3IXTA

Crystal structure of motavizumab fab bound to peptide epitope
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
220
structure length
212
Chain Sequence
QVTLRESGPALVKPTQTLTLTCTFSGFSLSTAGMSVGWIRQPPGKALEWLADIWWDDKKHYNPSLKDRLTISKDTSKNQVVLKVTNMDPADTATYYCARDMIFNFYFDVWGQGTTVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of respiratory syncytial virus neutralization by motavizumab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Motavizumab Fab light chain
total genus 38
structure length 212
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ixtA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ixtA01
4NN6C 2AJ3A 3RY5A 4PFEA 3MREB 2NTFA 4M02A 5TDOA 4JPWL 4BFIB 1VADA 3HG1D 3ET9F 4HFUL 1PZ5B 2BHYA 4MWFB 1UM6H 2DTMH 1AGFA 2AEWA 4PJ5A 4OLVH 5L0QC 2C1OB 4FQHA 4S1DC 5E9DE 4UT6L 3ALPA 3QIWD 2WBJC 3MJ8B 5HYFA 3IFNH 5C0BE 1F90H 2WIIA 2ZPKL 1BQHB 3SN6N 2P1YA 1S9YA 3VD5A 3GBNH 1A6ZA 5DTFA 1SJEB 2A9MH 2XZCL 4U1SA 5JO5A 3KXFD 4JHZA 1AGEA 1X5YA 1KYOK 4GBXD 3VFGL 1E27A 1FFPB 3OV6A 1ZA6B 4JEGB 5EPMA 4XMLH 3MLSL 4XMKL 1T2JA 5F93C 4ISVA 5IROC 5D1XC 4JN2B 1PQZA 2FHBA 1TVHA 4JKMA 1NBQA 3SOBL 4OKDA 3VH8G 4KH2A 1RV6X 1JGLH 4F33B 4FNLL 4JY4B 4HPYH 1U2CA 2DLTA 4UNUA 1YEKH 4V2BA 1YY8A 5BS0D 4FMFA 4LLWB 1AXSA 4X7DC 4YH6A 4M1DH 1JN6A 1IAKB 1A5FH 2BFVL 2O26U 5IHZA 1FG9C 1WFOA 5D1ZD 4TTDD 3VD7A 5IMLB 3THMH 4EUPG 1EZVY 3SGEH 1TJHH 5C07A 4UBDC 1L7IL 2GY5A 4KTEH 15C8L 3EYSL 3WN5B 2FWOA 1MUJA 4MXWH 4L8SA 3G6JA 2VAAB 3HZVA 4NHCL 3AXLA 3MQIA 1FNAA 3IDJB 3HE7B 3CC5B 5D2LF 1JNLH 5IEHB 1VERA 5CWSB 3O6FC 3B3IA 3KLHD 5BRZE 3L7EA 5FM5M 3K0WA 2BZDA 1D5BA 1JF6A 4Z9KB 5C08D 4G8IA 1MIMH 3GJFK 1CIDA 5IBTL 1F6AB 4FMKA 4OAWB 3RPIA 5B3JE 4KMQA 4LLYB 4UOJA 3HLAA 1I7ZA 4DZ8A 5E6ID 4ONGH 1UM4L 5IHBA 1ZSDA 4Z7VF 5DR5L 5I0ZA 3C9NA 3NIFE 3ZTJH 1QSFA 5L88H 4PJDF 4ODTL 3DMMD 4XI5C 4N0FA 4PY8I 2VDPH 3PL6D 2AEIT 3GO1L 1N6VA 4OFYD 4BH7A 1CGYA 3F5WA 2OZ4L 1T5XA 2HJLA 3HNSH 1MCKA 2AV7A 4HIIB 5TE6H 3NPSC 1JHKH 1KXQE 1JK8A 3K1DA 3MJ8A 1FVEA 1QLRB 2OR7A 4XCYB 2Z93B 3MLYL 4ZFGH 5KSBA 4N0UE 4QYOA 1XT5A 1MCEA 5IMKB 3V4UL 1K5NB 2UZYB 5DD3H 3EFFB 2A2QT 2B1AL 1PJ9A 4OCXL 1SYSA 4M62H 3FQWB 4PD4K 4RMTA 5F9DC 4YDLB 2CPCA 4RWHA 4Y1AE 4Y19D 3BKML 1DBKH 1J8HE 2WNGA 1LEGA 1FFRA 3BDXA 4NQDB 4QHMB 4LU5L 3QAZB 1NEZB 1KCKA 3DX8B 4HPYL 5AZEH 4KKAD 3SEPA 5ACZA 2CK2A 1QA9B 2NY2B 4KK6C 1WITA 4KI5F 4LDEB 4TUKL 1G9EA 5EOCJ 4TUJA 4UT7H 1FDLH 2IADA 2ZUQC 4HS6B 3L3KB 3FO9B 5DJZA 3ARGA 5TH2A 4BUHA 1HZHH 1D5XA 1X3DA 1RJLA 3LAFA 3VI4F 4KHTH 4PJHE 3BZEB 2JELH 3S36H 3BKJH 4HHAA 4OZHE 5J6GA 5E8OB 1GJIA 3S36X 1MHEA 4X7TB 4KTEL 4NO2A 1XGUA 1OAXH 5CP3A 4RGNB 4NHCH 1X6NA 2I60H 3QUML 5DD5L 4WW1B 2EEAA 4UI2A 4PP1C 2YMXL 2ZUXA 4JR9H 2ARWA 4FG6C 3GFUA 4U1IB 3MLXL 3EKCA 4PRHD 2EDQA 1MIML 1YZZA 5IBTH 3BE1H 3D1MC 3L1OL 5FK9A 3EHBC 1U41A 5CWSA 4KK8C 1RZKH 1DZBA 1U8MA 3C08H 3EYFA 3FB8B 4OGXL 1NANH 5D71H 1L9MA 2NW3B 3VFVA 4V1DB 3ZYJA 2GSGB 4LVOC 3VXNB 1SY6A 5L88L 2J5LC 2VL5B 2ICEA 2XN9B 4KJWC 3LDBB 3TV3H 3C6SA 1DUZA 4Y2DA 1N5YL 1NGQL 2EH8H 4AT6A 2I9TA 1RZGA 3BWUC 1RZ7H 5CLTA 1XR9B 5BV7H 5C71A 4G80B 3GSNL 3MV8E 3BESR 4G6AC 3DUHA 1V3JA 4ELKA 5FYKL 1F2XK 1XGTB 4UV7H 5EUOA 1TNNA 1TZIA 4UINL 4NGHH 4Q0XH 3LB6C 1C5CL 3HI5L 1FG2B 3FT4B 3RFZC 1UXWB 4ODWA 2CUMA 3RPKA 5I6XC 3QDGA 4P9HL 2R1YB 2B1AH 2DWEB 4EZMA 4Z18A 3OQ3B 2XKNB 4WHYG 2VRAA 3BKMH 5EBWA 2JK5B 5JLZB 4K7PX 4LU5H 1K5NA 4XPTH 1OTUC 43CAA 3MFFA 5GGVH 5HYJA 3VXMD 1A1NB 4J4PC 3MOBL 5L2KE 1RHHA 1JRHL 5C08E 1E28A 4MA3B 3R0NA 4NP4H 2DM7A 3MSPA 1GGUA 4I3RL 4ODBD 4P57B 4OSUH 4TN9A 3NFPA 3ILPB 3PNWB 3WS6A 2YK1H 3BAEL 2J3SA 1PKQA 4TVPD 4WI9A 5L8JB 4M43L 4PJHA 2KKQA 25C8L 4ODHL 3PIQA 2CKBA 3PWUB 3CSYB 1M7IA 1WGOA 3QIBA 3D2UA 1BFOA 4QHKJ 4JRXD 5B4MD 3BW9B 3GI9L 4TVPL 3O2DL 4BELD 1UJ3B 3P73A 3O9WD 1CD8A 1UFUA 3M07A 4QRSB 3QEHA 1T4KA 4X80H 4M5YL 2Y06L 3T0XA 4WI3A 1KXVC 5FFLA 3WXWH 4KAQL 5J89A 3FONA 4OLXL 4HULB 2CIKB 1BD2A 4F7TB 2C3HA 4D9LL 4M7JH 4BSVA 3QCTH 4RGND 1YMME 4LCYB 1RZ7L 2D7OA 4AH2A 2ZUWA 4JFED 4F7CB 5FGCE 3GSNH 2BNQD 3GSVA 4HMEA 2ICCA 3V2AR 3DGGA 4NQEE 2IBZY 4LCUB 1A4KA 3BGMB 5JA9A 2RCSH 2Y9RT 5E8EB 5MEPB 4PJIB 1WCBA 5IP4A 3MPCA 2IANA 4I18B 2EYRA 4RMWA 3U0WL 1NC4D 4D9RE 4UQ3A 1C5CH 1FORH 4H0IA 2BJMH 3OL2A 2EDOA 3TM6A 1NBZB 2YBRB 3K8KA 3HE7C 2QEJA 3UAJD 4ZUSA 4GG8B 1GC1H 4LARL 3RY6A 4ENED 2ICWI 2KDGA 3KPSE 2FGWL 1YEJH 5BO1H 3NCJL 4U1JB 4C83B 4YHKH 4BSWA 2CIIB 4DJMA 4DGVL 2AP2A 1J9CT 3LSOA 3LMJH 2EIZB 4FRWA 1A7RH 2NY2D 5B39A 4NP4L 2C3WA 2PW1A 4OSUL 3EO1B 3UBXB 4HJJH 2X7LA 1A1NA 3PP3H 5CJXC 1LD9B 2VQ1A 2YPLD 4HH8A 1MVFA 3CXHJ 5LAXB 1HEZA 3WUZA 2EKSA 3BAEH 1MH5B 2VIRB 4UT9H 1CGSL 1FL6A 2YD8A 3FO2B 4M43H 5DK2B 1U8PB 1B88A 3MACL 5FM4A 4C56B 2Y36L 2BSSB 3DIFA 5FHAL 4CDHA 5EIQA 4H1LG 3U2SA 1F58L 1JPFB 3DURB 1AHWA 1AXTL 3MRFB 2YD2A 4NNPL 5E1HB 3HC4H 1UYWH 4LVEA 5SWSB 4AG4L 5INDB 4X98A 1DANU 1UJ3A 1MCQA 3OAUH 4LEXL 3OKYA 4XX1G 5ANME 5DWUL 2OP4L 3GNML 3IDNA 4LCWE 3VFNB 1AD9B 1JGUL 1T7WA 4M7JL 4U6YB 4XBPB 3TIEB 5HI5C 5CEYA 2YN3A 3RVTD 3B5TA 2FJGA 3LKOA 2WM0A 1XF5A 2XWBB 5D96C 3TA3D 3JBG7 3ARQA 3RDTC 3S5LA 4P23A 3WFCH 2NNAB 2RIKA 3HR6A 5JORB 2XACC 1INQB 3BZFB 5FGBA 3MBEB 4QEGA 2F9BT 4J3VA 1CDUA 9CGTA 3MX0A 1BP3B 5HD8C 2AJXH 3DUUA 3T4YB 1WAAF 1LO2L 4GKSA 5K9OA 3IF1B 5EUKA 2R2BB 3T04D 5GRWA 1O0VA 1C7TA 4LGSB 4EOWL 4O02H 2P47B 4V1DE 4YHKL 3C60A 4DGVH 1WQVT 1EEYB 1IGYB 4GH7B 5FYJU 3EYVA 2FGZA 3OKDB 2CUHA 2GW5A 2B0SH 3IAQA 5C09E 4D9QD 4X99A 3MA7A 3ETBF 4GO6B 2OXHA 4NJ9H 1QOKA 1AGFB 1FVCB 5TGBB 1MCWM 1U8OB 3TCLA 5CINH 4QKXB 4JFZL 1RZKC 3UTSE 3EDKA 4OLWL 1RUKL 2UVEA 1ED3B 5I8CA 4H88H 5T1MB 1YMMD 2EDFA 4JY6A 4A6YL 4JY4A 3MCLL 5KSBB 3QDMA 1XH3A 3TNNA 5A16B 3QULA 3K4DA 4MJID 2CDEA 2AJYL 5IMKA 2VIRA 3W9EB 4UDTA 1IGJB 2EYSB 12E8L 2CO6B 4IRJC 3WIFA 1V7ML 1IAKA 1AXTH 1UG9A 1VSCA 2AI0L 4XNZB 5C0BD 5C6WH 1GVIA 5ILTL 1NGPH 3IS1X 4AG4H 1K2DA 2JB5L 3IJYA 4X9GA 3LZFL 3W0WE 3FOLA 4O2EA 4X9IA 5F8QC 4D0BA 3U2SB 4RDQG 2MNUA 1IEAA 1SMAA 3PP4H 3X3GL 3QDJB 5LGHL 3ULVD 1MFAH 1U42A 4JB9H 3WEXB 8FABB 3DVGB 2E9IA 4Y4KD 4JM2B 2NY5C 4HIXH 1P7KA 4R0LC 5C0JA 1FC1A 1H0DA 2P7TA 4X98B 4W4OA 4MJ2A 2E8YA 1ZANH 4S1RL 1CICD 2BSRB 3JV6A 3PDOA 4E0RB 1ZK9A 3TN0D 2X4PB 3L7EB 1S9VA 4Y1AA 5K9QI 4HHAB 5J6GB 1KEML 4HGKC 5IGXL 4JPKL 2NY1D 1TCRA 1KEGH 1CFVL 3Q5OA 2DM2A 1AQKL 3RWDA 4N5ED 1KF9B 3NA9H 2GYSA 4M8QA 5EC1B 5CIPB 1XF5B 2XWBA 3WJJC 1LEIB 3MA9H 1Z9MA 4UB0L 2W65B 4LCIH 1S8DB 3BD3A 4FOMA 2J8HA 1CU4L 3HZVB 3GJEB 1LO2H 5I75B 3CK0H 1PG7H 3RNKB 3ROLB 3SGDI 1AGCB 3BH8A 3QEQA 3AAZB 2G60L 1HWHB 3OXSB 4CJ0A 2AK4D 4KJWD 4OZHA 4CVXB 1IE5A 1MCPL 5ECJE 2PW2B 3G6DL 3HMXL 4CN6A 1N7MH 3BXNA 4QCIA 4Z76B 3Q2CA 4M8VA 2Z35A 5I8OL 4XNXL 2FIKB 4YHZH 2FO4B 4K3HA 4XCEB 3PP3K 2CR6A 2JCCF 3HHRB 2AJZB 1JNNH 3MO1B 5LGKA 3V79C 1QSFB 5I9QC 1FQ9C 1UWEL 1AQDB 4YO0B 1RZGB 2WZPD 1ZLSH 2ENSA 4CAGA 4O5LL 2MFNA 3ARYA 3QFDB 5FV2A 3IFPA 3NN8B 3GSNB 2QQNL 3LPGA 2F53D 3T2NH 3H9SB 1KPVB 5FF6B 3PHQB 3RJQB 4Q9CA 4LIQL 1W0VA 1RZJC 3HAEH 1T22B 3BPOB 3EDFA 3QUZA 5DEFA 1NL0H 3QUXC 4NUJB 2AJYH 2DBJA 4LEOB 2VDLH 2DDQH 3ARBA 3WNLA 2ARJQ 4HAGA 3K46A 1ED3A 3T09A 3V5KB 12E8H 1YJDL 2XT1B 3CGTA 5DSCA 4ZQKB 3W9DA 2X4QB 1J5OL 4LP5A 2FJFB 5ISZD 5ILTH 5JA8B 3L3OA 4L29A 1A4JA 2FNBA 1ZXQA 3BSZH 1J1PL 2DQUH 2NZ9C 3Q48A 4YFDB 3GMMA 3QUMB 2YRPA 1WZLA 5DHVB 4Z95H 2BNQB 4LLUB 3L3DB 3ZLQC 4I13B 5DD6A 2IFFH 3FO9A 5DJZB 1IC5L 1G1CA 5KVDL 5H2BA 1N3NA 4JPKH 1KEGL 3BPCA 4YXLL 2PCPB 2XPGB 1UJTA 1RZFL 4OI9A 4Y16D 1YEIH 1IBGH 4MZ2A 5SWZE 5FYJE 1DBMH 4EDWL 2XIDA 3KYAA 5J6HA 1NLBL 3BD5A 3C2AH 2HMID 1K8IB 4YR6B 3FZUC 3AREA 1NFKA 5HY9B 5F6HJ 5C0AA 2AJVH 3QEHB 4NWUH 3HMXH 1FNSH 3OHXA 1ZLUH 2H32A 5KSVA 1ODAA 3IETB 2MKWA 5E6IC 3F6LA 4EI5D 2K7PA 1P53A 4I0PD 1CDYA 3QEQB 4L3CB 1E6JH 2MPAL 5I1GH 5EDXA 4BSVB 4JANA 1CBVL 3VXNA 3DOSA 4OCLC 2H26B 4LSQL 4YDVA 4C57C 5FV1L 2Z35B 3S5LG 4P4RB 3WLWD 3B9EA 3EO9L 1JF1B 2QKIB 1MJJB 4WFED 2I25N 1YMMA 2QQNH 4KJPC 1MPAH 4XTRC 4AEFA 3RL1B 1WK0A 5IWLC 4QOKB 5F71A 3VW3H 3WHE1 4PRPA 1C16B 1KTDB 4P4KA 2P8LA 4MQ7B 4MJ6B 1ZAGA 2EDLA 5D5ME 3OTTA 4JFQA 4JKPH 5I30H 2YUWA 3MUGB 2MCPH 1ZT4B 2PNDA 2VDOH 2ZCHL 5DEFB 3SDDB 4F3FA 4G5ZL 1KXTB 1ZHBB 5C0FB 1G7LA 1X9QA 1QNZH 5J1AA 4JQIL 2HAZA 3BSZL 4M4PA 1GGCL 3GBMH 5DVKA 5EBWB 2X9YA 2ZNXA 5LXGH 1W8OA 4PJ8A 1HNGA 1KJMA 1UZ8B 5CBAB 1D5MA 1F3JA 4K94C 4ESKA 1XF1A 3AS3A 1T0PB 3TBYA 4Y4KA 3T1FB 4PJEE 5FYLE 2IFFL 3ULUD 1I9IH 4O9HH 4UILL 3IU4L 1HEZB 1R5WA 4R7NB 4WWKB 3CVHL 1FFOA 3GMMB 3SY0A 5T3XD 5KVFL 1CGTA 2DIJA 1UWXK 1RURL 3HAEA 4HS3A 1QFUL 4LLUA 4JHAH 3N9GH 3DYPA 1YEEL 4TPRL 1KN4L 3ARTA 3BMWA 3RNQB 1CGWA 3L3JA 3GEWB 2BMKB 2VZSA 5HGDA 3HE6D 4DAGL 4KROB 2XPGA 4Q97A 1G7QA 3OJVC 4HQQL 4JZOA 3MRHB 4NQUA 5DQ9A 3F7RA 2X4TA 4RFOH 3QAZC 1FNSL 1SBBA 4IDJH 5D7IF 1W0WB 4KK8D 2QL1A 4QHUB 4A2LA 1QR1A 3ZDYF 1YYLL 4IMLB 5JIPA 1LO5A 4EDXB 1D6VL 4N0UA 4ONFL 1UB5B 3U46B 2EYRB 5DRNA 3BP4A 4FQXB 1ITCA 5FOBB 1CBVH 2C7UB 4R7DB 4ALAH 4WV1C 3EO9H 5SWQB 3KNBA 5GS0D 5DC0A 1HYSC 1G0YR 4AH2B 3HPLB 4DKFH 4PRIB 2IWGA 1TMCB 4HIHB 1JIBA 4PJBF 1HXMB 3ZSSA 2F15A 3U0TA 2GTZA 4PRHB 3MRMB 4YE4L 4KKBD 5IB2A 1FYTD 4PJIA 3I2CH 4X4ZA 2A77L 1WVZA 5IM7A 4OBRA 1BBDH 1TVBA 3QO0A 1QSEB 2OK0L 4WI2A 2Q76A 3VRLF 4V1DD 1T80A 4HWBL 3T8XA 3V5HA 5CJ5A 1IAIH 4P4KB 4LASH 5JHDB 4JQIH 1K3IA 5AUMB 4PTUA 5H8DA 3U0PB 5GGTH 2OR9L 1WT5C 3T0EC 1A7PL 1U8HA 1O7SA 4ZUWB 4FFVD 1RJZB 3H9HA 4KHXL 2C3GA 2DI7A 4P46A 5LGJA 5IB4A 3LN4A 5AAWA 3S3JA 3PGDA 1FFQA 3Q3GB 4GMSH 5FA4A 4NNYA 5ESAA 3IB4A 3SE8L 2UYLB 1MLCB 2UZXB 1P7HL 4HIJB 3VXOA 3D18B 4WI4A 1A64A 1CDGA 3F6IA 4XBEL 4JHAL 4R3SA 3GJFH 1Q0XH 4G8GB 3WJLA 1YY8B 3GIVA 3SY0B 4HGMA 3NH7H 4PJBA 4NRXA 4WEBH 4G6JH 1XEDA 1LILA 4S1QH 4Y5VA 2COQA 4RWYL 1J87A 4AY0A 4GXUN 4M6AA 2BNRA 4A2MA 5MEQB 1I9RH 3MLWH 3RWHB 2V2XA 1CL7I 3QI9D 1EK3A 3JWOH 3RRQA 5E6IB 5T3ZD 3IKKA 4U1MA 3S5LB 2VXTL 5FKAB 4D0BB 4EIZC 3MV7E 1LE5A 3SGJC 3U6RB 1KENH 4W81A 4OZFH 1INEH 5EC2A 3B9DA 4H0GA 3SDDC 3BZ4B 3VE0A 3GMOB 4LNRB 3QZWB 3WLBA 5AG9A 2J88L 3PJSA 5I1KH 3RBSA 2A0LD 1YNKL 2X4PA 4WHTA 1MCOL 2WW8A 3QJHB 3VXTB 3QWRA 2ARJA 2R2BA 4PREB 4LQ1A 5E5RB 3MLZH 1XR8A 4OLUH 5AYUH 3TYFA 1ZSDB 4YE4H 4ZOCA 5B38B 4NO0A 2OS7A 2RJMA 4FTVB 3OJMB 2IFGA 5JMOC 1QFPA 3AM8A 1BBDL 3ZL4H 5B8CB 1ZGLM 2OK0H 3O45B 2AKRB 2NY1B 4R90H 1JZ8A 3QHZL 2VXQL 3WKML 1AD0B 3MROB 1T04B 1VEOA 2WUBL 4MA1B 3OR6B 4ODXA 3S3PA 4JFEB 1CT8B 5E2JA 3JWOC 2ITDB 4OGAC 4OM0H 2HH0H 2HRPH 4HV8B 1NSNL 5CGYC 1FNEB 4J4PD 1QSVA 3L5XH 4EN3C 1UWXH 3PGCA 1NLDH 4IRJD 4TVSa 4GRWB 4XP4H 2D03H 5DK0A 2YRLA 3ILQC 5D93C 1IT9H 4HW6A 3I02A 3VFOA 5M95B 2XWTB 1AHWC 5DS8B 1T1ZB 5IVXE 3BPLC 1YYMH 3B9KA 1IAOA 3H3PL 1U8IA 4L5FL 3QO1A 4OD2A 1T89C 4WHCA 1A22B 1NMAH 4U31A 3TWCL 5DUBA 1AFVL 3QI9A 3JWNC 3RWGA 1V3KA 3TO2A 3EOTH 3IKCB 1I9RL 3MLWL 2VXVL 1IGIL 2JJUA 1RUAL 5I1DA 4LFHD 4R2GB 5D1QB 1HHJA 5KSUA 1UT9A 2VOTA 4OIAA 4MA7L 1ZS8A 3QRGH 4YHNA 4ZUTA 3FRPA 1Y18A 4FFYL 4NKDB 5DJ2B 4YHYC 1WBYB 4UTAL 5E5MB 3STLB 4EN3D 1MAMH 4AMKH 4EUPB 2PTTA 4J3OC 4AEIH 1KLUB 1PBYA 1ONQA 5IMLA 5J7CC 1FCGA 2EDEA 4HGWA 2IH3A 2R0KH 5I8EA 1ZEAH 3VU2A 4PV8B 5TPWH 5DMGC 4QRPA 5CEZD 4NSKB 3EZ8A 3M8OL 1X4ZA 1DVFA 2AXJA 5AYUL 4WO4C 3UXFA 3C09C 2L7JA 5MENB 1E6OH 2IG2L 3VXSD 1IC4L 3A0OA 4RQQA 1F4WL 3EFDL 4Z76A 2ORBL 1JYXA 2LFGA 1YN6B 3TBWA 3QG6B 1EBAA 4F57H 1H3VA 4JPWH 1OTSC 1DN2A 5TDNA 4K3EH 2WUCH 4X5XB 1S5HB 3O8XC 5IVNA 2DYPA 1AQDA 2F74B 3QPQC 1MAJA 4LRNL 4YO0A 5KSAD 4N0YL 3RNKA 3ROLA 3ARRA 4XPBL 1XGTA 3OHXB 1VCAA 1F90L 2ZPKH 3QZWG 4ZDHA 1BX2B 3E3QC 2HH0L 1KB5H 5C3LD 5FF6A 2VLJA 4KK9C 4KQ4L 1IM3A 1D3CA 4JANB 2DWEA 4FQXC 4RGMB 2UVFA 5L2KB 4IIQC 1V5JA 2DS4A 3SBWC 1JK8B 3N1FC 2FL5A 2Z92A 5CGMA 3BP5A 4W70A 1GOFA 1S9WB 1MF2H 2VXUH 1VDGA 1BZ9B 2R0WH 3PQYD 4HCRH 1MREL 5HGBB 2WWKO 1UENA 3O81A 1E27B 2IAMD 5HYJB 4JO3L 4OI8A 2WBWB 4PJFF 4LCCB 4I1NB 3MYJA 1CLZL 2X1OA 3S98A 4R26H 2N1KA 3HN3A 5FECA 1AFVH 3EO0B 3O3AA 4ZOBA 4S0SD 5DJCA 3G5VA 5IUSA 5C7XH 4NDMB 1EAJA 3EJZD 4R0LA 1LO0H 1IKNA 1EX0A 3MV01 4OD2B 2B20A 1VFBA 4MDJB 4ODUB 4RAUA 1A5FL 3MRLA 3TA3B 2UUDK 3K7UA 1N3NB 1RIUH 1D7FA 1TJHL 1FGVL 1D5XB 1I8LA 3D2UB 2EEDA 5AZ2L 5D7JA 3VDBA 2XYCA 4LSUH 4IOIB 2HWZL 2APXA 1JPST 5D7KE 3OGCA 1BFVL 2NXZD 3HS0B 3PUCA 4TNVF 1EGJL 5HHOE 5J3HC 3QB7C 4JFFE 1KGCE 3KPRA 3IGAB 3LIZH 4JO2H 3UZVB 5C3TA 5T1KA 4RAHA 5DJ6B 3MLVH 3FOMB 3DMMC 3U1SL 3VRJB 3SE4A 3SDXB 3GGWB 2WLYA 3TFKC 2ORBH 2XI9A 1Q0YL 5FUZH 3GHEL 4QRPB 4WUUE 2VTFA 1I1AB 5DXWA 4X7FC 1MFEL 4A6YA 3QXTA 2RFXA 1AR2A 3VGHA 2NY7L 2H2PC 2WUCL 1G7QB 4JZNB 3DGGB 4ODTH 4UAOB 4KDWA 3E8UL 4NCC1 3GK8L 2IQAB 4M03A 5TDNB 2JJSA 3BFOA 1KB5L 2HFEA 4FFZH 4OGYL 5TE6L 3G9VA 2DQDH 2R15A 1VENA 4M3JA 1GRWA 4N1HB 4E9LA 2ZUYA 3SKUD 3MLYH 1C1EL 4L8CB 2XN9E 1KPRB 5BV7C 1KJ3L 4C83A 4XCYA 5I18H 2FSEB 3QFJB 1F4XH 1NGYB 3IDYB 1IKFL 2R1YA 3CFEA 1KIQA 5ALCH 1XIWD 5EBLA 1RZ8B 5CSZA 5FA3B 5IM7B 4HUMB 1EO8H 3OKEB 5JLZA 2HFTA 5KSAA 4XHQA 5JPNA 1A1MB 1OLZA 3HG1A 5E9DB 4P2RE 3L95B 1WWAX 2MWCA 5GGVY 5F1NA 2DL2A 3TN0B 3MUGA 1UA6H 1SEQH 2IANE 3FFCA 1TENA 4YBHA 5TE7L 5IK3A 2E8ZA 4LVHC 5FUCE 5D1ZA 4M3KB 1FFNA 5JW5B 4C56A 5DEGA 5L7XH 2CLZA 4P57A 2B39A 2BVPA 3NFPB 2G2RB 3WBDA 3GKWH 5D2NC 3H0TB 1PYWB 1RJLB 3BZEA 1NCDH 3DURA 5DD5H 5IVXB 3P30L 1MHEB 4I2XE 2Y4SA 4JAMA 3QUKB 3LIZL 4JO2L 5B21A 2X05A 4FQIL 3ZKND 4ACPA 5F1KC 3G08A 3V6FA 3VGBA 4GMTL 1NMBH 4KK5C 5CZXC 1LP9B 4U4BA 1JL8A 3VI3E 5MENE 5CJQH 3FQXA 3SDCA 5CCKL 3RP1A 1JGDA 5F7HA 3GMNB 1G7JB 1Q0YH 4U6YA 5EOCL 4L9DA 2F54D 1CR9L 1MFEH 4NN7B 3TCXA 4P2OD 4DUVA 1CF8L 2XICA 4G6AD 5D71L 5JIHA 4XX1E 4UT6H 2LTQB 3E8UH 1DDHA 2HVKB 3MRIA 4IRZH 1N5YH 5EIVA 1CDHA 2CIKA 2EH8L 3LN5B 4IRSB 2QR0B 3DETC 1EUTA 1YQVL 5MI0C 4EXPX 1CICA 2GK2A 1RUML 1CFQB 3BZFA 4P2RD 5FYKH 3NFSL 1WWBX 3EOAA 4G8FB 1E0OB 4RGNE 1UADC 1DUZB 4Y2DB 4JQXC 5B38G 4XMLL 4M93B 4BZYA 4U1LA 5HHMB 5DRNB 1UVQB 1OARH 1AIFA 2JE8A 4YPGB 1ZVHA 5EO0B 4KDTA 4CL7A 2A73A 3QJHA 1RUQH 3VXTA 2R8SH 1BM3L 4G7YL 4MS8C 4XCCL 5HYJE 5DLML 3FZUD 4HKBA 3D69B 3MUHL 1OVZA 5DJXA 3OJDB 1F6FB 2MHAB 2CD0A 2YD1A 5D5MB 3CPLA 2G75A 3BKYL 4K7FA 4Y89A 4P46B 1PZ5A 3F7VB 4M1DL 3QO0B 1UA6L 3WNKA 4KZEL 1UACH 2LAAA 4JM2C 1TJGH 1OD7A 2C3VA 3DRQA 1ZT1A 2VUOA 3THML 4TNVK 5DZOA 4PTUB 1A6ZB 2VQUA 3V6OA 3GKWL 4G8GA 4LSVH 3SKMB 1XGPB 4Q58C 25C8H 1DQML 5IK3B 1QBLH 4F58L 1IRAY 2YZ8A 3DX9A 5FUOH 3UTZB 5DK2A 2DQHL 1W2KT 3MNVA 4FQIH 4TVPH 3IJYB 1NMBL 3BDBA 2XWTA 4AZ8A 5E8NA 5CJQL 2CKBB 3LKPB 5IVXA 1NFDB 4U1MB 3PG2A 5I1HL 5LVEA 1EVUA 4WW2C 2Y07L 1IFHH 5JOEA 2DQFA 3JV6B 4E0RA 3FQXB 3MRPB 5JZ7D 3FCTA 2AK4B 4D9RD 2ERJC 4WV1A 4MJ5A 4QT5B 4OIIL 3ULUE 4JREB 1JZ5A 3ZO0A 4PYHA 2I27N 5HVGB 2UY6A 2L4OA 1TFHA 2BVOA 1AH1A 4EI6A 5SX5K 4F7TA 5EOTB 2RCSL 4ZFGL 1DFBH 1DQDH 5HBBA 4WGWB 4QHNA 1BM3H 3RAJH 1QSFE 1C12A 4JJ5A 3BN3B 4XCCH 3KPTA 3CFCH 3VMPA 4R97B 1Y0LA 2ED7A 1LNUA 2HKHL 3OR6A 4JFYA 2FBJL 4ORGA 4CADA 1A9EB 1DBKL 3QR2A 4PRPD 4GT7A 4Q2ZA 1IGFL 1KV3A 3M45A 2NY0B 5I75C 2PR4H 4X5LA 3TO4C 2GITB 3C09B 4UT7L 4NOFA 3VFMA 3PWPE 5GXBB 3UPRB 3PHSA 3MREA 4NPYA 2QQLH 1WAAE 4WUUA 4LIQE 3IFPB 4BSWB 1B4RA 1JE6A 4POUB 3GSNA 3UROR 2Q8BL 2YPKA 4MWFA 1TJGL 1GYAA 5D8JL 4N8CL 5KS9A 5IB3B 3WIHA 3OMZA 3U7AA 5DS8A 5LBSH 4ZDHB 4UT9L 3ARBB 2BDNH 4J23A 3TCLB 1R3LB 2J8UE 1DQMH 2DJUA 1OAKL 2I60L 1R3KA 4U6TA 1E4KC 3MACH 1OGTA 3D39B 2YD5A 5DUBB 4NO0D 4XWOD 3RDTA 1T21B 1BZ9A 4KKNA 1FL6B 1Q8MA 5DMKB 1DQQA 3NOIA 1HSAA 3QUYD 4M7LL 1F58H 1J0IA 1NGZA 4HLJA 3EJYD 2ZUTA 5IHZB 4R4ND 4U6HB 4P0DA 4RDQF 1IAOB 5C2BH 5BW7A 4PJIF 1OB1A 5DWUH 3REVA 1MCNA 3MV9D 5E8NB 5F7FA 3D5OF 1KJ2A 4CVZA 4PLNC 1DSFH 5C6TL 4FFVC 1JGUH 1NGQH 4O2EB 4HGWB 4KVCH 4IRSC 3G6JB 3QBTB 1LE9B 5BV7L 1Z9OA 3WUWB 3L5IA 3VFNA 4CMMA 3FCTB 3PABB 4JKWA 1NFIB 2QLVB 1D5BB 2ZOLB 4K3GA 5J12B 3IVKB 1U95B 1DQDL 2R23A 1CFNB 4UINH 2DD8H 3TF7C 3K2UH 4C54A 5I17A 2CJUH 4Q6IA 1NPUA 3S96B 1IGCH 2NX5B 3RHWK 3RAJL 4I77L 3T3MF 4M8QB 3JZ7A 1LGVA 4ZS6D 2WAHA 4KDVA 3OX8A 5F21B 3O9WA 4KKLC 3VRJA 4P3CL 5BCAA 3BGFC 1ZHKA 4XPTL 5F9AC 3VJ6A 3SCMA 1HHHB 3QDAA 4FQLL 1LO4L 1C12B 4I9WE 4MQXD 2GSIA 4RCAA 3ARED 3FB8A 4YGVA 3MRJB 2R4RH 4WEMB 1GGYA 4P4RA 3DETD 4V1DA 5IFJA 2YRZA 1H3PL 1G7PA 1JPSL 2EE6A 4JDTL 3EDDA 3TZVC 3E2HB 3I3BA 5KG9B 5D8JH 3KS0J 3VXRB 1DE4A 4NT6B 3RTQC 1D9KB 3S3SA 3ZKMD 4JFZH 4YAQA 3QUYC 5E1AB 4OLWH 4P2RA 4LRIA 1GOGA 1RK1A 3B9KC 2XOTA 4U0QB 2ID5A 3C87A 3MCLH 1JMXA 3MGOB 4PPTA 1F45A 1BFTA 3EO0A 3O3AB 4JHWL 4FHBD 5CUSL 5GJTL 3EBAA 2EZ0D 5FB8B 3O2DH 3U7YH 1T22A 4ZO8A 5FO8A 1NUGA 3B9AA 2NTSP 4KK6D 1LP9E 2XY2A 4LCWB 3CFEB 4TOYH 2O61B 4Y5XB 5CJ8A 3RWCB 1I4FA 1M4KA 4KAQH 3W9EA 3IJSB 3LZFH 2J8OA 2P5EA 3NMEA 3INUH 1OP3K 5E4IA 1ADQA 4L29B 4OCNC 3VG9C 3AS0A 4MX7A 5HHPA 4OF5A 1ND0A 5I66A 1KOAA 4IOSD 1I1FB 1K2DB 4HS3B 5HHNB 4NQVA 3SJVE 4AQOA 1F97A 4OZIF 1IEAB 4YK4B 1B3JA 4RAUB 3QCVH 3LKNB 4HPOH 2V5MA 3PWPD 3TA3A 4C58B 1UB6B 3A6BL 4WO4A 4TULL 3SE3A 1JTOA 2VB5A 5E2UH 3DO7A 2F19L 3WLWC 4U6VH 2DD8L 3MRCA 2R1WA 2CJUL 2BJML 3PABA 3KHOA 5I6XB 1XGUB 5DC4B 2YD9A 3L5JA 2EO9A 2GSGA 3U4AA 1X5ZA 1CU4H 2CDFA 3CK0L 4C55A 2FGWH 3QJFB 1YEJL 3U4EB 2A83A 3MNZA 5IG7B 1W8NA 1JI2A 1MCPH 1T4KB 3VMOA 1WZKA 2D9QB 4JFHD 5D7LE 2NR6D 4UDUB 1WWWX 3NTCH 2BSTA 4XNXH 4YHZL 3KPSB 3OKLB 1CTOA 1AO7E 5A2FA 1KPRA 2Q87A 4PJFB 1AGBA 3GSUA 1CICB 4KMTL 4O5LH 1HQRA 3L3HB 4CN4A 4PRDB 4WCYL 1OAUL 2BVTA 3T2NL 4YHML 3QHTC 1FZJA 3X13A 2JK5A 1HNFA 1QBAA 2YKLH 4ELKB 5BS0E 2IAMA 4MNHB 1Q9KA 4MQTB 5T33L 5MERB 2DDQL 1IGTA 4P2RB 4Z0XB 3G6AB 1RHHB 3BO8A 2PO6B 3QIUC 5F1NB 1FG2A 1UZ6E 3FT4A 2HKFH 4DFIA 3PV6B 4GAJL 4N68A 2K7QA 3OAUL 1II4E 4X6CA 3INUL 2PYFB 3TBSB 4BJLA 1U8LA 2G2RA 5DFVD 5L6YH 2FB4H 4I18C 3UTQA 4LHQB 4M7ZB 1FN4B 4Q9RH 4JVPA 1F2QA 3FB6B 3QCVL 4HPOL 1GAFH 2JKXA 4RBPH 5TE4L 3FFCB 2EKSB 5E2UL 4Y88A 4U6VL 3U82B 1TNMA 4Y5VB 4ZPVA 4X6DE 4G8GE 1FFOB 5D6CB 2VUYA 3KR3H 4JFFD 1RZIA 4B5EA 4DEPC 3OPZH 3MNVB 1RMFH 4CU6A 3S35X 2X89D 3DX7A 5ISZA 3MRCB 5H37H 2XQBL 3L3GB 3O3BA 4NZJA 3QXVA 2AJUL 4N9OB 4OQTH 4R9HA 1LP9A 3NFNA 2HJKB 4OD3H 3RL2A 4YUEL 3PWPB 1RFDH 4RRPG 1E6JL 1T20B 4IMLA 1AP2B 1LO5B 4L1DA 2FX8H 4TQEH 4FXLA 2EDBA 3LPWA 3LKQB 4ZFFB 1OD9A 1E4JA 1FAIH 2YD7A 5D1QC 2FYYB 4IHOB 4P99A 3UYRL 3UEZA 4ZNCD 5B38A 2ADGB 5GGRA 3AMLA 5D7IE 1I75A 1J0JA 2EDTA 3OKLA 4G43A 3RKDC 2YA2A 2LU7A 1MPAL 4JVUA 2R39A 5F7MC 3CFJB 4PJXB 1A14L 1HI6A 4KRNA 1S7VB 5CP3H 1OGAB 3HC3L 1KULA 1CFTB 5ESVA 3HUJB 2YWZA 4MB3A 4K71C 4YBLC 3B5GA 5GS0L 2OTUA 1MJJA 5HGGS 3B8YA 2QADC 5JNYA 5I30L 2F53A 5DYOA 5EU6B 1PGRB 4CKVX 4HWNA 3MUJA 2MCPL 4MJIA 1Y0LB 4G42B 2HKFL 2K9UA 4XP5H 2NZ9D 1NGPL 1OP3H 2Q86A 2JB5H 4HKZA 3G6AA 3VGDA 1HIMH 4YLQT 2P5ED 5C0AE 3UTSA 3PP4L 1JPGB 1IJ9A 5LGHH 3ULVF 4JB9L 2DWDA 4AENA 3E3QE 2BNUA 3U4BH 2CLVB 4HWUA 2ILLA 4HIXL 4L8SC 4S10A 3VRLE 5GJSH 5F9OH 3VWJA 4Q9RL 3GKZA 1R3JA 4O9HL 4UILH 4Z8FL 1KEMH 5K59F 2YPLE 5I73C 1NUNB 1W72L 3P0VH 4K55A 3OWEA 1OM3H 3FN0L 4P2QB 2Y5EA 4CNIB 5BQ7B 4ONHA 1KN4H 5E99H 1KCVH 1OGTB 3D39A 5EWIL 2AV1B 5KSUB 1YN7B 3NGBC 1PG7L 3FFCE 3L7FB 1EAPB 2OQJB 5DFVC 2G60H 2DMKA 2BSSA 5DK3A 5MEND 2ATPA 2N56A 1QHOA 1NANI 1JUFB 2AQ3A 4YDKH 4U7MA 3R4DA 5F7WC 1NGWB 3DXAB 3L5WA 2W0LA 5D1XB 5GS0C 4XPFL 2J5LB 1HYSD 4OJFH 3CFIC 3F7PC 2ADJB 3DYMA 3BRGC 5INDA 1T66C 4HX1A 1LDSA 4U1KB 1K4CA 1UCBL 1IZKA 4KJPD 1NCAL 3CNKA 4PG2C 3UYRH 3T0EA 4Y4FB 4EDXA 5JR1L 3DUUB 2IAND 4E42A 4JY5L 3RGVA 1LNUB 3ZYIA 4WWKD 5IEKB 1JI1A 1I7UA 4XI5D 4F9LC 5L2KD 3UJIL 4IEFB 2R4SH 1FL3A 3MXWL 1NL0L 3U48A 2ADGA 5GGRB 2R2CA 3NIGE 5F7NC 4UV4H 1QYGH 3OB0H 4NQSA 3SDAD 1OSPH 3QA3B 5GHWL 3CX5K 5F7EL 3BDYL 3GSRA 1X5AA 2GTZB 2EDRA 3ARGC 4HWBH 5IF0B 1NBVH 2C5DC 4HH9B 2NR6C 4NNXA 4Y5YB 4BFIA 1Z0MA 4WIQA 1A7NH 2UUDH 4WFEE 4Z7NF 3HZMA 3MUY1 1J1PH 2DQUL 1ZHLA 3WFDL 3OZ9H 1A7PH 1KCSL 3QEQE 4FFWD 4MMXC 3P4MB 1CN4A 1PSKH 3GSXB 4PUBH 4KVNL 1ORSB 4AL8H 3UPRA 3RUGB 2RGSA 3MO1A 3MGTA 1OGAD 3RDTB 1IC5H 3NIDF 4WUUB 3VXRA 2BOBB 5F89A 3SGJA 1RJZA 1G6RA 3H9HB 3P0VL 4MXVF 3FN0H 4ZUUA 5EPMB 1EA9C 5HI4D 4FQJL 1CLCA 5IB3A 1U8OA 4KXZH 4ETQA 3MRKB 4QF1A 1KCVL 1Q0XL 1QP1A 2I9LA 2VSDA 3MGOA 2NY6B 4KROD 4JG0L 2X89A 1L4IA 4NKMB 1JNJA 5HGHB 1MWAL 5HYQA 3C2AL 4YDJA 3QDMB 2DMBA 1JYVA 3LRHA 3N1GC 2PXYB 1RJCA 4Y16B 2HT2C 1LE9A 2DI8A 4NM8L 5F1OB 2P24A 3HI1A 1YN7A 3TH3T 5H35B 4ODSH 1EAPA 3O3UN 1M7DB 4H5SA 5T3ZE 4U6HA 1BD2D 3D9AH 2MPAH 1UEYA 1RJYA 4ELME 3QXAA 4I3GA 4R8WL 3KYMB 2Y23A 3N85H 1NCAH 4YWGL 4LSQH 4W6XB 5HJ3A 2BC4A 5I1KL 4GLRH 1A6WH 1S8DA 4TSAH 3WEXA 4F9PC 8FABA 1EXUA 4JFFA 3Q5YA 4JY5H 5HSFA 3OX8B 4RGNC 1KSRA 1R0AL 3CMOH 5CD3A 4OLUL 5F9JA 3QZWA 4MQXC 3UJIH 3FKUS 4PV8A 2E7LA 5FO7A 4NQCB 3S34H 4CVUA 4J1UA 4FQQB 4GG6B 3MRJA 5I1IH 3F7QA 2Q6WA 1BEYH 1VHPA 3RTQB 3QFJD 2DAVA 1MCRA 4LLVA 4JRXA 1C08B 1G7MA 2VDOL 3RPIB 5IMMA 1UKSA 2WUBH 4HK0B 1DE4B 3GRWA 3WS6C 5EUOE 2OI9C 3V6OE 3WS3A 5JPMB 5F9WC 5L9DL 4KZDH 2EEBA 4YAQB 3WFDH 1MELA 1VA9A 5KSBF 5LXGL 1KCSH 3MOQA 1TTFA 2JIXA 5B3JF 2DKSA 2DQTH 4Y5YA 2CK0L 4HZLB 4M61A 3WE6B 4MB4A 3RU8H 4AM0B 2Y72A 2K3TA 3N0PB 1I9EA 1GPOL 5MP6H 2ZOKB 1IM3B 2M8XA 3VH8A 2D03L 4HIEA 2B5IB 4Y8DC 3V0VA 1MCDA 3FRPG 1CK0L 1KCLA 3N9GL 3TESA 3LQZB 4PGEA 4LAJH 3NBNA 5E2VH 5ICXA 3ULUC 4LHUA 3PHOA 4HUUA 4KGJA 4ZFOL 3CFDA 2VZOA 1MWAH 3GUTA 3FQWA 5C9KA 4M6MH 2EKJA 1HH9B 2OL3H 1ND0B 5CEXB 2PO6A 5EORH 2VXVH 1I7TA 1MNUH 1FFNB 1GZQA 4KRPB 4L3EB 1YNTA 4IDJL 1EV2E 1NCBH 3O4OC 2RB8A 1U91B 1JWMB 4TUJB 3QHFL 1K4DB 3KXFE 4APQD 1D6VH 4L4VE 2PYFA 3SQBA 5D70H 4ONFH 2BP3A 5DD1L 3KWWB 1I4FB 4Q6YA 2XQYK 4X6CF 5JW3H 5IB1A 4UIKL 3NCEB 2R1XA 5GS1C 5TQ0L 1P4IL 4AEIL 4K8RD 1AKJB 4JFOB 4QXUH 2B8OT 3MLRL 5JXEA 4OCSH 1FE8H 4P5MB 1G7JA 2ZJSL 5EH1A 3STLA 1G7HA 2Z91A 3QEUB 3HS0A 4PS4H 3BIBX 4DUWA 3OB0K 3OKKB 2PXYD 1M6OA 4BK5A 1RPQA 3VCLA 3I2CL 3S35H 4WI7A 5IVOA 5T1LD 4PRID 1IMHC 5CD3B 2QADD 1BEYL 3VFSA 2WK2A 4DVBB 3EHBD 4JGMA 1JVKA 3BWAA 1R5IA 5CJBA 4LASL 4JZOB 1EERB 1ACYH 5DI8B 5L9DH 2GJJA 5ID0A 1NMCB 3RTQA 2NY3D 1A6AB 5EU4A 3BMVA 2H8PB 3RWFA 1X44A 3OKMB 5KSVB 4KQ4H 1PFCA 2IAMB 1WCQA 4LLMA 3B2UC 3ARZA 3IDMA 3SE8H 5F70A 4MAYC 5CEZH 4LGRB 2MQ0A 5L2JB 4MZ3A 1MREH 1FVEB 1QLRA 3JVGC 4PJXA 5EFIB 5JIKA 2MKLC 3DBXB 4O2FB 3BUYA 3DJ9A 3EZJB 3ARFA 3RUGE 4DOHB 4OFKA 3SDXF 5CHNA 4LCCC 4R26L 4N1EA 1KB9K 4LDLB 4BZ1H 3MJ9L 5C0CE 5IW1A 1SJXA 3MBXL 5JNYB 4UOW1 4M1GH 4I0KA 3DMMA 4XCNA 5C7XL 3CCHB 1YNLH 4TRPH 5B4MC 2VC2L 4NKIL 3U9UA 3JWOL 3CFDB 5KSAB 3FB6A 5E08H 3LQAH 4YIQB 1Q9OA 3JV0A 3X17A 4NDMA 4X6DA 4JO1L 3UTZA 4LSUL 1X4YA 1UKQA 3RNQA 1UZ8A 1A2YB 4QXUL 1D5MB 1YNKH 4IS6B 4XHJD 1ZLWK 1UC6A 5JW4N 3BIKA 5E8OA 3MJGX 3MLZL 1AO7A 3B8SA 4IOIA 1QO3A 3DTXB 3MRHA 2NXYD 1P9MC 4QRRB 1QFOA 3ZDXF 4NQCE 1H8SA 3CH1B 1TXKA 2LV4A 4LPXA 4WW1A 2WWMD 4P5KA 5K93A 1WZMA 4R4FH 5IROA 1N6UA 1NDMA 2VXQH 5T1KB 3WKMH 1UB5A 1BQLH 1RZJL 4PG9A 2XFXA 2LE9A 3FQNB 1YPZA 4JPVL 1MFBL 2Y6SD 4RRPA 1DCLA 3EOBA 3LKSB 4S0TD 3MRQB 2BNRB 4OCRH 1G9ML 2BY0A 4ZS6C 3RIAF 3VFSB 1F6LL 1OTTC 2DKMA 2Q1EA 3HPLA 4X4ME 5GSRA 1W72B 3TO4D 2W9DH 4PP2A 4BQBA 1A3QA 2A9ML 2WQ8A 2H2PD 1KTKE 3U0TB 3IRPX 4JJ5B 1X5HA 3KPPB 5LJYH 1H5BB 1A6AA 1G6VK 5EU4B 5HYSB 4ZFOB 4D0CA 4G8FA 5D1ZC 5JXAH 3MJ6A 5CEZL 2Z31D 1QSEA 4UBDD 2YSSA 3LQMA 2E27L 5GRUL 4B41A 3QWQB 3IDMB 4U0RB 5IBUB 2A9NL 4K07A 3H3PH 4L8CA 2DQGH 1EJ6A 1BVKB 4L5FH 4OZFA 5ALCL 1HXMA 1JPGA 1S7VA 2V5RA 2GT9B 1NMAL 5ENWB 2YPKB 3LH2L 3RZCA 1XZ0A 2V7HA 3EOTL 1YEKL 3DBXA 4O2FA 5KS9B 4EUPH 3MV8D 1T04A 3RJDA 2BFVH 3IJHB 2CRMA 1OCWH 2E6PA 5TE7H 3MV11 4FFYH 5A3ID 3BRFA 5C9JA 1U3JA 3CCHA 2D3VA 5JPNB 3KDMA 1L7IH 2PW1B 3ZHDA 3QDGE 5JO5B 3RA7L 3MOAH 1LK3H 5LKNA 1VFUA 1C5DA 2JJVA 5TPWL 2VKXA 4YNYB 4JQXA 1R3JB 3I02B 3VFOB 1QBBA 4JN2A 2UYLA 3VWKC 3ZTJG 4NQEB 4GAGL 4JRYB 5DZNA 4JCLA 1CR9H 4BKLB 4L3EE 4NOBA 1LE5B 5DR5H 5GGTA 1IQWL 4YDJB 4BFEA 1A6UH 5E7BA 1BWWA 1K4CB 2AV1A 3NZHL 2A6KA 4JPVH 2XY1A 1EGJA 5GPRA 2GFBB 2FR4B 4P5KB 3UX9B 3C8DA 1I8MB 2X9XA 3S88L 1NDMB 3VXMA 2AK4A 3RGVB 5E56A 3MJ7B 1JHKL 3QQ4A 1TTUA 5C09A 3NFSH 3LEVH 4MNQA 2NY4D 2NY1C 1DDHB 2HVKA 3MRIB 4X4XB 1T1YA 1SVZA 2EXWD 1S5IH 1CDCA 1OARL 2R2HB 2VNCA 4WHDA 1N2RB 4JDVA 2XV6B 5DUPL 3ULUF 1MF2L 1EXUB 1KTLA 4JFFB 1ZHKB 2R8SL 5DD3L 2DJSA 1B6UA 1OLLA 1BLNA 3WO3B 1INQA 4JO3H 4OCXH 4P5TD 1ZE3C 3CZFA 2A9NH 4ZFOA 4YDIH 5DVOA 2X4NA 1QSEE 3TT3H 1CLZH 1U3ZA 1XR8B 4HUWA 1F6AA 5KOMC 3TPUB 4FQPA 2YA1A 4XAKE 1ZGLA 3BKYH 3IAPA 1LO0L 4X5XA 2YD6A 5IFHH 4GRLA 2D7NA 5B8CA 1L6ZA 3O45A 4KZEH 3QT2A 4WW2A 4IDLA 2Z0BA 2VO5A 1XZ0B 5JPMA 3BH9A 3SDYH 4CW1B 2WLZA 1QFWM 1FGVH 3HZYA 3CDGA 4XC3L 5BRZA 2HWZH 3MRKA 5I76B 4N9GA 4ETYA 2H2SD 3LEXA 1BFVH 3P4OA 3MOAL 3JSSA 4F58H 5ISZE 3JV4A 2WBKA 4X6EA 2YMXH 4QYOB 4XPGH 4JR9L 3MLTA 1QKZL 3ME0A 3DRTA 1OL0A 4LBEA 4Y16A 2KZ1B 3L3IB 3V0VB 2FEDC 3FO1B 1NC4A 1H5BC 4GXUM 4PGEB 4LKXA 1T21A 3EYQD 2AXGA 3DX9B 5FUZL 4U1NB 2CH8A 3CU1A 3C08L 2EYSA 5I1HH 1HSAB 2NYYC 2FD6L 4YNYA 1LEGB 2UWEE 1TETH 3WNMA 5JUEL 1FO0L 5FECB 3SGKA 2A6IB 1JGEB 3EYQC 3NZHH 3KGRA 1HILA 1CVRA 4QXGL 1BQSA 3SDCD 2YD4A 3Q5TA 4L4VB 1MCLA 1OB1B 4OIIH 4JRYE 3REVB 3TO4A 5IMOA 5I8EB 2Y1VA 1K4DA 1BOYA 1CDBA 3WSQL 4HBQA 4R97C 4JLRB 5DJ0B 4HKJA 2XNAA 5C0EB 5JHLH 3AMKA 3GM8A 2WIMA 3KWWA 4F9LA 1EFXD 4WV1B 2VQTA 5T5NG 1TZGL 4NO2B 3QXDA 4LPWA 1HINL 1AKJA 1L0XA 4U3XA 4WHYH 2V7NA 4APQB 3SHSA 5IG7A 2WBJB 2R56H 2Q20A 4I0PC 3R0MA 5LCVH 2VDKL 4PJ7E 1MUJB 1F4XL 4MXQD 3C8HA 2X5PA 3KPRE 3IDJA 4Q74A 2FBJH 4ZFZA 1FNLA 2XXMB 4QHNB 1T0NB 4ZXBA 1XGYH 3GJFA 4Z7VE 5FHBL 1ERNA 3O9WB 5L8KB 2FEEI 3BJLA 4OZGA 1A1OA 1JRHH 2ICES 2NW3A 4NHUB 5DGRA 2W91A 2J12B 2VZ3A 3NAAH 3C60B 1CQKA 2I24N 3TT1L 1LK2B 4I3RH 4F7EA 1JRHI 4HT1H 4M7ZC 1Q9LB 3KJ4B 2D0FA 2EDDA 3TYGL 5ICZB 5L7XL 4JDZB 1G7PB 4N0FB 5HGBA 1SMOA 4GKNA 2Z4QA 4Z0XA 2GEEA 3FN3A 1ZHNB 1WICA 3MA7B 2AV7B 5I1JL 3DI2B 2JCCE 3P30H 5A1AA 1F3DJ 3GI9H 2AQ1A 3ZE0E 4DEPB 1WFTA 4XNMB 2CLRA 3UP1A 4RGOH 2X42A 3AY4C 2Q8AH 4LEOA 1HXYA 3JV4B 4X80L 5EOCH 4X6EB 2QSTA 3WO4C 1I1AC 1KIQB 1A0QH 1TETL 1Z0NA 3Q0HA 3Q1SL 4DW2H 1CF8H 1H3WM 1T2XA 2GIYA 2M26A 3WXWL 3RY6C 3T65B 1CWVA 2VERN 4QXGH 3L3OB 2BNRD 2N7AA 3EW3B 3RWCA 3E6HA 3NZ8B 4WFGD 2Z8SA 3WIFB 3SE9L 4X0KB 4XPHL 1XF4B 4TYUA 1HDMB 5ACZB 4Y4FD 1OGAE 2O93L 1CXLA 4LHJB 1E28B 1Q94B 4PJHF 4P2OB 2VKWA 2XXCB 4NWTL 3BEVB 3PWLB 1Q9OB 3ARDD 3O6FA 4CVZB 4K71B 4YBLB 5DHVA 3ARGB 5TF0A 5A40E 1TZGH 2GJZA 4KWUA 5HD8D 3RHWF 3UBXI 3ULVH 3WFHB 3VFWB 2W59A 4U3CA 4CMMB 3FFDA 3BPCB 1FZMA 2DQEH 1NFIA 2EC9T 4JFOA 3K8LA 4JZNA 1JWUA 3BW9A 3BISA 3O8XD 3GM0A 5DUMH 1FCCA 5I71B 1XCTB 1PY9A 3CJJA 1F4YL 5SX4H 3NCJH 3WL9B 2X1QA 3CH1A 3TZVD 4HWZA 4J8RA 2IC2A 1FZKA 2D4FA 2ESVE 2HFEB 4W6WB 3W2DL 1CLOL 5D93B 1FIEA 2PXYC 4NZTL 3X14B 1A7RL 4XAWH 2QBWA 3UBXG 1YPZB 3ZE1E 3MCKB 3MRQA 1UACL 5ERWA 3VD9A 3ZKQD 1JPSH 4JDTH 2PW2A 4HJJL 3D25A 2E7MA 2QR0A 4HK3N 1GGBL 1PLGL 5F3BA 2O5XL 1FSKB 3KPLA 3OG6B 3V9FA 2R29H 5HI3D 3P9LB 3WD5H 2P5WE 5GRVL 4F7MA 4H1LH 3GRWL 2DQIL 3HC0A 2ZUQB 4PRDA 2IMMA 2Z31A 2IANB 2V2TB 3R06B 2DQHH 1AIFB 2H9GB 4JHWH 5CUSH 5GJTH 4YPGA 4C4KT 3D85B 3EJYC 3I6GB 4JKLA 4L3AA 4U2ZA 1C16A 1T1XB 3PWVA 3QWRD 4JKKA 1VESA 4J3SA 3V8OA 3GSQB 1X5XA 3ELAT 4HKBB 4DW2L 4LSRH 2ZZUT 3HTLX 1IFHL 1WBZA 1GHFL 4JZJC 4EBQH 3VWJB 2OP4H 1F42A 1H9VA 1A3LH 4XNQA 1LHZA 2P42B 1U9KA 4U49A 4MNGE 4LL9A 4LMQE 3F62A 4I2XA 3KPQA 5CBAA 1KG0B 4DQOL 1WF5A 4F37K 2VXSH 4XNUL 3TN0A 2CO7B 4PB0L 5LAXA 3OG4B 1QVOB 4G7VL 5C07D 4TULH 1C5BL 4U1GB 3WFCL 1DFBL 1J05A 3ZHLA 4HLZH 3BEWA 2R2EA 4UUJB 1E4WL 1MH5A 3UAJC 3MR9B 2ZCLL 5J13B 3ULVL 2FLRT 3OAYK 3SKMA 4JRWA 1ES0A 4WWKA 4OV5A 5HGAB 3AVEA 4D0DB 3TBTA 3O6FB 5F44A 2FEDD 1MIEL 1PKQB 5K33A 2YHGA 1DR9A 2AJXL 3BYTA 5D6CA 3H0TA 4AEHL 4PJ7B 4XTRD 4WEUD 2AXFB 4OFPA 4YBQD 3VMNA 5T3XE 5I1LB 1IGFH 1J88A 3TGXA 1UH4A 5I8KL 1F02I 4PJAB 3WNPA 1U6AL 2CKNA 3WFEL 4X6DF 1FO0A 4Y0GA 5C0IA 1JZ2A 1U3HC 3T0EB 4R2GD 1J10A 5HY9A 2KZWA 5C0AB 2W1NA 3HUJF 1NAML 3FB7A 5C0ND 5BS0A 3CVIH 3PWPA 3QPXL 1NEUA 3MRBB 4MAYD 2YSSB 5LBSL 2APTA 2BXYA 3RIFF 2BVOB 1T1WB 4EN3B 1T3FB 3MCKA 3ZDYE 2UV3A 3CDCA 3L9RA 1V7NH 2WMPA 1OAKH 5EBMB 3D25B 4YEEA 5E0QA 4P23B 5FYJD 1WIPA 3CZJA 3EOAB 5KVEL 2HYMA 5LWYL 3RZCB 5F96H 4IBLT 5T33H 4P59H 1RAMA 1BREA 4HEPG 4GLRI 1FL5A 4F7MB 3QUXA 4NZRL 3H9YA 1SM3L 3DECA 2OTUB 2AI0H 5HYJD 2P46B 4M1CC 2NY6D 3EGSA 3BUTA 3VWKD 1UXSA 5BVJB 1P4LA 3S6CA 5DJXB 1DSFL 5C6TH 2CDGA 1X5KA 4HKZB 4U1JA 5GSVA 5ADPL 2FB4L 4IJ3C 2XRAH 4QGTA 3W5NA 5EU6E 1CDJA 4S1RH 5J1AB 4ZUWA 3ECBA 2MQ3A 5HVHB 3F7VA 4TSBH 1GAFL 3ES6A 3HZYB 1C5BH 1SYVB 1CFVH 3R1GL 3K2UL 1WC7B 3WFZA 3C2SA 3HZKB 2ED8A 1MIEH 2CXGA 2XTJD 3G04B 4LCIL 3PDGA 4AQ1B 3D0VA 3LV3A 4I77H 5D9SB 1T7ZA 1RMFL 3MLTB 1V3MA 2PYED 5BZWA 1ZT7A 3GMRB 4JFPB 5C8JB 3T3PF 4D2NA 4M1CD 4Q9QL 4FA8A 5K59E 1UH3A 4H5SB 1N8ZB 4Z7WA 5KANI 3HPJA 1MHPL 3X12B 3QUZC 3TBTB 1DVFD 1EDQA 3F8UB 3P77A 3B6SB 3P3YA 3QQ4B 1WTGT 4JG1L 4G6ML 5D7IB 3B5HA 5HJ3B 4L4TD 5I8OH 4OD3L 2K1MA 3KYNA 3M1BB 4G9FB 5FXCH 5E6IA 2OTWB 1JNNL 1NAMH 2FX8L 4TQEL 2AXHA 3LS4L 1N2RA 3CVIL 1UWEH 5FUCC 4K8RL 1FAIL 3C5JA 1P7KB 2ENYA 5E00A 5D7SH 5E94A 5I16B 2VZ1A 5IV2B 5FO9B 1IAII 3BZ4A 2XG5A 2L7UA 4MXQC 2D0HA 2H1PL 1EHXA 4QRRD 1S7UB 3DX6A 3HC3H 5KVEH 5LWYH 4WTZA 5IJKC 4Y4HC 1S7SB 2J6EH 2NY4C 1CD1B 2CRYA 2XTLA 4MVBD 5DO2D 3U7YL 1OTSD 1BVLA 1X5FA 1YJDH 1DEEB 1H15A 4P4KC 4GRLB 1SM3H 1IKNC 2NCMA 5GQBA 4RIRB 4HBCL 1CG9A 5FKPB 1RULH 1XMWA 4GKSB 5K9OB 4ORGB 3RX8A 3PQYB 1INDL 6CGTA 4Q2ZB 2KL6A 3LEXB 3TPUA 3VH8B 3PE9A 4P3DB 3KLAA 5GJSL 3VXUB 1G6RL 5E2WL 1QRKA 3DSFH 3DRTB 4LBEB 3JTSA 3SKNB 3VDAA 3H7BB 1DQQB 3VXUE 1W72H 1D9KA 1OM3L 2Z4QB 3UTTB 4YXLH 3R1GH 4M48L 4Z78B 5LGJB 4PG2A 1N0LA 3SGEI 1KIRA 5E99L 4ZUUB 4N9GB 5EWIH 2C26A 2F54A 3QUXD 1JGEA 1MLCA 1GOHA 2OZ4A 4NBZB 2H2SC 3B9KB 3DV4B 3HE6A 4GFTB 1NLBH 4ZAKA 4XHJC 4RGMC 4F33A 2WINB 2R9HC 4ZQKA 2X4QA 4JLRA 5DJ0A 1KACB 2O61A 2X4RB 4JG1H 5IVXF 1NCCL 3T0BA 3CXDL 1D5ZA 3T4AA 1IVLA 1R3HA 3UDWA 1IEBA 4MCZB 5FDYA 3QXDB 2E9JA 2R23B 1QG3A 2O5YL 1UCBH 2WBJA 1EFQA 3AB0C 3ARDA 4LSPL 3DYOA 5SX4I 2FECI 5JR1H 2RAMA 1S3KL 2ZSVB 2R69H 4WCYH 5C0JB 4X9HA 4MDIA 4P5TC 5KS9E 3ZYOA 1LDPL 3U79A 4MD4A 2XWJB 3CC5A 3IFOA 3O6FD 4NO3A 4ELMF 2R4SL 4H26A 5E94B 5I16A 3C60C 4WFHE 5MHSE 5KZCB 3ZTNL 1OF2B 4N0CD 3S96A 1KT2B 4XGZB 2IQ9H 5D2LE 3EJJX 1FL3B 2GI7A 4YQXL 3GSOB 4G5ZH 1I7ZB 1RULL 2KQMA 4DZ8B 1CD1A 2OM5A 4JRXB 3UTSD 4LNVA 3SDAC 2Q7YB 5LQBL 5FDWB 1INDH 4PGZA 3X14A 5E1AA 2HT2D 1QFWL 1J8HB 5F6IB 3IXAA 1TQCC 5HVHC 4YC2B 1H3XA 1A7QL 1ZLWH 4XCEA 4PJFA 5EN2B 4M00A 5E4EB 2CLRB 4RISH 1CZ8H 5CHNB 5KSBE 4L9LB 4M48H 1UM5L 1H8OA 2DLFL 3TBVA 1NEZG 2D7PA 3C6LA 4CMHC 3T0AA 2Z31B 2V2TA 5EBGA 3FTGB 3U9UB 1G6RB 4URTB 5BZDA 4FQ2L 4DAGH 3HNVL 3NCCB 5HHOA 1SYSB 2GY7B 1W0VB 3QIUD 4HQQH 1Q94A 1CDIA 2V9RA 1I1FA 1WZ1H 3KPNA 1LVEA 1Y6NR 1CXHA 4Z7UF 1ZLVK 2YEZB 5IKCB 4ZAKB 3RY4A 3MBEC 1YNTB 4HUVB 2FIRT 3ARXA 1I1AD 3BQUA 5HYEA 2O5YH 5IB5B 1KJMB 1KN2H 1C8PA 2FZ3B 3TLRA 1AXSB 2P5EE 4KKCD 4ALAL 4YWGH 4LSPH 4LSTH 4P9HC 5AD0A 1M7DA 2F54E 4MCZA 5J06A 3QJFA 3PWLA 3N50A 3LEYH 3PL6C 2X44D 4ZXBC 3FQNA 2Z91B 5GS0H 1HSBB 3ZTNH 4MSWA 1PKOA 3B4NA 4UDUA 1RZIB 2BCKB 4JCMA 3L3JB 3TJHC 5DF0A 1OSZA 5CSGA 2IQ9L 4XBGB 4H26B 4YQXH 4MAUL 5GISH 1F00I 1IAIL 4I4WA 1KB9J 3EYFB 1UQSA 1I3RA 1AGBB 3BWAB 4QGYA 2X4TB 1FPTL 4PJAA 3UC0L 1PKQE 5GGSA 5DRXB 2JB6B 2OR9H 3L3HA 3VXRD 1YEDA 3BPOC 5AAMA 1D9KD 1SBSL 4JJHA 2CK0H 4DKEH 4AT6B 1BAFH 1VEMA 3RU8L 3R06A 5BXFB 1Q9KB 3I50H 1CGVA 5DDHB 4AYFA 2YA0A 4XCFL 4QHKI 1OW0A 2FX7L 3F5WB 4RISL 3L6FA 3ARBC 4S1SH 4AIXA 4LLMB 5EUOB 4NO5A 4AM0A 3K3QA 5F3BB 4YDVB 2VDMH 5CAYB 5EBMA 4HIHA 1PVHA 4X5WA 1F3DH 5B39G 3A6OA 3HR5A 3DI3B 3QDGB 3BP5B 5EFIA 3QDMD 4Y7MA 2GJ6B 3QDHA 4Y4HB 1NBYB 4G6JL 3KYKL 4ZNEE 3ARFB 3K8MA 1NKOA 5EU6A 5T5NF 5MERA 1MNUL 2IEPA 3S37X 1KCUH 3QI9C 4GS7C 43CAB 4OZFG 1OHQA 4O4YL 5D6DA 4K9EL 2OX5A 4XCNB 1CS6A 5DEZA 4PJGF 1FH5L 1A1MA 2VXTH 5KN5A 1MQKL 3U0PA 4KC3B 3BEWB 4TSCL 1INEL 5JW3L 4UIKH 4R4BB 2QQKL 4PIRF 4K23L 5D1ZB 4LSTL 3U9PH 3LN4B 4C4KO 3I9GH 1G1YA 1FE8L 3MTRA 2ZJSH 5FA4B 3C5SB 4QRQB 2ADFL 1KLGA 3MXWH 4UV4L 4ONHB 3PWNA 1MY5A 4G8EB 3S35L 2ESVB 2RBLA 1F5WA 4X7SH 5KJRL 2P8MB 3OAZK 4PBXA 3ZL4L 1LEKB 3MFGB 2FJHB 3V7AE 1MHHA 2W38A 5INCB 1M6OB 1P69B 4MAUH 3BP7B 3DHMA 3CIQA 5I2IB 3CAFA 4KUCF 1AY1L 1CE6A 4IHOA 4NKQB 3DX7B 5ISZB 2CR3A 2EO1A 2VLRE 2DB8A 3OZ9L 4DVBA 1MSPA 1N64H 4OM0L 1SBSH 1NDGA 1KC5L 1MEXL 2HRPL 4I4WB 4GJTB 1T83A 5D1QD 2VITB 5FKAA 1BAFL 1PY4A 2D9CA 2V2WA 4G9DB 4QHUA 3WIIH 3RGHA 1HOCA 2OR8A 2HJKA 4PD4J 2ZUSA 3TIDA 4U1KA 2FEEL 1J8HD 2I9TB 4CVWA 2FX7H 3C5JB 4BQ8A 3BGMA 2UWEB 3RVVD 2WP3O 1HWGB 4S1SL 4FQXA 1OT2A 2C7UA 3LKQA 4PJBE 4R7DA 4ZFFA 5DRZA 1K3ZA 4OZ4A 2FYYA 4N8VG 1L7TH 5F97E 5GS2D 2W60A 3IU3B 1BF2A 1KCRH 2GAZB 3RDTD 3DX6B 2EE9A 2NLJA 4WNQA 5CMAA 2VLMD 2IBBA 1GL4B 5DVNA 1HI6B 5J1TC 1QRNA 2YUZA 1ACZA 3MJ9H 4OLYL 3OGOE 2IGFL 3HUJA 1XF2B 2NXYC 5JDJA 3KLDA 3MNWB 2ZSWA 5JW4M 1IGIH 1NGYA 4UMGA 4NM8H 2VC2H 4AJ0A 4LPUA 2EH7H 3C5ZB 4MA7H 1CE1L 4G6FB 2C1OA 4QOKE 3TN0C 1FH5H 5E08L 3V5HB 4ODXB 4NCC2 3D9AL 5IBUG 3MRRB 3UPAA 4R4NC 1P5UA 1AGEB 1H8NA 2D7TH 1EFXA 3RUGA 1WJ3A 3HB3C 4KGLA 5C0DA 3VXME 2R0KL 1FSKC 2HVJA 4JFPA 5C8JA 1SY6L 4N1CA 3GDBA 3KPRD 4OF6A 4U1NA 5F89B 4PGJA 1R0AH 2ADFH 3NCFB 2CMRH 1FJ1B 3B9VA 3UO1L 1JZ6A 4Q7DA 1YDPA 1JUFA 3SBWA 2VR5A 2ZKHH 4BH8A 3LD8B 3PGFH 2I9LB 4R4FL 4Z7QE 4L8DA 2F54B 4LHUD 1AO7B 4Y8AA 3TO4B 1QO3B 3LKPA 2HLAA 5DD0L 3P9MB 3QPQD 3TH2T 3TZVA 1L9NA 4LQFL 4OCRL 4XPBH 5J57B 4XP1L 5T1LA 4KZDL 4ZAKD 4NUGL 3RVWC 1KIPB 3SO3C 2FJHA 1WISA 4XXDA 3MV7B 2W9DL 1RIHL 1B4JL 4U2YA 1Y18B 4OKVA 4NKDA 5DJ2A 2FJGB 3LKOB 2VLLB 4PY7B 3FQUB 4OF0A 3PF2A 5MP6L 1MI5E 3BPNB 1C7SA 2IH3B 3GMOA 5AEAA 1FVDB 4OZGF 1L7TL 3HKFA 3AB0B 5GRUH 5KW9L 1JHTB 4YBQC 4FXGA 4U1LB 1PZUB 2DQGL 5EU7C 2P5WB 5C0GB 1I7UB 3V7MA 4FQQA 1ZA3A 2FCBA 5F72S 4GG6A 4RQQB 1E4XI 4GRWF 2GTWA 2E5EA 3N1PC 4NBYB 3QQ9C 1B6DA 5F88B 1U8QA 5F3HB 2HA1A 2HT4D 3VWKA 4O51A 2GAZA 1KT2A 4XGZA 3MZGB 1F8TH 1E4XH 4R2GC 5ICZA 4CU7A 1J0YA 4YXKL 2DYPB 4POZD 4XC1L 2AKRA 2W92A 1JTTA 3TA3C 1OCWL 5IF0A 2X6MA 3I75B 3FO0H 1GGIL 1U8NA 4E41B 2EIZA 4MB5A 2ATKB 4X99B 5TQ0H 3BVNB 4E5XA 5IFAH 2EC9U 4JFEA 2VDNL 4QF1B 3D3VE 3RA7H 3P4MA 5GRZA 3MLRH 1GC1C 4E41E 3EO1A 2AK4E 3UBXA 2JIXD 2X7LB 4OCSL 4RA3A 1FGNH 5HPOA 5C9JB 1EGJH 4PLKC 3H42L 4LKCA 4GSDH 1FC2D 1RU9H 3MRRA 2CMRL 1NCTA 3UO1H 2ADIB 3MLVL 2P24B 3HI1B 3MLUL 2DLHA 5CZKA 4GAGH 4Z7OF 5E4EC 5I1AB 1AGDA 3PGFL 3HB3D 1XF4A 3GHEH 5FGBC 5DMKA 2KQNA 5I1CH 32C2B 1PQZB 2J8UF 4MGXA 3QNZB 5FYLH 4PGDB 4GOSA 1V8HA 3L5HA 4M93C 1S78D 1YEGL 3GMPB 1SHMA 5GRXG 3DV4A 4DUXA 3RQ3A 4F8TA 3SGDH 3GK8H 5EIIA 4RMRA 1BJMA 3IKCA 3WV0A 1KTRL 4L4TE 3I3DA 1RIHH 3KJ4C 3HRPA 4Y2DD 4FFZL 3EIFA 4CMHB 3IDNB 5F9JB 1FBIL 4KRPC 2DQDL 3LEVL 3BQUB 4XBPA 3NACH 4M6OH 2NY2C 4QTIH 1S5IL 4XXDB 3U83A 1SJVA 1TTGA 2NY3B 2HTLD 4HJ0C 1TQBC 4WO4D 5DUPH 1MI5A 1OF2A 2NXYB 1I85C 2A6JA 1UCTA 4CBPA 3MRGB 4P2YA 4X4XA 3TJHD 2JCCB 2VL4A 4L8SB 5CIPA 3FQUA 1ADQL 5FCUH 3QNYB 2C4FU 2VZVA 1IKFH 1S7RB 2VAJA 3TT3L 3I6KA 2EXWC 4ZPTA 3N06B 5FDWA 1FV1B 5D2NB 3IFOB 1ORQB 4Y16C 3NIFF 3VGEA 3OXSA 1RY7B 4L1HA 3KPOA 4QY8B 5HHVL 5CZVH 3CZFB 1F8TL 4PJXE 4BFGA 1WAAA 3QEGL 4I48B 3PWJA 5IFHL 1P2CA 4XC1H 3W5MA 2Q6WB 4WJ5B 4LPCA 1EEYA 3LQAL 4P2QE 1IGYA 3HC0B 4HJGB 4LCWD 1RQ5A 3IS0X 4JO1H 3WJLC 2CKBH 3LVEA 1LK2A 4F7EB 4QXWA 4EJ1C 1J86A 1FLTX 4OT1L 1MFDL 1AJ7L 4F2MA 2AS5M 2VDNH 3LKRB 4BA8A 1G0XA 3MBED 3RVUD 4Z7UB 3PHOB 3KHQA 1MJ8H 1U58B 4HUUB 3QQNA 4X4MA 5BZDB 1NCDL 1FGNL 1FYTE 5FYJL 4XWOC 3H42H 5D7KD 1RK1B 4GSDL 4KKCC 3H9SA 2BSED 4DVRL 4M7LT 3LN9A 1A9BB 4KTYA 1Z2KA 4BZ2H 3ULVC 1I7TB 3VXQB 1UXWA 4DKDC 2DOCA 5CCKH 4P2QD 1GIGL 4KDTC 4LKCB 3ZT6A 5I1CL 1M71A 3V5KA 1CYGA 1U8JA 4HK3J 1EEZA 3ESUF 1HXYB 1FO0H 3MFFB 1MFBH 3VGAC 4MNQD 1QBML 2I07B 2J1KA 3ZE0F 2XQYG 1G9MH 4IRZL 1QVOA 3QNXA 2V9TA 3QDJE 1QA9A 5CS7A 4PGDA 1SEBA 3BN9C 3G5VB 4P5MA 3BP6A 3WSQH 1HK6A 5D2LA 1RUMH 4L4TA 5C09D 4D9QE 1MLBB 5D7LB 2AJSH 3L3DA 3NACL 4FFWC 5DD6B 1H3UA 1XF3B 5IMOB 3VGGA 5I74C 5T3ZL 3KPSD 5JXAL 3PXJA 4YPJA 3LPFA 2FZ3A 2Z8WC 2A38A 3PDOB 4IS6A 1RUQL 1NJ9B 4G7YH 5LCVL 3WFHA 1J0ZA 3HFML 5DLMH 4YFEA 3G08B 3V6FB 1NQBA 2VE6A 3GIZL 4U1HB 1LO3L 1KUMA 1LEIA 3C60D 3QEUA 1YEDB 5ID0B 3LH2H 3DNKA 5BS0B 4C59B 3WL9A 3QQ3B 3AY4A 3AREB 3QNYA 4QRUA 4J8RB 3CXHK 5BRZD 5HDQH 2BNQE 2IBGA 4OZHB 5JW4Q 1JV5A 4XVSH 4DTGL 1EEUA 4HT1L 2HFGL 4PB9L 2HTLC 5JDSA 2DQJL 3JWDH 3VFVB 2APBA 3KXFB 3SO3B 3PXHA 3BT2L 4OT1H 3FT2A 4QXTA 2IQAA 4PLJC 3B83A 2R0LL 4H1LA 4B7LA 4PJEA 1QBLL 3T0WA 3QUXB 3D39E 2FLBT 1HQRB 1EH9A 5I1JH 1BGXH 3DUSB 1CLYH 1JF1A 1KGCD 2QKIA 4JDZA 3C6LD 1UVQA 4DVRH 5E6YA 5DMJB 5DRZB 4OZ4B 3NN8A 2A73B 2VABB 2BY2A 5BVJA 3W82A 2Q8AL 1BD2E 1HCFX 4YZFF 2P8LB 2X1XR 3I6GA 3BHBA 4MQ7A 4OF8A 3MMEA 2J4WL 5DC9B 3ZDZF 4G3YL 1OY3B 3Q1SH 4X5WB 3IFLL 1QRNB 2Y07H 1IQWH 1X7QB 5E2TL 2PF6A 2MHAA 3KG5A 4OGZA 1BIHA 5FO8B 1XF2A 1I8LC 5E8PA 5GS2H 5D7JC 3SE9H 3WMSA 4NRZA 1XGRB 4WFGE 3KVQA 4RFNC 2X10A 5DURD 3U7WH 4RNRB 1UZ6F 3OKOA 3IJHA 3IYLW 2E6QA 3C5SA 1U3YA 2PTUA 4IJ3B 3V4VH 1YJDC 4Y4KB 1VPOL 1S7QA 2EDNA 4HFWA 2AJSL 5HYIA 4HZAA 3D0VB 1HDMA 3O8XB 3LRGA 4PRHE 3V4PL 5T3ZH 4Z7WF 3HPJB 4H20H 2HVJB 4ZYKA 1DLHA 2DQEL 4EQ3A 3B6SA 4WO4B 5HGAA 1A2YA 1DBBH 3CLEL 2FX9L 3CFCL 4PJEF 5E5UB 3HFMH 3VRIA 3KAAA 2IALB 4YDIL 1MRDL 3NCYS 4LSSL 4GBXC 2OL3B 3GIZH 3KLSA 4ZS7H 2Z31C 4EKXA 2X1PA 3FFDB 4K7PL 1IAIM 2PR4L 4P3WA 2JJSC 1PG7W 2XKSA 3W2DH 3EYUH 4HUKB 3QQ9D 4NZTH 3QWOA 4ZSOE 3SKJL 1TITA 1HOCB 4JHBA 4XAWL 3UTTE 4HMCA 5C0BB 1S7WA 4RZCA 4S1DD 3TVMA 2QQLL 4XVSL 4DTGH 1DEDA 1I3GL 2Q8BH 1OW0C 5EO9B 2DQJH 3VXRE 3SDYL 4RFNB 5GIRA 4MD0A 4N8CH 3ULSB 1GGBH 2O5XH 3WN5C 1MFNA 4LLQB 4XC3H 4JFHE 4GQ9H 4JFDB 1KBGH 4XP6H 2ZG1A 2W60B 4EI6B 3W0WB 5CJXA 3ARGD 4L3CA 1BJ1J 2BDNL 3MLPA 2GCYB 4OCYH 2VJXA 4F7PB 4Y4KC 3GRWH 2DQIH 1L6XA 5CILL 2EECA 4DGIL 3HUJE 4OIBA 4LMQI 1A4KB 5CD5C 5GZNC 4XPGL 3AFLA 5AWNL 4TTDC 1QKZH 5JORA 5SWZD 4WRLA 1TJIL 3EOYG 2DIAA 5MI0B 4B7IA 1F11B 4HXBL 1EPFA 3T0DA 4PJEB 2IPKB 3PQYA 5EO0A 1RD6A 2J4WH 1RVFL 2FD6H 1CD9B 1T6WA 4LSRL 4GKZA 4WU5B 4U1GC 5J8OA 1GHFH 1IGTB 4FTVD 1KB5B 1OAQH 2LTQC 4JZJB 4WTWA 3O9WC 1S78C 1A3LL 5JHDA 1B9ZA 2BVQB 1OT1A 3MMEB 3GSQA 1BECA 4KVCL 1X5IA 5HDLA 4PR5B 2ZSWB 1C5DB 3SQOH 1J0HA 2APVA 1I7RB 3TBSA 4DQOH 5M94B 2W0KA 2O5ZL 4I9WD 2VXSL 2NXZC 4OFYA 4PB0H 1TQBB 1XGRA 4G7VH 1BVZA 1QPPA 5ABDE 4BM7A 1WV7T 2ZCLH 4JRYA 1T7YA 2X70A 2X41A 3H2WA 5CP7B 2R56L 1IGCL 5E95B 3HMWL 4NRYB 2P43B 3AU1A 5IQ7H 4HFWB 2OCFD 4BYHA 1EFXB 1F4HA 4AEHH 3CLEH 4CNIA 3O4LE 4ENEC 3AC0A 1MRDH 2D31B 1YECH 3CSGA 1U2HA 4Z0BL 4N8VB 4ZS7L 4P3CH 1NAMB 2E7HA 2PETA 4D94A 4LP4A 5I8KH 2B4CL 1XGYL 4FQLH 4UTBH 3OXRB 1OWRM 1MCIA 1U6AH 4NQEA 2C9AA 4MAYB 4J3TA 3SKJH 1U8KB 4MNQB 1MRFH 2A6IA 2NX5E 2VLLA 4RAVA 5EOQL 3L3GA 3NAAL 1EZVX 3O3BB 3T77B 2ZSVA 4NQDD 3L5WB 5D1XA 3TT1H 5SWSA 1KNOA 1P4BH 1NC2B 2EYTA 3FQTA 4LLDB 4YXHH 5M7QA 4NM4H 1Z9SA 3DVFA 2VLJD 2YC1A 3F65A 1FVDA 4P48A 1HYRC 1WT5A 1N0XL 3WUWA 4GQ9L 4XP6L 3ZMRA 4N0UB 3NCYP 2GK0B 1T20A 3QG7H 2J2ZA 4MVBC 4E42B 3IVKA 4MD0B 3RWIA 4DGIH 2GTWB 4JREC 1QPXA 1TZHA 4Q6IB 5HVFB 4HS8H 4P59L 1TJIH 1AR1D 3SE3C 3VWKB 4G43B 4HXBH 4RGOL 4FXKB 4DZBB 4NZRH 1RIVH 4WUKH 4HG4J 3GJEA 3UZEA 4R96B 2F53E 4WW2B 2VLJE 4TOYL 3QIUA 2RR3A 4IRJA 5F1IB 3S4SA 3I75A 5DMIL 1T0NA 5CZXD 5D2NA 3IF1A 5EUKB 4UAOC 5HXMA 2F53B 4JQVA 3WIHL 5GS3A 3BXNB 4QCIB 5I76A 5EG6C 4OUUA 3P4OB 2XRAL 3GSWA 2LVCA 3K1KC 4X8JB 3RWEB 4PBWD 3I6LE 3SDCC 2PYEE 3T2OA 2VISA 4NQTA 3KLAB 1KPUB 3ARVA 5DJDB 3A6BH 3KS0H 5I1EL 1ZVSA 4Z7NE 1NC4B 5IW6A 1AGDB 1U8NB 4FS0A 5C07E 1TIUA 1N59B 4CN1A 5K9KA 5B22A 4EIGB 3D2UD 5I8CB 1KIRB 4M9OA 4O2CB 2NQCA 5DUML 4P2QA 1KELH 3UJTH 1XIWB 1F4YH 4MXVE 1MHCA 1N5AA 4NKMA 3HE6B 4UTBL 4MJ4A 3FO1A 1LQSR 1CLOH 1DUYA 4HKJB 2FJFA 4KKBC 4G6MH 1M7XA 4Y5XA 5D1XD 3DV6B 2VLKB 2VDQH 3L7FA 3NTCL 5AD0B 5EOQH 2HN7A 3X12A 1AXIB 4YFLI 1MJ7L 4YXHL 1HE7A 1YEFL 2V7NB 4APQA 1MI5B 1HILB 3T0EE 1OP9A 1MFCL 1PLGH 5CBEB 5IBLD 1CGUA 3BEVA 4GXVL 2D7QA 2PTTB 2R29L 3JVGA 3WD5L 2VR9A 1NGXA 3DLQR 1H0DB 2P7TB 3FB5A 4IIQB 4YHMH 5EO1B 3T08A 2NY5H 4IOFC 2H1PH 5ALBL 2YKLL 1UWGL 3QIWC 4PLOB 1JNHB 3LB6D 1IQDB 5GRJL 3GJFB 1MVUA 3B3IB 3O3EB 5CKGA 2J6EL 2E3VA 2GK0A 4WHTB 5C0RH 7FABL 3MCG1 4XVTL 5EZJB 1RIVL 4OQTA 1NKRA 2IF7A 2CDFB 3MRGA 4WTXA 2VE6B 4B53A 1DP0A 4GAJH 3QDGD 4HBCH 5LG1A 2YUXA 1B0RB 1I1YB 1G7MB 3C9NB 5IMMB 1BJ8A 4HWEL 5DO2C 4WI6A 3AAZA 3LKRA 5L6YL 1T0MA 2BRRL 3BX7C 4HH9A 1IL1B 3QDME 1MJUL 1T5XB 3ZYZA 3QIBC 1BX2A 4NHUA 4OB5L 2AK1H 1HKFA 4XNUH 3DSFL 4WW2F 4N8PA 2RQ8A 5IFJB 4DN3L 4IOFD 5TE4H 1P9MA 2QV2A 1S9YB 2AEQL 2X4OA 3HRZA 3SPVA 2Y25A 3EYOA 2FL5B 2Z92B 3ARDC 1J1OH 3PV7A 3RL1A 3WHE0 2VISB 2LABA 3K2MC 4MA8L 3QFDA 2FHCA 3FRUA 4X6BB 1U58A 4K7PY 4LLAA 3SCMD 5DFWH 2C4FT 1Z9LA 4P2CG 1S7XA 4WI5A 5FB8A 2AJUH 4OQTL 4P2OA 3GUTB 4NQED 3WFEH 2P44B 1Q72H 2M2DA 5HVWA 4L4TB 3QO1B 5A2IH 4TNWK 1NCCH 4WI8A 4PJFE 1GZQB 1CFBA 1QEWB 4YUEH 3RI5F 1RFDL 2C3XA 2WINA 1JWMA 1A4JB 2QADB 3T65A 3QPXH 3FMGL 1UM6L 1M1SA 4Q6IC 2VWEE 4OLVL 1D5ZB 1I85A 3T4AB 4YHNB 2R1XB 4PLKD 3RGVD 2L0DA 2WQRA 1EJOL 1A14H 1XCTA 1LDPH 4R7NA 5D2LB 3BD4A 5SX5H 3ARBD 3VI4E 1UWGH 2EICA 3SDAB 4ZG1A 4OFIA