2E4FA

Crystal structure of the cytoplasmic domain of g-protein-gated inward rectifier potassium channel kir3.2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
201
structure length
191
Chain Sequence
b'IQRYVRKDGKCNVHHGNAETLVFSTHAVISMRDGKLCLMFRVGDLRIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLGFYEVDYNSFHETYETSTPSLSAKELAELANRAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G protein-activated inward rectifier potassium channel 2
publication title Structural Diversity in the Cytoplasmic Region of G Protein-Gated Inward Rectifier K+ Channels
pubmed rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 38
structure length 191
sequence length 201
ec nomenclature
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 2e4fA00
3AT8A 3SPIA 1U4FA 3SPCA 2X6CA 3JYCA 2E4FA 3ATEA 3SYPA 2WLIA 2WLMA 3SPJA 3ATBA 2WLLA 2WLHA 3AUWB 1N9PA 3ATAA 3SYQA 1U4EA 2WLIB 2WLNA 2WLJA 2WLKA 1P7BA 2WLLB 3K6NA 3ATDA 4KFMA 3SYOA 1XL6A 4LP8A 1XL4A 3SPHA 2GIXA 2X6BA 3SYAA 3ZRSA 2QKSA 3AGWA 5KUMA 3ATFA 3VSQA 3SYCA 3SPGA 5KUKA 3AT9A 2X6AA
chains in the Genus database with same CATH superfamily
4A2HA 3DURB 4L1HA 3KLLA 3LQZA 4L29B 2JB5L 2F53D 3TXAA 4Z8FH 1EBPA 2VT0A 1O75A 2BJMH 1JZ8A 2QBWA 4PJEE 3LQZB 4K23H 3T6ZA 3U6RB 2YRLA 5K39A 5HHVH 5KSBA 4IRJC 2CJUH 4UQAA 1ADQL 4HMCA 2C1OA 5EFIB 1HSBB 3FU9A 2LU3A 2OTWA 5IREA 2H8PA 1MRDH 5KSBB 4OF6A 4U49A 5A7EA 3HFMH 1UACH 2C1OB 4BWWA 4NO3A 4CADB 1JP5A 5C0AD 5GGQH 5ETUA 1F41A 1UWEH 2H8PB 3RX8A 5FW6A 4BDVB 5EC2B 5H2BB 1S5IL 4UM9B 4NPKA 2E56A 4NO3B 2XTJC 4WEUD 1NWOA 3UTSD 4UOJA 2EYSA 1TIUA 2GJZA 3KBEA 5GS3A 4HIJB 2BFVL 3QEGL 4XVJH 2HFEB 5DDHB 1KY7A 2QSQA 4XXWC 2ZOTA 2R2CA 4R4BB 1XGPB 3ML9A 1QSEA 1S8DA 2HWZH 2OCJA 1PFOA 3HC4H 1BD2E 3SDAD 2NSMA 3VMOA 4HZAA 3O4LA 3MOAL 4RVBA 1P4BL 5K59E 5TFSH 1ROCA 3TT3L 4TNVF 1QSEB 4DPCX 2E6JA 3CZFB 3QQXA 4P99A 4RA3A 4YPJA 3UG4A 1W0WB 1NAKH 1K72A 3QIWB 4Z7WE 4WGVB 3HB3B 4UBDC 3MRQB 2PETA 2ATKA 1C1EL 4BKTC 4YPGB 1PLAA 2XN0A 2F19H 4FQCL 1T21B 4F80A 3TVMD 4Z3GA 3PCYA 2JCCF 3LD8B 2WW8A 5HXMA 4Y4HA 3L5XL 4JFQB 4QLRA 2B0SL 1QUNB 1IEBA 4MA8H 5B8CC 2B1AL 3FB6A 4UV7H 2Z7WA 4ODUA 2ZP9A 4MQ7A 3O8XA 2LU4A 4ZZFA 1IEBB 4NJAL 4OCYH 2R7EB 1EHLL 1WAPA 3TJPA 2KT6A 1D5XB 1G7HA 4NAJA 3SQOL 35C8H 3WAJA 2J73A 1JRHH 1XGZA 4JR9L 2GW5A 4DTGH 4NQVA 4N3TA 5DFAA 1AR2A 4G6FD 1AZZC 4FLOA 3QNXB 3APMA 4MAYB 4OZFA 3K0WA 1NCBH 2APWA 2DI7A 2X2HA 3P69A 1KGUA 3GSUB 3QJTB 3TEXA 4E0RA 4NQVB 3MCKA 4TQ8A 4YBLC 3MLZL 5IHHA 4A37A 2VWEC 2IVFC 2R59A 2Y7NA 2Z34A 3GSWB 4E0RB 4HALA 5GGUB 3B3IA 2JCCE 5IVZA 5I71B 4C56B 4AWJC 4QXWA 5SWZE 3NCJH 4QRQA 4WWID 5JW3H 3EDJA 3CX5J 1DQVA 3L9EA 5H94A 1JXKA 1GR7A 5IVZB 5KVGE 1OTUD 1ET7A 3GJFK 4IJ3B 4DQOH 3IB4A 2J6EA 3HAEH 4QRQB 3FT2B 5HGGS 4ADGA 3ARWA 4YDZA 4XNDA 1V8HA 4YVNA 1M7XA 3KLSA 4HCGA 4XWOC 1QLEB 4EI6A 8PAZA 2AJYL 5CZVL 4AW4A 2TRHA 4GXUM 4I48B 4NX0A 4A67A 1DBKH 3OL2A 4X9HA 4EUPH 1WUNT 3ARVA 1PG7H 3LS5H 4EI6B 5E5RB 4LEXL 4KKLD 4MD0B 4X4XB 1A9EB 2XSKA 4IMKC 3KHQA 1UENA 5BRPA 1WGOA 2XWTB 1ZEAH 3QUYA 2F53E 3NEEA 2AITA 2VW6A 3E3QC 3VA6A 4CVXB 3D1MC 1L9MA 1SHSA 3FCTA 1G9MC 3IMSA 4QTIL 3ULUC 4OLZH 4PBDA 5J57B 3I02A 3D34A 4QXGH 4YXKH 3UXFA 3PQYD 3HE6C 5FYLH 4N8VB 4UQ9A 4R7NB 4YXLH 4KK8D 1WTLA 4F92B 4CJ0A 4U1KA 1QO3B 2WXMA 3BWUC 4GLRH 5I6XC 1MNUL 1DR9A 1HDMA 1OSPH 1MPAL 2C4FU 2ENJA 1T2QL 1A6VL 4MMXA 2OXHB 1KCRH 4EN3D 1TSHA 3V5DB 1T04A 4U1KB 3REWA 1HDMB 2KDYA 4MA3B 4OCSH 3KNBB 5C0AE 3S3BB 4OBRA 3AG4B 1R46A 3RDTD 5CMAA 4M61A 2DWDA 5DZVA 4AW7A 3LRSA 1GHFL 2FH6A 2J8UB 3GIZL 4U3CA 4KV5E 5EORL 1I85A 5FCSH 4PW4A 3NSFA 3VFVB 5CN3A 1UD5A 2BLFA 5EF1A 1JPFA 1CS6A 2NOYA 3NRPA 4P9HL 2Q0ZX 5HI5C 3BWSA 4FEMA 2G2PA 1QX1A 3AXHA 1JPFB 3BDBA 3PWPB 1E2VA 4WHCA 4N6RB 1U8NB 4XVUC 2W60A 2OSXA 3FO0H 2VM9A 3MNDA 4Y16C 4B5ZA 2RACA 5CU5A 1TTCA 3VNYA 4A38A 1T03H 3B9EA 3L1OL 3T0VA 3LKQB 3C60C 4I0PC 3HRPA 3JWDL 3NDZE 3MV7A 1VEPA 1LP9B 3UZQB 2A74C 1K9TA 5GRXG 3VYPA 2ZCHL 5KS9F 4NNYA 3MRIA 4H8HA 4X42A 1CUOA 1S6NA 4OB5H 2H41A 1ACYH 3SDCB 1SUJA 3MV7B 1BVOA 3P2TA 2QZQA 4KXCA 4QRRB 4ZS6D 4YDIL 4DH2A 2DMKA 4BK5C 2VDMB 1B2YA 3VXNA 2PO6C 3THML 3WIIH 2ZOKB 4LB8A 2BERA 4K5LA 3OKDA 1RSFA 3VXNB 3W9DA 5CHNA 2VDPH 3VNZA 3US9A 4NT6A 3MBXL 2DYPA 1LVEA 3HAEB 2MOQA 3KWWB 2NPLX 5BOZG 3OKDB 4ZUUA 4YR6A 3NZ8A 5CHNB 2CHWA 1NFDB 1UXSA 1XCXA 3DJZA 1I7UA 3AREB 2XIBA 4NT6B 2DYPB 4TQEL 4XWGH 4L8BA 3X1EA 1YNTA 2IDSA 2WXJA 3A23A 5D1XA 2HKFL 4BELD 4AK1A 3NZ8B 4LL4A 3QZNA 1BXAA 1FDLL 1LO0L 1FVEA 3DI3B 5AEAA 3X11A 4LHUD 3WTWA 1YNTB 2FJFB 3NIDF 4W9DC 1JRHI 2IWFA 5D1XB 2X6UA 4O2CA 3PWUA 4H0GA 4F7KA 1JGUH 3X11B 5F7KC 4WKZA 3T0BA 1MY5A 2E6QA 3FCBA 2CUMA 4O2CB 1NQBA 3KHOA 1ZRUA 4O4YH 4K3DH 5DVMA 1EJOL 5L4JA 5FDWA 3NGBC 2JKRM 3LHPH 4WIQA 1OP5H 2YLHA 2ZXCA 4G8EA 4DP8X 3F7YA 3WJMA 3F58H 3BSZL 1W8NA 3EGSB 4DEUA 3WUWG 3CBJB 4OFKA 5D55A 4F8QA 1XF3A 1OTTC 4G8EB 3D7PA 2YD8A 3L1FA 2MIZA 4X8CA 4B41A 2FBJL 5IHZA 4DESA 3GF8A 5F96L 5DJZA 3LZQA 4XPAL 2C3VA 3AROA 4G5ZH 5KBNC 3PAZA 3TYFA 4CU7A 4JS7A 4TNVK 5TE6L 2E46A 1VLXA 2WBKA 3WV0A 3K8KA 5DJZB 3WKNA 3ECQA 4K3JH 2I85A 2FWUA 3QR2A 4I5BA 1YEFH 3DROB 4X5WA 5JPMA 3CD4A 3S3JA 3CV5A 3PQYE 2VGLM 1LO3L 2AMGA 1EIBA 3GMRB 3CFBA 4X0KB 4HGMA 2Z35A 1I8UA 2YIHA 4X5WB 5JPMB 2GC7C 1W91A 3VXMA 4PGJA 2CRIA 4H88H 1KXQE 5D6CA 2M83A 4HPOH 1G4RA 4H1LB 3ZDYF 3ZE0F 2IC2A 2V33A 4D9RD 1GSMA 3KPPA 1A1OB 1G84A 1A4KA 5K9QI 4O2EA 3VGDA 3PP3K 1UM5H 4TLKA 1W0VB 3BZ4A 1PIFA 1ZWIB 5F3BB 5D6CB 5F44A 3D25A 3MHZA 2RFXA 3GRWA 4O2EB 1A6AB 3M07A 5J06A 4WK2B 2G0LA 3BZ4B 2VXSH 1LK3L 3NA9H 3QI9D 4GLRI 1A3ZA 3EJYD 5FA4A 2RFXB 4X6CE 2BSSA 3H2QA 1X5MA 1XB3A 3DRQB 2NNXA 3K4ZA 2P5EE 2A2QT 4PWEA 3V9CA 4HKXA 5I1EH 4I13B 1M9SA 4ANXA 2BSSB 1BBDL 1O7SA 1MDAA 1YEEL 2YRZA 4FQHA 4F57L 5JHMA 3RQ3A 5IVXB 4PVBA 4HKXB 1MFNA 3RFRA 4MX7A 1Z32X 2VN4A 3QORA 4GW4A 4PY7A 4P9HC 1BFTA 4HZ1A 3OAYH 2BK8A 5BV7L 3PLYA 2X0WA 1UM4L 2I60L 5M95B 3ZDYE 5J12C 3ZE0E 2DZEA 5KVDE 2DTML 2YSSA 1TTFA 4TQIA 4LPVA 5HY9B 4Z7OB 4EIGB 3EOYG 4NPJA 1BDYA 3AMLA 5DWUH 4OCRH 4CN1A 1QI4A 2XZAH 4JFOB 3LZFH 5CKAA 1EO5A 3RVUC 2AKRA 4K3HA 3QW9A 3L6FA 4C4BA 4UDTA 1E27B 1N18A 2IAMC 1YN6A 2FWOA 5I0DA 1X9UA 4PS8A 2JLLA 4KXZH 3AWEA 3KWUA 3RWGA 3V0FA 2JQAA 2NZ9C 3RY4A 3M86A 5DFTA 3VFOA 4FD0A 3FAXA 5I8KL 3V55A 4DKFH 1KCSL 3GK8H 1D7CA 4XNAA 5A2CA 1WVZA 3B5TA 4NC1C 4TUOB 2VW7A 3VFOB 5KANI 2HLFC 3BN3B 4L3CB 1ZTMA 2X70A 2HG0A 1WD8A 1RJLB 2VZ3A 1FGVH 3QYCA 3ARDC 3MZTA 1PKQA 3G3LA 3U82B 3HJ0A 3ZR5A 3KH4A 3O2DH 4WLCA 1HXYA 3LNEA 4OJFH 4PN6A 3QFJB 1L6PA 2O72A 1G1YA 4KK5D 3T3PB 1GZPB 1OGPA 2BSED 1VESA 3H4HA 3K8LA 4G7RB 3DVGB 2NTSP 4N0CD 4PTUA 2FT7A 3O3DA 3B4NA 1QYGH 3QCTL 4XNUH 2HMIC 4NP4H 1BPVA 2LV4A 4YDMA 5F8QC 5I73C 2DQCH 4GH7B 5T8IA 5GGTA 4LOUC 2Y24A 5KZCB 3QIUB 1HZKA 4PB0L 3IETA 3U6XS 3UBGA 4E5XG 5F3HA 3NPZB 5E0FA 4WVRA 5T5NF 4RWYL 3GJFH 1T4KB 2ENYA 4HG4K 1C7SA 3UBXA 3AITA 4Y4FA 3VFWA 2R1YA 3V5KB 4F9LC 3NJMA 5DMKB 3QGVA 4HIHA 4AGPA 3UBXB 2XPGA 4G83A 3HBZA 5DS1A 3VFWB 4ERSL 5TPWL 2AJ3A 3CDGA 4FXGA 4XB3A 2FR4B 1ETA1 1ETB1 1R0AL 3FH8A 1SY6A 1BYPA 2Q10A 1NCWH 2AJ3B 4FXGB 3K6IA 2DQ6A 4YO0B 1NJ9A 4OCXH 1YYMH 4QT5A 4PW9A 1H3VA 1NEZG 1QBMH 3TA4D 2DB8A 1KN4L 3CFCL 2WXLA 3FQ1A 4PYHA 1M7DA 1FGNH 3I85A 2ESVB 5CP7B 5CGYC 1HWWA 3HS8A 1MJ8L 2XY2A 4LCIH 1M7DB 1UB5A 3FT4A 3HNSL 1DP0A 5G4MA 2WJ5A 4B0MB 4FJYA 3PE9A 2ICWA 2X1OA 4UIKH 2XN2A 1K6QH 1BQLL 1XXDC 4NCC2 2HTLC 1TTGA 1U58B 4NHUB 1D7BA 4O5LH 2ZIDA 1FYTD 5DD3L 4ADJA 2ITFA 4J2QA 2O6EA 1U3HA 1ACZA 3RRQA 4AYFB 1NKRA 5AYQA 1HC1A 4WU5A 3W0WD 4AC4A 2DWYA 2ZUVA 2VYRE 4ONFH 2I9TB 3FJTA 3OR6A 2DV6A 3ZL1A 1I9JH 2AK4D 2N7AA 2GY5A 1NAMA 4WO4C 2CKNA 4PJCB 1AHWB 5TDOB 2UVEA 4Q6YA 4AOFA 3OR6B 1IFHH 1QLEL 2X3AA 2J6EL 3C8KB 1KCKA 1ND0A 1CGSH 1MCOH 3SGJA 1AIFB 2Z7ZA 5BV7C 3HNTH 3LNFA 5D1QD 2BO0A 4EBQH 3PJSA 4ES8A 5EIQA 1HINL 4YJZL 1ND0B 1DQDH 4LAJH 5AW3B 1FFRA 2HT3D 5EOCJ 2XWDA 1NFKA 1R75A 4KK9C 5DTFA 1C7TA 1MCCA 4MXQC 1L7TH 5ILTL 3HUJF 1MY7A 2WXOA 1BJ1H 3BPNC 3IU3B 5EU6B 4ZD3H 5A1AA 2AJXH 1UZ6E 1XV8A 3JV4B 4QHKJ 1KB5B 1PU0A 1IBDA 3QUMH 3O6FA 3PY9A 4HUWA 3LPGA 3ATEA 4AEFA 3F7LA 1U2HA 4PJAF 5JIHA 3ISYA 4AYBA 1CBVH 4R84A 4LSUH 1MQ8A 1ZSDB 1MH5B 3AW5A 5A16B 4QRPB 3O6FB 4RH4A 2JB6B 3DETD 5LQBH 2C34A 3Q2WA 3TH4T 3GJFB 1Q9LB 2ZJSH 1T6WA 4IOFD 1TFHA 4WEEA 1W16A 3DHUA 3WEXA 1RH8A 3D12B 4NZTH 2LW3A 3T4YA 3UPCA 1A8ZA 3S88L 4JKWA 5GZND 1RUMH 4YC2C 5IHWA 1RZKH 3ARYA 5FHAL 4N8UA 2ZKWA 3L8QA 2DI9A 2DWEB 3S97C 3WIHA 4F8TA 3EYQC 1CICD 1MEXH 1YAZA 4BUQA 4QI3A 1U95A 3BQUC 3IJHA 5GS2H 1N9PA 4X7FC 2GBTA 2VAAB 2OX5A 1NGWA 1U95B 2CD0A 3SJVD 1BYNA 1NEUA 3KJ6H 5E6RB 3ZTNL 5IHUH 1XR8A 4PJAE 2FGWL 3KYMB 5CD3B 3II3A 1JPTH 1F3RB 5JIDA 4YX2H 1I1YA 3OC5A 4ANWA 2RCSL 4L2LA 3AT9A 3R06A 1FN4A 4JCWA 5T3ZL 3A67L 4L48A 4K9EC 1S3KH 2EDHA 3IF1A 3IKCB 4FADA 4NI3A 1E9OA 1JCKA 3QIWC 3S35L 1L9RA 5AVWB 1EAPA 4H0LC 1HHHB 4XN7A 1W72H 1OARH 1EEZB 3IF1B 4U2YA 5C09D 2OJEB 4NZRH 3NP3A 1E9OB 2YAMA 2YPKA 2AQRA 2R0KH 3QJHA 4NUJA 4YSCA 2J20A 3U7WH 5E6IB 5ALCH 4FHBD 5DRZA 4X5PA 2VDML 2VLJA 3ZYJA 4NUJB 4UT9A 3VWKC 4BFGA 2MSPA 4HSAC 3KEDA 5DRZB 1MJJA 5CSGA 2VLJB 1Z9LA 5EEUA 3FTWA 4N24A 5IBUB 2XN9A 1KBGH 3GGWB 4F7CA 1QI5A 3PP3H 2VL4A 3CG8A 2N3JA 2EVHA 4Z7QF 4ACPA 3CQPA 3I75A 3VD1A 2GBVA 5AWNL 5KVGH 4F7CB 1GL4B 3I6LE 4F7MA 5F9WC 4OVVA 4BRVA 1FYTE 1HIML 1N0LA 2NLJA 1LK2B 2W65A 4MAYC 5AZEL 3VB9A 2H32B 1G4MA 5GRUL 1AD0A 1QQDA 2NLJB 3ZKQD 2AABL 2W65B 3W0WE 3UYRL 1B3IA 1TF4A 1TZOA 2K0RA 1CD1B 5JHBA 5JHDD 1EEQA 1S9VB 2XY1A 4NUGL 5I71C 2WQ8A 5D7IF 1CDBA 2AK4E 1WC7B 3L3DA 3O9WD 4MDJA 4PJIA 3PAUA 3MFFA 4IRJA 4JFZL 4IJ3C 5FUZL 2WQUA 1AGFA 3L9BA 2NDFA 1WICA 4HMDA 4V1DD 4HOMA 4HK3J 2ZD0A 1K4DA 4MDJB 3SEPA 4K7PY 4YAQB 3EDKA 2Y7OA 4GRWE 4GFTB 5D1QE 1AGFB 5IJKC 1CDUA 1NCAH 3W3BA 4YEFA 3GTVA 4Z7QE 4HWZB 5ITFA 1R34A 3QZLA 1BD2B 12E8L 1JK8A 4HJGA 4JMXA 3UO1H 2LAAA 1E6JH 2V17H 3BP4B 3LRMA 3P77B 3R8BB 5A7BA 1YECL 1J9TA 1Z66A 5BZZA 1D9KA 4WI8A 4X99A 1XXFC 1NWPA 5F7AA 1JK8B 1MCWM 2PPFA 4HJGB 4F8NA 4H5SB 1W6WA 2UZIH 3MGOA 4OY9A 1XGTB 3LRHA 5LCVH 1U91B 3WE1A 5AKTA 1D9KB 2P7TA 2R23A 1JHTB 3NZHL 1NCGA 1RUAH 3NCEB 3MGOB 4MLSA 3SQRA 5HYSG 5D7IE 4FLQA 1G6RH 1NCCL 5A3ID 2P7TB 5GS0D 1HQ4B 5A6LA 4C83B 5TH2B 3ZR6A 4JB9L 1HEHC 4G5AA 4QKTA 1ZLSL 2MNWA 1B6DA 4NRXA 2F08A 1AZVA 2OR7A 3KPOB 1ASOA 3OG4B 1V7NH 4NOFA 2XPYA 3S8WA 1XGYH 4OF8A 4DO5A 5EG6C 3GRWL 4NRXB 2GITA 3EUUA 2B39A 1WBYB 4A39A 4G8GE 3BRGC 2KQMA 1XCQA 3KVPA 5MEOA 2P8MA 4XOCA 3WJLC 3R1GL 5E08H 4Q8BA 2ZUXA 1UZ8A 5IW3A 2I7SA 3ILQD 2Z3FA 4OBSA 1TO5A 5MEOB 5FGBA 4L4VD 3BAYA 4LPYA 3O3AA 2NR6C 3UTZA 1ZE3H 3QUXB 3LXCA 3M17B 4ZMWA 2AEPH 1ZJAA 2PYFA 1H5BC 3O3AB 4XP1L 1YQVH 3QJVB 5T5FL 2W9LA 3HG5A 4QNPF 3V6FA 5E24E 2F8XC 4BCZA 1Z9MA 2CMRL 4PRNA 4HK0A 2XKSA 2JCCB 4B9CA 1JPEA 1KPVA 1VF5C 3QO1B 3MODL 2X6MA 5DZPA 2EVFA 4GO9A 4NAQA 4PRNB 5C09E 2A6DA 3ZHDA 3H9SD 4OKVB 1LDSA 2FQEA 3ZUNC 2PCFA 4X98A 5E5MA 2NY3D 4KTEH 1XF5A 3IN0A 3QQ4A 4G7VL 3SDCC 4JZJB 4POZC 4X80L 5IVOA 3WSQH 4X98B 1WFMA 2WUBL 5D96B 4DUXA 1U4EA 2DQUL 3DIFA 3QQ4B 4CBPA 4OV5A 4M6OH 5DMYA 2XXFA 1FO0H 3DIFB 3S36X 4OV5B 2F53B 4YSDA 1V10A 4OFQA 1EZLA 3ZDZF 1JNNH 1LWHA 2VN3A 4ODSL 1PBYA 3DRTB 4R3SA 3V9EA 5L9DL 1I1RA 3AREC 2XVBA 2GABA 2Z1KA 4JUTA 4TUJB 2Y07H 5E6ZA 1RZFL 3S5LG 3BX7C 5JHLH 4YSRA 5C0AA 4R3SB 4EQ2A 3LCYA 5JHDE 5DK0A 4UCFA 1J1PL 2V2TA 3OQ3B 1KTKE 1R1CA 2F1BA 3PL6A 3OKKB 1SFDA 2AP2A 5C0AB 3RI5K 3UTSA 5GGTL 2WTOA 3RVTD 3V6ZB 4G8IA 3QC5X 1UM6H 1BW8A 5DK0B 2ZX5A 5HGHA 5B1JC 2V2TB 1VFAA 4EKJA 3UACA 1AMYA 1KIRA 4MFHA 2UY7A 4V1DE 4PJXE 3UTSB 4B9IA 3Q3GA 4F9PC 5TD4A 3D0LA 5LGKA 3GHEH 2QQNH 1WS7A 4WFHD 5CLXA 3SDAA 3L3OC 3MA7B 5DJAB 2GY7B 1H3TA 1QD0A 2B2XL 4OR1A 2ALAA 3ELAT 5JYMA 1E2ZA 2W0PA 2NY5H 3GKWH 3CN2A 3IU4H 3VG0H 3SDAB 3ZDZE 4Q6KA 3B9AA 4LSPH 1JPGA 1JE6A 1ZDSA 4TXVB 4PI0A 3B83A 3EJTA 2VXVL 1L9OA 3L4TA 3FZUC 1K4CA 5AW2B 4M7LT 3WFHB 4BV1A 4UF7C 1I82A 2WQWA 3R8QA 5IB4B 1QFWH 3L1EA 4HCRA 3MA9L 1A6WL 4KU1A 1IEHA 2DM2A 5I5JA 1M42A 5GSVB 5AVYB 3RX5A 1Z9SA 1P2CB 3QXVA 3K2UH 2BW4A 3JTSA 2W80C 2K6YA 1DYZA 4BFOA 6FABL 1LGVA 3TVMB 5EU3A 5C2BL 4JQVC 2E7LA 1Z9SB 3S4SA 1JF6A 4XMPL 1T7YA 3GTNA 1IBYA 1N10A 1P5VA 1QUPA 1W8OA 3JTSB 1CIUA 1XF2B 5MEPA 4F15C 3FOMA 2MHAA 5EO9A 2UX6A 1PEWA 4I0PA 3DO3A 5C0GB 1JHLL 5MEPB 1MVFA 2JKWA 5FO8A 2D7QA 5EO9B 3FFCD 4N0FB 2GJ6D 3N0AA 3SGKC 1JWUB 3H1ZA 5G5DB 4I4WA 1D3CA 2FJGA 2BVQA 3RWCB 4L4VE 3NJHA 4G6FB 1ZPUA 5FO9A 3RNKA 2X1XR 4I1NB 5T1MB 3L4VA 5KS9A 3GSXA 1BQHG 2BVQB 4B53A 3EO1A 5FO9B 4N2IA 3DGCR 3RNKB 5CCKL 5IBTH 1ZLEA 4PJ7F 3TNNA 3SYAA 4JRWA 2QHRH 3M8OL 4S2SA 4GT7A 5EUKA 5GPRA 3FQTA 3PWLA 4HFWB 2Q2EB 3BH8B 4S2SB 1IEAA 3BCDA 3H9SE 3BKCH 5DUBA 4KC3B 3QA3A 5AW6B 5I82A 1KB5L 2IAND 2WLJA 3TFKC 3BESR 4NQCD 5E8OB 1FZMB 4OLUL 1IEAB 5IP4A 4J39A 1J05B 5DUBB 2E8ZA 3VH8G 4XAWH 4NQSA 3WY4A 1PMYA 4DN4H 5J1TC 3G6JF 2UZPA 2ZWZA 3UGUA 4HIEB 3T71A 1S7TA 1B2WL 1R3IL 3MLVH 4YEEA 2QT6A 2YD9A 3BH4A 1IAIM 2XV6B 1J0IA 2H2SC 3MRNA 3V2AR 5LNDA 1MVUB 4FTDA 4FYTA 5DHVH 4XPBH 2WB1A 2O30A 4YBQC 4P5RA 4HUVA 1RURL 4R90H 1DLFL 3SZ6A 3QWOB 3ROLA 3PQYB 3QJFA 4MA7H 4JFXB 3S34L 1JYWA 2XWZA 3QHZL 3RZCC 4U6YA 4BQ8A 1IL1B 4FXKA 4R96A 4EN3A 1TITA 1OCWH 1HCYA 2DJ4A 3WIHL 2C3WA 3L3JA 2PR4L 4HC1L 1CIDA 1JL8A 3MLYH 4FXKB 1SRDA 5JIIA 4EN3B 4HGKC 3STLB 2AGJL 1LO2L 3M6DA 4P3WA 2ZAHA 4FE9A 5KBLA 5JPNC 1C16A 1RVFH 1RV6X 5A2BA 3QIUC 5FO7B 5GJTL 4PMEA 4YN3A 5C08D 3RDTB 3WG7B 3LV3B 4JFUA 3G6JE 2X6CA 1YEWA 1GW0A 1UEMA 4DAGH 1QSVA 4PJDA 1ES0A 1PTZA 4X6CB 1O6TA 1UH4A 4NQED 1KENH 4D0DB 1RLBA 2EXYC 2LTQC 1E0OB 3QZWA 3L5WB 4FLHA 4OQTH 4WFHE 4AKPA 4KAQL 1QFUH 3MV01 5C6TH 1WE5A 2EH7L 1W0YT 1ES0B 3FH7A 1DFXA 1ZA6B 1JV5B 2FEJA 3F83A 1DL7L 1WFUA 1A0QH 3MRFA 4FQJH 3B34A 1NPUA 2C5DC 5IW6B 1YNKH 2UXGA 1F90L 4LF3A 5CIPH 4JK0D 5GGVH 2EKJA 3G5WA 1VZGA 5FUOL 1GCYA 3MRFB 4MXWH 5FYJD 3CNKA 3IDGA 3V95A 5CBEA 1A9BA 2FDBP 2G3MA 2WBXA 3QT2A 2KBGA 1M1SA 2F1EA 3IFPA 4GW5A 4RAUA 4LF3B 3ZDYB 3ZE0B 5K9JL 5KSUB 1YY8A 1XSKA 2NYYC 3U83A 3L7EB 2XA8L 5CBEB 1IM3D 3QPKA 1C5CL 3EJZD 3OHXB 1E67A 2MTPA 2CBMA 4FA7B 4M48H 2I9LB 1YY8B 2XXGA 4KXAA 5LBGA 3N91A 1EXHA 1FFQA 2R39A 1CU4L 2DIAA 1NDMB 4L9LB 5AKSA 2OI9C 5SX5K 1ZIAA 3LEYL 2YC1B 4XCCL 1QFWI 3LXAA 5I15H 3H56A 1AQDA 4ZMOA 1YEJH 4L9DA 3Q2NA 3CQQA 1Q94A 1MIMH 4PWIA 3G08B 1Q1JL 2K4AA 5DLMH 2WQSA 3GSNH 3UMTA 4HEPA 3FFCE 4AYID 3FN9A 3NJIA 3RG1C 2ZWYA 3FQNB 3NG5A 3V0IA 5AAWC 4NM4H 4FABH 1N6QL 4Q9QL 4WFFD 5DS2A 1A14H 1JXDA 1T0PB 4L1BA 1CF8L 4X4YA 1BOGA 1U2YA 2EKSB 3ZRSA 4ONGH 1EBAA 1FNFA 2QEJA 2WPGA 2WKGA 5E99H 2ODHA 1AHWC 4RMQA 3SODB 2APXA 4KJPC 2D2OA 5FA3B 4R5TA 3RWJA 3WLWD 1KBKA 4LHUB 4GRLC 3AS2A 5ESQB 2W0LA 5HYQB 2DOCA 4RGNC 4Z3IA 4FMFA 2XXCB 1U92A 3AG1B 2VISA 4JRYD 1KDIA 2VR4A 3O11A 5JXAL 1FFOA 3B2VL 1J88A 3BWZA 1YMMD 2VR7A 2D3VA 5BZDA 4XNQB 2IANE 1SPDA 3O11B 4NQCE 4GXVH 4NEHB 1PX4A 3D69B 4R0LB 4YFLF 3FO2A 1UJTA 1TZ8A 3VX1A 2V0AA 1FLRL 2ED8A 3DOIA 4JDTL 2FX9H 5KJ7E 3QH3B 3FO2B 4R4FL 4LP4A 3D52A 5D2NA 3BFWA 4HOXA 1BVZA 4UTAA 4WUUE 1KLUB 4RMRA 2CNYA 4QMEA 3MNMA 4J3XA 5L7XL 4WNQA 3RWFB 1XGRA 2A0LD 2VQ4A 2ZUSA 3CDFA 3EO9H 2X89A 4AM0A 4G6KL 5DRWA 4XVSL 4WNQB 3KPQA 3DX8A 1MNNA 3OLIA 3TESA 3I2CH 1N3NB 3AQXA 2YBRA 2B59A 1ZK5A 1OCCB 4YGAB 2LLGA 5EN3A 2HT2D 3KPQB 4YQXH 3B9KA 5I19H 5FLVA 1PGRB 1RIVH 4ZFOA 1CL7I 2EIMB 1L0PA 1QZNA 2WCGA 4UAOB 4S1RH 1F4XH 5C0NC 1TJHL 2WBJA 3QI9B 3U4BH 2WNGA 3FQRA 3JTBA 2YAQA 4MJ5B 4CSTA 4NQEE 4DUWA 4HXBH 1J0ZA 4BSWB 1II4E 4J3SA 3V9FA 1PYWB 2XWXA 3PHOA 1CMOA 2H6UA 3VVWA 3M1BA 4Y88A 4DGYH 3FQYA 3N04A 4ENZA 2Q86A 5B3JF 4LBEB 1SEQL 4M5ZH 4UUJB 4K2UL 4D8PA 3M1BB 2EINB 4Y5VA 3TNMA 5D72L 4JHAL 2Q86B 3PS6A 1FZOA 1G7LA 5FYJE 4MLIA 3IGAA 4E9TA 1ZT1B 2A9NH 3OKOB 3HZVB 4O9HH 4CW1B 3TNMB 1VEMA 3ILEA 1IIKA 3VFRA 2F7IA 1FZOB 5E6IC 2OLDA 1G7LB 5JW4N 3MBED 1T4WA 4UINH 2KUTA 4UV4L 5AOLA 3TH2T 4PV1C 3QNFA 4EN2A 1SN5A 3UBHA 2Z8VC 3WNLA 4BZ2H 4YDLB 2AXFA 5LXGH 5KYUA 4X0NA 3VWJD 1MFDL 4I3SH 4FQ2L 2EZ0C 4QHLB 3SKNB 2OMZB 3LH9A 1XMEB 3U4EB 2ZUQC 3BSHA 3NIGE 2HTKD 1GGCH 4IKNA 5EIIA 1BQUA 3GSRB 5KYUB 1GGIH 5FB8A 4V2CB 3WMPA 5DSCB 2B1HL 2CSPA 3G5XA 3D3VD 1QKZH 1OM3H 1FCCA 2R2BB 2YRPA 3LN5A 4Z7VF 3MRBA 1CFMA 4GRMA 4P2RA 1ZTXL 5HGDB 4AZ8A 3WUZA 5C9JA 4A2GA 1JGDA 2DWXA 4AVIA 4GRWH 3LN5B 3I9AA 4IOIA 4NKDA 3NFPB 4DSYA 3KW7A 1JMZA 3U0PA 1JGDB 2OP4L 2DY2A 4G7YH 3GNMH 2NW3A 4Z78B 4KTDL 4WFFE 4NKIH 4IOIB 4PTTB 3GPSA 4MD4B 2C9RA 3DIVA 5EZOL 3LKPB 2PLTA 1IAOA 1MZYA 2NW3B 3ARFA 3HUJA 3KD4A 5IQ7H 3P4LA 2AF2A 3DO7A 2AC0A 1F45A 1CLZL 1IAOB 4JKNA 3D4YA 4XO4A 2XJLA 1MCPH 4KKAD 4OJYA 4X6EA 4UIMA 1ZANL 4JRYE 1IJ9A 2WIIB 3M1OA 2R29L 4XE5B 1XX9C 3TBTB 2FEDD 2OMYB 1G7MB 4RNRB 2IG2H 3CMOL 5A2FA 4PJAB 4YSEA 2DIEA 2IV8A 3B7UX 3VD7A 1YMME 4GQZA 1E6OL 2E5EA 2DLTA 1RZKC 4QXTA 4UQBA 4PP1C 3FHQA 1MFBH 3RWIB 3X3FH 1A2YA 3VFTB 1DFBL 3CFJA 1T22A 3WNIA 3QUZD 1HKLL 2FGZA 4DK5A 4A1RA 4HHAB 5H37A 1HH9A 4HCRL 2N7SA 1T22B 1NGQL 2UUDK 5GRWA 2O5ZH 4YK4B 1QFOA 3NRFA 4R97B 5TQ2L 1JZ7A 1HH9B 1KGIA 4LCUB 3UZEC 3OLDA 4X7EC 5DYOB 5DEGA 4PRBA 5DMGD 5B7FA 4OZHF 5AAMC 2FYYB 2G2RB 5HHOD 2AVGA 2X4OA 2WLMA 1ZHNB 1FNSH 4KOBA 4P46D 3BVDB 4F7PA 2ED6A 1QG3A 4L3AA 1K8DB 4BH7B 5CEZD 3DV4A 3MXWH 3DV6B 3L9RA 1A47A 3HMXA 3P0VH 3P0YL 5FOBB 3VD4A 4JCMA 4YBHA 1ODUA 3P02A 4PH8A 1NC2D 4OAWB 3OZ9L 3VGHA 4G8AC 1GYUA 4OLWL 2DDQL 3X1GA 3VWKA 4KKCC 1FYTB 1RQ5A 1Z2KA 5DQDH 4L4JA 3QUXC 3QE5A 3OB0H 5FF6B 1UOKA 3LZOA 4LASL 3NCYP 1T0MB 1V55B 3GB7A 1N7ML 1PLBA 3R0NA 4N90D 3W0WB 2EACA 2VKWA 1F3DJ 1FVCA 4GNKB 2BP5M 5GSRA 4ZPTA 1QZ1A 2VUYA 2BY1A 1NBYA 1AKPA 2IBBA 1X4YA 2AK4B 5GSRB 4OZHE 3B9DA 3QEQA 4DVBA 2Z8WC 2ZSVA 4Y19D 2BHZA 4YDVA 1LDPL 2WB7A 1GAFH 4MAUH 2FJSA 2Q8BL 3AXLB 3DMMA 2FHCA 3CFDA 2NY1D 3L3KB 5D1QB 4OF3A 1MW2A 5BMFH 5HHQB 4JZJC 4MQTB 1DZBA 1Q9OA 4FG6C 5F88A 3VFGH 3RWHA 2P5PA 4Z7QB 7PAZA 5D96C 3CFDB 5LO7A 1MW1A 4I3GA 4G7QB 1R4XA 3T0ED 2DMBA 2WVUA 3LKOA 5HDLA 5SX5H 3TZVC 2HFTA 1MRFL 5HGAA 3RWHB 3WL9A 5KBMA 2FX7L 1GOHA 5CZKA 3L5HA 4QAMB 4M62L 1TLMA 3GM0A 3LKOB 4IDJL 4KO6A 5D7IA 5HGAB 4JN2A 5GISL 3D3VE 4XMUA 2KL6A 2CO3A 2ADJA 2F58H 3ZHFA 2ITEA 5E1GA 1S3RA 4U0RC 5IMLA 5F7HA 1HT6A 1UEYA 5D7IB 1IC5H 4FFVC 2ADJB 3EFFB 1CGUA 1O9ZA 3E38A 5IMLB 2R1WA 3S3PA 2E27L 3P40A 4JG1H 1OSZA 2NY7H 1TZGL 4GINA 1HE8A 2OYKA 3GI9L 3WO4B 4XNYL 4EZKA 1L7IL 3DC0A 4QOKA 1CURA 5EU5A 4PJ8A 1AY1H 2W0FA 5FFGA 1OSZB 1XH1A 4JGNA 2LVCA 1JFQL 5IB5B 4BHUI 4NDMA 1D6EA 2I24N 2WIMA 2X2YA 5DJYB 5D2LF 4KMTH 4HS8L 3SJVA 1KLGB 2P1YA 1AE6H 1JVLA 1D5IL 4NDMB 1D6EB 2OR9L 3BP5A 4IEFB 1HQRB 4G82A 2OS7A 1CB4A 1CLCA 3SJVB 4DO4A 1Y18A 4IRSD 3FCSA 2D0GA 2OSLB 3PNRB 5GS0H 4S0SD 3CVIH 3RNQB 5B1KA 5BZXA 1EO7A 2KYIA 3BHBA 4WSJA 1IBZA 1YEIH 3FCSB 4M00A 3OKLA 3V4VH 1RFDL 3UAFA 4RFNB 5KVDL 1OB1A 1Q72L 2XQBH 4IU2A 3BHBB 1B4JH 2WKOF 3OKLB 1DCLA 2ZSWA 2NR6A 3NSJA 2XBTA 3WUWB 1KJVA 2GSMB 2XACC 4OT1L 1ACCA 5C09B 3CHQA 1GS6X 2X4NB 4XE0A 1F4WL 1TJIL 5EBGA 1VSCA 1WV7T 2IGTA 1A1MA 1SJVA 4PJ5D 3TBYB 3TVMC 4WI9A 3CLEL 1RK1A 3T5WA 4XN2A 2P9RA 2WZPD 1T83A 1A6PA 1ZVSB 5GIRA 3N1QC 2EIJB 4F2FA 3QS3A 1IC4H 3L5JA 3PV7A 4R5VA 1VPOL 3V0WL 4GO6B 5D70L 4Y4KA 2XIDA 2Y72A 3S48A 2YAOA 4CVZB 3NJGA 2YOAA 5I1LA 3T8MA 3TO4A 1N8ZB 5CEZE 3OPZH 4IBQA 2ADIA 4HX1A 1NM9A 2A73A 1X6LA 3L54A 5HVHB 4HGWA 1KELL 1BZOA 1INQB 2VR5A 1EGJL 2Y06L 2MQ0A 2ADIB 3CSPA 4MJID 4OU3A 3TONA 5CZXC 3JTTA 4OGXH 2CR0A 3V0VA 3PUCA 3DJSA 4W9EC 3UJIH 1MCLA 2BP3A 1VGEL 5EOQH 5D7HA 4YH6A 7TAAA 5FEBA 1RUPH 1T3FA 4N90E 1WBXA 3OMIB 3BPCA 5EF2A 4M6NL 1WAAF 2FO4B 5JHDB 1RI8A 1WZ1L 5DO8A 3D9AL 4Y1AE 3WIFB 2EICA 3B7TA 1HYRC 3TA3D 4V1DA 3BPCB 3WDJA 3O9WB 4WV1A 4Y19E 2EVJA 3E6HA 4KJQD 1CL7L 3NZUA 1CXIA 1MCRA 1AMXA 2G3NA 1OTUC 3INOA 4XTRD 3UX9B 2X44D 4V1DB 2DQHH 3E6HB 1HKFA 4HS3A 3MJGX 1G7IA 4I0KA 3BQVA 1NCDH 4I88A 2ADFL 1DQIA 3KL0A 2Y2YA 15C8L 5DUPH 4AJ0A 1EXUB 3QWRD 1G7IB 2J2ZB 4ZUVB 2FSEA 1QEWB 3T0EE 3ZDZB 1NOAA 4GQRA 1XIWD 1IO4C 1SOQA 4M7ZB 5D7EA 1DQLH 5JORB 4LLWB 1FG2B 2FSEB 2FT6A 4OSUL 5K1JA 3ZDWA 1KZYA 4HJUA 1INDL 4UQ3B 3MCLL 2VDQH 5T1KD 1XCWA 3HVNA 2QPUA 4OV6F 5TQ0H 1P7QA 1J9RA 1S9XB 1MHPH 5FR3A 5C2UB 4YXHL 5ACMA 2B5IC 2ZCKH 5FYKE 4AUJA 2ERJB 1E9PA 3D18A 3DPBB 4KK8C 4Z5RA 3A6BH 4X7CC 4HJEA 2VDRB 2NY5C 2OMNA 1YNLH 5DVNA 3UIYA 2OK0L 2VDNH 3L2NA 4KGJA 1P53A 4KQ4H 5B3NA 2VNCA 3D18B 1FFPA 2PTUA 3JWNH 3EFDH 1JZDC 3CZSA 3KGSA 4FTVD 1H3UA 4JZOA 1OCOB 2XWJA 3EDEA 5TF0A 3V4PB 4ZFOL 1QWNA 4GJTB 1FFPB 1A7RL 1DCEA 3S0PA 1AVAA 4TVPD 5L2JA 4M29A 3UJJL 3FQ4A 3BAEH 1IC7H 2H3KA 4HUUA 5JMOC 1FH5L 3KJ4B 5IROD 4YDJA 5HI4D 1XD1A 2DM4A 4L4VB 1GTNA 2XXMB 1OZUA 3BMVA 3B7YA 1M2VA 1NMBH 1EWHA 4WI5A 3VO0A 4E5XB 3MRJB 5AQ0A 4JX0A 4AIZA 3LH2L 4LLMA 1HOEA 4BH8A 3C2SA 3VA2C 3CIAA 2OMVA 3SGKA 3UTOA 3JSSA 1BVKB 5KWYC 3LKSB 1K8IB 4LLMB 4CKVX 1TT6A 2HH0H 2O5YH 3MACL 3KG5A 2X4RA 5CJ5A 3VRJA 2COVD 2ZXDA 3A47A 4HPYH 5D7SL 1WBZB 2NYKA 4A68A 2APTA 3OHXC 4B9JA 3H9SB 2X4RB 2CKBH 2NY3B 1GPOH 1MRCH 4L9LC 1T7XA 2I5YH 3MYJA 2VLKD 4ZS6C 1A3LL 1RPUA 4NC0B 4XZUB 5AB0A 2DAVA 4OLXH 2D73A 2JJWA 4AJVA 4H8QA 5I1DB 3EJUA 1F8TH 1S46A 1U30A 4XH2A 3K7UA 3PHQA 3K71A 1YUHB 5MI0C 4PJ7A 5I5RA 3DI2B 2QTVA 1DEDA 3N55A 1DJWA 4TN9A 2HKHH 4MJIE 3PHQB 4QXUH 4PJ7B 4U1SB 2FAUA 4G3YH 4XBGB 5H8DA 4KQ0A 1VCBC 3LEXB 1SXCA 2XZQL 2QPEB 4XB8A 2PUQT 1AGDA 5FW8A 3HCVA 4PG9B 3HI6L 1MIEH 4TSBH 4JG5A 2IADA 3UYPB 3DUUA 1XAUA 4HJ0C 1DBAL 3SCMA 3U48A 4Y0GA 4NNXA 3G6JA 1AGDB 2XG5A 3CH1B 3HCVB 2V7NB 3MRCA 3A4DA 4H2CA 4MXVF 4ELDA 3WXVH 1F6LL 2AJVL 5I9QB 1FBIH 1YJDH 2Z31C 5I0ZA 5IQMA 5EHFA 1A02N 2OULB 3G6JB 3MRCB 4FAAB 3EJQA 1TETL 3K46A 5IFAH 2APFA 1I3UA 4GW1B 5HDQL 5I66A 4BXVA 3N42F 2GK0A 1LNUA 2VR6A 3E6FA 1CDYA 3CX5K 4KHXL 5I0YA 1BBJB 3QARA 4ENEC 2ZWLT 4R0LC 3HC3H 4NGHL 2JI3A 4UZSA 3BVNA 4MWFB 4R26L 5JPNA 3K6SB 4NSKA 5DQ9B 3MLRL 4PWJA 1CDJA 4K8RH 2ICWJ 5ACLA 5C7ZA 2NUPB 4M1DL 4OLVH 2Z4QA 3WY3A 1P5UC 4I18B 4NSKB 1ZGLP 2OFQA 5BO0D 3QPXH 2KZKA 5LHDA 4LOEA 4OCNC 1MELA 3NAAL 1KEMH 5AVZB 1O0VA 3GHPA 3JZYA 3HLKA 2TSAA 1CFBA 1TJXA 1YEHL 4HIPA 5IY5B 1MG2C 1JNLL 2V5MA 4ODBD 4OUOA 2AAVA 1J10A 4KHTL 2ALWA 1U8OA 5CNHA 5ANME 5I30H 1GC1H 1NL0H 4Q2ZB 2AZAA 4AUUA 2DQGL 4J4PC 4ZMVA 5HI3D 3R4DA 1S7QB 2K78A 1FJ1B 5CGBA 1F11A 4ZMTA 4XCFH 4ZZKA 4FQQA 2GAZA 4FTVE 1BV8A 4UAOC 3OJMB 4B9FA 4GS7B 1IKNA 2GJ6A 4XP6H 2C9PA 4M7LH 1F11B 3QI9C 2BC4B 2GAZB 1OAUL 1YEKH 5EZIH 1KULA 1DEEB 3D2TA 3FFCB 3EJYC 2BS71 4PY8I 1UB6A 3NABH 2GJ6B 2XCMC 1HHIA 4HWEH 2CLRA 3E1F1 2MQCA 4Q52A 5AW8B 4ZX6A 2WZ0A 3GKZA 2HB0A 1OGAE 4M4RA 1HHIB 3D05A 1E5YA 2LLNA 4XMLH 4N8CH 2BPBA 4DGVL 4RWHA 5BS0E 4ZW3A 1TKWA 2H1LM 4M4RB 3BKYL 4ZUTB 1F4AA 1R5WB 2ZKHL 4H26B 1AIZA 4ZAKC 3NJNA 1KYOJ 4NWTL 3WD5H 3ZZQA 1CD9B 4O02H 1XSIA 4PUBL 1CFTA 4Y9BA 3CLFL 2QADD 4NQCA 3IJSA 2EO7A 4PP2A 3KS0H 5FUCE 4BXSV 1LYQA 1CFTB 2OYMA 4ZNEA 3GHBL 2IANB 3T8XA 3ZU8A 1TMQA 4NQCB 3U30C 4PRHA 2VLKE 2H0EA 3GLAA 3KLHD 1JPST 2DWTA 1ZJBA 2J57A 1QSFA 3OVUB 2CDEA 4JHVA 4XO8A 2DQTL 4HJJH 2J72A 2GJPA 1SDYA 1E8ZA 4BUGA 2J8HA 3S96A 3ZKMC 3RUGE 3NEXA 1UQSA 4Z95H 2J1YA 5AYTA 2Y4SA 1OAKL 5DJXA 2DLFL 7PCYA 1KWKA 2E7DA 2GT9B 5F9DC 4CNIA 3QJRB 4JFED 1WIPA 5DRXA 5JR1H 1OEZW 1UXWB 1ETZA 3BAXA 1X7SA 4RISH 3CFTA 2WXQA 3IVKB 4HKBA 1LL1A 3A4AA 3GXPA 3K0YA 3FQXB 1I9IH 4BZ1H 5C6WH 1WH0A 1WUZA 3RAJH 4IS6B 5C08A 2HG5A 2W07B 3II1A 3NMEA 4HKBB 3ZBMA 5ALBH 1N64H 5I1HL 2BWDA 4GMSH 1OW0A 1QWUA 4YL9A 2R69L 2EVGA 5C08B 3T3ME 3ECWA 4GKNA 5EEVA 1CXFA 2HZHA 3QUKA 4NZFA 5AVSB 1CC3A 1R19A 4KVCH 1RZJH 3OF6D 4TM9A 4NQEB 2NMSA 3CXHJ 2Y22A 4AGNA 5C8JB 3VFSA 4KPHH 2I7OA 1FC1A 1MFCH 3I50H 3QUKB 5GGVY 2XV2A 3RE0A 1S5HB 4GAAA 3BUYB 4J27A 4QYOA 8FABA 3VFSB 2HLAB 2J6WA 2DICA 3DSFL 3IGKA 4LEOA 3TV3H 1M2OA 5DUMH 1DQML 4S11A 3PDOA 5CCHE 3CC1A 4ZOCA 4QYOB 8FABB 1FAIL 4YK4C 3CN0A 4MNGE 4R97C 5D4IA 4OFVA 1I75A 4LP8A 4F24A 4C57C 4Z3EA 2BIQA 4UB0H 5IJVB 4NCC1 3ZRFC 2AJZA 2BNUA 5C0JB 3K74B 4WTZG 2D03L 1IM3B 1QNZL 2IFFH 3VFNB 3ZE1E 4JG0H 1TLKA 1OPOA 5KVEH 2FT8A 1OAZH 4OI9A 3OTTA 5HYSB 1QFPA 4ZFGL 3NIGB 3S35X 3MRKB 1ZHBA 5BO1L 1QSZA 4LKXA 3BVWA 3IDMA 3WNPA 4PQXA 2IJ0C 3FTUA 2HPTA 5CEXB 2UVFA 1AHMA 1HI6A 1RCYA 3L13A 3MJ9H 1KC5L 5KYWA 2GIMA 3VQ1C 4IRZH 1QRNA 3V8OA 3N1FC 1KJ3L 4FS0A 5D1ZD 2JF1A 4OI8A 3SPIA 4Y7OC 3VB8A 2H3NB 4OD2A 2CO6A 1L6ZA 4PGCA 5EPMA 1H3PL 1F86A 3TIDA 1AGBA 2VLRD 2P45B 1WGVA 3NQKA 4MHHG 1R33A 1T7VA 5D5MF 3SO3C 4HIXH 3KWTA 3ABMB 3EZ8A 3H2WA 1A7OL 1TZIA 2CO6B 4PI2A 1LEIA 3IFNH 3MGTB 4OKDA 1AG0A 2AW2A 2DQJH 1OZTG 1BAGA 2AQPA 2EIKB 3KM1A 4AT6A 5ADOL 5KJRH 2P42B 4D9LH 3AS0A 2O26U 3DWTA 5D1QC 4C58B 4Z7VA 4JRYB 2BNRD 4JQXA 2IPUK 4UTCA 3IDUA 1AS8A 1PAZA 3MLSL 2HT3C 3KCPA 3GBNH 2X2IA 3QXTA 4Y8DC 5DR5L 3QUMA 2FX8L 1NGZB 1GCFA 3CBRA 1YMMB 1IGFL 2NZ1A 2CBQA 2VMJA 2ATPA 3KH3A 3L17A 3C2AL 5TE7L 4DJMA 1EEYA 3KCPB 3CU7A 4ZUWA 3UPRB 4H2AA 3ARTA 4GAGL 3WNKA 2JELH 5ITBH 4WI2A 4LLDB 4I2XE 3MV8A 1XCTB 2N4IA 3T0DA 4HEMA 4YNYA 2IGFL 2VDRL 3F12B 4M5SA 3AC0A 3DETC 4LLQA 1P7KA 4JKPL 3U9PL 4TYUA 3FQUB 3X14A 4XR8C 2J25A 1GS8A 4N2KA 1L6XA 2I26N 3WIAA 2WSKA 2ED9A 1Q8MA 4J6RL 4WK0B 1P7KB 1NC4A 2WLLA 5T3XE 1MCWW 2D7TH 3V4PL 2KZWA 4WZ9A 3EUDA 5DT1L 4KO7A 5GZNC 3CTTA 4RQQA 1XGQA 3VE0B 1SQMA 3LXUX 4BFBD 2NYZA 3BN9C 4MYWB 4JZNA 2X4SA 4V33A 4W81A 4ATTA 3A4FA 3VDAA 1CICC 4F33A 1P4IL 3AM8C 3DSNA 2FVNA 3IMTA 1J0YA 1V7MH 3MREA 4X50A 5DHYA 5ID1A 3NCXA 2QVTA 2X4SB 3C6LA 3H6JA 2HVJB 1THAA 3CVHB 4NQDD 2G3ZA 1PNCA 4XNZB 1KYAA 3S5LB 4F33B 3U0WH 3QDMA 4GSRA 3DSNB 32C2A 4AUYA 4LFHG 2F7QA 3VG9C 1UT2A 1YYLL 1UYWL 1J9CT 1QVOB 4YHZL 2GTQA 1D2OA 4Y2LA 3EOBB 4FI6A 4HD5A 4OZHA 4W9KC 2BVUA 4N9GB 2DQIH 1KXHA 2G4GA 4X5LA 5LB1A 5EA0L 1NFIA 4MZ2A 5EBWB 1T1WA 4JFVA 1A7PL 4OZHB 3QJUB 3C8HA 4RZCB 2R9HD 3ZJAA 4AXWA 5I76B 2YPLD 4JAMA 4Y5YB 5DJCA 1NFIB 2HJFB 3K8MA 2P47B 3MBEA 3Q6GH 4N86A 5CU9A 1U8LB 3EYUH 5C0RL 4QRSB 4JAMB 1PDKA 1K5WA 1P6WA 4AEHL 2OZ4H 3L3IB 3MBEB 4B60A 2WP3T 2WGNB 2W9DL 2H26A 4N5ED 3UGEA 4PJGF 1FQ9C 2J1KA 3JVGC 1LJMA 1REIA 4APQC 4C4KT 4G6MH 2XX1A 2PCXA 3VWJB 3FHAA 1IBHA 1PJWA 1DHKA 4HH9A 1ECZA 5JOFB 2XFXA 5HVHC 5IT2L 2WCPA 2IALA 3EGXB 3D3VB 4U4IA 5EUOF 3M88A 3OAUH 4NFBA 4IOSD 2IDTA 3FPYA 4PRPA 1IC0A 3E1ZA 5D7KD 3EYFB 3FSAA 4L4TA 2P52A 1WP6A 1JXJA 5ESVA 3D51A 3BT0A 3QQ3B 2WBWB 1HHKB 5DZ9A 3L2MA 1DO5A 1ZMYA 4JN1L 3DTUB 5E8NA 5GJSH 3FCUB 4A6YH 2VLRE 4CMHB 1BLIA 5D71L 2BY0A 1OHQA 1Q38A 3F2LA 3ZK0A 3EHBC 3SKOB 4KVPA 2VXUL 3O9WC 1JERA 5E8NB 5BXFA 2CA3A 1KXTB 1NDTA 3ARXA 4Z3TA 3SKJL 3MDJA 4MD5B 5C3TA 4YHNB 5CM1A 2H0JA 4KKBD 2JIXD 4N2LA 4MASA 4JPSA 5FYKH 2BNRE 1MAJA 5GHWH 4WEBL 4Z7UE 2WQVA 5T1LD 3WFCL 2C7UA 4X9IA 5FW7A 1QA9B 4NBYB 5EUOE 1AFVL 1R5IA 3AQDA 1UOLA 3QUZA 5LCVA 1E90A 4NO2A 3HEIB 3K6DA 4DP7X 4JPWL 1FL3A 1FZKB 2BSTA 2NW2A 1JI2A 2Z91B 5CILH 5EU7C 4GY4A 3TX4A 4W70A 3U36A 2XPZA 3QUZB 3TPUB 3G6DH 1U93B 3K2IA 1KWGA 4H20L 4OZGA 1FL3B 3VH8B 3U7YH 1RZ7L 4ZX4A 1O7DE 3IDNA 1BYOA 5D2LA 4TRPL 4FFWC 3RTQC 3RVXD 2R0WH 5GRJH 1BFVL 3UEQA 2FIKB 2ERJC 5A3IC 4JVPA 1LMIA 5HHOA 1M05A 1JK9B 5GS0C 4K5NA 1CXKA 5DZNA 1OAYH 2XG4B 3A6CH 4HQQL 2R4SL 5HHOB 4Z0BH 3FQ2A 1DDTA 1PQZA 2EE6A 4MMZA 4NFCA 4P46B 2IQ9L 3B2PA 4NENB 2JSFA 3OKEB 2HN7A 2AQ2A 3B56A 4UANA 3UEZA 4DVRL 4NQDE 2WKOA 1NMCB 3FH5A 1NC2B 1E5UI 1JZEA 2HN7B 2ORBL 3ILQC 4OZFG 5EO0B 3TT1H 1J5OH 3VXQB 4WWKA 4ZFZA 4JDVA 1ZCRA 4RX4D 1PAMA 4GUPB 1CVRA 1GKOA 1PKOA 1TTBA 2PTTB 5LN8A 4ZFZB 2X1QA 3MRLB 5JXED 2WXIA 2UY6B 4QYAA 1T1XB 3ROOB 1JF1B 4M1GL 4AMKH 3W39B 3BGFC 1R6VA 4KDTC 3C5ZD 4IMLA 4Y19B 3SPJA 1KGCD 1UOWA 4WQOA 3DVNA 2YPLE 3NSDA 2BVPA 2JKLA 2ICEA 3P3YA 5J3HD 1OGTA 1P9MA 4OM1L 2ZXAA 3KPRD 4UI2A 1WWCA 1WAEA 2XJKA 2JH2A 4ODHL 3AWFA 3TN0D 3MTRA 2EUXA 3GMLA 4ZTOL 4WSKA 2ICEB 2R56H 2NY1B 1GY2A 5DD0L 3ZKND 3BFQG 3MV9D 2MCG1 4AE0A 2ZXEB 1FO0A 5FKAB 3BWAA 1OXYA 3NP4A 4IKKA 3U9UB 4XN9A 4UMGA 2EXSA 4YHML 4ABUA 5I1GH 4HISA 4A6YB 3BUBA 2FK9A 3T0EB 2QSCL 3ME0A 5H4ZA 4FZEH 5F1IB 3LN4B 2VQ1B 2DH3A 5C0DA 4FQIL 4KNUA 1WAAA 2F9BT 4C8XA 4HULB 3D39A 1BM3L 3UDWA 3VTAA 4DZBB 4L3FA 4P48A 2HX7A 5JHLA 1MCNA 4MJJA 3LY6A 4GKZB 4LRNH 1SLVA 5D7KE 3O0RL 2R0LL 3TO2B 5FECA 1IVLA 4YSOA 5K5YA 3LXBA 1CFVH 1SMDA 2DLHA 3IT8D 3V5HB 2X4QB 4DP2X 5JIPA 4MMYB 3UG3A 3S36H 1MI5D 3EZJB 1KUMA 2EIZB 2H1PH 4MZ3A 3HTLX 3F05A 2WLIA 3MNZA 2XV3A 3RVTC 5I9QC 4JM2F 1IAIL 4ZMYA 3HNVL 1AC6A 2BP0A 1EO8H 3VFUA 1FNLA 4IRSA 3MNZB 3MRGB 5D93C 3RJOA 4I9XA 5JW4M 4JREC 5SV3A 1I8MB 4L5FL 2ETWA 4HJSA 1T2JA 1AI1H 4IRSB 4FL4C 4DZ8A 4IHOB 3ETBJ 1THCA 2KI6A 5CLYA 1NGXA 3SGEI 4K15A 4NRZB 3C9NB 5BQDA 4X4MA 2EIDA 5FYJL 4NNPH 4IKLA 3HI5H 3JWNC 4I18C 4JO1L 4PW3A 2B3IA 1ZVYA 5AOJA 4FFTA 4GI9A 5GGRB 2VERN 5GS1A 5CJOL 3O6LL 1BG9A 2CNZA 1XO8A 3OAZK 4PBWD 2PCPA 1YDPA 2PMZA 1QLFB 3IAPA 4PJ5A 3OSKA 4GMTH 4BQCA 3GSVA 2YPVH 4QF1A 3RKDC 4PJ5B 2EC8A 1DVFA 3SY6A 5AUMB 4H40A 2EUWA 2PP9A 3MR9A 3QIBD 2NUTB 4R8WL 2OMUA 4G42A 2CG9X 4QF1B 1WFJA 4JPIA 1JGLL 3FT3A 3ARBD 3MR9B 4G70B 4LBAA 4N2NA 2FB4L 3U2IA 3WEAA 4CILA 5C6PB 1FNEA 4P23D 3HE7A 4GS7C 4GAYA 4EI0A 1MQKL 3GXNA 1P4LB 2WAHA 1N67A 3EH3B 4UYQA 3GJEA 4AQ1A 4DHLA 1T6BX 4NZUH 2FRGP 4YHIA 4CMMB 5K9OA 1HX0A 2FO1A 4ZFFB 3TCXA 4MJIB 2ZX6A 1DSFL 4XNXH 2V5TA 2YGPA 3LX9A 5K9OB 5DD1L 1T0NB 4PGZA 2JQZA 4LFHD 2A1WL 4IIZA 1MCDA 3LNGA 4XRCA 4EOWL 1H3GA 1MWAH 1N2RB 1NMAH 3FOLA 3O3UN 4FGMA 5TK2A 3V0DA 4MS8C 5BZWA 4XRCB 5EEXA 2XBZA 2A7BA 1JVKA 3O0LA 4OF0A 3TA3B 4MNQA 4MDRA 4KROC 1BZ7B 4M7JL 3HHSA 1KGCE 2CM6A 5BZWB 1Z7JA 3HC0A 3KPRE 1I8LA 3BPOB 5C0IA 1NSNH 4UILH 4CU6A 3QWRA 2XUWA 2DKUA 3N1PC 3QRGH 5BVPL 2GYSA 3MV9E 1UADC 4JY5L 1A1NB 4G43B 5DHVA 1SJHA 1PZDA 4W9HC 3IPFA 3HRZC 1OWWA 2D2CC 3PPEA 2Z31A 5C07D 4AGLA 1WHPA 3DTXA 3BGMA 1SBSL 1SM3L 1XIWB 5CJBA 3ULSA 1KNOB 1I8IA 1A7QH 1YJDC 5IOPA 3BGMB 2H45A 5AVXB 5F9OL 3LJ3A 1QOKA 5T1KB 3AG3B 3OBAA 1TCRB 3ULSB 4N85A 3NA4A 1I8IB 2WQRA 3DO4A 5IB1B 3OGCA 1N4XL 1FPTL 2HX9A 4KQ3H 2VUOA 3IK2A 1QLRA 3KWXA 1P5UA 2AFNA 2YGVA 3R19A 4P07A 4DCQB 3BPLC 1LEKA 1UHVA 3CVHL 4K8RC 1UT1A 2B7DT 1HILB 5INCB 4K3EH 1QLRB 1MI5E 5J5EA 3FRPA 3SE8H 1MAMH 3LEVH 3N42B 3TIEA 4FTVB 3RL1B 2OQJB 4OQTA 2VRAA 3K6NA 3H3PL 1WYJA 5J9PA 4H25A 3L4WA 1I53A 3IS0X 3TIEB 3KPSA 2BRQA 5F7DB 2GIXA 2JK5A 4MB5A 4UT6H 1YRKA 5J56B 1N5YL 5BNXD 5J9PB 4J4PA 2IBGA 3KPNA 3SE9L 3FQWB 1GJUA 1HNFA 4PWKA 2JK5B 3SPCA 3UIZA 2P5WE 3RGBA 4A2MA 3SDXE 4PHZA 4JEGB 3ESOA 3PDDA 4CDGC 1J5DA 3C12A 4NLHA 1LD9B 1F18A 3RBSA 3O4LD 5EOCH 7FABH 2AXHA 3BZEA 2W81C 1P1VA 3N85H 1T20B 3KLAB 4LRIA 3ZT6A 3Q9QA 1CFSA 3VFMA 3UTTD 1V3LA 1YSOA 5EOTB 3AQZA 2W9EH 3DXAA 4TTDC 1R47A 3EJZC 1JZ6A 4J3OG 4EVNB 3CK0L 3BE1L 2JFCA 3QQ9D 4KY1L 3FB7A 1R3LB 2XOTA 5FGSA 4EDWL 2A9DA 1TNNA 1KTDA 5JMRA 2EEBA 1ED3A 2VLKB 2FUTA 3GSNA 2ZG1A 3FB7B 1NCOA 2MCPL 2X9XA 1MWAB 4Y4HD 5TDNA 2BY2A 1JZIA 3QHTC 1ORQA 3KPLB 1EHAA 1J8HE 5L8LB 1F56A 4RDBA 4EZMA 2Y2TA 1ORQB 4BFIB 3O8XD 3RUGB 1NGPH 2R8SH 1QRKA 3POCA 4WUKH 2FATL 3O41A 5BOPA 2DQEH 2Y6SD 4JANB 2MNUA 3JVFC 4X8JA 1FSKC 4BWUA 5ISZD 1CE1L 4H8PA 1WZAA 4ZFQA 1S7WB 2DQDH 1MW3A 1RJZB 4MCZA 4OGYL 5AALA 1GRWA 4P2OC 4NYLA 2WV3A 5CXPA 3TCLA 2I07A 3BJLA 5KSVA 4HMEA 5IW1B 4ODWB 2W88A 1H8LA 1C12B 4Y9FA 3UBXG 5GXBB 3MX0B 2LGNA 5DFVD 3D0VA 3T3MB 2PPAA 2TRYA 3B43A 3WXWL 1YEDA 1NBVL 2I07B 3B6SA 3TCLB 1HFUA 4X6FA 1UA6L 3NFSL 3INUH 1O6SA 2IXQA 3RY5A 5DC0A 1VDGA 2D3JA 1QBLL 1J18A 5T3XH 3FUMA 4PWFA 5JZ7D 4X6FB 4KI5C 5F7UA 3R0MA 4P3CH 4Q0XH 5IMKA 1NZRA 1BGXL 1K2DB 1MCKA 2A83B 2N01B 1I1CA 5EO1B 3WFEL 3NCCB 5C07E 4FQ1L 4HUXA 1D6VH 3DOSA 4YE0A 3SOTA 1A6UH 5IQ9A 5L8JB 4E9SA 4I89A 1Z6JT 3D2UA 4MNGB 5EZLA 1XMWA 4HUXB 4TNGA 3DTDA 5HTSA 1UKTA 4BCYA 2G75B 2AVFA 3ET9F 4CC4C 2BSDA 3HC2A 2VRKA 1D5MB 1NCJA 5HHPA 4EMZA 5EZLB 1RZJC 3QUYD 5DVKA 5I8EA 2E0PA 2MMXA 1F13A 2IMMA 3P54A 2JJTA 3GMOA 4KRMB 2XT1B 2Y6TE 4NN6B 3T9WA 5CEZL 3ZE1B 1RIUH 4U1LB 3TBSB 5L6YH 2GK2A 2Y7QA 2Z1PA 2AQSA 2EDQA 1U8CA 3VI3F 3QBTB 3B37A 2CQVA 5IIEA 3OJVC 2HT2C 3RWDB 5JW4Q 3T8VA 4NJ9H 4OJEH 3IRPX 2EE0A 3JV6B 4XNZC 3SSGA 4XN1A 4CSSA 4PBVC 5I18H 3HZKA 5FCUL 3EG9A 1AACA 1V3MA 1KG0A 3EOAB 4JVUA 4M3HA 2CJTA 3NPSC 5DK2A 3EG9B 4M02A 5AOIA 3FB8B 2FCBA 3AS3A 1BJMA 4HT1L 4BBWA 2GI7A 2YKLH 1NANH 4DK3A 1CYWA 2BP8A 4XP4L 3UGXA 1QSEE 3PFUA 3BYTA 1JN6A 2XVGA 3SE3A 3O4LE 3WS3A 1SEBB 4Y5YC 3BC9A 2IQAB 5ICYA 1UOVA 3I3EA 4LAQH 4UTBH 1DVZA 3O2WL 4YIQB 2MPVA 3BKJL 3UTTE 1S9WB 4MB4A 1HH6A 5ICYB 4HCIA 2QADB 1G7PA 2XTLA 3WE6A 2O93L 2UX7A 1IT9L 3QEUB 4Z0XA 1VJSA 1FRGL 5IFJB 2EUZA 1HH6B 3VWJC 2XZCH 3X17A 2Y25A 1AR1D 1QHPA 4Y1SA 3LSOA 1JGVH 3DGGA 2G0KA 3SBQA 3GMNB 2HTKC 4Z0XB 5I8OH 4PR5B 3VDCA 2E8YA 5D5MA 3AGWA 2O5XH 5LBSH 3BZFA 4I2XB 3LSOB 4TKWA 4JW3A 4QHKI 4LXFA 4S1SL 4HLEA 2OKMA 5E9DA 3RIFF 2ODIA 4JFEA 3EAKA 2C8NA 1SOKA 1AGCB 5BQ7A 4XC3L 2AXGA 2Y36L 3FMGH 1HYSD 3M7OA 5D8JL 1ZV9A 4JFEB 1FVDA 2M1KA 2YXFA 3D85A 3F5WA 2AXGB 4HA1A 4XMVA 5KN5A 2H7WA 3QAQA 1TEFA 5ISZE 1H15A 1WEJL 1JPSH 4LCVA 1L3NA 2HJKB 2VH5L 3UTQA 3NQIA 2YEQA 1ZVNA 4LU5L 2JMRA 4ZS7H 4KKAC 3SY0A 4U05A 1AXTL 3CFEA 4Z77B 3FUEA 3WN6A 4XBEL 2ZXBA 4JJHA 2FEDC 4NPYB 2JB5H 3VD0A 4JFFA 3MZGB 3O2VL 2DIJA 3FU0A 2KLRA 5E2UL 4NKQB 5CN1A 4U3XA 1HOCA 2GSGA 4TPRL 3NTCL 5K69A 1ADQH 4PS4L 4WKXA 3X1FA 1KCWA 3G6AA 4WGWB 1HOCB 3FSVA 4GAJL 2GSGB 1O7VA 4KRLB 5ESAA 3QFDA 3NJKA 1RERA 1TU2A 4KJYB 3QFDB 1S5IH 3EYSL 1CGTA 1IFRA 2VB5A 1D2PA 4XNMB 1OHZA 3EOTL 2BFVH 3IM1A 3PWJB 3QEGH 2GKIA 4P46C 4DFHA 5HGBA 1FP5A 3DBXB 2XA3A 4G7SB 2A6IB 3VXMD 4RFOL 4U1JA 1AHKA 1J86A 1YHPA 3UAAA 5CJQL 3ZXAC 3MUJA 1TYEB 3MOAH 4AQAA 1P4BH 1YA5A 2BDNL 2A77L 3MVSA 4KXDA 3TT3H 5EF0A 3MMEA 4LL9A 4L1DA 4ODXA 2AQ1A 3JVGA 1XTMA 3OWEA 4AEIL 3RLSA 4APQA 2PYED 2VOTA 4UQ2A 3ALXA 4S1DD 5ACZA 4K9JA 1LO5B 1UVQA 2DIBA 3MMEB 5D1ZB 2B08A 3P9MB 3OXRA 4WRLA 2P44B 2GHZA 4UQ2B 1C1EH 1UVQB 1S7SB 3CIQA 2VLRB 1SJEA 1BVLA 4PJGA 3ZT5A 1MREL 2Z65C 4FQCH 5FK9A 2HUHA 3BEVB 3T77A 3P4OA 3LIZL 1JD9A 3L5XH 4U1HA 2GG1A 2D9QB 1IBGL 1J12A 2B0SH 2BW5A 2DN7A 3QORD 4ZO7A 4M7KL 3T77B 1RHHB 2B1AH 3P4OB 4RAHA 1HWHB 4BE5A 4U1HB 2V5YA 3L5IA 1NANI 2BNRB 4HWBA 4G2AA 1RK0A 4L8SB 4NJAH 4L3EA 4OGAD 4AH2B 4BJLA 1EHLH 4JMNA 3SE6A 3VACA 4DUVA 5E94A 3EDDA 1OQOA 4LLYB 3K91A 5EUOB 3SQOH 3T0EC 4Z3HA 1EPFA 1NLDL 4HKZA 3MUZ1 3MV7E 2XFGB 3D87B 2D7PA 1E4JA 4JR9H 1IB5A 3DDFA 4J3OD 3WKQA 3BMWA 1IX2A 3PABB 5DQJA 3F62A 4ZXBC 3VGAB 3BT2L 4F3FA 1DBBL 1YZZA 5D1ZI 1XT5A 5DQJB 5E5LA 3GSOB 4Q9RL 4EJ1C 1S2EA 3MLZH 4H8WL 1M56B 2YFOA 3RHWK 3K6FA 3FFDA 4X7SL 1NKGA 1WHOA 4K7FA 4WFGD 3BLBA 4IBLT 3MRPA 4ZJ9A 3FO1A 3IJ9A 3O4OC 4K7FB 4OD3L 2N1TE 3HKZA 4KRPC 1LTXA 1RUQL 1TQBB 3L3GA 2J5LC 4FNSA 4HU2A 5D6DC 4GT0A 3APNA 4TVPL 3P4MB 4NQDA 2AJYH 5CZVH 1I1AD 4Y2DA 3L3GB 1VACA 4OM0L 5D1XE 3C5JA 2QKIB 3TM6A 3IGLA 2COQA 2YXVA 5MEQA 3MCG1 1WFOA 3UZVA 4NQDB 5JQIB 4FP8L 4WW2B 1JV2A 3CHPA 4LEXH 1IQDA 4FYSA 3C5JB 2ZAGA 4KFMA 3V4VA 4FQLL 4WJ5B 5B1AB 1RZ8A 3UZVB 1VB9A 3G5YB 3STZA 1FA4A 3RA7L 3CZNA 4B9KC 5FKPB 1OAXL 2IPTL 4Y4FD 4XN8A 4F37F 2QGDA 2GIYA 4QTIH 1E4KA 4PJ6A 3STZB 2ZZUT 2A99A 2EADA 1E4XL 1URZA 1GIGL 2WYHA 4TV3A 1M3JA 2EIEA 3P73B 1Q9WB 1MNUH 4HP5A 4EDXA 1MPAH 1TZHB 3GXUB 1T2QH 1A6VH 3MLTA 5ELIA 2YPLB 3Q5OA 4N5UA 2J43A 2ZOUA 3H8NA 1SOSA 5A40E 3BAJA 2P48B 4LLVA 4N26A 4U31A 4YFEA 1GYAA 2JE8A 5INDA 2IEPA 5GGSB 3EBGA 2F15A 4NRYA 5C86A 5IM7A 3ZW3A 2F74B 1GHFH 1TVHB 3GIZH 1DVQA 2BX5A 2A6KA 4O58L 5EORH 1CG9A 1G43A 1CGYA 2OV0A 4LHQB 5CN2A 1HEZA 3VJ6A 5HJ3A 3TBWB 2I69A 2CXKA 2A6KB 1JTOA 3GBDA 3VXME 1CFNA 3HN8A 4IOSA 4P9HH 2WY3B 1M9WA 2OAAA 5HJ3B 1X5JA 3FT9A 3IEAA 3BISA 3O6KL 3IDJB 5AENA 4LVHB 4OCLC 2WANA 2H2PD 5FFOA 4APXA 3EYOA 4Q4IA 5F6HJ 3VI4F 4ODTL 3H9HB 4FOMA 2X4PB 1KCBA 1U3HD 2BXZA 3RIFK 2QELA 2AAAA 3EYOB 1GZHA 2YJQA 3LS4L 4JRFA 3W38A 3L1OH 2L7UA 2FL5A 2HUEA 1S78C 3JWDH 1XZ0B 4CVUA 2X7LB 1U8JA 1IGCL 2IGLA 2QQQA 3JWOL 2ZCHH 4FQXC 3TA3C 1S7RA 2JJSC 6PCYA 1IMHC 1P6FA 4KJQC 3ES6B 4DEPC 1DTUA 1U8JB 3V6OA 2B77A 1YEGL 1S7RB 5IMMB 5T1LA 1BF2A 4YDIH 1EANA 2C3GA 2JIXB 4RESB 5K1NA 1T6VN 1OV8A 3T65A 3THMH 3PNWB 2B4CL 2BIOA 3PF2A 5T1LB 4YOKA 5M94B 4WCYL 1DUZB 2B3RA 4YSQA 5F21B 5EZJB 4GSQA 2D3LA 3MBXH 2WVVB 4ETQA 3ATAA 5C0CA 1F3JB 4AJYV 4YFDB 4ABQA 3L3HA 2D8KA 4TQEH 2XVLA 4HF5L 1BAWA 1G9EA 2HKFH 3O45A 4JM2A 1LO0H 1FDLH 3OXSA 3CSBA 5GRYA 3IDXL 3HPJB 4PREA 4CDHA 1E5CA 4KKPA 4XX5A 3NSYA 3O45B 4D9QE 4WFGE 2NCEA 5E1AB 3IXAA 3S4SG 4XMKL 5GGRY 3DX9B 5D7JA 1KLFA 1UD4A 5KJ4A 1EJOH 4NKOA 5IV2A 3T3PE 4CN4A 2YN5A 1PKQE 1HL5A 2IWEA 3J7HA 2OTUB 4URTB 1KIPA 3BSZH 4XI5C 5EN2A 4NKOB 4JE4B 2BCMA 2D7NA 1YVLA 3WCYA 1M6UA 5LVEA 1I8KB 5K1VA 1JYNA 5EEWA 2FBJH 2QQKL 4PVLA 4R2GC 4XCYA 4E41A 5F96H 3ULVD 1E7UA 1BIHA 5IROC 4XPAH 4KY2A 1VGKA 5TE6H 2EYRA 4XCYB 5J7CC 1BP3B 1TQWA 1Z1WA 2BOCA 2NXYC 1XF4B 2IDFA 5TF1L 5JOEA 4W9GC 4P5TA 1R3KA 1VGKB 3KLKA 1LO3H 1EFXA 1Q0XL 2CLZB 1IV8A 4FFYA 1ZS8B 3C5ZB 3TLRA 3QSKB 4OTXL 2WZ6A 1YY9D 1RZIB 2VZOA 3UAJD 4YHPA 1MCEA 2HPOA 3KPRB 3NJJA 1MKFA 1YN7A 2NY2C 1DSYA 3CHXA 3TN0B 1SFHA 1SF5A 3MJ7B 2ARJB 3MV9B 7CGTA 2ZX9A 1LK3H 2ITDA 1XB6A 4O51A 3BW9A 1DQJB 1EDQA 1UWGL 1KXVC 2R4RL 4IQHA 4O51B 4JLRA 3BW9B 4HW6A 4ISVB 1BBDH 1YEEH 4NO5B 2XN9D 3BO8B 4F57H 4XP5L 1EMTL 3EO0B 5C9KA 4MVBD 2YMOA 5FWRA 4JFDA 2E9GA 4P57A 4KUCD 3NN8B 5DJ2A 5BV7H 3CPLA 3X2QB 5IEKB 2R51A 1UM4H 2I60H 4P57B 2LFEA 1M71A 3LKRB 2ZOLA 5CFHA 2BCKA 1I9EA 3FT0A 2DTMH 3HG1A 3KMDA 4PJ9C 5ICZB 1DQQB 1SUHA 4Y8AA 4QDGA 5MP6L 5A2JH 2XC8A 1MI5B 2ID5A 2VLLB 4I3RL 1EZVX 2ZOLB 2BCKB 2W92A 3WO3B 5IF0A 3R4RA 4HH8A 2WWKO 3NJFA 5EV7A 2HT4C 3KYKL 1DUYB 1G1KA 3KLQA 5I17A 3C75A 3MROB 4WI0B 4AKOA 4CSPA 3QHFL 1D5BA 5IF0B 4F7TB 5C3LD 3QZWG 5IKCA 4IRJD 1JGEB 3Q9PA 4Z9KB 1CFQB 5I8KH 1B3JA 4U6HA 3TEZA 1KCSH 5IKCB 5CCGE 3WJJA 4UQDA 3Q1EA 1URIA 3QNYA 1KPUA 2E7BA 2JKXA 3MRRB 3SDXB 3IXTA 2B4CC 4F5CA 3CZJA 4NQUA 3U46A 1DBJL 4F37K 3IXTB 3ULVF 1ZD6A 2FQFA 3U46B 4HBQA 1EX0A 3C6SA 1KGJA 2J44A 1GOGA 2FD6L 3SGDI 1DJXA 1ZT4A 3RU8L 4LCWA 1SDAB 1CT8A 3QCTH 3P9LA 1DLHA 4XXDB 1MHHA 4C55A 1KBWA 1ZHKA 4PV8B 3MLUL 4BFRA 3FL7A 2J56A 1S7XB 4PB0H 1AD9A 5BRZA 3QIBB 1ZHLA 3P9LB 4P5MA 1MHHB 4RWYH 3IDIA 4CBZA 5BW7A 1SDDA 4MHHI 1Z0NA 4UZUA 5HI3C 2DMHA 4NERA 1R17A 1LMKA 1L3WA 2CE6A 1AD9B 4HJIA 3ARBB 2IPKA 1RUKL 2BIMA 5AKVA 3S5ZA 1MUJB 1F6AB 4P23B 5FS5A 1KJMA 1SDDB 4UBDD 4EI5C 2WVTA 4ERSH 5TPWH 3CCHA 4HEPG 2BSRB 3BGAA 5DVLA 2X88A 3K72B 1OSYA 2DL9A 2R1XB 3ESMA 1R0AH 2PWHA 3KYNA 1R24A 5IBLD 1Q0EA 4KO5A 3CCHB 3MLWL 2WD0A 3SYQA 3RX7A 3ULVE 5D4HA 2JNZA 1T89A 3KYNB 1R24B 5C7XL 5DEZA 1QR1A 4XPHL 2G5BB 1IAKA 5G55A 3GMMA 4O02A 1CN4A 1KN4H 1FHGA 1RK7A 3CC5A 4LLUA 1FNAA 3O6ML 3CFCH 1T1ZA 3GI8L 1QR1B 4D0BB 4QCIA 3CFKB 4MZIA 1PSKL 3ZTDC 1MJ8H 1T1ZB 2AEWA 1USZA 1CLOL 2V2XA 3FAWA 4JY4A 3HNSH 4HWBL 2QADC 4MYPA 4BQ9A 2YQBA 2HFFA 4X4ZA 3V79C 1G9NL 2X1WL 3VXTA 4YZFF 1BQLH 2X28A 5EF3A 4JY4B 4HIIB 5C07A 4CA4A 1HSAB 1N5AB 4AMXA 4RRPM 2BVYA 5DD3H 1RZGA 4RIRA 4OZFH 3S2AA 3ZPDA 1AKJD 2A5UA 3QNZA 3PXHA 4X7TA 5GRZA 2RMNA 3Q2LA 4P2QA 5C07B 3S37L 3QEHA 3FUNA 2VLJE 4H44C 4PJIF 5KBPA 4PLJC 4RIRB 4X7TB 3GXDA 2JKSA 3HZMB 3KXFA 3KVDD 1IVTA 3T2QA 2XN9E 1OAQL 3N40F 4KH2A 4IW4C 4TSAL 5T5NG 2RBLA 3WLBA 4N8PA 2PKDA 3NZSA 4BZ1A 3UROR 1QLEH 2WTPA 2JI2A 5A2KH 4OCWL 2J6EH 1TTAA 2EXTA 1GTFA 2BWIA 3SYOA 5BRQA 3VU1A 5K39B 5FYKU 3P11L 3QFGA 3CSTA 1HINH 4LNVA 4JPVL 5DLLA 4D2NA 1CJYA 1T66D 2OTWB 5TE4L 3VCLA 4ABWA 3GPEA 3V8CA 4ONHA 3ZL2A 3ULUD 5ILTH 5DS8A 3PL6D 2IH1A 3US0A 1C9SA 4L2YA 5ETUB 2WYZA 4PJIE 4PSPA 4QEGA 3E9TA 5DF0A 2EYSB 4DP0X 2GJZB 3PP4L 2K6WA 3KLDA 4TULL 1JUFA 1FF5A 4ABVA 3B9VA 3I6KA 1S8DB 4GEJA 1U2CA 3HI1A 2Q1EA 4BWTA 3C6EA 1IGTA 1NKOA 3VI3A 2HKAA 2A9ML 3O4LB 3S88H 1PD1A 3DK2A 1NDGA 3UTTA 1HAWA 3IPBA 2X3BA 4JFYA 5F9JA 5F7LB 5FHAH 4C4UA 1IGTB 3MRMA 4MDIA 3UTTB 2JTYA 4RSYA 1WDAA 2ZUUA 1UXMA 1DBML 3CDYA 3CPUA 3QYMA 4XBPA 2WUCL 2Q7YA 1OF2A 1GGYA 2ATKB 3IDYB 4RMSA 3GRBA 1OL0A 4J6IA 2HRHA 2MPAL 3B7RL 5DHMC 5EIIG 4WTQA 2SODB 3ZTNH 2CO7A 2V7HA 4IRZA 4XVUD 4Y4HB 2FGWH 2PXYC 3N6YA 3TWCL 4GKOA 3FB6B 2RCSH 5T3ZH 2F0CA 4Y2NA 2CGRL 4ODUB 3UP1A 3A67H 3C60D 4I0PD 4MQ7B 4PFEA 3CU1A 4AL8L 4AV4A 3O8XB 1X9QA 5HDWA 3S35H 3VQ2C 4W9JC 3VU2A 3TBCA 1G7HB 4IIQC 2VM4A 2E4TA 4LK4A 1AXSA 5ISZA 5TK4A 3RWEA 3FB5A 2FQDA 5E1IA 5F7WC 3Q06A 4KDWA 4OZFB 4LPCA 2VMEA 1AXSB 5ISZB 2XNAA 2PO6D 4ANKA 4XCEA 3FB5B 2HRGA 4UNUA 4PRDA 2VDMH 4AV5A 2D31A 2FJUB 3MCKB 5IWLC 3H53A 3LQAL 2X3CA 2E9JA 2EDOA 4PGDA 1J0JA 2IDUA 3B3IB 4P5KA 5TDPA 2UWEF 2WSPA 2PTVA 4HD9A 4S1QL 1I3GL 4L8SC 4WHYG 2CHZA 4TNWF 1CWVA 4POYA 5C1MB 3I9GL 3I3DA 4UT7L 3NIFF 4JGJA 1KYOK 5H94B 1E5ZA 1UT9A 1PIGA 2X9ZA 4P5KB 5TDPB 3WKML 3W37A 5AWNH 2YA2A 4IU3A 2HA1A 2GSIA 3ARGC 4OFDA 1TTUA 3ULUF 3A22A 4UOZA 1HIMH 5AYUL 5AZEH 3CFNA 1BIIA 3I74A 1NBCA 5GRUH 2GUOA 2AABH 5C70A 3UYRH 2WC7A 2X87A 3BWUF 1O7DC 3QXWA 1OTSC 3OLEA 2P80A 4NUGH 2WO2B 4A7SA 1SXSA 4ZODA 4X6BA 4X9FA 2W94A 4I87A 3CDZA 4GBXA 3QUYB 5FUZH 4JFZH 3FCTB 4DF9A 3BSGA 4ALAL 1RMFL 3HR5A 4UWQB 3I02B 3SBWA 5F89A 4J28A 1ZTXE 3CDZB 1CE6A 3HVDA 1HVXA 1RSYA 2WXPA 2IDQA 5B1BB 4HV8A 5F89B 4IJTA 3ZKXC 3ZSTA 2QKIC 3NIFE 4LVNB 5L8KB 3N44F 4MMXB 1B0WA 2H9GA 3FUKA 5AG8A 4ZYKA 12E8H 4WW2C 3E3QE 4HV8B 4J7RA 3ULUE 1T04B 3REWB 2AQNA 1YECH 1CZ8L 5E6YA 1M1XA 2FEEL 3UTSE 4E36A 4ZYKB 1HL4A 3ELQA 4GIPD 5CMAB 3GZPA 4M61B 3HZYA 4PJBF 2DWDB 1YC7A 3LRSB 2YD3A 5CP3A 1R3JA 2YMXL 1QFHA 4JPKL 3NZHH 3LNHA 1J8SA 5AOMA 2MCAA 4GIOA 4GB9A 4FQPA 3VXOA 4H1LH 3FXIC 1NCCH 1R3JB 1KJ2A 4XC1L 3CXHK 5JDJA 4FFYL </