3IXTA

Crystal structure of motavizumab fab bound to peptide epitope
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
220
structure length
212
Chain Sequence
QVTLRESGPALVKPTQTLTLTCTFSGFSLSTAGMSVGWIRQPPGKALEWLADIWWDDKKHYNPSLKDRLTISKDTSKNQVVLKVTNMDPADTATYYCARDMIFNFYFDVWGQGTTVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Motavizumab Fab light chain
publication title Structural basis of respiratory syncytial virus neutralization by motavizumab.
pubmed doi rcsb
source organism Mus musculus
total genus 38
structure length 212
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ixtA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ixtA01
2NY7H 2I5YH 5BW7C 4F57H 5T3ZE 4G3YL 4YHPB 5TQ0H 3CAFA 2BRRH 4B41A 2J8UA 3QWOB 5ID0B 4HFUH 4LLDB 4PFEA 4ODVH 3UJIH 5GJSL 1M6OB 4ZSOB 5E8NA 1QR1B 4UDTA 2R23A 5IVXF 4K94H 2RB8A 1DVFD 3HG1A 1G7PB 2VLKE 1EX0A 3TO4B 2EDDA 4ZS7L 4LVHC 3I9GL 2AEWA 2APBA 4JCMA 5A2KH 5C0JB 4JFZL 3O6LL 3W11D 1U42A 3BKYL 2O5YL 2V6HA 3M45A 5DJ2A 1XR9A 3EFDL 1JRHI 2DAVA 1JZ3A 4W81A 5FOBA 5C07D 4MMXC 4PJBA 3CU1A 2ZPKH 2J5LB 4LF3B 2CKNA 3SBWA 4DGVH 1YDPB 4DN4L 4FN0A 2GAZB 4L5FH 5F9OL 1QKZH 2NY0C 5LKNA 5JOFB 2MCPH 3E6FA 4LSPH 4HF5L 1BREA 1DBBH 3IFLL 2A73B 5E8DH 4DZ8A 2UVEA 4NBYB 3RHWK 4U1NB 2VYRE 3FB6A 4KPHH 2GYSA 2HMIC 4G8GE 5CD5C 3WFEH 2RFXB 4JDVB 4U1GC 4S1SL 4FQLH 4UT6L 1WZLA 4PP2A 3P4MA 1MCLA 2X2YA 5ETUB 3NVQA 2DTSA 2XWTA 5DI8A 1A9EA 4UT9H 5HYSA 4XAKE 2DQJL 5FO7B 2J1KA 3QP3A 4H8WH 4OCYL 4AQ1B 2J7LA 4X9BA 1EBAA 1I1AA 1Z6JT 5HYFA 2A9ML 3F7VB 5BOZG 1N8ZB 3VXUA 2JJUA 1HWGB 2IAMA 3L3KB 4KU1A 3P4OA 1YEKL 1UJ3A 1CE6A 4YK4B 3DJ9A 5I8KH 3FRUA 2VR9A 4Y4KD 1Q94A 1XF3A 3SGEH 4RGNC 4QTIH 3SE8L 5ESQA 3MRBB 4PJAA 5F9AC 4ZD3L 3S36H 3BSZL 2VLME 2R4SH 3RWEA 3GMPA 1FVCA 1H8SA 4H26A 5GSRB 5F7HA 2EEAA 3MV11 4EI5C 3V5KB 2IANA 2Z93A 1ODAA 4JVWA 4GBXC 3CDCA 4GUPB 4XWGL 3TBTB 1U2CA 4FQ1L 2DIBA 2EE3A 2BVOB 4Y4HA 5FYKU 3NA9H 4LLMA 4OT1H 3STZB 3IETB 5FM5O 5BVJA 4UV7H 5C0ND 2A6JA 1XCTB 3BN9D 3OXSA 4K9EL 2HKHH 2PW1A 3KPTA 1G7JA 3QIWB 3EYSH 4Y0GA 3BWAA 3OG4B 1CFQB 1NC4D 4YPJA 3TBSB 1XZ0B 5CUSL 4QCIB 3NPZB 1IRAY 3C6LB 1QRKA 1U9KA 4LSQH 4P5TA 4Y2DD 5J6GB 3NZ8A 5KVGL 4X6FA 1FNSH 2AQ3A 4WU7A 4JLRA 4K3HA 3WSQL 3QUYD 4N9GA 4PJ9C 1WAAE 4XCYA 3OKNB 2NXZD 2F54A 4NWUL 1G9NH 5CJQL 3GJFB 4MQXC 5CSZA 1HWHB 2FH8A 3IDIA 4MA7H 4I5BB 5HI3D 1ZLSH 3K8LA 1F4XH 4YHLL 2GSGB 3TNNB 1JGUL 2F53A 4P99A 3G9AB 1PAMA 4PS4L 3TJHC 4OJFH 5CLWA 2ICWA 2VLLB 5H2BA 4PGBB 5I30L 1YEDA 1CT8A 3WIFA 1RPQA 5JW4N 5GRWA 32C2A 2H3NB 2BNRD 2PYED 1KB5H 5E8PB 4XVUD 4M5ZH 4HKZB 5IB4B 3F62A 1AKJA 5IHBA 4O2CB 1BMGA 1LE5B 4LSDA 4FQCH 4APQB 1NMBL 2CK0L 2VZ3A 4P2RE 4R26H 2DQUL 1NCWL 4JPIA 4WWKC 5GGSA 3G5VB 3MRNB 4DJMA 5MI0B 3DI3B 4JFEE 5IB5A 3HE6D 3O81A 5H94A 3FT2A 4MNQA 5A1AA 1RUQL 4Z76B 2G2RB 2NY1B 4PJCE 2OSLA 2H41A 3WL9A 4AL8H 2HG5A 3CH1B 1WAAF 4YLQT 1DLFL 1DBJH 1IC7H 4M3JA 4LVNC 1UWXH 2WWMD 5D93C 1XF4B 4MJ6B 2IBGA 2LV4A 3H9HA 4F7CA 1DL7L 1FFNB 2J6EL 3T77B 2XKUA 3KGRA 5DTFB 5IWLA 1MH5B 4DGIH 3O6FD 3MLZL 3TYGL 3UAJC 3JUYA 3MLWH 4LFHG 2J8UB 1AE6L 2UYLB 3FTGB 2QSQA 3EW3B 1OGAE 2NY4B 3QUXC 5ACMA 4MCYA 1RK0A 4YUEH 4D8PA 1FYHB 1C5CH 5ERWB 4RA3A 4WW2F 4FZEL 4ELMB 3U9UB 2R4RH 3KPMA 4Y16D 1ZVYA 3HG1B 4XMPL 2IG2H 2EIZB 4NQDB 1RMFL 4L4JA 1J1PL 2J12B 4QHNB 2WBJB 5GPRA 3BXNA 2OL3L 5DJ2B 1XR9B 3TJEL 1J1OL 4DZBA 3QIBB 3IXTA 4PJCF 3O3AA 3UPRB 3A6BH 3E6HA 3MRRB 2JIXA 5FM5M 4YHIA 4IRSD 3FO9A 4PJBB 2EDNA 4BZ2H 1U91B 2Y36L 3FO1B 4PY7A 1CGVA 4MXWL 4JHZA 1Z5LA 3PNWA 1QHOA 3L5JA 4AEHH 5CGYD 1N64L 1NBQA 2X42A 1MCWM 3QQ4A 3E6FB 4J3XA 2DYPA 3PDOA 4X8XA 4DZ8B 1I1YB 3K2UH 5SWSB 3FB6B 3QDGA 2NY5H 4HDIB 5T1LD 4M7LH 1RULH 3M1BA 2Z91A 3HI5H 4OGZA 1IGCL 4PUBH 4QGTA 5E95B 2XWTB 4D9LL 1SJXA 1A9EB 5HYSB 4H1LB 1X4XA 5I73C 2FATL 2YD1A 4XP1H 3MRKB 4TRPH 5DJXB 2NNAB 2OM5A 2ZSVA 1R3LA 4NC2B 5LAXB 3BKML 1I1AB 2Q6WA 4KROD 5CZKA 3P9WB 4HULB 3ARXA 3QEQB 5HHPA 1GCFA 1K3ZA 1BX2B 3VXUB 3SDCA 3TBYA 4FOMA 1S7VA 1UJ3B 1S8DB 3T1WA 1Y6MR 2OQJB 1YA5A 2X4TB 3UJTL 2MOVA 5T1DH 3ZKNC 3U7YL 4RRPA 5F7DB 3BP7A 2XN9B 3BQUB 4OTXH 1NH6A 4HKBB 5DEFA 5C07E 4OLZL 4MB5A 2BOBA 1BJMA 2DICA 2ED9A 5DZOA 2AV7A 5F1SA 1BF8A 5C9JA 1P9MC 1HHJA 5E6YA 3DVNA 1B6DA 3FOLB 3EZ8A 1I9JH 2CDEA 3F7QA 3MNVB 5E99H 4GW5A 5JXED 4M5YL 4FQIH 4J4PC 4G9FA 4MJ4A 1OPGH 4LLMB 2A9NL 1U6AL 3HZKB 1QPXA 4PD4K 4PLJC 3C08L 4P59H 5CEZD 3OXSB 3T0ED 2PW1B 1G7JB 5LBSL 1QFUH 2VC2L 3RX7A 4HUXB 2B2XH 2WWKT 3PWJA 3MBXH 3RZCD 4HMCA 4JO2L 5FKAB 4YIQA 3BKJH 3U30B 2QBWA 2W9EH 4XWOC 4LCCA 4OGXH 3VFGH 5FAAA 4KJQD 4GBXA 1TMCB 4WU7B 1S3KH 3HE7C 4JLRB 4E42B 2E7LA 4OD3L 3TT3L 1ZTXL 1S7RA 3R0MA 3VFTB 2Z92B 3JV6A 4JFQA 4ODTH 43C9B 2B20A 4Z95H 4XRCA 3U0WH 2A6KA 1LP9A 3FAWA 4XB8A 4OFVA 1NGYB 1FG9C 2J4WH 2CJUH 3P9MB 5FCUH 1V3LA 2F53B 3KDMA 5D7SL 6FABL 1AO7A 5IVZB 2EDLA 4C59B 2ICWB 1YEDB 1CT8B 3WIFB 4EUPG 1UWGH 3HNSH 3SOBL 5C09A 4MNHB 1L7IL 3H7BA 4M9OA 5DRZA 3UJJL 3CPLB 1FNEB 2YRLA 3BJLA 2ZUUA 1XF5A 4LCWA 3RL2A 3IXAB 4HC1H 5F44A 2N4IA 3OF6D 1X5XA 5F89A 5TDPB 1OARL 2XA8L 4P49A 3WIHL 3ULUL 4ZOAA 3C60D 3G5XA 5BQ7B 3SDXA 4W4OC 4LVOB 5FGBA 2WMPA 4KTYA 1EV2E 1KPVA 1OAUH 3G6AA 1A2YB 1KTKE 3WFBH 2EE2A 3K0WA 3PG2A 1EJOH 4MJIB 3IYLW 3ZDYF 4WO4C 1F4YL 2E27H 4WY7L 1TCMA 5JTWA 4EUPH 4PLNC 3RVWD 2EH7L 4HGKC 4ZMAT 2Z8RA 4GH7B 4HPOH 2R8SL 3KJ6H 4F7CB 3H9HB 4PBXA 4UI2A 4YEEA 1NGPH 1SEQL 4YHYC 1QSEB 2VLJB 5DD5H 5EWIL 2V9TA 2BNRE 4XPFH 2PYEE 3FMGL 4OZIE 4OQTH 4GRLD 4P0DA 1WTGT 3PABA 4XB7A 3O2DH 1U8NB 4IDLA 4YBLB 2ICCA 4PRDB 2CUMA 3QR2A 3KPMB 2F5AH 1AXTL 2FLBT 5FYKL 2VDQL 2V17L 4XPTL 1FO0B 5HHVH 3VD3A 2KZWA 5CCKL 1BZ9A 2XQBL 5ISZB 1FYTA 2W0KA 1KIQA 3BXNB 4NQSA 3VFNB 3HA0A 4CGTA 3BESR 1XR8A 2FLRT 4FQPA 3IXTB 2WP3T 3HCVA 5CZXC 1FZKA 3FO9B 1XF2A 4G6ML 1UXWA 1KJ2A 2VXVL 1FJ1A 5I1JH 5DJ0A 3CK0H 5E8OB 1WT5C 2DYPB 1HSBA 4WI4A 4JCLA 2WQRA 3THMH 2Z0BA 4X6CB 1IM9D 4LRNL 4LVHB 1ZT4A 5E7BA 3ZZ1A 4L29A 3FB7B 4X0KA 4HK0B 2D7TH 3N1MC 4WGWB 5A2IH 4HIIA 3TO2B 3GUTB 4OZIF 2FNBA 1V8HA 1NAMB 5HYQA 4N9OB 3U4AA 4PJ8C 1IEBB 2V2TA 1SJEA 1B4RA 1M7DA 1NPUA 4UOJA 2Q6WB 1AI1H 3QFDB 4ZFOA 2EYRB 1YZZA 4JRYD 3B5GA 2NY0B 1J0KA 3KVQA 3RA7H 1S7VB 4I18C 4RA0C 4R97C 4UINH 2Z31D 3GI9L 4M7LT 1JPFA 1HZHH 4X7DC 4U1GB 3MRPB 3MA9L 5C2BH 3BP7B 4XH2A 2QSVA 3T2QA 5IG7B 2P8PA 3EO0B 5C0FA 4OZGE 4RMVA 4LAJH 4S0TD 5C9JB 1NKRA 3AM8A 4M1DL 1UH2A 4G3YH 5DDHB 4PP1D 2VZTA 1QBLH 3HMWH 4GW5B 4NRYA 3TP4A 5GJSH 4G9FB 1WC7A 4AYFA 4OIAA 4QT5A 5IR1A 3VXMB 1Z9MA 3LKRA 1PLGL 3U2SA 1ADQH 4TVPL 1EHXA 1SVZA 2D7OA 4UIKH 3EGSB 5HHQA 4HJGB 3VXOA 3HB3C 1B88A 4BSWA 3ZSSA 4RGNB 3JWOC 5DJDB 2PYFB 3PWJB 2ESVA 3I9GH 4YIQB 3BGAA 5DURB 3BKYH 4JANB 2O5YH 4EI5B 1PG7X 2AQ2A 4H88L 4Y1AA 4BQ6A 3EFDH 4BK5A 4PJIA 4GBXB 4FXLA 5I66A 1G1CA 3BVNA 1JL8A 4YR6A 3OKOB 4WU5A 3QH3A 2R1WB 2QL1A 4JZJC 1VGEL 1XAUA 2BXZA 3JV6B 3JZ7A 4JFQB 1G7HA 1MJJA 2FBJL 4DN4H 2A6KB 1YPZB 1UWXK 1LP9B 4OZGF 3AY4C 2CLVA 5DEGA 5F9OH 2VMFA 1P5VA 5FXCH 2OYPA 3SGDH 5MENB 1Q9KA 3T3ME 5KSBE 3WNKA 1T2QL 4Z7UA 4Y19D 1MAKA 1S5HA 1T21A 1AO7B 2XRAH 3TH4T 2FDBP 3OXRA 5JOPD 4UT6H 4WTWA 3HS0A 5C09B 3AXLA 1IQWL 4S11A 3R4DA 2MKWA 5EU5B 5CEZE 4OCYH 4PJ9B 3T0EE 3LKSA 3IJHB 4NKDA 1EFXD 5C9KA 3I50H 4P3CL 5TGBA 2A9MH 2H2PC 4BKLB 4GRWB 2C5DC 5GQBA 3MLRL 4WI7A 1YEKH 5F3BA 2HT4C 5GJTL 3SDXB 2DDQL 2VR4A 1F3RB 3IKCA 3G6AB 4Y4FD 3GMOB 1J8HD 4Z7VA 4RWYH 3CVHA 4IMKA 3ARRA 3LY6A 4JO3H 3PHQA 3TBWB 5E8EB 3GMNB 5EH1A 4F7PA 2HTLD 4JQXC 4HXBL 2XY2A 1NFDA 4ZD3H 3BSZH 5C0EA 4JZNA 4PGCB 5DD6A 4MDJB 1K4CA 1OP5H 2PO6D 4NYLB 2AK4A 1MCRA 5A40E 2BVQA 3T3MF 2BHYA 3LIZL 3ZYOA 5KSBF 4XWGH 2NZIA 4WWKB 1XGUA 2P1YA 4FQ1H 4W4OA 2ZCKL 2MQCA 4TTDC 1KXVC 5INCA 4ZFFA 2Q3AA 2UZYB 3MLXL 1FL6B 3PABB 4K9EH 3WJLA 3DXAA 3NTCL 2VN7A 5GGTL 5KS9A 4LSRL 1F02I 4FFVD 5JPNA 4LVNB 3TT1L 5CUSH 3TPUA 5D93B 2P7TB 1NCAL 3GZKA 3WCYA 3ARDD 5BZDB 3EO1B 5KVGH 4L3EA 2Y4SA 1IM3B 5IJVA 5EU7C 1BZ9B 3RI5K 4NQSB 3ZT5A 1QEWA 4JJ5A 5CINL 1XR8B 2QQNL 2X70A 3OMZA 5F8RC 5CJQH 1F2XK 3QUXB 4I3GA 3HCVB 3AB0C 4F37K 3BKCL 4F9LC 3S96A 1A7OH 1FE8H 4PLKD 2Q1EA 5FHAL 3BUYA 4ZUTB 4N1EA 5BS0B 2V5YA 1FJ1B 5F9JA 1I3RA 2D4DA 3GBLA 1JGUH 3IJSA 3IJYB 4MVBD 4PS4H 1DFBL 3EFFA 1HSBB 4MNGE 3O3BA 3P4LA 4O51B 1BQLL 1ZT4B 3EKCA 4X0KB 3KPPA 5J3HC 4R96B 1OTTD 4OGAD 4M48H 3L3GB 2A6IA 3NFSL 4EVNA 1F3DH 3BI9X 1DQQA 3CCHA 4P2OC 3RY4A 4AEIH 4MQ7A 3O2VH 4R90H 3JTSA 3W9EB 3MRHB 1HCFX 1NMBH 2CK0H 1H8NA 1EGJA 2PTVA 2DQUH 2I07A 1M7DB 1NCWH 4KXZI 4PRPA 3WFZA 3DMMC 1A6TA 5F97E 5CHNA 2KZ1B 4R4BB 5T5NF 3EYUL 3QWRD 4Q97A 5KZCD 1X5IA 4J7RA 3V52L 2LU4A 1RUQH 2AJZB 5GZOD 3BW9A 1RVFL 2DQIL 4C56D 1U8HB 3O8XC 4OFYA 4ZAKD 4XH2B 5IROC 4ELKA 5C0FB 5BXFA 3DV6A 1ZGLA 1JPGB 3WD5H 5ENWB 5I73B 5HVFB 2J6EH 1DR9A 4J1UA 4PJ8A 1YMHA 4C4KO 3LEVH 4G80A 3DETC 3MLZH 4KQ4L 1FFOB 1KG0B 3L1OL 5IHZA 5IF0A 3MV9D 1AE6H 1HILA 3VXTB 3QPXL 4JFPA 3O11A 3HNVH 5C7XL 4NRYB 1EH9A 4TSAL 4ONOA 1WC7B 4FFZL 1Q1JH 2D2OA 3EOTH 1U3ZA 5AYUL 3LKRB 3U2SB 4R4NC 5JIPA 4DFHA 5SX5K 2AXHA 3P73A 4KK5D 4BSWB 4AENB 1WICA 3PGFL 5FGSA 1NLBH 1L6XA 1J1PH 5IB2A 4JRYE 4M61B 5EO0A 3LQAL 5HD8D 3ULVL 4LPCA 5DUBA 2YUXA 3TJEH 1J1OH 4PJIB 4H20L 1GGYA 3OAZH 2N7BA 2HWZH 1RK1A 3BVNB 2C3WA 4KJPC 4YR6B 1BECA 5I71C 5DXWA 1BLNA 4ONHB 3OAUL 3RGVD 1OHQA 5IM7A 4TUJA 4TTGA 1G7HB 1T1ZA 1NBZA 1N64H 4RDQG 2B4CH 4XNQA 1Q9KB 3CSYA 5EA0L 4PJEE 4Z7UB 3V0AC 1S5HB 2DS4A 3OXRB 3DV4A 5HY9A 1NBYA 4ODBD 1ONQA 2GY5A 2QQKH 3L3JA 3HUJE 3HS0B 4JFFB 4GG8B 1DANT 4D9LH 4YXLH 5E4EC 1OSPL 3QUMA 2FATH 4K3JH 2IF7A 1UWEL 5KOMC 5SWZA 1YEHL 2DD8L 3LKSB 5HHXL 2K7QA 3BKMH 5D2NA 4OZHE 1A7RL 1X5JA 4JN2A 5IFJB 1MAML 2BCKA 3MRIA 5T3XL 2LU3A 1AJ7L 1RHFA 3BDBA 5F3BB 3HPJA 4K8RL 4IIQC 3UJTH 2VXUL 3E8UL 2VZ1A 3U7YH 1WBZA 5C0GA 4DK3A 3RAJL 4OLZH 4YHNA 4RMQA 1MFDH 1IMHC 1SJVA 4P3WA 5EZJB 5I74C 2Q8BH 4JZNB 2ATPB 1INQA 4P57A 4KWUA 1GAFL 3KPSA 1TZHA 4P5KA 4Y19E 4PJEF 2K1MA 5ABDE 1WZMA 5JOPE 1XGUB 4UBDC 1MCEA 2BNQB 1FIEA 1EO5A 5INCB 1U6AH 3HUJF 2RCSL 3GSQA 4IOFD 5EO1B 4BZ1L 1MJ8L 2YC1A 2P5EB 2R0KL 2NW2B 3C08H 4XP9L 1IKNC 1RUMH 4PG9B 2MPAL 2VDLL 2VC2H 3N85H 1S9YA 4WO4B 2B8OT 3HI1A 1FFPB 4JO2H 4OZHF 4DTGL 4DK6A 2HT3D 4QRPA 5EU3B 3WIIL 1II4E 2DL2A 4NQXA 1HHGB 3I2CL 4L3EB 4YHYB 3CZJA 3WO4C 2WK2A 4OD3H 1J8HE 1QEWB 1MFCL 1U92B 1V7ML 5D9SB 4FZ8L 1N26A 1VEPA 5J89A 3ZDZE 1NLDL 3FT3A 2DWEB 1F4HA 3MLVL 1O7VA 3S36X 3BUYB 3P9LA 3QDHA 4X83A 2HH0L 5D7SH 5D1ZC 2YBRA 3WJJC 3TGXA 4TULL 3WLWD 1UH4A 3MUJA 3SOBH 1G84A 3IS1X 4UTBL 2BFVL 4NBXB 5CD3A 3KPPB 1L7IH 4L3CB 2YPLD 3UJJH 3IDJA 2A6IB 4Y8DC 4EVNB 1IKFL 3CCHB 3ARWA 4DUXA 5DD0L 4NNYB 2I27N 1OARH 4F9LA 2XA8H 4X99B 4PRPB 3WIHH 3E3QE 3ULUH 4HK3N 5L7XL 4BH7B 3RJQB 4KJYA 1CICC 4P9HC 3SPVB 2DF3A 4R4FH 3X12B 4KKBD 3B9KC 3B9VA 1T22A 1J86A 1MY5A 4Q6IA 1F4YH 2Y06H 5C0BA 3ZDZF 1T3FA 5F9WC 4NUGL 4J2XA 2EH7H 1NDMA 2MQ3A 4P2OA 4IRJD 2R8SH 1BJ1H 5E6ID 3KXFD 4AY0A 3Q2CA 2FEDC 4XCFH 3O3EB 3QHFH 3JBG7 4PJ8B 1YMHB 1SEQH 2OR7A 3ZSTA 4G80B 5C2UB 3FQTB 1W8OA 1QO3A 1M7IB 1T20A 1KTLB 1HCVA 1HILB 2EKSB 1A6ZA 4JFPB 1S7UA 3FMGH 4I8DA 5CJBA 3L7FA 4I18B 2AJ3B 3BD4A 5GGSY 3LKNA 3RKDC 4FABL 3WMSA 2C7UA 4WI5A 5J7CC 4ZPVA 4M6AA 3K74B 4BFIA 4J3UA 3O8XA 1QFPA 1UJTA 5IBUG 4OV6F 1TVBB 1P4BL 3H7LA 4HS3B 2HFTA 1AXIB 1CYGA 1AXTH 2XICA 3JV4A 2VDQH 4CN1A 2V17H 1F45A 4XPTH 3ROOB 4AK1A 1F42A 5HGAB 4MZ3A 3NAAH 5CCKH 2XQBH 1QSFA 1XIWA 4MAYC 2A38A 5DUBB 3UPCA 4XNUL 1KN4L 4C56E 3LRSA 1P69B 3EYFB 5CJ5A 4HV8A 3MXWL 4WI9A 1JTPA 5F72S 3VI3E 4G6MH 3TIEA 4PJ5A 3QCUH 2EO1A 1NBZB 3TVMD 5CMAB 2VZOA 5I1EL 2WUCH 4HIXL 4LSSL 3CX5J 2G9HA 4LRNH 1P6AB 3B8YA 3MV9E 4NFDA 3DV4B 5DQDL 1AC6A 1I4FB 1NBYB 1Q0XH 1ONQB 5C0IB 3RTQC 1RHHB 3ZT6A 1U3YA 4EN3C 3PHSA 4A6YA 3QUMB 5J1AB 5FUOL 2H32A 3WYRA 4AEFA 3U46A 1LNUA 2DQHL 1ZHBB 4JZJB 5D1QC 1QNZL 3HZMA 1U8MA 2ZUYA 4JN2B 1ORSA 2NYYC 3MRIB 1N3NA 1G7MA 5EORL 3PQYA 1FSKC 3RIAF 1KCLA 1CFVH 1S7SA 1BZ7B 5DJZA 3HPJB 3KPRD 5LWYL 4CU7A 3GI9H 2OTWA 1HNGA 2X10A 4JFDA 3BZ4B 1F5WA 5DHVA 5F6IB 1C7SA 4BQCA 4G6KL 1Z0NA 4NKMB 3VH8B 2DLFL 4M02A 3O4LA 3WXVL 3GMMA 2A0LD 1N5YL 1T4KA 2YOCA 3VI3F 3F7YB 4KH2A 1EO8L 1INQB 1AGDA 4LQ1A 1UGNA 2OR8A 4D0DA 3EJYD 1TZHB 1IGJA 1YYMH 2HVJA 4G6JH 2MKLC 4M9PA 4XNXL 5D7LB 2I9LA 3SJVB 3BO8A 3GSQB 5DK0A 1ZA3B 1PLGH 3D0LB 3DUUA 3FZUC 4M03A 5J0BA 5BZWB 4BH8A 1UZ6E 4N8PA 5B38G 4H5SA 4F2MA 4P2QD 5KTEL 2GHWB 4FP8L 3GKZA 3MNWA 1QFWI 1I9EA 1ZSDA 4H88H 3NOIA 4JQVC 2V2WA 1PSKH 1ES0B 1ZHKB 3ARBA 3K4DA 1FO0L 3LOWA 3NCYP 4XMLL 3DUSA 4Z7WE 3G6DL 5EOTB 5FOJA 3FT3B 2FBJH 4XHJD 4HUNB 3ESVF 1IKNA 1BQHG 3OJ2C 1JMXA 2DN7A 4KVCL 1QBML 2NY6C 1IAKA 3P9LB 1CXHA 3I3EA 5GHWL 12E8L 1D6VL 2NLJB 2ZG1A 5EBMB 1QG3A 2CD0A 3ARED 4XPHH 2K9UA 1A0QH 2E8ZA 3QO0A 3CFJB 1EPFA 4AIZB 2HLFC 4D0CA 4RSVA 5JQ6L 4J3OC 5AYQA 2IQAB 4L4VD 3JXAA 4PLOB 2HFGL 3WKNA 5ICYA 4RGMC 1A3LL 3X11A 2P44B 2BVUA 1HDMA 1RV6X 3VJ6B 3TA3A 1IAIL 5JQHC 1DCLA 4KKLC 3IDJB 2MCG1 1KIUA 4XC1H 5HHMB 1TIUA 2E6PA 3MJ8A 4P3CH 1CTOA 1NAML 3AB0B 1UZ6F 5I16B 5GIRA 4FG6C 1WK0A 2KBGA 5GJTH 3L6FB 3IFNH 1MQ8A 1NSNL 2ADGA 2DDQH 3TH3T 3OX8A 5IJKC 4CAGA 3OAZK 3FFCA 3FO2B 5E0QA 4KZEL 4WHTA 4CJ1A 5EOCJ 4HXBH 4JQIL 5C0BB 1T3FB 3BD3A 3BIKA 3NN8B 4P2OB 5EUKB 1XGPA 2BHZA 4WI2A 4ZUSB 3SCMD 4QLRA 5J9PA 5T1MA 4Y7MA 3GFUA 3VMPA 4PB0L 5CFHA 3LIZH 5DSCA 4LRIC 4RAUB 1LO4H 3DMMB 1QO3B 2VLRD 2R2BB 3D85A 3ILPA 1T20B 2ZCKH 1ZT7A 2CLZB 4S1DD 4X6DA 1CICA 4I4WA 1JNLL 5HYIA 2YPLE 3MLXH 3L7FB 2L7JA 2ZCHL 2CIIA 5A16B 4R7DA 3D3VD 3V4PL 1TJGH 2NY2D 2W0PA 2WBWB 3NTCH 3QIUA 3ARGA 5GGTH 4LSRH 1B0WA 3MUY1 3O8XB 5BOPA 3PXHA 5FCSH 4NCDA 3ARFD 4KUCD 3TT1H 3LN4A 4N0CD 3MQIA 1J0JA 1NCAH 2FYYB 5LCVL 2DTML 1BOYA 2Z35B 4KC3B 1Q72L 3MFFB 1K8IA 1KNOB 4UQ2A 2H2SC 4Z7QF 3SEPA 4KKAD 5CINH 1UKTA 2QQNH 1WBXB 4D94A 4XP5L 1CGXA 4HV8B 4MD5A 3BHBA 5KSAC 2PR4L 4HS6B 3C8KA 3KXFE 3LMJL 1HOCB 2C1PA 3PP3K 3DARA 1GZQA 3TCLA 1DFBH 4RDQF 1URLA 4LARL 1NEZA 4UB0L 3QDJD 2G9HB 5D72L 4U1JA 5B3NA 1A64A 4M7ZC 3QULA 2GK0B 4MAYA 3O4OC 4F7MB 2GY7B 3C9NA 3B9DA 1GGCL 1J87A 4A6YB 3L3OB 3MV01 5I71B 5FDWB 1D5BA 2H32B 1PKQE 1R24B 1M4KA 2XKSA 2QHRL 1I1FA 2A77H 3RDTA 4F3FB 3S5LA 3BIBX 3EYUH 2F5BL 4KKNA 3PQYB 3V6FA 5F3HA 2ED7A 4W4NA 3R1GH 3T0WA 1R3KB 3CU7A 1BEYL 3CC5B 3N1GC 4PB9L 5C0AA 4ONGL 1EVUA 2FH6A 4QYOA 5E4IA 3EZJB 4CUCA 1FAIL 1O0VA 3O4LB 5E4EB 1T4KB 1N59B 1GGUA 3SKMA 4G8EA 5D1QA 4EXKA 1ZAGA 4KQ4H 1X4ZA 4D0DB 4PJDB 2KL6A 4RAVB 4FQXD 4MS8D 1IGJB 4X4ZA 4X98A 1HEZB 2GEEA 3QI9A 5B4MD 4TSAH 4ZO6A 2VITB 4GRMB 4FFZH 4IIQB 5D5MA 4I0PA 5KVEL 2CKBA 5AYUH 3SGKA 1UYWL 1A7PL 1DSFL 4KTEL 4QXUL 1U8LB 1IEAA 5M95B 4XBPB 3PGFH 3CFEA 1PG7W 4HK3J 4LOUD 4F2MB 5I74B 5FUZL 1LDPH 3EDKA 43CAA 4GSDH 1ZS8B 3ULVH 3KPRE 4NCC2 2OS7A 3QA3B 4H20H 2V2WB 5HDLA 2EZ0C 1L0QA 3WXWL 3NFNB 2ZKHH 3ZE2E 3OAUH 3UYPA 2AQ1A 3BMVA 4LDOB 4DUVA 4X7CC 1P53A 5DMKA 1IAKB 3AVEA 5L2KD 1HHKA 3VGDA 3QFJD 3QO0B 4LBEB 4UT7L 4JRXA 3HFMH 1G7QA 5HI5C 3OZ9L 5EDXA 3RVUD 3NIGF 4JQVA 2C1OA 5C08D 5ICYB 3WO4B 1HDMB 3GMLA 3M8OL 1LO5A 5MERA 1UWEH 3GSNB 1YEHH 2DD8H 5HHXH 4PJHB 1HNFA 3BIAX 4P2QE 1MAMH 5T3XH 5EU4A 1U8OA 1CLCA 1YMMD 2BP3A 3MBED 2IEPA 1E4XL 3VXRD 1FPTL 1A1OB 1ZKAA 2VXUH 3E8UH 1C08A 2XTJC 3FN0H 5D1ZB 3VG0L 2F58H 2NR6C 1U8QB 3OX8B 1E28B 5HYJA 3Q3GB 4MCZA 4YDIL 3FFCB 1ZLUK 3RAJH 3EYQD 3LHPL 2V9RA 3OR6B 5DD1L 4ZTOH 1RIUH 15C8L 1IGYA 3RWCA 1DEEA 3BIKB 1WIUA 5HGBA 1CF8L 2BSRA 5T1MB 3MV7B 5DRXB 7FABL 3RNKB 3GMQB 2Q76A 3RVTC 1RIHL 3H42L 5DSCB 1KCUL 1A4JA 3CMOH 4KI5F 5IESL 3JV5A 5IHLB 4L4VE 1CICB 4BZ1H 5IVNA 3HN3A 2X40A 3IDGA 1FVDA 4X6EA 3B9KB 1JZ8A 2FSEA 2VDLH 2YA1A 1HH6B 1GZPB 3RP1A 4ZNEA 4Z7OE 5F9WB 3QPQC 4QRTB 5F7MC 4NKQB 2A1WL 4P4KD 1WBYA 2ICEB 3GNML 3CSGA 3QXTA 1U0QA 3WIIH 4WEBL 4MA8L 3IVKB 3SGJA 2BSSB 2NX5D 1V7MH 1C16B 5HYSG 1JUFB 4FZ8H 3QG7L 1LDSA 3C09C 4KK8C 1NLDH 1TTFA 3O6KL 1F3JA 1RD6A 5LGKA 4MD5B 3ZKSD 3AMKA 1TTUA 3BRFA 1CDUA 2DKSA 5MP6H 4K2UL 4ETQA 1BD2D 5ANME 3TCLB 2AXGA 1VPOL 2VLRE 2H8PB 1MJUH 4IOSD 4BELD 2BFVH 5FA4B 2Q7YA 3A67L 3U83A 3QULB 1K5NB 4LSTL 3VXPB 4MAYB 1BVZA 3ZTNL 1CQKA 4U1HB 3LB6C 3D3VE 3C9NB 2K3TA 1IKFH 1FORL 3GB7B 4I48B 1IC4L 1BZQK 1D5BB 5DD0H 3B83A 2APVA 4OCRL 3QISA 3CDGB 1S9XB 2DM4A 4MQSB 4Z7OF 1YN6A 5KSAA 3RDTB 2H45A 4MXQC 2VKWA 5L7XH 4UV4H 3S5LB 4HKXB 4JM2A 3FONA 5HHNB 1QFWL 2R0LH 2J3SA 3NBNA 1W2KT 3V6FB 3LH2L 4XPAL 4S10A 4KK6C 4QTHA 3VFPA 1ZEAH 2GUOB 1OGTA 3MJ6A 3RTQB 4NUGH 1CGTA 5TFSL 1VB9A 3GSVA 4CW1A 1LEKA 4EN3B 3H6JA 3VFUA 3WNPA 1F8TL 1INDL 3MODL 4HBQA 2Y7QA 5IK3A 3SKMB 4GS7C 1LD9B 5D1QB 4CNIA 1DLHA 2AJSL 5DC0A 2D9CA 3QDJE 4QWWD 1T0MA 1T03L 3CH8A 5DVOA 5FV1L 3VD7A 4X98B 5GRJL 4ZQKB 1FSKB 1QPPA 3LEXA 4U33A 4M4RA 1LK2A 1NCDL 3ZKMD 5J1TC 3PWPD 1EERB 3K4ZA 4P46C 4PBVC 4FABH 5D5MB 5DVLA 5EUOF 2CKBB 4BM7A 3MUGA 2YK1H 4GKSB 4I3SL 1P4BH 3MZTA 4XNYL 3JWNC 4NRZB 1XF1A 4ZUWA 4KUCF 1MNUL 3CFEB 2UWEA 1VSCA 3QQNA 4XVJL 4GG6B 1KN2L 1H3PH 3BAEL 4PY8I 3RUGF 2FX7H 2OK0L 4X9IA 5CJXA 3C2AH 1YUHB 2EIDA 3V4UL 4GAFB 5D1XC 5CIPB 4N5ED 4WRLA 3OAYH 1B9ZA 1KN4H 4JZOA 1TJIH 3MR9A 1LEIA 3LSOA 3RPIB 3MXWH 2EH8L 1AD0A 1A1NA 4L4TB 3FQRB 4PRHA 1QA9A 4HD9A 4QRRB 4NUJB 1U8JB 4NRXB 3F12B 1KLFA 3FN9A 2WZPD 5I1EH 2YR3A 1ACYL 1C5BH 4HIXH 1J12A 4DAGL 2IAMD 1DQML 1UG9A 1E27A 1A6WL 4JRXB 3V6OA 1G7QB 4AJ0A 5SX4H 4QOKA 5KVFL 4EDXA 3QJFA 4GO6B 5MERB 1H9VA 1P7HL 4HWZB 4IJ3C 4TNVF 2P45B 4J23A 2DQHH 4J3TA 3S37L 1S5IL 1FNFA 1A7NL 4K3DL 2OMBA 4J12A 1AR1C 5CJ8A 5T1KA 3IDNB 3KYKL 4NP4L 5TPWL 1EHLH 1Z3GL 2IAND 1EGJL 2JCCB 2ITCB 1H5BC 3F58L 3KS0J 3C5JB 3WUZA 5HYJB 1S7WB 4Y4HD 4FHBD 4U1LA 4AZ8A 4NQCB 4G6KH 4P4RB 1NUDA 2DLFH 4F8TA 1E4JA 3MJ7B 4RGMB 1BVKA 2L4OA 3WXVH 1AIFA 1TCRB 1N5YH 3AMLA 4JFXA 3OGCA 4M6NL 2HTKD 1EO8H 1DEEB 5IVXA 4OZFA 4XVSL 2BSRB 1I8KA 5L2KE 2R0ZH 3DRQA 5GS0C 2Q76B 4XAWL 4YZFE 5JA9A 3QFJE 1UXSA 3KPOA 2GCYA 4P5TD 1A4JB 1XGRB 1A6UL 3BDXA 4XNXH 1ZVSA 1QLFA 5EBWA 4YO0B 5C08E 2YUZA 3WS6C 1S7XA 1BIIA 1S9WA 4NN5C 3VDBA 4Q9QL 2YRPA 4WHCA 1I8MA 2F54D 4X6EB 1UCBL 4U0RC 5I1AB 4PJ7E 2FSEB 4PV8B 1N6QH 1EAPA 1EUTA 2AI0H 2Y9RT 3NCMA 3P0VH 4RFEB 2ZG2A 2F53D 3PWUA 1YMME 4NOBA 3FQWA 1KJVA 4ZPTA 1QYGL 3VXRE 4CKVX 5F6HI 1NMAL 5K33A 2VB5A 4AT6A 4YH6A 1XCQA 3UTTB 1INEL 3HC4L 3CD4A 4PJXB 2IADA 5L9DL 1JK8A 4LHJB 2I24N 1AKJD 3FT4A 1OTUC 3G6DH 2I26N 1F3JB 3P0GB 5JHDA 5C6TL 1WLHA 1HH9A 3W0WA 1QBMH 5FO9A 5GHWH 2P24B 12E8H 2Y72A 1D6VH 2VERN 1T80A 2FHCA 5DS8B 5C8JA 1EMTL 4OI8A 2DQEL 4Z78A 5DO2D 3C8HA 3QNZB 2VLKA 4YZFF 2CGRH 5JQ6H 1T0NA 1WWCA 4MNQD 4RRPG 2HFGH 2DJ4A 3JWOL 2Q7YB 4CU6A 4PRAA 3RWDB 3QSKB 2DQCL 1IAIH 3QCVL 4LLUB 1JIBA 2P5WA 4LHQB 5E2TH 2VZUA 3N1PC 1CVSC 4MJ5A 4IHOB 1KB9K 1FLTX 3OPZL 1BFOA 1HHIA 3ZLQC 3AS2A 4PJ7F 3QUML 4XVTL 1CQYA 1DVFC 5KSAB 1CCZA 1QD0A 1NSNH 5J11B 4D2NA 3U36A 2WAHA 3W11C 3T09A 3MYZA 2NX5E 1W0WB 2FX9L 1DQJB 3VFPB 2GKIA 2Y25A 3IAQA 3KLAB 4M7ZB 4NKIL 1J0IA 1TZGL 2Y23A 1YJDC 4JQIH 2F8XC 2GQHA 1FVEB 3O4OB 4HUWB 3ILQD 4CW1B 4HLJA 4WCYL 5I1DA 1J0HA 4H0IA 1U41A 1MCPL 5D6DC 4OKVA 3GJFK 5CEYA 2NW3B 2VZVA 3RWJB 1BD2E 4IOIA 5FECA 5JW5A 1DLHB 3HPLA 4E5XA 1T0MB 1OSZB 1T1WB 4OB5L 1CR9L 1NANI 3LEXB 2ID5A 2ZCHH 2GSIA 3QNXB 4F9PC 1X3DA 3VMNA 3X17A 4NO3A 2JIXD 4TUKL 3L5XL 3V4PH 4AQOA 3RL1B 2IWGA 1DBML 1T1YA 2DLHA 1KBGL 1D5XB 2AJYH 3CIQA 2WIIB 4ZUWB 1C8PA 2UWEB 3SE9L 1P4LA 3D39A 1Q72H 4G7YL 1FDLL 4U1IA 2BRQA 3QDGD 2ADFL 2XTLA 3BH9A 3TPKA 3BGMA 2X7LB 5IEKB 1CFNB 2UZIH 3AAZA 4XBGA 4XP5H 3DI2B 4Y4KC 1AFVL 3EHBD 4P46A 5ACZA 1A1NB 3KR3L 5I1HL 1VKXB 2PR4H 4PRHB 2HJLA 1BVLB 4KRPD 4BQBA 4JDTL 3LMJH 1RUKL 1OCWH 2O26U 4JEGB 1NC2A 3DLQR 4UB0H 1UB5B 1K9TA 2LVCA 3SDCD 3KPNB 4ALAH 4JKPL 4ZS6D 1X6NA 3ZDXE 1H0DB 1M7XA 2VZSA 4I2XA 1T5WB 2YD9A 3PWPE 5D1XA 4X5LA 1GGCH 2IBZY 3MRGA 3D48R 2VUOA 2IMNA 4QOKB 4C54A 4EDXB 5C0NC 1AXSA 5I75C 3BN9C 4JFYB 5TE7L 3DOSA 4EI6A 4OUUA 3FL7A 2EDTA 3PV6A 5T1KB 1FGNH 2F5BH 2Y6SD 3TIDB 2D9QB 4XXDA 4NBZB 3ET9F 1BOGB 2ORBL 1GIGL 5F1NA 3IFOA 4Y2DC 1BEYH 2J8UF 5AEAA 2W9DL 4G9FD 4U1LB 3U6RA 4JE4B 4O4YL 2AERT 3QUYC 2NY3D 5HHOB 3X13B 1BVKB 2OL3A 3WNOA 2NXZC 1QLRA 4U6VL 3VXSB 1AIFB 1MCDA 5ESAB 3UBXA 1CD0A 3K8MA 1AP2B 2IBBA 5IVXB 1EEYB 5HI3C 4KVNL 4MB3A 3RWGA 5I8OL 4OM1L 1IGFH 5EZIL 2VQUA 2Y5EA 4OF0A 5GRUL 3KPOB 2GCYB 1R3HB 4LP5A 3BE1L 2JJSA 3ARZA 1EXUB 3VG9C 3ZDXF 1AGEA 2CDFB 2XTJB 3CX2A 4M7KH 4XVUC 4A2LA 4HW6A 1UYWH 1A7PH 1DSFH 2JB6B 2V7HA 1KEML 5ALBL 4PJAE 1EAPB 5FUZH 4LCYA 1FV1B 4JY6A 3F6LA 2FBOJ 3PWUB 2IANE 1VACA 1X5YA 1P1ZA 4ZPTB 5JOEA 5LGHL 4M7JL 3HE6C 3K1KC 5JUEL 2YN5A 5EU6D 3VXNA 1XCQB 1RJLB 3WXWH 1J8KA 2IADB 1GYAA 5HPMB 3FT4B 1CXIA 1ZHNA 3C87A 5GGRB 5IUSA 4LCWD 3MRQA 3HZYA 3ZT7A 4PJGA 1NUNB 1AHWA 4G8IA 3SKOA 2WWMC 5KSUB 1KJ2H 4M6OL 1KB9J 2Q3ZA 2VISA 4UT7H 1MLCB 2VLKB 3O6FC 4FFYL 5DC9B 5HGHB 4HWEH 1EZVY 5DEZA 3OZ9H 2ENSA 4PRAB 3CFKA 3MRDB 2AKRA 2PN5A 1G9NC 4FTVD 4YC2C 1AY1H 5IV2A 1F11A 3M8OH 4DVBA 2F54E 2FWOB 4Q7DA 5D6CA 3GSUB 4NQUA 2I60L 3C09B 3WEXA 1NJ9B 1AGBB 1BFOB 1HHIB 3MRLB 4PJAF 5FK9B 4LPXA 4OI7A 4A6YL 5DWUL 4NQEA 1B0GA 3CFBB 3MGAA 4YEFA 2CXGA 4Y16C 2F53E 3PIQA 1UB6B 1E4XH 3RVVD 1FPTH 4P23A 2DB8A 3QEGL 4K23L 3O9WD 4ZUVA 3LEYH 3L3IA 4NQVA 2XFXB 4YDIH 4UNVA 1HXYA 1I1RA 1A3RL 3LKPA 4G8GB 4YFEA 1QOKA 2XQYG 5DD1H 4XT1C 4LHUB 15C8H 3QZWB 1JYWA 2ATKA 4IRSC 2DM3A 3DX8A 1G7LA 1CF8H 1PQZA 2XZCL 3ELAT 3VCLA 5ICXB 1FZJA 2BMKA 4LPVA 4O2EA 4OKVB 2WIMA 4WV1A 4HS8L 5CGYC 4WEMB 7FABH 1A1MA 1WUNT 2X4PA 3QXDA 3H42H 4ZYKB 5F7FA 3TYFB 3UTQB 1KCUH 5JW5B 5J12C 1IT9L 5IESH 4HGWA 4WWID 4MNQE 1CXLA 2KPNA 1FYTD 4WI3A 5EBLB 1D9KA 4PYGA 4O2FA 3REVA 3HAEA 3KYMA 5KSVB 2GSIB 4FXKB 4LLAA 4P3DA 1J0YA 5I9QC 2HJKB 1CDGA 5DHXB 1VFAA 1I7TB 5F1IA 2OXHA 2A1WH 3T2NH 2YEZA 3GNMH 1UT9A 2HVKA 4KROC 5IMMB 3EYOA 3G9VA 3MGTB 3KNBB 4G6FB 5IBLD 5FIEA 4MA8H 4CDGC 3MFGB 4GS7B 4Q6YA 4Q0XH 1KJ3L 4V2BA 4KMLB 1MIML 2FJGA 3G5YA 2P43B 4OCMC 5A3ID 3BGMB 5IB3B 3VFSA 3QG7H 5IW6A 1DDHA 1PEWA 4K07A 3O6KH 3AAZB 4KRNA 4XBGB 2FX8L 5D2LA 2AEPL 2WLZA 4P46B 2HJFA 1FNGA 4TPRL 4JDZA 2HRPL 4UQ3A 1AQKH 1JNNL 2L0DA 3KPLB 4QO1A 2JB5H 2DM7A 4K2UH 1YEEH 5I8CA 4U6HA 2DL9A 3Q6FA 2DM2A 3ZMRA 3ZYZA 5EULV 5IGXH 3AFLA 4LLVB 2VDML 1K4DA 3H9SA 3A67H 3I75A 1TZIB 2ITDA 3LKQA 4QRSA 2VABA 3QB7C 4FQJL 5JA8B 4LSTH 5JXEC 5BJTB 2Q87A 1W0VB 2Q86A 5D1XB 3QYCA 2R56L 1IC4H 3QHZL 1KLUA 4UNUA 2WM0A 3H2WA 4Y4KA 5GGQL 4EI6B 3T0EC 4DUWA 1N0XL 3GSNL 3HC0A 3OKKB 2QR0A 3PV6B 2FD6H 3RZCC 1CI5A 2NY5C 1QFWH 4DKDC 3PDDA 3QDGE 4NZTL 3LH2H 5F70A 4XPAH 2FIKB 1W0YT 5F1NB 2PTTA 4NWTL 4KJQC 5DJCA 1JGEB 1ETZA 4N8VA 4AM0B 2PF6A 3BZEA 1G1YA 3U6RB 2AGJL 1OF2B 5TFSH 1QLRB 4O02H 3V0WH 1X5GA 3SKNA 2W60A 1L9NA 4AH2B 3QRFM 1F8TH 1INDH 4IJ3B 4K7PL 3MODH 2PXYA 4KTDL 1NL0L 2ESVD 3MXVL 4QF1B 1LQSR 4XCCH 2IFFH 4J3SA 2VIRA 1T03H 4P2RB 4Y1AD 5C0CA 1T1XB 2EXYD 5J8OA 4OIIL 2HP4A 2YA2A 1MFAL 3QBTB 1H5BB 1R5VA 3UDWC 4JFEB 4OD2A 1F6FB 3DBXA 4L3AA 4MLIA 2Y07L 1G9MH 4OCWL 2MHAA 4C83A 4XZUA 4U4BA 5D8JL 5E94B 3NACL 4M8QA 4PJCB 2X9WA 4X4XB 4XNYH 5D7JA 5DZLA 4WUUA 4POZD 1JWMB 1ZA6A 2VJXA 1MNUH 3SE3C 4LCYB 1FZMA 2ZP0T 3BWUC 1MJ7L 1PYWB 3A6OA 4IDJL 4UIMB 1ND0A 1KN2H 3OR7A 3BAEH 2OK0H 1VACB 3C60C 1OD7A 1P1ZB 5KOVC 2OR9L 2HYMA 4B5EA 2F15A 1F4WL 4G43B 2Q8AL 3V4UH 3MYJA 1FC1A 1IJ9A 1ORQA 1JE6A 4G9FE 1DBAL 1KCSL 2ERJC 1JF6A 2EH8H 1I1CA 4ISVB 4NN5B 1J5OL 1J05A 3LQZA 1KELL 1OGAB 3GI8L 3MRQB 5LVEA 3HZYB 2FJHA 4DFIA 3WBDA 1AHWB 4U0RB 5DJYB 3RVWC 3SKOB 1KPUA 1A6PA 4GXVL 5GRZA 1DQMH 3NFPA 1BBJA 3TN0A 2CDGA 4JAMB 1TPXC 4TN9A 3UXFA 3CZFA 5IFHH 3S97C 4HKJA 3MV8A 4CRPA 2QEJA 1I3GL 4HX1B 3V5HB 1AGFA 1VENA 1RZ7L 5DJ8A 5KVFH 2IJ0C 4XHQA 3MLSL 4DVBB 4GRLC 1KPRB 2IPKB 2J8HA 1TQCC 2GFBB 1A7NH 5E2WL 4FFWD 3B6SA 4DGYL 2NQCA 2OTUA 3KYKH 1B0GB 4NP4H 1Z3GH 2AK4D 2XWJB 3MGOB 1S7TB 3RNQA 2V9QA 1EGJH 3PIQB 5FHBL 3JWDC 3AC0A 3U4EB 4JVPA 5EU6E 3WDJA 4NQVB 3SE4A 4U1KB 3LKPB 4OLYL 4F7TB 2B5IC 5CSBA 4LCWE 4ZXBA 1I9RH 3DXAD 2OCFD 2ATKB 5D71L 1G7LB 5IEHB 2X1OA 1K8DB 4XVSH 4LEXL 1FZJB 4ORGB 4LKCA 4Y5YC 5ITBH 1IFHH 4XAWH 1A1MB 2X4PB 1BFVH 1DVFB 4XTRD 2E7HA 1BWMA 2ZNXA 3FB8B 3T4AA 3L5WA 5DQJB 1JF1B 1UQSA 2QADD 4DN3L 5DMYA 1I8IA 5CKAA 4EQ2A 4FTVE 1UCBH 2R2EB 5C3LD 1BFTA 1MEXL 3OKEA 8FABA 1J1XH 1F2QA 5TH2B 5C07B 1LP9F 2CKBL 4IRSA 2FGWH 4OZGA 3I3BA 4NDMA 4PGEA 3EYOB 1OM3L 5IIEA 3EOAA 1NMAH 2EDYA 1CLZL 1IGTA 3ZKQD 1UKSA 3HC4H 4RIRA 1H3VA 1KLGA 2Z31C 5L9DH 4M1CD 4OKDA 5EO9B 3DX6A 1P7QA 3SKUD 1E6OL 1A7QH 1FRGL 3CUPA 3RQ3A 4D3CL 1OTSD 4JDZB 1CLYL 3U7WL 5AZ2H 2WINB 3VU2A 5FF6B 4PRPD 1NDGA 1EMTH 3FAXA 1VFBA 2DQEH 4X5XB 1IAMA 1NAKL 3R0NA 3Q6FB 4X6BA 1RJZA 1T89C 4PP1C 4NHUA 3BP4B 2YD4A 1TETL 5I2IB 2ZNWA 1FYTE 3I75B 3LKQB 3N9GL 4QRSB 2VABB 5EC2B 1UH3A 3QCVH 2R15A 2XWBB 3ZKXC 5KANG 4OFYD 4YHPA 4UU9B 3VE0B 3S4SB 4Y4KB 3QUMH 4XVTH 3KYNA 3QWOA 4LLDA 1N0LA 1U36A 3HC0B 4JKLA 4WFHD 3T0DA 1M6OA 4ZSOA 5GGTA 1BHGA 4BUHA 2ZUTA 2DQGH 2PTTB 3FCTB 3UTZB 1ETZB 4NKIH 4MXQD 4KDTA 4KI1A 3TO4A 1TZGH 4U2YA 3BZEB 3VGAC 3VWJD 1MF2L 3Q1SL 1JWSA 3SKNB 4BQ9A 1N7ML 3BP6B 3SHSA 4HWBL 5I75B 1C5DB 4OCLC 2BJML 5F71A 4KK9D 3CFIC 1IZJA 1NC4B 1JWUA 3RZCA 4ZFGL 2YPKB 4KKCD 4OB5H 1CR9H 4KFZC 1YDPA 1CE1H 2BVPB 2GAZA 1BBDL 3FFDB 4HJJL 3HTLX 4OD2B 3OKLB 3DBXB 4Y2DB 3L5XH 3VRLE 1EBPA 2H26A 2O61A 3VDAA 1DBMH 2JK5B 4U1NA 1KBGH 3QUYB 2JLLA 3S98A 1YECL 4MA3B 2NXZB 1Z0MA 3VRJB 1KIRB 5ETUA 2I9TA 4G7YH 2ZUQC 1FDLH 3D2UD 3OR7B 3PHOA 2ADFH 4NM4H 3LS5L 3QXVA 5FO7A 1O5DT 1TJHL 1ORQB 1JYNA 4IS6B 4CL7A 3B2VL 4JPKL 3F7VA 4Y4FC 2DQDL 3RPKA 1FBIL 5E1HB 3UDWA 3VG9B 5F8QC 4QNPF 2ZJSL 1LO3L 2BNRB 1J05B 2PYEB 5SWZD 1O7SA 2HTLC 35C8L 2FJHB 4JDTH 5ICZB 1QLEL 3UBXI 3E2HC 1KPUB 25C8L 2ESVE 3KJ4C 3RZWA 2R69L 3OF6A 2PO6C 3SE3A 1BBJB 2UY7A 3LPWA 5HVGB 1TFHA 4Z8FH 4Y1AE 4HKJB 2DI8A 1VERA 3MRBA 3J8F7 3C60A 4GKZA 2A2QT 3MUZ1 3MJ9A 1MLBB 4XGZA 3HE6B 4O5LL 2KQNA 4JKWA 3CVIL 1UENA 3VRLF 5ADOL 1JZ7A 3V5KA 5TE7H 1T66D 4ODSH 2K7PA 3BOVA 1DN2A 1GOHA 4GUPA 5E00B 3ZTJG 3TBTA 1FL5B 1QHPA 1CU4L 3IETA 4JJHA 3STZA 4FFVC 3KPSD 3LV3A 5E5RB 5C6WH 1X5AA 3E3QC 3RNQB 1RZIA 1Q0YL 1UM6L 3ARDC 1TITA 3WS3B 3O6FB 4MNGA 4GAGL 5SWQB 3BEWB 4O4YH 1WWAX 4KZDL 4NNXB 4QCIA 3MCKB 1CGWA 4Q9RL 2QLVB 4YC2B 2EDRA 1FIGL 4ZXBB 1IAOB 3ARSA 1KYOJ 4PLKC 2XNAA 2HLAA 5DYOA 4KVNH 4RZCB 5I8OH 4OM1H 1BAFL 4QRPD 1T7YA 3OKNA 1T2JA 3T65A 5GRUH 4MVBC 3ZTJH 4Y16B 3GJFA 1BQSA 3T4AB 3BE1H 3L5WB 2NZ9D 1UQSB 4PJIF 3NIFE 4Z7VE 2GJ6D 3IB4A 4I3RL 1WFUA 2B7DT 1KB5B 2GSGA 3T2OA 1OTTC 1FQ9C 4OGAC 1NUGA 3TNNA 1IE5A 4QRUB 4WJ5B 4XNZC 3IU3A 1KEMH 3OKEB 5ALBH 1NFDE 2VLLA 4PGBA 2OP4L 2HT2D 3EJZD 2H3NA 1HIML 4IRSB 1WFNA 1MIEH 5E8PA 4OZGB 2AK4E 4HKZA 5IB4A 1M05A 5GISH 3VD5A 5IIEB 5LGHH 3ABZA 5JUEH 5KJRL 4O2CA 3S7GA 5J12B 1IGTB 5BMFH 1LE5A 4XP4L 4WTXA 4APQA 4UAOC 2BY3A 1Q9OB 5T1LB 5GZOC 4K9EC 1WV7T 3MRNA 3SN6N 3GBML 1CGSL 5CBAB 2O5XL 1MCJA 3DXAE 3FKUS 2FJFB 4ZAKC 1ACZA 5C1MB 5KS9E 5I9QB 2A6DB 3QDAA 4Z76A 4M6OH 2E7CA 5BV7C 3CH1A 4FFYH 4KROB 4Y5XC 5IFAL 2DI9A 3PV7A 1XF4A 2YA0A 4MJ6A 3NIFF 4Z7VF 1OAYL 2Z31A 8CGTA 5DTFA 1MH5A 1L7TL 2I60H 5HI4D 3RY6A 1A7BA 5D70L 1NCCL 1NFDF 1KULA 4A6YH 3WV0A 3S6CA 3KYNB 2UYLA 5EN2A 4KK5C 2H32H 3FTGA 3MOBL 4N68A 4LSVL 4POUB 3X3FL 1RSFA 5ERWA 3LPGA 4ERSL 1V7NL 1T89A 5KSBB 4ELMA 3U9UA 5HD8C 3P3YA 1L0YA 1ZK9A 4N0FB 1QRND 2EIZA 2SEBA 4NQDA 2YWYA 1YY8B 5FYJD 5DHVH 5EPMB 4ZTPH 4QHNA 2WBJA 3RGVC 3WNMA 4GMTH 1JWSB 2XZCH 2GIYA 5KS9F 2B1AL 4HS8H 3BRGC 3H3KA 3MLYH 5FYJU 1DE4B 1QFOA 2X41A 3FQXB 3T0EB 3QIBA 5AG9A 5I1IH 3UPRA 1IT9H 2VDKH 1VEOA 3MRRA 1IGML 3L5IA 1JWUB 1ZVHA 3RZCB 1U91A 1QSFD 1XIWD 3FO1A 4WFFD 1PZ5B 1EFQA 5IQ7L 1I8LC 4NZDA 5FDYA 1SBBA 1RZ8B 2BOCB 3EYVA 2H26B 3LN5A 4JG0L 2O61B 1KXQE 1I1YA 5TDOB 5SWSA 5CZVL 4HDIA 4PJ5D 5EOCL 5K59F 2HKFL 3SDDD 1SJHA 4WFHE 4K7FB 3CFDB 4JVUA 2I9TB 3IU4L 3GIVB 3PHOB 4H1LA 1Z9OA 1MIMH 2EDQA 3MRKA 4LNRB 4CVZB 5DJXA 2NNAA 5LAXA 4OFIA 4FQQA 5CSGA 3D9AH 3GIZL 3RHWF 4QHUB 5KVMC 2FX8H 3QEQA 2AEPH 5T3ZL 1CBVL 1BX2A 4F58L 4ENED 5HXMA 4TPRH 2HRPH 3Q6GL 3I3DA 1S8DA 1JNNH 2ADIA 1T7WA 2OQJA 2X4TA 2BVTA 2JJTA 3WDIA 4LMQI 5F7DA 1EFXA 2XN9A 3BQUA 4HKBA 2VDMH 5A2JH 1DQDL 1ZHLB 4JFDD 5EG6C 3TH2T 3C60B 4GKZB 1F00I 4XGZB 1CD1B 4G9DB 4IOFC 2R56H 4WDIB 3FOLA 3MMEA 2ERJB 1WZKA 3MNVA 2B4CC 1ZLVH 1WISA 3TF7C 5GXBB 3GSNH 2BC4B 5D4QA 3HZKA 3LV3B 1CK0L 2HT3C 4Z7NE 1H8OA 1RZIB 4WGVB 4NWTH 4U2ZA 5DHYA 1TPXB 4HUXA 4MNGB 1IEHA 1LK3L 3UMTA 2AGJH 5FKAA 2G60L 1UVQB 1YQ2A 2IPUG 3L95A 1UEMA 5SWZE 1XGQB 4R8WL 3QXUA 1OAZL 4K7PH 4GRLB 4ODXB 5D2NE 2DLTA 1NL0H 1TQCB 3MXVH 4E42A 2XNAB 3IAGC 2HLAB 5DYOB 4AMKL 1R5IB 5A2LH 5E9DD 3T65B 3VFTA 2Z92A 43C9A 1WCBB 3V0VB 3WLWC 4OIIH 1MFAH 4CMHC 1K6QL 3ARBD 4KGLA 3S9DB 1NGYA 3KAAA 4YQXL 2Y07H 3DO7B 3P9MA 1HKFA 3F6IA 3T2PA 4X7SL 3DX7A 3IU3B 5IVZA 3WE6A 2B5IB 3W2DH 5DLML 5E6ZA 3VWKD 4MNHA 4QRQB 1NEZG 1MJ7H 2VE6B 4IDJH 3TNMB 3KPSE 2HRLA 3CPLA 5FYLH 1FNEA 4Y5YB 1MRFL 1M05B 2XG5A 3EBAA 1JP5A 4Z7NF 1C7TA 1F4WH 2BK8A 2Q8AH 3IXAA 2ILLA 5T33H 3S3SA 3GK8L 1KCSH 2X4NB 5TDPA 1IM9B 3TA3D 1PG7L 4I0CC 4KKBC 1AGCA 1XGTB 1J5OH 1KELH 5BQ7A 1LEGB 5MEQB 1T5XA 4EUPB 4PJFA 2YSSA 3VA2C 4NJ9L 1A2YA 3P4NB 3G04B 4IRJC 3S5LG 5E6IC 2AABL 2FGZA 2CPCA 4GXVH 1LO2L 4L8CB 1A02N 4MJIA 2HA1A 4QRPE 4ZOCA 4XP6L 2B39A 2VN4A 3KPQB 4NC1E 3RU8L 1I3GH 3ZE1E 3QWRA 1RZ7H 4LSUL 3T4YB 5IB1B 4JRYB 2GJ6E 1NANH 5JLZB 2XA3A 3MLSH 2ARWA 2Z31B 2AJVL 4KHTL 5EFIB 1QSEA 4IRZH 1LGVA 2E9WA 3GRWA 3IDYC 2VLJA 5E2WH 3D5OF 4MZ2A 1KEGL 5C0DA 1GRWA 4X4ME 4DGYH 5EN2B 3V79C 5EIIB 4U6TA 1T2XA 3B5TA 3I02B 3D85D 1U8NA 4PJEB 5FV2A 4X80L 3W9DB 1IGIH 4PRDA 5F1KC 4XPBH 4GW4B 3ETBF 3MV9A 4L9LC 2SEBB 5F7EL 1CZ8L 4NHCL 1CG9B 3HUJB 3QIUD 3ARGD 1A6VL 1FO0A 4J6RL 3ZKXB 5BW7A 1EEZA 1WGOA 5ISZA 5FYLD 5JHLL 3VFNA 1OAXH 3IDXH 3TVMC 1OAKL 1U3HD 3Q5TA 2IPTL 2AS5M 4NC0B 4OZHB 1T83C 3QDMA 2D3VA 1IILE 5E5MA 4L8SC 1UC6A 3ZE1F 2B0SH 2BX5A 5TF1L 5E8OA 1MEXH 3EYVB 3LN5B 3CLEL 5DR5L 3VGAB 3L9RB 4X6CA 2CKBH 3FB7A 4HK0A 3CMGA 2D03L 1MCBA 1NGQL 1SJHB 1OM3H 3TO2A 3GUTA 4UDUB 1SY6A 1NAMA 3DYOA 4ODHL 5KG9B 3B4NA 1TXKA 1PD6A 3IGAB 1CLZH 4KDVA 1IEBA 4Y19B 1JZ4A 1QRNE 5GS0L 1KUMA 4FQQB 1ZOXA 3QFDA 2EYRA 3NCJL 5CP3A 1E6OH 5FYJE 1FRGH 4OBRA 3PGCB 2BNUA 5J56B 5DQ9B 1CLYH 2D0FA 1JHTA 2A0LC 2ADIB 3KLSA 1A21A 1MHEB 4Q74A 4YHOH 5EOQH 3RDTD 2VXSH 4YX2L 4QXGL 3MRPA 3V7MA 1EFXB 3M17B 1MPAL 4KMQA 3HI6L 4OV5B 3EJYC 5IG7A 3MRMA 1XGYL 5H37G 1TETH 3EO0A 5E24E 2ZUQB 1CIUA 1QSFE 4JKKA 4WFFE 2CO7B 2WANA 5C0AD 2UUDK 3UTSD 2ZUSA 2CMRH 3QEUB 4WUKL 1VGKB 5DDHA 4Y4FB 4U6XA 3NMEA 1J8HB 3MMEB 4PJ5E 5ILTL 4Z7WA 4OI9A 4TYUA 1MI5D 2WWKO 4WI8A 5H35B 1MWAA 3RGHA 4LFHD 3E2HB 3VXMA 3KJ4B 1AD9A 4LKXB 2PO6B 3EGSA 3E1F1 2FZ3A 5E70A 4OCNC 4HJGA 5I18L 3QI9D 5DHYB 4YDKL 3BP5B 5DJDA 3CSBA 2PYFA 5JZ7D 4I0PD 4TNWK 3TV3L 5H37H 2QQLH 1MF2H 1SYSA 3Q1SH 4YBQD 2AW2A 3L95B 4JANA 2CRZA 3P2TA 4EI5A 2AJUL 2LAAA 4XHJC 3N1QC 5CP7B 2F19L 1R3IL 3GDBA 3OKOA 4E41A 2YD7A 4UTAL 3ZDYE 4K3EL 4KRLB 2R1WA 2YD5A 3OGOE 4ZFGH 3AREC 3VGGA 5E2VL 4RMWA 3I6LD 1YPZA 4JFDE 4YXKH 3QCTH 3PL6D 1BBDH 4HJJH 3MRFB 3ARDB 3ZHKA 5MENA 1YYLH 2QTEA 3QRGL 5K9JH 3NPSC 2X1XR 3DROB 3DX7B 1YECH 2KKQA 2DWDB 3WE6B 5I76B 2OXGA 3EOBB 4KY1H 4JGMA 4D0BA 4YJZL 4O9HL 5C0RL 1YJDL 1U8IA 3LS5H 5DRWB 5EU5A 5GS1C 4PJ9A 3A0OA 3IJHA 5SX5H 1FLRL 3B2VH 1JF5A 2DQDH 4BKLA 1FBIH 4NGHL 3HZVB 4I0KA 4NIKB 1JPTL 3GHBH 1LO3H 1AGCB 4U1MB 2P48B 3FOMA 4WHYG 35C8H 1T5XB 1S7QB 4WENB 4PJFB 1QLEH 1DQLH 2YSSB 4XNZB 1HXMB 4PREB 3HHRB 1ITBB 1IBGL 3SCMC 25C8H 3GMOA 4HIHB 5DA0B 2KQMA 1UADC 2R69H 1E6JL 5E9DE 5CLTA 3LKOB 3TBWA 5E8EA 3GMNA 3P0YH 5F7UA 5L6YL 2XIDA 2NY7L 2I5YL 1YN7B 4PGCA 4YAQA 3LQMA 4MDJA 5FFLA 4BK4A 4S1DC 4O5LH 5K9KA 5KZCB 3EUUA 2R2CA 5TQ0L 4NYLA 5ADOH 2BRRL 5E03A 3QG6B 4UAOB 2J88H 2P47B 3MREB 3CXDL 3I85A 1KCVH 1S9KC 2NY2C 4WWKA 3VA6A 4NO2B 3UPAA 5CGMA 4C56B 5C0DB 1XEDA 4ZAKB 1CU4H 5CWSB 3ARFC 4N0CC 4Z77A 4IRJA 4QHKJ 1E4KC 4WHYH 1FL6A 1SYVB 1I7UB 2R2HA 5BV7B 3O41B 1MCIA 4GAGH 1KGCD 4Y5XB 5BVPL 3H9YA 5HPOA 4KZDH 5JIHA 4KKAC 3MV9B 2EDKA 2P7TA 4Q9RH 2WP3O 1FIGH 3DIFA 5BZDA 3EO1A 1FG2B 4OLWL 2R0WL 5HDOA 1IM3A 1EEZB 4M6ML 3OJDB 2ZPKL 4DGVL 2NXYD 4LPTA 3QUXA 3QDMB 1UA6L 1QKZL 2L7UA 1G6RA 1A4KB 3OB8A 5E5MB 1G0YR 1ZV5A 4ZUTA 5BS0A 5FO8A 5JIIA 4LP4A 4LEOA 5FM8A 5GS3A 3D25B 3IJYA 4HZLB 5IT2L 2PKDA 3GSOB 4OCSH 3PP4L 2BERA 3L3DB 2IALB 4O51A 4HUMB 2OP4H 4U0QB 4UT9L 2GTZB 1ZLVK 3UCRA 1HIMH 1HINL 1I7RB 5DJ6B 4R96A 3RGVB 1A5FL 5T5FH 5KN5B 4EZMA 1LWRA 3L3GA 1E0OB 5KJRH 3PWNB 4LPUA 3W9EA 3MRHA 4LLYB 5ACLA 1T83A 1IARB 4X6DE 4XP4H 3UZQA 1I9IL 4CMMA 3SO3C 3SQOL 5I8KL 2AXFB 3GBMH 2O5XH 3VD9A 4R4BA 4B7LA 3T0XA 2BNUB 5EBGA 1JHTB 2AJZA 2KUTA 5FYLE 1Q9LA 3JUZA 4QTIL 1JV5A 3P77B 1U8HA 4JM2D 2R4SL 3OJVC 4KUZL 4QHLA 1GGIH 4CU8A 5IFAH 3ARYA 3MRMB 3MC0A 4V2CB 4FQXC 4MS8C 1JPGA 1GH7A 5ENWA 5B4MC 5J06A 2E3VA 1OAYH 4ZOBA 3KPRA 4EDWL 1L7TH 1FFOA 1KG0A 4U6XB 1NCCH 4GJTB 4OZFG 4UV7L 3VXTA 3Q0HA 4Z7WB 4FA8A 5BRZD 1RZKC 4LSVH 4JGUA 2HKHL 2Q20A 1MWAB 3X3FH 3P11L 4LOUC 2IPUK 5ESVB 5HDQL 4ERSH 1AD9B 4OLXL 1BFSA 3SDAD 2FZ3B 4X6DF 4AENA 3L5HA 2FR4B 3HNTL 4ZS7H 3IDMA 1P9MA 3QXAA 1SYSB 4JFZH 3O6LH 4M61A 3WHE0 5F93C 2D7QA 2B1AH 4MGXA 1G9NL 4W6WB 6CGTA 1UKQA 1MCKA 2CR3A 4E41B 4J4PA 1IGMH 4HUKB 4MA7L 5JORB 3KLDA 4OZFH 4ONHA 3REWB 4U1SB 3RWIA 5IQ7H 1DJSA 3FB5B 1EVTC 2AAVA 5JR1L 3RVUC 5C0AE 3UTSE 1JYVA 4JG0H 4HF5H 3IFLH 2ZCLL 1DBKL 2HN7B 4PRHD 1KB5L 3MTRA 4PPTA 5EOCH 4S1SH 3R06B 4JPWL 1JTTA 4JFFA 1MI5E 4GG8A 4D0BB 4HCRA 3I6GA 1U8IB 3HE7A 3IU4H 4PR5A 4FQCL 2DQJH 3TZVD 4R26L 3MBEC 3U7AA 4KHXL 1QUNA 3AREA 2XACC 1YEIL 5J57B 2MNUA 4V1DD 4KJWD 5T3ZH 4QOKD 5IFJA 1CBVH 4F58H 1MCHA 3EYQC 2YPLB 3FOMB 3Q6GH 3K2MC 3T1FA 3KLHD 5L0QC 1X7QB 5T1KD 4PV9A 2C26A 2X4OB 1PKOA 5DUPL 3SE8H 2G5BB 1FL3B 4NO0D 3MA7A 3I6LE 5EZJA 4YNYB 4YAQB 2ATPA 2EDXA 4N5UA 5K9KB 1DQTA 5CEXB 2W65A 1F6AA 2DMCA 1P2CB 2C4FU 3IKKA 3BZFA 1F90L 3CLFL 4YUEL 1FGVL 2BNQA 2ICWI 1V3JA 5SX4I 5EO1A 4P4KC 4Z77B 1CK0H 3CDYA 4IRJB 4EIGB 5E6IB 3LPFA 2P5EA 2R4RL 3KXFB 2NW2A 4L1HA 4U6YB 4PG9A 5ANMA 2R2HB 4WO4A 3IDUA 1GC1C 4GQPH 2AJXL 2UV3A 1FFPA 4JG1L 3WHE1 2G60H 1KCKA 3LRGA 5EU3A 3BH8B 3DIFB 4R8WH 1HHGA 1OAZH 4DWHA 3D3VA 1A8JH 3I84A 3IDYB 2F8VA 3WSQH 4AMKH 2EDHA 1U92A 3S34L 5D9SA 1PKQB 2OBGA 4NWUH 4AEHL 1EEQA 4DVRL 2AEIT 5CEZL 2DWEA 1U8PB 4YFLF 3V2AR 4OF7A 2G5RA 1G6RB 4YQXH 3VFRA 4RX4A 3WFCL 3C5ZD 4YHLH 2NY5L 5FO8B 2PW2B 4LEOB 1PY9A 4X7SH 5GGUB 3HI5L 4EIZC 4L9LB 5AD0B 3RI5F 5JHDD 4I77L 5I30H 3W0WD 5DLMH 2XG4A 4N0YL 4L3CA 4XP1L 3DECA 5HTSA 4TRPL 4F37F 2DJSA 3TVMB 3GHEL 3GMRB 1OLZA 2CH8A 5D7IA 4JREC 3K7UA 3GK8H 4NCC1 4NNYA 1KGCE 3K80A 3QDJA 4CMMB 4F80A 2P5WD 4X99A 4L8SB 2W91A 3T04D 1ZGLP 4BH7A 2FL5B 5FB8B 1QACA 1RUPL 3INUL 1WT5A 4NJ9H 4RQQA 4OTXL 3RWFB 3SPVA 2V5TA 2AABH 1NFIB 2QJDA 2BSTA 1Q9LB 1VFMA 3X12A 5SV4A 1GGBL 1JV5B 3RU8H 4QHLB 3QUKA 1DLFH 4QWWC 1CVRA 1ED3A 2V5RA 3V7AG 1DL7H 3MLTA 3ZKMC 4BUGA 3O3EA 5E99L 4U7SA 4KHTH 2AJVH 3KPRB 3UBXG 2IC2A 5JO5B 3TYGH 3FQTA 3MJ9L 1OPGL 1M7IA 1UZ8B 1KTLA 3SBWC 2EKSA 1V5JA 4HIJB 2QKIB 1IAII 4P59L 4I18A 2AJ3A 5JDSA 4Q9BA 3OWEA 1QFHA 3EDFA 1QFUL 2X4QB 2ZUWA 3MBXL 3V6ZB 4FZEH 2IBZX 4B53A 1TVBA 3OV6A 4HS3A 1RI8A 3BKJL 4X4YB 5DJAB 3HR5A 2W9EL 4XMPH 4N5EC 4OGXL 4YFDB 5FA3B 3VFGL 1CZ8H 1RMFH 3ROOA 3IDMB 1Y0LB 3QXAB 5HGAA 4J6RH 2YD2A 4NT6A 2ADJB 4R2GD 3U1SL 3OKMA 2OL3H 2AV1B 4EEEA 1OAKH 4ODTL 2IPTH 4HIEB 4CVUA 3U0WL 4LCUA 3CJJA 4N0UE 3D39D 3B9EA 3EYFA 5MEOB 5IBUB 4XX1G 2IAMC 1I3VA 4OLVL 4P2QB 2Y36H 4MXWH 3RWIB 2DQFB 4KRMB 3MO1B 1GHFL 5CMAA 3KHOA 4YDLC 5IMKB 3NH7L 4CVWA 5TF1H 2C3VA 3JWDL 3CLEH 1UWGL 5DR5H 2C3XA 2X1QA 1I4FA 5C0IA 2D03H 2XPGB 5BRZE 1NGZB 3ROLA 1RHHA 1IGCH 1NC2D 2MSPA 3FQUA 4TUOB 3I6GB 4PR5B 3HE7B 2NTFB 5J1AA 3GBNL 5CS7A 3RVXD 5L2KA 1OOAA 5FGCE 3WHXB 3CX5K 1ZHBA 4JZJA 3AREB 3QFJA 5GS0H 2Y1VA 4Y4HC 4KV5E 1WIPA 4OSUL 3NCJH 4CVXB 3DHJA 3BYTA 3AY4A 4L4VB 2ZOLB 1HYSD 4K55A 3NPSB 3T1FB 3VW3L 1BZ7A 1JPSL 3VFVA 2W0LA 2HTKC 3BZ4A 4YX2H 4O58L 4QXGH 4PV9B 1MPAH 4NKMA 3VH8A 4RMRA 4HPOL 1XGYH 1H15B 1U93B 3QQ9D 4JM2F 4P5TC 3MA7B 3F7YA 5GS1B 3AU1B 5GSVB 4L8DB 3PP3H 4R9HA 1S9VB 2W65B 3TC9A 1F6AB 1MHHB 4XPFL 2P49B 4PRHE 5ILTH 2Z4QA 3BZFB 3MRJB 4M5YH 2A74B 5D7LA 3UZVB 4HH9B 3O2DL 4LU5L 3SJVA 1T0PB 1C12B 4HUUB 2A9NH 3MZGB 3DGGA 1EZVX 4XNMA 1HHHA 3SCMB 1ZA3A 3HLAB 4F8QA 3D0LA 2MWCA 3HAEG 5BZWA 5ANMB 5LBSH 3V6OE 4UMGA 2IMMA 4YDKH 2I25N 2EIEA 4JQXA 4V1DE 2Z9TA 2VLRB 3TV3H 4KV5F 3W39B 4ODUB 4QOKE 4JY4B 1MSPA 4E0RB 2CQVA 2AJUH 4ODWB 5AWNL 3D3VB 1D7FA 3U48A 1ES0A 2NY2B 2FECI 1ZHKA 4UUJB 4K3EH 2UWEF 3TT3H 1WEJL 1ZTXH 4S1QL 5KW9L 3ARFB 3K4AA 3KYOA 2W0FB 1Y6KR 5EOTA 3VRIA 1GXEA 5DO2C 4LGSB 5I1JL 3DX9B 3STLB 5B38B 3TM6A 2XT1B 4OF5A 3THML 2JTDA 1JZ5A 2R9HD 3VFRB 3QRGH 2EYSB 4G8FB 2NLJA 1MRCL 5EBMA 1EJ6A 1XH3B 6FABH 3HAEH 3L7EA 1VDGA 1AQDA 3CFJA 5C70A 4AIZA 2OMNA 5CAYB 1CDBA 2IQAA 2GJZA 1AR2A 2EDEA 5C0RH 3VJ6A 3ECBA 4OFPA 2NMSA 5IWLC 1EDQA 1BQHB 5D7IB 1FLRH 3V9FA 4NGHH 5I16A 3QDJB 1KC5L 3UYRL 1I7ZB 4S0SD 3F5WA 4UINL 3OSKA 3L6FA 3OQ3B 1HZHL 3ILQC 4X7TB 4QGYA 1BP3B 5C2BL 1IBGH 4K7PX 4RQQB 4NQED 1D6EA 4R7NB 2BSTB 5FEBA 3SDYL 1YY9D 1E6JH 4ONFL 3FO2A 1J10A 5CBEB 4P23D 5TDNB 4WY7H 3QUKB 4N8VG 5EUKA 3NN8A 4ZUSA 3H9ZA 2V7NB 1ED3B 3MLTB 3IT8D 4YDVB 1CDYA 1QBLL 3HMWL 3ARVA 3CXDH 4NPYB 4RAUA 3SO3B 5EWIH 1M71B 3DMMA 5JHDE 3HR6A 2R2BA 3W0WE 2P8MA 5LGJB 5KVDL 2CLZA 4MQTB 1G7IB 5L2JB 5IOPA 1ADQL 4UIKL 4HZAA 5E2UL 2KDGA 4R97B 5A16A 3D1MC 5JDSB 3P40A 4TOYL 4ACPA 1T7XA 5IROA 1D9KD 1RU9L 5BVPH 3HR5B 4FQXB 2P5WE 1FP5A 5FYKH 2FYYA 3Q48A 1E4XI 1X5LA 2Z35A 4OQ1A 4OLWH 3PWPA 2R0WH 3EHBC 3MFFA 4LIQL 1W72A 4NT6B 1KNOA 4X8JB 3OKMB 4M6MH 1HKLL 4KRPC 4MD0B 1WBXA 2V5MA 4LCUB 1ZLUH 1VEMA 4X5WB 1CDJA 4R3SB 1UA6H 3SDCC 3VD4A 3OB0H 3KS0H 2VXVH 3KHQA 4ZS6C 4HS6A 4XCNB 3ULUD 3C2SA 2LFGA 3U0PA 1HOCA 2XRAL 5IT2H 2C3VB 3PP4H 3ARQA 3TWCL 5FKPA 1ERNA 1HINH 2HFEA 2J2ZA 1A5FH 3QUZD 3FO0L 2WBKA 3MACL 2GK0A 3ROLB 1C1EL 4F7MA 4K71C 3I50L 3I6KA 2Y6SC 3FQUB 3L3OA 3U0TB 5FDWA 5L2KB 3H9SD 3CXHK 1R24A 2YUWA 5K93A 3A6CL 1I9IH 3GJEB 3QFJB 1A6AA 3SQOH 4F3FA 3B9AA 2ZSWA 3FN3A 5C08B 2R29L 2NY3C 4Z18A 4Z6AT 4HUVB 4RWYL 1OW0C 4JO3L 4NZRL 3VFVB 1QVOB 3B3IB 1R3KA 2YMXL 3CC5A 4PJ7B 1N6VA 3MA9H 3JVGC 4KUZH 3D39E 5E1AB 2R1XA 4LCCC 5FYKD 3BFOA 1YMMB 1REIA 3MBEB 1N59A 3VXRB 4EXPX 2E7LC 4EDWH 4M1DH 3WFHB 4PJDA 3GM0A 4KI5D 2VH5L 4RAVA 1JNHB 2Z4QB 3BPCA 1WFOA 1HEZA 3TFKD 1R6VA 2PXYD 2VITA 3GRWL 2IGFL 5L0QB 3P11H 4GRMA 4IIQA 3DGGB 4XNMB 1HHHB 4MAUL 5HDQH 2X05A 5GGVY 4TVPH 4OLXH 5C0CD 3GSRB 1U8LA 1A9BB 3JTTB 4XBPA 4I2XE 4JKMA 1JCKA 3HNTH 4P9ML 5BV7L 4M93C 4S2SB 1ZS8A 4PTUA 4WUUD 5D7JD 4PRBA 3VXQA 3QA3A 2ZOKB 2YXMA 4P2CG 1QBBA 3NFNA 1A7OL 1FE8L 1VGEH 3KYOB 1NGXA 3LDBC 3VRIB 4P4KB 3IAPA 5FGBC 4DW2L 3C6SA 5JR1H 4BSVB 4H0GA 4MWFA 1KIPB 2ZCLH 1DBKH 2NX5B 2VAAA 1KT2A 3V7AE 1T2QH 4AIOA 2MMXA 3L7EB 4LBEA 3MOAL 4F15C 1AQDB 4M48L 1CFBA 4JPWH 2GJZB 3EDJA 5C71A 3V5DA 2VQ1B 1IQWH 4AEIL 3O2VL 4R90L 1JN6B 1QZ1A 3ECBB 5ECJE 1KF9B 3TN0D 3IF1B 3RVVC 1RIVL 1S78D 3GSNA 3MV8D 4KHXH 4XI5D 4PJHA 1BD2B 1X5KA 1YEIH 3O9WC 1CDCA 4BFGA 1SY6L 4X9HA 5F21B 3W5NA 3F5WB 3MLRH 4LLWB 4IBLT 1NGWB 4CN6A 4WW1A 3ALWA 1PGRB 4U49A 1A1OA 2EYTB 5D1ZA 1U8QA 3WJJA 1E28A 4Z7QE 2IH3B 2XKNB 3Q3GA 1D6EB 3D87B 4TVPD 5GGVL 1JTOA 2WQ8A 1FFRA 3WD5L 5DUPH 1IL1B 2P42B 3OR6A 4XX1E 3LEVL 2DJUA 4JREB 2DMKA 3MV7A 2IQ9L 5DRXA 3RNKA 3GMQA 3HNVL 4ZXBD 1F90H 4PJGE 3CLFH 3DYPA 3DURA 4RCAA 1FGVH 1Q1JL 2P8MB 5B8CC 5E8NB 3EOTL 4YPGA 5IOPB 4UDTB 2R23B 1L6ZA 1MAJA 5IBLC 3B9KA 4FRWA 5L88L 1HH6A 1MWAL 4URTB 1GZPA 1NLBL 4HJ0D 2AJXH 4QRTA 1RZJC 4JG1H 5A3IC 2ICEA 3Q5YA 5TE6L 3D18A 3D6GA 1IZKA 3IVKA 2HWZL 3H8NA 3PWPB 1SHMA 1W72B 2BSSA 5DZNA 5FOBB 4NQEE 1C16A 1G0XA 4TSBL 4LGPB 3S34H 1JUFA 1SQ2N 3UYOD 1X5FA 2EO9A 4HG4K 1RJCA 1ZE3C 4DVRH 1N5AA 3SKJL 5CEZH 2FB4L 1X6LA 2B4CL 3BKCH 2XXCB 5FHAH 3WFCH 3U0PB 2QV2A 2UY6A 1P7QD 4PP2B 1OLLA 1YC7A 3HMXA 2QQKL 3CXHJ 3P4MB 5FKPB 5DMGD 4I77H 1BQLH 5DI8B 2H8PA 4YXLL 4PJGF 4N0YH 5FA4A 2HFEB 4K3JL 1K5NA 3VXPA 4U1HA 3AM8C 3GHEH 3NFSH 5T5NG 1DUYA 3G6JE 3I6KB 3GB7A 3CFCL 4I48A 1PZUB 2IAMB 4RGOL 1Q9WA 2CIKA 3P4OB 3CDGA 1S9XA 1A6AB 1CE6B 3FRUB 2ZSWB 4YDLB 4HKXA 5HHNA 2PTUA 1RUPH 3VMOA 3INUH 1Q94B 3V52H 5F7KC 1XF3B 1CL7L 4N1CA 1KV3A 2OTPA 1GGBH 2GUOA 1MFDL 5ESQB 1RVFH 4PJAB 2DQIH 2FECL 2Q8BL 3RWEB 3GMPB 3RTQA 1FVCB 1OQOA 2R1XB 4FNLL 4H26B 1MREL 3RY5A 4EN3A 4MDIA 4DOHE 2CLRA 3ULUE 3LAFA 2IANB 2Z93B 2EXYC 2W38A 1R3JA 1JBJA 3TO4D 2W1NA 1LD9A 2P46B 5D2LE 3BYYA 4Y4HB 3MJ9H 1TVHA 5IBTL 3L1OH 5BVJB 2BXYA 3CNKA 2A6JB 2FHFA 3BPCB 3QPXH 4ZQKA 4POZC 3NIGE 5C7XH 3ZE0E 1RUML 2YZ8A 5JXAL 1OW0A 4GT7A 5DFVD 3N85L 4XPGL 3BWAB 2X89D 3VFMA 3G6JF 3MX0A 3JVGA 4GKSA 3H9SE 4BA8A 3RBSA 4YGAB 4NRZA 4P5TB 4YBHA 3NZ8B 4X6FB 1FHGA 2VXTL 3KG5A 4GG6A 3U1SH 3QNYA 4N9GB 4PTUB 4OFDA 3LQAH 4XCYB 5AAWA 3FJTA 2F54B 1YUHA 4PRBB 3VXQB 5CIPA 2JJVA 3BEVA 5CSZB 4WNQA 3IDIB 3RPIA 2RBLA 1EHNA 4OLVH 4L4TA 1NGXB 3FQRA 5HVWA 4Y2OA 3D0VA 4L1DA 2QHLA 1M1SA 5FYKE 1WWWX 3C6SB 1U8JA 4NUJA 4QRRA 1GHFH 1GOGA 3F12A 4NRXA 3ULUF 3NH7H 3GJFH 5KANI 1V3KA 1GPOL 4N90D 4MWFB 5H2BB 3JWDH 4QXTA 5EA0H 4IMKC 5EU6A 2VAAB 1G6RL 1KT2B 32C2B 5D2LF 2D31A 4KI5E 5LQBL 4C55A 1WJ3A 3B43A 5GZND 1AKJB 4LMQE 3ZHLA 4FFWC 2YD3A 3V5DB 3ZE0F 1OWRM 3ME0A 5F1OB 3CDFA 1OSPH 4YDJA 1P7KA 3GBNH 4HWZA 1RURL 5B39A