4C83A