3IXTA

Crystal structure of motavizumab fab bound to peptide epitope
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
220
structure length
212
Chain Sequence
b'QVTLRESGPALVKPTQTLTLTCTFSGFSLSTAGMSVGWIRQPPGKALEWLADIWWDDKKHYNPSLKDRLTISKDTSKNQVVLKVTNMDPADTATYYCARDMIFNFYFDVWGQGTTVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Motavizumab Fab light chain
publication title Structural basis of respiratory syncytial virus neutralization by motavizumab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 38
structure length 212
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ixtA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ixtA01
4XC3L 3E6FA 2X2YA 4D0BA 1A2YB 4OV5A 2P5WA 3DUHA 2LABA 4ONGH 1FZMB 1IGML 3NCJH 4XRCB 1FFRA 1KIRA 4KRPD 4H8WH 4Y19A 1WBYA 5FYKD 3BH8A 2H3NB 3WJJA 4WWKA 1L6XA 4PGEA 1OAUL 3ZT5A 1JTPA 2D7NA 4HPOL 1RUAH 1MLBA 5F96L 4MLSA 2RCSH 1FZOB 5JOPD 2WBKA 1F6AB 1I85A 4H1LG 3A67H 4QXTA 1QLEH 4LCWE 1A21A 5D8JH 3BRDA 2BVPB 1JNNH 1GZQB 3P3YA 1MAMH 4JN1H 4OGXL 1BOGA 1G7LA 3DUUB 4OFDA 3UTTE 2I9TB 5KVFH 4K94H 4JFQB 1IQWL 5E6IA 2A77L 1ZOXA 3H9YA 4G7YL 4EI5D 2MQ3A 2FJGA 2VH5L 1MPAL 2F8VA 5JO5A 1IZJA 2IBBA 4PJ9C 3PHSA 5E8DH 5DMJB 3QZWA 3DVIA 3CMGA 1VEPA 3MCLH 4ODTH 4POUB 1KPRA 3TBWA 2P8MB 5KSUA 4JPKL 3N50A 2VDRL 2YPLA 4QRUB 5A40E 2ZSVA 1AKJB 4NQDA 4HIIA 3VFOA 1NC4D 5J12C 3TCLB 1RUKL 2P47B 4PRDA 3PQYD 4OT1H 3ECBA 4KK9D 2FX9H 3UTSA 1IAII 1WAAA 1HWGB 1QBLL 2O5XL 4FQ2L 3U9UB 3FQTA 5AZEL 5EBWB 2JIXA 1QSFB 1L0XA 1WGOA 1AO7A 1MFCH 1X7QA 3OF6D 2P5EB 3FB6B 4XP6H 2Z35B 5F1OB 5J11C 5IB5A 3IFPB 3RNQA 3G5ZA 2LVCA 3X3FH 4NHUB 2JB5H 3NPSC 1QKZL 3OZ9L 1SYSB 1T7YA 4KKLD 4KMLB 4I48B 1IC7H 1IGTA 4UQ2B 1MHPL 4X8JA 3L7EA 3V0VA 4KI5F 1IZKA 4CMMA 3AXLB 5IFAH 3V4PL 5F6IB 4NKOB 4P46A 3LB6D 2QSQA 3H6JA 4QHKJ 1UB5B 1DQMH 1CIDA 4WW1A 3ULVC 1M7XA 4F37F 1W8OA 3VFTA 3DI3B 3I2CL 4BUHA 3L3KB 3RY4A 5AD0A 2DQJH 3MBXL 5FOBB 4Y1AB 2ESVD 4P5MB 3WLWC 3GBMH 4JE4B 1V7MH 5GS1B 4UINL 4KDTA 2DDQH 3EGSB 2Y07L 5M94B 2VXUL 1J0HA 4D0CB 4OLWL 4G3YL 4N8VA 1B0RA 3NIDF 4Y4HB 5GGRY 1UACL 5J06A 4KI5C 4PP2A 2JJUA 3GKWH 1SJVA 2EDEA 4R3SA 2F53B 4XCCL 3WXWH 3TWCH 3MLWH 4OKVB 5KVGH 4WGVB 4UBDD 2X4TA 3MRJB 2D7TL 3QXVA 2NLJA 1MQKH 2R4RH 2PO6C 4ZOBA 3RGHA 4X4ME 4PTUB 5BMFH 3KPQB 3O3UN 3QRGH 2EDKA 2MKLC 5TJWK 1I8MB 4XMKH 1TMCB 4PJEA 5HGGS 2XTJD 3NABL 2NYYD 2OJZH 1A4KB 3SKOA 5GIRB 4IIQA 5I71B 1VKXA 2NY7L 3BAEH 4MNGA 4O2CB 1AXSA 4L4JA 2R2HA 4OIAA 1J1PH 4PJGB 2D7QA 3MRIA 4ZYKB 4M5YL 5DQJB 1NAMH 1UB6B 1HSAA 2HT3C 2ZKHL 3OKNA 3GSXA 1FBIL 4JDTH 1KTKE 1WCBB 4EI5A 3RAJL 1RZJL 3L3OA 5J9PA 3MLUL 3FKUS 3MJ9A 1ED3A 2YD7A 1FCGA 4NJ9H 2O61B 1YEFH 1IEHA 3RY5A 3CLFH 4OZFG 4F7PB 3O6LL 2Y25A 3R0NA 3PG2A 1QSFE 3KPLB 2LTQC 3S88L 3KLHC 3FB8A 2P5EE 2VAJA 4XVTL 4GXUN 3RVUC 5C70A 3QYCA 1MJ7H 3SE9H 1TENA 3U2SB 1EJOL 5EOCJ 2O93L 1R3IH 3QQ4B 4GKZB 3OG4B 4MQTB 4MA7H 3GDBA 4R7DB 3OF6A 5L8KB 1FN4B 3UTPE 1FNGB 3LEXB 2NTFA 5AG8A 1NCNA 1P4BH 4F15B 1WEJH 3HUJB 4NUGH 2QQKH 1C1EL 4WHDA 2ZCLL 5J6HB 4KJQC 2D4DA 3GSQA 3MOQA 4LNVA 3IJHA 2APWA 3MJ8A 5DK3A 5I9QB 4D9LL 3EYQD 3PL6B 1MCKA 3QI9D 5KW9L 3IFNH 2ZZUT 5T3ZL 4Y1AE 3FCTA 3O3EB 3IXAB 4U0RC 2FB4L 2C5DC 5D7SL 2I07B 4UNVA 2VERN 3VFSA 3IB4A 4QLRA 1JHLL 4MA3A 5J1SC 3LN5B 3GFUA 5SX5H 3VA2C 1MVUA 1Q9WB 1HI6A 2VXVL 4LLQB 2IBZY 4TTGA 3EO9H 5T3XH 2ESVA 1T5WB 2F53E 2OM5A 3T2PA 3ZKQD 5C0IA 3HLAB 3LEVL 3BIAX 3NCYS 1V7NH 4LP4A 4G6AD 4L3AA 4DZ8A 5IW6A 4HFWA 1EO8L 4JQVC 1MCLA 1K4DA 2FH8A 1DLFL 2XN9E 3CFCL 4E42A 1GC1L 2VIRA 1OLZA 3KPOB 2NTSP 3RVXD 1ZA3A 2BXYA 1FL6A 4LSPH 1I85C 4N0FA 4Z95H 3R1GL 1T0NA 1GGIL 4N9OB 3S3PA 5FDWB 3RDTC 5CLTA 5DRWB 5HY9B 5EC2B 1MLCA 4J3XA 1KIQB 2YR3A 3HE6A 1LP9E 4D9RD 1Z5LB 4DFIA 1NCBH 1WAAF 4PJGE 5CEXA 3OR6A 5DURD 3S34H 1U8NB 3WDIA 4LLWA 3CPLA 2HJFB 2R1WA 2JTDA 5E6IC 3MRDA 4WV1A 3LCYA 4ETQB 3IVKA 3V4VL 3O3BB 4OIIH 1NCDH 1PYWA 1EEZB 3A6BH 1AHWB 5TE4H 4XBPB 1E28A 4XP4L 3ELAT 2WINA 4GAFB 4EOWL 2ATKA 3HR5B 1I3VA 3QXUA 5FYKL 3SCMC 4HC1H 4Z8FH 3IKKA 1F42A 1S7UB 3SKMB 4KZDH 1QD0A 4YC2C 4QRTA 1AFVL 4NKMB 4QRRD 5DEFB 1KPUB 2C3WA 4PD4J 2AJSH 4NO3A 4OJFL 3ZTJH 3RIAK 5I1CL 2OP4H 2AABL 5CJOL 4KVNH 4S1DC 5C86A 4KQ4L 15C8L 4XPHH 5TGBA 3IU3B 1AGFB 1FVCA 3EO1B 1YNKH 3JWNC 1KXTB 4X6EA 3UBXA 3LSOB 2J88L 2EXYD 4NN6B 2AQ2A 5IFJB 3GJFK 3WN5C 4PLNC 2OL3A 2E27H 1F5WA 1KLFA 2CRMA 5B39G 5I8CA 2P24B 1C5CH 2YS4A 4LSDA 3CDGA 5I1KL 1EGJL 4GBXD 4HWEH 1QUNA 3GJFB 4TSCL 5AWNH 5D5MB 3I6KA 5GQBA 3C5ZB 1KOAA 4X99B 4P46C 4NO5B 4Z18A 5T3XE 4LPTA 4TVPD 4GW1A 4OM0L 3QI9A 4GS7B 1S9XA 3RZCA 1N8ZB 3EDKA 5SX4I 4R7NB 1A5FL 4GRWB 3T3MF 5C71A 5HYSA 3GSWA 4YK4C 4PJEF 4EI6A 3HMWH 4NHCL 3TA3B 1I9IH 3MACH 1WBXA 2ZG1A 4W6WB 3RWJA 5J8OA 3IFOB 3MNWB 1TJIL 5CJXA 5LG1A 3REVA 3U4EB 1A9BB 3UJTL 3E2HC 3I75A 5BV7L 3D0VA 1L4IA 3QXDA 5IV2B 1JGLH 2FD6H 3OR7A 5JPNB 2DIBA 1TTGA 3LOWA 1I8IA 1ZT4A 4XC1H 4WUKH 3PWLB 2DWDB 2VLLA 3T0BA 1DLHB 4NNPL 3QUZD 4LSVL 4JZJA 2GJZB 4DKFL 1FZKB 1T6VN 4U1HA 2CJUL 1N6UA 3MRRB 4JRYB 1Y6KR 2NXZD 1SBSH 4G7VL 1DUZA 4GSDH 4JHZA 2FBJH 4PJ7B 1I7UB 9CGTA 4XX1G 1CE1L 2AXJA 1FNSH 2DL9A 1E4KA 1CGSH 3RX5A 1YDPA 3N85H 3U1SH 1NFDA 5HVWA 1ZLWK 3HI1B 3TO4B 2V9QA 3RTQC 4HHAA 1FC1A 1MI5D 4QF1B 4X0KA 1G0DA 4M93B 2XRAL 4PB0L 4DK3A 5MP6H 3CFEB 5KZCD 4YZFE 5CUSH 1NUNB 5EBMA 2IQAA 3BW9B 2R69L 4I5BA 3GSNA 3MRQA 4CVXB 2PNDA 3H42H 4NBZB 5CINH 4OCRH 2Q76B 1ZLWH 4HH9B 3DBXA 4K7PH 2YRLA 4PREB 4QRRA 5FGBA 1JUFB 2B39A 2H32B 1NDMB 5HHNB 5FF6A 2VKWA 2YMXL 1I9JL 3KPNB 2DLFL 1C08B 3TVMA 2YEZA 1DBBL 4LCIH 1CT8B 4X98A 4YEFA 3C8DA 3P9MA 2C7UA 5D5ME 1OPGH 3F7VA 1FH5H 3O6ML 4K3DH 4QTIL 1T80A 2ICEB 3GB7B 4Q97A 3BD4A 2VZTA 3DX6A 1D3CA 1I9RH 2FJFA 3HCVA 3QUXB 4JFDA 4XNZC 5E2VH 5ESVA 2LQRA 4W6YB 4YHZL 1A14L 4CW1A 2EDBA 1N5AA 2HVJB 4PY7B 4GRWE 4JHAH 3B5TA 2AV1A 4WDIB 3QIBC 1OD9A 1HOCB 1B3JA 2BMKA 2DYPD 4U3HA 3ZLQC 3QEGL 1KULA 3SO3C 5LBSH 4N8CL 1S9YB 3DPBA 4DCQA 4WFFD 4X4XA 2XA8L 5B38B 4WU5B 3ULSB 5TDNA 5CWSA 3WLBA 4LLMB 4U2YA 3KPRB 5ANMB 4ENEC 1CU4H 4GAJH 1KBGL 2VLKD 1NKOA 3K2MC 1FZMA 2ZOLA 3V6ZA 4XRCA 2KL6A 3RVWD 1W0VB 5FAAA 1A7RL 4F7MB 5HDOA 2GUOA 3U79A 4YXLL 4QO1A 5CD5C 1WC7A 2DWEA 4JM2C 1XZ0A 5C0JB 3O2VL 1A64A 2CUHA 5IQ9B 3Q6FB 3I9GL 5HHOB 3FQXA 1YEDB 5E94B 2FATL 3BP5B 4P2RB 3V6FA 4PUBL 1KIPB 3MRNB 2BVPA 1OT2A 2VITB 4M6OH 2OXHA 4PJ7E 1GZQA 3QUZA 3GHBH 3GMLB 4Z7NF 4S1QH 3EJYD 5ADPL 4LSSL 4HIJB 2GT9B 1JPFB 3NIFE 1J11A 1NGQH 2LVEA 4MAYC 4HLJA 4LCCB 4P23B 1FFNA 1VA9A 3AREB 1OY3B 3UDWA 3SBWA 4KROC 2DQIL 2C9AA 1FL5A 4IRSB 2YK1H 5JUEH 3O4LB 4HWNA 1EXUB 1Q9OB 3KWWB 1JF5A 4PJIB 5E99H 2P8MA 1XGPB 3FQUA 5DVOA 2J8OA 4FQXC 3FO1B 4NM4L 4QRUA 3FQNB 1MI5A 1AKJA 3G9AB 5I1HL 3DYOA 4FA8A 3QG7L 3QHZL 3TCLA 4UV7L 5FO9B 4XNMB 1Q1JL 2VDPH 4U1JA 3DIFB 4OFKA 5L7XL 3ALXA 4FQCH 3V5DB 4OD1H 4LLUB 4RGOH 4K23H 1EO5A 5J89A 3LQAH 5HPOA 3WD5H 4AG4H 4WI3A 4DN3H 2P5EA 3EAKA 2Z35A 3WFEH 5IB4B 3UYPA 3I6LD 4GG6F 1Y0LA 4NHUA 1MCWM 3BKML 4G42A 1RJZA 1SYSA 1W0WB 4YAQB 1ZEAL 2R56L 4I48A 4MA8H 3TZVB 1U36A 4X9IA 1F8TH 3EBAA 3MYZA 3QCTL 1VENA 3C60B 3SDAD 1LE5B 3AVEA 4HULB 3AXLA 1M7DA 4YUEL 1D5XB 4NKOA 3M17B 5I6XB 3QIUC 1UB5A 3KPRE 5EH1A 3RZCC 5FV1L 2HLFD 4OZ4B 4HGMA 1BP3B 2DYPA 2W60B 4Y4FD 2B1HH 5D6CA 1UCBH 4MDJA 1QLRB 4ELMA 4CMHC 4KTEH 4AEIL 2EYSB 4CDHA 5E4EC 3D2UB 3HHRB 5E4IA 1E0OB 3L6FB 3MOAH 4P5MA 5IB1A 3QZWG 1IC5L 5T3ZE 5JHDE 4DQOH 3D48R 4JFFE 2MCG1 2VLKA 4D0CA 5HHOE 1ITCA 2P46B 1OTUD 4KK8D 3GSRA 5EO9B 4Y4HA 2VUOA 3BPLB 4P2RE 3HG1B 1J1OH 2KKQA 4GKOA 1HINL 4Q58C 4RFNC 4LARH 3BHBA 2F53A 4Y5VC 3MR9A 5IG7A 2LU3A 3B6SB 3R4DA 4OKVA 3G9VA 4V2BA 5SX4H 3MRJA 5DD5L 2R1YB 4LOUC 2ZUXA 1ONQA 4PTUA 3KPQA 2UYLB 5F88B 3OB0H 2NY6B 3LS5H 1I8MA 5SV3A 1RZ8B 3E1F1 3T77A 1MFAH 4TVPL 2VZVA 4DKEH 1P6FA 1T1YB 1CIUA 4NGHH 2VNCA 2BY1A 2H1PL 4LPWA 4Z7OE 4MQXD 3ARSA 1NAMA 1MNUH 5BV7B 1DBML 1A4KA 4I3SL 3O4LE 1JPSL 3QWOB 4PJIE 5DQDL 3O41A 3VRJB 3GMQB 4PJCB 4WFGE 1QFWI 3R06A 4DTGL 1N4XH 4FTVD 1UB6A 5DQJA 3U7YL 3VWJD 5FK9B 2YD8A 4G6ML 1O0VA 1B6UA 2AQ1A 3JWDH 1BGXL 1RV6X 1PDKA 3ROOB 4WTXA 5F7YC 1DVFC 3N9GL 5D8JL 3U46A 5C0BB 1OWWA 5CEZH 4YO0B 4HJGB 1C5BH 5ESAB 1MAML 3KPLA 3MUY1 3RJDA 4P9MH 1T7ZA 3G6JA 3EYUL 4PRBB 1YEGL 1FV1A 3S36L 5F7EH 4GXVH 3AS2A 3VXUB 4KMTL 4EVNB 3U9PL 2HFEB 4U1MA 4N8VG 1QVOA 3MLZH 4PJXB 4UT6H 4WY7H 4AYFA 5DFVD 2ATPA 4K71B 1R5IA 2BHYA 3ARFB 1MY5A 1ZANH 4GUPA 3DRTB 2BC4B 4R7DA 2PXYB 1FNGA 2GAZB 3LEXA 2UUDK 3K2UL 4FFWD 4HUMB 3WUWB 3HUJA 4JG1L 2DS4A 1A7QH 4L5FL 5J6HA 1U6AH 3IKCA 1CXHA 3ZE0E 3TLRA 3TJHD 5AEAA 3DVNB 5ILTH 1S7QA 3PL6A 3SDAA 1P4LB 1P5VA 2MCPL 3DX7B 4YXHH 5ITBL 3DSNA 2CIIB 1CTOA 4UOW0 1CXEA 5EOCL 2A83B 4X7FC 4Y4FA 4P49A 4OSUL 2YD4A 2JB5L 1LO3H 3RVTC 2NMSA 3SE8H 4LLQA 2X4QB 1GGUA 4H25B 2A2QT 4ODSH 3RGVC 3WHE0 3PQYE 3HLAA 1GAFH 3T8XA 3MPCA 2EXWD 2FIRT 1NEZB 4DEPB 1CBVL 4NBYB 1RU9H 1I1FA 3ARGB 3GK8L 5C6TH 1PLGL 4L4VB 2IALB 1GOGA 5MHSE 3ZMRA 4HK0B 1F58H 4XAWL 5FDWA 1MCDA 1X3DA 5DRWA 1RIVL 4M62L 3L3HA 5HY9A 4M6NH 2CGRH 1KIQA 4IBLT 4P5KB 3VXRD 1P9MA 5A2LH 1N6VA 3GBML 1HILB 3NZHL 4NJAL 1B4JL 3O45A 2HJFA 3LIZL 4BFIB 1NFIB 4XNYH 4ETQA 5IVXA 3WNNA 1JK8A 3WIIH 3O3BA 2WP3O 2PUQT 4G8GB 5LGHL 1OHQA 3IDGA 2XI9A 1EEZA 1NMBL 4M8VA 3TO4D 1AHWA 2DQTH 1ZLSH 5L88H 4WHTA 4HC1A 3E0GA 4HW6A 3I50H 3VWJA 4NPYB 2BFVL 3SKNA 5HGBB 3KVQA 3QRGL 1S7UA 4K7PY 3SKMA 1QFHA 4XCYB 2NY4B 4NQED 4NKMA 3QDJB 3VXUE 1MVFA 4KU1A 3DECA 4PJXE 2FHCA 1LILA 2A9MH 3WKNA 3P9WB 1CFVH 2PW1A 4M7ZB 2EIBA 4GKNA 4WJ5B 1N7MH 3CVHA 4NQXA 5F1SA 2AGJH 1BF8A 2KBGA 1U8QB 4DFHA 1FSKB 3IU3A 1J1PL 3ROLB 3V0WH 4PG2C 5ISZB 4JREB 3EDEA 2X4OB 2R39A 3I02B 3U82B 2I5YH 5HSFA 3WNMA 3VXMD 5IFJA 2XWJB 4IJ3B 2KZWA 2VLJD 1D5ZA 3CUPB 2ZUTA 4PRID 1M71B 2P24A 1KELH 3HC3H 2XZAL 4QNPE 4LRIA 5D5MA 5F6IC 1T83A 4WU7B 2YBRB 2P8PB 2BERA 4P2OB 3NH7H 2ORBL 3SE9L 1W2KT 2XZCH 3HB3D 4X6CB 4E5XB 3T0XA 1QRNB 5GHWL 2H9GA 4F58L 1EMTL 4YDLB 5T5FH 5GS1C 1MUJB 4KUZH 3TT1H 1PJ9A 3ARZA 4JY6A 4PGZA 1J88A 3BEWB 1SJEA 3IFOA 3MNWA 3S35H 3BSZH 3IS1X 3GBNH 5GRUL 4L4VE 1A9BA 3EOTH 3U4EA 1NAKL 1CLOH 2N4IA 2X4NA 4JFXA 5IKCB 5C0AB 5TF1H 2WQ8A 3H3BC 1WFUA 2LAAA 3W2DH 3MROA 3OWEA 1I3UA 1DE4A 4Q6YA 3G04B 5ID0B 1TDQA 2G5BB 2XPGB 3PWLA 2DWDA 1XAUA 3ZZ1A 1CD9B 1BIHA 5C0FB 1DLHA 4TQEH 3ABZA 1RZKH 3UPRB 1MF2L 3A6CL 1FZKA 3UBXG 3DMMD 3U48A 1L7IH 5IBTL 2PYED 3MJ7B 4G8GE 3OJDB 3LH2L 1ZE3C 2IAND 3G6JF 4PS4L 5B8CA 4JRYA 3VXRA 1EFXB 2YPVL 5I71C 25C8H 2BVUA 1LO2H 2A6DB 4C56D 3P77B 4B0MM 3CU1A 4IS6B 3GKZA 4ODXA 4PJ7A 1I7UA 4JZOA 5TE6H 5D7KE 3UZVB 1EEYB 3T0DA 2GSGB 5DVNA 4EXKA 3TO4A 1MH5B 3QDJE 4P59L 4W68A 4ERSL 3HUJF 3CFEA 5EZLB 5I8EA 3P73A 4NT6A 4YDKH 3I3EA 2AK4E 4FNLH 4PV9B 5HDBE 1I75A 4ZNCD 1FG2A 5T1DH 5EO0A 5E8EB 5HYSG 4KZEL 3W11C 3D18B 4CVXA 5ISZE 2GITA 2F54B 4Z5RA 2Q76A 4HH9A 1BQLL 1YJDH 4NQEA 4RWYH 4XWOC 4PREA 3U0PB 2IAMB 2DQDL 5HHNA 4MD5A 3ZTNL 1QFWH 4HIEB 3H7BA 4Y5YA 5DSCB 3KPNA 2JF1A 4OCYH 4HPYL 1SMOA 2D31B 3NFSL 1VACB 4I1NB 4L3EB 5ABDE 3S4SA 4LGRB 5F44A 1NGYA 4I8DA 2DAVA 43CAB 4F15C 5BW7C 2XV6B 5DR5L 2ICEA 2C3XA 3GB7A 1FIGL 3LZFH 2CH8A 5I19L 5TPWL 3RBGA 3QUXA 2FSEB 4PRIA 3BEVA 5ADOL 3BWUC 4X6CE 1VFBB 5I9QC 5JLZA 4OGZA 2EDQA 3CDYA 4J4PD 1QRNE 5KVMC 1FG9C 4WDIA 1YMHA 1HOCA 2W65B 3CDCA 4EUPB 1S9YA 2Y9RT 1J1XH 5I1IH 3SOBH 3LD8B 5JW4R 5B38A 4WU5A 2XIDA 3ULSA 4QT5B 3PUCA 3IDIB 3CVHL 5CKGA 1NANI 3L3GA 4CDGC 4LIQL 1YNTB 3RRQA 4LLMA 3MLTB 3DXAD 2X44D 3QNXB 2E27L 4K8RL 5ANMA 1Y6MR 5C0AE 2SEBB 3RUGB 4NQVB 1M1SA 1KN2L 1KCVH 5IVXF 4L1DA 1DP0A 4JGUA 1UVQB 3HG1D 1LK3H 5MERA 1PSKL 1B9ZA 1KGCD 1KLGB 1TETL 1FRGH 4K3EL 2O26U 3QXAA 5HDQL 1IAIL 4P2QD 2Q8BH 3B2VH 5C0JA 4YGAB 5IQ9A 4KK6D 3TH4T 5J1AA 2VE6B 3RP1A 3OKOA 1FNLA 2GYSA 4YBHA 3BP5A 5C07E 5IBUG 1INEL 1Q0YL 1CVRA 3NMEA 5E9DD 4C58B 4MJ6A 1KIPA 1XR8B 1ZT7B 4L8SB 1J0YA 4TOYL 1EX0A 2NY3D 3DO3A 3MV7B 1LO5B 4XXCC 3GMLA 4APQC 4PJ5D 4XGZB 2PYEA 1JGVL 4LFHD 1JPFA 5JA8B 2IANA 3RL2A 3VFGH 1Q94A 2FCBA 1H15A 3RIAF 5JDSB 5DJCA 4P23A 5ICXA 4PGBB 5CEZD 3T0EC 4NSKB 3GO1H 3QAZC 3AU1B 3LKPB 5E2WH 4IRSA 3OPZH 3KWWA 4JFZL 4PJIA 2E6JA 5K9KB 1CYGA 5JDJA 1YY8A 5HGHA 1GGCL 4U7SA 2F54E 3CMOL 3OJMB 2X1OA 1ZA6B 2OR7A 5D5MF 3ZE2E 1I1YB 5JOFA 5FO9A 3RL1B 2DQGL 4OD2A 2VL5A 4UILH 2R8SL 1PEWA 3DIFA 2VB5A 2PTUA 3TYGL 3H0TB 3FT4B 3V5DA 4HS3B 4JZNB 4LLUA 3B9VA 1X5LA 4JPWH 3OXRA 4BM7A 2YXFA 3BGMB 4J3WA 4P48A 2E8ZA 2X70B 1CGSL 3N85L 2HFGL 4NN6C 1CK0H 5IB4A 1NCCH 3UYOD 2AJXL 1JP5A 3MNVB 4G8EA 3VGHA 1W0WA 4YAQA 5EU3A 5ITFB 4KPHH 2MNUA 4YHLL 4U33A 2AW2A 1WQVT 1T83C 3C5ZC 4U1IB 2YD3A 5DI8A 3DV4B 4I9WD 4OCRL 1Z0NA 2K1MA 5DMYA 3LMJL 4XPAL 2NNAB 3M17A 2C1PA 5E1HB 3DUSB 1JVKA 3FRUB 4P9HL 4J4PA 2Q8AL 5DQ9B 4PGDA 4JKMA 1E27B 1MFDL 3ZSTA 2W60A 3RUGE 1NBZA 3IXTA 4QHMA 1WWAX 5ENWB 4LCIL 1QLRA 3UJIH 1OD7A 5GSVA 1BZ7A 2EYSA 4JO1H 3TA3C 3UX9B 5FM5M 1DEEA 4MWFA 4PD4K 5MEND 2CDFB 2IADA 3DXAA 4TNVF 4PJ7F 4KRMB 4PLKD 2VABA 4CN1A 3B9KB 3CZFB 1CR9L 3HFML 5JIPA 3HG1A 3OJVC 1TJHL 2WMPA 5D1ZD 1KG0A 5FDYA 1RJLB 3T04D 5H35A 4HEME 4P2QA 1UT9A 4XI5C 4Z6AT 3MV7E 5GGQL 1AR2A 2R1YA 1ZHKA 3OKKB 4XBEH 1CICC 5F88A 4R2GC 2HT2C 2IPKA 1IKNC 4NQTA 5JIHA 1RZ8A 2DICA 5E9DA 3ZE1E 3TBYB 4E0RB 1T1YA 4IM8A 4K9EL 5HDLA 4AIOA 3L5XL 3PDDA 4TN9A 3FONB 3OX8B 2HWZL 5IT2L 3UPAA 1TQBB 5F89A 5IQ7L 2LU7A 3LHPL 1W0YT 1EV2E 4PJ5A 1QSEB 4I4WB 1MCSA 3O2WH 4PJCA 4DW2H 4YIQB 2R2EB 1IFHL 3QO0A 1KB5L 4ODUA 1IGCH 4NN5B 4JQIH 4ODVH 4XP1L 1KENH 4M93C 4ZS6D 2KDGA 3LKSA 4BQCA 3L5IA 5F7DA 1EAJA 3RKDD 3QEHB 5IMMB 5C0BA 4DGYH 2EIZA 3Q3GB 5ACZA 5HYFA 4YGVB 5C0GB 5ESAA 4ZUUA 1CFQA 1MRDH 2FR4A 1WFTA 1DSFH 3OB8A 2IQ9H 1IT9H 2XQYG 3DHJA 3QO1B 4PRBA 3NFPB 4EEEA 1BJ8A 1NGQL 3H9HB 1D6EB 3VXUA 3WXVL 4OF0A 1RZJC 3TH3T 5HI5C 4QGYA 2HFEA 4ZNEE 2K7PA 1RUPL 2DJUA 3WFBL 4FXLA 3JTSB 3WHXA 4OQTH 3FQRB 4DWHA 4P0DA 2R2CA 3ARFA 1Z3GL 2BC4A 3K4DA 2PXYA 4JO3H 5D7JB 1S3KL 3DARA 4ZO6A 1G6RB 5TQ0L 4YH6A 3VFNB 1MHEB 3QDMD 1HCFX 5BOZG 4NO0B 3DI2B 2VDPL 1FYTB 3TJEH 4BQBA 3BQUB 1ZHLB 1G6RH 3DVNA 3QA3B 1P4LA 3GZKA 2NY5L 1F13A 2EDYA 4CRPA 4IRZH 1JI2A 3N1GC 1JYXA 1IM9B 3EOBA 1N6QL 3PJSB 3JZ7A 3PHOB 1T2QL 1U3HD 3MXWL 2APBA 3NACH 2A83A 35C8H 4G9FB 4YNYA 1WLHA 4YBQD 2IGFL 4KVCH 1U8OB 2AI0H 4N5UA 4DAGL 1F8TL 3LRSA 5EA0H 5MENA 3ILPB 1JZ2A 2YD6A 4Z7OF 3VG9B 1NLDH 5JR1L 1DDHB 1P7QD 1TVHB 1G84A 3ARGA 4PJIF 5LVEA 1S78D 1FJ1A 5T1MB 5D1ZA 4N9GB 1UEYA 1U92A 2IALA 1DJSA 5DD3H 5A3IC 1U8LB 1NANH 3LKRB 1BM3H 5E8OA 2Z91A 1QEWB 4WI5A 4ONFL 4HQQH 4TNWK 1EFXD 3V0AC 4KJYB 1QSEE 3QR2A 4XT1C 2KPNA 3ARDD 5ALCH 2HTLC 3HNSL 1QHPA 1CL7I 4P2CG 1EVUA 1UA6L 4UI2A 2DTML 4LCCC 1ZHBB 3KLAB 1PBYA 4FFZL 4J3SA 3AREC 3T2OA 1EHLH 3Q1SL 1TIUA 1S7VA 4G6FD 2X4RA 3WL9B 3X13A 1LQSR 1IGIL 2HT4C 4XCFH 1SEQL 5HGBA 3NA9H 2FHBA 4HUNB 5I66B 4DVRL 4G8FB 1XF2B 1F2XK 3S96B 4F33A 4GKSA 4J6RH 1XF1A 3B8YA 1LO4L 2EYTB 3AUVA 1NGXB 4S1SL 1SVCP 5CCKL 3CXHJ 3IF1B 3NN8A 1CS6A 1O5DT 3Q6GL 3ZDYE 2ZG3A 2MJWA 4FN0A 1OAYH 3ROLA 1OGAB 3P4LA 1ZLVK 4HXAL 4C83B 4X9FA 3TNNB 1YEEL 3JWDL 4KHTL 3KR3H 4LDEB 3QJFB 4M7LL 1FYTE 3TZVC 3CUPA 3QJHB 1A7NH 4LPUA 5DHYA 5AYUH 3HNTL 3C60C 2BNRD 3K8MA 4GH7B 1XFPA 1TJGH 2APTA 1KEMH 4PR5B 4AEEA 1G9MH 1HHGB 3PIQB 1HQ4B 4LBEA 1MCBA 3WIFB 2P8PA 1HXYB 1H3VA 1OGTB 2AJZA 4LCUB 1PVHA 2CO7B 2Y36H 1JGEB 4E5XA 3B8SA 2XICA 3QDGB 5HGAB 5DRNB 1JNHA 2ZUYA 3S3JA 43C9B 5GJSH 5IFHL 5J3HD 3JV6B 1G7PB 1KJMA 1FNHA 1QBAA 3MLSL 2Z8VC 5JNYB 4X7SL 5DFWH 4NKIH 4ZOAA 1AI1H 4LRNL 5DUPH 3INUL 4PJCF 3BPLC 3BZ4B 1RULL 4OCNC 4CNIB 3MA9L 4L4TB 4YHOH 3UEZA 4LIQE 3ZTJG 5FUZH 1H3PL 5BO1H 5IKCA 3U30B 2B4CL 4YE4H 2YRPA 5IJKA 3VD3A 3G04A 3T0WA 5ID0A 4HIXL 3TBTB 1CFSB 1S9KC 4P4KB 2CK0H 2CLRB 2R0KH 3HPLB 3UPRA 2BOCB 2ZNXA 4Z0XA 1G7JB 1K8DB 5C1MB 4MCZB 3MJ7A 5D2LE 5F6HI 3LKQB 5J6GA 4UV4H 3O6FD 1D5IH 2J3SA 5GGVY 4EBQH 5BV7C 1EFXA 4FFVD 4WVRA 1U58A 4ODSL 4KKLC 3P77A 4HXBL 1EK3A 1BZ9B 3BRGC 1RSFA 4ZQKB 4M5ZH 2DIJA 1I7TB 2FYYB 1LO0L 2WANA 1KT2B 2VLME 3VFPB 4IEFB 1AQDB 4MCYA 3GGWA 3OKYA 4ZUWB 5CILL 4ZSOB 4HWBH 3FAXA 4D3CH 2OS7A 1MH5A 5DD6B 3QUKB 2V6HA 4O9HH 1AY1L 1I3RA 1FNAA 1CVSC 3EO0B 4YDJA 1A0QH 2GK0B 5B4MD 1MWAB 3GI9H 1J87A 4KKCD 4LSRH 1OGAE 3FT3A 2L7JA 2PR4H 3JSSA 4OD3H 2DMBA 1MWAH 4QNPF 3C9NA 1P5UA 3U0PA 2IAMA 4X5LA 3CCHB 3GI8L 3CFBB 3KPPB 1KB5B 2BSRB 3RBSA 2W38A 2DQTL 4K71C 4HH8A 1XIWB 3E3QE 5DLMH 1QNZH 3X11A 3GMPB 4L3EA 3VD5A 5CGMA 1YEJL 1NDGA 1JV5B 5D70L 4G9DB 2CMRL 3NVQA 43CAA 3VI3F 4R0LC 4JPVH 3WBDA 1K2DB 1X5GA 2QJDA 5DJXA 1EHAA 3ZYZA 2I26N 2FSEA 2HTKD 4X5XB 5EUOB 4AEHL 3BT2L 3V52H 1VFBA 3CVIL 3QDGE 4F9PA 5FUOH 3QG6A 1BFTA 2BNRA 1H3WM 1RK0B 3C5SA 4N1HB 1DBKL 2APVA 4X9GA 1A4JA 1BFVH 2NYYC 1F3RB 1GGBL 3LS4H 3V0WL 1I8LA 4QT5A 2W0FB 3IDIA 1NCWL 1BAFH 1AJ7H 1CG9A 1YNTA 4MNQB 4HUVB 3HRPA 1OB1A 5BXFB 2HJLB 1UCTA 4S0SD 2SEBA 4NQVA 3B9KD 3TP4A 1BREA 5J1TC 3BKCH 3FHQA 5DMIL 4D94A 1N5YL 5BCAA 4ODBD 2QHRL 4NZRH 3QEUA 4JHBA 1VGEL 4KQ3L 3QFDB 1FLRH 1OSPH 2DLIA 4OLVL 5D2NE 1IAKA 1KUMA 3ARGC 4QEGA 2EH8L 3ULUL 1FO0L 2VDNH 4AENA 5C0RL 5EZOH 3NH7L 5KN5B 3NAAH 2VE6A 4UTBH 2QEJA 3MRBB 3AM8A 2NCMA 3PV6A 4LQFL 3EDDA 5LGJA 1TXKA 4MGXA 2WK2A 2IBGA 5T5FL 4MZ2A 3FTGB 3BGFC 4Q6IB 3OKDB 2NW2B 2EE2A 1FGVH 3S4SG 1A3RL 2VDML 5HDBF 4XGZA 4G6JH 3FO2B 1OW0C 4Y88A 5C09D 4HMDA 3O6FA 5T1LD 1CLOL 3EFDH 1CGUA 1A47A 4DK6A 2DN7A 2Z8RA 4GAGL 4BQ6A 4NSKA 3PXHA 3D69A 3AU1A 5B22A 2ERJB 1FDLL 4K2UL 4TSAL 4J8RB 3V7AE 5I8OL 1CLZL 3EYQC 4ZDHB 2XQBL 2XTLA 5K9KA 2JJTC 1A8JH 1FCCA 4M1GH 4JRXD 2NY4C 3P4NB 5F9OH 1IBGL 1MCNA 5CSGA 4N5ED 5SWSB 4POYA 2ZUWA 3RL1A 1XGQA 2NY0C 1LD9B 4FQ1H 3CSYB 3IDMB 2FL5B 1CL7H 2PYFA 4M7ZC 4Y8DC 3FT4A 1VHPA 4HS3A 1E6OL 1U93B 1FSKC 5GS2H 5EZJB 4MXQD 4UT9L 3MZTA 5HHMB 4LSQL 3LPGA 4JREC 3WS3A 5JW5B 1KN4L 1HWHB 4IJ3C 2QQLH 2ZPKH 5EUOE 3MNVA 3QHFH 1RZGB 1XGRA 3VXOA 3U0TB 4O5LL 4O2FA 5D72H 1TZGH 1FYHB 5DJZB 4CKVX 1HH9B 3MODH 2BY0A 2CR6A 2AJYL 4P2OC 2NNAA 3MV9B 4ESKA 3FRUA 3PGDB 3TEUA 5I2IA 3ARBB 5L0QB 4FFYH 3B4NA 1QFWL 3HKFA 1P2CA 3VRIB 3QPXH 1GZPB 1D6VH 5ENWA 4YDLC 4QTHB 1K8IA 1FGNL 2OR8A 4OGYH 5C6WH 2XZZA 3L3DB 4MZ3A 5D71H 1E4XI 4RDQF 1R6VA 2R4SH 1TQCB 3W39A 1G7IB 2ADIB 3GM8A 4O4YL 1KCRL 4ZD3L 5KVEL 1SJHB 4U3CA 4W4OC 5D1XD 2G2RB 4V1DE 1I1AD 3B9KA 1QFPA 5FHAH 6CGTA 4JDVB 2CLVB 3RIFK 2VUYA 1F6LL 5JXAL 1NLBH 4X8XA 3D6GA 2XACC 4I77H 3P0VL 3WE6A 4Q9QH 1KNOB 3RVVC 1YEKL 5ELIA 3OKKA 5C0CE 4L9LC 4GO6B 1T20B 2A1WH 3TBYA 1DUYA 2R0ZL 3MRFA 1KTRL 3ZE2F 2EZ0D 1NC2B 2Q3AA 3C08L 2WNGA 4R26H 3VJ6B 5MI0C 3HZYB 5TDPA 5B3JF 4RGMB 3FMGL 1X44A 2DLEA 4GBXC 1QSEA 4I4WA 5K59E 2P8LA 2QQNH 5GXBB 4YIQA 1NUGA 2BDNH 3QNZB 1F4WL 2OJEA 4YHNA 2BP3A 4PB9H 5HD8C 4GRLD 5SWSE 5GZNC 3HMXH 5IBLC 1GPOH 1PY4A 4OLUL 4OLEA 2E7LC 3DRQA 5IMMA 2NY1D 3MRGA 4JB9H 2W0LA 1SMAA 4HCRL 5HHME 5C0GA 2CO6B 3ESUF 1A1MA 4Z7WB 1IQDB 1MAKA 3S6CA 2IAMC 1BJ1H 4FZEH 1KGCE 5EC1B 2WIMA 4OQTA 1GJIA 4JFEB 4PJ9B 1C16B 3C5JB 1MCWW 1D9KD 2BHUA 5GGVL 4N0RA 3JTSA 3T1WA 3C6LB 1SM3H 4WEMB 5HI3D 1HCVA 3QP3A 4Q9RH 4M43H 4C4KT 1OAZH 4E41B 5ETUB 2OI9B 5D7JA 5J12B 4ONHB 3PHQB 1G6RA 3VFNA 3SDYH 2VZ3A 3MV9E 3TF7C 4X83A 3VGAC 1BLNB 3WKMH 5F7MC 3QXTA 4NO0A 5A43C 3WFCL 3BQUA 3MYJB 3NFNA 3QA3A 4KK5C 5CHNB 3FO0L 3U0WH 4IOSD 4Z0BH 5DK0B 3LD8C 1U91B 5TFSH 3ZHKA 5I73C 1BFSA 5HHVL 4PJBE 1IM9A 5EU4B 1GOFA 2CK2A 1MREH 4WENB 4OZIB 3PJSA 2F5AH 2A74B 4I3RL 4PRHB 4RISH 1RVFL 4ZS7H 1HXMB 3EYOB 5CIPH 3VWKD 4AJ0A 4I2XE 4U1KB 5HBBA 1J86A 1PGRB 4LFHG 4WI4A 3MLRH 4QXGL 2V17H 4G9FA 2RR3A 3WFHB 3OAUL 1U8OA 4Y16B 1ADQH 4X5WA 3VW3H 4MJID 2A38A 1AC6A 1TNMA 4NQSA 4WEBH 5F8RC 4KTYA 3ILPA 3ZE1F 1QFOA 3PGFH 2YUVA 2DBLH 5TQ2L 1VB9A 2VSDA 3KXFD 1FQ9C 4FP8H 2AJUH 1E4WL 5D1XA 1I1AA 4ZFOA 4R4NC 1FL3B 1U2HA 4AK1A 3DGCR 3D3VB 4HJJH 1XF3A 4N9GA 3QWRA 3ULVH 1BIIB 4L8SC 1HHJB 2EE6A 1GRWA 1F2QA 1ZGLB 2QTEA 4NCC2 3V7MA 4OLYL 4XZUB 2HMID 5EU6B 4R9HA 4LCYB 2DM7A 1U3JA 2Z31C 2HH0H 4P3CL 4CU7A 3KLAA 1FO0B 3IT8D 2H6PB 4I9WE 2VAAB 3MLYL 4UIMB 1DEDA 1DQLL 1UZ6E 2WUBH 5EBLA 4Z7VA 1MRFL 2JCCB 1OAXL 1KC5L 4NCDA 3QEQE 4Z7WE 4R6UA 5F6HJ 2VLRD 4GRLA 5FV2A 1XF2A 1NL0H 1UYWH 2RGSA 3X3GH 1F4XL 2DKUA 5LAXA 2W9LA 4JFEE 5FHBL 2EDHA 2EYTA 1JHKL 4ZTPL 1NGXA 4P5TD 4JLRB 1INDL 2EYRA 3OJ2C 5J7CC 1FFOB 3RWDB 1S5HA 4HDIA 4E41E 1QLFB 3CFKB 5DJ2B 3O9WB 3TNNA 3MNZA 5C9JB 4KJWC 3O0RL 2JB6B 3QJFA 3MOBL 2G60H 3DGGB 3HC4H 5IHBA 3WMSA 3MGOB 5JMOC 5FCUL 3X14B 3U4AA 5IVZA 4PR5A 4OZIE 1NBYB 4NWTL 5CBEA 3WIFA 3IGAB 4WUUD 1HXYA 3O11B 5DF0A 3SGDH 1OGTA 3NCMA 4LCUA 2FO1A 3GRWL 3MUGB 2FZ3B 2GY7B 4MNQD 3QDGA 3Q2CA 4Q9BA 5HGAA 4FG6C 4FQLH 3ARTA 2AEQL 1JYVA 1AIFA 2AXHA 5C8JA 4LVOB 3BN3B 3UJJL 5C08B 1JPTL 3VWKA 1G7PA 4G6KL 1KJ2L 2X09A 1MIEL 3T4YA 1HKLL 3D3VE 5IWLC 4XMPL 2GCYB 2D03H 3BZ4A 4L4TA 4MJIA 3T3PF 3TJEL 3F7QA 3IJSB 2BVQB 4OFIA 1ZLUK 2YN5A 3V4UL 4R8WL 3KXFA 1XMWA 5CZVL 4U0RB 4IRZL 5D96B 3FFDB 4IOIB 2XWBB 5DWUH 4K3JL 5EU6E 2I60L 1CFSA 1S7SA 2VDOH 3O3DB 4FMFA 1M4KA 1UWGL 2CLRA 4UNUA 1DZBA 1G7JA 4N0CC 1E4XH 2F58H 3ULUE 1MFEL 2CLZB 4XHJD 2ZUVA 2FEEI 5IMOB 1TQBC 1BWWA 1IGYB 3PE9A 5E70A 2JCCE 5IROA 1CF8L 2J8UB 4HWBA 2CRIA 1LDPH 4PTTA 3BDYH 1CGYA 2AEPH 2WBJB 4MD4A 2FYYA 1MCOH 4NN5C 1KT2A 2H45A 4S1RL 3VFPA 1AQDA 4ZUWA 3ORJA 4ZSOA 1L6ZA 3RDTB 2F5BH 1IEBB 1IVLA 1UC6A 3GHEL 5DD3L 4ZFOL 1PKOA 1K6QL 1M7IB 3SDCD 1T6WA 4XHQA 2XZQL 1CGVA 3TC9A 3DURB 5K9OB 3RZWA 2QBWA 2HJKB 3QQ9C 1MWAA 2Q3ZA 4PJFB 3G6AA 5TE7H 2VLRA 4JN2A 1IM3B 3E8UL 4PJAB 1JN6B 5ALCL 2YD9A 2G75B 1EO7A 1OAKH 5DTFB 3KS0H 1YYMH 3RA7L 2B0SL 3P0GB 3KPPA 1EHLL 2UWEA 2BSRA 3EYFB 3DROB 1Y6NR 2FX8H 2DQCL 3HI6H 4HK3J 3WEXB 1YNLL 3GNML 5CZKA 1SVZA 3GMPA 1WITA 1NBQA 1B0GA 1JV5A 5D7JC 2QADD 1AP2B 1S9VB 1JMXA 1Q38A 4F3FB 1OARH 2O5YL 5BRZD 2FEDC 3BDXA 4JFPB 2HVKB 1ODAA 3BE1H 2V2XA 3KPSD 2BNQD 1AD9A 3EYSL 1ZT1B 5C08E 1KFAL 4RDQG 3OSKA 4MQXC 4N0UE 5GGSY 4RFOH 4EDWL 5ICYA 4O58H 4MNQA 3S35X 3OKMA 2Q7YB 2AEIT 4D9QE 5BXFA 3J7HA 5FYLL 4TNWF 3QH3A 1F90L 4LGSB 4KV5F 4YWGL 4CVZA 1NGZA 1AE6L 3MUJA 4LDLB 1HIMH 2ZOKA 3WFDH 5CJQL 4Z7VF 3H3KA 3FRPA 4PGCA 4XP9L 1JTOA 4GT7A 3VH8B 1FIEA 2DQUH 3HE7D 3D39B 5EOTB 2R0LH 3THMH 4PJHA 3EOAA 1JGDA 1ZVYA 4XWGH 4K8RC 4ZXBC 4IRJB 4HKXA 1H3GA 1OAQL 3RY6C 1J12A 1RHHA 3FTGA 3PDOA 2W9DL 2J8HA 1F00I 3H3PL 5TH2A 4MLIA 1MJUH 3B43A 2NW2A 1UJ3B 2YZ8A 3BP4A 2H26B 3QFJB 2W1NA 3FO2A 4H0HB 4X4ZA 5EWIL 2HLAB 2FGWH 4S2SB 2COQA 1Q9LB 4QRPB 4QOKE 1JZ5A 1OCWL 4JGMA 1HDMB 3UTZB 3TJHC 2DQEL 3G5VB 4PJFE 1NGWB 2EIEA 4JKPL 4OI8A 3GMOB 3V6OE 4PJAE 2E7CA 2GK2A 4P57A 3VGBA 4JG0H 3SJVB 1BBJB 1TFHA 4OCSH 1H5BB 3D0LB 3C8HA 3P4NA 4HS8H 3FN3A 4NKDB 1VFAB 2L7UA 3SDCA 4TULH 2DD8L 3UO1H 4OAWB 2ARWA 3P0YL 1FLTX 1LD9A 1X5IA 2E5EA 4U6HA 3CSYA 1JPGA 3IDMA 2FL5A 2F19H 4PJ9D 2BRRL 5EZIL 5T33H 5I30H 1J8HD 5EZJA 3MFGB 4LKCB 5DK2A 3ZKMC 4LASH 3MRPB 4XNUH 1FFPB 2AK1H 4AMKL 2VC2L 3TH2T 4JVWA 5T5NG 4HJ0C 4UUJA 4BK5A 4XVJH 2VDKH 5KVDH 2PCPB 1JGUL 3QSKB 3BESR 3E3QC 3CH1B 1ZGLP 4XBGB 5FYJL 5H2BA 4WFHD 5CLWA 3CFJA 2IPTL 3Q0HA 8FABB 5D1QB 4NQUA 2XY2A 3BPOB 4LSRL 5CJ5A 2ITDA 4NQCB 5DMKB 1HH9A 2OR9L 4UTAH 1J0IA 4M6ML 4PRAA 3FT2A 3MV9A 2AXFB 1UWXK 5E7FA 4BZ1L 3KPSA 5F9WB 3ZL4H 2BNQA 4JR9H 5CSZA 1DR9A 5DMGC 2A6KA 4KWUA 5C2BH 2IPUK 4HX1B 3S3SA 1UWEL 5DT1L 4CJ0A 4YPGB 1R5WB 5I1EL 3TN0B 1L7TH 4XNZB 4Y8AA 2ADIA 5GISL 4CADB 3WS6C 3CXHK 1E6JH 4OKDA 4U1NA 3VXQB 3P11H 4I18C 1A7PL 2G2RA 2AJVH 2VDLL 5E6ZA 3U30C 5BS0D 3MLPA 2HG5A 1HQRA 3MRMB 5K9QI 4WNQA 4P9HC 2A6IA 5BJTB 4XH2B 2XA3A 1GIGH 2XFXB 4NZUL 1A6VH 4AY0A 4OM1L 4LHUB 3WLWD 1MJJA 1YQVH 4H20H 4P4KC 5JHLL 5D2NC 1KNOA 3DO7A 1E4JA 4O00A 3H9ZA 4JANB 3LKOB 3SN6N 1KJ2B 3MX0A 1ZS8B 5I75B 4I0PB 4QRPE 4KI5D 4X4YB 1UM5H 5E00B 3K3QA 1RUQL 3GSOB 4KH2A 3VJ6A 1JFQH 4JM2B 2UWEF 3BD3A 5EORL 1B4RA 1K9TA 2OSLA 1ORSB 5F9JB 1FLRL 3HMXA 4LLDA 2PO6D 4BSWA 5DRZA 1ZWIB 3P4OB 2GSIB 3LEYH 1OTSC 3NAAL 4ALAL 3VDAA 3OAZH 3KPTA 4DGVH 4HKJB 3KYKH 1EEQA 2OK0H 4OZGE 4RX4A 1INQB 5I18H 5AAMA 4K9EC 1CGWA 4QKXB 3QULB 5INDA 5CBAB 7FABH 4OB5L 3G6DH 4M9PA 4OCWH 4ZUVA 1T21B 2H41A 5DJDB 2CIKB 2HRPH 1GHFH 1Y18B 4WGWB 1IQDA 2NW3B 2HT3D 4YHKL 4GQ9L 1IC4H 5EC1A 1AQKL 1KB9K 1AGDB 1A6WL 3ZKNC 3VCLB 4KROB 3X12B 4PJ9A 1XIWC 3NCYP 5C0NC 3FQWA 3HZMB 3SKJH 2WQRA 4FABH 1DBAL 2VTFA 4XCEB 5E2TL 3K46A 3QQNA 4YXKH 5K9JL 4NQCE 4E41A 3WSQH 5ETUA 1XCQA 3KLHD 2VDQH 4ONHA 3PHQA 5F9OL 3RVUD 3ET9F 1BLNA 4L3CB 3M8OH 4FQ1L 2HFFB 3MYJA 3DMMC 2OQJB 2AJ3B 2V9TA 5C09E 5IOPA 5CHNA 3HZVB 3B5GA 4PJHF 5CIPA 5DJ6B 2HKHH 1U91A 5LKNA 3QUMH 4EJ1C 5FB8B 3IDXH 3MRKA 4POZC 1UXSB 4PRHA 2ICWB 4OLXL 4RQQB 1ADQA 2ADFL 3GIZL 4U1KA 1RURL 5B3NA 4KJQD 1YYLH 2E6PA 3MCKA 3MBED 4X6BA 2BVEA 4JRXE 4WFEE 5IF0B 1WT5A 3C6SB 3HN3A 2DBJA 3PWVB 2P43B 2LU4A 1CD8A 3MRLB 2NY5C 1QBBA 5I1GL 3EUUA 5DUML 1OSZB 2KZ1B 1ZSDB 3HAEH 1WZMA 3HZKB 1FZJA 5L9DL 3TT3L 4HLZH 1J5OH 3ES6A 5K59F 1KJVB 4OUOA 5IEKB 3K80A 1BIIA 5E4EB 1I3GL 1LEGB 2KQMA 3B9AA 4H88H 5CP7B 5D7LB 4PBWD 4Q6IC 4JKWA 4M7LT 5F7WC 1ZGLA 1Z9SA 4XZUA 3VE0A 5JORA 4LCYA 3DVGA 1LE9A 4QHNB 5I74C 5BQ7B 1BPVA 5E08H 3VMOA 2QSTA 2CDGA 3FFCE 2H6PA 2VAAA 2X4UA 4Y5VB 4H1LB 1F3DJ 4NOBA 4DN4H 5KOVC 5I1DB 4JJ5A 1MFBH 4MNHB 5LWYL 5KSAC 4H1LH 3OKEB 1HHKB 1WZKA 1EEUA 2EDRA 5E6ID 1DQQA 1CLYH 1U9KA 4GW5B 3RWCB 4LCWB 1MCRA 1QBML 4Z78A 1UQSA 1T1ZA 2BOBA 1U8KB 2C4XA 3MXVH 1YPZB 2JJVA 4JLRA 4J3OC 3ZSSA 3UTTB 3RNKB 5HTSA 3RWDA 3KYNB 3DV6A 4LLVA 4XVUC 4HMEA 4LU5H 2IF7A 1JRHL 4TPRH 1QLFA 4HKBB 3BIKA 3SCMD 1U95B 2HKFH 5KAQF 1KF9B 4R90L 3TCXA 4F2MB 5SWQB 4JFHE 1DVFB 5EUKB 4KAQH 1GPOL 3UTSD 2WZPD 3MGOA 3TBSA 4LVEA 4S1DD 4LEXL 4KHXH 5KJRL 2YN3A 1NBYA 2CXKA 3VRLE 4F7CA 1WBZA 3VI4E 3DSFH 1DL7H 1JWMA 4ZUSA 2NY3C 2N7BA 2Z0BA 4OQ1A 2Y06L 3PP4H 4UNTA 2IG2H 1AC0A 3ARBC 5L0QC 4YJZL 4HWZB 3TV3L 5IEHB 4GRMB 2FZ3A 5IMKB 3RIFF 1XEDA 3ZDZE 4G8IB 3MLXH 1WUNT 1VADA 3G5XB 4UT7H 1YECH 3EZJB 4DOHE 1TNNA 3O2DL 5I76A 1MCEA 1X5XA 4W6XB 1FNFA 1BEYL 5C08A 1XH3B 1C5DB 2VRAA 1TQCC 4TTDC 4X7TA 5SV4A 4P46D 1UM6L 2N7AA 1WIOA 2X41A 4XNXH 5ID1A 3WIHL 2GCYA 3C2SA 5IHUL 4YDVA 4LF3B 3IDJB 2R29L 1G7QA 2RFXB 3FOMB 3IDUA 3CH8A 3PDGA 1NGPH 1S5IL 5SWZB 4ZG1A 4WHCA 3VD7A 5D7LE 4XP5H 5FYLE 2V2TA 1KLUA 4JDZB 4HZAA 3L1OH 3FFDA 4IOIA 4PJ8B 2FIKA 2OZ4H 2GKIA 4UB0L 3PWJB 3Q5OA 3BP6B 1FC2D 3U7WL 2XKUA 4HUXA 1CZ8L 4K7FA 1S7XB 1TVBB 3QFJD 4NRZB 3I6GB 1T3FB 1N2RB 1S8DB 5EIVA 4IDJL 5IMOA 2JJWA 2XKNA 3RGVB 2L4OA 2B4CC 1RMFL 2CKBL 3G5YB 4RGMC 1I4FB 3PGFL 3IU4H 4D0DB 3NZ8A 4JQVA 3WNOA 3PWPB 3F58L 2J8UA 3JV4B 4NDMB 2C3VA 4NM8H 2R0WH 2VZ1A 2OYPA 5F1IB 4AL8H 4QXUL 4N8PA 4HT1L 3SJVD 2XXCB 5F70A 4Z7UA 3RDTA 1IEBA 4B5EA 1YPZE 1M7IA 2HA1A 3CD4A 1KCSH 4HS6B 5GGTL 2W9EH 2ZUQC 2DB8A 5J0BA 4ONOA 2VXQH 1OM3H 5IK3A 2GJ6D 2NX5D 2Z4QB 1KTDA 1JN6A 5AZ2H 1DN0A 4PRNB 2ZJSH 2G75A 2ARJQ 1RFDL 5GRJH 2ED7A 4PGJA 5DTFA 1BMGA 4NNXB 3W9DB 2A9NL 3CFDB 1PY9A 2X4PA 3UPCA 1T2XA 3BPNC 3RTQD 3DROA 1WZ1H 3IFLH 4XXDA 3RWGB 4A6YB 5HYJB 1MCPH 3C6LC 4X9HA 3BZFA 2OBGA 3L9RB 4WEUD 5JIKA 3S37H 4OZFB 3CJJA 4JPIB 3SCMA 1XF4B 3TIEA 1XCTB 4A6YH 1A6TB 4EIZC 2OI9C 4RMTA 4JVUA 1IEAB 1S9VA 4TSBL 1U8MB 1UM4L 2V7NB 2QV2A 4N0YH 3U4BH 4NZTL 3P2TA 5MEPA 2HVKA 3QIWC 3ULVF 1RUMH 5C7XH 1KTLB 5EOQL 3UC0H 4EQ3A 1T0PB 4WO4C 1ZT1A 3MV8B 5FYJE 4EZMA 1SY6H 4TUKH 1OWRM 4GFTB 2BHZA 4MAUL 2ICCA 5IESL 4Y2DB 1KYOK 3VG0L 3WN5A 3UYRH 1A6ZB 3PNWA 4YHYB 1R5VB 2FECI 1N3NB 4Y16C 4HZLA 1R3LA 2QR0B 1PKQB 1WT5C 2DQHH 1M6OB 1W72L 4X7DC 2EH7H 5SWZE 3RWHA 3QIBD 32C2B 3L95B 4M02A 3U36B 2YD5A 2GTZA 1A6AA 2WWKO 5HGDB 2IMMA 1N0XL 4CN6A 4NN7B 2JCCF 4LPXA 3V7AG 5JW3L 5FKPA 5A2FA 4L8DB 1IGFL 5D9SA 1G9NL 4IMLB 2O5ZH 3HI5H 2FHFA 1J18A 3D39A 4ENED 2FLBT 5EO1B 2H2SC 1XGYL 1LK2B 1DFBH 1ACYL 4IRJA 2BNUB 2W0PA 5I1JL 2EDFA 5DJ8B 4KRLB 4WW2C 3F8UB 2ZCHH 3PWPE 4LAQH 4F9LC 4U7KA 5KTEH 1F02I 2DQFB 5DVLA 3V2AR 1F4YL 3EFFA 3OHXB 2H26A 4U1LB 3QFJA 4N90D 4ZTOL 1KCUL 3IDNA 5C0EA 3ULUC 2BJML 4CU8A 2I9LB 2HLAA 4WI7A 1JHTB 4WUUE 3IDYB 1OF2B 4OLZH 4U49A 5DD0L 3HE6D 1AXTH 2OLDA 3U6RB 1VDGA 5E2UH 5HVHB 2XN9B 1H8NA 3BKJH 1MIMH 3GMOA 4M61B 2DKMA 3O6KH 2RB8A 3SJVA 4J7RA 4UIKH 3FOLB 3VXSD 4U6VH 3QCUH 1WSST 2J6EH 3VXPB 1U3HC 4ZPTA 5GGSB 3QPQC 4NKDA 4MAYD 1LP9B 5HYJE 2X1PA 3DTXB 3SDXA 2GJ6A 4KROD 4O02H 1G9EA 1B2WL 4RAVA 5FM4A 2NX5A 3QCVH 1C8PA 3P30H 3TO2B 2FGZA 1YEIL 2X89D 2E9IA 1FFPA 3BPCA 3D85D 3MRCA 4RAUB 4MS8C 3FL7A 4YX2L 4RMWA 4KUCF 2AEPL 3O9WC 3T4AA 4OTXH 4LSUL 2B2XL 1VPOL 2P7TA 4FQXD 12E8H 3RTQA 4BH8B 3FRPG 1A7OL 3NTCL 3WV0A 2AKRB 3CH1A 3QDHA 4XMLH 3WDJA 4XBGA 1T66C 1ZMYA 1YMMD 1MJ8L 4JFOB 5GJTL 1NCAL 1IKFL 3MV8E 1BQHB 4XPFH 1MCCA 4NQCA 5DMKA 2ADJB 3OKLB 1PG7H 4BKLB 3CLEL 1YYML 4XPGH 3ARDC 3OTTA 4ZAKB 3FB5A 1PKQE 2FX8L 5E5RB 5B39B 1MHHB 1S7WB 4Z77B 1D5MB 3TBVA 4UDTB 2AXGA 3PABB 2E3VA 2NXYB 4LVOC 3WO3B 2UY7A 4QRSA 4AIXA 2UV3A 1LNUA 3W9EA 1RZ7H 1UJTA 4YPGA 3HNVL 1P7KB 1JIBA 5GS0L 4G43A 4HFUL 2DJ4A 4MDIA 1ZTXH 1LEIB 4GMSL 4PJDA 4CADA 4QY8A 2WIIA 3JWOL 3L3IB 2J8UF 3QIUD 1WFOA 3PWNB 2IH3B 5JXEC 3RZCD 2WW8A 4BZ2L 3QIBA 3MRMA 2JELL 5HJ3B 4IOFD 4M1DL 4XH2A 4NRYB 2B7DT 1EERB 2XY1A 5KSBE 1DQJB 5D96C 4Z7UF 1U3ZA 5IR1A 2DL2A 3GMRB 1ND0A 3QQ3B 4U6XB 4M7KH 1CQKA 1U8HA 5DZOA 1AXIB 5EIIB 1FPTH 1PAMA 5CFHA 2BVYA 4PJAF 1F11B 5E5UB 3SPVA 1HHHA 5BVPL 1WTLA 5E00A 2MWCA 1CDBA 2D7PA 1Q0XL 5BRZE 4JM2A 4ZPVA 2M26A 1ORSA 2WBJC 4LOUD 4L9DA 3UTQA 1ZWIA 3P4OA 2GSIA 4TRPL 3H9SB 1A6UL 4FQJL 1MCFA 4HUKB 4OF3A 2P1YA 3MLVL 2FX7L 5DD1L 4HAFA 5T1KB 4XWGL 1T03H 1INQA 4XC3H 5DS8B 1HSBB 1WWBX 3JVGC 5EULV 3BI9X 3QULA 3V6OC 4APQB 5LQBL 2CKBB 1IGMH 1T21A 3VXSA 5KANI 5MEQB 1NMCB 2CIKA 1Y18A 1MFNA 1YN6B 4MAYA 4HBCL 2WLYA 5FM8A 3NIGF 3CK0L 4F57L 1AGDA 2UZIL 3WCYA 3T0EB 3VCLA 3X12A 1OLLA 3QAZB 1OAUH 1ITBB 5DZNA 1QOKA 4HPOH 4RGNE 4NP4H 2X89A 5F96H 3D85A 3WNKA 2ARJB 4MX7A 4XCEA 1F6FB 4UZGA 4FQXA 5DHVB 3GUTB 5IGXL 4OZHB 1NBVL 1T04A 5DUBB 4XVSL 4LVHB 1EJ6A 1BD2E 4OGXH 2Y5TA 5D6DC 1UFUA 2ITCB 1U8PB 1YMMA 3TVMD 4H26B 3QUMA 1YUHB 1IQWH 4NC1C 4BH7A 2A77H 2F19L 5FKAB 2OQJA 5LJYH 2AJ3A 4M4PA 5ACMA 3HZVA 3UCRA 4XNQB 5DJ6A 3D25A 4G7YH 2VH5H 1ES0B 1MPAH 4XNUL 2HYMA 4YHIB 1NQBA 3HC0B 5EU5A 5A2IH 5GGUB 4RQQA 4JFDD 4RZCA 3DX9B 1XGUB 5KSVB 4JPKH 4MXVF 5I8KL 2VDRH 3MJ9L 3MV01 3VDCA 3C6SA 1RJCA 1RUKH 3PWVA 1A9EB 3MRLA 4G80A 1U8IA 3FB7B 3HAEA 4CVWA 4P3DB 3AAZA 3GJFH 2NR6C 4OF8A 3RWEA 2R9HC 1CI5A 3QIUA 1QBLH 1OSZA 2O5XH 3ETBF 4FQ2H 1ZSDA 3E6HB 4JAMB 1G7HA 4KKCC 1CXIA 4YDIH 4M3KB 3RWIA 3AY4C 3K8LA 3RVTD 4IRJC 3STZB 3F12A 3WNLA 4PLOB 3PWUA 1LEGA 4GRWH 3MO1B 5F3HA 4GG6A 5J56B 2OTUA 1QKZH 3OZ9H 3RGVD 1W72B 2DF3A 2IH1B 3UZEA 3SDXF 1UJ3C 1K5NA 2C4FU 4CGTA 1QR1B 5D7IB 1MHPH 3QB7C 3UMTA 1NMAL 3H9SE 4Q0XL 5EFIA 2AJVL 3V4PH 5C2UB 4M7JL 1TZHB 1C12B 4Y5VA 1R0AL 4H1LA 4RBPK 2YA1A 3ZKXB 1MHCA 1I7ZB 4PRPB 2EKSB 4XX1E 1CICB 2Y6SD 5D93C 3I2CH 4MYWB 3OKEA 4R2GB 5ECJE 3WJLA 1H5BC 3KJ4B 3MBXH 4K3HA 4JFYB 2MPAL 4KKNA 4QCIB 3RWCA 4LCWA 3T0EE 4OV6F 4Z76B 2Y07H 1U8KA 2VXUH 4OLWH 4G3YH 1YPZA 4TUOB 3ZYOA 4JY5L 1UACH 5BS0E 3UTTA 4QHUB 1R3JA 1F4HA 4FZ8H 1F3JA 3TYFA 1BVLB 2ZSWA 4XCCH 4HKBA 3W0WB 3CNKA 5FGCB 1U95A 4OZHE 1AKJD 1J9CT 3CZJA 1XR9A 3ZDXF 4F2MA 4U6TA 2D7TH 1DVFA 4K55A 4PJDF 2J4WL 4TUJB 5E8PA 3RU8L 1QSZA 1T22A 4NUJB 4G5ZL 3WUZA 5I18L 1CQYA 3E6FB 1WJ3A 4HUWA 4D0BB 5D1QC 2YUZA 3BPOC 3JTTB 3D9AL 2P5WB 3G6DL 1QSFD 5F7FA 1EAPB 2FEEL 3NABH 2VXTL 3GJEB 1GHFL 2DMKA 2P5ED 4Y19B 1DANT 3B83A 1WBYB 3VXTA 2NY7H 2JJSC 3BH8B 5F9WC 1LVEA 4JM4L 4M5YH 1KV3A 4GRMA 2H32H 3ARQA 4PGEB 5IMKA 2ZKHH 4HKZB 1FBIH 3RAJH 1MLBB 1RZJH 4LNRB 1DBJL 3MLUH 3SKJL 3F6LA 1A1NB 1OQOA 3TN0C 2PTVA 2YKLH 1J8KA 4JM2F 1T1WB 3O6LH 2RQ8A 3K4AA 5L2KE 4UU9A 3NIDE 3S88H 1VFMA 2UZYB 5TDOB 4JRWA 1JBJA 4XVTH 2WUCL 4QHLA 3FOMA 3L7FA 2OZ4A 1I7RB 1A1OB 1EJOH 4Y1AD 2FJGB 4JDZA 2WAHA 3KLDA 5JO5B 4PJ8A 4ZMAT 1GOHA 3PWJA 5D7IE 4JO4H 4MXQC 1A2YA 2FO4B 4URTB 1JF1B 5I75C 4I0PC 1S7XA 3MJGX 4Y4HD 1TVBA 1N64H 5J13C 4JO2L 4LSTL 2OL3L 2YPLB 1CDIA 2V2WB 2ZSVB 4NQDB 4HIIB 1TCRB 1C1EH 3RGVA 3VFOB 2H3NA 2F53D 2ZCLH 2IFFH 3SQOL 1I4FA 5JHDB 2B1AL 4PRPE 4D0DA 4JFFB 2NY2B 3RX7A 5KW9H 3JV4A 4M48L 4EDXB 4KTDL 2XN9D 2APXA 4ODWB 4HIHB 3FQTB 1SYVB 5T3ZH 1FZOA 2JIXB 1F6AA 2D9CA 1AO7B 1X7QB 2FB4H 1OP5K 5LCVL 3OL2A 1SHMA 4YHML 5D4QA 1EH9A 5IB5B 4R4FL 1WK0A 3RNQB 4HS6A 1JHLH 1RI8A 2I9TA 3DUUA 2VXVH 2VOTA 4X4MA 4KC3B 3G08B 1JJUA 4JFQA 5I15L 2Z4QA 1IGTB 3W0WE 2Q6WB 5FGCE 1T7VA 4PRNA 2K7QA 3LEVH 3L7EB 3V0VB 1A3LL 5A2KH 1P6AB 1EO8H 3VRLF 1QFUH 1DLFH 3CFCH 1GC1H 3RWGA 4A6YA 4WW1B 2P5WE 3R1GH 3ZDZF 4JPIA 1GGIH 4AQOA 1NSNL 3W11D 3L5WB 1IEAA 4Y19E 5AD0B 5CMAB 1MEXL 3HTLX 4KY1L 4XWOD 1RJYB 5F97E 1G0YR 3U9UA 1SY6A 5EBWA 6FABL 1HZHL 1B0RB 2EDWA 1QSFA 4Y4KC 1Q72L 1JNLH 3TNMB 4FQIL 4PP2B 4PG2A 3LN4B 3FB6A 3IFPA 4R3SB 4XP4H 4EOWH 2OTPA 2X4TB 3AS1A 5LXGL 3C2AL 4UQ2A 1RZFL 3PL6D 4KKBC 2ZCKH 4GAYB 4PP1C 1AFVH 4NWUL 32C2A 3L95A 3U36A 4OJFH 4KHXL 1MAJA 3GSNL 4XB8A 4BZYA 5I1CH 2AABH 3BZEB 5CJOH 4KQ4H 4J3UA 5T3XD 15C8H 4MNGB 1O7VA 4L8DA 3LVEA 4KJPC 4WTWA 3MRIB 2P44B 1SQ2N 2X40A 3L3KA 1JCKA 3OKNB 2YPLE 5EO1A 2J88H 4PG9B 4NQDE 5FOBA 4Y1AA 1UEMA 4EI5B 1YECL 1RHFA 4LPCA 3VMPA 5GS1A 1YY9C 1ED3B 2CUMA 3EGSA 1D9KC 1WAAE 2ID5A 4RMRA 1YPZF 1EGJH 4A2LA 2GHWB 2DQFA 1KPVB 5CP3H 4AM0B 3OHXA 4TSCH 2YPKB 4XNXL 3ARPA 1JWUB 1AO7E 3FN0L 5IB3B 2ZG2A 1BWMA 1NC4B 3FB8B 4KKAC 3LRHA 2J5LC 3QUYC 3PQYB 4X80L 2LV4A 3MGTB 5CEYB 3H7LA 4OM0H 2XN9A 4QHKI 4WHYH 1A5FH 2J6EA 3WJLC 1F4AA 3JV0A 4JQXC 1HKFA 1KSRA 4AH2B 4ONGL 5BVJB 3NCJL 2NTFB 2M2DA 4H8WL 5GIRA 3F6IA 1LP9A 4O2CA 1TJIH 3DTXA 3UAJC 3GSQB 4PJGA 4ZYKA 3UJTH 5BV7H 3IAQA 2AS5M 2IC2A 4BUGA 1WCBA 2LE9A 4RAUA 1RUAL 4XAKE 2RCSL 4BH8A 3A67L 3FCTB 2IMNA 1QLEL 4NNPH 4U7MA 2O61A 2AERT 4LSVH 1JNNL 4F7PA 4M9OA 1GXEA 4PLJC 3VFSB 4DKFH 1K85A 2PETA 3SDDC 4JN1L 2YHGA 1V8HA 1X5KA 2FH6A 4JFOA 1MVUB 2CJUH 4M8QB 2DI7A 3PV7A 5KVFL 3F7YB 1BQHA 3LDBB 4K94L 5FYKE 1MOEA 2ESVB 5GRWA 3O8XC 2X05A 4G7VH 3KNBB 3OKLA 3U2SA 2EIDA 4DZ8B 2HMIC 1CE1H 1X4ZA 3QQ4A 4HFWB 2BCKB 4RCAA 5GGRB 3QT2A 5E8DL 1Z9LA 4GKZA 4E42B 1QO3B 1PD6A 2V5SA 3T3ME 3MCLL 5B39A 5JOPE 4ODTL 4C54A 1MHHA 1S7WA 1D5MA 1FN4A 4N0FB 3PABA 1Z2KA 4PJEE 1T0NB 4R0LB 2XRAH 4PB0H 3C5ZD 5BW7A 1P7KA 1MLCB 1LEIA 4OT1L 1ZGLM 4MNGE 2R69H 3TM6A 1UH3A 2FX9L 3L3IA 1BOYA 3PWNA 3OR6B 2XOTA 4LLWB 4Y7MA 5DEGB 1MQ8A 3MRDB 3GM0A 5C7XL 3IVKB 1PYWB 3O3EA 1DQJA 2UUDH 3IXAA 4LMQE 3ZT7A 2XTJB 4F7TB 1MFCL 1RAMA 2YMXH 1I9JH 4PJ8C 3IS0X 2DLFH 2I07A 4P5TC 3TA3D 4XP6L 1SY6L 2VWEC 1E28B 1DBBH 3X3FL 1CDJA 2WINB 1IGJB 3LN5A 1Q9WA 3N1MC 1IC7L 4FQQB 3O6MH 4QTIH 1T5WA 4OBRA 4QRTB 5FO8B 4RMSA 3OGOE 5IFAL 4YHZH 1A14H 3VXNB 2X9YA 4XI5D 1DQML 3KPOA 3QEGH 1CICD 5FCSH 5TGBB 1FVCB 4B41A 4R2GD 2HT2D 4X6EB 3UBXB 5EC2A 4JRYD 2DQJL 5T1KA 2ILLA 1GH7A 2VZUA 1Z5LA 2D0HA 3BGFB 1V7ML 2OL3B 2DDQL 1RIHH 1KBGH 1U8NA 1AGBB 4XXCA 1IL1B 4S0TD 4APQA 5FECB 1JMZA 3ZO0A 2I27N 5MEQA 1I8KB 4O51B 1A7RH 4YXLH 4XCNB 1KIUA 3I6KB 3GKWL 5KBNC 5L8JB 4KFZC 4XBPA 3WXWL 3O2VH 3TWCL 3T0EA 4NIKB 3MLWL 2KUTA 5KVGL 3HR5A 3I9GH 4GW1B 4HUUB 3BJ91 4AIZB 1MQKL 2R4RL 2FATH 3K4ZA 5BMFL 2GW5A 2F74B 1MIML 2ESVE 4EKXA 4PUBH 5HYSB 3GUTA 3GSWB 3O6KL 2WWMD 4XMKL 3V5KB 5DEFA 1KPUA 2H8PB 3M1BB 1LEKB 5DUBA 3QCUL 4S11A 2NY0B 1WBXB 5DZLA 2OJZL 5E2JA 3BGAA 2AK4B 5F72S 4LSSH 5ADPH 3BAEL 4H26A 1YUHA 4LQ1A 3D87B 3REVB 5FKAA 1AGFA 2DI9A 3ALPA 3EO1A 1J0ZA 1NAML 1KJ3H 1YN7B 3I75B 4LP5A 4XNQA 3D0VB 2EDNA 3LSOA 4JDTL 3QXDB 2DQIH 4Y2DC 3FAWA 1QA9B 3QUXD 4YHYC 3DX9A 2VLLB 4NJ9L 4NFCA 5KSVA 1YEFL 3MMEB 3CLFL 4JKLA 4JZJB 4NM4H 2F8OA 3GJFA 3UXFA 5I1HH 1ERNA 3C5ZA 3QG7H 3QHZH 4MMZC 4UV7H 4X99A 2XTJE 1UH4A 4NO5A 1Q1JH 4FOMA 1T89C 4P3DA 4NN7C 3EW3B 5L7XH 4OF6A 1MJ7L 1LGVA 4NKQB 1DUZB 1LMKA 3E6HA 1N8ZA 1R3IL 4JAMA 4R7NA 3KPRD 4MA7L 2F8XC 3STZA 1NFDB 2Y4SA 3DWTA 5DXWA 4Y89A 4M3JA 2Z8SA 3CAFA 3T08A 3TA3A 4HHAB 3OAYK 3BKMH 1P4BL 1WEJL 2WM0A 2IH1A 3F65A 1ZEAH 1LP9F 2R56H 4NUGL 2QQKL 2UZXB 4Z7NE 4PJGF 5T3ZD 1ZTXL 4JFFD 2IQAB 1I1RA 3QCTH 4I5BB 3GSNB 1HN1A 5HHOD 3MRQB 3IFNL 4P2RD 3KJ6H 4YUEH 4ZUTB 5IV2A 3IDYC 5JPNA 1TZHA 4QRRB 5A3ID 5IBUB 1KCLA 1A6PA 5HVHC 4TVSa 1L9MA 3TFKC 1I7ZA 1AGEB 2EKSA 2WP3T 2GJZA 1CICA 4WWID 2RBLA 4L9LB 4X98B 4LKXB 1IKNA 2HTLD 1JZ6A 2C7UB 1JNJA 3F7VB 3MRRA 3EO9L 5C07B 5T3XL 4QCIA 1OL0A 1IC5H 5KG9B 4P23D 1JZ4A 3ARED 1V7NL 5MI0B 5ESVB 2FJFB 3GIVB 4IRSD 4CW1B 3O4LD 4GBXB 5FIEA 4Y5XB 1HINH 1RY7B 2BMKB 3HI1A 1K3IA 3HAEG 4LSPL 4FQHB 1Q9KB 4HLZG 4Z95L 4DCQB 4QF1A 5F3BB 4X4XB 2QSVA 1BQSA 5DD5H 2FNBA 1CE6B 2DMCA 5F93C 2D2OA 4TUJA 3BW9A 4RGNC 1NCBL 4TVPH 3S34L 4DKDC 3JTTA 4MHHI 2ZOLB 4N1CA 3V6ZB 2H1PH 1EAPA 4OIIL 1JUFA 3GJEA 1NCDL 2H32A 4MB5A 5IP4A 5C3TA 1NDMA 1DBMH 2GUOB 3IRPX 4I3SH 4OFYD 1JPSH 1TVDA 3A6BL 1WC7B 2DWEB 5DQDH 5TE4L 4HGWB 1XZ0B 1C08A 1CD1B 4DTGH 4ZAKC 1CT8A 3U7YH 4G6MH 4HKZA 3TZVD 1RK1B 2EO9A 4EN3C 1T7WA 2E7MA 2NXYC 4J1UB 1BGXH 3FQXB 4NP4L 4LNRA 3C60D 4HC1L 3V6FB 4Z8FL 1CDYA 4KZDL 1A1NA 5MEOB 5HHXH 3AMKA 3N9GH 4D9RE 5HI4D 2HRLA 1T1WA 4XTRC 3P4MB 5JA9A 3VGAB 1OTTC 2AJSL 2BSED 3QUZB 1TCMA 2HVJA 4PY7A 2OP4L 4KVNL 5TDOA 1NFDE 4XPHL 3EYUH 1YEGH 2Q87A 3S36H 1I7RA 5I73B 1YNKL 1A1OA 1BJMA 3D2UD 4KMTH 3U9PH 2NXZB 1FFNB 4EUPH 5CZXD 4PV8B 3KPRA 1FL5B 4J2XA 4EXPX 2FO4A 4U1SB 4ZO9A 3N06B 1C5CL 1JF1A 3C09B 4HWEL 3FQUB 1W0VA 3UROR 4HV8B 4QRRE 3K2UH 3SGJC 4F7MA 1MI5B 2V2WA 5AWNL 4JG1H 1TCRA 3VGEA 4L5FH 5KZCB 4JCLA 1TTFA 5JHDA 4U1JB 4JFFA 3Q6FA 1A7BA 5E95B 2MCPH 4NZJA 4EDXA 2GY5A 5HHOA 1HNFA 1YEDA 5E94A 5ITBH 4ODWA 4HIHA 1SYVA 2XWTB 4P2RA 2NY6D 1OP9A 3A0OA 4YDIL 1N26A 3P40A 5MHSD 3MRNA 5JZ7C 3VU2A 2QLVB 2VITA 4OZHF 1R3HB 4Z9KB 5EOCH 3HMWL 4JFDE 1I9IL 1Y0LB 3MACL 4OSUH 4YZFF 4G42B 2FECL 1RJZB 4A2MA 3SE3C 5F8QC 1VESA 2W07A 3G08A 1NMCC 4HIJA 2GT9A 2Z31B 4RMVA 1RQ5A 2Q6WA 3LAFA 2C4FT 3BP7B 1F97A 4LCCA 3AREA 2ED8A 4RA3A 1M7DB 4TVPE 3C8KB 1JGLL 2FD6L 4XPTH 1CBVH 3DLQR 3LQZB 3O4LA 1EXUA 3GK8H 1Q9OA 4XC1L 5C0BD 4WUKL 1PLGH 2XQYK 5E56A 2DYPB 1XGPA 3MV11 1EZVY 1H3UA 2BXZA 3FO1A 5D6CB 1IRAY 3FQNA 4XAWH 4MDJB 4ELMB 1RIVH 4M62H 3L5WA 1ULVA 2C26A 4XNMA 5CMAA 2CD0A 4LVHC 5EU7C 2MQ0A 5IB1B 3NZHH 4HWUA 4NJAH 3VXUD 4LLAA 1B4JH 3CXDH 1SBSL 2Z93B 1ZHNB 1RJYA 3LIZH 4GSDL 2FBJL 2GJJA 2VLKB 1VEMA 4GRWF 1FNSL 3GSRB 1BFOB 5K9QG 5LGHH 3TNMA 3U1SL 3ARFD 1NMBH 4CAGA 3LN4A 2PXYD 4FZ8L 4OFYA 5DHXB 3BHBB 3MR9B 5IG7B 2YWYA 4M1CC 1PFCA 4H0GA 5MP6L 2BFVH 4LEOB 3TZVA 5CUSL 1ONQB 3BUYB 5D7IF 3ILQC 3C60A 4AEFA 4YR6B 1LE5A 4ZOCA 2N56A 4GAYA 3REWB 3T77B 3H42L 5CINL 1D5XA 3T65B 3JUYA 4K7PL 3BZEA 4ORGB 1NAMB 4OZ4A 1JYWA 1ZK9A 3O41B 2YOCA 3R06B 3J8F7 3KLSA 1K4CB 1MI5E 3D2UA 4HMCA 4PG9A 3L6FA 1OPGL 1FH5L 1EGJA 4K3DL 2QKIB 4OGAD 5CP3A 5DVKA 2E6QA 2YKLL 1I9RL 3U46B 5E2VL 5CGYC 1KPVA 2XZAH 5EO9A 3ARGD 4Y0GA 4AM0A 4JHAL 2YPKA 4L4VD 3TGXA 1JWUA 4P3WA 3NIFF 5IB3A 1NC4A 1G9NC 5LBSL 2VISB 3B6SA 3G6JB 3PQYA 1FV1B 3MGTA 5CEYA 2ORBH 3ZKXC 2H2PC 4U1MB 1U42A 1QVOB 2UYLA 2ATPB 1R5IB 3KJ4C 5GHWH 5FA4B 4F58H 1EMTH 1CU4L 4GAJL 4JO4L 4AH2A 4MQ7B 4GUPB 1U0QA 4NC2B 4NCC1 5BVJA 4G8GD 1N64L 2X5PA 1HH6B 3QWOA 5GRUH 4JGJA 3GMQA 3VRJA 3IKCB 2IFFL 1NAKH 3F7PC 4Q2ZB 3MBEC 3SE4C 5SX5K 5FK9A 1PZ5B 4LGPB 4WFFE 1S7QB 1UGNA 4XB7A 3ESVF 5D7KD 3S37X 3SDAB 4ELME 1EVTC 2V5YA 3FZUC 1FORH 3ROOA 5ACLA 2NY4D 3FJTA 1CTNA 3QDJD 3B3IB 1P4IH 2XKSA 4YO0A 4M6OL 1CDHA 2NY0D 2VLKE 4HJGA 4K3GA 1PX4A 1MF2H 4Y4FB 2DLGA 3A6CH 3GHBL 4J23A 5FGSA 2AK4D 4HAGA 5IBTH 4S1QL 4M8QA 3LH2H 4PS4H 3F7YA 5I17B 5ISZD 2YPVH 3KNBA 3Q5YA 2MQCA 3WJJC 4EVNA 4WWKC 3T8XB 4PJXA 5ESQB 2BCKA 3EJZD 5GGRA 3DYPA 1QFUL 2YK1L 5JUEL 1QO3A 3KPMB 1I1FB 5E99L 3DRTA 5FA3B 2GAZA 4P59H 3D5OF 4ERSH 4R0LA 3WUWA 2EO1A 3FHAA 4EQ2A 4CUCA 3L3HB 1VEOA 5IIEB 1MY7A 4P2OD 3ARUA 4KZEH 4FQCL 4OD1L 3EKCA 3O45B 3DX7A 4RGOL 4K23L 5DEGA 1BQLH 1L0YA 1QRND 4YFEA 5IVXB 3DETD 1JK8B 2DQDH 3LQAL 5BZDB 2CIIA 3WD5L 3KAAA 4AG4L 3ZTNH 3ZKSD 1JNLL 2BSSB 2Z92B 3IDGB 4M4RA 4F7TA 1C7TA 4DN3L 4OI7A 3WFEL 4HPYH 3S9DB 3NFSH 4WHTB 1IGJA 5IHZB 5GS0C 3VWJB 4FTVB 3DX8B 2RIKA 3SKNB 4MA8L 2X4QA 4FQQA 4H25A 4OCMC 3JWOC 5C0AD 3ZYJA 5C9KA 3B2UC 3G6JE 5DR5H 3QXWA 1MCHA 1FIGH 2ZCKL 5I19H 1ETZB 1AR1C 4N1EA 5TPWH 5FO8A 1UADC 5ADOH 2NY2C 3VXNA 1NPUA 1NEZA 3OQ3B 1CDCA 2PW1B 3RVVD 4GKNB 4C55A 2Y7QB 2FJHB 3CVHB 4NQXB 4L4VA 1BQHG 2B1HL 1BBDH 1QQDB 4HK0A 5FM5O 1UCBL 4KTEL 3I6LE 4ZXBB 3CVHH 4H5SB 2B5IB 5C07D 3HUJE 4LIQH 3QNYB 4P5KA 3MOAL 1HILA 5DO2C 4K8RH 1D5ZB 2B8OT 4DQOL 1AGBA 1KN2H 1IL1A 4BFIA 1NFIA 4J3VA 3V8OA 5FECA 2D3VA 1TLKA 1GC1C 1I8KA 4O51A 1OW0A 2J12B 4G8GA 4YFLF 5D2LB 1J1OL 1PSKH 2X4SB 2K9UA 4XCNA 1TETH 4K3EH 3AFLA 5HD8D 1IAIH 5HDQH 4LARL 5GZND 5IBLD 2JK5B 1ZAGA 5A16B 4NPYA 4HUUA 2K3TA 4AIZA 2JKXA 2F74A 2JJTA 1INEH 1Q0YH 3LS5L 2H9GB 2F54D 4XCYA 1MFAL 3CX5J 3QDJA 3V5KA 1B88A 4DKEL 4TOYH 2H8PA 3M1BA 2IAMD 4NGHL 1D5BB 1LEKA 4KDTC 1PG7X 2W59A 1M05B 4JY6B 2BVOB 5C3LD 1H0DB 4YEEA 1MNUL 4WJ5A 1SJEB 3ZE0F 2AK4A 1IJ9A 1JGVH 1U8QA 1WISA 2IWGA 4L3ED 2X4NB 4JFXB 4KRPC 1N4XL 5FEBA 1YN7A 1NEUA 5ISZA 4RAHA 4L1HA 1DCLA 2X4OA 3MROB 2DM4A 2E9BA 3I02A 1DE4B 2XWJA 1UXWB 1QA9A 3AS0A 3NBNA 1NCUA 2P4AB 4JFZH 1M71A 1GGCH 5CEZL 3CMOH 3MMEA 4TNVK 5IVXE 1C5BL 5EIQA 5L6YH 1ZLVH 4KK5D 3BXNB 2DQGH 4P9ML 3QRFM 4WU7A 4ZFGH 5B8CB 2YBRA 2R8SH 5IHLB 3VXRB 3KGRA 4P2OA 2I25N 3TYGH 2QHLA 4IIQC 5F7EL 3HA0A 4QHLB 2DTSA 4GXVL 3T09A 4X6CA 5FO7B 4ODXB 4FTVE 3PF2A 1X4YA 4JZOB 3MLZL 4UT6L 2XYCA 4WY7L 1QRNA 3I85A 1X5AA 4NNYB