1MFDL

The solution structure of a trisaccharide-antibody complex: comparison of nmr measurements with a crystal structure
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
b'QAVVTQESALTTSPGETVTLTCRSSTGTVTSGNHANWVQEKPDHLFTGLIGDTNNRAPGVPARFSGSLIGDKAALTITGAQPEDEAIYFCALWCNNHWIFGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLSRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-LAMBDA SE155-4 FAB (LIGHT CHAIN)
publication title Solution structure of a trisaccharide-antibody complex: comparison of NMR measurements with a crystal structure.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 52
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 1993-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfdL01
5B39B 2O61B 3PV6B 4KHXH 3MBEC 4QLRA 3SGKA 4KUZH 3UBXG 4Z7VE 1LK3H 3W39B 5I73C 1A6VL 2OS7A 2FX7L 1IEBA 2KQNA 1RJYA 3JTSB 3V6ZB 5JW4Q 5EBGA 3KPOA 4NP4L 3UTZB 4QXGH 3LEVL 1IGFL 3WIIL 2DQHH 4S1RL 5E9DE 1HHHA 5IVXE 2E27L 2W92A 3AY4A 3MLXH 3EOYG 1F4WL 5KSAD 4R3SB 1J0ZA 1DBBH 1YZZA 3TC9A 5EBWA 2VIRB 2AQ2A 1RIHH 2DTSA 4WJ5A 4Y5VB 1QFWI 3OXSB 5H8DA 3QIUA 3VMPA 3D2UB 4JRXB 1LILA 5LQBL 3DMMD 2VDOL 5DMKB 1T1WA 1FNEA 4FFYL 4LAJH 2R69H 1TIUA 2DWDA 3WFCH 1N4XH 2ERJC 2M26A 4NKDB 4JN1H 3RWFA 1PX4A 4WI7A 3MLYH 3VDAA 4MZ3A 5FF6A 3LQAH 4HFUL 2VJXA 2XPGA 1EEYB 4AIZB 3L3JA 1UA6H 3EYUL 3SDDA 3R06B 5IFAH 2MCG1 5CP3H 4G6ML 4YDLB 1JWMB 4JCLA 5I9QC 1QLEH 2F19L 4Z7UB 2PO6C 1LEGB 5TGBB 2I27N 1A6AB 3UAJC 4HKXA 2BVEA 2HG5B 1WEJH 3G5ZB 3G6AB 3NAAL 3O8XD 1F4YL 3TBYB 1A3RH 2X4TB 5D1ZD 1FQ9C 2Q86B 2GIYA 5FYLE 3O6FC 4IIQA 5ICYB 3TBTA 3QUYD 2R2EB 3LN4A 3WIFA 2V2TB 4HC1L 4PJFA 4HGWA 1I85A 2EO9A 4X4ZA 5E70A 3RAJH 1WK0A 1QYGH 1GL4B 5D71H 3RIAK 1XGRB 2A6KB 2NLJB 1D3CA 3O4OC 2PW1A 1J0YA 2EDOA 3JV4B 3EO0A 5IJVB 5IKCB 4JFDE 2WWKT 4MJIA 5C0CB 5KJRH 3QEUB 4G42A 3TBVA 5ANMA 5ICXA 5GS0D 3DUSB 4X6CE 3HMWH 4WY7H 3OKMA 2RCSH 4BUGA 4PLJC 2E5EA 5CUSL 2MJWA 3KLHD 1WUNT 1J8HE 3WYRA 2FEEI 4A6YB 1DQJB 2NY2B 1KCUL 1A7NL 1IKFH 3BPCA 2ZG3A 4C83A 3GGWB 1I7TA 3AMLA 5ILTL 3U2SB 4KJPC 1BREA 2GAZB 2BK8A 1NJ9B 2P46B 1PJ9A 1MEXH 3ILQD 1FYTE 1OTSD 4NZTL 3FQRA 1CDHA 3ARSA 4ZO7A 4BSWA 1G1YA 4YBLB 3O6ML 3MRHB 2UY7A 3UYRL 5ADPH 3EYOA 5HXMA 3B9KA 4YHNA 1TQCC 2DKSA 3DUHA 3ISWA 1I8LC 5H37H 4D0CB 1KLGA 3BEWB 3CU1A 4WEUD 2VE6A 1ODAA 1A7OH 2VMFA 1EXUB 1U8IB 5DJ2A 5EOCH 3VH8G 1MREL 4JO2H 3QH3B 1HXYB 4AM0B 4LCWD 4JY5L 5EG6C 4XH2B 4BZ2L 2DMCA 2QR0B 5KVFH 4LMQE 1FFOB 5D9SB 4JRXE 2WP3T 4M7LH 2XA8L 3FT3B 4MB4A 1H15B 4Y16A 1G7IA 4XCNA 1XGPA 3BH8A 3UTTA 5F7NC 5EZOL 1JPTL 5BW7C 3FQWB 3T08A 3UBXB 3O4LD 3FQXB 2UUDH 3S4SG 2H26B 3GSUA 3NCEB 4HWBL 3IDJA 4DZBB 1TZGH 2R0ZH 4HLZH 4IMLA 1CLZL 4KK8C 5L88H 5CZXD 4KHTH 4LCYB 4NCC1 2P44B 5CD5C 1IBGL 1I1AC 3EYQC 4D0BA 4HAFA 5JORB 5J3HD 1AFVH 4PJXA 4MJ6A 3TZVC 1UM4H 2Z31D 4BELD 3D3VA 1F97A 2HP4A 4F33A 3FO1B 4WEMB 4HJGB 3BKMH 2MSPA 2VH5H 4MDJB 3EJZC 1D5MA 3UJJL 4R7NB 4H25A 5DUBA 4RX4A 4B0MM 1OCWL 3QUXB 5ENWA 3MRRB 4RGOL 4GW5B 4NWTH 4I77L 1AGCB 3BQUB 4X5XA 1KPUB 3FAWA 2ZUQB 3G6DL 3QDGE 3WEXA 2HTKD 1DN0B 2VLKE 3KR3H 4NN5B 3S35H 3MOAL 5DHXB 4G9FB 4PJDB 1LO3H 1LGVA 1NKRA 2IFGA 1OAXL 4L8DB 4L29A 5GJSL 4L8BA 3EFDL 4LKXB 1QRND 2BNRD 3EW3B 3O6KH 4PRIB 3HUJA 3SDXB 4F2MB 4KUCD 4QXWA 3UTSA 5E2WL 2EYSB 2VAAA 3HR6A 1FO0L 5DJ6A 2G2RA 5EO0A 4BUHA 5C0CE 3IDMB 2Q8AL 4PGEA 4HIHB 5ITFA 2FDBP 3WHXB 2P5WA 3QQNA 1Z0NA 1DEDA 1IGCH 4ALAL 4P2CG 1QVOA 2BOBA 2FECL 3IVKB 4TTGA 4Q9RL 5HVGB 3KPMB 2IH1B 3H7BB 2D0HA 4XCEB 5LAXB 4YHYC 1VHPA 2ORBH 4GG6A 1B90A 3IDGA 1J87A 1FJ1A 3FRPG 1FV1B 4G80B 5DF0A 3C60C 4MQ7B 4PLKC 4Y5YB 3LH2L 5I1HH 2LVCA 2AJYL 1Y0LB 1FL5A 3FB7A 1FZOB 1CLYH 3CH1A 4UDTB 3T2QA 3FQNA 2NX5A 4G9DB 4RAHA 2BVQB 3K1KC 1QR1A 5JR1L 1T7WA 5L7XH 1N5YL 1MJJA 1AHWA 2P5EA 3U0PB 5FB8B 1MF2L 1UJTA 3NTCL 4PGCB 2MMXA 5CIPB 2FL5B 3T04D 4C56B 5ERWA 4UINH 5MP6H 3EOBA 4XVUD 3I6KA 1CQKA 3MRPA 4DAGH 4UBDD 5C6PB 1XIWD 3GI8L 1RZIA 3SKOA 2EH7H 1G7PA 1MHHB 3G5VA 4X6FA 2FBOJ 3QIUD 4RA0C 1RZ8A 1S9WB 4MD5B 1RZKH 1HWGB 1RU9L 4HS6A 1Z3GL 4XP9L 3V95A 4YDJA 1I4FA 1X4XA 3M07A 3PP4H 4MSWB 4LFHG 1FZJB 1Y6KR 3RY6A 2FATH 4OM0L 3PXHA 2FCBA 5HHXH 1GOGA 2CK2A 3WFDH 1HH6A 5E24E 3IFLH 5I1EL 1VDGA 4LLUB 1HCVA 5KBNC 3SKNB 2EDHA 4Q9BA 1KG0A 2EYTB 2Z35B 3U30C 4M7ZB 5F7FA 1RIUL 4WFED 1HSBB 3S36L 3VH8B 1FLRH 5IMKA 4X98B 3BPNB 4N90E 4YDIL 3EFFB 3OMZA 3B9VA 5EOTA 1KBGL 1QG3A 2E6QA 4NQCE 1YY9D 4AK1A 3WUWB 5DEZA 4JPWL 1AGFB 1I3UA 4PJ9B 4Y19A 1K4DB 3A67L 4V1DE 1E4KC 4O2FA 3V5KA 1EV2E 1M71A 3SKJH 2ATPB 2QSTA 1YYMH 4JM4L 3S4SB 3V0VB 4KQ4H 3MBED 3OKEB 1FC1A 5IHUH 4G9FE 3P4OA 3QPXL 4GLRI 4PJDE 4Y4KC 3RHWK 4KQ3L 1NMAH 3QG7H 5GGQH 4ELKA 3MR9A 5FYJU 1BVKB 3X3FH 2JK5B 3FMGH 1J1PL 5JXAL 3MOBH 1D5BA 4ZO8A 1MFEL 4XC1H 4GG6F 5JHLH 3K74B 1X5YA 2WIMA 1SJHB 1F4XH 4X80L 2FJHB 4G6JH 2QQNH 2G5BB 1FGNH 4OQ1A 2UZIH 4WI3A 4MX7A 4ONGH 5DZNA 1W72A 2BJMH 4PRBB 4XNMA 1SJVA 1RVFH 2PXYC 3E3QE 2VXQL 4L9DA 1CGYA 3PIQA 3GJEA 2LTQB 2FNBA 1WZ1L 3VGBA 5DR5L 4XNUL 3P40A 1T2QL 3SY0B 3ROOB 2BERA 3TNMB 4PGBA 3FO9A 1F3RB 3C2SA 1I1YA 5MHSE 3U6RB 1QA9A 2EE2A 1K2DB 1L0XA 1MFAL 1NGZB 3CCHB 4NCC2 1NFDA 3BP7A 5D4QA 2ZUWA 3LEXA 3S37X 4Z78B 4HJJL 5BOPA 2PYEA 2ID5A 4C56E 3DIFB 2CR3A 5F9OH 4YNYA 5FKAB 4JREC 3ZLQC 1BOGA 4EIZC 2PO6D 3V6FB 2HFGL 4PB0H 4W70A 3UAJD 4MDIA 1JNNL 4X9BA 1R3LA 5I18H 2XG5A 2X40A 3QEQE 4DGVL 5FGCB 1JRHL 5FXCH 2QHRH 1C16B 4PJAB 4JRYD 2E8ZA 3S96A 5F21B 4BKLB 2NY0B 3O6FD 4NOFA 4MNHA 2VERN 3NFSH 1WT5C 1XCTB 1WZKA 3TO2A 4ODTH 2I26N 1M6OA 4YK4C 3MRIA 4PLOB 3KPRE 1MLCA 5C0NC 4LP5A 3L5XH 1ACYL 3WJLC 5D6CB 4V2BA 5DJYA 4K2UL 1L0YA 5ALBH 2K1MA 4LLDB 3H9SA 4WO4C 3MV9B 2ZCHH 3P4MA 3UJIH 3RWDA 3TLRA 5KVEL 1TJGH 1ORQB 1ZHKA 1B4RA 3QNYB 3D3VD 5TQ0H 3DUUA 1CXEA 1X5LA 4TVSa 2H3NB 1SEBA 4P2OC 3KHQA 4QXUL 5E6ZA 1B4JL 3VXRB 1EFXA 1TNMA 4ERSH 3HNSL 4EKXA 4OJFH 1MRDH 4RX4D 1M4KA 3RVVC 4PLJD 3K2UH 1PKQA 4NQDB 3UZVB 2HMID 4ESKA 2OZ4A 4OGXH 4M7KL 1QLFB 1UXSA 3QHFH 4TNVF 2Y7QA 3BUYB 3BWAA 5DZLA 4TNWK 4K7PH 5TDOB 3IDYB 5B8CC 4FQXD 1C08A 3P0GB 4JDTH 2YS4A 1S5IH 1HSAB 1WFOA 1P5VA 5FM5O 4RIRB 2IBBA 2R1WA 3GIVB 3HC3H 2NXYC 1S7QB 5FUCE 5D70L 2Q6WA 1P6AB 5CINH 4OLEA 5HGAB 4U1GB 3VI3F 4NQEB 2DTMH 1I7UA 4G7YH 4P46B 4U3HA 4CN6A 4R7DA 3WXWL 4LPTA 4KJQC 1E4XI 5H35A 4ZUWB 4K9EL 4GAJH 1OWWA 2XNAB 4ZPVA 4FXGA 5MEOB 4HW6A 4QHMA 4JFEE 1JUFB 5DEGA 1YNTB 5I1GH 4LU5L 4NN7B 4N0RA 2X4PB 3EGSB 1WWBX 3VFGH 3OTTA 4M1DL 1QO3B 3KYAA 4NGHL 2ZG1A 4KDTC 1PGRB 1RZGB 1YJDL 1UH2A 4ZODA 5A2LH 1S7XA 2FLBT 4LCCC 2QHLA 4L5FH 15C8L 3P73B 4G8GE 2Z4QB 4KK8D 1TZIB 5INDA 2DWEA 3OB0H 3S5LG 5CD5D 1UCBL 3EYQD 1NDGB 4XZUB 1JWSB 3O41B 2WK2A 1I7ZB 1MRCH 4HK0A 3TZVD 3QNXB 1EHNA 4OSUL 3I75B 4HH9B 5TDPB 3B43A 2XN9E 4KUZL 2PN5A 1XR8A 3EJZD 3QDMB 4FNLL 5IBTH 5TDNA 3HB3C 4PJAE 1U3HB 4D8PA 3QDJA 1N59A 4FA8A 4F7PA 3WFEH 2FGWH 5F96H 2Y07H 3U9UA 4PJ5D 4CDHA 3NFNB 4JJ5A 3BIKA 3EBAA 3OAUL 3WD5H 3PQYE 3TP4A 1OAYL 3MLXL 1FRGH 2BCKA 5I76A 3OKOB 4ISVA 4I0PC 1DBBL 4CKVX 4P4RA 1RHHB 3ULVH 1RIHL 1Q9KA 3WKML 3OKLB 5FIEA 1QKZH 4GQ9H 3RPIA 1N4XL 4LLYA 2DN7A 3FOMA 5FHBH 3NGBC 3VXRE 2N1KA 1R3IH 2J5LB 1MCQA 1WC7A 2RGSA 1S7RB 1UACH 1IGTB 3QDHA 1IGJA 1UA6L 5BZWA 2NY1C 2GCYA 2JB6B 3RZCA 1N6VA 2R0WH 5EO1A 5IFAL 2P8MB 2Y36H 4OCMC 3HC0A 1ZA6A 1QLRB 4XNXL 1GHFH 2W9EL 1T4KA 3C60D 1J7VR 1WEJL 3CZFB 4FTVD 4BA8A 2XT1B 5I66A 1A3RL 3VI3E 3SJVD 1PG7W 4PY7A 4UQ3A 4JFXA 5EU6A 1DJSA 5CAYB 2XZAH 4UT9H 2P8PB 4NQEE 4HZLB 3V5HB 1CD8A 1A22B 5DJ8B 4G8EA 1P7KA 5KVGH 5BXFA 5HHNA 1NGWB 1UJ3C 3VFNA 1S7VB 3HRPA 3QNZB 3MA7A 4JPIB 1B0GB 4PG9B 3G9AB 2DI8A 2VLJB 1E4WH 3WXVH 1LDSA 4TPRL 3VMNA 1T20A 2IH3B 2MPAH 4IRJB 3Q1SH 5F1NB 2DIBA 5FUZH 1KTDA 4NQVA 3CUPB 1WAAA 1X44A 5B21A 3VXTA 5KSBB 4HPOH 5T5NF 3VE0A 2JB5L 4I3RH 3FHAA 1JPGA 2VDLH 4Y1AA 2CXKA 4WY7L 2GQHA 3TCXA 4IRSA 2RCSL 1IM3B 5L9DL 3H42H 2PYED 1JGUH 3WE6A 5F71A 3HE7A 3W9EA 5E5MB 2E7CA 1IKFL 3PV7A 1I9RH 5DJCA 2V17H 2OMNA 2Z91A 4H0IA 4M61B 4M5YH 2F15A 1F58H 5HI5C 5F3BB 5MEQA 5F7DA 5JW5B 5IBUB 4URTB 4OM1H 3QDME 3OWEA 1OPGL 5CP7A 5HVHB 4WFGE 5MI0C 4XPFL 4JDVB 5T3ZH 3DXAB 4Z7NF 4X0KA 4U6TA 1TCRA 3FB5A 4ORGB 4ZXBB 1W0WA 2R8SL 2YRLA 5F1KC 5ADPL 4JFYA 1K5NB 4XPBL 3W2DH 5DS8B 4ZUVA 4TYUA 1MLBB 5DGQA 2HWZL 4BQCA 1FNSL 1FFPA 5EO9B 2X9YA 3IDIB 4S1QH 3K3QA 3H9SD 1YEGL 5EOCL 2NY5H 5TE6L 2RHEA 3MRDB 4KROC 1NMBL 3QWOB 4WFHD 1JF1B 2FJGB 1RIVL 2BVOB 3X13B 5CGTA 1AY1H 1X5GA 4IDJH 4K23H 1XF5A 1BD2B 3PE9A 1FVEA 1W0VB 5A16B 3VWKA 4NKIH 5BRZA 4F58L 1UCTA 5IJKA 3SPVB 3EO1A 2Q7YB 5GGTA 4P49A 3F7VB 2W1NA 1CN4A 3GHEL 2VLRA 2IWGA 3C9NA 3QRGL 4AT6B 3EAKA 4LPYA 1KIQA 1TZGL 2R0ZL 3VRJB 2ZP0T 4YHMH 5L88L 2OJEA 4I9WE 3CJJA 1EA9C 4IOIB 5BV7B 1SJEB 2WWMC 1QPPA 3FL7A 5DK0B 1FZKA 1I8KB 4P5TC 3GZKA 2CLVA 2XI9A 3QQ9C 1F2QA 4K9EC 4ONFH 3MCG1 1A9BB 4F7TA 2VH5L 2ZJSH 3DX9A 1Q9WB 2CMRH 2BNUA 3SGEI 1PYWA 2MHAB 2BVUA 3BIBX 4Y4HB 2HLAB 4LEOA 1MCWM 5F6IC 4BH7A 2ADJA 3F12B 3IFNH 1JYXA 2O5XH 1WAAF 4M02A 4NWTL 3AU1A 5GGVH 1A6PA 1G7LA 3RWIB 1OF2B 3U46A 2B0SH 3OHXA 1TLKA 3TIEB 4O2CB 3KR3L 3T77B 3S35L 1G7JA 3IF1B 2HFTA 3MUGB 1A3QA 3WSQH 3MYJA 3BGMA 5M95B 3I6LD 3MJ9L 1JPSH 3SDCA 5IROA 2Y23A 3LKPB 3O6KL 4WW2B 1AXSA 4OV5B 3BVNB 5F9JA 1A21A 2H9GA 3LKNA 4NJ9L 5GGTH 5A2IH 1QBAA 4OB5H 4RBPK 3OL2A 2EIZB 3OJDB 1IGCL 3T65A 1TTFA 2D3VA 1YEHL 4OCSL 3OJ2C 1KLFA 5JNYB 4OZGA 2OTUB 2BRQA 3GIZH 2Y1VA 4QHNA 1GC1L 1MI5D 2ORBL 5C92A 2D4DA 4X6DB 5HHOB 5D1QD 4YUEL 4YDLC 5FCSH 4JHBA 1RUKH 4P2OD 5I1HL 3RWEA 1KENL 3VU2A 4Q9QH 3MO1A 1CLYL 4R4BB 3GSXB 4NRYA 4G8FA 4PYGA 1ZLVK 1NCTA 3GMRA 2R4SH 3QDJD 4WI8A 1QFUH 5L7XL 2X1WL 2C1PB 3RVVD 2W38A 1JGDA 3ARZA 3V9FA 4PJHB 2MKWA 3FFDB 5C09B 4PTTA 1T5WA 4D9QE 2VZVA 1P2CB 4NPYB 2VL4A 4LP4A 4OD1L 3MQIA 3GMLA 4HXAL 4O9HH 5MP6L 2IALA 3WS6A 3FT2A 3NIGF 5D93B 5DRZB 4DAGL 2EKSB 1WCQA 5AEAA 3BRGC 1KB5B 5HDOA 1WCBB 5HGBB 4GW4B 1J12A 3QCTH 4ELMF 4WGWB 1C1EH 2NXYD 2HRPH 2RAMA 1RZKL 3ZO0A 3DETC 3W39A 1B2WH 1IC5H 3L6FA 3IDXH 3BN3B 4F9PA 4L3EA 1BD2E 3PWNA 5DTFA 5JOPE 3PP4L 3SGKC 4AH2B 3NCFB 4QRRA 1AKJD 3VXSD 4OT1H 4PTUB 2EDFA 1JIBA 4GRMB 5I8EA 5T3ZE 5HHXL 1I3VA 1UWXH 3SE4C 3TNNA 5L8JB 2EICA 3ALPA 3RZCD 4OZIA 4YGVA 3ECBB 4MNQA 3IFLL 3BDBA 3ROLA 1HHKB 5EA0H 3WDIA 4NHUB 3CXDH 4Y5VA 5GZOD 4OKVA 3OXSA 4ZOBA 4ZD3L 4KVNH 4NT6A 1FLRL 1CR9L 4I1NB 1WAAE 2BNQB 5EU6D 2WIIB 4NKDA 4KAQH 5HYFA 2E7BA 4YBLC 1YDPB 4HKZB 4JG1H 3JV6A 1V3LA 2DQDH 2FIRT 2C3XA 1EEYA 2LAAA 4AIZA 2KL6A 2DDQH 4XMLL 2VQUA 4QRQA 4JDZB 1DBJL 1JWMA 5IHUL 1KIRB 4Z7UA 1NCWH 2BSRA 3ZT5A 1LEGA 5DGRA 1NMAL 3QG7L 5GGQL 1JYVA 2HG5A 4L4VE 2IADA 1EIBA 4OZGF 2YOCA 3UTPE 3X3FL 2NY6B 4FG6C 2O5ZH 5GIRB 3TBYA 3MOBL 2Q86A 4XC1L 1M7XA 5F1OB 2WUBL 5LBSL 4M5ZL 4AL8H 4N5UA 1HHJB 1F4XL 4G6AD 1UWGL 4Y1AD 4G6JL 4JVPA 3WN5C 1KCRL 1I8IA 4JY6A 4UAOB 5IV2A 3KNBA 2BJML 5C08E 1RVFL 1T5XB 1CICD 4K3EH 2D7TL 1CZ8L 1LP9B 4I0PD 5H2BA 3HE7D 3SE8H 4P4KB 4JFPB 1DBKH 3LRSA 1XGRA 2C7UB 1KN2H 2A6KA 2NLJA 5B3JE 5EULV 5HHOE 3CFDB 1A1NB 5GISH 4NBZB 1HILA 4JZJB 4CVWA 3JWOL 4KDVA 5HI3C 5IKCA 5F70A 2F53B 4JKLA 2FO1A 4NYLA 2XWTB 1CT8A 4NDMB 5JZ7C 2YMXH 3STLA 4WI6A 4PJHE 3MRMA 3DVGA 3NIGE 4BFGA 2NY1D 3VD7A 1CD1B 3QUXC 1MWAA 3RRQA 4QRSA 5F9OL 1UB5B 1P1ZB 1DQJA 4ELME 4QO1A 1JMZA 2XY1A 8CGTA 4FZ8L 3KYKH 4PB0L 5JPNB 4MQXC 1EZVY 4DUWA 4P9MH 5I18L 4OQTL 3CVHA 1BLNA 4NN5C 2GAZA 4OLYH 4JFFB 4KV5F 4HWNA 4KPHL 5HYJB 3VWKD 1UKSA 4UV7H 2X42A 4L4TA 4RWYH 1H0DB 3PP3K 5EB9A 1A64A 1NFIB 3DSFL 3MRHA 3P11L 1NC2D 4HUUB 3CSGA 1NC4A 4Z0XB 3JUYA 2NPLX 1S7TA 3VG9B 2DQCH 5E9DD 3DTXA 1D6EB 4Y2DB 3E3QC 2ZCHL 1FDLH 3UJIL 2UV3A 2WW8A 5C0AE 4ACPA 3S36X 3QH3A 5TQ0L 2VUYA 1HXYA 2WNGA 4XH2A 1BQHG 1BZ7B 2WANA 4WUUE 3A0OA 4XPTH 5GGSA 4Y5YC 3ZDXF 1MCWW 4KRNA 4WTZG 4ERSL 3T2OA 2BNQE 1MRDL 5E95B 5AZEL 4DFHA 4FQ2H 3K2UL 4WEBH 4N8CH 2LU4A 3FQXA 3L7FA 4JO3L 1MWAH 3QWRD 3U9PH 2H26A 4X9HA 1WBXA 5MENB 1CFTA 3TCLB 2NY7L 1A1OB 3VFRB 4LCYA 1P69B 3E6FB 5JORA 4O51B 1S5IL 4OZGE 5HI5D 5IB3B 3CVHH 4WNQA 2ITCB 1YNLL 1RV6X 3HC3L 1YQVL 2GK0B 3MOQA 5EIIB 5JOFB 1Q72H 5CEYB 1AC0A 3FO1A 3SDCD 1FE8H 5CINL 1J10A 2CDGB 1GC1C 1PQZA 4JGJA 4OD2A 3WHE0 5FYLD 5IB5B 3PJSB 1BFSA 1BJMA 4R7NA 3C6SA 1UADC 4N5EC 5IB4B 3P0VH 2A6IA 4P5KB 4W6YB 1H8NA 4GW5A 2QADC 3VXQB 1LE5B 2C3VB 1AGCA 3BQUA 3MLRH 2ZNXA 1LP9E 1KPUA 4UUJA 4KROD 5JPMA 2WINA 1KJVB 5I1GL 1A6ZB 3O45A 3VFGL 3VA2C 5EU4B 5C70A 5J13B 2A73A 4X5LA 4JFDD 2NYYD 2VDQH 3PDDA 3S7GA 3LMJL 5TE4L 1GVIA 1F8TH 3IAQA 3VA6A 1FYHB 2F53E 4JPVH 4PRIA 3B5HA 3SDXA 2CR6A 3DVFA 4JKWA 3MACH 4ZFOB 1CLCA 3GK8H 4L5FL 2OJZL 1RZKC 4HKJB 3GHBH 3CDFA 4HBQA 3VRLE 1J8HD 4PJ9C 3H7BA 2WWMD 3S34L 4UTAH 5E8PB 4QHKI 3V0WH 3QQ9D 5I15H 4KV5E 1U92B 5IHBA 4D9RE 4L8SC 1Z9LA 4G80A 3MV7B 5BS0A 2B7DT 5JDSA 3REWA 1RURH 4JFFE 1H5BA 5AZ2H 5IB1B 3QA3B 1FZOA 5FUCC 4ZUSB 2FGWL 5F96L 1N5AB 2XIDA 3TV3H 1FAIL 4J3UA 1XGQA 3UPRB 4PGCA 3IXTB 4DUXA 4XHJC 3QO0A 1FRGL 2X4OB 5JIHA 2EDWA 4PPTA 3HG1E 5D7JB 4OZFA 2H2PC 3BT2L 2LTQC 1D5ZA 4HS3B 3ZDXE 3NBNA 1MFCH 1ZHNB 4BK5A 1ZGLM 3D2UD 3P4NA 4JRXD 3QI9C 4BQ6A 5FHAH 3P9WB 3DV4B 3VGDA 5FHBL 3CDGB 1R3IL 4N8VA 5C0RL 2ESVB 1R5WA 3VWJC 1BM3L 1WZMA 4KFZC 3HI1B 3BDXA 1E28B 3QHZH 1FZJA 1QSVA 1UACL 4PUBH 5DUML 2XKSA 4PRPA 4M1CC 4M7JH 1G7HA 5C2UB 1CFSA 3QQ4B 5MENE 3CFJB 3I3EA 2VTFA 2Y36L 4OUOA 5GRVL 5C0IA 4PJ8B 2VDMH 2HFEA 1U2HA 5C07B 5C86A 4HX1B 4WV1C 3SKNA 3WNPA 3PGCA 4XGZB 5F3HA 2VISA 3PWVA 5EZJA 1OAKH 4ONOA 1J11A 5DJXB 1A4JA 2XZAL 1M05B 4OUUB 3WO4C 3PXJA 4UT9L 2ICCA 4KK9C 1BQHB 4XCFL 5KN5A 3HS0B 5KVGL 1JGVH 3JWOC 5IESL 1AGFA 1J88A 3VFVA 4XCCH 3P9MB 3ZTNL 3OSKA 4UOW0 4U1MA 3E1F1 4MJ4A 4FQJH 1UG9A 4XBPB 2UWEA 4OLWL 4NJAH 3ME0A 1IRAY 4OZFH 3RZWA 3WXVL 2WMPA 3DROB 4J3TA 2BY2A 1ZLWK 3SQBA 3S4SA 3V0VA 3Q1SL 5FUZL 1QBML 4EI5A 1ZHLA 3I50H 3DETD 1KACB 3WNMA 4YC2C 4HPOL 5I1CH 4ODWB 1BVKA 4U4BA 2JK5A 4I3RL 3L3IB 1GGCL 4XVSL 5ISZE 5C0CD 2APBA 3M8OL 5KG9B 1D9KB 4G8IA 3LKSA 3O3DB 1NAMB 1PG7H 1LHZA 2P24A 2JJSC 3N9GH 4KKBC 3H42L 4TSBH 4XWOC 3L7EB 4HUWB 4PRBA 4J7RA 5ESQB 1PY9A 4U6VH 4L3CB 2BSSB 1I9RL 1OGTB 1QSFB 1FH5L 1MPAH 2V17L 1REIA 5E0QA 4M5YL 4D2NA 5SWSA 3WDJA 5IM7A 5B38B 1F58L 1A2YB 1RJLB 5L2KA 3ROOA 2W0FB 3TNMA 1XEDA 5BVJB 2C4XA 1VB9A 5EZLB 4ODVL 5CJ8A 3D18A 2WLZA 4D0DA 1OGAB 1QZ1A 1XF3B 3U6RA 5T3ZL 4NO5B 3ARWA 3Q6GL 4OLZH 4FQLL 2VB5A 3H3PH 1AC6A 4U1GC 4Y8DC 1HYSC 4P46C 5JIPA 4QOKE 4S1QL 4UNTA 2DL9A 2NY5L 3GKWL 5FKAA 5ESAA 2YD4A 1KJ3H 1U8MB 4YDKL 2VNCA 1KPRB 4J1UB 4FG6D 4J8RB 5KSVB 4MQTB 4IDJL 1BMGA 5EFIB 2AK4B 1KFAH 1RZ7L 3TBSB 4NKIL 5I1KH 5IOPA 4LBEB 2FX9H 3FRPA 1AGDB 3EZJB 2ESVE 4XHQA 5F7UA 4OGYH 2OTWA 1XCTA 4FMFA 4GH7B 4X8XA 3VFPA 3BP5A 2XWJA 4POUB 5DFVC 1NBZB 2PW2B 5D6CA 2P8LB 4YEEA 1HI6B 1KCVH 3ARPA 3CX5K 4Z7OF 1AQDB 2VQTA 3MV9A 3RDTA 3MYZA 4Q6YA 2SEBA 2EZ0C 4ONFL 3JV0A 1DUYA 2NNAB 3U7YH 5ACLA 2ZJSL 1MCEA 2H3NA 3T2NH 1UEMA 2UWEF 5J8OA 3MCKB 5J12B 4PP2B 5DI8A 4RMTA 2W59A 1MRFL 3MZGB 5E6YA 1HINL 4N90D 3IFNL 3SN6N 1R3JA 3N1MC 1RK1B 5BQ7A 1JZ5A 2R2CA 3QUXD 1KJ2B 4U6HA 1U36A 4QY8A 2K7PA 32C2B 4LSQH 3BQUD 1OVZA 4X9IA 4X83A 3BUYA 2B0SL 3W0WB 4W68A 1X5HA 4MQXD 1QSEB 1QFWL 5DD0H 4LSPH 4TUKH 3CK0L 4G9FD 5C0JB 3JTTA 4TUOB 5GSRB 2XZQH 4PJIA 2J6EL 5IFJA 3C8KA 1S7QA 4EOWH 4PRID 2DQJH 5GGTL 5D6DA 4PLNC 4QWWD 2Y06H 1F3JA 3TJHC 3C5ZB 2DM7A 3W5NA 1KB5L 2J5LC 2NZIA 3MNWA 3GIZL 2XNAA 1S7SB 3M1BA 4ZPTB 4EDWH 2P43B 3UMTA 1QSFE 3CLFH 4XNZB 4MAYC 2OQJA 4HIIA 1YNTA 4G6KH 1RUKL 5CBAA 2X4PA 4K3GA 5MHSD 3UDWA 1N2RB 1PD6A 1WBZB 2L0DA 2R4SL 2WBKA 1QFUL 4X5WB 5HGDB 5AAMA 5JIKA 4FQQB 2H1PH 3LPFA 4LSDA 3PL6A 4Q6IA 1IGML 4BFIA 4O9HL 4LDEB 4WCYH 4C56D 3Q6FA 2O5YH 4H8WH 3MLVH 3O41A 5GJTL 3CSYB 4BQ9A 1I7ZA 2IMNA 4DN4H 1G0DA 5JO5B 3QCTL 3KJ6H 3W11C 1C1EL 3GKZA 4X7FC 4H5SB 2HRPL 4HH9A 1FN4A 5TDPA 3QEQD 3B9EA 3IXAA 4KC3B 1FLTX 5SWQA 1B2WL 1IC5L 3IDXL 1TPXB 2AK4E 3RNKB 5AUMB 2YUZA 1B0RB 4OLVH 4N5ED 4P57B 5DA0B 5DSCB 3X11A 5F7MC 4XI5D 2P4AB 3ARXA 1MVUB 2QADD 5ID1A 3KPRD 3QJHB 2YC1B 2X4QA 1F6AA 1ZVSA 3FFCB 1BFTA 2OLDA 3I9GH 3R4DA 2DM2A 3T4AB 3IRPX 3BOVA 3SCMC 1S5HA 1EX0A 2UWEE 3IJSB 1MY7A 3BUTA 4LKCA 4KVNL 5FK9B 5E6IB 1EAJA 1M7DA 4PJGF 3B4NA 4LARH 1BZQK 5JQHC 3RY4A 5DQJB 5HVHC 4KAQL 1MNUH 2DD8H 4OCYH 1VACB 2X09A 3LRGA 3VFTA 4PJCB 5T1MA 3RVUC 4J3OC 2NTFB 4LHUB 2DQDL 4PJIF 4ZXBC 1IGTA 3RGVB 3S35X 3V6OE 4PJ9D 1RULH 5DRWB 2Y25A 4ZAKC 1V5JA 2DDQL 4MLSA 2QLVB 4R96A 2P8MA 5DMGC 2ZSWB 4CW1A 4M93C 1NCWL 1QLRA 5IMLA 1T0MB 4NC1E 1EJOL 2F5AH 4LDOB 4BYHA 1MVFA 2AERT 2O5ZL 1P9MC 2AJZB 2R39A 4MXWH 4AENB 5L2KE 3HPJA 1NBVL 4K55A 1YYLH 3VFUA 4UILL 5DJZB 5E8OB 3CPLA 2OSLB 5KOMC 2JLLA 4AEIH 5I1DB 1A7QH 4HZLA 4YHZH 2YBRB 4YR6B 4JM2B 4XHJD 3RUGB 4K3EL 3O4LB 5E03A 3LIZH 2AEQH 4I4WB 3D0VB 3V5DB 1DBKL 1S7VA 5D7IB 4F80A 4DQOL 1QHOA 3QIWB 1GGYA 2H2PD 4JFED 1S3KH 4JPIA 4RA3A 5HI4D 4JQIL 3HI6L 3SDAC 5GISL 5DYOB 2GSIB 1GZPB 5D7IF 4NKMA 5F1NA 3MRGB 1ZT7B 2BHZA 4NQTA 1JZ7A 2IANA 5D1XB 5KSBA 4ZQKB 2Z31B 2CDEB 4EN3A 1CDBA 4NZDA 1FGVL 2YA0A 1PAMA 3BESR 2C1OA 3OG4B 1IM9B 3OR7B 4ETQB 5CZVL 2NXZC 5IEHA 4Y4HC 5JW3L 1NBQA 4ODXA 4ETYA 4F7EA 2J8UB 3VXMB 4UIKH 3MX0A 5DQ9B 2Y72A 3KYKL 2ICWA 4NO2A 2J8UF 5E5MA 3CMGA 1M1SA 2IQAB 3NH7H 2YUWA 4LRIC 5ID0B 1H3VA 3NZ8A 4P9ML 3U7WH 2EDXA 5F88B 5GRWA 1HQRB 3KPNB 4OLYL 1CBVH 4O58H 4JLRB 1J8KA 4N0YL 3R8QA 3SEPA 4LSTL 2C9AA 2D7OA 4HMEA 3RIFF 5JXEC 1GAFL 4L1DA 5FCUL 3N1QC 4JDVA 4JFZH 3DXAA 3K1DA 2A6JB 4ORGA 2GSGB 2EDEA 1K5NA 1PSKH 4HMCA 4U6XA 5HDQH 4AG4H 2DQCL 3OPZH 1FCGA 3IDNB 3IFPB 2HTLD 2Q76B 5FYJE 1FDLL 5EO9A 3L5JA 5E94A 4N0CD 3MV9D 4X7SH 4B7LA 3MC0A 3ULUH 3MRDA 4PJGE 3S5LA 3TIDB 1R5IA 2ARJA 3QQ3A 1AI1H 1RHFA 3GJFK 4XPTL 5EU3B 3T0EB 1J0HA 3ARDA 3KYNB 3EKCA 3NCYP 5FV2A 4P48A 3VXRD 5INCA 3SPVA 4GS7B 4N8CL 4U2YA 3O3EA 3F7VA 1OTUC 4XWOD 1I1FA 4DZ8A 3DPBA 3BKYH 4NQDD 4AT6A 5C0GB 2ADIA 5FKPA 2YD9A 4PV8B 3VDCA 3C2AH 4I5BB 2ZWLT 1XR9A 1JP5A 4IOIA 2HH0H 5C0FB 1SJEA 2H6PB 4MA7H 3VGAB 3REVB 2J7LA 3FO0H 4ZDHB 4FFWC 4JQXA 4D3CH 3CVHL 3KJ4C 5D93C 4RFEB 3WS3B 1D5XB 4FFVC 1KCSH 4Y0GA 1FE8L 3DRQB 5DHVH 5T3XH 2ZCKH 3MNZA 3WUZA 2WQRA 3D48R 1Q9WA 4LLMB 1QSZA 2PTVA 4ODUA 3RJDA 3VXUA 2OK0H 2MHAA 2HLAA 2EYRB 4NQED 4YDVA 3F12A 1E6JL 1HYSD 4HH8A 4P46D 3MPCA 1DVFA 3GSVB 1JFQL 1XAUA 2NY4C 1T2XA 4HQQL 4EVNB 4IMKC 5LG1A 3RUGE 5E2TH 3MLRL 4CAGA 1BAFL 4HSQA 1OP5H 2X1XR 5D7IE 2YHGA 4LHJB 1UKQA 2H32B 3IF1A 3TYFB 2IFFH 4POZC 2CJUH 3MRKB 4AQOA 1ADQL 3E8UL 1WTGT 5DVOA 2VDQL 4PRHE 4XP6H 1TTUA 4N0UE 5K9JH 3ARQA 5FGBA 1F8TL 3NFPB 3AAZA 3UROR 4WW2A 2OP4H 5C2BH 2VDNH 3DV6B 4LLWA 2E9IA 3ARGC 3MACL 5IMOB 4N68A 3GK8L 3U4BH 2FD6H 4NQUA 3X14B 2HKFH 5DFVD 2EIZA 4H26A 5IWLA 4NKQB 4RDQG 5AYUL 5EH1A 2RFXA 1LK2A 2J8UE 1OM3H 4LGPB 3B6SA 2GJ6B 3VXME 5FEBA 4UTAL 3T3PF 3V0WL 3W82A 2MTPA 1HOCB 3BMVA 1XGTB 4X6DA 3UO1H 4E41B 1MJ8L 2Q1EA 5FM5M 4KJYA 5HHVH 3I2CH 1RURL 2BOCA 1P7QA 5DEFA 1EK3A 3QDMD 5C0DB 4LMQI 3GSXA 3LV3B 4WFGD 5K9KA 1U3HD 5IK3A 1LO5B 4KXZH 4QHUA 5SWZB 3TV3L 4FN0A 1BF8A 2R0KH 5E2UH 4OI7A 3QO1B 1YY8B 4BH8B 5FO9A 1BZ9B 3MLTB 3MRQB 5D2NB 3Q0HA 4FQPA 5CBEB 4FXKB 2B2XL 3CU7A 4Z5RB 3QFDB 3LDBC 4UQ2B 3S3JA 1D5IL 5IB2B 1ES0A 1WV7T 5HGBA 2P7TA 4GW4A 5IQ9B 1MFCL 1KXTB 3LSOA 3IETA 3SOBH 3G5YB 1AD9A 2IPKB 2AEWA 4NO3B 3T0EE 3IU3B 4PREB 2X4RB 3INUL 1CGUA 1JN6B 3TJHD 4K7PX 3QHZL 4HT1H 1EBPA 2W0PA 4R26H 1MCKA 2F54E 4P2RA 3B8YA 4ZO6A 4Z18A 4LSVL 3KLAA 5HDLA 2DL2A 4X8JB 4LSRH 2VDML 3ECBA 3MODH 4UIMB 4EDXB 4MAYD 1JF6A 1MFBH 5IQ7H 1ZEAH 2WBJB 3EOTH 5I9QB 4C54A 1H3PL 2GJJA 4U0QB 5GSVB 1WFTA 4OGAC 4J6RH 1CU4L 2IANE 1MUJA 2HN7B 2WIIA 5CJOH 2DI9A 4MA8L 3ZDYF 1QFOA 2BSTB 3GRWA 1JGVL 4PD4K 1CD0A 1ZVYA 4YHIA 5C0BB 1YDPA 4YXKH 4HKZA 1KTLA 2R2BA 4P23A 4FQJL 1FCCA 1XH3A 3KWWA 1YEDA 4E42B 4LVHC 2GYSA 4AMKL 4P99A 1O7SA 5DVLA 2YEZA 1U93B 1PZ5B 4Y2DC 5E4EB 5CD3B 2VLJD 4PJ7A 4JDZA 2HVJA 1KIRA 2X4UB 3ZKNC 4IRJD 1CGXA 1AE6H 5I1CL 2L7JA 4KVCH 3G04B 5F7EL 4MAUH 1R0AL 3EIFA 3VXNB 5GIRA 3X12B 4OD3H 4QT5A 3GMQB 1JHLH 1HHJA 2AABH 1JNLH 1PG7L 5DJ0B 5FA3A 3T2PA 3N9GL 3WNLA 3QFJE 4DOHB 4QF1B 2D7NA 4FZEH 3PWLA 4N0FA 1A6UH 4U6VL 1NGYA 1PY4A 3WFZA 1L9MA 4HBCL 2JCCB 2GJ6E 3DVIA 2I24N 4P4KA 3BYTA 2VQ1B 4Y5XB 3S88H 1T7XA 2PR4H 1GPOH 2CXGA 3MMEA 2OR7A 4OBRA 2JCCF 4E41E 3Q2CA 3TN0C 2EE6A 3SGDH 3N1GC 4JZJA 3TVMA 3P9LA 2X9XA 2EDTA 2FZ3B 4NRZA 4OLZL 4C4KO 3BGFB 3GRWH 1NCBH 2BY1A 5SWZE 3RVUD 2FIKB 2QV2A 4ZXBD 4QNPF 3L5WA 5I30H 3HZKA 4NBYB 3MBXH 2MNUA 3VMOA 5D2NE 2GUOA 2GFBB 5DMGD 1CDGA 3HAEB 1UB5A 2D9CA 1T21B 4OCXL 1JZ8A 2IAMA 3MLZH 5CWSB 5ITBH 2A9MH 2GT9A 4PY8J 2WLYA 5I8KH 3GSQB 4K94H 4UNUA 4HXBL 4LEXH 4ODHH 1MSPA 5IUSA 1KFAL 3OKDB 4EZMA 5J13C 2YSSB 4HS8H 1BD2D 2FX9L 5HYJA 1L4IA 5JOPD 1IQDA 1UZ6F 3BP4B 4NM8H 4OGYL 1H0DA 5ETUB 2PNDA 2VDPL 3FKUS 5I16A 3D85B 1ZHBB 5J11B 1S9XB 3VXUE 3D6GA 3LKOB 3TPUA 1WISA 3R8BB 1KCVL 2Y5EA 5T1KB 3H6JA 5D2LA 3ZE1E 3WNNA 1D6EA 1ZSDB 4HIEB 3UXFA 3A6BL 4LCIH 2ZPKL 1I1AB 4LVOC 5DQDL 4P3CH 4WWKA 3WNOA 1DL7L 5F1SA 3T2NL 1VFAA 1OOAA 3FQUA 1KNOB 5FO8A 5GRJH 3OKNB 3ZDYE 2YD6A 1Q0XH 3UPAA 1KTKE 3SGJC 5D5MB 1RZJH 1GXEA 2QSCL 4Y4HD 2CKBA 4W6XB 5CHNA 1IEAB 5C6TL 3LOWA 3P0YH 2CRMA 3ZKMC 2W60A 5DJAA 1G9EA 1NLDH 3MRLB 2R1YB 2YPLA 5D7LB 3OB8A 1EVTC 3HNTL 2R2HB 1A1OA 3VFRA 5DD0L 4LSPL 1AP2B 1B6UA 4DKFL 4HCRA 1OAQL 4J4PA 5F7KC 5D7JC 5IB3A 3F62A 1EMTL 4QYOB 1IAOB 1T3FB 2XZQL 4L4VD 5EIIA 4X4MA 5CEYA 3UTPD 4UZGA 4EOWL 2BY3A 5KAQG 2DQJL 3MFGB 3L3GA 5I75C 1FBIL 1IEHA 3OBAA 5L6YH 5CSZB 2YD3A 1U8NB 4QCIA 2YD1A 4P5KA 4DOHE 3N0PB 3VXQA 1Z5LB 3QAZC 2BMKA 5E1AB 5BJTB 1G6RL 1NEZG 3GJFB 4FOMA 4OLXH 3QJFB 3AREA 4EDWL 2JCCE 2ICWJ 4XX1E 1R3HB 3CLFL 4JZNB 2HVKA 2DF3A 4G6KL 1LDPH 5HHOD 1FAKT 4HK3N 2YA2A 5EU4A 4XP4H 5E7FA 3HZMB 4XBGB 3GBML 4FTVB 4UTBL 3RU8H 3KXFB 4MNGB 3U0TB 3EYFB 2CKBH 4QNPE 3S8WA 4R8WL 1ZGLA 5FYKH 5C09D 2FYYB 3GDBA 3L3HB 3KPQB 4HKJA 2EKJA 3IKCA 1LO0H 4ZNCD 3NN8B 2E6PA 2O5YL 4KTDH 4YAQB 4H8WL 3MLVL 2VC2H 4LOUC 4WRLA 1MIEL 4C57C 4HCRH 1JNHB 3KJ6L 3QULA 2OMBA 3HMXL 1OLLA 4FFVD 1U92A 1MJUH 4GAFB 2GEEA 3MV7A 4CNIA 1VPOH 2F5BL 5D2LF 1YMMB 1QNZH 4OLVL 1U95B 1AQKH 4WHCA 4JRWA 4OF6A 1DLHB 2WZPD 3I85A 4PGDB 1W2KT 4X7TA 1N5AA 2V6HA 5ESVA 2IGFH 2ICEB 4ORZC 1H5BC 4YX2H 4GKNB 3KPSE 1ZLUH 2EIEA 2CK0L 1CTOA 2VXVL 5F72S 2E9BA 4FQCL 5ICZA 3DBXA 2HFFB 4GAGH 4EJ1C 1SM3H 3QIBC 4POZD 5L2JA 3BN9D 1R5VB 3IJHB 3HRZB 2AK1L 1KJMA 3ARYA 3AXLB 5JW4R 1ZHNA 2FX8H 1BIIA 2G9HA 5LJYH 3EHBC 4LARL 4M8QA 1P4BL 2A77H 2OBGA 4WU5B 5FM8A 2BNQD 4OTXH 4PJBA 3FN9A 2IPUK 3FZUC 3QSKB 5EIVA 4U7SA 1RULL 1V8HA 4P5MA 2EIDA 3X17A 3QQ4A 1F45A 1MCIA 5SV4A 4XXDB 4YJZL 4PJ8A 3WFBH 4MMXC 5C07A 2X4NA 2F5AL 2QKIB 3QDAA 4LLQA 4P2QA 1A47A 4Y4KB 2W65A 1T89A 4MXWL 1DDHA 5I1IL 4XPAL 3HE6B 2NY6D 5F1IA 1YYLL 5DJXA 4DGYH 4XC3L 2AXGB 4GRLC 3VRIA 5HBBA 4NO0A 4XPGH 4L9LA 4LIQE 2FRGP 3HS0A 4W4NA 3JBG7 2AEQL 3RTQA 3SQOL 3VFMA 2DLHA 3SKMB 3H9YA 3BZ4B 3O3BA 3P9MA 4OFVA 1CG9A 2CIIB 2PXYB 1S3KL 4DEPB 3IDUA 5KANI 1MH5B 2X1OA 2BFVH 1N3NB 2I25N 3MJGX 3FAXA 4MCZB 5FO7A 1S7UB 3ARFA 4TN9A 2PCPB 1EAPB 4F9LA 3TA3B 3Q3GA 3GB7A 4IOSD 2F53D 1KV3A 4LASH 3KXFE 3H3KA 3L3IA 4MNGE 1NGXB 3F7YB 2Q8BL 5J12C 4M00A 1H3TA 1WQVT 3T09A 3DNKA 3BO8B 1CCZA 2CRIA 1Y18B 5GS1C 3W81A 1JTPA 3D39B 3BPOB 1ZT1B 1OSZB 4UIKL 4XAKE 3L7EA 1YN7A 1ED3B 4JO4L 5IVOA 3V6OC 3RKDC 4DJMA 5DHYB 3MREA 3EYVA 3LS4L 3MLPA 1P6FA 3G6JF 3O9WB 4ENEC 2XQBH 3NH7L 4L8CB 5B4MC 2YRPA 3TO4A 3UJTH 4L1HA 4D9RD 4QGTA 1NEZB 1FVDB 1CBVL 4NC1C 4O58L 4LGRB 2W0FA 4OLUL 4R97B 5BVJA 4OGAD 4WU7B 3B2UC 4JFFD 2XTJB 2EC9T 4JFZL 4NO5A 4R90L 5HYJD 1YUHB 1NDMB 1YEJH 5HYQB 1BX2B 1N7ML 2NTSP 3JVGC 1CDYA 1PSKL 4EBQH 5EUOA 4X7EC 3OPZL 5HJ3B 5HPOA 3CZJA 4X7DC 3EYSL 4JKMA 4PJBF 4Y2DD 2RQ8A 4X7SL 1S9VB 4WO4B 1KOAA 1H3GA 3SBWC 4JB9H 3ZKND 2ZOLA 2XKNB 3GMNB 1U8MA 43CAA 4K8RH 2CH8A 4JO1L 4DTGH 1AI1L 4J8RA 4JZOA 5KSVA 4RGNE 5EFIA 1EEZA 3DOSA 1N6QH 4YHPB 1AO7B 1BBJB 1G0YR 2Z0BA 3ET9F 3FB6A 3QPQC 1AGDA 2I07A 3MV8B 1FPTH 5IR1B 4J3WA 3BKYL 4JFOA 3FT4A 4JAMA 2AGJL 1XCQB 2HLFC 3OF6A 1NBZA 2PW2A 3C2AL 5MEND 1RUAH 3OR6B 2A74B 5CJQH 1NH6A 1HI6A 4TRPL 1X5KA 2DM4A 2X70B 1J1OL 1LO4L 3FO0L 4GMSL 1FO0B 2OL3A 4NRXB 4F15B 5DMIL 5J56B 5D72H 5J6GB 1EO8H 2B1AL 1J86A 3DX7A 5DC0A 2ZCKL 1A3LH 1G7QB 1WFUA 3VI4F 1T1ZB 4JVWA 1DQQA 1SMOA 1NGQH 1SYVB 3RDTC 3H0TA 5HY9B 4HFWB 2VDRH 3H3BC 4UU9B 1S78C 1RK1A 1NCCL 3PHOA 1Q8MA 3BW9A 5KZCB 5KS9A 1KJ2A 1BGXH 5E2TL 5I8OH 2JKXA 2D0FA 2H8PB 32C2A 5EC2A 2IPUG 5HDBE 2E7LC 1Q9OA 5C8JB 3W0WA 3IYLW 1BQLH 1JGLH 3IGAB 4QGYA 3BD4A 4G3YH 3WFHB 5GRUH 2IFFL 1DBAL 5ACZA 2CJUL 2EXWC 5EPMB 2XWBB 4IHOA 4LPVA 3GMOB 1IKNA 5KSAA 1IFHH 4GBXB 4H8WC 3P4LA 1ZK9A 4CJ1A 1LE9B 1OW0A 5C2BL 1NKOA 5E6IC 1PLGL 3UP1A 3VFOB 3DMMA 3NACH 2FD6L 2HKFL 2VZUA 2AJXH 1U3YA 4LCCB 3E0GA 1INDH 1DLFL 3G6JE 4G43B 3D39E 4RMUA 2DYPB 1VFBB 3Q5YA 3AM8C 1S7SA 2OL3H 3O2VH 5BOZG 3UO1L 5D8JL 5IHZB 5T1LB 2X6MA 3P30H 2KKQA 5EUOF 1QOKA 2V7NB 5HHVL 2DJSA 4CJ0A 4WI5A 3F7QA 1N2RA 2J88L 2XTJE 4YHLH 1DANT 1ZA3B 5DD6A 3ZYOA 5HGDA 2X44D 3LN5B 4MCYB 1U3ZA 4JN2B 5D1ZA 3ZKMD 4F7MB 1KJ2H 2VZSA 3V4UH 4H88H 4PJBE 4KDWA 5FOBB 1SBSH 4F57L 4JM2C 2FLRT 2GTWB 5IEKB 5E00A 1YC8A 4TSCH 5D7JD 2X4SB 4M7LT 3QIWC 5JO5A 2YPKB 1UKTA 4HPYH 3HC4H 4RQQA 1HQ4B 3SOBL 2F9BT 3RNKA 5AUMA 3BP6A 1B0RA 1CE6B 1AO7E 7CGTA 3NIFE 4YGAB 2ESVD 3NGBB 3MV8E 4ZTOL 5BZDA 1MVUA 1T7VA 4POYA 5F89B 1CDCA 3FFCA 4WTWA 1WWWX 4KRLB 1JMXA 4LSRL 3MODL 4MHHI 3VGFA 3HLAB 1MFBL 5I8CB 2LVEA 3FO2B 4PJ8D 3WLWC 5C07D 3EOTL 1S8DB 2DKUA 3LRHA 1JK8A 5MEPA 3GEWB 1IT9H 4PBXA 5I2IB 3DO7B 4BSVB 1X7QA 4XAWH 4Z7VB 3DX6B 2AJSL 4U1KA 5CJOL 2OI9B 3J8F7 5DQJA 3R1GL 4EUPH 2KZWA 1KC5H 3L9RA 4QRPE 4FQHB 1JTTA 2IJ0C 4PJCA 4YXKL 1U8HA 3RGVA 1PFCA 4YPJA 1K4CB 1HIML 2VXSH 5DRWA 4UT7L 2R4RL 4Z95H 5IVXB 4EXPX 4AY0A 2APXA 3S3PA 4KVCL 2ED8A 3BE1H 5D7KE 5HPMA 4MAUL 1UC6A 1V7MH 4MMZC 3QZWB 3CFKA 5TF1H 3FONA 4OD3L 4KRMB 4AENA 3EO9H 4OCRL 5C7XL 3T0EC 1AXIB 5DT1H 5E8OA 2A2QT 1FNGB 5I1DA 3RKPA 1D9KD 4E5XB 5GS0H 4FZEL 2GY7B 2YBRA 4UDUA 4YR6A 4U1JA 2IEPA 3MFFB 3O4LA 3ZKXC 3LY6A 4FQ1H 4I4WA 3QIBD 3BD5A 5I1JH 2IBGA 2IBZY 1I1RA 4RSVA 5EUOE 3KAAA 5HVWA 1QSFD 4LF3B 3S88L 2PR4L 3PWUB 4RAVB 1T1XB 2YWZA 4CMMB 3VGAC 3DYOA 5DYOA 2GSIA 2NW2A 4KKCC 3WMSA 3MRGA 1P4LA 2DQEL 4RZCB 2HJKB 3RWCB 1AGBA 3SDYH 5D1XA 5JMOC 5JLZB 1OGAD 2Z31A 2Z9TA 4RMSA 1Q1JL 4GKOA 5I71C 1BFOB 1UZ8A 3GRWL 5MI0B 1NCBL 3FZUD 1IM9A 4JHAH 1VKXA 1DQML 3DVNB 3MRBA 3PGDA 1ZAGA 1MCCA 3PHSA 4AQ1B 4ZFZA 1XF1A 5CJXA 3WLBB 5T5FH 5ITBL 5LGKA 1U2CA 3HNVH 2IQAA 2HJLB 4BQBA 5F88A 3ETBF 3MRFA 4ODHL 4DKEL 4JLRA 1UXWA 4HIJB 1R24B 2AK4D 3CIQA 3LQZB 4DW2H 2CO6B 4NZJA 4DVBB 1JV5B 3MSPA 2HT4D 4XCYB 2AVGA 1W8OA 1QRNA 4JHWL 1VA9A 2O26U 4IS6B 2GSGA 3TT1L 4HV8B 1N0XL 4DN3L 4M8VA 1UEYA 4QRTA 4X6CB 4X4YB 4LQ1A 1FNLA 2VZOA 3IFPA 1ZLSH 5FA4B 3L3KA 1S9KC 4LCIL 1I9IH 3GI9H 4Z0BL 4P5TB 4CVXA 1QBLL 2XFXA 3K8LA 1I9JH 4GAYA 2DQTH 4LIQL 1H3WM 2VRAA 5GRJL 1MHEB 1KT2B 4Z76B 4A2MA 2YD8A 5L8LB 5A3IC 3BYYA 4PB9H 3KLDA 3PDOB 1MCPH 2R9HD 3BPLB 1FYTB 3P0YL 3QEHA 4EEEA 5F6IB 4NFBA 1RAMA 2X2YA 1FSKC 3GSNA 5EBMA 3MRJA 5JHDB 3W0WD 4Z7WA 2D03H 5EIQA 4I5BA 5D2NC 5B4MD 4M43H 3TYGH 3GMPB 5C0FA 1QSED 2H6PA 4LSUH 5FUOL 3DURB 4ZDHA 4HKBA 3D25B 1HHGB 1L0QA 3WS3A 3B2UD 1D5XA 1MIML 1H9VA 4YHKL 3RNQA 1I8MB 1XIWA 1YPZA 2Y5TA 3DRQA 3HCVB 1PG7X 5MERA 3F7RA 3FOLB 4LLMA 2V9RA 4HDIA 5E8DH 2AJVL 3BRDA 4I18A 3TM6A 5DO2C 5L6YL 4HUKB 1T0PB 3UZEA 3C5ZD 1SEQH 2Q87A 3BZDA 4I2XA 1XF2B 1GH7A 4PBWD 4K7FB 4KGJA 1XFPA 2JTDA 2E7HA 1GIGH 1NCAH 4HLZG 2ZNWA 3OG6B 4JKPH 4XRCB 4PG2C 2VZ1A 1JWUA 2LQRA 4XNYH 1TITA 43C9B 2WBJC 1TVHA 4XP4L 4ZMAT 1JHTA 4MJ2A 4GKZB 2J2ZA 3RU8L 3JWDH 2HJFA 1T6WA 2CKBL 3DV6A 1CVSC 5IW6B 5EWIH 2E3VA 3DLQR 3JSSA 3NCCB 3C08H 1FVCB 2HLFD 2I60L 4KRPC 3GSNH 1ORSA 4O2EB 4KTDL 3SE9L 1A7RL 1DFBH 1SY6A 5DC4B 3ARRA 4R0LB 4PJEA 1M7IB 1MQ8A 4HCRL 1L7TL 5JMRA 1HOCA 4LLVA 3BH9B 4YE4L 3QDGB 5E4EC 2VLKB 1VPOL 2G75B 2F8XC 1LEKB 3MBEA 1AQKL 3LV3A 3N1FC 1I3RB 4D9LH 1S78D 4F7CA 1GGBH 1T83C 4KWUA 5ABDE 3CFBA 2IGFL 2FBJH 4Z8FH 1Q0YL 3QO1A 1YY8A 5DRXB 3AROA 3MRQA 1IEBB 4KZEH 3FFCD 2OCFD 2DOCA 3WIHA 5CBEA 5FYJD 1RJYB 4MXQC 5C9JA 4GAGL 1BQUA 1SM3L 4NFCA 2VXUH 4UQ2A 1U8OB 3MROA 1WIUA 5IB2A 3L3DA 1IC4H 3MLSH 4Y5XC 3KYMA 5IQ9A 4KMTH 4TNVK 2XZCH 3D0LA 2FX8L 4HLJA 1HHHB 3LB6D 1MCJA 4Z7WF 5E6ID 3G5YA 2A77L 5FDYA 1BVLA 3BKCH 3B5GA 3IU3A 1KTRL 2WBWB 2FWOA 2YK1H 2OX5A 5EBWB 4WJ5B 4LCWE 3BGFC 4NZRH 1YPZF 4LHUD 1SY6H 3PWJA 3RGVD 1RUPH 3PWPE 5JHDE 1P84J 4R4FL 3RWFB 5CILL 4MD4B 4UIMA 1S7WB 2VOTA 1ND0A 4EDXA 3E2HC 1MFNA 4LRNH 4NHCH 1CFQB 1T66D 2VZTA 3L3JB 4P9HH 4YXLL 2PO6A 2D31A 3SDDB 2AJUH 1DSFH 2XZZA 2EDJA 2ATKA 1WVZA 3WUWG 1MCLA 2VSCA 4JRYA 1NGPH 4XPGL 3L95A 4HKXB 3T1WA 1KIPA 3O6FA 3WN5B 3QUZC 1ZT4A 4K3DH 2PETA 5C0BA 1VADA 1RJZA 4JM2D 3ESVF 5J11C 3HZYA 1U91A 1CLOH 2DQFA 4IIQB 1EEQA 1UQSB 3TBTB 3QIWD 4ZTPH 3LN4B 1U93A 2BFVL 4PJFB 4HGWB 1ZVHA 4X6BA 5CD3A 4DCQB 4P23C 4L4JA 2BDNH 1G9NH 1UFUA 4TSAL 4PRHD 5EORH 3BZFA 4FFZH 4PJFF 5TFSH 5D1XD 3VXNA 4FABL 4PJEF 3FTGA 2PW1B 1IM9D 4YEFA 3GMQA 5GGRA 4KK6C 2CLRA 3EO0B 5TQ2L 5DJ0A 4NKOA 5FECA 4TVPH 4AEEA 1CWVA 4MJIB 4QF1A 5EU7E 4NQCB 1LO2H 7FABH 2BNRE 3VXMD 4MVBC 2NY3B 4G42B 3WLWD 2XQBL 4V1DB 5ANMB 5ICXB 3VDBA 1FFRA 4YBQD 2VQ1A 1AGEB 4O4YH 5DD3L 5HGGS 4ZNEE 3UJTL 4N8PA 5DA4A 3OKMB 2F74B 4LPXA 4PRDA 2ILLA 4FQXA 4NM4H 1YEIH 2VN4A 2A83A 1KSRA 1U8KA 1K8IB 2AEPH 1IAKA 1ZE3C 4GRWH 3BPCB 4DUVA 3QB7C 4C83B 1I7TB 1YEJL 5DRNA 4EBQL 5DLMH 2FIKA 3RVXC 2ZOKA 2QJDA 3OB0K 2WUCH 3TEUA 5KANG 5IF0B 1JL8A 4CU8A 3U82B 3FQRB 2FB4H 1DQLH 1I8LA 1NMCB 3L3OA 4JB9L 3BAEL 3EYOB 1GGTA 3MRCB 3B9KB 4K3JH 4YHNB 4JY4A 4K8RL 4DTGL 2VE6B 4YFEA 2QQLH 5ADOH 2NZ9C 3BHBA 4S1SH 2X10A 3T0ED 5DJ2B 2DQGH 3BDYL 1AR2A 1A9EA 1IGYA 2YZ1A 1V7NH 5CSBA 5BW7A 3HTLX 3P77A 3QCUH 2R1XB 1S9XA 3JXAA 4XBEH 4Y16B 1RUAL 4BFEA 1G7IB 5CJQL 3BH8B 3UTTB 4GRWF 2I9TA 4S1DC 2Z93A 3VCLA 4J12A 1L9NA 1I1AA 4KKCD 4OCNC 3VXPA 3GSUB 4MYWB 5D72L 3CC5B 1UM5H 3TZVA 2NMSA 3IDJB 3RL2A 3NZHL 1U8LA 2J4WH 5GRYA 1NGQL 1U8JA 2I5YH 1FIGH 4D0BB 3QEQB 1KNOA 3OKNA 2VDRL 1T04A 1RJCA 4PJXB 3UYOD 4KKAC 4MJ6B 5D5MA 2DJ4A 3QUMA 4WWKC 3CSBA 3KPPA 5GGUA 4F33B 1BGXL 3CH8A 3K81A 4PJXF 5I8OL 4PIRF 5BO1L 1IAIM 2R1YA 5D7LA 2QADB 1D5MB 4KI5F 4U1HA 5GRVK 4PJ5A 3KPRB 1BQLL 1JGLL 2I9LA 5DUBB 1CTNA 1A14H 4IBLT 1JZ2A 5ENWB 1AP2A 4LCUB 4PJFE 4JGUA 1NAKH 4H1LG 3C5JA 3ZHKA 1T3FA 4O02H 4ZSOA 5DWUH 1T03H 1TJIH 3CX2A 2VSDA 4RGNC 3WEXB 4QTHA 3HPLB 2AJXL 3D69A 1INDL 4L29B 4L8BB 1U8NA 5LGHL 4MJIE 4XB7A 4A2LA 3DGGA 5E1AA 3UTSB 5BJTA 4XT1C 3WL9B 2GJ6D 3NCBB 2VAAB 2OL3L 3OAZH 2DM3A 3QWQB 4PGEB 5ITFB 5ANME 4JPKL 3MGOA 2P5WB 3ZSSA 3HUJF 2CLZB 3P30L 2Z8RA 2OR9H 4E41D 2BOBB 1RFDH 4L8SB 3O6LH 3C60A 3HZMA 4XBGA 1MFDH 5JIIA 4FTVA 4GG6B 3QUMH 2D4FA 3IDGB 3EYFA 3OZ9H 1FJ1B 3HE6C 4GQPH 4RDQF 1N64L 5GHWH 5SWZD 3SJVA 5IFHH 3V4UL 2CIKA 4H88L 4NBXB 4JR9H 2FYYA 3FB7B 3CH1B 3KPQA 4ONHA 3MNVB 5D7SH 3FQNB 1SBSL 2B1HL 2NX5B 5CGMA 1A6TA 2VL5A 1QR1B 4TSCL 2A6DA 3C09B 1AHWB 3BEVA 4U3XA 1ZS8A 1JNHA 1B3JA 4HPYL 4DEPC 4JFEB 4RCAA 4LNRA 5ERWB 2ENYA 4JE4B 4TQEH 3EOBB 3RBSA 1J1XH 3UTQA 3PGFL 4HF5H 1U41A 3MRPB 1YMMA 3QI9B 4F8QA 4TULH 5DO2D 3TA3C 1OLZA 1P5UA 1YEKL 1RZIB 3SKOB 1LNUA 1XZ0A 2A1WH 2C3WA 2XXCB 5TPWH 3G5VB 4X6FB 3VWJB 1H8OA 3DRTA 1RZ8B 1UB6B 1B0WA 2ICEA 4GRWE 5T1DH 3LZFH 4B41A 2G5RA 4TVPD 4HS6B 4GKNA 1A6VH 3MRNB 3BPOC 4YDJB 1I4FB 1LEIA 4G8GB 3UTTE 2VITA 1F90H 3T0DA 3O9WC 2WBJD 3IJHA 1KCKA 1BFVH 4HC1A 4WV1B 2OR8A 5CEZD 1IGFH 3WIIH 4U1NA 3O2WL 2XN9B 1HH6B 4R97C 4XAWL 1A7BA 2E27H 2DLFH 5CEXB 1F11A 3LCYA 1F4WH 1OARH 5K33A 3TBWA 2XTJC 4PJXE 4WU5A 5HGHA 3WO4B 1KG0B 3MJ8B 3D3VE 4KI5E 5C0BD 1JF5A 1K9TA 2VXSL 4HWZA 2CUMA 4FFYH 5IMKB 2OXHA 1W72H 2Y9RT 1E4KA 2CRYA 2ADGB 5EOTB 1JPST 3PQYB 4YO0A 5C1MB 1UWEL 2C3GA 4Y19B 5DVMA 3BE1L 3IAPA 3T8XA 2Z8WC 4HFUH 4O2FB 3V5KB 4Y4KA 4U6YA 3U1SL 1FFQA 2IC2A 3D87B 4YC2B 4YQXH 1M71B 3EO9L 3EDDA 3ZE2F 3TJEL 2AXGA 3V7MA 5AG8A 5EN2A 3P4OB 5EUKA 4Z6AT 2XV6B 3ELAT 3MZTA 3MR9B 4MHHG 5GRXG 5IMMA 4MXQD 1F4YH 4FQ1L 1D5BB 5I1JL 3HUJE 3UTSE 4H0GA 5JUEH 5T5NG 1S9YB 2P5WE 1OQOA 2MFNA 3ZL4H 4XNQA 1VGEH 5J06A 3NCJL 4MCZA 4KJPD 1C12A 4F15C 1VGKA 3PIQB 1TZHB 3CGTA 3GJEB 1AIFA 4GG6E 2AJ3A 4XVTL 1NEUA 4JHAL 3H9HA 1HHIA 2YXFA 4H1LB 4PGBB 3FO9B 3PHQA 4QRUA 1I1YB 1QPXA 2HT2C 4AJ0A 5IT2H 3BZEA 1OAZL 1Y18A 4OZHA 3WNKA 4TTDC 1ZT1A 4LVEA 1K6QH 3ARBC 1ED3A 2NX5E 4Y2OA 5T5FL 3QXTA 4G6FB 3BP7B 3HNVL 3LEXB 2OXGA 4YH6A 4YFDB 1N8ZA 3G9VA 2P5EE 2DBJA 5C0EA 1NUDA 5GRZA 4R4NC 4GXUN 1JZ6A 5IBUG 3RWJA 4NQSB 1BOYA 1NFDF 2GKIA 1FVDA 3VJ6A 1KEGL 1YEEL 1XGUA 4HWBA 1VEOA 1BOGB 4GBXC 1DEEA 1KCUH 4M1GH 1A7NH 5FGSA 2AXFA 4MDIB 1YUHA 4APQC 4Z77A 3TGXA 2DQIH 3QUZD 5ILTH 1R3LB 3WHE1 4YHOL 3D85D 1WT5A 3S96B 4XMKH 4QHLA 1ZLSL 4GG8A 2OZ4H 3WJLA 5CLWA 5IW1A 1LD9B 5T1KD 4P2YA 1I9IL 1ZTXL 1BP3B 4GKSA 1X6LA 3GI9L 3MRIB 4WO4A 1I1AD 1G9ML 1MLCB 2ZSVA 1VERA 1MI5A 1GCFA 1I9JL 3WO3B 5I1AA 5DJYB 2DQTL 1K3IA 3K4DA 1ZGLP 3I3BA 5D1QA 4Y4FC 4ZUTA 4KHXL 5JW4M 3BSZH 3KDMB 4P2OA 1LK3L 5CJBA 3RWDB 3QEGH 1MREH 1ZHKB 4ZSOE 3HR5A 4W4OC 1YMHB 3RP1A 4AEFA 3DUUB 3AMKA 4BK4A 1WWCA 5IR1A 1SEBB 4BZ2H 3DHMA 1UWXK 2H2SC 5D7LD 3QUKA 2D03L 3TYGL 2W91A 4M43L 1EFXB 4QXGL 5I1LA 3A6OA 2DQHL 3OX8B 5EZOH 5B8CA 1PKQB 1QQDB 1WJ3A 4NRXA 2X05A 4Y19E 4DK6A 2Y7QB 1H3XA 2BVTA 3BWAB 5I19H 1G7QA 1CLZH 4YIQA 1C08B 3CXHJ 4CVZA 5E8DL 1SYVA 2XG4A 5K9OB 3ZTJG 5HVFB 1ZWIA 4CGTA 1WBYA 4HFWA 5SX4H 2DLGA 2R69L 3RVXD 5L0QB 3WFCL 1SEQL 3DARA 3C87A 4LDLB 4KY1H 4JN1L 5TF0A 3MLYL 2Q6WB 3U7AA 3SJVE 1AKJA 3MTRA 3VXSA 1GIGL 3LQAL 1NCAL 5DZOA 2P49B 4GJTB 1I7UB 3UJJH 4JKPL 1UVQB 2D7PA 4XNYL 1WIOA 3LKQB 4RGOH 2ZZUT 4OZHF 5H35B 4MAYB 3B8SA 3KS0H 5EPMA 2NZ9D 1QLEL 4ZPVB 3AS1A 3T0AA 3T4YB 4NSKB 4PLKD 4FS0A 4QHMB 2JJTC 3BXNA 2DI7A 3KXFD 3K46A 4KDTA 5DEGB 3VFOA 2PYFA 3T0BA 2OI9C 2BZDA 1RK0A 35C8H 4LCCA 3TH2T 1G7MB 5J57B 5EU5A 3O11A 4XAKD 1KGCD 1DFBL 4G43A 4JANA 3EFDH 5GJSH 1SYSA 3ULVF 4S1DD 2YN5A 3RAJL 5J89A 1VFBA 1QYGL 5E2WH 1S7XB 1NFDE 3ZE0F 2PUQT 5D71L 5IHZA 4I0KA 4AZ8A 2DBLH 4WHYG 4ALAH 2V7NA 2PYEE 2W07A 1YMMD 2YWYA 4HK0B 2AKRA 3HN3A 1NBYA 3V8OA 2UZXB 1GGBL 2EDBA 4MCYA 2FBJL 3RX5A 4Z8FL 1JGEA 5J9PA 4GW1A 5KJRL 1XR8B 3EDJA 5TH2A 2YD5A 5TDNB 1TETH 3LH2H 4KZEL 1EEUA 3HMWL 3O8XC 4D8PB 2FR4B 2GJZA 5IG7A 1N59B 1NUGA 1TMCB 4X99A 1E6OH 2DS4A 5JR1H 3U9UB 1OTTC 1CICA 1IC4L 1CFBA 3CSPA 2X4SA 4LSSH 4I0PA 3QUYC 4KMTL 4MJ5A 4JJ5B 3BIKB 3SCMB 4N1HB 2D2OA 5DDHA 2BCKB 5B22A 4ISVB 4WWID 3TH3T 3BKCL 3H9SE 3RQ3A 4P4RB 1MEXL 2CDFB 1Q9KB 3GI8H 3BD3A 4NZRL 3LPGA 1U8QA 2VR5A 4S0TD 1RUPL 2IBZX 3RPIB 2BP3A 1UH4A 4LLYB 5CCKH 3FOMB 1I9EA 4ZAKB 5F9AC 1A7OL 4QHKJ 1PKQE 4E0RA 3H8NA 1IGJB 4P9HL 4M93B 2JJUA 4ODSH 4JO2L 4Y4KD 5A2JH 1TVBB 3KLHC 5EO1B 1A4KB 4OAWB 1HH9A 5GGRY 3HE6D 3HC0B 5I2IA 3M17B 4ZG1A 5KVFL 4Z7VA 5FFLA 4M7LL 1T4KB 1NGPL 5I1EH 4K3DL 5I66B 5AD0B 1QEWA 4FQHA 4LAQH 3FN0H 4PY7B 1K4CA 4UQ3B 1NC2A 1MHCB 4JFXB 1CLOL 1LQSR 4X4XA 4XXCC 1UJ3A 2PXYD 5F6HJ 3FCTB 5E9DA 4KHTL 4G8EB 4P3DB 2BDNL 3TT3H 1G9NL 1DE4B 3SDAB 1AFVL 3U4AA 3VFNB 5EORL 3OKKA 3A67H 4XVJH 4FFZL 5TFSL 1UM4L 4F37F 3TA3D 3PABA 1R6VA 3MA7B 4PV9A 4WFFD 3BKML 1V3JA 2J3SA 1T20B 3OAYH 2AV7A 3V8CA 1KTDB 4NQVB 3UEZA 3QPXH 2ZG2A 3ULVE 2NXZB 3BPLC 4TUJB 3VXTB 4KQ3H 4WHTA 4OF7A 3VE0B 3TWCH 3D39D 1INQA 1LO2L 3D1MC 3ZE0E 3MFFA 8FABA 1EJ6A 1J1PH 5JXAH 4M4RA 3QWRA 1JPGB 2V2WB 4O4YL 3C6LC 3O9WD 3UC0H 4LF3A 4X80H 1YJDC 5HYEA 1YQ2A 1T1XA 4CMMA 4NM4L 1YEIL 3WE6B 2K7QA 1X5JA 1LO3L 1RPQA 2AEPL 4MGXA 3B5TA 2KPNA 4E9LA 5DJCB 2XTJD 4L4VB 1BFOA 2Z91B 1G9MC 1OT2A 4XNUH 5DR5H 4M9PA 3EOAB 5DLML 4U1SA 5F7DB 1QTYT 2LV4A 3DVNA 1ONQB 3IRZA 5CP7B 5I74B 2AAVA 5C0ND 4X0KB 5C08B 1TCRB 3FB5B 3QDJE 3WLBA 4JG0H 1FC2D 4HD9A 4JFYB 1CYGA 4K3JL 4WO4D 3SHSA 2XYCA 1X3DA 4HJJH 3QXDA 1U8PA 3QXAB 2QQLL 4N1CA 5ADOL 1FFPB 4CADA 2AQ3A 4S1SL 2Q20A 1R24A 3LQZA 2V2XA 1DBMH 4JFDA 1AO7D 4Z7NE 2HFGH 1V7NL 1JNNH 3MV8D 3QCUL 4HV8A 1JRHH 4Q7DA 5EU7C 5BRZB 3GBNH 3ARVA 3RBGA 4UINL 5KSUA 4R0LC 1J8HA 2VLRB 4ELMB 3DX8A 3KJ4B 1KIQB 1F5WA 2X7LA 2OJEB 4M6NH 2EH7L 2ICWI 4ZYKA 2D0GA 2E8YA 2I5YL 3LQAC 4B50A 1KT2A 5B39A 2O61A 3PV6A 1FZKB 4IJ3B 1FYTA 5FYLH 2ICES 4F7TB 1Q38A 5KZCD 2YXMA 3ARBD 4DK3A 3JTSA 4S0SD 2NY4B 3V6ZA 2BNUB 4KJQD 2FATL 4LEOB 5EU6E 4BH7B 2ADJB 3UTZA 1JYWA 3W5MA 3AU1B 3DO3A 3DURA 3WFDL 4LNVA 5C0AB 1G7LB 2UZYB 5D7KD 1OP3H 1QFWM 4O02L 2X89D 4R3SA 3BGAA 1T03L 1WTLA 4GBXD 4M6OH 1CXIA 3DI3B 3OHXB 1HE7A 2VIRA 3K8MA 4WUUB 3AY4C 3D2UA 5E56A 4JRXA 1OD9A 4UBDC 3ARGB 3MYJB 3BGMB 5DMKA 3OGCB 5E1HB 3NPZB 5DURB 3QIUC 1AXSB 5D70H 5F9JB 4I18C 2DYPD 3PUCA 2H9GB 3LKNB 4K7FA 4XTRC 2Z92B 2EDYA 4RWHA 4Y1AE 5GZNC 2OR9L 4XRCA 2IF7A 5T1LD 3SKJL 1YYML 3R06A 4OZGB 4PD4J 3F8UB 4KQ4L 4Y4FD 4U1LB 3RWGB 4QHNB 4GKZA 5TGBA 3QUML 1A6AA 3OZ9L 3SDDC 3HB3D 2AV1B 5GHWL 3G5ZA 3G6AA 3FMGL 2X4TA 4LU5H 3RWEB 1V05A 1IE5A 4JR9L 5JHLL 2JIXB 4LVNC 3MO1B 4NGHH 5D7SL 2WM0A 5ICYA 2QQNL 4O2EA 1FGNL 2R2EA 2UZIL 4KXZI 4HEPG 2V2TA 4ONGL 3QT2A 4K7PY 1JGDB 1MCHA 2Z8VC 4PTTB 1T5WB 3LDBB 4IIQC 4OF8A 4J3SA 2CSPA 3GMLB 3ZT7A 3QDGA 4TQEL 2IALB 1I85C 2VLKA 3FT2B 3KS0J 4XB8A 3ILPB 4HF5L 4WVRA 2FHFA 2VWEE 1UCBH 1LEKA 3QCVH 4TULL 1KXVC 3IU4H 1BPVA 3JV4A 1I3RA 3LD8B 5TPWL 5IJVA 1MCBA 4P9HC 1X5FA 3AUVA 1CGVA 1EERB 5T1DL 3LZFL 1LVEA 5C0CA 3QEUA 4U1IB 4KZDH 3L6FB 4FNLH 5DRXA 4L3EB 3PWNB 3DUSA 5DTFB 5BRZE 1F90L 3SE4A 1KEMH 4QRRB 2NY3C 4PGJA 1U8OA 1HKFA 4IM8A 5I8EB 1BFVL 2VLRE 4A6YA 3TNNB 4OZIB 5GQBA 4YGVB 3OAUH 3GGWA 4MNQB 2DLFL 4MD0B 1OAYH 3U2SA 1OARL 2QHRL 4LPWA 3ROLB 4OZIF 4M9OA 1NJ9A 1G9NC 4OKVB 1EO5A 4OF3A 3NFSL 2KUTA 4ODTL 4NT6B 3WKMH 1W72L 1JPFB 3L5XL 5GS3A 3KHOA 4LVHB 1SVZA 4MD4A 5ALBL 1S7WA 2GITB 1GGUA 4D0CA 4P3WA 3BEWA 1NMCC 5L8KB 3JV6B 1T7ZA 3HG1B 1EXUA 3BIAX 1CFQA 3B9KC 1U8IA 4W6WB 1RUQH 1TJGL 4YQXL 1AD0B 4RMRA 4AM0A 3DWTA 4QRQB 4CN4A 2QR0A 1FFOA 2BSRB 4XNXH 5D9SA 2W9EH 3FT3A 1H15A 2IADB 3WN5A 4WUKH 4OJFL 4Z7UF 3FQWA 3UBXA 1TQBB 2DMKA 4L3AA 5JUEL 1OTTD 4OGXL 4Y16C 3U36B 3QHFL 1UQSA 1MJ7H 1I8IB 4JY6B 5IV2B 4JFQB 3KNBB 4K7PL 4DZBA 4JQVA 4A6YH 5BMFH 3ZL4L 4DCQA 1OT1A 1VGEL 4JDTL 1ZXQA 2AXHA 4MLIA 2GI7A 3TN0B 5H2BB 2MCPH 1FHGA 5I0ZA 3LRSB 4AYFA 4HUXB 1ITCA 4QTIH 1QD0A 2UVEA 2M2DA 4HJGA 1PX3A 4TPRH 4RFOH 3WCYA 1HILB 4MDJA 4ZUUB 1E27B 3SGDI 5IT2L 4AIXA 3T3MF 5DMJB 2DTML 4KI5C 4G7YL 5A2KH 4DVRH 4MQSB 1K6QL 4NQCA 4NYLB 1FIEA 1HZHH 3QUXA 2F8VA 3MRRA 1CT8B 2JB5H 1I3GH 4V1DA 4GAJL 5B38G 3STLB 1AGEA 3MRMB 3DVGB 4OZFG 2F74A 1MWAB 3RI5F 4QRSB 5L9DH 1BJ1H 2HMIC 1DN0A 1FFNB 3MXVH 4C4KT 2APVA 1O0VA 4G9FA 4PJDA 1K8IA 5ALCH 4M1GL 4FQXC 2DQIL 4L8DA 1G6VK 5KTEH 3CMOH 4LKXA 3CVHB 1BLNB 4N8VG 1EUTA 5ISZB 4F2MA 1ITBB 4XMKL 2EYSA 3IDMA 3I02B 4HIHA 5I6XB 5IF0A 2OZ4L 1OPGH 4L4TB 3WHXA 4L3EE 5H94B 4XPFH 1QHPA 3IVKA 4QRRE 3KPMA 4P0DA 2IH1A 3X3GH 2R8SH 2VKXA 1NC4B 4RNRB 1MRCL 3MRCA 4XCEA 4LVOB 4XPBH 4EQ3A 1S7TB 1CGSH 4P5TD 5LAXA 4M48H 3QXUA 4QKXB 4LPCA 4OZIE 2P48B 2HWZH 3DTXB 3BSZL 1FNSH 4MNQE 1FV1A 1YEGH 4MQ7A 3VGHA 3QEGL 5IBTL 4Y5YA 5TE6H 1Y0LA 1FYTD 3NOIA 1NMBH 4UDTA 4NUGH 1RIVH 2MQCA 4OFDA 3WFEL 4G9DA 2BVQA 2R1XA 2Y07L 5GGSB 3MJ9A 1XGYH 3U0PA 5FB8A 2RBLA 3C6LD 3PWPD 5JHDD 3VFSB 4F58H 5CIPA 2FL5A 4QOKB 3WD5L 4C56A 3L7FB 4OFYD 3C09C 1VESA 3GHEH 1AHWC 3QRGH 1WBXB 3CC5A 1CFTB 5I19L 3IAGC 3ULVL 2LAGB 1A1MB 1MHHA 3QEQA 4I48B 1S9WA 4MD5A 1QKZL 4WNQB 5JOEA 4GQ9L 5I75B 4Z7UE 4KY1L 4PBVC 2V5YA 1VCAA 1PQZB 1MOEA 4MSWA 4OD2B 2QL1A 3QAZB 3KPRA 3C6SB 3OKYA 1IAIH 2R0WL 2A6IB 4LCUA 3IFOB 1GHFL 3RY6C 4UUJB 4LLUA 4YZFF 5JPMB 1NUFA 4N1EA 2EYTA 5TE7H 2F58H 2WINB 2Z35A 3T3ME 3O45B 5D96C 1HSBA 2BC4B 3HPLA 4Q9CA 3VH8A 1DCLA 2A73B 35C8L 1CXKA 4X98A 1UGNA 3MJ9H 4PJDF 1MCOH 2ARJQ 5DMYA 3EFFA 3RIFK 1AR1C 5CIPH 3WL9A 2N56A 3WUWA 3QG6B 4NJ9H 1MELA 4PJ9A 1K4DA 2DBLL 2D7MA 2CLZA 4NOBA 3SDXF 2ARWA 3QDGD 4OCSH 1YEHH 2E7MA 1E4WL 1FNHA 2ATPA 3SKUD 2VLKD 5SX5H 4OI9A 25C8H 2MPAL 4HEME 4L8SA 4PGZA 3OKEA 2X1QA 4MWFB 1EHLH 1GC1H 1AJ7H 4X6EB 5HTSA 4YUEH 3QISA 5BS0B 5HYSG 5JDSB 2VDLL 1OHQA 1TETL 2CKNA 1KENH 3REWB 2W0KA 1H5BB 4QXTB 5GGVY 1SJHA 4OFKA 2V9QA 3MNVA 2FJHA 1OD7A 1FP5A 2G5BA 3DECA 1P7HL 1C5DB 2C4FU 4L4TE 1E6OL 1JGUL 2B39A 3IJYB 1XGQB 4LSSL 3SE3A 3QIBB 4OD1H 4JFEA 2DLEA 2YR3A 4HXAH 5E08H 3QO0B 4S10A 3SY0A 3QI9A 4OZFB 1WIPA 4OM1L 1WITA 3Q5OA 1D5ZB 2NW3B 2QQQA 1GJIA 1VFOA 3VWJA 2CUHA 3P4NB 5FGRA 1UB6A 1K2DA 3CCHA 1NGZA 5HYIA 3W2DL 4XTRD 5CCKL 3MRNA 4N8VB 4Z78A 1R5WB 4G8GA 3NPSB 5GZND 2QSQA 4ZOEA 4PRPB 3DIFA 3MLUH 4ODSL 1G7HB 5F7YC 1CFSB 1QR4A 4WV1A 3V6FA 5C0IB 3SDDD 3AS2A 2XN9A 2HFEB 1AY1L 5CEXA 4K23L 5T33H 1C16A 4U05A 3PGCB 2EH8H 4GRLB 4LHUG 4PJAA 2VISB 1TENA 5F3HB 4BKLA 3MJ8A 3PWVB 1NCDH 5EZJB 5F97E 4WGVB 4LAQL 2B4CH 3FN0L 4ZD3H 2MWCA 2BY0A 2D7QA 1A4JB 4KU1A 3CVIH 3JZ7A 4DGIH 1CR9H 5FAAA 4YHML 2ADGA 4DKAA 5KN5B 3PQYA 1CDIA 3TT3L 3D5OF 4YZFE 3VFVB 3N85H 4LLDA 3ALWA 4XVJL 2V5TA 1BJ8A 4U1MB 3DJ9A 2X9WA 2UWEB 2VR9A 1ORQA 3L5IA 5HI3D 3QNYA 1U9KA 4XMLH 1Z6JT 5CMAB 3MLWH 2CMRL 3FB8B 1DBJH 3MUZ1 3R0NA 4EI5B 1ZHLB 1CXLA 3K4ZA 3MGAA 5JZ7D 3TWCL 3ZHDA 4OQTA 3RX8A 3VXRA 5GS1B 4MJID 2O5XL 2JJSA 4NQCD 1OP5K 5GGVL 4PRIE 4OV6F 2NY3D 5LBSH 2WUBH 3SDXE 3U79A 4NQDA 4M5ZH 3UC0L 4V1DD 1ERNA 5J4MA 1UWGH 1QLFA 4G8IB 3LKSB 1KCRH 2P24B 2R23B 1S9YA 5TDOA 1X5ZA 4I0CC 1F00I 3KGRA 4U0RB 2PTUA 2EDQA 3WSQL 2D7TH 1CZ8H 1HSAA 1TZHA 3ZT6A 4RIRA 1JPSL 5SWSB