3IXTA

Crystal structure of motavizumab fab bound to peptide epitope
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
220
structure length
212
Chain Sequence
QVTLRESGPALVKPTQTLTLTCTFSGFSLSTAGMSVGWIRQPPGKALEWLADIWWDDKKHYNPSLKDRLTISKDTSKNQVVLKVTNMDPADTATYYCARDMIFNFYFDVWGQGTTVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Motavizumab Fab light chain
publication title Structural basis of respiratory syncytial virus neutralization by motavizumab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 38
structure length 212
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ixtA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ixtA01
2HT4C 2E9JA 5DI8B 1AXTH 1K2DB 2VL5B 4LEXH 1AGCA 3IAPA 3RVXC 4PP1D 5HHQB 1EFXD 4UDTB 1NGPH 4K71B 4LCCA 2BRRH 1J8HD 4QRPD 3CX5K 2HVKA 3RQ3A 5D72H 1RHFA 3ZO0A 4H8WL 5C08A 2DQEL 2OR9H 4E41B 4PY8J 3ZKSD 3D3VE 4L8CB 3MODL 1YDPA 3VWJA 3D39E 4M5YL 3V52H 1OD9A 4F33B 4KKCD 3SBWA 4DVBA 2YD5A 1CDJA 4P2QD 5GQBA 1FNEA 3LB6C 1ZT4B 1J05B 2DI8A 3EFDH 4QHLA 1QSED 4EUPA 5IV2B 1OTUD 1X5FA 1J0HA 1VEMA 4OD3L 4UMGA 1NFDF 1F8TH 3U0PB 1CFTA 3S36L 4P3CH 5JXAL 5KN5A 4NCDA 3NTCL 2QQQA 4MJIE 2DKMA 4JY5H 4JO2H 1UJ3B 4D9LL 3WL9A 1HQRB 5H37G 1E4KC 3RNQB 2VR4A 2CDGB 4AEIL 5J4MA 2CDEA 3VXSB 4J23A 4JRXB 1DCLA 4BSVB 4N1EA 1YY8A 2A77L 3W39A 3JZ7A 1KV3A 3JWOC 4PS4L 3O41A 4MAUL 1LEKA 3IETA 3IDGB 5GS0D 3VMPA 5CP7A 3S37H 2J6EH 2OR7A 1W0WA 4WW2B 4GRLB 4WWKC 4GG6A 2HFEA 2DLFL 3F8UB 4LPCA 2OK0L 4PY8I 2YK1H 3CFEB 3E8UH 4LCIL 4KDTC 1SEBB 5DRXB 4W6YB 2AEQL 3EAKA 4PJXF 4TSCH 5FKPA 4GQ9H 4J1UB 2GJZB 1NLDH 5JOEA 4NQDB 1RJZB 2XN9E 3CU1A 5E5UB 1CXEA 2OSLB 3AREA 3ULSA 3EGSA 3LPGA 4RFNB 1D5BB 3GSXA 3T65B 4NC1C 4NDMB 1TJIL 2AK4D 4Z7UA 1FLRH 5C0GA 1OCWL 5SX4I 3MLWH 3PQYE 3VFGL 1BP3B 2NW3B 4F9LC 1J5OL 3UTTA 4OCXH 2I25N 5K9KA 5I19H 4Y19A 4NZUH 3MV8B 5EU4A 5KANI 1U93A 4QF1A 4ELMF 1LNUB 1WZLA 3GM8A 1G1CA 3X3FH 1RUKL 4NBZB 4PJBE 4G7YL 5JW5A 3N0PB 4WNQB 2OP4H 2ESVA 3QWQB 4JQXA 2HLFD 5EC1B 1E6JL 1KXVC 4LARH 1C5CH 4QXGL 4RWHA 1DEEB 4JFEB 3P9MA 2IBBA 2AXHA 1NCUA 3LS5H 4NRYA 3OAUL 4OGYH 5ANMB 5MEND 4AEHH 3I6KB 2VRAA 4LRNH 5ERWB 3SBWC 1ZS8B 1GGUA 3LH2L 4K2UH 1UEYA 5DHVB 5GJTH 1NDMA 4PJ7E 3WFBH 3AXLA 1WK0A 5K93A 1JZ6A 4RX4D 5L6YL 3TN0B 3S36X 1DBKL 3VFWA 5FUOH 3U30C 1FIGL 1QBML 1CLZH 1KENH 4E42B 3SKOB 2ARJQ 3H3BC 1KCRH 2CK2A 4LPVA 3FN0H 4X6DF 4NQXB 5DGRA 5ESAB 5ABDE 4XXDB 1RZKH 1A02N 4X6FB 3V0WL 4PB9L 5DMYA 2AEIT 5KSUB 1RUPH 4PJGE 3SJVA 5D6CB 5E6YA 5F7HA 4HXAH 5ALCL 1TMCB 1W0VA 3U0TA 1CDGA 4LIQE 2XZAH 2L4OA 4IRJB 4PJ5D 4QTHA 5IMMB 1NFDA 4LHUB 4TNVK 2WP3T 3P4OA 4GKSA 1CD9B 3LKOB 3QG7L 2OZ4A 2KBGA 2Y06H 1KOAA 3MMEA 1V3JA 3SDDB 3B2VL 1X5AA 2CGRL 5JHDD 2YD7A 3MNVA 1JGVL 3RGHA 3EJYC 3NA4A 2VDPL 5AG9A 4C57C 4KMQA 4NKQB 3VI3F 3D0LB 3HE6B 5KVEL 3VWKD 4KTYA 3IS0X 4I48B 4QRQB 3GK8H 4O5LH 4AIOA 5FK9B 2VH5H 5TFSL 1WF5A 4Y7MA 2V17H 3QCTL 2EIDA 1ACZA 3AREC 1YEJH 4Z8FL 4PP2B 1KCUL 1H3PL 4MCYA 1S9VA 4BFEA 1K85A 2CO6B 4YHIA 1NC2B 4YK4B 4R96A 4YWGH 4FTVE 5KW9H 1T66C 3C8HA 1FFQA 1FDLL 4FMKA 4PJXA 1H5BB 4R7DA 5KJRL 3L7EB 3S88L 1T83C 2VABB 1IGIL 3SE3C 3C6LD 2V7NA 3HRZB 1UWEH 1FNGA 2D4FA 4GAYA 1ZHNB 3QPXH 3OR7A 5ADOL 3DO7B 2R9HD 3G6JB 3PUCA 2ARJA 3BIKA 1JPSL 5GS2D 1AGDB 2PW1B 4OCLC 4NRZB 3B5TA 4Z7QE 5BRZE 4I9WD 1BZ9B 4JVWA 3MNZA 4K3DL 5IVXE 4NFDA 1E27B 2IFFL 1HZHH 1HXYB 4LDOB 3MRDB 4Y0GA 4OAWA 1KJ2A 3KJ4B 1KF9B 2IQ9L 3MRNB 1HHJB 3GMNA 5GGQL 1CU4H 1GL4B 1S7XB 4ELMA 3WXWL 2XG5A 4K23H 1FJ1A 2X9XA 4MNGE 3KPPB 1VB9A 2X4RB 3B8YA 4LSTH 5B22A 1DP0A 2XA8L 3UDWC 5GJSH 2EO9A 3VGAC 2GTZB 4HIXH 3QDMA 1X4YA 2ED8A 1MIEH 2VDQH 3RL1A 2D7NA 5A40E 4CN6A 3D9AH 5IROA 2JB6A 1N2RB 3MRPA 5EOCJ 4MQ7B 4FQXC 2DDQL 3LIZH 4HH8A 1CDIA 2YKLL 1BQLL 3UJIL 1QUNA 4KJYB 2V5SA 3SGDI 1F02I 2BY1A 4G8FB 1AXSA 1QZ1A 3DBXB 3Q6FA 3TA3D 4ZAKC 5TPWL 4LCYB 2GY7B 2G60L 1RZGA 1MFBH 4ODTL 4XVUC 1OAKL 4WUKL 2Q3AA 1E4JA 5I30H 4NWUH 5TDOB 4MAYD 4S1DC 4M61A 5IKCB 4EBQH 4GQPH 4HAFA 5HHNB 1LDPL 1X5ZA 4KZEH 3V8CA 1A8JH 2HH0L 2NZIA 4N9GA 4ETQB 2BVOA 2IALA 2X4SA 4BK4A 5D7IF 3LQAH 4NHUB 2ERJC 1UACH 3O9WD 1HNGA 4TULH 1F3RB 5FHAL 1HCVA 2ICES 4WI2A 4BQ6A 3QULA 2HT3C 3ME0A 5C07E 1IGYA 1D6EA 2I07B 1BEYL 3RX8A 3QQ9D 1NFIA 3RDTC 5CEZH 4WWKB 1G9NC 1H8NA 3WFEH 2V2TB 4P5KA 5DZLA 3SDCC 5E08H 5DMGD 1EA9C 1FFNB 1PEWA 1YEDB 3D0VA 4P9HH 4WVRA 2JTDA 3PWVB 3MLSH 1JMXA 3VRJA 4MD4B 3QYCA 3T0XA 1XCTA 3LKSA 2ATPA 4TQEL 2UUDH 3HAEG 5D6DA 3V5DB 3ULUD 3ARGC 3DX6B 1OSZA 4I4WA 1HE7A 1S9WA 4M7JH 3IDIA 1FNSL 3JWDC 2JCCB 5ICXA 4Y4KC 5AAWA 4NN6C 1MREL 1SYVA 2YA1A 3CXDL 3T0EE 4LRIC 4AK1A 4PYHA 4D0DA 5HGHB 3QFJA 2NY1C 3TLRA 4XHJD 2XWBA 3MR9B 2BC4A 3U0WL 4DJMA 1DVFA 1X6LA 5EFIB 5A2KH 4C58B 4LPWA 4QKXB 3EYSH 4LCCB 1CBVL 3B9AA 3N1MC 4KJQD 5D5MF 1AR2A 3HC4L 1JYNA 1N6QL 4HG4J 5IT2L 3HZYB 4MLIA 4XPHL 3IF1B 4YAQB 3PHQA 3ZTNL 4O2FA 2UUDK 1RIVH 1R3JA 3INUL 1YDPB 3VWJB 2NY5H 5F7DA 2ZUTA 4HCRH 4KI5D 3GSUA 4R90L 4M93B 1KPRB 1FNEB 4JFFD 4BZ2L 4QHLB 4EUPB 4MMXC 1A6TA 5TH2B 1CFTB 1GVIA 3QEGL 3U30B 32C2A 5KN5B 2W60A 1OAZH 2YD3A 4YZFF 1F90L 1QFOA 4KRPB 3ZSSA 1KB9K 2W07A 3U48A 3ET9F 3V4VL 2EE6A 4I2XE 3C60A 5HBBA 2CDEB 3JVGC 4ONHB 1QFWM 2CLRA 3R8BB 4QRPE 3TP4A 4H1LH 3O41B 2QADC 4U1MA 4YBHA 1G6RA 1R3LB 4KJWC 1LEKB 5ADPH 1FNLA 3R0MA 2R15A 2EDOA 1W0WB 3KHOA 5LWYL 2AGJH 4NJAH 3PHSA 4OIIL 4RSVA 3L5HA 4KY1L 4P2QE 1BWWA 5FKPB 4HS6B 4X4YA 1ACYL 4TSBH 2VO5A 5D7IA 2Q8AH 2IANE 4OZFG 5BVPL 2ZNXA 1P53A 3AREB 3HI1B 3ULSB 3EGSB 3QUYD 1H3TA 3GSXB 4GMSH 3VFNA 2Y07L 1X44A 4FQCH 2W1NA 4Y16C 5C0GB 1ZKAA 4XGZB 1HHIA 3C5ZA 4JDZA 3UTTB 1UA6H 3O4OC 5K9KB 2CR6A 4K8RC 1T1YA 3ARBA 5JNYA 4Y19B 5EU4B 2R23A 4L5FL 5E2JA 5I18H 4GRWF 1IMHC 4G9FD 1U93B 2V2XA 2FBOJ 3WHE0 5DZOA 4YEFA 3ARDD 5JMOC 1IGTA 5JW5B 1EAJA 1BQHB 4LSRH 2ESVB 5DQDH 3F62A 4KKAD 3WHE1 1P2CA 4ZFFA 1U8OA 1FAIH 4NRYB 1OM3L 4LAQL 1LEIA 1FP5A 5CIPA 2MHAA 4CJ0A 2AERT 3VRLF 3C09C 1NDMB 2D7TL 3UBXA 1NUNB 3AXLB 5GS0H 5MEOA 5D5MA 3VFWB 2Z93A 3JUZA 2R1YA 3VXRE 1I8LA 2LVCA 3VA6A 1TVHA 2HT2C 2VLRD 1DR9A 4HUXA 5INCA 3BKYL 1S7WA 3RWHA 4GAGL 2B7DT 3SJVB 1ZLVH 4G9DA 3I84A 4BQ8A 1N5YH 3U0TB 4ZPTA 3MJ9A 4ZAKB 3V5KA 5F1SA 3H0TA 1PY4A 2A83A 1NFDB 4KQ3H 1QRKA 2NYYC 1NGXB 1OARH 1CCZA 4GKSB 4BQBA 1XT5A 2W59A 4WUUE 4LVNC 2A73A 3MMEB 4Q58C 5K9QI 1SJVA 3MNVB 3ES6A 4QEGA 1KTKE 5I66A 3LCYA 2Y7QA 4NP4H 1CD8A 2GK2A 4FNLL 5IBLD 2OL3H 5DJAA 2CRIA 3MRLA 1GSMA 2DQFA 2GEEA 4YPGA 1S5IL 4M6OL 1MY5A 1A4JA 4Y1AB 1UM6H 1FVDB 1AXIB 3LKQA 5F72S 1VA9A 4FQQB 4MCYB 1MPAL 1S9VB 3RGVA 3FQNA 3SDCB 1N0XH 2G5RA 3HG1E 4YHIB 5FV1L 4R96B 2YS4A 3PWPA 3C5ZC 4ZO8A 1KCLA 4PJXB 2IMNA 4R7DB 4Z7OE 1AHWA 3ARBC 3WFCH 5ACZB 2F19H 2P7TB 2MMXA 4PJ5E 5E5MA 2V7NB 3U79A 1FNGB 4GAYB 3OR7B 5IBTH 2NTFA 4M8QB 4S0SD 2ARJB 4Z76A 1PEZA 3BIKB 3TFKD 3ARGB 1DE4A 1QHOA 2FSEA 3NAAH 5JHDE 4RZCB 4NQEA 3LN4A 3P0YH 4LASH 4Y4KB 3EDFA 4OAWB 1KJ2B 1W8NA 3T1WA 4PV9A 1S7VA 4HBCL 5IJKC 4AZ8A 5BZWA 3GMNB 1F13A 5AEAA 5E8EA 1DQJA 4ELMB 2Q20A 5DURD 3LN9A 3PWNA 4F58L 1FJ1B 2X4OA 4XAWH 5L8KB 3BESR 2YPLD 1B88A 2AKRA 3GRWL 4U6TA 4M7KH 2CXGA 3QDMB 5ITFA 1RV6X 1G0DA 1V5JA 1V7NL 3SKNA 3BYYA 2FGWL 3PXHA 3MRPB 2BXZA 1EHLH 3EYQD 1P4BH 2DYPA 4J4PD 1WZ1L 3I75A 1ETZA 4G6KL 4XBEH 1AXSB 5LGHL 4F37F 4I9WE 3LEYL 1V3KA 1T2QH 3Q6FB 3LPWA 4F8QA 1MAKA 3NIGE 5B39A 5DFWH 2EICA 1RZGB 4CADA 2X89D 4KUCD 2W9EL 1DQQA 2FX9L 4X6DB 1FZKA 3EHBD 5CJ8A 4M61B 2WUCH 3I6LE 3PE9A 2Z35A 1MJ8L 1W72H 4N9GB 4U0RC 2IALB 2X4SB 1IILE 4XPAH 1N7MH 3BT2H 5GS2H 3DHJA 4E5XA 4NO5A 3U1SL 4UAOB 2QADB 2FLRT 5E9DD 1IGYB 1D6EB 4OFVA 1NFIB 5CZXC 5EOTA 4PJFE 4P5KB 3L3IA 4YC2C 3AMKA 4FZEH 2J4WL 4UINL 1PVHA 2HRLA 3D0VB 4HHAA 3V4UL 5D2LE 4YXHL 3VRJB 1EJOL 1FVEA 1T7WA 3LQZA 2N56A 4BSWA 1NAKL 3QAZC 1XCTB 3LKSB 1FE8H 5AWNH 1DQML 2I27N 1YYML 2ATPB 3KYKL 1OSZB 5E7BA 1S9WB 1UH3A 3IDIB 3V6OA 3WKMH 1X5JA 5ICXB 5HI5D 1ERNA 4PRPE 4MA7H 1SYVB 4NWTL 1I9IH 3CC5A 1J1PH 3PGFL 3GBMH 3KPRA 3NMEA 5DJ6A 4D0DB 5LJYH 5LGJA 3KS0J 4HC1H 4L9LC 1XIWD 2BC4B 3UJJL 4HH9B 4YQXH 5L2JA 1QSFA 1VGEL 5I15L 1J8KA 4NGHH 3ELAT 3PL6D 3S5LA 3MREB 5FO8A 2YR3A 2C3HA 4HKZB 2YD2A 2VN4A 4ZXBC 4HF5L 2X1XR 5IMOA 3DWTA 3PHQB 4R4FL 2GITA 1XH3A 2BY0A 1T0MB 3CVIH 3T4AA 1I4FA 5B21A 5JZ7D 4GRMB 4RDQG 4FQ2H 5F7DB 3FRPA 2HRPL 1BFSA 3ZTJG 3GSUB 2DF3A 2IF7A 4MNQE 4M62L 2DAVA 5HDQH 5DMIL 4ODVH 2GFBA 1A6TB 4TNVF 2ZCKH 1UM4H 3OV6A 4X9GA 3MGTB 2W60B 1FZOA 2N7BA 3FONA 4LL9A 1KEML 3DJ9A 2JJSC 1LQSR 2JELH 2R29H 1J1OL 2IBZX 3C60B 1NBYA 5ILTL 2FATH 2CLRB 2FO1A 3MCLH 4NYLA 3ULUH 4F2MB 3BN9C 4HKBA 3QJFB 4U1MB 4D0CA 5DS8A 1G6RB 5SX5H 1HWGB 2PN5A 3D87B 3GMOB 3LVEA 3DROA 4HWUA 1FCGA 3MYJA 4PJ9D 4DK6A 2FECI 1OVZA 2PXYC 1NL0H 5DD6A 1TTUA 3VXMD 3P11L 4PJAF 3NFSL 4X6BA 4X4YB 5D7IB 3FB8B 5EA0L 1YECH 3O8XC 1FORH 2O93L 4UZGA 5I1AB 3MLYL 4G6AD 4XB7A 4JO3H 4F15C 4GW4A 5JQ6L 4JN2A 1HHIB 4FA8A 5IW6A 3FOMB 3C5ZB 5IHUL 4JDZB 1ZTXH 1JUFA 2Y5EA 1YMMD 2AAVA 3CUPA 2D4DA 5F7LB 5ITBH 1T1YB 3ARBB 1FQ9C 2LQRA 2R23B 2J6EA 4XBPA 3DI3B 2VQUA 1A3RH 2SEBA 2V2XB 4HD9A 1D9KD 3OKEA 3KLSA 4U1LA 4RGOH 4UTAH 2A2QT 2C3XA 3LKPA 1R5VA 1IGTB 3AY4C 4LDLB 2ZSWA 4I0PA 2HLAA 5DQJA 3MRIA 5SV3A 4EI6A 5BS0D 2YPKB 3QDGD 1JPTL 4KTEL 1P2CB 3QIUA 4KKLD 4PRBA 1P84K 4F57L 1U8OB 3NIFF 1AO7A 1AD0B 1LEIB 1MVFA 4FQJH 1XGPA 5CIPB 5DO2C 5C09A 1WC7A 2VKWA 4NCC1 4WGWB 5I1EH 1EVTC 3UBXB 4O2CA 4PJHE 5MEOB 5D5MB 5F96L 3FQUA 4BA8A 4G3YL 2Z93B 2AQ2A 1AE6L 5AD0A 5FO9B 3OTTA 3HE7A 5KSAC 1TVHB 4R2GB 5DC9B 3ARPA 1A7NL 3D6GA 1EPFA 4HUXB 2F5AH 2F53A 1OAXH 1UCBH 4K7PH 1S7WB 2OJZL 1JCKA 2BSRA 1OSPH 1IL1A 4G9DB 4CJ1A 4DGYL 2NY2B 1KJ3L 4ZPTB 3WD5H 5TGBA 3V5KB 2OZ4L 3H0TB 2CPCA 2FIRT 4LP5A 2A83B 4RIRB 4JFYA 5DSCA 2NY7H 4TOYH 4MZ2A 5CMAA 4E41D 5L2KB 4XPFL 3NCFB 2A73B 2PYEA 5CZVH 3X14A 4L8BA 5HHXH 3CSBA 3DV4A 3K2UL 5GRZA 3ES6B 3WFDH 1AD9A 5I66B 1GOGA 1Y18B 1YA5A 2H26A 5DJAB 3I9GL 3PV6B 2DQFB 4YPGB 3VGFA 3VDAA 3DX9A 2ADFL 2NLJA 4UV7H 2E7CA 5ICZB 3LKQB 5A43C 5FGCE 4LLUA 5EZIH 4L9DA 4ERSH 3UO1H 1SY6H 3P4MA 5DR5H 3FQNB 3RGVB 1TZHA 2YWZA 3PWPB 5I0ZA 4PRHA 3JUYA 1MI5A 4PJAA 1FZMA 4G5ZH 5LBSL 1AHWB 4Z7VF 5D1ZA 5ELIA 5E5MB 1MCFA 15C8H 5ENWA 5J89A 3QAZB 5B38A 4CVXA 2NTFB 4Z76B 4PYGA 3GIVB 2XXMB 1BZ7B 1MLCA 4PB0H 1DE4B 5E6IC 3HMXA 1X4ZA 4OUUB 4NQEB 2CIIA 1KJ2L 2I26N 3LN4B 4Y2OA 3BUYA 3KXFA 4P4KD 4OQTA 1BPVA 4W81A 2KZ1B 4Y4FC 5IHBA 4ZQKA 5DVKA 1MJJA 4FFVD 4PV9B 1S7VB 1GRWA 4G80A 2JIXA 3J8F7 3GKZA 5FXCH 1MNUL 2KKQA 2DQDL 4MA3A 4NQDD 5BZWB 2B0SH 4GRWB 3TYFB 4TVPL 5E8EB 3PGDA 1DQJB 3DVGA 4BH7A 5GGVL 3PWNB 3HZMA 3D85B 1VKXB 2X4OB 3V7AE 4KI1A 4I0KA 2AKRB 3CZFA 2VZ1A 1FZJB 4Y2DA 4WFGD 1T6VN 4D0BA 4N0UA 3HI5L 5ITFB 3CK0H 4H8WH 4R4NC 2Y5TA 2H2PC 2DQEH 1SHMA 4QGTA 3SKNB 3O4LA 5DJ2A 5HHOA 4U1HA 3ARWA 4M5YH 4YXLL 3VFSA 3EO9L 2C3VA 2DYPB 5DQ9A 3I75B 1ETZB 5B3NA 1BFOA 1QPXA 2R0LL 2RHEA 5IEHA 4OD3H 4U6VL 4PBWD 4QRRA 3S36H 4L4VA 3EYFA 4JN1L 4KUZL 2YOCA 2CJUL 1PQZA 4CADB 1AR1C 3AB0C 2WQ8A 4BUHA 4M7LL 1DQQB 2ZNWA 3EW3B 4D9LH 1A22B 1GIGL 1AQKL 3MLZL 2YPLE 4MX7A 2Z35B 1OGAA 3X13B 1BD2B 4MXVE 2CRZA 4PS4H 2MNUA 1PJ9A 4KVNH 4RWYL 4E5XB 4NO5B 4Y88A 3TN0D 8FABA 1RZKC 1MCJA 3RVUD 4GLRI 3BP5B 4ZFZA 2ZCHL 2VB5A 4PGBA 5HGAA 1IFHL 3VCLA 5EOTB 5A2IH 2HA1A 5F88A 3L3IB 4P46A 4Z0XA 2QQNL 3CGTA 3F58L 4IM8A 1FYTA 2AEQH 4HX1B 5DJDA 4HHAB 1JBJA 2WANA 1FVEB 3LQZB 1DLHA 4BSWB 2P4AB 2ED7A 4IRJD 1ZHLB 3V6ZA 2NY4B 3RVWC 4F15B 4MXQD 3UYRH 1TJIH 1IRAY 4I13B 1HIML 3L3KB 1MCWM 1QHPA 1OCWH 3DECA 1XF5A 4LCWE 4APQC 5JOFB 5ISZD 3EDJA 1BGXL 4LSQL 2WNGA 1DN2A 3CSYA 1J5OH 1A1OA 3CC5B 3KPRB 4H5SA 4PIRF 5EBMA 5LGJB 1CLOL 3ISWA 5L2JB 1QSFB 1EO7A 1RUKH 1T5WA 4U1IA 4TTGA 1QRNA 2HTLC 2XQBH 3S5LB 2ADIB 3G6DL 5FO8B 3WNLA 4Y2DC 5JIIA 4QXGH 3QIBC 4OM0L 5IMOB 4U6YA 1G0YR 4CDGC 25C8L 3EJJX 2GITB 1XH3B 4UOW1 3T4AB 1I4FB 3OAUH 2A6KA 1PDKA 1GXEA 4QXUL 3CH1A 4JKMA 1ZLSL 2BFVH 3LH2H 4GAFB 5JIPA 3V7AG 3VGGA 4ZD3L 1Q0XH 1YZZA 5KSBE 4N8VG 1R3KB 1DBKH 2ADJA 2GFBB 1QBMH 5JPMA 3LV3B 5KSAB 1FZOB 1B6DA 3U7WH 5KVDL 3GFUA 4PB9H 3TPUA 3O2DH 1NUGA 1MCBA 3TESA 5BJTA 4I3RH 1QOKA 4WV1A 5GZOD 5ALCH 1U36A 3BSZL 1IEAA 3B9KC 4PTTA 1G6RL 3O45A 2IBGA 4NYLB 2I5YH 1KIQB 5IB1A 3QG7H 5DS8B 4BYHA 2IPKB 4JRYE 1CXKA 5TQ2H 3MLUH 4HCRA 4OZIE 5IB3A 3B2VH 2AXGA 4ZUVA 4P3DB 1KB5H 2CGRH 3MYJB 1JGVH 5GISH 4XNUL 4Y5YA 2VDPH 3T2NH 4CVWA 3D69A 3VXUD 2AJUL 4X6BB 5KVEH 4QRTB 3EOAA 3QCUL 4JFQA 4TTDC 1UWXH 1E4XH 4UT7L 1TDQA 4HFUH 3QCTH 3ARUA 3WSQH 1VHPA 1KCUH 4Q9RL 5IMKA 1D6VL 2P44B 5GGTH 4MXWH 1EAPA 2VZUA 4PY7A 5IJVA 5F9AC 4GW4B 3OKNB 1NMAL 2R69L 1A7BA 3BWAA 4JN2B 4WRLA 5IW6B 3N1PC 2ZG1A 1FDLH 2P5WA 3EOBA 4QHNA 4X0KB 1JUFB 4H1LA 5HD8C 4EEEA 5KJRH 3CUPB 3S88H 1IGIH 4DTGL 2ICCA 3HMWH 3KR3L 4XBPB 1OP5H 5ADOH 4LNRA 5M95B 3OSKA 1JPSH 2SEBB 2VDRL 3MRMA 4U1JA 3DVIA 4U1LB 5EUKA 1MFDL 3LKPB 4P9HC 1AQDB 4L3AA 5E6IB 1G7JA 2ZSWB 3CMGA 3RVTC 2HLAB 4LSUH 4K3DH 3MRIB 4EI6B 2IFFH 2C3WA 1PY9A 2O61A 2RJMA 2IQ9H 5DUPL 1ZGLA 5EU6A 4ZOAA 3QIUB 3F6LA 3RY4A 1KJVA 1J8HA 2CDFA 1RULL 1X5XA 4XP6L 3GGWB 3QBTB 1UH2A 3H9SE 4P48A 1B0GA 1XGPB 1IT9L 2W0PA 2XA8H 5C09B 1WC7B 3Q48A 1UYWH 2GKIA 4HJ0C 4O2CB 5I74C 4M4RA 3HB3C 3S97C 3EIFA 5DMKA 1HYSC 5HI3D 5AD0B 1UCTA 3HE7B 4NQVA 3FOLA 3OKDB 2NW2A 4JFPA 2DDQH 2UV3A 4PJDE 5T5NF 2F53B 4RISH 1PLGL 2NR6C 3TNNA 3UJIH 3NCJH 1LP9E 2BSRB 2GT9A 1I9EA 3X11A 3OKKA 3V79C 4WV1C 4DGVH 1IL1B 4XCFL 3MJ9L 4HLZG 5EIQA 4FOMA 5TPWH 5IW1A 4WO4A 5SWZE 4LSVH 1J12A 5TGBB 3GMQA 4QOKD 4ODTH 1CVSC 4G8GE 5FA4A 4JFYB 1B2WL 2NY5C 5C08D 5DSCB 3AB0B 1LO3H 5CMAB 4YHZL 4PLJD 5KTEL 3X14B 4I77L 4L8BB 1LDPH 3VWJD 3SGEI 4U4BA 4NZTL 3D2UD 2HH0H 1AD9B 4XMLH 2CUIA 2H26B 3RA7L 4OCWL 4B50A 4GSDL 4HWBA 1S7QB 4ZYKB 3SDXE 2NLJB 5DD5L 4LLUB 1A7QH 1IAIL 4KRPD 4YH6A 4EVNA 1FHGA 1ZEAH 3P4MB 5F6IB 4P9ML 2H9GA 4EIGB 1TZHB 1LHZA 4DKEL 1NGZA 3NGBC 1IGML 1S7TA 3T0WA 1MI5B 4PJAB 5LG1A 5D4QA 1FZMB 3V0AC 2AK4A 2Y25A 3E3QE 4EN3D 1BJ1J 2A74A 4KK9C 5D1ZB 5ENWB 2MFNA 4N8CH 3CMOH 4GW5A 3OJMB 3OJVC 3T8XA 4E41E 3AM8A 1JWSA 1MLCB 4UQ2A 4ZS6C 1I1FB 3F7QA 3CZJA 2XIDA 5DJYA 2NY3D 4APQB 4TYUA 4UTBL 2CIIB 4L3ED 3BUYB 3KXFB 2VYRE 2FDBP 3CXDH 4ZQKB 3BZDA 5DRZB 3V95A 4P2CG 4G80B 4PP1C 5LKNA 2JIXB 5E8DH 3U0WH 2RGSA 4IMKA 3OHXA 4MA3B 2FEEL 1C5BL 4M9OA 3PGDB 1Z3GH 1Z9SA 3DVGB 4BH7B 4WEBH 3HZMB 1C16A 4GBXA 5C0IA 1YY9D 1FN4A 4M6AA 2GYSA 1NUFA 2RCSH 3CZFB 1CBVH 1YC7A 4R26L 1P4IL 3Q5OA 4Y2DB 2CQVA 3HC4H 4GKZA 4RA0C 4D0BB 4P4RB 1N6QH 5IT2H 4N0UB 3WS6C 1U8HA 4KKCC 3QIBB 2Y5TB 3ZTNH 3AS0A 5IWLA 2YD4A 3VXSE 2AQ3A 4JRXE 5C0JA 3O4LB 4Y19D 2H2SD 1OTUC 2EYRA 2UZIL 5DJ2B 1UEMA 5HHOB 4RX4A 1MLBA 2VWEE 3VFSB 4R90H 2C3VB 5DQ9B 1KT2A 4HWNA 3TM6A 4BZ2H 3UP1A 2BVPB 4YHNB 1BFOB 1JGEA 3L9RB 1N64L 3CJJA 5JOPD 1OT2A 4U49A 1JIBA 1JYVA 2ESVD 2YBRB 3QEGH 4L4VB 3EYFB 2NX5D 4QRRB 4YHKL 4FQIH 2K7PA 3ZE0F 2CD0A 2ICWA 5FM5M 1F90H 5DK3A 3RI5K 1JTOA 2XRAL 3JTTB 2VZ3A 5CJQL 4XCEA 5DVMA 3V4VH 3C2AL 1J9CT 4MX7B 4AQOA 1OGAB 4XVTL 3ZE2F 1INQA 4HGWA 4WTZA 4XCYA 2FR4A 4WFGE 2PO6D 4DZBA 5J57B 2F8OA 3QUZA 3UBXI 3WNPA 8FABB 1FPTH 1WAAF 4N9OB 2VXQL 1VFMA 3CDYA 3W11D 1CIDA 4ZFZB 4ZS7H 5HGAB 1T89A 4OT1L 4Q9QL 3MV8E 3VCLB 3I6GA 1PGRB 1Y6KR 4KWUA 5F88B 3TBSA 2DQHL 5DJDB 1FYTB 3ULUF 3N85L 2V6HA 3SJVD 1ACYH 1K4CA 1K6QH 1B0WA 2QR0A 3BUTA 3KWWB 1E0OB 1RJYA 5BVPH 2BHYA 1Q9LA 4M02A 1I7ZA 4PG9A 4OGXL 3DXAA 2XKNA 4JFEE 1GZPA 1RD6A 2J5LC 2IQAA 1M7IA 4NCC2 5F21B 4NFBA 2Y07H 3UC0L 5C6TL 3F5WA 1XF5B 3Q6GH 3ARSA 5ESVA 5ANME 1CGTA 2EDFA 3KYAA 3ZYOA 3O3BA 4RQQB 3CSYB 1A1OB 4DUWA 1NCWL 4RMVA 5IMLA 4X7CC 1A6VL 5EBMB 4MZ3A 1KLUA 4RBPK 5D8JH 2HLFC 1OTSC 1T5WB 3UPRA 3S3SA 1QRNB 1JNNL 1NEZA 4PLNC 1SBSH 4H26A 4LEOA 1GOFA 3DRTA 3MRHA 5FUCC 4D9RE 4KI5F 1IAII 1LO4L 4U6YB 1NMBL 4LPYA 4OLYH 4CN1A 5I1LB 3DX7A 2A6JA 3SOBL 4R97C 4CMHC 1OM3H 3QHZL 1G1YA 4LAQH 5HDBE 4LP4A 2A6KB 5BMFL 1ZHBA 4Q6YA 1AI1L 2XQYG 3CH1B 3PDGA 3S4SA 2X4NA 5JR1L 2DQIL 5CLTA 4MVBD 2AABL 3DYMA 5J8OA 4KZDL 5I74B 4OFKA 2MCPL 3T04D 2HMID 5IQ9B 2ADJB 5I8KL 4F9PA 3OQ3B 4LEXL 3QO0A 3ZDYE 1JP5A 2QQKL 2P8PB 3TA3A 3BKYH 1I3UA 4L4TB 1Y0LA 5AZEL 2WAHA 5D72L 4GAGH 2P42B 3HRPA 2FEEI 4WV1B 4TVPD 1CD1A 4PTTB 2AEPL 1TZIA 2MWCA 3MRCA 5D7KD 4OGAD 3QDMD 1MHEB 4U7SA 5GSVA 4XAKD 1WBXA 2E7LA 4P2OA 4PRDB 5IB1B 1YNTA 4AQ1B 2B8OT 5M94B 2DQTH 2V9QA 3VWKC 2E9IA 5IB3B 3O9WA 2AXGB 5F9JA 2IH3A 3G6JE 5C2UB 1F8TL 1OQXA 5I1GH 4P3CL 1GAFL 1ADQH 2P5EA 3D69B 3TNMA 3AS1A 4HIHA 1Q9WA 3EOAB 3VI4F 5GHWL 5ICYA 1Q38A 5F1NA 1S5IH 2AJYL 5CILH 5FM5O 1JZ2A 3SO3C 4NKMB 5HYSA 3C8DA 1F45A 4X7EC 4CAGA 5C1MB 5IMKB 4G6FB 5DJCA 2E6JA 4QCIA 4UNUA 5IJVB 4Q0XL 1VACB 3C6LC 3QO1B 5FHBL 3EJZD 2R9HC 1CFVL 1QFWL 3EOBB 1LO2L 4QHNB 3GMLA 4X9FA 4H1LB 3S37L 2J6EL 1TTFA 3GSVA 4K07A 2YK1L 3K3QA 4LNRB 2IADA 5D1XD 3MRMB 3DVFA 1MCKA 3OL2A 4YDVA 4U3HA 4TSCL 4JDVA 5EUKB 4P2YA 5C0DA 4O4YL 1ZAGA 1RPQA 4S0TD 1X9QA 3CXHJ 5A16B 2OTPA 3EDDA 3BYTA 2OYPA 1IQDB 3A6BH 3RBGA 1WGOA 3MQIA 1ZGLB 5EU6B 2ADGA 3QB7C 5DK2A 3DUHA 4HBCH 4HMCA 1KJVB 1J8HB 2CDFB 1G9ML 3MLWL 2UY6A 3REVA 4F58H 4LKXB 4LFHG 1XF2A 1NGQH 1V8HA 4Z7WF 4NZUL 2UVFA 1KXQE 1QBBA 4UV4L 4Y4HA 5DMKB 3KPNB 4OCMC 4F9PC 2LABA 3EYVA 4X8JA 5E8OA 4X4MA 2FGWH 1QSEB 5E2UL 1EEYB 1DN0A 3QFJD 4NQVB 5GS1C 3TA3C 1F58L 3MA9L 1ZLWK 2NW2B 4JFPB 4X5WB 1IKNA 5L0QC 1PX4A 4LHUG 1DVFD 4YDLB 4LARL 1C5CL 2GT9B 3R06B 3MZGB 3OKKB 3X11B 4G6KH 1X5YA 3TZVA 1I1AA 3S3PA 3MV7A 3LEYH 4PGJA 4MCZB 4MAYC 1MFNA 2D31A 5IW1B 3BVNA 1CI5A 4WO4B 1A1NB 4WI5A 1G7PA 3VFMA 5F3BB 3GMQB 5I1IH 1ROWA 4OGYL 3HPLB 5ACLA 4PPTA 3V0VB 4HUMB 2W9EH 4LVOC 2Q76A 5GJTL 3O9WC 1ZT1A 1L6XA 1JYWA 5KS9F 2GHWB 1OF2B 2DD8H 3ARFA 1MJ8H 5FUOL 1KENL 4PD4J 5DUBB 3S35L 5J6HB 4UU9B 3QQ9C 1A6AA 2JLLA 5CBEB 1KCRL 2OLDA 3FN0L 1TITA 3FB5B 3C87A 3KAAA 4HK3J 1A3LL 3SPVA 2JCCE 5C0ND 1LE9A 1S5HA 2YA0A 4M1GL 5JA8B 1MFCH 2VLME 2YXFA 4HXAL 1X5GA 1I9JL 4X4XA 3BGAA 4WHYG 4EVNB 2XZAL 1K8IA 2H9GB 4BQ9A 2J4WH 3V4UH 1NGZB 1J86A 1G0XA 3BIAX 3QIWA 2XFXA 3GMMA 4YXHH 4HS3A 3QUYA 3S37X 3C60D 5FAAA 2Y06L 4XNZB 3FFCD 4GH7B 2AK4B 1ZV5A 4ESKA 5EZLA 5DRNA 1YYMH 4GW5B 4Q2ZA 3L3GA 3L3OA 4YBLC 3KYKH 2J5LB 3T8XB 1SVCP 3HMXL 1JWSB 4UQ2B 4ODWA 4XHJC 3GI9L 5D70H 3ZMRA 1JV5A 3HTLX 5F1KC 4OQTL 5DJYB 1A6PA 2ARWA 4O5LL 2OL3B 3B43A 2DL9A 2VH5L 5I1JL 3DO3A 4HZAA 1YEGH 3VDBA 3V5HA 4KJQC 4OGZA 5DHXB 4S1QH 3OHXB 4XP9H 3UJJH 3IKCA 5CCKL 3ZYIA 1VGEH 1SY6A 2VMFA 1C16B 4GBXB 5D7JA 5C0IB 2X7LA 4L8DB 2JJWA 2FX8H 2HJKA 4GKZB 1T21A 4KI5C 5MENB 1ZOXA 2K1MA 1ITCA 1M7DA 1AH1A 5C0JB 4OF6A 4R97B 2EYRB 1R6VA 5JHLL 3PHOB 1MLBB 3H3PH 2HRPH 1HZHL 3LN5A 3NH7L 2L7UA 1KT2B 3U4AA 4KUCF 5J06A 2VLRA 4M62H 4JO4H 5DMIH 4LLYA 4JKPL 3GMPA 4Z7WA 2NTSP 2BSED 4NN7C 3TIDA 1UH4A 4MNHA 1OP9A 2EXYD 1NCBH 5L7XL 2ICWB 1YUHA 4LSTL 1IKFH 4ZO7A 1H0DA 5GJSL 3SKJL 1QQDA 3QPQD 4AT6A 1YPZF 2YD6A 5T1LD 4XCEB 4AJ0A 3OKOB 1J1OH 1FGVL 4RAVB 1WUNT 4XNYH 2R1XA 3S35X 5ILTH 5I76A 3D1MC 4FQ1H 1INQB 1ZVSA 4HGWB 2FR4B 4WY7H 3FN9A 3QUZB 1CE6A 1WWWX 4ZSOB 1AIFA 3LIZL 4AYFA 2F9BT 1AC0A 3P4LA 3C8KA 3UTTE 5HGBA 5E94A 3KPQB 5F9WB 1L7IH 4Y19E 3RJQB 3VWKB 4XC1L 1SM3H 4R2GD 3I6GB 4X6CF 2NXZB 2AJVH 4J6RL 3WMSA 5KS9A 3WCYA 3P11H 3NFSH 1MFBL 1P7HL 4O00A 2BNRD 2NY2D 2QR0B 2ESVE 1RJYB 3UTZA 4PG9B 4EBQL 2LFGA 3DUUA 3DXAB 1QSVA 1HH6A 2XKNB 1GZPB 1FSKC 1S7UA 2IQAB 3D39A 2H6PA 1M7IB 5ID1A 4JZJC 3LQAL 3I3DA 3BDXA 3PGCA 4HXBH 3F5WB 4X80L 2EDYA 2ID5A 3PV7A 5IHUH 3VDCA 3KVQA 5I71B 5C2BL 4PJ8A 3ARDC 1PZ5A 4CU6A 3L5IA 3CU7A 5CEZL 4LOUD 4DAGH 2FJHA 2P45B 1KLUB 5E4IA 4UIKL 1I3VA 4KKAC 4RAUA 4P23D 3P2TA 3DIFA 2EECA 2J88H 3MLSL 2R2EB 3NCCB 3UPRB 1NEZB 4H26B 4LEOB 4MHHG 3RGVD 1A3QA 2C7UA 3ARZA 3DRTB 3MRHB 1CF8H 2A0LD 4QYOB 1JPTH 3TT1H 4KTEH 4LGSB 3SJVE 5JTWA 5F1OB 2GW5A 3VFOA 4HKXA 3DX7B 4KQ4H 1T5XB 2CKBH 1FYHB 2BVEA 1NFDE 4OKVB 4Y5XC 4OLEA 3VJ6A 3OB0H 3S4SB 2X4NB 4JM4H 4D3CH 1H8OA 4S1SH 2GK0A 4GLRH 4NQED 5F96H 2FHFA 4J4PA 1BVLB 4JFHE 4PJIF 1TFHA 1KFAL 2XN9A 4XCCH 3TA3B 1YMHB 3EYSL 3VXQA 1Y0LB 5IB2A 2FO4A 1MRFL 9CGTA 2OJZH 4Y1AE 3UROR 3MROA 2VLLA 4OCYH 4H0GA 4H8WC 1S3KL 3PQYA 1CD1B 2X09A 1KJ3H 2IAMD 4MAYB 1TZIB 1XF3B 3MRCB 4KKNA 4DGIH 2OZ4H 3GBLA 3DURA 2NY5L 5GSVB 5L8JB 1WBXB 3QDJD 4HCRL 5EG6C 4TRPH 1T2XA 1YNTB 4PJXE 3TJEH 4XPFH 4LVOB 3O9WB 3BDYH 2IH3B 4JQVA 4UT9L 1YPZA 5F44A 2XY1A 2APXA 2DYPD 5E9DA 2WIMA 3WNKA 2P5EB 3TNMB 4M5ZH 1Q9WB 1OAZL 5ICYB 1IQWL 5TDNB 3GSWA 2ADFH 3OXRB 4OZGF 4BK5A 5HYSB 3EO1A 4LU5L 2BOBB 1P6FA 3O2DA 3QEQD 5DJCB 4QCIB 2NPLX 2AJZA 2QEJA 5JUEL 1JNJA 4KK5D 4X6CA 3U9UA 3K1KC 4ELME 4L1DA 4XZUA 3TFKC 4TVPE 3GMLB 4AH2B 1WBYA 5LBSH 2IFGA 5D7KE 1WEJH 3G9VA 1RQ5A 3GSVB 1FFOA 1BQHG 1RJLA 3QDME 2AGJL 4O51A 2D9CA 5C7XL 3TJHD 1R5WA 1KB5A 2IADB 3RL2A 4QLRA 2EYTB 4IDLA 4YBLB 4YDVB 4JDVB 3EDKA 5C0DB 4PR5A 2EIEA 4ACPA 1RFDH 3TH3T 4OI8A 4NNXA 2Q8AL 2A38A 4X5LA 1FV1A 5EIIB 3QQ4A 2AVGA 3KPOB 3MZTA 2ADGB 5HTSA 4M43L 2DQDH 1I7RB 4FQCL 5GGTA 4PJCF 4TVPH 5K9JL 2NY4D 1XF2B 3IFLL 1CXIA 3GHEH 4X6DE 2RFXA 3M1BA 4M03A 5DVOA 5I18L 3EYQC 4CUCA 4Y4HB 2K3TA 4TNWK 2OXHA 4J4PC 5JXED 3EYVB 5E8OB 4JFFB 5TF0A 3RI5F 4LK4A 1DN0B 3PWJA 3HAEA 4LSRL 5J11B 1N3NA 3EO9H 5DQDL 4QGYA 4QWWD 1QSFD 1I1AB 1BF8A 2B1AL 3EHBC 1FAIL 2D31B 5HYQA 5I6XC 3BVNB 4U6VH 3SGKA 1G7PB 3VFMB 2RAMA 4JN1H 4NN7B 5B8CA 1OP3H 1LVEA 3P9WB 3WNNA 5GGSA 4M7LH 4PJIA 3VI3E 2Q76B 5FEBA 3TCLB 1GIGH 1J1XL 5GS0L 4LCUA 5T3ZE 1VPOH 1RZ8A 3Q3GA 3LZFH 4GXVL 4OLZH 5BRZA 3HUJF 1RIHL 3UYOD 4JPIA 2AK1H 1A6AB 1QNZL 2YC1B 1EHAA 4HK3N 4PJ9A 1NCAH 4ZNCD 4YHML 2UYLA 4RWYH 2BSSA 4HWBL 1JGLL 4WFFD 5CSZA 1LE9B 2MPAL 4N0CD 4X4XB 1N5YL 2E7HA 2VIRA 1K8IB 3F58H 4G6JL 4KQ3L 3QIWB 2XFXB 2VDKL 3QUYB 4HS3B 1ZT7A 1DDHA 5JO5B 5LVEA 1MFEL 5EZLB 3L3HA 5HI5C 2AJXL 1PG7H 4OZGA 4Q2ZB 3L3GB 3L3OB 5I1HL 4PLOB 4NP4L 1WWCA 1HIMH 5EUOF 2LU4A 4JZJB 1XGUA 1JV5B 1XIWC 5F6HJ 2IG2H 4G9FB 1VEOA 2W0KA 1YEHH 1D9KA 3IDMA 5T3XE 5GSRA 5JW3L 3ARDB 4MLSA 1JWUA 2EDJA 3PL6C 1NCTA 1KN4L 4B5EA 1CLOH 3V5HB 3QDGA 1QFHA 2YSSA 1N0XL 2VAAA 3MCKA 3IKCB 1BX2A 1T0NA 3OJ2C 5F7UA 5D7JB 2AXFA 3IVKA 5C0AD 2X7LB 3G6DH 3WFCL 5JZ7C 4U3XA 5CD5D 3BPNC 4ZNEA 1T21B 4OM0H 5JIKA 5IBTL 2DIBA 25C8H 1QR1A 4OZFA 3DMMA 3SGEH 1M7DB 2IPTL 3UMTA 3WDHA 4QXUH 1SJHA 1JZ5A 4PJCA 4LASL 4G6ML 4BQCA 2O26U 1ZLSH 4E0RA 1OLZA 4DN4L 3LN5B 1JTTA 4O02L 4NHCH 1Y6MR 4ZD3H 1ZHKA 3BWUC 1ZXQA 2VLRB 1F4YH 1U91A 4I0PD 1Q1JL 4Z7WB 5F6HI 2J8HA 3B5HA 4MNHB 5E00A 5IB5A 3M8OL 3BRFA 3QIUD 1YUHB 5D7IE 1AO7D 1QQDB 4AT6B 2DWEA 3NOIA 4W6XB 3GHBH 2R1XB 3BSZH 4HPYL 4DKDC 4KHTL 5C09D 3T2OA 4P57B 2EO1A 1ZA3B 1ZVSB 4HLZH 4N1HB 4PJ9C 3T0AA 1G6RH 1CE6B 2O5YH 3T0EA 4MWFA 1F3JA 3C8KB 2R39A 1F4WL 3A6CH 5HGBB 5E94B 2EDWA 2I24N 3HE7D 4RMQA 4XBEL 2CK0L 3T1FA 5FDWA 3ZYZA 2YRZA 2VDLH 1KTLA 4U3CA 2QV2A 3F7RA 5KS9B 1BWMA 1XGQB 1T04A 3MRBB 3KPSA 2AJUH 4G6AC 4X9IA 5C8JA 2X1QA 1WWAX 1YQVL 3SQOH 3U4BL 3PF2A 2H1PL 3L5XH 3HI6L 2GIYA 2FX7H 3UTZB 2EDHA 2WUCL 2AV7A 1KUMA 3DUUB 4FXGA 1HH6B 4Q9RH 1D6VH 1S7UB 2FWOA 3PWLA 1HKFA 2H6PB 2ZSVA 5ID1B 5I9QB 1NMAH 2DQUL 2OTWB 2PYED 2R69H 3PGCB 3BT2L 4NQCE 2OMBA 1TQBC 4WJ5A 1D9KC 2EC9T 4AMKL 3OG4B 3P73A 1PZ5B 4KC3B 1D5IL 1J0ZA 3ZKXC 3OKMA 4MA1C 2EEAA 1N0LA 1UGNA 2FJHB 3MRRA 5D5ME 4P4KA 5D7SL 5E8PA 3RRQA 4RAUB 1CICA 4YHYC 4KKLC 1BQSA 3DIFB 2K7QA 1EHNA 4ZO9A 5DD1H 3TH2T 1JTPA 5EUOA 4QRSA 1YNKL 3QXVA 4MQTB 2C7UB 4I2XA 5AWNL 1P9MA 4PRHD 3VFOB 3HHRB 3C08L 1MI5D 4HKXB 2R2HA 43CAA 4F7CA 4P5MB 4WHTA 4OCRH 5D1ZD 3VG0L 4XP6H 2CR3A 3VFTB 2YXMA 2EDKA 3QWOA 1IT9H 1KCVL 3AVEA 4WU5A 4MA7L 5L2KE 4YZFE 4C83A 2GK0B 5EWIL 1BREA 3A67L 4HUNB 3MV01 3ROLA 1I85C 1KXTB 3A6OA 3KXFD 2EIZA 5I1DA 2XN9B 3B6SA 2JIXD 4WW1A 1K5NB 3WFZA 3E3QC 1OWRM 3TYGH 1YJDL 3MUJA 2FO4B 2QL1A 3O3AB 1GYAA 1CE1L 2A9NL 5F3HA 3MROB 4XHQA 4JY6A 3MJ9H 4FZ8L 2VLLB 3WO4B 1GGYA 2FNBA 1TPXB 3CVIL 1MHHB 4FQ2L 1EEZA 3PWPE 1B2WH 4RDQF 4Q9CA 2JB5L 4HIIA 4YHZH 4HG4K 5FYLD 5KTEH 3O4LD 3ROOA 1HOCA 3F7YA 1WIPA 2GTWA 3Q5YA 1YPZB 4NZTH 3E6FA 4GAJH 4PFEA 3GSRA 4LHQB 4IEFB 5E9DB 1WSST 4UDUA 2F58L 1Z5LA 2XZQL 4N1CA 2EZ0C 1O5DT 2NQCA 3RA7H 1KTDA 4OCWH 4LLVA 4KK6D 3BD4A 4L4VD 4XVSH 4LPTA 4WU7B 4NKIH 2R56L 5HI4C 4X83A 4JHWL 5MEQA 4DFIA 5DD5H 1PSKL 2ICWI 1DUYA 2WBWB 1ED3A 2VE6A 2AJZB 5I1CH 2FATL 4P9MH 1MRDL 4X6CB 4OTXL 4GRWE 4ZTPL 1A6ZA 3BDBA 1BLNA 4MD5A 2X4PA 5DK0A 4DKEH 3ULUL 2JJUA 3DGGA 2VWEC 1IGMH 4XZUB 12E8H 3OAZK 1OGAD 4KVCH 3CFJA 1WBYB 4WW2C 4GRLC 3W9EA 4TUKH 4KHXL 1XR8B 1FFOB 1RJLB 4O51B 4J2XA 3TBYA 4P4KC 4FQPA 4M6NL 4P49A 1R5WB 5T1KA 4CDHA 5HSFA 1KB5B 1U8KB 1NL0L 1DQLL 1G6VK 1I8IB 3K0WA 3CDGA 1DFBL 2WBJD 1KPVA 2BY3A 4FFVC 1FGNL 2EXWD 4EQ2A 3CVHH 3NA9L 3LKNA 1AGFA 4FP8H 3U82B 1DUZB 5JW4M 1ADQA 4UTBH 5CHNA 4P46D 3RP1A 3QQ4B 2W65A 4HBQA 2QSTA 4RFNC 3PL6B 4JO3L 3BOVA 3VRLE 3SHSA 3FQRA 1CGUA 3BZFA 1R5IB 3WDJA 1C5BH 2VQ1B 3M17A 4NPYA 4Q6IA 4ORGA 4WUUA 3WS3A 4FFYH 2LTQC 1NFKA 4LPUA 5LGKA 2DLHA 5ITBL 3M1BB 4R26H 5DT1L 5L88L 3SDAA 3WJJC 2P47B 4XXCA 1KNOA 3BPNB 2FEDD 1A3RL 5DD3H 2C4FU 5FYKH 4OIAA 1BD2E 2W0FB 1EEQA 4QHMB 1CDYA 4NQTA 3BRGC 3PWJB 3HAEB 2FZ3A 2YWYA 5EBWB 3RBSA 4DQOL 1WICA 1N3NB 2DQGH 3G5XA 5EN2B 4ENED 2Q1EA 4JAMA 3BD3A 2C1PA 1N64H 3MA7B 5FYJD 3MRQB 3ZKMD 5HYQB 2IH1A 2Q7YA 1U8NB 4ZDHB 5SV4A 5IEKA 5B8CB 3N50A 1SBBA 5GGSB 4YGVA 3OMZA 2EIBA 2FYYA 4PJIB 5I1EL 3GM0A 2VXSL 3ALWA 5CJQH 4LCUB 5FV2A 1F6AA 1B4RA 3TN0C 5HXMA 1XEDA 1RZ8B 3Q3GB 4JPVL 1WBZB 3MACL 3RVUC 2FLBT 1KGCE 4PGZA 2JJTA 5FF6A 4JPIB 2YD1A 4PJ9B 2UYLB 4NM8L 4ZODA 5EORL 2BNQD 2BSSB 5CSZB 1OAXL 1UCBL 2VXQH 4K7PL 5CGTA 3VXMB 5IHLB 1JWMA 3VXUA 2XQYK 1OSPL 4XNQA 4OT1H 3KPRE 4Q9QH 4P99A 2J2ZA 4NNYA 1ZVYA 1ORSB 4IRJC 2VIRB 3WD5L 4J12A 4Y8DC 2MJWA 2BJMH 4CNIA 2UVEA 5MERA 1QSFE 2V2WA 1X4XA 4KV5F 3KGRA 4L4JA 5T33L 1IGFH 4OKDA 3BH9A 4GG6F 1ZT7B 1DDHB 4WI3A 3IGAB 1IGCL 5CZVL 1UVQB 1T2JA 5HHXL 4OGXH 2BERA 3QUKA 1GC1L 3S96A 2G75A 4OZGB 4B7LA 1YMMB 4OD2A 5IQ7H 1PAMA 4V1DA 4QO1A 2Y23A 3LD8C 2DQCL 3UC0H 1XGUB 2WBKA 1D5MA 3WLBA 1UXSA 1LK2A 1D9KB 4JM2D 3BMVA 4UV7L 5E2VL 1JWUB 1P84J 1I1YA 1A6VH 1U6AH 5EZIL 4Z7UF 3ZKXB 1PKQA 4WFFE 5EO0A 1SY6L 1DBBH 3QDGB 1D5ZA 2YSSB 3IFNL 2YUVA 4YK4C 3MCKB 1BX2B 3AAZA 4Q6IC 4YHYB 1I7TA 4FFZH 4X7FC 1JNNH 2AXFB 3IVKB 5H2BA 3MUHL 1MCLA 4WI4A 3TEUA 1S9XA 2H3NB 3V8OA 5DWUH 1LO4H 1M4KA 1NMBH 3RVVC 3SE8H 2P5WD 1QR1B 3OPZL 3DMMB 3EZ8A 3NCYP 1DL7L 4PB0L 3QHZH 3VXOA 2WMPA 1SJHB 3S34L 4PJCB 4E0RB 1NBVL 4U1KA 4V2BA 3MBEA 5IK3B 2DQIH 1Q9KA 4GUPB 2DBLL 1ZHKB 5JMRA 4K7FA 4YUEH 5HPMA 4KZDH 1U91B 2MCPH 4KROB 1MSPA 1FCCA 2VLKA 5D2LA 2B0SL 5E1AA 4DEPB 5I8KH 3GMRA 3QG6A 4K3EH 2Q6WA 3KNBB 5EU6D 1XF1A 1A14L 5GZOC 5IVZA 5E00B 4BFIA 5IB5B 2QQKH 1JHLL 4L1HA 1P69B 1SMOA 4YHPA 5AZEH 4QOKA 2DWEB 3CH8A 3JSSA 6CGTA 3CK0L 4PRIA 4ZUSA 1U8JA 4B7IA 5HJ3A 2AEPH 2VDMH 1MRCH 2A9MH 4PRPA 1ZA6A 2CSPA 2XTJB 4R3SA 5GRWA 3D2UA 4MWFB 4K7PX 3RUGF 1F3JB 1BF2A 4GMTL 2H41A 5FDWB 1WTLA 1NCDH 3ULVD 1KTLB 3L7FB 3GUTA 4M3JA 1CXLA 4CVZA 4K3JL 1GAFH 1T04B 3HUJB 3KPSB 1PX3A 2VJXA 5C8JB 1TENA 5GHWH 4ONGL 2BZDA 3RZCA 3FRUB 2GSGA 2AJYH 4HMDA 4WO4D 4ELKA 2AV7B 1CS6A 2WWKT 5A3ID 4FN0A 2Z4QA 1JPST 4P2RD 3PWLB 2FWOB 5D1QA 4Q0XH 4W4OC 4EN3A 3B3IB 4OBRA 2DMCA 1QPPA 2APWA 2WLYA 5FHBH 4JHAH 2AJ3A 3LSOB 4KVNL 4PLKD 4WJ5B 1CFVH 1QFWH 1LO2H 2ZOLB 5C09E 3VXTA 1A47A 3VRIA 1UXWA 3P73B 4YXKL 4L3EA 1WT5C 4P4KB 5E8PB 4F3FB 4J3SA 5BOPA 2A6IA 4UILL 1CICB 3B8SA 3RIFF 1PFCA 5EZOL 4O4YH 5CGMA 2VLJA 5IVOA 5EUOB 4QRSB 2PW2A 3EUUA 1HI6A 2FRGP 2F53E 1YNLL 1CDCA 1YYLL 3FRPG 1IM3A 4HJJH 3RWEA 5F93C 1GGIH 2K9UA 43CAB 3UYRL 2R2HB 3B9EA 1HHHA 3STBA 4WHTB 4RGMC 3FQWA 1G9MH 4FQLH 2E9BA 1GGCL 1JF6A 3QWOB 2OM5A 2V5YA 5HI3C 4HMEA 2LTQB 4WU5B 3V6FA 2PYFA 2AS5M 1JN6A 1X6NA 4M6MH 2R0ZL 4HK0B 1JF5A 4HT1L 1NGYA 4UV4H 4OZHF 1B90A 3ARVA 2EIZB 4RRPG 3OXSA 1EEUA 5E2UH 5J1AA 2XQBL 1F58H 2VAJA 3B6SB 3MA9H 4LCCC 4WW1B 3LQMA 1CFSA 3WHXA 2P43B 1Q94A 2NX5A 4R4BA 4TPRL 1F2QA 3P9LA 2Y36L 2D7QA 5F3HB 2JJVA 5KOVC 4JY6B 4GBXD 4PLJC 1N4XL 4KRLB 3VWJC 4X9BA 1C08A 5IIEA 1EEZB 2CKBA 4M93C 5MHSD 2BFVL 4PJAE 3MV9D 4G7VH 4HIIB 1YEFH 3GEWB 1Q0XL 2PO6A 3ROOB 2MOVA 1HOCB 2GTWB 4HFWA 1YQ2A 3M45A 1TNNA 1FNFA 1PG7W 3E6FB 1IVLA 5SWSD 3BW9A 3GSRB 4LQFH 1BFTA 2QQLH 3S35H 4EIZC 4UDUB 3JXAA 3HFMH 1EGJH 3JTSA 4QHUA 1Z5LB 1WIOA 4KRPC 4M9PA 1A3LH 5IF0B 3U7WL 4LLVB 4FQHA 3L5JA 4M1GH 3S9DB 3KXFE 3O2DL 1G7LA 2WM0A 3H9ZA 3MFGB 3RUGA 4I3RL 1W0YT 2VISA 5HYJD 1I9JH 4R9HA 2EDXA 1GH7A 2J8UF 4LSPL 5DUML 1ED3B 1H15A 4OV5A 2VE6B 4YHOL 2D3VA 1A6ZB 4MD5B 1BLNB 2X4PB 3I2CH 1NDGA 3DGGB 2EH7L 1JPGA 2I5YL 3MLPA 3IT8D 4X7TA 1U3HA 4HKJA 5TQ2L 2F54D 3CFJB 2CH8A 3MLUL 3OKLA 4YE4H 5DXWA 3W9EB 1UWGH 2NY3C 2V7HB 1KB5L 2NYYD 5ISZB 1QLFB 3QUZD 4N0UE 3FHAA 5GISL 3TBYB 2EDQA 4PG2A 4A6YH 4NM4L 5T1KB 3HMXH 3FZUD 3MJ7A 3N06B 3T2NL 1KPVB 3GI9H 3LKNB 3O4LE 1AGFB 5AZ2H 1G84A 3LD8B 1X3DA 2R0KH 3NIFE 4OQTH 3I3EA 1HILB 5HHOE 1A6WH 2NXZD 5FGBA 4U6HA 5CHNB 3IYLW 1TZGH 2OCFD 1E4XL 3IJSA 4LIQL 4HFUL 1QKZL 4KPHL 2W65B 3WSQL 3BX7C 3QI9A 1YY9C 5I1JH 4PV8B 5GGTL 4MXWL 3FQRB 3X17A 3BZFB 4QRRE 1JHKH 4L4VE 5CCKH 3CNKA 3M17B 4NPYB 3DXAD 4Q6IB 4ORGB 1ULVA 4WUUB 3WS3B 3IRZA 3TBWA 3IDNB 2H2SC 2BHZA 2NMSA 5DZNA 4EDWL 2Q7NA 3SDAB 3HMWL 4GKNA 4I8DA 3RWFA 3MC0A 3NPSC 5FYLH 4JVUA 3UPCA 1OGAE 3IJHA 2E8ZA 4E9LA 2ITCA 1OB1A 5JHLH 1KJMA 1OW0A 1DEDA 1SJEA 2FZ3B 4LSUL 4JQXC 1ORQA 1VGKB 3H9YA 5K59F 3QJHA 3NH7H 4ZFGL 3G5YB 1DQTA 4RGND 4JR9H 4UNVA 4JAMB 2Z91A 5CUSL 4JKPH 1ZWIA 2IH1B 1FYTE 2VN7A 5IEKB 2BP3A 4OZHA 3ESUF 5L7XH 1CN4A 4YGVB 1UYWL 2FYYB 1E28A 3SKJH 1EIBA 2A6DA 2PO6C 2VOTA 1X5IA 1L9MA 4AIZA 5E0QA 4ZUTA 1F6AB 1FGVH 4QHKJ 1H3GA 2EDNA 1H8SA 3W11C 5FF6B 4MD0A 2A1WH 3NCEB 5DEFB 2VC2L 4ETYA 1IJ9A 3QA3B 4RISL 1IC4L 5D7LD 4J8RA 3NCJL 1JWMB 3VXUB 1M71A 4DGVL 5GXBB 1I3RA 4XC1H 4XNQB 4OM1L 4Z7VE 4IDJH 4J6RH 1IEBA 4XP5L 5CEZE 4LSVL 2ATKA 4Z5RA 3CLEL 4CNIB 5MERB 1DLFL 4F7EA 2V2WB 3C9NA 3VA2C 4YNYA 1QRNE 5E1HB 1KG0A 1LO3L 3MPCA 1OOAA 5J9PA 1BM3L 2C9AA 2MKWA 3HZVA 3CFIC 3QUKB 4J7RA 3S96B 4P2OD 3ZT7A 2G75B 4OLUL 4Z18A 4OD2B 4XMLL 4V1DB 3WV0A 2J8UA 1I9RH 1Z0MA 3OG6B 4X80H 4Z7NF 1EX0A 5D1XA 5AYUL 1D5MB 2W9DH 3WLBB 1UXSB 4FXKA 3SCMA 1INEH 5C2BH 3D5OF 4QHKI 2P5ED 5DDHA 4XPBL 1DBAH 1I1YB 1A7QL 1PKQB 5EO0B 1JFQL 1ZEAL 4UIKH 1D5ZB 2GCYA 4GW1A 5FYJH 5DJXB 3AAZB 1F00I 4LLAA 1VSCA 1WFNA 3QFDA 5H2BB 5FCUL 4TVSa 4L4TE 1PZUB 4LLQA 3CFCL 1S9XB 1EVUA 1RZJL 4N8CL 3CMOL 2DLIA 4NOBA 3TO2A 4XNMB 4MVBC 4Z78A 1F3DH 2G2RB 2WP3O 2YEZA 5DC0A 4Z0BL 2D2OA 5ETUA 4RGMB 2HMIC 1S7SB 4HUUA 4BZ1L 3O6FA 2OQJB 4K7FB 4WWID 5HPMB 5E8DL 3SDYL 3X12B 2VLKB 5E1AB 3U7AA 1U8QA 3QG6B 2WQRA 1Z3GL 1CXFA 2Q6WB 4WEBL 1QBAA 4MDIA 4NKDA 1AGCB 1KFAH 5IVZB 1E4XI 1MJ7H 1MAML 3VGEA 1I75A 2RCSL 1PBYA 3CX2A 4OGAC 1MRFH 4QOKB 2HVKB 3PWUA 4D9QD 4PRIB 2VITA 5C08B 4ZUSB 1U8JB 1S3KH 5IROC 2AV1A 5I75B 2VXVL 1UG9A 1S78D 2FCBA 3PJSA 4XPTL 1ZA6B 4R3SB 5TE6L 4Y4HD 1FL6A 3D2UB 4WIQA 3A0OA 3NFNA 4DVBB 1A0QL 5D9SA 1UKQA 3WLWD 2R2CA 3PG2A 4UT9H 4CVZB 4WDIA 5CSGA 4FQIL 5EU7C 3BHBA 3TZVD 1I1AD 2X6MA 1CDUA 3MV7D 3RZCB 1IQWH 2FHBA 2GSGB 3EJZC 4FMFA 4ELKB 3WIIH 2ORBH 3WL9B 2VZVA 4LU5H 2X1PA 4OSUH 5EU6E 3FFCA 5D1QB 3MXWH 5JUEH 4PRNA 1J8HE 4EN3B 4UI2A 1YY8B 3NZ8A 2X4QA 3W39B 2APVA 2AJ3B 4UAOC 5D1XC 1AKJA 4NSKA 4OFPA 3K7UA 1IE5A 5C6PB 3IETB 1FPTL 3ARFD 5KSBA 5CP7B 3VRIB 1UXWB 2D03L 4OLWL 1TVBA 4ZS7L 4GG6B 2HFEB 2NY3B 5AYQA 5C7XH 5I73B 4L3EB 1DQDH 1II4E 3JWDH 5BCAA 3K80A 2A6IB 3MOQA 3I85A 5TDPA 1NMCC 3IXTA 1QSEE 2VLJB 1K6QL 1KC5H 1G7IA 3FO1A 2PW2B 2ZKHL 1HI6B 3RWEB 1IM3B 2EC8A 5D6DC 4YBQD 3QIWD 1Y6NR 3RWIA 1IZKA 5ID0A 4M43H 1HHHB 2Z9TA 1NCNA 4Z7UB 3F12A 2VERN 3FQWB 3Q6GL 5K9JH 4OQ1A 2GJ6D 3IFLH 5IBUB 3L3JA 3VU2A 5JW4N 1QLRA 5EBLA 4D8PA 1JZ7A 4QF1B 1DVFC 5D8JL 1DBMH 3NPSB 2JKXA 3RAJL 1Z9MA 3QXDA 4PGEA 3OXSB 3T08A 3ULVH 2EDLA 5J1AB 3GSQA 1SBSL 1T4KA 2V5MA 4KAQL 1CFSB 3KLDA 1EO8H 1OPGL 4UB0H 1Q94B 2NX5B 4R4BB 1TJHH 4XVJL 1UFUA 3P9LB 5C0CD 3MTRA 3ARRA 3P9MB 1L0YA 4OLYL 1T7XA 2H32H 5D7JD 2B1AH 1SYSA 5T1LA 1XAUA 1C08B 5IIEB 2CKBB 4BZYA 4C56D 1I3GL 2GY5A 1CLYH 2AK4E 3EKCA 1ZE3C 3U36A 3W2DL 2PO6B 1KCSL 1J1XH 4XBGA 1F42A 5C0NC 2Z92A 4HFWB 4LF3A 4GXVH 3FT2A 1RIHH 3WEXA 3PP3K 4YHLH 1SVZA 1QNZH 4QHUB 1OTTD 2GAZA 2B4CL 4YHMH 1F6FB 2DS4A 4HWBH 1JGLH 4PGCA 4FQHB 1KULA 1TQCB 1UKSA 4HV8A 4WCYH 1G7LB 3RUGB 2MPAH 4YFEA 4N90D 3C60C 2BNRA 3M07A 4JGMA 1W0VB 3H9SA 1MCEA 2YN3A 5C0BD 1H15B 4OV5B 2NY6B 3OZ9L 4QTHB 2JF1A 3Q1SH 1E6OH 4G6JH 1JPGB 3P4OB 2VDKH 1U3HB 2DQTL 3GJFK 3CLFH 3QHFL 2BSTA 1MFEH 5FUCE 2UY7A 2AJXH 2XXCB 5F8QC 1MHPL 5MENE 4YO0A 2MCG1 5MHSE 5I1HH 5I1GL 3TBTA 1JPFA 3MJ7B 1ADQL 3VH8G 4PJDA 1B3JA 5EDXA 2ZPKH 3S7GA 3CPLA 5CILL 3IJSB 4ODHH 4P23A 5JW3H 3GSNH 3VXPA 1KN4H 1QA9A 2BMKA 4K94L 1QD0A 4G8GA 3BZ4A 4R0LA 2ZUUA 3LHPH 2IJ0C 5GIRA 4LHJB 3D3VD 3P3YA 1K4DA 3TBWB 3W5NA 3D39D 2IGFL 3K4ZA 4MQXD 1T03H 4YX2L 3N1QC 1N5AA 1O7VA 4GKNB 3RWFB 3O2VL 5FKAA 1Q72L 1ZVHA 4PJ8D 2IPTH 2ITCB 4JJ5A 1OB1B 4RMUA 1KJMB 2XTLA 3EOTL 4ZSOE 3CVHA 3MNZB 4G6MH 4J3VA 1ORQB 1NLBL 4DN4H 3A6BL 4MJID 4YIQA 4O02H 4YR6A 5BW7A 4G43A 2GI7A 5DI8A 4XRCA 2Z91B 1L6ZA 1K2DA 1Q1JH 3O2WL 3QPQC 2VL5A 4CU7A 1ZWIB 5E7FA 5LXGL 4OZHB 3ARQA 1CFQA 1NGQL 1T22A 3M8OH 3VMOA 2CLVA 3B83A 4XP1H 1UADC 2IAMA 1E28B 4AEEA 4AIZB 3DXAE 1QSZA 4ZUTB 4OF0A 3QDJA 3RL1B 4L8CA 2HKHL 4HPYH 5DLMH 4KHTH 2X4UA 1I8LC 3QXAA 1A1MA 4MD0B 2JB6B 4PGDA 4R2GC 1LDSA 4F33A 4XPGL 1LGVA 1ZT4A 4O9HH 1F4WH 1WFOA 4J8RB 1M71B 1I3RB 2CK0H 2NY2C 2XN9D 4W6WB 4KMTL 5DGQA 4PUBL 5EC2A 1IEBB 4GJTB 4UQ3A 4Z5RB 5I1IL 2AI0L 1FFPA 4F7EB 3C9NB 1UJ3A 4YNYB 3QEQA 4S2SA 1KG0B 1YQVH 1HQRA 3U4BH 3PQYD 2H1PH 2X40A 1WTGT 3HI6H 4FABH 1CQKA 1CR9L 5J9PB 3HZVB 1S9YA 2R8SH 5C0FA 1H3VA 2DD8L 2BVOB 2COQA 2Q8BL 3MCG1 2DQUH 4LOUC 4XC3H 2J8UB 3AS3A 1J0KA 3QUXD 5D1XB 2DRUA 4AMKH 4LKCA 4P23C 3QULB 1MFCL 1TIUA 4FXKB 3SCMB 2EEDA 1XGRA 2V5TA 1D5IH 5DDHB 2OTUA 3RGVC 1MCQA 5D7SH 2GJZA 3SE4A 2GCYB 2BOCA 4KXZH 5CKGA 5DTFA 3QH3A 1J0YA 1WWBX 5FGSA 1NMCB 1AHWC 1JVKA 2CO7B 3QFDB 1YNKH 1HNFA 2IC2A 3FJTA 4IOFD 4LLQB 3MBXH 2YUXA 3KLHD 1AJ7H 1FBIH 3N9GH 2OJEA 5BOZG 3C08H 4JDTL 4Z78B 4I4WB 1KBGH 2NW3A 2YEZB 3VG0H 5D70L 2N7AA 4UBDD 1KCVH 5JXEA 3ZE0E 4NZRL 4HUUB 4JEGB 4N5ED 3S3JA 3SGJA 3QFJB 5EWIH 1MUJA 3A67H 1YEGL 2MSPA 5DD0H 2XWBB 5EO1A 3TC9A 4S1QL 4XP9L 2PF6A 4H0IA 5T5NG 1DVFB 1DZBA 5ACMA 1U8QB 1I8MA 1VFAA 4NKDB 4EDXA 3ZE2E 2IAMC 3MJ8A 2FX8L 1YJDH 3L95A 2J8OA 2XNAA 1CE1H 3O11A 2A9NH 1WAAE 3PWUB 4FZ8H 4O2FB 2AV1B 1RZ7L 1R3JB 4KKBD 1ZS8A 3PJSB 2EC9U 5DHVA 3H3PL 1FL6B 1QR4A 1RHHA 3ULUE 3NFNB 4HUWA 2JB5H 3BP4A 5D9SB 2I9TA 2QSVA 4JO4L 5MEPA 2YUWA 4NQXA 2XACC 1RK0A 4WDIB 5ESAA 5J13B 3V2AR 32C2B 2F58H 2XZQH 1NCBL 5EU5A 4X6FA 3BHBB 5CJXA 5BO1H 1IKFL 4KK5C 2RR3A 3O3EA 3VGHA 3MUZ1 2R56H 4JHWH 4XNYL 2DJSA 1PSKH 3FFCB 2DTMH 1OLLA 4OF8A 4LHUA 4FQ1L 4PRNB 1F11A 1MRDH 4OTXH 3NZ8B 3LKOA 2X4QB 3LPFA 4P3WA 4ZTPH 4WY7L 3TJHC 4D9QE 4NSKB 1C12A 3B9KD 2GUOA 4WI6A 5BRZD 3WUWA 3QDAA 5KSBB 3IFPA 5B3JF 3ZT6A 1TVBB 1F2XK 1L7IL 1MIMH 4KHXH 2LV4A 1SM3L 5IESH 4M8VA 4M6NH 2AJVL 4KI5E 1DQLH 3RKPA 1NKOA 2HJFA 1DFBH 5HVHC 4I48A 1FGNH 4JFFE 3NA9H 4X4ME 3N1FC 3IXTB 5TDPB 4U1GC 3DI2B 1G7IB 2GJJA 2E7BA 5T1MA 3FO1B 2PTUA 1AY1H 2Y1VA 5KVMC 1SJXA 2NY4C 3H9HA 1E4WH 3S4SG 1LD9A 5C0AA 5ID0B 1F6LL 4XMPH 3VFNB 3V6OC 4HXBL 3F12B 1C1EH 2R0WL 4KTDL 5JXEC 5C9KA 1MF2H 5EIVA 1IAOA 3HRZA 1VERA 4ZMAT 5BV7B 1ZHNA 2ZJSL 3NABH 3L3JB 3DO7A 5DT1H 5JNYB 5L88H 1QLRB 5EBLB 4D8PB 1IC5L 5KZCB 3HA0A 4DAGL 5TE4L 3T4YA 4QWWC 2WWMD 4PGEB 2J88L 5E03A 4M7LT 4D2NA 4DQOH 5TE7H 1VFBA 1NC4A 3GIZH 5K9OA 1CF8L 4X9HA 3TT1L 4ZFFB 4JPKL 5I8CA 5GRUH 3QRGL 5FOBA 1S7XA 1QFPA 2UZXB 3TVMD 1U2CA 4KQ4L 3NPZB 3FT3A 4HJGA 5KVFL 2CKBL 1SYSB 5T1LB 3TV3L 5HHVL 5BQ7A 2GTZA 2MHAB 3STZA 3DMMD 4D3CL 4JM4L 3VI4E 2VXSH 2WINA 4S1SL 3U36B 5A2JH 5CP3A 1CGSL 1U3YA 3QWRA 4OFYD 4WHCA 1R3HA 2Z92B 3W0WA 4KGJA 4LF3B 5C07D 4L3CA 1N2RA 2W38A 4JPVH 3MACH 3FT2B 2G5BA 2R1YB 3TBVA 4N0CC 3X3GH 4K7PY 3I50L 2GAZB 1ZGLP 4NM8H 5EORH 4EI5D 1OAQL 5KAQF 4G9FE 3E2HB 4XCCL 4PGCB 4KROD 5INCB 4HV8B 3DBXA 3RWHB 2ZUSA 2BNRB 4OCYL 4N0YL 1HKLH 2X2YA 4LVHB 3DNKA 4DGIL 4WFHD 1MQ8A 3U7YL 3QZWA 1CVRA 5T33H 4TRPL 4ONOA 3HLAA 3TJEL 2DLEA 1IGCH 3WIHA 1E4KA 2BSTB 3BDYL 5GPRA 1GC1H 2XTJD 4ETQA 1MCRA 4YO0B 3T0ED 1A2YA 5H37H 3LMJL 2Y7QB 4XWGH 1JPFB 3OB8A 2DQCH 3GDBA 4M5ZL 1U9KA 3DSFL 3MRLB 1EGJA 5C92A 1T7YA 1PYWA 4HGMA 3CPLB 1WZMA 3ZDZF 4P23B 1JF1A 1A4JB 3H2WA 4YGAB 1QLEL 1YN7A 5E2VH 2HKFH 3KPSD 2X1WL 3VXPB 2VLRE 4KDTA 4Z7WE 4G8GB 5CD5C 1RUQH 3IFNH 4PRAA 2VQTA 4DOHB 3LKRA 3IJYA 3BZ4B 3FMGL 4N90E 3DSNA 4XWOC 3C2SA 1K4DB 2AXJA 4POZD 1WEJL 1GCFA 1N5AB 3K46A 4RCAA 3OPZH 4ORZC 5FKAB 5KVGL 4A6YA 1DL7H 3BH8A 4NUGH 3V7MA 2FSEB 4GS7C 4I0PC 4FFWD 4F9LA 2E8YA 1RFDL 5C3LD 3CVHB 3S34H 1NBVH 4YJZL 4Q9BA 2VXUH 1CICD 1ZSDA 1WFUA 4YR6B 1MJUL 2DBLH 4K9EH 4G43B 5FM8A 3QIUC 1DBJH 4XRCB 4OLXL 5EFIA 5IR1A 2FHCA 5KS9E 5I1KL 4ZOCA 1ZLUH 1G9MC 2QBWA 1A14H 1CFQB 3KPTA 3CXHK 3K8KA 3NCMA 1T22B 2CLVB 1JHLH 3HZYA 3GHEL 2IAMB 3RPKA 4TUOA 2N1KA 3IF1A 4YAQA 2PUQT 2L0DA 3QDJB 3UJTH 2MQ0A 4JCLA 1G9EA 1IC1A 2X4UB 3HE7C 3QXAB 1A1MB 4PGDB 4I3GA 1KPRA 3FO9A 5E99L 3THML 1SMAA 1A9BA 4GMTH 1TCMA 2I9LA 2IAND 4XMKL 1U95A 5TH2A 3WE6A 3F65A 5CJOH 3QRFM 5EC2B 4P0DA 4K3JH 3VFVA 4UQ3B 3ZHKA 5B39B 2QHRL 1FFPB 2VR5A 1ZLUK 3QEQB 1VDGA 4S2SB 5KANG 4ONGH 5IFAL 1IM9D 1FZKB 3DVNA 2X10A 1S9YB 4ONHA 3IAGC 1VPOL 4JM2F 4F37K 4JKWA 5JDJA 3LZFL 4OLZL 5C0FB 1I7UA 3R4DA 5C9JA 4JO1L 3CAFA 2AK1L 1R3LA 2E5EA 1HWHB 1NCAL 3GBNH 1MCOH 2AW2A 1MQKL 3TF7C 4MJ5A 3IDJA 5C71A 4LKCB 5M7QA 5IHZA 2QHLA 1MCSA 2WBJA 3MLRH 4YXKH 3O6MH 1EUUA 1XGRB 4ODSL 3RX5A 2OTUB 5F6IC 3UTQA 1OAYH 1C7SA 4HS6A 4PD4K 4DFHA 1B9ZA 3P40A 2BOCB 4UILH 5DTFB 3QH3B 4F8TA 4HDIA 5EZOH 5HVHB 5GZND 4U1NA 3MX0A 4XH2A 4IOIA 1TETH 2DTSA 4U1GB 2ZG3A 3KJ6H 1QEWA 5D1ZC 2OR8A 1YNLH 3HI1A 1YYLH 1D7FA 4CW1A 2OJEB 1V3LA 3QXTA 1PG7L 5EOQH 4XGZA 1A7OL 5FA3A 4JLRA 4HPOL 1GGCH 2IG2L 1BBDH 3VXRD 1YEHL 3BPOB 5T1KD 1T83A 3SE3A 5HDLA 2R0ZH 3AROA 3AUVA 5DJ6B 4HUKB 1MUJB 4HT1H 3HNTL 5EO1B 5HYEA 1YPZE 4JZNA 5E9DE 3LRHA 1HDMA 1I8MB 1BQHA 4ISVA 1VFAB 4BFBD 4EDXB 4QNPF 3MJ8B 4UOW0 1OTSD 2GQHA 4B41A 3GI8L 2O5XH 2W0LA 4TPRH 3L95B 3S6CA 2XNAB 4KU1A 2Y36H 4WUUD 3O11B 1H3XA 2YPVL 4U7KA 3S8WA 4IRSD 1N4XH 4FHBD 3ULVF 4X6CE 2LAGB 3AGVA 3HN3A 2PCPA 3SDAD 3UDWA 1JE6A 1RHHB 2O5ZL 2HYMA 2XKUA 2ZCLL 4HUWB 4NHCL 2F74A 3BP4B 4NNPH 2I9TB 3EOYG 3BPLC 1F4YL 4KK6C 1BFVL 2BNQA 3F7VA 4DUVA 5FUZL 1U42A 5MEPB 5EOCL 3Q0HA 1A64A 1RK0B 2D0HA 5BVJA 5IM7A 4FQXA 1VENA 5EU5B 1Z6JT 3G08A 3HG1D 4JREB 1IAIM 3FONB 3O3EB 2AJSH 4HSQA 1LE5A 3CDFA 4U2ZA 1MEXL 2FBJH 3PABA 3BI9X 3GHBL 4ZAKA 4S10A 4LSPH 1RZIA 1NBYB 2Y6SD 5DUMH 1U3JA 3KYOA 4JGUA 1T20A 1F11B 1NGXA 4YHOH 4NC2B 2CRMA 2EDRA 2CMRL 2EH7H 1JGUL 4HKBB 2O5YL 5DFVD 5INDA 4D0CB 1C12B 2GUOB 5CKAA 2WBJC 3WUWB 2EXWC 5B4MD 3A6CL 3IFPB 3DROB 2APTA 1UB6A 2VDLL 4P46C 5CEYA 4PJEF 4NM4H 3BP6A 4BKLA 3BJ91 3QQ3A 4JM2A 2HJFB 1CK0L 5DD6B 4OF7A 3ALPA 3UZQA 2FH8A 5I0DA 3P0VL 1A5FL 4Y1AA 3SQOL 1EXUA 4RMRA 1FVDA 3DETD 3L5XL 5T1MB 4LIQH 2FX7L 1QKZH 4FQQA 1MY7A 4KPHH 3ARYA 1N8ZA 3RDTA 5IFHH 1PG7X 5GRJH 3H9HB 3SDCA 2LU7A 2DICA 1RZFH 1GPOH 1LD9B 2Z8SA 3R1GH 3QEHA 5C0AB 1CDHA 1U8IA 4JFXA 4NUJA 2APFA 2EH8L 3VFRA 2FEDC 5F7WC 2DWDA 3LQAC 3T3PF 5BV7L 5ACZA 2IPUG 2UWEF 2P7TA 4NQSA 1IAOB 5D2NA 4PJIE 4V1DD 4M8QA 4EDWH 3QDHA 3ARGA 3ARTA 4HLJA 3T4YB 1RVFL 4MSWA 4ENEC 3AS2A 4RZCA 3OKEB 3HAEH 1R5VB 4Y4KA 5DD1L 3W9DA 4GS7B 3ZKMC 4I0PB 4AEFA 5DQJB 3K4AA 3LDBC 1VFBB 1NC4B 4LRIA 5IUSA 5K9OB 4ZFGH 1AC6A 3IS1X 3VXME 3UTOA 5GGSY 5I8CB 2NZ9D 3OAYH 4PRBB 5FOBB 5CUSH 1FO0H 4YFLF 1AO7B 1UC6A 3I6LD 3FT3B 4HEME 4HJGB 4OCRL 2DM3A 4Z77A 5BQ7B 3O6LH 1C5DA 2DB8A 1HSBA 3STZB 3HNVH 5FOJA 1WJ3A 2WINB 1W8OA 1R3HB 3W0WB 5LQBL 2FD6L 3WO3B 2HAZA 4L3CB 3FQUB 4OZGE 1YMME 2G5BB 3MBED 3TBVB 3UCRA 2VDOH 3JBG7 1HH9A 3ZHDA 2VC2H 4AY0A 3UTSA 2FJFA 3VW3L 4LBEA 2CUHA 4XI5D 2I60H 2VLKD 3TYGL 1IC4H 4OM1H 4WI9A 3OAYK 5BS0E 2H32A 4XP5H 3QDGE 3CLEH 1KN2L 1DLFH 4X6DA 3QZWB 5T1DH 4PRID 4P2RA 3ALXA 3IRPX 3OGCA 2VXTL 3HLAB 3L6FA 1BM3H 2PYEB 3GJFA 2CUMA 1HCFX 2CIKA 4PRPD 3DV4B 4ZNEE 4LLWA 3JVGA 2HWZH 4Y5YC 4GAJL 4JM2C 4OLUH 1A2YB 1XGYH 3V4PL 2C4FT 2AEWA 3CSPA 2BNUA 1UENA 2NY0D 6FABL 3LRSA 2W92A 4PJCE 3GO1H 5AYUH 1PYWB 1MCWW 4NO2A 3MRJA 3DX9B 4XVSL 1JF1B 4NKIL 5LCVH 1YN7B 5CGYD 4XPBH 1MCDA 3RZCD 1CYGA 1JFQH 5I1CL 4PRAB 3LKRB 3IJYB 3ZKND 2EKSA 1ITBB 4PJEA 1P7QD 4PRHB 12E8L 5D2NC 3MRKA 4URTB 4KVCL 3F6IA 4M1CD 5D1QD 3DYPA 5FCUH 1LO5A 4TUKL 1F4AA 3CFCH 3S98A 1NAMH 3LS4L 3BGMA 4OZFH 4WFHE 1RZJH 5B38B 4CVXB 2C5DC 1QO3A 4MNQD 2Y4SA 4Y16A 1NEUA 4MA8L 3VD7A 4A6YB 4KFZC 3BH8B 3CVHL 1CWVA 4Z0BH 4FP8L 3EYUL 2D7PA 2XTJE 3G5ZA 3SKUD 2M8XA 1ZSDB 2UWEA 1FH5H 5E5RB 1MJJB 2D0GA 4HH9A 4BZ1H 2VLJD 3SDYH 4POUB 2VUYA 3GSNA 5IR1B 5HHMB 3MREA 3HUJE 3KPSE 3KDMA 4FFYL 4HKZA 1TNMA 5T5FL 1MAMH 3ILPA 4TUOB 3HR5A 2VSCA 4JHZA 4JG0L 1JK8A 1L7TH 1T0MA 4WGVB 3RY6A 4EJ1C 4F80A 1L0QA 5DD3L 4GRMA 1AGEA 3MV9A 5FYKL 1RU9L 3GJEA 1H3UA 2VXVH 4XPTH 3ULVC 2QSQA 3FB7A 4RMTA 4QY8A 4U1HB 3FO9B 5TE6H 1TJGH 5SWSA 4YDLC 1A9BB 2DQGL 1XFPA 2BY2A 1A21A 1A0QH 2I9LB 1INDH 1U95B 3BPLB 3WE6B 4WO4C 5IEHB 3MGTA 4M7ZC 3VFVB 5A3IC 3GZKA 3IU4L 5J6GA 1PQZB 1BOYA 5HYJA 3T3MF 3WN5A 5DHYA 3IB4A 3HZKA 5EUOE 1LWRA 1BVKA 4NQDE 1K3IA 3DVNB 3G6AA 4PLKC 2F15A 5GS0C