2HFEB

Rb+ complex of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
211
structure length
211
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords FAB Heavy Chain
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
source organism Mus musculus
total genus 50
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hfeB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hfeB01
4AL8L 4XXDB 1UKQA 3DHJA 2XWJA 3TN0D 3ZO0A 2FSEB 4AEFA 1FG2A 2YWZA 5EPMA 5E7FA 3LQAH 2DQIL 5I17A 2VDOH 1ODAA 1RZ7L 2DIBA 4OLYL 3WUZA 4LSPL 1NGQL 3L5WB 2F8OA 3CSYB 5EO1B 5CIPH 5SX5K 5FYJD 3QUXA 2PTTA 4UT6H 5KZCB 3G5XB 1IGML 3MRQB 4QHLB 1X5AA 3QQ3B 2D0GA 1ULVA 1M7DB 3QXDA 1NBVL 2A74A 2WLYA 3VFVB 1I4FA 1ZV5A 1FC2D 4Z7OF 1PZUB 5LAXA 3S5LG 4YAQA 4CU6A 4DZ8B 4NZTL 5E7BA 3QYCA 2DQTL 4QHKI 3BW9B 3OX8B 2Q7NA 2C1PB 4KRMB 4F7EA 4JRXB 1FG9C 4POZC 4KRNA 3L9RA 1JHLH 1XZ0B 4P59L 1Q72H 4YH6A 1NMCC 2DICA 3KPNB 3VFSB 3RVVD 4KJYA 5IJVA 1M05B 3A0OA 2F19H 5D93B 4X4YA 1LE5A 1Q9OB 2DI7A 3OSKA 1GRWA 2FIKA 1CLOH 4MD0A 4LAQH 1RIUL 1K9TA 4WGWB 4IMKA 3VXRD 5DJ0B 3DUSA 2J88L 5L2KA 1PW3A 4Y16B 2IG2L 3MA7A 3LN5B 4U1HA 4MHHG 3VFNB 5TPWH 4TUKL 3V5KA 4ZPTA 1OARL 1FL5A 1KJ2A 1KPUB 4YJZL 4GRWB 1DEEA 4M43L 1MIEH 2HN7A 4KI5D 4XNXH 3TBYB 1BLNA 1HI6A 1Y18B 1AKJA 1DBMH 3VXNA 1F6LL 4PRNA 5B38G 4LIQL 5GRUL 5FYKL 4ENED 1FV1B 5MP6L 3IXTA 5DLMH 4MA8H 2HG5B 3BZFB 2Q86A 4K7PH 2DYPB 2P8LB 1I7ZB 4K23H 1FCGA 1UADC 3CLFL 4OF8A 1K2DA 3SDCD 1C08B 3B9DA 1DL7H 1KIUA 3T1FA 3U4EB 3WFDH 1YDPA 3NH7H 3KWWB 5JOEA 3U7AA 3BT2H 1NCTA 1U6AH 2ZSWA 4DN4H 4PJCF 1UH2A 1UG9A 1LD9B 5FB8B 2GQHA 4F7TB 1KGCD 4G9FA 4V2BA 2NQCA 3QEHB 1JNHA 4NO3B 5I8EA 4X98A 2AS5M 1DANU 5IEHB 4TRPL 3FQWB 5I1KH 3T2QA 1MFDL 3FT2B 1R5WB 5IMMB 2FECI 4OZHA 3D69B 2EDQA 3QUYD 1FYHB 5CSGA 2XQYG 3CJJA 4K3HA 5FKAA 5FHBH 3WS3A 5AAWA 1XGTB 2YPLA 4LFHD 1X5XA 3WYRA 2EIEA 4RMWA 5TDOB 4OTXL 4CVXB 2VXTH 2VNCA 1M7XA 3QDME 2XTLA 3LN4B 1RJZA 5CKGA 3X3GH 1HILA 4XCNA 3IB4A 1IC7H 2VTFA 4TSBL 3T4YA 4DQOL 3RGVC 1PKQE 1OW0A 3F6IA 3UC0H 2MQ0A 5IHUL 1ZEAL 3B43A 1RZGA 4GG6F 1HWHB 4K3JH 4MX7A 2EEAA 4RISL 4P57A 2R4RL 1QHOA 3ARQA 5HGAA 1N0XH 3THML 1RY7B 3GRWA 4U7MA 5IB2B 4QRQA 4UTBL 1HHKA 2IFFH 4OZ4A 5FEBA 1CIDA 5J13C 1X5KA 2BC4B 3K4ZA 4KTEL 5D6CA 3IDUA 4PGDA 2OP4L 5KANG 5E2VH 4A2MA 2MCG1 3INUL 1YNKH 3KG5A 2CKBB 1U8MA 2VC2H 1RUPL 2VZOA 3FZUC 3BH9B 4QYOB 4JM2B 1T5XB 2X42A 2DL2A 3ARFD 1SYVA 2AVGA 4L5FH 5GGTA 3G5ZB 4I8DA 3JWDL 3U9UB 1OF2A 3IDXH 5FO8B 4LNVA 4N1EA 4JN2B 1CTOA 1QFWH 2ZCLL 3JTTB 1EHXA 3GSXB 5ALBH 1ZT1B 5ESAB 2Q7YB 3RTQC 3O45A 1E28B 5GRJH 5JOFB 1IT9H 1IRAY 1F6AA 2A38A 1CLZL 3M17A 1IC4L 5JORA 4HS3B 3EFDL 1NUFA 3ZKND 1AGBB 2FEDD 4YGVA 5EU3A 1FPTL 3C2AH 5DK0B 2Y7QB 3V79C 1RUQH 3BIKB 5D2NB 1DSFH 4J8RB 4BZ2L 3MRBA 4ONGL 1OGAE 1WWCA 3SGKC 3K1KC 4PV8B 3MJ9H 3OXSA 1A5FL 3B2UC 3NTCL 1BZ9A 3FB6A 1QRNB 3UJIH 5D8JH 2CDGA 4EN3C 5EU6E 1C7SA 3V6ZA 1S78D 5HVHB 2NTFA 5FGCB 1NCCH 3X3FH 1L0YA 3DSFH 3O3BB 3PGDB 3NABH 3EYQD 3QA3A 3TFKD 1RIHH 2RB8A 4M03A 2BCKB 3JWDC 2J6EA 3QULB 3G5VB 4FRWA 4LP5A 1QR1B 2AK1H 2HT3D 4M7ZC 2J5LC 5I0DA 5DRXA 4L3EB 1GGIL 4YIQA 3VH8B 2Q6WA 3ZKSD 3KPOB 3DETD 3S36X 4NRXB 1Z5LB 1OB1A 4UT9H 15C8L 1UJ3A 2JJUA 3NVQA 1ETZA 2WIIA 5DJ8B 5LXGH 5JLZA 5ISZA 4Y19E 1RUAH 3KJ6L 5EH1A 3OHXB 3RZWA 4XC1L 2HTLD 1N5YL 1A7PH 2NY4B 4NYLA 5MEOA 1E27A 1SJXA 2JJTC 3C08L 3ARUA 2IH3A 1QPPA 4WV1C 3HE6A 3QCVH 5HHPB 4BQ8A 4LSDA 3DMMB 3W0WE 5E0QA 3MGOA 4JFOB 3MUJA 3RGVA 5ACMA 4KMQA 1RZ8B 3O2WH 4V1DB 1X6LA 4G8GB 3B2VL 4YX2L 3U0PB 4YHNA 2VERN 1R24B 2BERA 3ALXA 1OGAD 1S3KH 4YDLB 5E2WL 4K3EL 4FN0A 1G7QA 4FFYH 2I5YH 1CT8B 3FO2B 4L4TD 3OAUL 3HE7D 3HS0A 1I7RB 3AY4C 5IFJB 2OTWB 4PUBH 5I1EL 1KBGL 1RD6A 3RWGB 3ZE0F 2CMRH 1JN6B 2VAAB 5BZWB 5E94A 3B3IA 1TNMA 1R5VA 5C0AA 4WO4B 1MEXH 5LWYL 2GUOA 3LEVL 4LLVB 2ITCA 4FQCL 5CZXD 4U1JB 4P9HC 1UEMA 4MCZB 3P4NA 1WZKA 5ESQA 1CS6A 5K59E 3BPOB 3I6KA 5TGBB 4HWZB 4UV4H 3SKOB 4PJIB 5IVXB 2CDEB 1MJUL 4HF5L 3VD3A 4WU5B 1QFWM 3GZKA 5D7JD 1FFNB 1HXMA 1MCSA 4AM0B 5C0RL 2HT4D 2NX5D 3SGEH 3H9SB 3L3OA 3DRQA 5IKCB 5EWIH 4Y19D 1EH9A 4H5SB 1JJUA 3MBXH 4LSTH 1WC7B 5D7LE 3CH1B 5T5NF 2YPKA 4G6FD 3OR6B 1A7OH 4OF7A 1HHHA 4APQD 3IDNB 1T1XA 3DX6B 4XTRD 1ZANH 3DTXA 3GSUB 5ICYA 3W0WD 3C6LD 3BO8B 4TULH 5BOPA 1N26A 3QCTL 2A6KA 4M61B 1QEWB 1EFXB 2Z91A 1W0WA 5KVFL 4Y88A 4J4PD 3PHOA 3QFDB 1I9JH 1F11A 1T22B 3F6LA 5CFHA 3ROLB 1BPVA 1WAAE 1M7IB 1SJVA 1N6VA 4JR9H 4DWHA 2HJLB 5CSZA 4ZO6A 1N7MH 3KPSE 1CDHA 1X5HA 3FCTA 1CFQA 4H8WH 1PJ9A 1JI1A 2AXGA 2X4OB 3FB8A 2R0WL 4WWKD 3FFCA 5J57B 1TETH 3JWOL 3UTZA 3P0YH 4Z7UE 4I48A 4P2CG 4GBXD 4PJXA 1VEOA 3PHQA 4CL7A 1QVOB 1EJOH 4MD5A 4Z9KB 5HSFA 2FJGB 5DZOA 2IQ9H 2WINA 3I2CL 4HBQA 1A1NB 1NFDF 1FIEA 2OR9H 1W0VB 4ZUTB 4ISVA 1KCSH 4BH8A 4HPOL 2GTWB 1GZQA 1MFNA 3RWDA 2PO6D 3CFCH 3NZ8B 4KAQL 4JRYA 2QL1A 3P30H 5DVLA 4Z0XA 4MJ5B 1AGDB 1HNFA 3O8XD 4BK4A 4BQBA 4JQXA 5I16B 2AABH 2PW1A 4XMPL 5JW4N 4XP1H 1KEGH 1UB5A 4JY4B 2BSTB 1HCFX 2AJYL 3MXVL 1HEZA 1MRFH 3R4DA 3RL2A 1AO7D 5TQ2H 3WN5C 3AS2A 1FYTE 4YDKH 4WJ5B 2P5ED 1DLFH 2HLAB 5DHYA 7FABL 2FSEA 3NIGE 4KV5E 4LLMA 3BP7B 4P5TB 2NXZB 2P5WE 5C6WH 4CVZB 4H1LB 3AY4A 4PLKD 5EU7E 3U0TB 1Q1JL 2I60H 4LCIH 4FXKB 5KAQF 3L5XL 4N0YL 2ENSA 3VDAA 4OKVB 3G5XA 4UDUB 1U9KA 5EN2B 3FRPG 4LLWA 2VL4A 3SPVB 1EEZB 1UA6L 3JWOC 4QHLA 1LO3H 4YHKL 4JFDE 4WFEE 3KPSD 1HK6A 1OSPL 1M7DA 4NRYB 5GGSB 5C6TL 3VFVA 3P4OA 1AP2A 4AG4H 4C55A 5T1LD 4HMDA 3VDBA 1N3NA 1U42A 4ZOCA 4M1GH 2H2PC 4HIXL 4NZRH 1EZVX 4LCUA 1EPFA 3QUZB 4N5ED 5SWZB 5SX4I 4DZ8A 3BW9A 1IFHL 3OX8A 2C1PA 4JRXA 1BFTA 2J8UF 5DT1L 5JHLL 4BSWB 2R8SH 1XZ0A 5DRWB 3TO4D 1R0AL 4MJ6B 2GSIB 4K3DL 4LP4A 5B3JF 2L7JA 2WNGA 4Q0XL 4YHLL 1ZLWH 3AM8C 3KPNA 3RU8L 3VFSA 4OGYH 4M7KH 1FORH 1M05A 1RZKH 1Q9OA 2P4AB 2FX9L 4OD2B 3E1F1 1OPGH 1T89C 1BQLH 5CZKA 4ORGA 1PBYA 4Y16A 3LN5A 4YPGB 4MNQA 3T0VA 1ZVSB 5DO2D 1KPUA 1LO0H 4L3AA 3C2SA 3TBYA 5D2NC 1Y18A 4P48A 1RSFA 3L6FA 4RNRB 1FYTD 4Y2DB 4PJ5B 2Z31D 1OL0A 1FV1A 1MSPA 2HG5A 3BZFA 2DYPA 1PSKH 2P5WD 2P8LA 1I7ZA 2W0FB 4E5XB 3CX5K 4AMKH 1U8LB 1B4JL 1C08A 2BY2A 2R29H 3U4EA 2KPNA 3W2DH 3CFDB 1NAKL 2DLTA 3QFJE 5CZVL 3KWWA 2IANE 2Z8VC 5C08B 3LKNA 2B7DT 5I15H 1LD9A 4F7TA 1ZGLB 3O6KH 2ILLA 1J05B 1WICA 4PJGE 3BEWA 3QEHA 4PRDB 4NO3A 3OJVC 1CF8L 1M71B 2XKUA 3VRIB 5IEHA 5MERB 2Y06H 3FQWA 2Z4QA 3VG0L 5IHZA 3HPJB 1WK0A 3S37H 3BAEH 1WBXB 1R5WA 4Z7WB 2YD7A 5IMMA 1HYRC 2VKWA 2VDKL 4MXQC 4YBLC 1K5NB 1G6RL 3D69A 2VDNH 2BDNH 5C0FA 1EGJL 1G9ML 1VPOL 2P8MB 5CKAA 3IJSB 3CFEB 4X5LA 1XGTA 1MFAL 2F54D 4KUZH 1JGLL 3W39B 5D71L 2AEIT 2VLJB 5TDOA 1AFVH 4CVXA 4C56D 3CNKA 3U6RB 2CK0L 2IGFH 1HIMH 3HCVB 5F89B 4HSQA 3KXFA 3DMMC 2DQHL 2YK1H 4PYHA 1U36A 5I8CB 2IBZY 5DD3L 5EA0L 3O3UN 1JCKA 4PG2C 2A83B 4I77H 1A3QA 1T6VN 1WGOA 1DQMH 1VGEH 5ITBH 4K3GA 3PDGA 1T0PB 1S5HB 2JJVA 4LOUC 4I3SL 1G7IB 2F53D 5IB2A 4X5XA 2H26B 3NIFF 4OZFH 2VLKE 2BC4A 2RFXB 1P4LB 5C8JB 4CMHB 1YMHB 1CFSB 3QH3B 5EFIB 4N8VG 4NHUB 3MV9D 3O2DA 2CKBA 5JQ6L 1IAIL 1MCFA 4LIQE 3T0EB 5AZEH 3QFJD 3BH9A 5EBLB 5MEQB 1M1SA 4F37K 4U7SA 5IVZB 4QYOA 4JM2A 1T5XA 5BS0D 1T0NB 1I8KA 4NDMB 1G9MC 3MOAL 2FLRT 5GGVH 1NCBL 3BPOC 2AEWA 5HYQB 1FVEB 4PLJC 3U9UA 4NT6B 1I1AD 3IDYB 1NEUA 5F1NB 5FO8A 4LARH 1D5BB 2NZ9D 4JN2A 1QACA 2B4CH 1TJIH 2ZWLT 3ZT5A 2I07B 3GSXA 1E6JL 4N1HB 3Q6GL 5HI4C 4G3YH 5ESAA 4UTAH 4NHCH 3KPTA 5JOFA 1E28A 3PV6B 5DA4A 3BD3A 3GSRA 1T89A 4XVUD 3KPMA 4M6OH 4WW1B 4JY6B 4XVJL 1CICA 3ARBB 3ZDZE 1AGBA 4LPWA 2MPAL 5E5UB 3UTPD 5DK0A 5DSCB 4XWOC 3ZYZA 3S7GA 2Y7QA 1RIVH 4GO6B 4OSUH 3SE9L 3EOAB 4MYWB 4FA8A 4LSUL 5D2NA 5T3ZH 4MS8C 4RRPG 4XCCL 2X4QB 4J8RA 2ED8A 4X6DB 1FNHA 2G75B 1U8QB 4PV8A 3IU4H 12E8L 1N5AA 4HFUH 2ZPKL 3ZKXB 3BWAB 4KQ3H 1QRNA 2BVEA 3O9WD 4BELD 2APTA 3MRCA 5IOPB 1I7UB 5D6DC 1A22B 2ESVB 2Q8BH 5FA3B 1JZ6A 5C1MB 3BE1H 3PUCA 3IYLW 4KK6D 3O3BA 3BISA 1JGVL 3WNLA 1II4E 2VDRH 2BCKA 4QGTA 4EOWL 5TDPB 3SN6N 1QBML 3WEXB 1QR1A 2ATKA 3G5VA 5E6IB 1NCNA 1B2WL 1OTSC 1JNNL 1HXYA 3VH8A 2IEPA 1RURL 5E99H 5CUSL 5D7SL 1Z5LA 4X7TB 2QQNL 3DURB 4Y4HD 1CDGA 4HDIA 4M6NH 4NOFA 1MHCB 2HYMA 3MA9L 2VLRE 3LKSA 1KEMH 1NLDL 3OHXA 5F93C 4UINL 1QKZH 3I85A 1ZVHA 5CGYD 2CKNA 5I9QB 1RZJH 3C87A 2BY1A 4G7VL 5DS8B 4M00A 3BH8B 1EUUA 3QEQB 5HHPA 1ZGLP 4JY5L 4S1QL 3DMMA 4IJ3B 3RY5A 1FVCB 2HH0H 3R1GH 4JFOA 4KTDH 1YECH 1XF1A 3BKJH 3TT1H 2BP3A 1Z6JT 1RZ8A 5TQ0L 1NCDH 2DQCL 1NANI 3PJSA 3Q5YA 1CGXA 4PG2A 1H3UA 4V1DA 5FV1L 4PP1D 1MI5E 2EYTB 3U0PA 2FO1A 5I8KL 4FABH 1EV2E 1R24A 4PTUB 4YDIL 3QUKA 2XZAL 1YMMB 2A0LC 3I9GH 1NCAL 4P5TC 2NXZC 4M7LL 3MOBH 1CT8A 3FO2A 1CDYA 5CJQL 1UM6L 2X89A 3AREC 1I7RA 1RZFH 2GJZB 5D7IB 5D9SA 4ZO7A 3RWGA 1JN6A 2A1WL 4OUUB 5BZWA 5I66A 3SKMB 5C09E 4WO4A 1T1ZA 1OP5K 4KQ4L 4LLVA 9CGTA 4YFLI 4MCZA 3TYFB 3BUYB 1EGJA 3D2UB 2DLIA 5TGBA 4HWZA 4XAKE 1EMTH 3SKOA 4PJIA 5IVXA 3HTLX 2CDEA 2FL5B 2APVA 4WU5A 5FM5O 2NY6D 2Z0BA 5BOZG 2UVFA 1AJ7L 3D3VD 3TEUA 3UBXG 3TLRA 4ODTL 3EJYC 5F9OH 4NQSA 3RVWD 1Q0YH 3H9SA 2A9ML 4YHIB 5IF0A 2GK0B 3P0GB 3ZTNL 4I3RH 4U6VL 4G6KL 4H5SA 1UZ6F 1FH5L 3LB6C 3CH1A 2WIMA 4MLSA 2AP2A 3IDNA 1Q9LB 5AG9A 3DX6A 1TZGL 3WJJC 3KPRD 1LO4L 2OYPA 3GSUA 3NPZB 4RGNC 4TQEH 4ZS7L 4Z7OE 1OP3H 3BO8A 4XPHH 5J6HB 5C0CE 3ULUL 3CPLB 4JB9H 4OT1H 4LRNH 1QEWA 4M61A 5D1XB 5CIPB 4LFHG 5ADOL 4K2UH 3OKEB 5CWSB 4YHYC 5D6DA 1MI5D 1BD2D 2VXVH 3QFDA 1TCRB 2W1NA 1T22A 2HA1A 5L6YL 3ROLA 2Y5TB 5DVNA 4M62L 1A9EB 5E6YA 2HJLA 5GZND 5HYFA 1Q0XL 5ICZB 2VYRE 4XCEB 4LVHB 1HINL 5GRVK 5JA8B 1REIA 4PJHE 5LCVH 1NMBH 3WKNA 4GKZB 2X4OA 3QIWB 4F15B 1KSRA 3V4VH 3ARGC 5IV2B 1JL8A 4KK5D 4HXAL 3DIFB 3BN9C 3OB0K 2ZUQC 5E5MA 3WFBL 4G5ZL 4GRWE 4TUOB 1QVOA 3U83A 3UPCA 3VFUB 1QLEH 5TF0A 2E6PA 3KS0J 2FJGA 4XAKD 4R2GD 3ILQC 3OGOE 3CMOH 3P73A 5EO0B 1DVFD 1NBQA 3RVXC 2H3NB 2W0PA 3VWJD 3FO1A 4YLQT 4PJEB 3IRPX 2DIAA 2YOCA 1XGQB 4U1MB 5HDQH 2HWZH 4X80L 4JFQA 5C2UB 2ERJB 4UMGA 4GRLD 5A3IC 4B7LA 5BQ7A 4MJ5A 3GI8H 5IWLC 3ULUC 5I16A 3MYJB 4RCAA 5D5MA 1I3GH 1DQJB 4JY4A 2BSTA 4RFOL 4ODSL 4PJCE 4PJXF 5F3BB 4XPTL 4HWEL 1CD8A 1VFBA 4NO0D 3BKML 5ITFB 4Q9QL 2HLAA 5TJWK 3BP7A 4P5TA 1O0VA 3IU3B 2DDQH 2KZWA 2PR4L 2W9DL 4PS4L 5TH2B 4CVZA 3U0TA 2VN4A 4FXKA 5KTEL 1PG7W 1F58L 4OKVA 4UDUA 5EN2A 3LAFA 3T8XB 4OCXH 4WCYL 1IM9B 3LDBB 4YUEL 3MLWL 3SPVA 3STLB 1MCLA 1P4IH 2WBJC 2VAJA 4NRYA 5GGSA 4FTVB 3MLVH 1FFQA 3QO1A 2FBOJ 4DGIH 4BKLB 1RULH 3T0EC 1PLGL 2VDPL 2AI0H 5DUBB 1BVZA 3B8YA 3GNML 3QUZA 4P9MH 4X4XB 2BVOB 5FO7B 5SWZA 1PEZA 4A6YH 4ODHL 4TTDC 3OWEA 3EOTL 2CLZB 5SWSB 5HYEA 5DRWA 3KR3H 3W11C 4POUB 4HD9A 2GSIA 4C83B 2ZUWA 4R8WH 4PRIE 3IDYC 4N8VA 3LSOA 4DEPB 3VWKD 2ZCKL 1KB5H 3B9EA 1IJ9A 4QXTB 1A3LH 5DD5H 4OD2A 2OL3H 1TIUA 4Q58C 1CFVH 5JXED 3TWCL 1L6ZA 4LL9A 2QSTA 2H1PL 3ARBC 3OAZH 2CH8A 1SYSB 4CJ0A 5AG8A 5IESL 1A2YB 4YPGA 3QQ9D 2XPGB 3O6LL 1RFDL 4Z0BL 5HYJB 3IFLL 1ZVSA 3IDIA 4JGUA 4RAUB 1K6QH 1NCUA 4FQXD 4BK5A 3L3GB 2IPKA 5DFTA 3SCMD 1YC8A 3IDGB 4RNRA 5KSUB 4HJ0C 4Y2DA 5FCSH 4ODBD 4PJ5A 2Y07L 2HMIC 3QWOB 4E41E 3ZE1F 5GS0L 4JJ5B 3KLDA 4E5XA 2PXYB 3CD4A 1X5IA 1FZJB 1CI5A 1YYMH 2XY1A 3ARRA 4JKWA 4DKEL 1J1OH 2H8PB 3CFDA 4LSRH 1U3ZA 2FX7L 4RRPA 4ETYA 4Y5XB 1WWWX 3FMGH 5GJSL 2BRQA 5C08A 3WNPA 3O2VH 4Z7NF 3TH4T 3MXWL 3CGTA 3U48A 1HE7A 1J05A 5E6IC 1GGTA 5KSVB 4PRDA 4Y5YB 3MR9A 1LE9B 2HKHL 4KKNA 1F4WL 5D70H 4QY8A 2XI9A 1RMFL 4QOKD 2EDDA 4HQQL 3HPJA 4IRJB 5F7EL 5FA4B 3GJFH 1WBXA 3MMEB 2MCPL 5GGRB 4FG6D 1RHFA 4HMCA 4PP2B 2DLEA 1DCLA 1AY1L 1K5NA 3D39E 5CAYB 5BVPL 1S7XB 3S98A 3VFGL 3QIUD 3IJSA 3K8KA 1CK0H 3CFEA 2MMXA 2PUQT 5AYUH 3MJ6A 3BP5A 4QRSB 4F3FB 1U2CA 4M5YL 1NBZA 4ODVL 2VLJA 4NNXB 3D85A 3IFOB 3U6RA 5F1SA 1T2JA 5LGKA 1CL7L 2BRRL 1H0DB 3HCVA 5IT2H 4X5WA 2OR8A 5D7KD 5I8CA 3MODH 1JZ2A 3ZLQC 5D2LE 5CSBA 4JQIL 5H35B 3MV8D 3NN8B 4JFHE 1Z0NA 2A83A 3WNKA 3WXWH 5CBAB 2XN9D 2EDYA 4GXUN 1I1FB 1PX3A 1S5HA 3KAAA 4JEGB 3VXPB 2Q8AH 1G7IA 1WWBX 1J0YA 3PWPB 3CX5J 2MJWA 3CVHL 2H26A 1B6UA 4WHTB 2VDOL 1CGSH 3NIDF 2RFXA 4E41D 3FKUS 1P4LA 1D3CA 4O02H 5C8JA 4LLQB 1YMHA 3QH3A 4UT6L 1XF3B 4NHUA 1TITA 4Q9RH 4LK4A 3WUWG 3TYGH 5EBLA 5MEQA 5C0ND 5IVZA 1OD7A 2AERT 1T0NA 2J4WH 1UXWB 1RJCA 3VFPB 3MBEB 3UROR 5HYQA 1FVEA 4NT6A 4LLUB 4YE4H 5D72H 5F1NA 4LU5H 2XXCB 1VENA 4H0HB 1DQLL 3WFEL 4WHYG 1JHLL 4D9RE 1Q72L 3H6JA 4K7PX 4HCRH 5I1CH 2BY0A 1EHLH 3HAEH 3PV6A 2HFGH 4JFPB 1S9KC 2E27L 5GS3A 3ZE0E 4JY6A 4Y4KB 5IFAL 3O6MH 5JW3H 3ARBA 2F19L 3A6BH 1W8OA 3BZDA 3MRPB 1CLOL 4IRZH 1EHNA 2EE9A 4LAQL 3TBSA 3QDJE 4JM2F 4UIMB 2X9YA 3SGJC 1DJSA 5DSCA 1FL3B 3O11B 3SEPA 3EOAA 3UBXA 2CSPA 4G6AC 5SX5H 5TPWL 3TJHC 2X4QA 4X6DA 2G75A 1U8QA 4BZYA 2R0LL 1VFAA 4X7SH 1MIEL 1MREH 4XNXL 3BWAA 4TPRH 4WUUA 4P46D 4XHJC 1CFNB 5D1XC 3WDHA 5IOPA 1DBML 4RX4D 4ONFH 4MA3B 1I7UA 2P44B 1VFOA 4AH2B 4LBEB 2ESVA 5FA3A 3DVNB 4E42B 4NKMB 4MA8L 5DLML 3MRDB 5IROC 2HJKB 2Y5EA 3SDAB 4K23L 1ZTXH 3BIAX 1J8KA 4QCIB 2UWEE 4Y4FD 1DL7L 1JPTH 4G8IB 3WEXA 2F5AH 4O2FB 3MUZ1 1CE6B 1MAKA 5E6IA 2YA0A 4YC2C 3TJEH 4F2MB 4YPJA 4F15C 3BT2L 4QNPF 3TA3A 1U6AL 4DN4L 3QIBD 3DURA 3VRJA 5IBUG 4MDJB 4KKLC 2O26U 1JWUB 4ZFGH 5LBSH 5I1KL 4ZTPH 3HC4H 3PGCB 5ESVB 4JFEE 3P3YA 3CDGB 3T0XA 3MUHL 1MUJB 2EYSA 4PGJA 3RX8A 1IGJA 3I3BA 1BVKB 4ELMB 5DFVD 4D9RD 5FHBL 4IOFC 3W9EB 5DS8A 5FCUL 3BH8A 1D9KB 1A3RH 1JRHI 2DBJA 1ZLSH 1QSFB 4U1GB 2ERJC 1FRGH 1S9WB 1FVCA 1YEHH 2VE6A 4L4VE 2ATPB 2VXTL 2DM2A 3OXRA 4G80B 4Z7VE 5FGSA 3QHFH 3X3GL 4HW6A 4HUWB 1LILA 5C07B 4OLUH 1A4KB 3QDAA 1IC7L 5AYQA 5C3TA 2EYTA 4AK1A 3S88H 3TPKA 2Y6SD 2AV7B 4ZOEA 3QDGD 3UC0L 4JO4L 1WQVT 3JV0A 43CAB 2RAMA 2ITDB 5FOJA 4XNMB 1YMMA 4K3JL 1Y6KR 5SX4H 1H3TA 5DTFB 1N0XL 3K2MC 4PRPE 1U92B 1WJ3A 5D7IA 2GJZA 1CFBA 2P1YA 4L8SB 2X4RB 1YPZA 2WUBH 3IJYB 4HLJA 3F7YB 4OUUA 4QRUA 3TF7C 4LPVA 3FQRB 3SKMA 4WNQB 3DXAD 3LV3A 2IJ0C 1KCRH 3LDBC 1I9EA 5E2VL 2YC1B 2ED7A 1QYGH 3TYFA 4XWGH 5I30L 1YNKL 3OR7A 3BUYA 3ULVF 3D2UA 1J9CT 3AU1B 4WEMB 3QNYB 1A14H 4LSQH 4L5FL 5I1AB 5M94B 3C8HA 3KJ4B 3SDDB 3IDXL 1KJMB 3QP3A 4TVPE 4YHIA 4ZFOB 1QFWL 2GK0A 3VXUD 2AJZB 4ERSH 4P2QB 3FOMA 5D1ZD 4JFED 4DEPC 4X7DC 1NFKA 1IT9L 1G84A 4J3WA 4OFVA 4M1CD 3CSGA 1Q9LA 3ROOB 5HHQB 3HA0A 2W92A 1LQSR 2O61A 3CFIC 3TCLA 5J6HA 1B90A 3C2AL 4PY7B 3CPLA 1F5WA 4JFFB 5D1XA 5CIPA 2NMSA 4OBRA 3ZHDA 3VDCA 1DSFL 3L1OH 3VMPA 3OKEA 5K9QG 2J8UE 5CWSA 1TCRA 1T1YB 3MJ9L 2GJ6E 3EDJA 2V6HA 5B3JE 5TDNB 1DLHA 2Y5TA 4CVUA 4ZD3H 5IROA 4ZFZB 1R3HA 1A9EA 4HG4J 4JGMA 3UJIL 2EH7L 5GRWA 5D8JL 1UM5H 3G6JE 4OM1H 2CGRH 5E8EB 4BFIA 2G60H 4G8FB 2PXYC 1RK1B 1NCCL 2IAMD 3X3FL 1MF2H 4MJ2A 3DSFL 4DZBB 3BPNC 4GKZA 4NPYB 2VL5A 3NABL 3QIWA 4RGNE 3DVGB 5IV2A 4J23A 3HZMB 4Y5XC 2ADJB 1KTKE 3DIFA 2AK1L 5DEZA 3VXME 2XA3A 2VLLB 3SO5A 2I27N 2P47B 1WFTA 4R0LB 1KENH 3C8KB 3MV11 4UT9L 3CXDL 2OJZH 4JKMA 4AL8H 2H3NA 3D0LA 4IRJC 2LQRA 1IAOA 3FAWA 5LXGL 4PJEA 1SEBB 1JUFB 1QD0A 4HK0B 3JWNC 5EZIH 1XGQA 1RUAL 4U1MA 5L8JB 5I73C 1A7PL 3QI9D 4U1KA 4TVPD 4LAJH 2X1XR 2XWTB 5A2KH 3GSNA 1U3JA 2HKFL 4GLRH 3MYJA 1L0QA 5F9DC 5JO5B 1ADQA 1DQJA 5A16B 5DURD 4Y8DC 3GBLA 4R4BB 4PGCB 5F3BA 1NBVH 4OLVH 4CADB 1H8SA 5DD6B 4G8EB 2AXHA 3O2WL 3QAZB 4JDTL 5ITFA 1L4IA 5FUOH 4Z7WE 2WWKT 3T04D 2DWDA 4PG9B 4X6EB 5TH2A 5LGJA 4Y2OA 1AXTH 5AWNH 4M7JH 2Q76B 1S3KL 3WO3B 5INDB 4JG0H 3GHBL 5IQ7L 5HVWA 3ULUE 4U2ZA 4FFYL 2I5YL 2V9QA 2WWKO 3QUXD 1G0XA 1IM9A 3STLA 2A6DA 3B9KD 4YZFE 5D5MF 2GSGB 3ECBB 3LRSB 5IBLC 4FTVA 3QXAB 1PQZB 1FLTX 2MTPA 1MEXL 1UM4H 4BKLA 1SMOA 4KJQC 1WFUA 4ZUUA 4PJAF 1H3PH 3MTRA 2XQYK 2BVOA 1OY3B 4HK3J 4TUKH 4HZLB 2BVQB 1PY9A 4TOYL 4UV4L 4L3CB 5T3XD 2CLZA 3VXMD 5HJ3B 5SWSA 3IT8D 3RRQA 1I3VA 1AQDB 3GSVB 3MBEC 4C83A 2FYYA 1A1MB 3HPLB 5GGQH 1SVCP 1GVIA 4FQJL 4LIQH 3O3DB 3OMZA 4QXTA 3NIFE 5MP6H 2VZ3A 5EWIL 4H0IA 3MBXL 4LSTL 2P8PB 2JK5B 4NN5B 1I9RH 4W68A 3TZVD 4X7EC 4Y4KC 1H5BA 1A7OL 1SYSA 5L2KD 2XPGA 4O5LH 5HYJA 2M2DA 3IJHB 4RAUA 4X8XA 3ARVA 5H37H 2VUOA 3L3GA 4R4NC 2QTEA 1I1RA 4TULL 2EKJA 5HGGS 4OZFB 5KSUA 3GK8H 4NWTH 3V6BR 4TRPH 2WANA 2ICWB 1AKJD 5DJ2A 5E4EB 4N0FA 3QWOA 5A43C 2BNUB 2ZSVA 2YS4A 4JJ5A 3FFDB 4EBQH 1I9JL 2IPUG 2NY1B 1FZJA 3PHSA 1T0MA 3UYRH 4JR9L 1P2CB 1N7ML 4FXLA 5C0IB 4LCCA 1X7QB 4XH2B 5FIEA 4Y5XA 3SDAC 3ULSB 1B9ZA 4OZIE 3AXLB 3K80A 1JHTB 4H8WL 3AGVA 1KLFA 1N4XH 4KKAD 5KSVA 3A67H 4Y5YA 4GT7A 3LEYH 2LABA 1TETL 1W72A 3C5ZC 3P0YL 5CD5D 4HUMB 5FDYA 4OZGA 4UI2A 5FA4A 1FHGA 3MMEA 1EJOL 4PFEA 2VLME 4PP2A 1NANH 1S7XA 2IQ9L 1ACYH 1QG3A 1KXTB 4HIEB 2OR9L 3NCBB 2R4RH 4PJDF 3BDYH 1V3JA 1KCSL 4QRSA 4F3FA 2CLRB 3S6CA 1MCQA 2NY0D 1G7HA 1UACH 2DM3A 4NQEB 1S5IH 3DI2B 5F1IB 5HY9A 4NNXA 2FH6A 3CFCL 4KTEH 3IFOA 1JHKH 1A47A 3P30L 2R9HD 2DS4A 2XKSA 1D9KC 1H0DA 4ZFOL 1IEAB 4MNHB 2AABL 5DRZB 2N1KA 3TT3H 1KEGL 5A2IH 3QUML 1J8HA 1KG0B 3ZZ1A 4N0CC 3IGAB 4P5KB 3TNMA 5H35A 2D7NA 4DKDC 1MRFL 5TQ2L 5CBAA 4JHAH 1DLFL 3TN0B 3MCKB 3VXPA 1I8MA 5E95B 5HHVH 3PWPA 4U7KA 2RR3A 1RUKH 4WHTA 5HDLA 2I60L 4LCIL 2IC2A 1A6ZB 4H8WC 3VD7A 3MJ8B 3WIFB 2D31B 3TBVB 3QEQE 3GIZH 1ES0B 1LO3L 1IC4H 4HLZH 2DJ4A 2XYCA 1JFQH 4YBQD 1CU4H 1FZMB 2AQ3A 4AG4L 3D87B 1UXWA 4M1GL 4NZRL 3VFPA 3MBEA 5FYKU 3MLTB 4HUUB 2JTDA 4MWFB 1ZWIB 4PRHE 3KLSA 1FJ1B 2R8SL 3KJ4C 2AK4E 2VLMD 1YNLH 2BXZA 2EH8H 3SDDC 3VXSE 4JFPA 2E9JA 5FDWB 5C0DB 4HXBH 2G5BA 1XF4B 4OGYL 1VFMA 4M7KL 1FORL 5JXAH 2NTSP 3MRPA 1OPGL 3KPPB 1OWRM 3KGRA 4FFVC 4UIMA 1BQLL 2BX5A 1FL3A 3O11A 4L8BB 4RIRB 1PDKA 4W4OA 2ZKHH 5I74B 1EDQA 4ZUVB 5T1DH 2BSRB 1CFTB 3S37X 1CFNA 35C8H 3MCLH 5EZLB 4P9HH 1VKXB 4GSDH 5TE6H 4MA3A 4FQ2H 4AH2A 4GAFB 5HI3C 4LBEA 2R1XB 4E42A 4NKMA 4Y5VB 3MRDA 1PSKL 2HT2C 2HJKA 1A7BA 4XI5C 3SDAA 1NPUA 5A40E 3JTSB 3UTTE 4QCIA 4AMKL 1BFVL 4YXKL 4G8IA 3W2DL 4O2FA 1MCWW 1PFCA 3HFMH 4O9HH 3O3EB 4F2MA 2GKIA 1ZKAA 4X6DF 2DQJH 5I15L 3KDMB 4KK8C 1IQWH 4OJFH 3O6KL 2WWMD 2DQUH 5C71A 1EO5A 3BUTA 5JTWA 5HDOA 4D9QD 2Y06L 4R0LC 5SV3A 2X6MA 3PGCA 3S37L 3BAEL 1RV6X 3CDGA 1Q38A 5JPNB 1MUJA 1JP5A 3AC0A 2VDNL 2BDNL 2ADFL 3ET9F 3QUYB 5E9DE 2MKWA 3E6FB 5GISH 4ELMA 4J3OC 1DQQB 1XEDA 1QTYT 5L8LB 4JREC 5FF6B 3W9EA 1JF1B 2AK4D 4GXVL 3VRLF 3VXSD 3LQMA 4Q6IB 4P0DA 5CMAA 2YZ8A 1SY6A 4KUZL 2XT1B 1BVLB 3HE6D 3WHE0 1AFVL 2ATPA 5I6XC 4U6XB 1JYVA 3P9WB 2IGFL 5ICXB 1HIML 1N6UA 5LWYH 3I02B 4FQCH 1F4AA 4HUWA 3ZT7A 2OTUB 1A4KA 5F9WB 4GOSA 5BO1H 5FUZL 2YK1L 4XC3H 5CJ8A 2XTJE 1NGZB 2YRZA 43CAA 3TIDB 3ZL4H 4XNMA 5DC0A 4I77L 5ELIA 1IM3A 3GBML 3T65B 1DQML 1VGEL 5ITBL 1T4KB 1U92A 5EZJB 4LQFH 2JJSA 4JGJA 4L8SA 1IGCH 2X4RA 3IJYA 4DVRH 1OTTD 2JB5H 3A6CH 1PVHA 3F7YA 3FQRA 4FQQB 3MRHA 4WNQA 4LHJB 3TNNB 3HC3H 1MCIA 4JFYB 5C0AD 1DEDA 3UTTD 4PJ9D 4L29B 1P6AB 5AZEL 1S7QB 5BW7C 4NZJA 3AU1A 3BRFA 1YJDH 3QNYA 5DGQA 3DO3A 3QCTH 3ARFB 5GGVL 3EFFB 5I1AA 3E6HA 3ARDA 3SDDA 3UAJD 1KJMA 2LTQB 4LARL 4ZFOA 2B4CL 2JIXB 2AJZA 5C6PB 1TJIL 1YPZF 1CVRA 3RWJB 1J1PH 1X5JA 2NW2B 4G3YL 4TSAL 4UTAL 1IC1A 4NHCL 4WU7B 3OG6B 1MCWM 2MWCA 4ZAKC 4OD1L 1U3HB 1ED3B 2JCCE 4MHHI 4ETQB 5KVMC 5BZDA 5EULV 3K46A 1CD0A 4KK9C 4NN5C 3QPXH 5HHQA 4UBDC 2VMFA 3CZJA 3LHPH 5DXWA 2BOBB 3OKOA 2E6JA 5F7YC 4Y8AA 5TE7L 4OSUL 1EFQA 2MOVA 5HPOA 2GCYA 3LD8B 5IK3B 4EEEA 3S34H 5T3ZL 4JFZH 4R3SB 2H9GB 3IU4L 1T1YA 1MIMH 4HFUL 1PKQB 5CILH 5TDNA 2XTJD 5J1AB 5AAMA 4UAOB 4KQ3L 5GXBB 5E4EC 1T04B 1LEKB 3C60C 1JF6A 4OKDA 5E8EA 2Q8BL 2Y25A 4G8FA 4HPOH 4RMQA 2NY1C 1RK1A 3BE1L 3MUY1 4OM0H 2GI7A 2OR7A 4DZBA 4NPYA 4A6YB 4KAQH 5E1AB 5DMGD 5JHDE 3DVGA 4E0RB 4XMKH 4QF1B 4Z6AT 2VDRL 4UNVA 4XCYB 3HZMA 4NQTA 3SDXF 3VGEA 2ADJA 1U8JA 4XBGB 3EZJB 4JN1H 4K8RD 4KRPD 3DLQR 2JELL 4G6ML 2VLLA 5JUEL 2B4CC 4R0LA 3DUHA 5FYJL 1KB5B 2ZZUT 2R2CA 2GAZB 3MRJB 2OL3B 1FC1A 4M6NL 2EKSB 4K71B 4LEXH 4EJ1C 5CP7B 4NCC2 5E8DL 1MRCH 1KEML 1QKZL 5EUOF 2R1WB 3SDYL 4S10A 3UJTL 1FNFA 2XWTA 3DGCR 2WSKA 4N0YH 5LQBH 4U4BA 5I19H 3BJLA 3PNWB 3CMGA 2K9UA 5JO5A 3RAJH 3IXAB 5A16A 3DYMA 2D4DA 1MQ8A 3LRGA 1J0KA 4L9LB 4MNQE 4R4BA 4PGCA 3SGDI 1C8PA 3R1GL 2HH0L 3F7RA 4CADA 4KTDL 1YECL 5DD6A 3BKJL 4G8EA 3SJVA 3AS0A 4ZXBA 5GZOC 3V6FB 3UYOD 4LVOB 5LJYH 4OGXH 3DBXB 3IAQA 4LNRA 3G9VA 1T20B 1A7RH 3MLZH 5TE4H 4PG9A 4FABL 4PJEF 4XGZB 4RFEA 1HHIB 2LU3A 4Z78B 2DRUA 3RWCB 4QGYA 5JDJA 2W91A 2Q76A 5INDA 1OGAB 3P9MA 3TN0C 4K3DH 3BGFB 4ZS6D 5KANI 3I9GL 4DN3H 3GBNH 3MOBL 2MHAB 3HE7B 4U1NB 2HJFB 5KZCD 3TIEB 1RZFL 2GSGA 3ECBA 3LRSA 5EU6B 1OTUD 1UC6A 3QXAA 5BW7A 1PQZA 2BVUA 3GJFB 1GJIA 3L7FB 4HZLA 2BVQA 2ADGA 4EUPG 1QR4A 4L3CA 1HKLH 3LQZB 3FHQA 2W38A 5HJ3A 4AIZB 4JRXD 3GSVA 5D7JB 4HV8B 1A1MA 3HPLA 3S4SG 2NX5B 4P3CH 4MQSB 5F9OL 5H2BB 5KSBF 2ZUVA 3NIDE 1YNTA 5HDBF 3D25A 1LMKA 4Y19B 2ORBH 3IKCB 4BZ1H 2P8PA 2JK5A 3RVVC 1B4JH 3ZDXF 4Z8FH 4PPTA 4PB9H 3KXFE 5HHME 3WIHH 4G6FB 1XGPB 4APQB 1L7IH 4Y16D 3P77B 3OZ9H 5IUSA 3U7YH 3MLUL 4MNQD 1CD1B 3O6FB 1EX0A 4TQEL 3W0WB 3C6LB 4J3TA 4OZFA 4QXUH 5ANME 4JB9L 2ZG1A 3J7HA 4OT1L 4LRNL 5DRNB 1CF8H 4NNPH 5I74C 3S96B 4F7CB 5FAAA 1OP5H 2ICWA 3PWVA 4K2UL 2BNUA 3S97C 2O93L 4KI5C 4P23B 3FFDA 1EBAA 3WS6C 4HS8H 1G6RH 2FX8H 5IQ9B 4Y1AE 3OJMB 4ENEC 1P2CA 2UYLA 5C0IA 2C3HA 4Y5VC 3FL7A 1X7QA 3NFSH 4LVEA 4XH2A 3ZYJA 4X6FB 3ULSA 5E70A 2FECL 1JHTA 2DD8H 5LCVL 3SDCC 1NMBL 5F9JB 4WWKB 3V4VL 4XHQA 4WTXA 1JRHH 2YPVH 3PG2A 3HAEB 1YEKH 1A4JB 3VGFA 3DVIA 4GXUM 3QQNA 5F6HI 1QLEL 2FO4A 4U33A 3RVTD 2EC8A 3CMOL 3O0RL 4K7FB 2YEZB 5MHSD 5DK2B 4PBVC 4HIEA 3QRGH 3MLSH 1JI2A 5T5NG 4PGZA 4AQ1B 7CGTA 4GUPB 4PLOB 1PG7L 2CLRA 5C0JA 3ARXA 3QUYC 5HDQL 2HWZL 3FB5B 4NQEA 2QQKL 4J3XA 5F1IA 3ZKQD 2PO6B 1QBLH 1XCQB 2DAVA 1I3RA 1GGCH 5MI0B 3MRLB 3O8XB 4Q6IC 5BVJB 3IETB 4MNHA 1A6VH 2H2SD 5DRZA 4NQCE 5D7LB 1JNJA 5HHMD 3KXFD 1M6OB 4X9BA 4DJMA 4QNPE 1KG0A 4EDXB 4P5KA 3IGAA 4OZGF 5M95B 5GS2D 2Z8RA 4YHOH 1ZSDB 1BMGA 5F9WC 4E9LA 1R3LB 3UZVB 1KNOB 5CJOH 1BIHA 3TN0A 3MCKA 3HUJB 1P7KB 1S7RB 1UENA 2DDQL 5DJCB 2GK2A 3NA9L 5C9KA 1XR9B 4C4KT 3OB0H 1EJ6A 2F5BH 3P40A 1AGCB 3MJ8A 3VFOB 4R4FH 1T7ZA 1QSFE 2D31A 4HIIA 3TBVA 2FEEI 4M7LT 4OCXL 2NY2B 1ES0A 4Y1AD 1I8IB 3ZTJG 2UZYB 4MNGE 4XVJH 1DUZB 1P4IL 1HWGB 4HIJB 3KPSB 4C4KO 4U6TA 3MLVL 4WHCA 5C07E 1OHQA 1A02N 1FZMA 5T1LB 4DGIL 4JM2D 1RULL 43C9B 4NGHH 5JQHC 2AI0L 2BNQE 3MLTA 4MWFA 4P9ML 4I0PB 1ZWIA 4KTYA 4A6YL 2WUCH 4HJGA 4BFEA 5C2BH 1C5BH 4QTHB 1G6VK 3RP1A 5HYSB 4NQXA 4Z7UB 1FJ1A 3Q6FB 4R7DB 2B20A 3ARFC 1RJLB 4QHNB 3TO4B 5DVKA 4JLRA 4YDJB 2KQMA 4R8WL 3DROB 1WWAX 2LTQC 5FDWA 1OWWA 1XF4A 3RIFF 1LEIB 3HI1B 5F8QC 3WJLA 4KROD 1A3LL 1F3JB 3X11B 5DD5L 1CICD 3HNVH 4ZYKB 3V0WH 4NOBA 3KPPA 5CEXB 1CFVL 1TCMA 2VR4A 4HHAB 5IR1A 2CR6A 5BRZE 2YN3A 5EIVA 3U7WH 3I6LD 1TVBB 4L8BA 3VMOA 5JZ7D 3MX0A 5I75B 3MJ7A 1I3UA 3ZKNC 4TVPH 5MENE 2FEDC 4DUVA 1U8PB 2X1QA 4NQCD 4ZUVA 4F9LA 2BSRA 1K6QL 1UKTA 1CFTA 4NNYB 1G7MB 3G04B 3DWTA 1ZT4A 5EZLA 3VD9A 4DGVH 1FYTB 2YWYA 1QRND 4P2QE 3MA9H 2R1XA 1H9VA 1J0HA 4Y5VA 3F8UB 1ORSB 2P5WB 4UAOC 2XKNA 3JTSA 1JPSH 4L8CB 3MLXL 4PD4J 1WBZB 4WDIB 5JMOC 1KUMA 1S78C 1J1OL 3CIQA 2F58H 2PCPA 3O3EA 3QHZH 3WDIA 3FMGL 3TFKC 3EYQC 3O2VL 4YHPB 3GMLB 4JFDB 2VZTA 4JFFE 1HN1A 2MFNA 2HT3C 1O5DT 3BRDA 1NL0L 5D70L 2DMKA 4JZJB 3CFBB 5DWUH 3DETC 4N8CL 1TVHB 1I1YB 4RGOL 1MCJA 2LFGA 5JPNA 3RBGA 2FWOB 1C12B 4OD3H 2VR5A 2NY4D 3E6FA 1DQQA 2R4SH 3JV5A 1CK0L 1JF1A 4XRCB 2HTLC 1FNSH 3GDBA 4Q6IA 2VQUA 1OP3K 2CDFB 4ACPA 1C16B 2Q3AA 4ZQKB 3VFTB 2EC9T 1BVLA 5EORH 2QBWA 2XA8H 5CP3H 2I9LB 5DZNA 4C56B 5J9PA 4U6XA 5ICXA 1RK0B 3I02A 3K4AA 3KLHD 1HSAA 5IT2L 4L9LC 1CQKA 2OTUA 3L7EB 2BOCB 3TGXA 4LEOB 1TJHH 3ULVD 5IMKB 4V1DD 3EO9H 3MODL 3VMNA 5C0BE 4D0BA 4IMLB 3RKDD 2ZUSA 1N6QH 4I18A 1F4YH 1NGZA 1NGWB 4H88H 5MEND 3RDTD 4LVOC 4U2YA 3TIDA 5I2IB 3MOQA 3OBAA 4NFCA 4JFXA 3T65A 3W5NA 5DHXB 1NGPH 5EZJA 5L9DL 1T1WB 3RWHB 4H20H 2X89D 3FQUB 1KJ2H 4B53A 2YXMA 1BQUA 3BGFC 1CGSL 5HYSG 4U6VH 1JWMB 1SJHB 3TNNA 4KC3B 5DVMA 4QRRE 5DMIL 3HE7C 4JFYA 1X5FA 1RPQA 4WO4D 3NMEA 2V5SA 2FGZA 2XICA 4Q9RL 4L29A 1KJVB 4JJHA 4RWYH 1S7QA 3TYGL 3QFJB 2D03H 4NO5A 2FZ3B 2IANB 1CXFA 1S7UB 8FABB 3OKYA 2J4WL 2NPLX 3KNBB 1OVZA 3EFFA 5IVOA 4PJGB 1I1AB 5D72L 4LU5L 1EAPB 1U91B 1IZKA 2JIXA 4KUCF 5D7JC 3MRRB 2NW2A 4JZNB 4UOJA 4HCRL 4WU7A 2HT4C 2IF7A 1EHLL 2HFGL 4NCC1 5D5ME 5KVGH 1U3HA 1ED3A 3NCMA 3O6ML 5JW3L 3SE3C 3A6BL 3BP6B 2DQEH 4OV6F 1NC2B 4JPKH 4CUCA 1E4XI 1AR2A 2BOBA 4IRZL 3GJEB 3OGCB 4PJAE 5CLTA 4APQC 1YZZA 3QDMA 3S3PA 2EDNA 5IK3A 4WI3A 1IE5A 4H26B 4XTRC 5KS9E 2RBLA 4DKFH 5L88H 2E7LA 2WV3A 4R3SA 3C6LC 4X0KB 4ZNEE 5EZOH 2FJHB 4X7SL 1MREL 1YQVH 5J1AA 3M07A 4TPRL 3MV01 1KPVA 3O9WB 1WT5C 4GW5A 2ZUYA 2YD9A 1T04A 4NQDE 4YNYB 4ONFL 4J4PC 4LHUB 3CUPA 5FO9B 3SQBA 1B0RB 1J87A 4LPXA 2XACC 3ZHKA 4ZUSB 1F3RB 4IIQC 4A6YA 5GSVA 1ZTXL 4E0RA 4QF1A 3N1PC 2M8XA 2VLKB 4XCYA 1JPTL 1KN4H 1FDLH 4QRRD 1G9EA 2F5AL 4XBGA 5J1TC 4Z7QF 3GRWH 1VGKB 3TJEL 3CXHK 1HH6B 4RFOH 2KQNA 1NMAH 3EW3B 1NJ9B 4WWKC 1KB5A 3MO1B 2E3VA 1H3XA 4QRPE 3MRJA 4HWEH 1XH3B 2OL3A 1KXVC 4MXWL 4GBXC 3O4LE 2EKSA 4ZFGL 5LBSL 4P2OD 5CP7A 1VADB 1KT2B 4ZTPL 4NJ9H 3HC4L 2DQDL 3D5OF 1IGYB 5F71A 2R1WA 4XPFH 4HAGA 4J6RH 2BSSB 3BHBB 4S1DD 3PNWA 5D1QB 2W59A 1BEYL 2E7MA 1A3RL 4YUEH 3IXAA 5F7LB 1ZLSL 3OKDB 2PO6C 1FRGL 1AC6A 4O2CB 1CXKA 5IGXH 1YEHL 3O8XC 3GSQB 2Z93B 5E03A 2DKUA 32C2B 3MLYH 5ILTH 3QHFL 4D0CB 3V6FA 3UDWA 4OLUL 3L3KB 1CGVA 3DBXA 4NZUH 1T20A 3S88L 2A0LD 1HHIA 1C5DB 3IVKB 4Z78A 3REVB 3RVUD 4LRIA 2BY3A 1OGAA 5EUKB 2X4PB 4PJDE 1BGXH 2MHAA 1PYWB 4U1NA 3NGBB 2HJFA 2ZCKH 2RHEA 3TIEA 5DZLA 5FXCH 2WZPD 2WUBL 5EU6A 1Y6MR 4K94H 4OV5B 1BF8A 2XZQH 1KB9J 3GJFA 3L3IB 1KCRL 4PJFF 1QYGL 4PB0H 4DCQB 4X4ME 4XWGL 1BHGA 3L7FA 5ERWA 1TJGH 3RNQB 5IESH 1QLRB 3QUZD 3LQZA 1JMZA 1U58B 5ALCH 2XWBB 4AIZA 4B7IA 2NY6B 4B50A 3ZKMD 5D7JA 4I0PC 4LSQL 2I26N 4MVBD 4N5EC 4QRPD 2IALB 1GPOH 2MQCA 5FHAH 2KZ1B 1QFHA 5GRYA 3O4LD 4EN3B 3TO4C 4LLDB 4ERSL 2DMCA 2VLRB 5FYJE 4Y19A 3IKCA 3BGMB 2A9NH 1XGPA 3QO0B 1NDGB 4APQA 3P77A 3WSQH 3KPRB 1RU9H 2J5LB 2DM4A 1CD1A 3O6FA 3MXWH 4NO2B 3Q0HA 4FS0A 1GXEA 3W0WA 5I75C 4KVCH 3EKCA 1GGYA 3ARPA 1JTTA 5DRNA 3CSPA 4UDTB 3S96A 3CH8A 4F7CA 1S9VB 4OLEA 3L1OL 5DO2C 3BYTA 4Y2DD 4DK3A 2EC9U 1OM3H 4J4PA 4P23A 1MI5B 1D6EB 3H7BB 4ZD3L 5IQ9A 3FRUB 2Z31C 2EDBA 4PJBE 1UM5L 3FQTB 4OM1L 2J1KA 5IMOB 3B5HA 1QA9B 4X6FA 2G60L 3BQUD 1WBYB 3FB7B 2C5DC 2AEQH 1MF2L 4HEME 5EU7C 2EDLA 3WMSA 3KYNB 5F9JA 3VXRE 1NUNB 4WWKA 1YY8B 2NY5H 1T2QH 2LVEA 5C09B 5K9OB 4M9OA 1CXHA 3X12B 3HAEA 1A4JA 4KI5E 1UGNA 5DEGB 1KENL 4XB7A 4R2GB 2C9AA 4GKSB 4K7FA 2YEZA 4L1HA 5JNYA 1DVFB 5DK2A 2OJZL 4JZJC 4P4KD 3VWJB 3JV4B 1UEYA 1ZAGA 1TZIB 2DF3A 3CVHH 5EZIL 3FB5A 3M1BA 3CDYA 2C3WA 4JO1H 2PO6A 1XCQA 4GRLB 3WO4B 3D85D 3GKWH 5HHOE 3O8XA 2BHYA 5BVJA 3IETA 1JPGB 2XRAH 3TCXA 5D7LA 1M6OA 2NYYD 1ACZA 4J1UB 1KGCE 1ZHNB 4OLVL 1IKNC 4WUKH 4WUUE 1ZSDA 4M5ZH 1R3LA 1KNOA 3PV7A 1DFBH 2ICWJ 2OMNA 3JVGC 1P7KA 5FUOL 5C0CB 1DQLH 2LU7A 3MUGA 2EEBA 3L95B 4NN7B 3SE8H 1HHGB 1AXTL 3WFEH 1XR9A 5AWNL 3H8NA 2YD1A 4M7JL 4JM4H 4JG0L 1AGCA 3VFOA 1WAAA 3VRLE 1X5LA 3WNMA 4JQVA 2BFVH 2E27H 2FHFA 4KKCD 1I8IA 2NY3D 4ZFFB 1J5OL 5EIIA 1HYSD 1DUZA 2JB6A 5IFAH 4D8PB 1C1EH 3TC9A 3EO0B 1Q94B 3KPSA 2IMMA 2YD5A 3RUGA 3I3EA 1FIGH 5DGRA 1UM4L 4XPBL 5T1LA 4PJHB 43C9A 3PDOB 1SJEB 4JVWA 1KJ3H 4M6MH 4U05A 3UBXI 1H3PL 4I0PA 4M4RA 3HN3A 1NAMA 2UZIH 4QTHA 1KTLB 2AKRB 5HYSA 4Z7UA 2R0LH 3Q6FA 4R7DA 1WZLA 2V5MA 2HLFD 3TO4A 3T0DA 4K8RH 1I1AC 3DROA 1UFUA 2NZ9C 5GGQL 1LEIA 1LNUB 2VOTA 3HI1A 4OF5A 1F3JA 4U49A 3LCYA 4BSVB 2ZUTA 4ZYKA 2VDMH 3RI5F 4JKPH 1ZHLB 4XVUC 1A7QH 1I9RL 5DQDH 1TVBA 4EI5A 1KOAA 1FL6B 5HHOD 4R90H 3EIFA 2AEPL 4O5LL 1U8PA 1XR8B 4G6JL 4FQXB 4NNYA 1G7MA 2X9XA 2NLJB 3G04A 4PJCB 4ZO8A 4ZSOB 4QRTB 4KY1H 4N9GB 4HX1B 3GK8L 1FYTA 3MRKB 4WUUD 2QR0B 1P7QB 4NWTL 4XVTH 5KVDH 1DUYB 1MJ7H 2J8HA 2IBZX 1ORSA 3UPRB 4EBQL 2ESVD 2P5WA 1NEZB 3BFOA 2O5XL 4EI6B 3O9WC 4AIXA 3H9ZA 4L8CA 1BP3B 3UYRL 1WBZA 1ITBB 1X5YA 1ZT7B 1R3JB 5FCUH 4D9LH 1DTUA 2X1OA 4JANB 3FONB 5DD0H 4KK6C 3A6OA 2APWA 4YHPA 3GMLA 4XP9H 2FD6H 4JFDA 3G5YB 1N4XL 3TA3D 1OGTB 2WQ8A 3ALPA 1KXQE 5EBGA 3A67L 4K7PY 3LEYL 3WN5B 1UWEH 3R0NA 1DBAH 2EIZA 3K0WA 3SBWA 4JZJA 4XP4H 4QOKB 3CFBA 4OLZH 3SGDH 1TVHA 5IB5A 3SOBH 5JW4Q 4JO4H 3GMNB 4Y4HC 2FWOA 3GMQB 5IHLB 2ZG2A 1ACYL 3QIUB 3BDYL 3NZHH 4PRIB 2OJEA 4XRCA 1LP9F 4PJ7F 2CDFA 2GJJA 1UACL 5CCKH 4ZQKA 3VFTA 1S5IL 2I9LA 1JHKL 5D1QC 1RK0A 3SDXE 1MHEA 5DJXB 3MFFB 4HAFA 4QXWA 3L7EA 5GS0D 2BOCA 5I30H 1MJJB 4UT7L 3TT3L 4YEFA 4LEOA 5IMKA 4QHKJ 1EVTC 4MJIE 2CQVA 4DOHE 4LMQE 4WW2C 3S36H 1EEYB 1SBBA 3X17A 4X6CE 4WGVB 2WMPA 1MWAH 4JHAL 4PP1C 5BJTB 1J0JA 1JWSB 4ZNCD 2CPCA 1YMMD 1FFPA 3UTQB 3RNKB 4WIQA 1U8IB 5HHVL 3FQXA 1H3WM 1T1WA 3RWHA 1RUKL 5EUOE 3FQUA 1JWMA 1SJHA 5FUCE 4E41B 3MZTA 3NGBC 4EQ2A 5E5RB 1AGFB 3C9NB 3FQNA 3GIZL 2O5YH 1MCKA 1BREA 1KJVA 4NSKB 1G9NL 2GHWB 3QFJA 3OF6A 3D2UD 2OBGA 2FZ3A 5ECJE 2IANA 1JFQL 1S7UA 8FABA 1CU4L 3CK0L 4IHOB 2FBJH 2EDOA 2UVEA 4PJGA 1I1AA 1F2XK 1EAPA 1QZ1A 1U91A 3BOVA 4OBSA 2NY6C 1DBBH 3Q3GB 3MRRA 3QJHB 3QBTB 1IAKB 3IF1B 1HOCB 4JZNA 4L4TE 4LMQI 2SEBA 5EU5A 3MACH 1Z9LA 1YNLL 1ORQB 1CWVA 2EH8L 2M1KA 2EH7H 3D39B 1JZ7A 4Q2ZA 4OFPA 3RVWC 4HXBL 5ID0B 5JXAL 3BP6A 1NC2A 3DGGB 2LE9A 3GJEA 4G6AD 3OL2A 1DDHB 1L9NA 3OGCA 3BZ4B 4P99A 2F74B 4H26A 4O00A 1DP0A 1I9IH 2ZKHL 4XNZC 5T1DL 4X0KA 4MJID 5D2LB 2FJHA 3STZB 3CXDH 2NX5E 4P46B 35C8L 4OCYH 1IEBB 3MCLL 3O9WA 4YBLB 4P9HL 4GSDL 4WI6A 3ES6B 5TE6L 5FO9A 4LHUA 5HVFB 4FQ2L 4RBPK 1B0RA 5KSBE 5HDBE 3U1SL 1G9NC 4UQ3B 1ND0B 1SBSH 1VEPA 5A2FA 5GZNC 1WZ1H 4OIAA 3ZDXE 4Y4FB 1WCBB 2VLKA 3QIWD 2HKFH 2W65B 4KZDH 2FJFB 1VGKA 3QQ4B 3HFML 4O9HL 1UXSB 3QG7H 4H0GA 3F7VB 5I1DB 1NJ9A 2DQJL 4KKLD 3HRZB 3MO1A 3PQYE 2NXYB 4KK5C 4TTGA 4OJFL 1IQWL 5HGDA 1XH3A 3LPGA 2DQUL 4JDTH 2DWEB 3O2DH 2P7TB 2XZCL 1VADA 1KT2A 2V2XA 3PWNB 4R2GC 1IGYA 1DVFC 3VWJC 5DMKB 3GHBH 5IQ7H 5GISL 2BSSA 3BHBA 2G5RA 1G7JB 5F1OB 5D1QA 3EDEA 1JV5A 3LKOB 3MLRH 2VITB 3OKDA 4H25B 3DECA 4GRLC 3WO4C 4O2CA 3EYUH 4EDWL 3GSQA 4HZAA 4R96A 2Z93A 32C2A 2VZVA 4NKOB 2GW5A 1QFOA 4D0CA 4OAWB 2IPUK 1G6RB 3QDJB 1LO2H 4YFEA 5BO1L 1EK3A 3ABZA 1C5DA 4XC3L 4TOYH 3IVKA 5GHWH 5B21A 3REVA 4X7CC 5FYLE 4HT1H 4LCWE 5EUKA 2X4PA 4D2NA 3ZL4L 3U2SB 1PY4A 3MC0A 4WFGE 3X13B 4W6XB 3C6SA 1PYWA 4PJ8D 4QKXB 4WENB 3RTQA 4LQFL 2X70B 4FQJH 2AXFB 1FZKA 4NN7C 3ILPB 1IGCL 3EAKA 4DVRL 3ZSTA 2JB5L 3A6CL 4Z77B 5JIKA 1FNEB 4OV5A 5B4MD 2ARJB 1RHHB 3HC3L 3L3IA 1HNGA 4IDJH 1QBAA 4DCQA 1S7SB 4I2XE 3REWA 2UWEB 4O58H 3LMJL 3GB7A 3N1MC 1AO7E 1JGEB 1MCCA 1S9XB 2P5EE 1YJDL 3VXQB 3I84A 3SGKA 3I50L 3HUJE 3PQYD 1ZS8A 2IALA 2Q1EA 5E4IA 3VJ6B 1CBVL 1KULA 3IAPA 3PP4H 4ZOBA 4EN3A 4LLDA 3F58H 1I8LC 5IMLB 3VH8G 1NC4D 4OFIA 4UV7H 1FAIH 2VLRA 4F80A 1J1PL 4RMSA 1D6VH 1WISA 1FO0H 4JFEB 3R8BB 3BGMA 1MVUB 1P6FA 3L3HB 3QO0A 2DTSA 1J8HE 1TFHA 1P84J 5JXEC 1F3DJ 3QPXL 2X2YA 3HB3C 4P3WA 4NO2A 3FJTA 3LHPL 4X6BB 4WHDA 1QFUH 5C9JB 5IVNA 4UZGA 2DLGA 4L4VB 1EVUA 2DBLH 4Z7VB 2B5IB 3LEXB 3QQ9C 4UDTA 3S34L 2B1AH 2R2EB 4EVNB 1U8OB 3LKRA 4FQXC 4PR5B 5KW9H 5GRXG 4JFZL 1MI5A 1D6EA 1MRDH 2BVPB 1MIML 3H7BA 5CILL 3SCMC 2FGWH 3KHOA 2R1YB 2YR3A 4XPGH 3FRUA 3ULVH 5FYLD 4LCWD 3FQTA 1X9QA 2VRAA 1DQDH 5EC2B 4WFGD 2JJTA 3MREB 3V8OA 1QA9A 2XY2A 4D0DB 5B39B 3FB7A 4PRPB 2IAMB 4OM0L 4WV1A 3FTGB 3KYNA 1YJDC 2XNAB 2YMXL 4HC1L 3RA7H 3BMWA 4XMKL 1YY8A 5C09A 5DJZB 1S7WA 4PTTB 3X12A 5SV4A 4JN1L 5KVEH 3QUMH 4S2SB 1CXLA 2PYEA 3RPKA 3V7MA 4X9IA 5DEGA 4X83A 4N1CA 4GKSA 1DVFA 4KKBD 4TYUA 4R97B 1SEQH 4XXDA 4ZO9A 3VGAC 3BPLC 3EYFB 1UQSB 3VWJA 4LEXL 3HC0B 4J3UA 3JV4A 1OLZA 4NUGH 1TZIA 4FG6C 2A2QT 1MRCL 3AREB 4GAGH 3DHMA 3QI9B 5GPRA 4BFBD 1KN2H 3QIUC 3L5WA 4GRLA 5LQBL 3CSYA 5EO1A 3QPQD 3C09B 4PGBB 5I19L 1D7FA 2P49B 2VN7A 2YD2A 3CVIH 3MRQA 3L3JB 4Z5RB 3RAJL 4GKNB 2GITB 5DURB 3QQ3A 3QHTC 2F8XC 3P4MB 4J1UA 1J8HD 4QEGA 4DVBB 2QV2A 2KBGA 1H8OA 4LDLB 5K59F 4M93C 2YBRB 3V6OE 1NSNL 4C57C 4TNWF 5T1MB 4OCSH 4OGXL 1D5ZB 1D5MB 3KVQA 5C0CA 1A7RL 2ZOKB 3ISWA 3MLZL 5TE4L 4I3GA 4RAVB 3L95A 6FABH 3PWPD 5CEZE 5L7XH 1HHGA 3T3PE 2J8UB 3ZE2F 1WIPA 3AVEA 5DEFB 3T3MF 3KHQA 4YQXH 1G1CA 2GJ6B 4DN3L 3GBNL 2K7PA 2F54E 2PTTB 3B9KB 4ZFFA 4W6YB 4BH7B 3G6JB 4C56E 4D8PA 1BJ8A 3EO0A 1Q94A 5E00B 4K07A 4JDVB 1P7HL 1OT2A 3CX2A 4J12A 1LDSA 4PJHA 3PDOA 4P3DB 5IB3B 4RGNB 3HNTH 5DJ0A 5TF1H 3TESA 3U4AA 5C0NC 4MJ4A 3M8OL 3VFNA 1MVFA 4MQ7B 1E4XH 1HKLL 1KTLA 2AKRA 4FFWC 5ACZB 4HKXB 3VXMB 5HGBB 4KPHH 3FO0H 4YHYB 2Y72A 4MMZC 2Z35B 1URLA 2F53E 4NQUA 4P3CL 4XP6L 1K4DB 1WITA 3DPBA 4GS7B 1RJYB 2FNBA 3S9DB 5IJVB 2WQRA 1WCQA 3EHBD 1LE5B 2ORBL 1MFEH 4BZ1L 1ZHLA 2EXYD 3RUGF 3MV9E 1BFVH 1AC0A 4YXKH 3TZVB 4Z8FL 4PB9L 3WIHL 4NKDB 4C58B 2B2XH 2QKIB 3ARGB 3UTSE 2OCFD 2EZ0D 1FE8H 2WW8A 3DUSB 1L7IL 5L2KB 5INCB 2XZZA 3OZ9L 5K9QI 1XR8A 5BS0E 3U7YL 3DYPA 2N7AA 2ZUQB 4FQXA 1JBJA 4Z7UF 2NLJA 5FB8A 4PJCA 1KJ2B 4QRTA 4N9GA 4QXUL 2QHRH 1QSEE 2CO7B 3MRKA 4NNPL 1HI6B 1P7QA 1DUYA 4OF3A 3K3QA 3OKMB 3FT2A 1OQXA 2YD6A 4P46C 4HS8L 2FX8L 2ADFH 5CEZD 2D7PA 3VI4F 2VISB 4MGXA 5HHXH 1ZT7A 4KI1A 1CIUA 4GXVH 3NFSL 4JANA 1V7NH 3FONA 2A73B 4H1LG 2DD8L 4Y4FC 3UTPE 3KPLB 3IS1X 4KJWD 3G5YA 3WFCH 3LN4A 4MAYD 1JRHL 2BZDA 3WN5A 2A6JB 2CLVB 2YPVL 5I8EB 5FUZH 1YEKL 2NXYC 1PGRB 5E8NB 3QIBC 3GMNA 5JOPD 1EIBA 3MLPA 5B3NA 4OZHF 1T7YA 3GBMH 3QRGL 3MLSL 2AJSL 3EO1B 4PRIA 3LRHA 1YN7B 2NY0B 2DMBA 1NUDA 2Y36H 3GM0A 4CN6A 5DFVC 2PTUA 1QBLL 3LS5H 2WBJB 1GGCL 5DJXA 3SE4C 3MFFA 1A6VL 3O4OB 1MJJA 1KIPB 3KPQB 3UTSD 4GFTB 4WY7H 5I18H 1G7LB 2AJUL 2NNAB 1EEYA 2L0DA 4F9PC 5GRVL 4PREB 2V2WB 4U0QB 4YHOL 2EE6A 3X14B 1JWSA 3G5ZA 5CJOL 5J3HD 2Y6SC 3E3QE 4MX7B 3RNKA 1U8IA 4P57B 2YHGA 1LEGB 1QSED 3AM8A 1JIBA 3JTTA 5FGRA 1SMAA 4WI8A 3GMMB 3TV3H 4KUCD 1U95B 1NGXB 1E4KC 1ZT1A 4TSAH 2QADD 2F5BL 2Q7YA 4BFGA 4R4FL 5I8OH 1AGFA 1EAJA 1SHMA 2F9BT 3C9NA 4GMTH 4OD1H 4FQLH 5LVEA 4YHZH 1U8MB 1NH6A 3R06B 4HS3A 4GQ9H 3NA4A 3PL6D 4FMKA 4OZIB 2EO1A 3JXAA 5TE7H 4OIIH 4NGHL 3BIKA 1HZHH 2WUCL 1K3IA 1C5BL 5C2BL 3ARDD 4DTGL 3Q3GA 2VO5A 3I3DA 4CDGC 1V8HA 5J0BA 1WLHA 1Q9WB 1IAKA 3VE0B 3IF1A 2CIKB 1S7VB 1HOCA 1YEEH 5J1SC 1VHPA 1ZE3C 4XCFH 1ORQA 4DW2H 3D39A 1X4ZA 4KDVA 4MDIB 2AV1B 5ID0A 5D1ZC 3L5IA 4FFVD 2YRLA 2V2TB 3C5SB 3DGGA 5CD3B 3HNVL 3V0WL 3PGDA 2UUDK 1DDHA 4PJFE 3U7WL 4M1CC 3BZ4A 1WEJL 3LKQB 1UH3A 3QULA 2F74A 1KCKA 1RVFL 2JELH 5HI5D 4ZTOH 3W81A 4G6MH 4TVPL 4L3EA 4JPWH 3DRTB 4HFWB 2ZP0T 5JUEH 2BNRE 3KPOA 4OB5H 5FYJH 3GUTB 3MRBB 3D3VE 4NRXA 5D2LA 1YQ2A 2B5IC 3STZA 4P46A 1IEBA 1FAKT 4PLNC 4DFHA 4DGVL 4RX4A 3ES6A 2X5PA 5CBEB 3FB6B 5DJ8A 1BJ1H 5E8DH 4UQ3A 1ND0A 3SDYH 4NZDA 4UNTA 3K7UA 4JKLA 3UJTH 5BV7H 1JPSL 5T1KD 1RI8A 3EOYG 3OJDB 5F7HA 1WCBA 1NUGA 2W65A 1CCZA 2FJFA 2IAMC 3KYMB 2F58L 3KPRE 2GT9B 1UXSA 3QHZL 3HMWH 3F7VA 1P9MC 5I1DA 25C8H 2CXGA 5DRXB 3HRZA 5AEAA 3U82B 5DK3A 2CUHA 4WFHD 2DWEA 3WXVH 4X99B 2P7TA 4G8GA 1YY9D 4UNUA 1BD2E 5DWUL 2ICEB 5FK9B 2DQFB 3IDJB 4PRHB 4R97C 1IGTB 2AXJA 3RIAF 3EDDA 2YA1A 4OD3L 5DMKA 1MAMH 2R4SL 3CFJB 2ZJSH 1GOHA 2AK4B 1FNSL 3LKOA 3VXSB 3MSPA 5IFJA 2OTWA 2VITA 3QI9C 2E6QA 3RZCD 2V17H 2VAAA 5EORL 4BQ9A 2XA8L 3HE6B 3C09C 3MV7E 1JE6A 3SJVD 5I1HL 4ZXBD 2WK2A 4U1JA 1G6RA 3QDJA 1XFPA 4NC1E 1TJHL 3EOBB 3EO9L 3S35H 1N6QL 1Y6NR 4XBEH 1F4YL 3Q5OA 4H88L 1AHWB 3BEVB 2BNRD 4OGAD 1KYOK 5KSAD 3X13A 1P5VA 1FFNA 3GSOB 1FNLA 4AM0A 4Q6YA 1NGPL 2X70A 2X4SB 2AXFA 4NBZB 1EO8H 3ILPA 3TH3T 3QWQB 1QP1A 4H20L 5IKCA 1KJ2L 4Z77A 1FNEA 3PP3K 5EU4B 3DSNA 3B5TA 2AQ2A 1RHHA 3QUXC 1WC7A 3B9KC 3E0GA 5C0AB 3UTTB 1ONQB 3BXNB 1S7SA 4PJ9B 3OR6A 2UWEA 4RWYL 3D48R 2D03L 1JGEA 1S9XA 3MLUH 3CVHB 3VXQA 2DTMH 1IEHA 1HDMB 3P11H 4KFZC 1EFXA 3VJ6A 2Z8WC 5IMLA 2H6PB 5A2JH 4JFEA 1M7IA 3T2NL 1YYLH 3UZQA 3LH2L 1J12A 1GAFH 4GS7C 5E9DB 3L3HA 4MLIA 5KVGL 3S5LB 3V4PH 3RHWF 4IEFB 4UIKH 4P2RE 3BKYH 2DQEL 1IKFH 4XVSL 4JPKL 4MZ2A 4U0RC 4YC2B 4OLWH 2O5ZH 4X6BA 3TZVC 1LO5B 2QSVA 5C9JA 4D3CH 1UCBL 3MV7D 4L4VA 4Z7VA 3KYOB 3LEXA 1AXSB 2R2EA 1DR9A 5C86A 1U8OA 4ONOA 4YHMH 4PR5A 4DKFL 1I7TB 5L88L 2Z91B 5J12C 1W0WB 2BVPA 2V7HB 1ZVYA 5FKPB 1VA9A 5EZOL 1B6DA 3QCUH 3GIVB 2R1YA 1YQVL 2XTJB 3O0RH 3VFRB 4GKOA 2B39A 1A1NA 4NIKB 1W0VA 5F97E 4ZUTA 5EC2A 3ARZA 3MREA 2AAVA 1PG7H 2UY6A 4D0DA 5B39A 2GTWA 4PRPA 2IAMA 4URTB 3LY6A 2QQKH 3NZ8A 3FTGA 3CFKB 2XNAA 1AGDA 2AXGB 2QQQA 5DJZA 1KN4L 1FDLL 4PTTA 3P9LB 3FN9A 2AGJH 3GRWL 1OAKH 4KH2A 5B38B 4S2SA 5F7DB 4CAGA 1JNLH 1NMAL 4KKAC 4I48B 4HMEA 3QXTA 4ZSOE 3VD5A 2OS7A 3OPZH 3PHQB 4WJ5A 3VI3F 3QB7C 1UWGH 5CD5C 2RIKA 1EBPA 3IFPB 3EYFA 1UQSA 4X4ZA 5DYOB 2E7CA 1WFOA 4NJ9L 4H1LA 3VCLB 3AREA 3NA9H 4GW4B 5KBNC 3MQIA 3QI9A 4BH8B 2G9HB 4XPFL 3PWJB 4ESKA 1BWWA 4J6RL 5GRZA 4PGBA 1A0QH 3R8QA 2NY0C 2R23B 3L3JA 4XNYH 3PIQB 1EEZA 4Z5RA 3T4AB 4GKNA 1FGNL 1KPRB 4JZOB 1I1CA 1XF2B 4FQHB 3DUUB 2JCCB 2R9HC 5F96H 5IGXL 4P2RD 1BJMA 3MLYL 3O4OC 2YBRA 5ILTL 1U8NB 1MHHB 4QOKE 4YBHA 5T1MA 3FT4B 1QQDB 1D5ZA 1D5MA 4NZUL 5F7UA 1ROWA 3H7LA 2DLFH 2ZOKA 5DHYB 1OW0C 4TNWK 4CGTA 4KDWA 1HH9B 4LLMB 4RAVA 4GG6E 4BSWA 3BZEB 2J8UA 5DEFA 1MPAH 4MJ6A 3K8MA 1R3KB 2CRMA 4GJTB 1HQRB 2GJ6A 1BGXL 5BMFH 2YUXA 4XAWH 1OCWH 1UWXK 1LP9E 4PJ7E 3B9KA 2K3TA 4BH7A 1Z9OA 3G6JA 1ZLVK 4LLWB 1XAUA 2B1HH 2LVCA 1HCVA 5E00A 4K94L 4JDVA 2XZQL 4OFYA 3WJJA 4P3DA 5D7KE 3P4OB 1AP2B 5C3LD 5IB3A 5JHDB 4PB0L 1XIWD 3O3AB 5CEYB 3HZYB 1N3NB 1TJGL 4MQ7A 1E4WH 3MV8E 4HH8A 4LCUB 4YBQC 5IG7B 5ALCL 5ACZA 2YA2A 4HKXA 3VXMA 2XN9E 5HGBA 1H8NA 4LGPB 1C5CH 2Z35A 1UYWH 4WFFE 2APBA 4I13B 5CP3A 4BQCA 2J6EL 1GPOL 5FHAL 2Q87A 3UPAA 1K4DA 1F3DH 2MQ3A 4F8TA 3QXWA 1RJYA 2W0FA 1B0WA 3N85H 5IEKB 4N90D 3TBTB 5J8OA 2COQA 4Z76B 3E8UH 3MLXH 1U8LA 2HTKD 3BPNB 1JZ8A 3TZVA 4PJHF 4U31A 1A6AB 4NKDA 1MWAB 2QKIA 3ARGA 2A9NL 4FZ8H 4ORGB 3BP4B 1OAYH 5INCA 4U3CA 3PWUB 3WSQL 1RU9L 4MNQB 3GSNH 4GRWF 1ZGLA 3BDXA 3CDCA 4NC0B 4KVCL 1SQ2N 4L1DA 3QDHA 1NL0H 1M71A 3VRIA 1ADQH 1WFNA 5MERA 4HKJB 3L6FB 4N8CH 1OM3L 4TSCH 2KUTA 2QSCH 4RGOH 3OKMA 4Z7WA 4ZG1A 1XT5A 4K94C 5I73B 2P8MA 2VISA 4BJLA 2DL9A 5E8OB 4DUWA 5IWLA 1OAUH 2A73A 2AEQL 3TM6A 4DKAA 3W39A 3KPLA 2ARWA 1T80A 4YWGL 2PYFB 4IS6B 3WNNA 3LKNB 4RMRA 3B83A 2NY5L 1T2QL 5F89A 3HG1E 3MYZA 2A6JA 2CLVA 5GQBA 3BEWB 5EOCH 4CDHA 2Z4QB 1VERA 2WWMC 5E8NA 5F9AC 5FM8A 5IHZB 3EYSH 3T0WA 1UJ3C 1K4CB 5C0FB 2DB8A 3EO1A 4WFFD 2DOCA 5L9DH 2C7UB 3BYYA 1YN7A 4QO1A 4CNIB 2X4UB 4O4YH 5IB4B 5ACLA 2YUZA 4YK4C 5FM4A 1B0GB 4JO1L 5DMIH 2WBJA 3G6AB 3GKWL 1CFSA 3N9GH 5EFIA 5T5FH 4PRAB 4F58L 2XRAL 1V3KA 3HE6C 3T0EA 5HHMB 3KXFB 1KIPA 3OG4B 3KPQA 3SQOH 1JYNA 1UB6B 1G7LA 2EDWA 3QISA 2NNAA 4IOSD 2AJVH 2D7TH 4PREA 4WUKL 2V2WA 4R9HA 4XP5H 4NDMA 4M5ZL 3X14A 1PEWA 3L5JA 1DFBL 1IC5H 4N0UE 5ANMB 1LEGA 1AHWC 1D5BA 1R3IL 4NQVB 4WHYH 4IRSD 3GMMA 3SE8L 1CLYL 1U95A 1T6WA 2I07A 4X5XB 1NGXA 4JM4L 5KJRH 2NY5C 4RFNB 1F2QA 4Y7MA 1OTTC 2BFVL 4Y1AB 3EJZD 4WW1A 1VEMA 1U93B 1C1EL 4F37F 3R06A 2C1OB 1H3GA 5FYLH 3OJ2C 1FIGL 4OZIA 4PJ9C 4ZUWB 2VH5H 2A77H 1TTUA 3GO1H 4PRBB 1I8KB 4QHMB 5IBTH 1KJ3L 4M6ML 3VA2C 1DQTA 3QDGE 3HG1D 4U1SB 2D7MA 5CJ5A 2X09A 3LPWA 2UZIL 1CDUA 4OI8A 1Q9WA 1FFRA 2JIXD 3HLAB 2CIKA 3VE0A 1S7VA 4JHBA 4K8RL 3UAJC 2H41A 4BM7A 4FZEL 2UV3A 4LPYA 2WM0A 1W72H 4MDIA 2AV1A 3GSRB 3V9FA 4KROB 1S7TB 2E8YA 3DXAE 3KPMB 2V2TA 1U3HD 4RGMB 3C5SA 1F97A 5CD3A 3CC5B 1CICB 2VDML 3LOWA 4JKPL 4U6YB 1K85A 3T77B 1A7QL 3TVMD 1XGUB 3LKQA 5DQDL 5TDPA 4NC2B 4R90L 1U0QA 3QDMD 3NFPB 3DRTA 4HFWA 3WLWD 2R2HB 4NQCB 1JGUL 3C5ZB 3GUTA 1BAFH 4OQTH 3N1GC 4LDOB 4X7TA 1N5AB 4KY1L 2VDLL 1QHPA 4JO2H 4Z95H 5CBEA 4FP8L 4MXWH 1MHCA 3VXUE 4XVTL 5KVDL 3MRCB 1MJ7L 2DQDH 2XTJC 3BD5A 4FXGB 1T21B 3OJDA 4MB4A 3E2HB 5T33H 3BKCL 4D9LL 1BEYH 5H8DA 3KYMA 2OMBA 2GT9A 5DD0L 1KC5H 2ATKB 3QEQA 5DMGC 3GMRB 3MJGX 4MNGB 4OCLC 5HVGB 1HXYB 4HWBH 2FD6L 3HZVB 4XP9L 5D2LF 4K8RC 4KRPC 4KMTH 4X99A 4KJPD 1UWEL 1FO0B 1F02I 1R5IB 1DBAL 2OZ4H 4WTZA 5I1LB 4XP4L 2APXA 4OLZL 1JVKA 4HDIB 2ICEA 4YGAB 2YKLL 5F72S 3ZYOA 5FK9A 1JK8B 3SOBL 2BNQB 1NKRA 2DQFA 2QHLA 3IDJA 4PTUA 4PRHA 1YEFL 4OLXL 3LKSB 1IGTA 3MZGB 4JHZA 4BUGA 1NFDE 1MY5A 2EIBA 5B8CB 4CVWA 3CFJA 3RIAK 3VU2A 3NZHL 2AK4A 3GMOB 3VXSA 3ZMRA 4MQXD 4WEUD 3D18B 4Q74A 5CINH 4TN9A 5CCKL 1RUMH 1YEGL 1F90H 1KTRL 1LDPH 1U41A 3EYOB 2DKMA 3B5GA 3NCJH 4JQXC 3QWRD 3MRNB 5BRZB 4NN6B 3PJSB 3EOBA 1P1ZB 2FL5A 2NY7L 2WLZA 3S36L 5MENB 1AHWA 3BEVA 3U79A 3RDTB 4L8DB 3VW3H 3AFLA 1MWAL 5EG6C 4R6UA 1CXIA 3QUKB 3GSOA 3KYKH 2X4SA 4IOIB 1F6FB 4NKQB 3QNXB 4G7YH 2DN7A 5D9SB 4ZS6C 3QUMB 5EU4A 5EU6D 1UVQB 5AD0B 5I66B 1HSBB 3MFGB 3MROB 4KVNH 1ONQA 3BXNA 1T1ZB 3UTTA 4PJ9A 1AH1A 3SGJA 2O5YL 1AQKH 1U3YA 1OTUC 4OCRH 5JW5B 2D0FA 5CEZH 4OF6A 1K8DB 4ODUB 1X44A 3VD4A 4PJIF 5IVXF 3CVHA 4JCMA 5KG9B 3H42L 1UZ8B 1HDMA 3O81A 2H32H 3I6GB 2FBJL 2DJUA 1MJ8L 1Y0LB 2QEJA 1JPFB 3LS4H 1DBBL 3LZFH 4NP4H 2H6PA 3ZE2E 3T3ME 4NQSB 5IF0B 1KCLA 4QXGH 2B0SH 3PGFH 3MACL 4KWUA 4G43B 5E9DA 5ICZA 2OTPA 1ZHKB 4XCEA 3S5LA 2UWEF 4LPCA 2VXSH 5D93C 4ALAH 3ZHLA 2W0LA 3RHWK 3BN3B 2FH8A 5F8RC 4QWWD 1LO5A 4HGKC 1S9YB 1QSVA 3O6FD 4XNQB 2VZ1A 2E5EA 4I0KA 3KYOA 4Y16C 1AXSA 4LLAA 1CE1H 2D2OA 5T3XE 1SY6H 1I9IL 5CHNB 2RGSA 1I7TA 2YUWA 4TUOA 2BJMH 1KYOJ 1OSZB 4W4NA 2V7HA 3VFUA 5FKPA 1QNZH 2NR6D 5C0BB 2I25N 3GIVA 4P23D 2CUIA 5EO0A 3VFRA 2YXFA 4OCYL 5MEPB 2HFFB 5JIIA 2QQLH 4MSWB 3V52H 3IFNL