1MFDL

The solution structure of a trisaccharide-antibody complex: comparison of nmr measurements with a crystal structure
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
QAVVTQESALTTSPGETVTLTCRSSTGTVTSGNHANWVQEKPDHLFTGLIGDTNNRAPGVPARFSGSLIGDKAALTITGAQPEDEAIYFCALWCNNHWIFGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLSRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG1-LAMBDA SE155-4 FAB (LIGHT CHAIN)
publication title Solution structure of a trisaccharide-antibody complex: comparison of NMR measurements with a crystal structure.
pubmed doi rcsb
source organism Mus musculus
total genus 52
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 1993-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfdL01
3W5MA 3MRPA 1AY1L 3K3QA 3OGOE 4RFOL 3S35X 3LKQA 3T08A 1V3JA 5D1ZC 5EO0B 5GRWA 2GK0A 1X5HA 3CPLB 4PJEF 1S5HB 3MGOA 2C4FT 2DKMA 1MRDL 4PIRF 5DUMH 4U1LB 3ARGC 5TF0A 4Q9QL 5KVGH 2G5BB 4NC2B 4P9ML 3MV01 2QQKL 3VW3L 4YDVB 5ELIA 3DVGB 4O9HH 5GRJL 3TT1H 3VFGH 4LRIA 2ORBH 2AJZA 4P2RD 3KLAA 2WINB 1I4FA 4XP5H 3VWKD 1FNSL 1NGQL 3ULVF 4G9DB 4GAFB 1TJIH 2BCKB 3LQZB 1UACH 1YN7B 4AQ1B 1TCRA 1E27A 2KUTA 2WSKA 4UIKL 1TNMA 3JZ7A 1IGFH 4JEGB 2C7UA 5C7XH 2B1AH 3N50A 1NANH 5EBLA 3D25A 2J6EL 3JWOL 3KAAA 1QVOB 3MV8E 5D96B 3GMLB 4R6UA 2GTZA 3RJDA 1EEZB 2V5TA 5E2UL 4YGVB 3UCRA 2NNAB 2MOVA 3OKKA 3CMOH 3FCTA 5C6TH 4CDGC 2BVYA 4K7FB 3HC3H 4NFCA 5C0BD 4L4TB 1GZPA 2ICWI 1IGTA 3F7YA 3HUJE 3O3BB 4WFHD 5CJOL 3V4UH 5D96C 1KLUB 1Q9KB 4XXDB 4PJFE 5AZEH 1I1AD 3N1FC 5KOVC 2IJ0C 1U92A 2B2XL 2XIDA 4WTZG 1A1OA 5SX5K 1RIVL 1XR8A 5T3ZD 5ISZA 3EO9H 3QIWD 5IEKB 1AP2B 4PJXF 5AAWA 2E6PA 2ZOLA 4PJEB 3C5ZB 4EXPX 4L8SB 1KOAA 2OMBA 4U1NA 4JFPB 4U3CA 1D6VH 1NAKH 2XFXA 4H20L 4ONFL 1P7HL 3DX9B 5J11B 2IG2H 4MZ3A 4Z7UA 4LSUH 2AGJL 4EDXA 1CG9B 3QJHB 3C5ZC 2W0FB 4L8SC 3ES6A 3HFMH 4NZJA 4UTBL 3WEXB 1QR1A 5HHME 3D3VD 1NGPH 5CSBA 4P2RE 5D2LF 3T09A 5ICYA 2V9TA 2FZ3B 4S1SH 2DTMH 5J11C 3UJIL 4Q0XH 2JKXA 3ULVC 5CGYD 3TBYA 2OCFD 3BP7B 5T5NG 1EMTH 5IHZB 3BO8A 1MCCA 4QRUA 1I8MB 3GJFK 4O5LH 3O6KL 1I7ZA 3SDDB 3HZYA 1ZHLA 1OTSC 5BW7A 1D6EB 3MMEB 3BUTA 3RY6C 4KKLC 1EJOL 3DV4A 4PV8A 3BKMH 2ITDB 3ZKQD 4NKOA 2ATPB 2H26A 3ARXA 3QH3A 5IHUH 3T3ME 5L6YH 4Y2DA 4TSCL 1SYSA 3SQBA 3SDDC 3BESR 4JFZL 4LASH 3EYQD 1SVZA 5C0BE 1IQWL 4DVBA 4E5XB 2F8OA 1CICB 3QNXB 4NHUA 4WFHE 5I73B 1NAMH 4LNRA 1C7SA 3D85D 3O8XA 4TTDC 2GTWA 4OZ4B 3RZCB 4PTUA 4Y7MA 5D70L 1F00I 1X7QA 2DLIA 1NCDH 4LOUC 3RWHA 4XPBL 2NCMA 2X70A 5DQ9A 3L3KA 4EOWH 4AL8L 5DEGA 5MHSD 3CUPB 5DO2D 1IKFH 1ORQA 4PR5A 1OPGH 5T3ZE 1MHEA 1JWUA 4TOYH 5I1KH 1K4CB 5BMFL 1CICC 2XN9A 5I73C 1KV3A 3NIFE 1B0GB 4KV5E 3RZCC 4D0BA 4AT6A 5HTSA 4ESKA 1GZQA 1CDHA 3R06A 1G6RA 1Q72L 4OF7A 1IL1B 1BD2B 1F11A 3SE4A 1W2KT 5IKCA 2XKUA 2JELL 3LRSA 2CDGB 4U6YB 5KG9B 2XA8L 3B9KD 4JB9L 1HWGB 3QUKA 4MD4B 4HHAB 5I8CB 3GHEL 1KXQE 1HEZA 4WCYH 3AM8C 4R4FH 3SE8L 5EZIH 5D5ME 1K5NA 1OM3L 3D3VE 4V1DA 3LS5L 1DL7L 1LQSR 2WUBH 4C54A 3QZWG 1EX0A 5FHBH 4EJ1C 2QHRH 1HSAB 4KMTL 1FYTB 1EEYA 5I8KL 5T33H 5E8PB 5FECB 1A0QL 5GGQH 1YYML 4Y8AA 3P2TA 4LHJB 1HQ4B 1RD6A 4WHDA 4GKZB 4NM4H 2EZ0C 3TH4T 4OBRA 1Q8MA 3NA9H 4ZSOE 3MLUL 3FMGH 5KVGL 5DA0B 3ZDXE 3AY4A 5F44A 2R23A 3UYOD 1WAAE 5J7CC 4QKXB 2ADJA 4H0IA 4I0PA 4N5ED 1A2YB 2XKNA 1HHJA 3BH8A 2YD5A 4PLKD 4HDIB 1G9NH 5FYJH 1IILE 1RJZB 5D7KD 4UTAH 3KYNB 3RWIA 1TJIL 4YFLI 3LY6A 1RIUH 3PL6A 2X89A 1IAOA 2BXZA 5FHAL 4UDTA 4ZTPH 1J1XL 3QFDB 3VFUB 2XXCB 4X83A 1CVSC 3OG6B 1NLBH 3MUY1 5MHSE 1EO8H 4YBHA 4JZJA 3O3DB 3OF6D 4HEME 3FO9B 5DJXB 3U36B 3DUSB 5FM5O 4HPYH 3E3QC 3IDGA 1JFQH 1NCCL 3T0VA 5I71B 2HFFA 2EEBA 3V6ZA 2GITB 2WV3A 3VRJA 1UG9A 4EQ2A 2M2DA 2VWEC 3DXAB 1QZ1A 4QHNA 3QUYD 3BZFA 1S9XA 3MRJA 3P9MA 1W0WA 5TGBB 2DWDA 2OZ4L 3HI5H 1DE4A 3M1BB 3BQUB 5I71C 3GSQA 2VDQH 3LSOA 3T4AB 5BS0D 1G0DA 5E2VH 3T0ED 3ILQD 2QBWA 4GW4B 1QBML 5HHVH 1RMFL 3BHBB 1J12A 3QIUB 3EO9L 3HNVH 4AMKH 2H32A 4XNZB 2F54A 3PGDB 2DQEH 2F8VA 3M07A 4G8GE 5GSRB 3QDMD 4G80B 4HH9A 5B3JF 4NGHL 3BQUC 1K6QH 1RURH 1QHOA 4ZOCA 4OLUL 1BJ1H 4HMEA 4YBQD 2H6PB 2OL3L 2IBZX 3FQTA 2EC9T 1GOFA 3QIUC 1AXTL 5B39A 2VDNH 1QQDA 2QJDA 5ESAB 1RUPL 5L2KB 1FDLL 4XNZC 1UA6L 5LWYH 3GRWA 1FL3B 1XF1A 1K3IA 3VGDA 1YEKH 5IMLB 2MKLC 2UV3A 4WVRA 3PHQB 2DQFB 5DJCB 3SDCD 5T5FH 3MREA 3SY0A 5D7KE 4KDTA 4KKAC 4K9EC 2FX9L 3GMPB 2BHYA 4Q0XL 4K3GA 3C60D 1RZ8B 1DANT 4JFQA 1EMTL 3ILPA 4ODSH 3UC0L 1P6FA 4WU5B 3ZL4H 2IMMA 1N0XH 2NYYC 5K9KB 1PZ5A 2OR8A 4IHOB 2W9LA 1W72A 1I8LA 1SYVA 5CJQL 3ZLQC 3G6JB 1JWSA 1EGJL 2FD6H 2YD2A 3PQYD 3H3PH 1VEMA 1A7NH 5ICZA 5GGSY 5DXWA 4OKVA 5IJVA 1MHCA 5IP4A 1P4IH 5HHQA 1VGEL 1FYHB 3ARED 1ZLVK 3HZMA 1N59A 5F1KC 4OZHF 3BYTA 3VXRD 1UM5H 1H8NA 3OWEA 5DRWB 2NQCA 4RIRA 4KKNA 1TZHB 1WCQA 1RJLB 3EJZC 5C07A 3EUUA 1VADB 4I13B 1F4YL 2VMFA 4WTWA 2JB5L 3VH8G 1RZFH 5BS0E 3H2WA 4EOWL 5CBEB 1AD9B 2D7OA 3T0EE 4DZBB 3MXVH 2CGRL 1OPGL 4OLWH 2BNUB 4W70A 5I1KL 4H25B 5DJ2B 2WLYA 1KNOB 3OXRB 1IGYA 1BGXH 4MB4A 1TETL 1PJ9A 2CRMA 2IQAA 1CLOL 1OAQH 3F58L 3GSUB 3QDME 1CU4L 4GBXD 1GC1H 2Q20A 3IYLW 2FBJL 3U7YL 1TZGL 3BE1L 1NC4B 2AKRB 2E8ZA 4Q9BA 1QSZA 1PLGL 4MXQC 5EIIB 3VRIB 4QXUH 3PV6A 4D0DA 3K1KC 1I1FB 1MWAB 3DIFA 3OTTA 4IRZH 4JKPL 4FZEL 1IBGH 3GSWA 5GS2D 3MJGX 4YZFE 1ZT4B 3OV6A 2WUBL 1C08B 2VE6B 2XZCL 5FHBL 3QFJB 7CGTA 5HPOA 3ARYA 2AEQL 4QNPE 5F8RC 2R0LH 1Z9LA 3ZZ1A 5C0EB 5GGQL 2HMID 4HAGA 3CDCA 4UUJA 1YECH 5EB9A 4OZHB 1IAIH 5T1KD 3I6GB 4CN6A 2ITCB 5FA4A 1WVZA 3GSOA 3IDNA 4NM4L 1EZVY 2L4OA 3KR3H 2HVKB 3PQYE 5FB8A 1B4JH 3NA9L 1T3FA 1F3JB 4KTDH 1NFDB 2JE8A 2Q86A 1HCFX 1YEJH 1UKSA 3VXRE 4QRRB 2YOCA 5EU6E 1NMCB 4MDIB 5JMRA 1QEWB 5EBWB 5EOTB 4NQXA 5GGVL 1HHIB 3WS6A 3K7UA 1LNUA 1OAZH 2VLKB 3L9RB 4HKZB 1S9YB 1EO8L 3VFPA 2X4PB 4IMLB 3NCYP 3BWAA 1NMCC 3QZWB 2P5WD 4XCCH 4OZGB 1JGDB 4HPYL 4OGXL 3W39B 2B4CH 2MQ3A 1FZKA 1VFUA 1EUUA 4IRJA 1ZGLB 1AGFA 2ATKB 5J12B 3SKJH 5C8JB 1I8KB 6FABH 5DFWH 4ZNEA 1U3HB 1ZEAL 1RZKH 2YEZB 5CWSB 5C0CA 5LVEA 5DS8B 2P8MA 5F21B 2XRAH 1YPZB 4LPCA 1IKNA 4Z77A 2HKHL 1F6LL 1NEZG 2QSTA 1GGCL 3ULUH 4JFYB 1PZUB 4MA7L 5E2VL 4RGNB 4MJ4A 3OB8A 5J12C 4XP1H 4OZIB 2DL2A 3HNVL 4F8QA 2AI0H 4NKDA 3GUTB 2ADIA 3LKNB 3RNKA 4AMKL 1XAUA 1U3HC 3SCMA 3WNPA 3QEHB 3MQIA 3MRIB 2FBOJ 5F9OL 5HGHB 5ETUA 2VZ1A 3TO4A 5E5MB 2IAMA 4RGNC 3MLTB 2FLRT 2XQBL 1VFBA 4Y1AB 4NFDA 3VFOB 1V7NH 3GI8L 4IIQB 4KJPD 1U95A 4TVPD 5HYSG 4CVUA 3OJVC 5LWYL 1EO5A 3PF2A 4C4KT 1WFOA 1YEKL 2A73A 4JO1L 1G7MB 3OKEA 1OP5K 1G7HA 4X9FA 5T5FL 4E9LA 3U6RA 4K94C 2G75B 1QO3B 1HYRC 2FX8H 2ZUTA 4NIKB 4XVJL 1G6VK 1QD0A 3BJLA 4IIQC 4AM0B 2DYPD 2NR6C 1LE9B 3F12B 4ODSL 4RNRA 1KIPB 5IQ7H 5C6WH 3ZL4L 3KJ6H 1CLZH 4OJFL 3L5WB 1CN4A 3TNNA 2O61B 1VERA 5HXMA 1AKJA 3P11H 2P5WE 3T1FB 1DQJA 3LDBB 4JFFB 3CXDL 2DD8H 4K7PH 2VDRL 5INDB 1P4IL 2QHLA 1X5YA 3QA3A 1ZS8A 4EI6B 5FUZH 2FEDC 3C87A 2IADB 1U2HA 4ODHL 1FCGA 3JV6B 4HEPG 4DUVA 3WE6A 3LDBC 4BZYA 2R56H 1U93B 2LFGA 5KS9A 5HYJB 5JQ6H 1WIPA 4Z7WB 1IGCL 1ZA6A 3MXVL 3Q3GA 5C0RH 2DMCA 2DQGH 4OLWL 4PJGE 5FKAA 3SEPA 3NVQA 3D1MC 4OZFA 1QFWI 4LKCB 1CE6B 3RUGA 2BHUA 4PJHA 1CIUA 5EU4B 4R9HA 5DC0A 4JPIB 4QGTA 4KQ3H 4X9GA 1OSZA 5DGQA 5TE4L 5HD8D 4MA8H 5T1MB 2PTTB 4LCYA 4M1CD 2WWKO 3JWOC 5CMAB 4WHTA 1AGBA 1GSMA 2BNQB 3H9SE 4PP2A 2PTVA 4TVPE 3WN5A 4KQ4H 4QXUL 4YHZL 2Z4QA 3QDGE 1CF8H 1ZGLM 3QG6A 1LP9E 3MYJA 1HE7A 4OLVL 1T7VA 1G7JA 3MJ8B 4ZQKB 5DMIL 4ODTH 1BBDL 1IT9H 1J8HB 4NO0A 4LVNB 2OMNA 5I8EA 5C92A 2R0LL 4HKBA 4KMLB 4HZLB 4BH8B 5CILH 3VH8B 5E6IA 2R1YB 1XIWB 5F7DA 1AGDB 4NQDB 1IAIL 3CGTA 3EBAA 4OM1H 1UB5B 2ARWA 3ARWA 1MIMH 5C0DB 2X4SB 2ZZUT 3LHPL 4R2GD 5FYLL 1OOAA 1OB1A 4LVNC 1L9MA 1G6RH 4RAVB 4Q2ZA 1KYOK 5HYQA 4AIXA 1UWGL 3X14A 3QJFB 3P77B 1XIWC 3G5XA 4KK8C 1IGJB 4ZS7H 1FRGH 3G5ZA 3AXLB 2VZUA 2RB8A 1YMME 4ZFFB 5LGKA 5E8EA 3PNWA 4O58H 4KMQA 2YN5A 3WFHB 4Y5XA 4MXWH 3KXFB 1QP1A 3ARDD 1LEIB 3CZFB 2CRYA 2DKSA 4IJ3B 4GW1B 5TQ0L 3W0WB 5IBLD 2VDOH 4OUUB 3Q5TA 4U1JA 1U91B 3MGTA 5GJTL 4MCZB 3RVTD 1JF1B 1TITA 3FQUB 2IALA 1TQCB 2F58H 4XNXL 5HPMA 1Q9OA 1RZIB 4K71B 5BV7H 3GMMA 4LF3A 4IJ3C 5EU5A 1OWRM 3KPRD 1MIEL 5HGBA 4G9FB 2R8SL 2ICEB 4RMVA 2XRAL 2AERT 3DHJA 4LGSB 1VCAA 1OTUD 3T8XA 5KS9F 3O2DL 4FQXB 1TQCC 4PRID 4HMCA 1WF5A 4OCYL 4K71C 2ICWA 4QEGA 2WQ8A 2X42A 1MNUL 5EORH 3JTSB 4GMSH 4NM8L 1K4DB 2NX5A 3MBEA 4FFWC 3RUGF 3A6BL 3L1OH 2Z93B 4HK3J 4JVPA 4P3DB 1NSNL 3C9NA 4FQXC 2HRLA 5H94A 2NXZB 1DBML 1OAUL 4GAJL 3LN9A 4WWKB 5CP7A 5E00B 1V7NL 4PJ7B 2HJLA 3HLAA 3SKOB 3S37X 1WWWX 1PKOA 2GUOA 2E7MA 4UMGA 1A6TA 1RUAL 3EFDH 1A7QH 4HFWB 1WZKA 2YPLA 4L9DA 2B8OT 4KJYB 3VXSD 2C4FU 2BVEA 1KT2A 2NXZC 5D2NE 4DCQA 4OI8A 2FX8L 3P9LB 4WWKC 4JKKA 1OARH 4G6FD 4L29B 1NEZB 1T20B 1U8JB 2AJXH 4LPYA 5I16A 3KJ6L 4QYOB 4CJ0A 5IFJB 3FRUB 4PBWD 4UIMB 1R24B 2Q6WA 2B0SL 5C08A 3WFDL 2VXSH 3P11L 2PYFA 2PXYA 2WP3O 2D9QB 3FOLB 5FUCC 5KSBA 3HZVB 3S36H 4RZCA 4TPRH 1V7MH 2DD8L 4K7PL 5B22A 1AH1A 1JK8A 4HS3A 1KLGA 1I3UA 4OCNC 4P2YA 3B5GA 4HIEA 3KYAA 4DGVL 4IEFB 3PXJA 4G6MH 3AB0B 4ODXB 2DIAA 4E0RB 5FA3A 1C16B 1WBZA 3KPRE 3MRDB 4P5TA 1FFPA 1NL0H 3FT4A 3GRWH 4GQ9H 4R96A 5BXFA 2R56L 5C9JB 5HYSB 3EOAA 3BW9B 5EN2B 3QPQD 4NN5B 4H88H 3UO1H 2IMNA 2DM2A 2H2SD 3GSNA 2DQGL 4PRIE 3AB0C 3DYMA 3T0BA 1N6QL 2VXTH 3RDTA 1WICA 1ZVHA 1ZHKB 1WWBX 3EO1A 4UV7H 5D1ZD 5K59F 1W72H 4DVRH 3KPPB 4NN5C 1GHFL 3VFWB 3VFRB 4Z7VB 3ZT7A 4CJ1A 3D87B 2YZ1A 3ARGD 3GJEB 4W6YB 1QNZH 4AH2A 5IJKA 2RFXA 4JQXA 1K8DA 4QRTB 1JPFB 1CF8L 3OKDA 1JP5A 2DLFH 2K9UA 4H0HB 2O5XL 1OHQA 4B7IA 4E41A 3BFOA 4GRLB 2YBRA 1UYWH 3QSKB 4ODTL 2EDJA 2EYRB 1IT9L 4ZMAT 1KB9K 4NNXA 1PYWB 3LRHA 3AAZA 3AS3A 4A6YL 2X4UA 4LNVA 4XP6H 3NCCB 4MMZC 3L95A 1KPUA 5DD5H 2OL3B 3DO7A 1H3PL 4GRLC 3HRZA 3RL2B 5HGAB 5C0IB 5DMJB 2A6KA 3KPMA 4AG4L 5BQ7A 1FNLA 1UZ6F 2R0ZH 1IEHA 3L3DA 4PG9B 4PLOB 2NW2B 2HYMA 2AK4E 2Y1VA 5J4MA 2HH0L 1XCQB 1XGUA 1P84J 1PKQB 2PYEA 4KZEH 5CHNB 1FRGL 2AV7B 4POUB 1NCBH 5FGSA 1HDMA 4OLXH 2NTFA 3O45B 1A1MB 3L7FA 3MOAL 4PRHA 1E4XH 1E4WH 1U8IA 2GQHA 5JDSA 4LHUA 3T0AA 1MJUH 4MXWL 4CGTA 5JXEA 4L4TD 3NCJH 4CNIB 3S35H 3N06B 5EC1B 5EZJB 2ZUUA 5IF0A 1VPOH 5MEQA 4GSDH 3HS0A 5KSBF 1MAML 2W59A 3QXWA 4O51A 1UWXK 5CEYA 2EEAA 1OVZA 4ODVH 4OI9A 1OGAA 1S8DA 5FYKU 1IFHL 2H8PA 3QIBB 2PTUA 4MSWA 4ISVB 3LZFH 1XF3A 3C5ZD 3QHTC 3HZKB 3QDJA 1UZ8A 1I3VA 4R90H 4RFEA 1S7RB 3R8QA 1KTDA 2VDML 3ET9F 2VERN 4KRNA 1LWRA 2MNUA 4M7ZB 1I1YA 3ULVD 3RWFA 3DBXB 3QIBC 4FXGA 1GJIA 2FGZA 1CIDA 2C3WA 2OSLB 5EOCJ 2IH3A 3BT2H 3LKPB 4XMLL 3RRQA 3L1OL 1ZKAA 5JIHA 5SWQB 5F7NC 1OTSD 5IMKB 1NGWB 1ETZA 3CVIH 4KKLD 1SJHB 4Z5RA 3PWVB 1MLCA 4ACPA 2OTUA 1KCUH 2HWZH 4JM2B 32C2B 1I9JL 4M7ZC 3FT2A 2GSIA 3ZE2F 1XFPA 5KN5B 3SDDD 5TQ2H 2AS5M 1A7QL 1BREA 4YDLB 2I9LA 3WIIL 4MNQA 4TTDD 2UUDH 2Q8BH 2HAZA 3ARTA 1JGUL 4JM2C 4LOUD 1XMWA 4AEIH 2B1HL 1MHHB 3MC0A 2CUIA 5FKPB 2AXFA 5C0AB 2C1PA 3Q6FB 5C0FA 3EO0B 4P2OA 1MCRA 1T66C 2LU3A 3B9DA 4L4TE 4YDLC 1ROWA 1CICD 1PSKH 5I74B 3RZCD 4TPRL 5DVLA 1A6WH 3NCBB 4NO2A 5CIPA 2J8UB 1V7ML 1CDIA 1UCBH 4ODBD 2FECL 1XGQB 2FATL 1BFOA 3TH2T 3VWJB 2R1WB 4G6ML 3CSPA 5ENWB 4TNWF 4PJEE 4GQ9L 4J4PC 5I74C 1NGXB 4Q97A 3IFLL 1NDMB 1SMOA 3M17A 3VXTA 4NT6A 1BD2D 4M1DH 4AY0A 5E08L 1DN2A 3K74B 4H88L 1N7ML 3UO1L 3VWJC 3OKNA 2X1XR 3FFCB 4PJ5B 4OTXH 1D5ZA 1G9NC 4G7VL 3ULVE 5DSCA 2C3VB 5EO1A 3SQOH 4TRPL 2CK2A 2GJZB 5F9JA 1QBLL 4ORGB 3TPUB 1PY9A 1FG2B 5IG7B 5J6HB 1UB6B 4X8XA 3VXNA 3TPKA 1JNLL 2W07A 2ED9A 4NQVA 3ABZA 2EZ0D 3G6DL 3SKMB 1FYTD 1JHTA 2HRPL 3NTCL 3V4PH 3IF1B 5BO1L 2GJ6B 4N9OB 1Z2KA 3VGHA 4CVXB 2EC9U 1MCFA 1VACB 2HN7A 3KPQA 1FFQA 4XMPH 4D8PA 5EUOA 4WU7A 3Q2CA 4U1IB 5EWIL 2ENSA 4OQ1A 1HCVA 3T2PA 4QHLA 1CTNA 4CRPA 3LQAL 4M61A 4XP6L 1U41A 4OZFH 5B3NA 2DJUA 4J3TA 3BUYA 1HZHH 2P45B 4H26B 1QFHA 4UU9B 5E8OA 3PWJB 1EBAA 5IW1A 5DQJB 3JSSA 3HC0B 5DDHA 5I0DA 1PEWA 5I1AA 2ARJQ 1ACYH 3AMKA 4YR6B 1MCOH 2YUWA 3DX6B 1NEUA 4M4PA 2DDQH 4BUHA 1EJ6A 3HR6A 1BD2E 4XPAH 3FO2A 4CW1A 3DXAD 1MFEL 2M1KA 1UXWB 3CFDA 3ARFB 5KJRH 3PWPA 3BP5B 2QKIA 1LVEA 3PDDA 1A21A 3ARRA 4WIQA 4H1LA 2IGFL 3BQUD 5JOFA 4WJ5B 5IV2B 2ID5A 2G2RB 3KPLA 1JPTH 3RWGB 4M9OA 2Z31A 2V2XA 1EAJA 5HVFB 2NY1B 3QIUD 1IM3A 3ARFC 1MF2L 5F8QC 1FYTE 1I7RA 1M1SA 1EXUB 4Z0BL 1KJMB 1F13A 4F8TA 5I1JL 4JHWL 5CEXB 2OLDA 1AO7A 4MX7A 3ZE1F 5HHOB 4LIQL 5F70A 4J1UA 3S96B 4R90L 3CK0L 4IS6A 4AEFA 3AU1B 2XY2A 4FQ1H 4KKAD 4P4RB 2NY1C 5HY9A 4HULB 1JNNH 2ESVA 1FH5H 3VI4F 1U8HB 5L2KD 4HJGB 2EDFA 2P5EA 3BEWA 3U48A 2FJGA 1CFTA 4UT6L 2NYYD 3I9GL 1BVKA 1ES0A 4AQOA 8CGTA 4RMTA 2X6MA 1LK3H 3TA3A 4J6RH 4Z78A 2HWZL 5GGRA 1CGVA 4NC1C 2BSTA 3VXPB 5BOZG 2R69L 3I50L 2OBGA 3MACL 3QO0A 2VWEE 1WTGT 4ETQA 5JW4N 4KY1L 2X4NB 1NMAH 3EJZD 3IFOA 4HLZG 2JCCB 1KEGL 5ACMA 3HHRB 2JB6A 3LS4H 1LO3H 5GS1A 3DXAE 3I02A 5H8DA 4JFDA 2Q7YA 5HGDA 3U4BH 4PJ9B 5I76B 1F3RB 1A6WL 1UM6H 4Y5YA 1Q94A 3LKOA 2MFNA 1UCBL 5IB5A 3MRQB 4ZPTA 1Q9WB 3LAFA 3QCUL 4F7MA 3T4YB 2R0KL 4N68A 1EDQA 3UPCA 4MXQD 4PJ9C 4TVSa 3VXQB 4UDUA 5KTEL 3ZDYF 3QB7C 3NPSB 3DX8B 3NFPB 3VFTA 3H9ZA 1NC4D 1D9KB 4GXVL 3FB6A 4OTXL 4DJMA 3B6SA 3MOBH 1KIRA 3BSZL 2GEEA 4ZS6C 1TMCB 1X4YA 5L2KE 2WNGA 1DQTA 1YA5A 3PP4L 1PW3A 2BMKB 3KHQA 4X6CA 3QUML 3OAYH 2AP2A 4JM4H 3NPSC 3NZ8B 3BH9B 1D9KC 3UAJC 3QFJD 2MKWA 4QTHB 5AYQA 5FO8B 5DJYA 4LDOB 2I9TA 4L3EA 2Y06H 4U0RB 1NPUA 2I26N 2AJZB 2ZUSA 4WDIB 3HB3C 3MLRH 3QULA 3RA7H 1T7WA 2I5YH 3G6JE 4HSQA 4ZYKA 1E27B 4ZO7A 5EPMB 4XMPL 5IMOA 1WJ3A 5HDBE 1K9TA 5J0BA 4U0RC 1RUQL 1Y18A 3DGCR 3KWWA 2VN4A 4XNMB 3D25B 3ZHDA 5KVMC 2FEEI 3GSNH 3ULUC 2Y6SC 3OB0K 4NQCA 3DHMA 3MLSL 1B0RA 2Y5TB 4S2SA 2MJWA 2GTZB 2V7HA 1TFHA 3WHXA 3MRLA 4R4BB 1HNGA 4P57A 4XPHH 5AWNL 2VLJB 3FCTB 4HX1A 2VQUA 2X44D 2VLKD 4QRSA 5B3JE 4EXKA 3DYOA 3RHWF 5GRXG 2XA3A 1JV5A 5FV2A 5JXAH 1U8MA 1H15B 3O3EB 1RUKL 4WWID 4QRQA 2X05A 5KSAA 2C5DC 1J7VR 3QHZL 1UKTA 4L8DA 2EDHA 1XR8B 2CSPA 3WKMH 1X6LA 5ISZB 4NBYB 3BDBA 2DWEA 4D9LH 3VFNB 1RZJL 1U3HD 4RCAA 4ZG1A 5IFAH 3TZVB 3G6AA 3VXMB 4LSQL 1DQMH 4NWUH 4S1DC 4HWUA 3SBWC 2XACC 4F7CB 1IAIM 4RGND 1P1ZA 2NW3A 2W0LA 4OLYL 1ZGLP 4Z7UB 2WLZA 2MWCA 3QFJE 2QL1A 1U8NB 4KI5C 3TZVC 3GHBH 4HF5H 2HT3C 2FB4H 3MLPA 5L88H 5D72H 1KG0B 4CKVX 2D0HA 1YEEL 1JGLH 4OZHE 4FQ1L 2BOCB 5K9QI 3KPOA 4ODWB 1DLHA 1R3IH 4G3YH 1JNNL 1FH5L 2XPGA 2NR6D 3BO8B 4N1EA 4EN3B 1I9EA 4MNHB 1QYGL 4F9LC 3T0XA 1KSRA 1K2DB 5I1CH 2IBGA 3DSFL 4PV8B 4P2QB 1CFQB 3LVEA 4HIXL 2G9HB 2N7BA 5IM7A 5DR5H 5A40E 4KH2A 4K3JH 3UTSB 3H7LA 5TFSH 4UZGA 2H26B 4EN3C 5MEOB 4N9GB 1HNFA 2R1XB 4FXLA 4XBGA 1SYSB 2VLKE 2X4TA 4EUPA 2FIKA 4HUXA 4DVBB 2FEDD 1QFUH 3GB7A 1AQKH 4JQVC 4X5LA 5EZOH 3IDMA 4PTUB 4OZGE 3JBG7 4NRYB 4JFFD 1ZLUK 3RWHB 3QQ3B 4LLUB 2V5YA 1CGYA 2BP3A 3IJSB 2YRZA 4A6YB 2EDNA 1JZ8A 3B9EA 1JWUB 1KJ2A 2FR4B 3X13B 1JI1A 1UWEH 3B2UD 2W60A 2J4WL 4NZTH 1IGMH 1KJ3H 1DEEB 4AT6B 3QISA 5JPMB 1YPZE 1FJ1A 5HYJD 3I3BA 4YO0A 2FJHB 3RKPA 5IKCB 3VE0A 1P7QA 1RHHB 4RGNE 1S7SA 4OFIA 4J3XA 4OZIE 4Y19A 4M5YL 1HEZB 4MCYA 3CVHL 4Y4KB 2CUMA 5DJ0B 4ORZC 1ZMYA 4LCUB 4DWHA 4L4VA 3W11C 5BZDA 3GNMH 3GIVA 4C4KO 5JHDA 2BNQD 3MOBL 4M7LH 4Y4KC 2DJ4A 3ISWA 4BFIA 3I75A 1CT8B 3GBLA 4UB0L 4OFKA 1A9BA 4HC1L 1R3JB 4DGYH 2QTEA 3GEWB 1UVQA 4JM4L 4MQTB 4MJ5A 1CYGA 4OD2A 1ZOXA 4QF1B 1YJDL 3D0LA 2CKBL 4C83B 1J8HD 1GGIH 5CIPH 5EZLA 4ODUB 3GSVA 3UYPA 3V5DA 2R23B 1MCNA 3V8OA 3OKLB 5IK3A 2XKNB 5LBSL 1HHJB 3QBTB 5FO9A 5C0JA 1HHKB 4LPTA 4HG4K 3BPCA 1XIWD 5HHXL 2AXJA 4KK8D 4NQDD 2EH8L 4MD5A 4QXGH 4KRLB 4R8WH 4QXTB 3KYMB 4D94A 4GRWH 4UDTB 3HI1B 2CLRA 5HHPA 2DI9A 3UJTH 2EE9A 2ADGA 3L3GB 1S7TA 1JNHA 4JG0L 4TQEH 3EJJX 4C57C 1ZANL 1KCSH 4JZJB 3OAUL 2X10A 4XC1H 3TO2B 1OAXH 1JPSL 2X1OA 4WEUD 1L9NA 4GW5A 4K3EH 3DV6B 2VAAA 1Q0YH 1KN4H 1XGPA 4XPHL 4XNUH 2IF7A 5E2WL 3MR9B 4FQLL 5HYJE 1SEQH 3DUHA 4Z7WE 1EHLH 1EVTC 1XR9A 5CGTA 3KXFD 3WLWC 3ZE0F 5L8JB 3OAZK 3NCEB 3BZFB 4JZJC 2LVEA 3HNTL 1FLTX 4HW6A 1T1ZB 3P9MB 4GRMA 4U6XB 1W0WB 2D9CA 5JXAL 4P48A 3W0WD 1DE4B 1IC5H 1BQSA 3JUZA 3L3OA 3FONB 1M05A 4CDHA 4XVSH 3TBSB 4P5KB 5E1AA 1C5CH 2UVFA 3WKML 3S8WA 1LEKB 1A7PH 3IJHA 4D9LL 4RISH 3R0MA 4G9FD 5IVXB 4LLYA 4Y0GA 1T89C 2BNQE 5GGSA 4L3CA 4IOFC 4X5XA 1MCQA 4NWUL 4FNLH 1KTRL 3DX7A 2VZ3A 4FQXD 3MRHA 1RZ7H 3GGWA 3TN0B 2DQCH 1RVFL 2JJWA 1FZOA 1U3JA 5TPWL 1J8HE 3BGFB 4I5BA 3MV8A 5M95B 4X8JA 2YK1H 4HF5L 4IBLT 1U0QA 3O9WA 4PBVC 2QADB 1JGVH 4NWTH 1MCPH 4DN4H 2H2PC 1C1EL 5FYKH 5EO9B 2YD1A 3NIDE 4OZFG 4X7SL 2NXZD 4WNQA 3TN0C 4M5ZL 5F93C 4WWKD 1IM9A 1JGEA 4I2XB 5I1LA 2H9GA 3VJ6B 3BGFC 3DURA 3HUJA 4X80H 5K9OA 1VKXA 3BPNB 2DQHL 2MCPH 3UTTB 3N0PB 4PJFA 1YMHA 2QADC 1KN2L 5DK0B 5TE6L 4M62L 3OPZH 2LE9A 3MFGB 3DRTA 5C70A 5ICZB 3TNMA 5IOPA 1BFVH 4H1LH 4XHJD 1F6FB 1MHCB 3WUZA 5HHQB 3VD4A 3ARBA 3BPNC 4KUZH 1DDHB 3L3IA 2FNBA 5H37H 3KXFE 1QFUL 3RU8H 3PWNB 1MY5A 2O5YL 3TLRA 5A43C 2OTWA 3RPIB 3AS1A 2HFEA 4HGWA 3HR5B 4LSRH 5J9PA 1CFVL 1AI1H 4LLVA 3QAZB 5JPNA 4UQ3B 2BC4A 1DVFB 2KPNA 2Z92A 5IEHA 4U6HA 1IGYB 2UZXB 4P2RA 1IGML 2IQAB 5F3BB 1YUHA 3NMEA 1S7VA 5DJAA 4I18A 4OF0A 3R1GH 3W5NA 1IEBA 1A22B 2YKLH 4UOJA 3QAZC 2Z0BA 4HQQL 1DUZA 1QFPA 3IFNH 3LQAC 1DVFC 1WT5A 4TSBH 2E8YA 3P4OB 2WK2A 3WUWA 1IGIL 3FB7B 1M4KA 3T65A 5CINH 4GG8A 2R2BB 5ID1A 2EYSB 3JV4A 3WD5L 1XGRA 2K7QA 3MNZB 1IQDB 3D39B 3GSWB 4YAQB 1BM3H 1PQZB 3OMZA 3O3AA 5D7JA 2DQJH 4PGBB 5DYOA 3MLWH 4FQIH 4JFOA 3MPCA 5TF1L 5E8NB 5IBUG 4DOHB 5HVWA 4LCIH 5C0BA 4PJ7E 3PGFH 1DLFH 4M7LL 2PO6B 4Q6IA 1N26A 4R26L 4BSWA 3PWLB 2AAVA 3REVB 5E2TH 4UUJB 4NPYB 1I1AA 4L1DA 4DGYL 4BQ9A 2R0WL 3E6HA 2I24N 4GRLD 4QHUB 1U2CA 4LPUA 1Y6NR 3QXUA 3OZ9H 1RJCA 3QQ9C 2R2EB 3O2VL 1T3FB 4PV9B 3LN4B 4O2CA 4C56D 2PO6C 1DJSA 4ZUWA 4HS6A 1A5FH 1CXKA 1P4BH 1WTLA 3RI5K 1ZTXH 4WHYG 4KPHH 3TJEL 1S9WA 3VGAB 3JWDH 3RZWA 1KPRB 2DQTH 1WK0A 3KDMA 2NY2B 1A14H 1MFDL 3HUJF 4YIQA 2Z91B 4TQEL 3VFPB 5F1IB 4PJFF 1G7IA 5D5MA 4K3EL 1G7QB 4ZNCD 4N0CC 3D3VA 2FGWL 1EFXB 1KN4L 3VGAC 1G0XA 4X9BA 4QY8A 4PUBH 1DEDA 2AJVH 2IANB 1SEQL 3CFJA 1AGFB 2FHCA 1FFOB 2BSRA 4N0UB 4HJJL 5MEPA 1CGSH 3WCYA 4URTB 4KJQD 4YFEA 4WI6A 1RIHL 1QFWH 2P8MB 3MRKB 1IC5L 4L9LA 1G9ML 4XVSL 2J8OA 4ZSOA 1YC8A 4OD3L 3INUL 1JE6A 1WAAA 3VG0H 5F89B 5CSZA 5I1IL 2ADIB 3RNKB 3RIAF 4Z7VE 5I66A 3WJJC 4ONGH 3SCMB 3SKUD 4LHQB 3S5LB 3GJFB 1IKNC 4J23A 2CQVA 3D85A 1PX4A 3TWCH 3TF7C 1YNTB 3QT2A 1JYXA 4HUVA 1ZVSB 1RZ7L 1J1OL 5BOPA 4U2ZA 2WBKA 1NJ9B 2Y4SA 3U9PL 3H9HB 3SCMC 1NMBL 5BVJA 4C56E 25C8H 2YK1L 2V2TA 2OJEB 2FX7L 1WC7A 5H35A 3QUZB 1JGVL 1PG7L 5FYKL 4XI5C 1PFCA 3OR6B 2VDKH 4LKXB 5DHYA 1UM4H 5DQDH 1BZ9A 4JM2D 3T3MF 3E1F1 1MUJA 1VGKB 3L3HB 3B9KA 4X80L 4RNRB 1PVHA 4HWBA 1YDPA 2COQA 3SPVB 3O0RH 3QUZC 2WAHA 4KAQL 1T66D 5K9JL 1SM3H 3QUMB 3LKRA 4PREA 1PKQE 1JYWA 1MREL 3U2SA 4DKEL 3FB5A 5ALBH 5LG1A 4HK0A 3FOMB 2Q76B 4U1KB 4Q6YA 5C0AD 3F7VA 5D7IB 1D5XB 4YDIH 1LE5A 1MRFH 3NBNA 4KUZL 1AE6H 1Q38A 2M8XA 3KPSB 3MLVH 3NIFF 4X99A 2A6IA 4KV5F 5K59E 3RU8L 3V0WL 3D69B 4J4PD 3GI9L 2VXVL 4Z95H 4G6JH 5CD5C 1WBXA 4JY5L 3HCVA 4GOSA 3VWJD 1QOKA 4N0FA 3MJ7B 2A6DB 3U0PB 4OZFB 1INEL 3P0VL 1S5IH 3H7BB 1YEHL 1A02N 4PJDB 5D5MF 3W9DA 3B8YA 4PJHB 3TBWB 1UT9A 5TDNA 4JGJA 3R1GL 5DRXA 5FDWB 4F7PA 1NCWL 2F53B 1UC6A 1OSZB 3T04D 3T77B 4LCYB 1PAMA 1IAMA 4PJ5D 3FFCD 4WHTB 5DLML 1HHHB 3EOTH 4U4BA 3OF6A 3BEVA 4KDVA 3CC5B 2UYLA 4WI3A 4LHUG 4JJHA 4EUPH 4LLAA 3MYJB 1BM3L 2QR0A 5HYFA 1G7JB 4WW2A 2FSEA 1T83A 1WAAF 3V6OC 3OJMB 3GDBA 3SKNB 3QNYA 4NQUA 3TIDA 4LCIL 4RX4D 4C55A 1DLFL 3QUYA 4GAYA 4FP8L 5IW6B 3FQRB 4OCRH 1XCTA 5F7DB 2GJ6D 3B2VL 4Q7DA 4XT1C 3ZO0A 5BS0A 3VGFA 4KWUA 3T0EA 1BQHA 5LGJB 4GKSB 3OZ9L 3C5SA 5ADPH 1RZJC 2SEBA 1C5BH 5HYQB 3X14B 4JLRA 4U7MA 3G5XB 3QDMA 5DJDA 2VUYA 5F71A 3UPRB 3GSRA 3I6KA 1MAJA 1DN0A 4HCRA 1QBBA 5JW5B 3RTQA 4RMRA 2R15A 2GCYA 1LGVA 2HVJA 1QA9A 1A14L 2J8UE 1I7UA 1W0YT 4DKFH 3EDFA 5DEFA 1KIQB 3WO4B 3PHOA 1Q1JH 3T3PE 4TUKH 5GZNC 1T5XB 3UZVB 4JO4H 4X7DC 2QSQA 2PW2A 4P4KB 3MRFB 4JCLA 2X1WL 3SDCA 4LEOB 3CDFA 4JRWA 5IBUB 3T2NL 2W65B 4PY7B 4RSVA 4LLDB 4NJAH 5I1HL 3MCLL 5DUBB 2BSSB 3C60A 2VIRA 4X0KA 5JIPA 3WO4C 1Q9OB 5EBGA 5DD1H 4LF3B 3VD3A 4OFVA 3FFCE 2VLLA 2YRPA 3ARFD 1B88A 4P4KC 1ED3B 1QFWL 3OXSB 1F6AA 4HAFA 1GOHA 4OD1H 3TGXA 2ZOKB 3PQYA 3T8XB 3CCHB 1CXEA 1CZ8L 3VG0L 4YUEH 3IGAA 1CS6A 5CLTA 1ZHBA 2NY1D 3AREA 3T0WA 3GIZH 1FVDA 3VXRA 5EU6A 3FTGB 1CXIA 1NLDH 1HKFA 2HT4C 4HS8H 1I1RA 4XAWH 5HHOD 1A6VH 3C9NB 1H5BB 1HINH 2GJ6E 2XWTB 4LL9A 3TV3H 5I30H 3MBXH 1WQVT 1R3KA 3AC0A 4PFEA 4HIJA 4M7KL 3CVHB 1CL7I 3VFVA 1IC7H 2D3VA 3LQMA 1I7TA 3NFSH 5INCB 2GUOB 3CFCL 3NOIA 5HBBA 1DQQA 2YPLB 3ZT5A 3GO1L 5LAXA 4GBXA 1A1NA 4M8QB 2VDKL 3SDAA 1BP3B 4WW2F 1CGWA 3L6FA 2YS4A 3MRBB 1A4JA 1OT1A 2Q8AH 2FO1A 3CFKB 3O0RL 3FL7A 3STLA 2XNAA 12E8H 3DUUB 2VTFA 2Q6WB 4HGKC 1SM3L 4ONOA 5C08B 2OJZL 3B3IA 2PXYB 1D5MA 3FT3B 2CKBB 3LV3A 1ADQA 1V5JA 3MGAA 1KLGB 4NRZA 4M02A 1ZA3A 5DC9B 5F88A 1MRFL 4XP4L 3MLVL 1N2RB 2FO4A 5C2BL 1EHAA 1WBZB 1Z5LB 4JFXB 4P5TB 4PJIF 1FFPB 5KAQF 1JWMA 4IRSB 2PXYC 3R0NA 4PJ9D 5T1KA 1YJDC 5FYLD 2IPTH 4S11A 5IGXH 1T0NA 3ARUA 4S1QH 2IQ9L 3UTZA 5CZVL 2Q3AA 4G43B 4RA3A 5D4QA 2AK1H 5E4EB 1AJ7H 3MLYL 2X1PA 4P5TC 2WMPA 4ZS6D 3RDTB 4IRSC 5MP6H 1E0OB 1FL6A 2GHWB 2PR4L 4RWHA 4YZFF 3UJJH 3EO1B 3U4EB 1WITA 5HHOE 4LCCA 3TBVB 3W9EB 3ECBB 2VISA 4TULH 1SJEB 1D9KD 5TE7H 3UAJD 5E4EC 3WHE1 5CKAA 4NC1E 1I3RA 3EOTL 4QT5A 1XGTA 3RDTC 1T21A 1K8DB 4AIZB 2P5WA 1T0MB 2B5IB 2YPKB 3UMTA 4CADA 4CVWA 5ITBL 1MCKA 3HB3D 3WIFB 3FHQA 2VQ1B 2YBRB 1SJXA 1MVUB 2CK0H 4ZUUA 4X4ZA 4H1LG 5LGHL 4NNXB 3RKDC 4JQIH 3RL1B 2VDPL 5KSVA 2CPCA 5J89A 5IJKC 3IS1X 1WIUA 4YQXL 1Q0XL 5D8JL 4J3UA 2B5IC 2Y6SD 3RWCB 4JRXB 3VA6A 4L3AA 2VYRE 1FG9C 3RY5A 1KPUB 1MJ7H 7FABH 4F37K 2E3VA 3V6FB 3HRZB 1GAFL 5E99L 2X2YA 1CE1H 4FQJH 1ONQA 1FBIH 2JCCE 1PGRB 3QQ4B 4NKMA 1U58B 5ACZA 1ZT1B 1KBGH 3L3DB 4PRDA 1A3LH 2XZQL 5HGGS 4HKXA 4UINH 4NZRL 1MJJA 4G8IB 1IAKB 4PJAB 1AR2A 4P9HH 4ZAKB 4HUNB 3JVGA 5EC2B 5JDJA 3FQNB 3UDWC 1K8IA 5DD0H 4YXHL 3EAKA 5FYLE 2P8PB 2VLJD 3PDOA 1DBBH 4N0YH 3H9SA 2OXHA 4DKFL 1U8IB 5JDSB 5BZWB 4LHUB 3ZE1E 1A3RL 3QDGA 4JO4L 1KJVA 2RBLA 4ZAKC 1NC2B 1LP9A 1MLBB 3QXDA 2RAMA 4LSVH 2JK5A 4P46B 3V7AE 3VI4E 2MHAA 4O51B 4S1DD 2XV6B 5CEYB 3V6BR 4YHYB 5LXGH 2V2WA 2DYPA 4BYHA 2H1PL 5F3HB 5T3ZH 5J1SC 2H8PB 1XF3B 1T04B 4KI5D 3TZVD 3QDJB 3HAEA 4MVBC 5A16A 5EA0H 1UZ8B 1KCVL 4P46C 3VXMD 3WHE0 2HT3D 1WBYB 4GKNA 1TLKA 4NNYB 4GT7A 4LPVA 3H6JA 2DKUA 3ZYIA 4NUJB 4YHYC 2F15A 4IMKA 4S1RL 4O2FA 4YUEL 3HPLB 2F9BT 3SDYH 1RPQA 4MWFB 4XC3L 5DZOA 2IC2A 2CDEB 3BZ4B 1B6UA 1NLDL 2IBZY 1CLYL 4PG2A 1CD1A 1QTYT 2IH3B 3NH7H 4XVTL 1F97A 5GSVB 1N64L 5FGCB 1DQLL 4XAWL 1NQBA 1YMMA 3CMGA 4RQQA 4Y8DC 1HINL 1OT2A 4JN1H 4YHIA 4B53A 1BX2B 3VG9B 4L5FL 2JIXB 2HA1A 1UH4A 1O7SA 4HV8B 1I9RL 2YC1A 4YDJA 1J5OL 1V3LA 1AQDA 3X3FL 4EN3D 3I2CH 1B4RA 3P4MA 3ZDZE 1DBJH 1X5JA 3BKCL 1N4XH 2Q3ZA 3TYFB 5EU3B 2X1QA 3VG9C 4PP1C 5KVDH 4I3RL 5IQ9A 4OCXL 4P2QD 4XPGL 3D9AH 1FO0L 1FHGA 1HWHB 4UV4L 4KZDH 2Y7QB 3DYPA 3FB8B 3UTSD 2FCBA 2VLJE 4HIHB 2AXFB 4C59B 3WIHL 2Q8AL 4M6AA 1ZLSL 1N8ZB 1IEAB 1N6UA 5FYJU 2AV1A 3C6LA 1NFKA 5DHVA 2OS7A 3GSXA 4X9IA 3SGDI 3GMRB 3IS0X 3A67H 2BOBA 2CO7B 1HH9A 3J7HA 5I8OH 4G42B 1TZIA 4QCIA 2P24A 3X11A 3HG1B 5EFIB 1CK0H 1OQOA 1V3KA 4NUGL 1UENA 4FMFA 4F2MA 2R4SL 4KI5E 3VFSB 4GRWB 1KEML 5IGXL 1FZMB 1LK2A 1FL5B 1N3NB 4S1QL 3VXME 2YWYA 4X4YB 5ERWB 3O2WL 3QYCA 1T1YA 3W11D 4OSUH 4PGDA 3OKNB 3IETA 4ENEC 2AK1L 4XWGH 1N6VA 4KTEH 3KPNB 3FO1A 1M71A 2WBJB 3WS3B 1J1PH 2F19L 1LP9F 4Y4KD 1HIML 4HWBH 5D2NA 4JDTH 4NQSB 5A2IH 1LMKA 4JHAH 3QNZA 3ROOB 1SQ2N 4NQVB 1ND0A 4FXKB 3G08A 1BWWA 2ICWJ 3ARDA 2WBJC 1T1XA 4BZ1H 2JJVA 5SX4I 5GS0H 1XF2A 4MJIB 4WI4A 4YWGL 4NNPL 3P4NB 1MJ8L 3MRGA 1RUMH 1FCCA 2V5RA 3WJLA 4P2QE 3U0TA 3AS0A 2V9RA 3QQNA 5EUOB 4XCNA 4WU7B 4GQPH 3GMNA 1XF5A 3UTSE 1EVUA 3KPRA 4XNYH 3WDJA 4BSJA 3BOVA 4QHLB 1G7PA 1G9MC 2QV2A 5T3XL 5E9DB 7FABL 3BXNA 1NGYA 5IB1B 3BD5A 4ZUSB 1FV1A 1YEDA 2PETA 2XWJB 1AD0B 4MQXC 4PRIA 3QG7H 4WV1A 4JO3L 3RWEA 2FL5A 1A3LL 4DK6A 3PABB 5IW1B 3SJVD 2GSGA 1KIUA 2X09A 3WLWD 1GIGH 5ILTL 3V5KB 2NY5H 3O41A 4P59H 2GFBB 3IDXL 1T6WA 1QRKA 5IT2H 2X41A 2EYTB 3FQXB 4LSSH 1F2XK 4Z8FH 1MEXL 5F9DC 2GKIA 4CW1B 2EDTA 3BKYH 4LBEB 1UH3A 3N85L 1OP3H 3B9AA 3NACH 2QKIB 4UT9H 4NYLA 2HJKB 3IU3A 4H1LB 4IOFD 4M4RA 3KPLB 4D3CL 4DEPB 4DUWA 4BSVA 4F7TB 2EE2A 4ZFZB 4MA3B 3F6LA 3D0VA 4JVWA 1R5WB 4FZ8L 4PRNB 1U6AH 5DMKA 1KB5A 4MX7B 5EA0L 4C58B 2PF6A 1KENL 4YHNB 3MA9L 2H2PD 4PLJC 2X9XA 2A1WL 5JLZA 2VLRE 5EBMB 4DEPC 4HCRH 5CJXC 4DAGL 4XX1G 3SDYL 3TN0D 2OR7A 2BRQA 1HQRB 1FVEB 2AK4A 3OKOB 4I4WA 4PPTA 3SE9L 3LPFA 1ODAA 3THML 3HI6H 4LVHB 4APQB 2QADD 4PJCB 2VXUH 3LEYH 4JN1L 3TA3B 3H42L 4EIZC 1JTTA 4Z78B 2V7NA 5ESQB 1J0YA 3WFBL 1TQBB 3LIZL 1AR1C 1L7TH 3I2CL 3K8KA 2VABA 2A74B 4LVHC 3SJVE 4APQC 3UTTD 2E7LC 4Q9RH 3MJ9L 4IOIB 3VFMA 1H0DB 3L5JA 4ETQB 3O6FB 1FQ9C 4UT7H 4XB8A 5K93A 3TA3C 4YEFA 5KVDL 5D1ZA 4WY7H 3EYVB 4KZDL 2JB6B 4Y4HB 1H3XA 1TQBC 1OW0A 3U7WL 4MAUL 1TDQA 1YNLH 3ARGA 3I02B 1FFRA 3O6MH 4XP9L 3HA0A 5FOBB 3O6FC 5AD0B 5DT1L 4H8WH 3CU7A 1J88A 5HDQH 2HFTA 1R5IA 3HMXA 3EZJB 4G5ZH 4Y4HC 1BVZA 3X12B 2IPKB 3WMSA 2YRLA 1FIGH 2G5BA 4YJZL 4XZUB 1DVFD 2GYSA 3WL9B 1CK0L 4YDVA 1DFBH 1LO0H 3DVGA 4YXLL 2YD8A 4HXAL 1ZE3C 5IVXE 2OQJB 5IHLB 1BQLH 1QSEB 4XBEL 5DWUL 4G9DA 5HI4C 1A6UL 5CEZH 2BCKA 3KNBA 4OGAC 3LQZA 3IAPA 4HT1H 3RWJB 2EH7H 2K7PA 1S9VB 4HXBH 3FB6B 3EDDA 4WI9A 4XWGL 3RJQB 2C1OA 2VITB 1J1PL 2EDOA 4CU6A 1B3JA 4JAMA 1QVOA 3GMLA 1EEZA 3MCKB 3D39D 4JDTL 3U4AA 4YGVA 1NGZA 2E9JA 2DQDL 3WSQL 5GS2H 5EOCH 2YUVA 2ADFL 3QQ9D 4K7FA 1A8JH 1ADQH 4I2XE 2EDDA 4L4TA 4BZ1L 4MJ6B 4YPJA 1BMGA 2PO6D 3O3BA 5GS0L 1VFAB 2KZ1B 4JPKH 1A47A 2D7NA 1KLUA 1Q9KA 2VLMD 4XXDA 4YFDB 5IVZB 3UTTE 4OLZH 1RUML 1KC5H 1MI5B 2N56A 1WWCA 3ZE0E 4LAQL 4ZYKB 3JV0A 4M43H 2XXMB 5JHLH 3ZYOA 2YXFA 5CBAB 5IESL 3P0YH 4K2UL 5AUMA 5IEKA 1AP2A 1EEQA 1OCWH 1QFOA 2G60L 4KKCC 4PJEA 3C5ZA 4OF3A 4L8SA 2VXQL 3SOBH 5D7SL 5GGTL 2MTPA 2V7HB 4N0CD 1RFDL 3UBXG 5LQBH 4JFPA 4LRNL 4Y16B 4PRPB 5CCKH 1A7RH 4U49A 1F4WL 4H5SA 1YEGH 2VZOA 3DX9A 4HX1B 3KLDA 2NY2D 4R7DA 3MNVB 5IUSA 3D2UB 1CG9A 3QJHA 4OGZA 2YUZA 2MPAL 2BVTA 3CLEL 3QDAA 3WEXA 3UZEA 2P49B 4QRQB 3RY6A 1EFXD 4Y16C 2YA1A 4KK9C 2WZPD 2FZ3A 3QI9B 4HWEL 1T22B 2IAND 3BP7A 1F4XH 5JW4M 3BKYL 3FN0L 5IHZA 2F5BH 4XXCC 2V17L 1I8MA 2CH8A 3SDDA 5DJ8A 5DURB 3D5OF 4UT9L 1D6EA 3MMEA 2CJUL 1O0VA 2IH1B 2ITDA 3HPJA 3D39E 2YHGA 1LO5A 3QI9C 4KHTL 4YHLL 1BOGB 3MLZH 2XTJB 1WIOA 4XCYB 3IDIB 3MRNB 2KH2B 5ABDE 1GPOH 3CJJA 4DOHE 3WFCL 5DI8B 1TTGA 4S0TD 1HXMB 4JG1H 1CICA 4G7YH 3QNXA 1FLRH 3C2AH 2BVPA 2OI9B 4OZ4A 3RZCA 2VLME 1NDGB 1E6OH 4XI5D 1E4KA 4NRXA 4ELKB 3KPOB 1DLHB 3KS0J 2XTJC 4UILH 3CUPA 5I15H 1EPFA 2QSVA 2BFVH 1K4CA 4GXUN 1JIBA 3CSGA 2DQIH 2EE6A 2VL5B 4TVPH 1INQA 3TM6A 3QUZD 2VXUL 1B0GA 1FNGA 2OI9C 3AM8A 3G5YB 4LIQE 5DZLA 3TIEB 1GCFA 3EOBB 3WUWG 1IL1A 5GGRY 1BD2A 4WUUB 1JYNA 4JPWL 5CAYB 3BRGC 2CDGA 4JZOB 4U6YA 5KG9A 1L7TL 3RPKA 1CXFA 4MD4A 5I8CA 4P3WA 1F90L 1FC2D 4A2LA 3C09B 3S3SA 2JLLA 5JQHC 4XBPB 3EYFB 2YD6A 3MNWB 3IDMB 4PS4H 1QFWM 1UH2A 2VR9A 4F80A 3HAEH 5DD6A 4XTRC 5CD5D 5KVEH 1HSAA 1MPAL 4O2EB 4UNTA 1FYTA 3E0GA 2IANE 3HKFA 3QO1B 4N0UE 3KPSD 3C09C 5FECA 2D4FA 1KFAL 2ZJSL 2WIIB 2YPVH 3VI3E 2I07B 1BEYH 1HQ4A 4FTVB 4WGVB 4GKZA 1FJ1B 1T2QH 1TTFA 4FQ2L 4NN7B 4G5ZL 3VE0B 1U8KB 3QPXL 4YHMH 1FIGL 3L5HA 4U1HB 6CGTA 1C5DB 1SY6A 1A2YA 2HTKD 5H2BB 4KRPB 1DR9A 4Y4FB 5IR1A 2OP4H 4HDIA 4WGWB 5B38B 3SGEI 1RJZA 4OIIL 2V6HA 3JXAA 3KYNA 5CEZL 4HT1L 4NN7C 5JOEA 4L4VB 4N8CL 2F53D 3IU4H 5DHXB 5BZDB 5JW3H 3QFDA 3VFUA 3U0WH 3CFBA 3PJSB 5JHDB 1A3QA 4MXVE 4KRPC 4Y4FC 3O3DA 2P4AB 3FO9A 5DJXA 4BFIB 4M7LT 5F7EL 3Q6GH 5JZ7C 3BPOB 3VDAA 1JHLL 5DHVH 4OD2B 5ECJE 2GITA 4YK4B 5EOCL 2DIBA 4D0CB 1HI6A 5JIIA 1TNNA 3DXAA 5EZLB 3RVWC 1P53A 2D7MA 3FN3A 4NZDA 3K2UL 1X44A 3WBDA 1ZK9A 2V5MA 1HHGB 1CBVH 1QRNB 5C0JB 5FO9B 5TGBA 4I3SH 3CAFA 3H3BC 2KZWA 2D7TL 3BPOC 4OB5L 4OLZL 1QSFB 3MRRB 3BQUA 3BMVA 2DBJA 4PD4K 2BVQA 4JY6B 5T1DH 4YK4C 2Y07H 4GW4A 2CLRB 3AGVA 5JHLL 2K3TA 3H0TB 3SDXF 3QIUA 4KVCL 1S7TB 4M7JL 5GZND 2C3GA 2EIZB 5D7IE 3EDEA 3PGDA 3KPSE 1FVCB 3G9VA 1A9EB 2ZKHH 1HXYB 5FV1L 2UUDK 4P3CH 5FK9B 2OM5A 4G8EA 4WEBH 4UNUA 3V95A 3GMQB 1M7DB 4JDZB 5ESAA 4WTXA 5L2KA 3SN6N 3F7QA 1FL3A 2XICA 4OGYL 4GRMB 4J8RB 5IMLA 1GGTA 2GY5A 3C8KA 3PHQA 2DQFA 4P4KD 5DJCA 3FQWA 3BD3A 4PJDE 1FO0B 2LAAA 4KC3B 3GMPA 4HUWB 5E7FA 1XGYH 2F53E 3IJYB 1RZ8A 2RIKA 4EBQL 3V6OE 5D1QB 1BQUA 1SBSH 3BDYH 2BRRL 5K9KA 5GGSB 4IHOA 3LOWA 2HT4D 2BVOA 4Y5VB 3G6JA 4OCSH 3G04A 5L7XL 2NY0B 1TVDA 5JUEL 2CIIB 1I8IB 1LD9B 1BECA 5D1QC 3UBXB 4N8VG 2OK0L 3MV8B 1AIFB 3L5XH 1TZHA 3O9WB 3QCVH 4Y5VC 1FLRL 3SDXB 3C2AL 5JOPD 4HMDA 1E6OL 3ORJA 1VADA 5IFHL 2NY0C 2R39A 1N5AB 3P30L 3ZHLA 5CBEA 4JY4B 1DQDH 5AZ2H 1WLHA 1MCBA 2H9GB 3GMOB 5TDPB 1INDH 1L6ZA 1OY3B 4H25A 5DJ2A 3O9WC 3OXRA 5FO7B 4F3FB 3IB4A 3U46B 2YPLD 4ELMF 2J8HA 3GSUA 5E5UB 1Q9LB 2DBLL 1NC4A 2LABA 3MV7B 4LSPL 3IAGC 5EIIA 3A6CL 1JUFB 2AW2A 3VRIA 1I1FA 2A77H 1MWAA 1X5ZA 5C08D 3U7AA 4FOMA 2OTWB 5HJ3A 4ZFGL 2PXYD 2NY3B 2HKFH 4MMXC 1KB5H 1ZT4A 4R7NB 1C08A 3NIGE 2VE6A 5KVEL 4OCWH 3QFJA 1VFMA 5BJTB 1TJGH 1BQHG 2Z92B 2AJYH 3MRCA 5IEHB 5HHMB 5DUML 2QQQA 2F8XC 3QUXD 4P5TD 3CLFH 1NBZB 1JPGB 4IRSD 2NY3C 4OZHA 3EHBC 3I6GA 3RAJH 2ITCA 3VFGL 3TT1L 3BYYA 4O9HL 2ORBL 3QRGH 2HVKA 4XP5L 4YXKH 1F3JA 4I48B 1UACL 1R3LB 3DJ9A 1U8PB 2ZUYA 3O4LB 4OF5A 3CIQA 1L0QA 2NZIA 3VCLA 1IGFL 3RDTD 5C7XL 2B1AL 3Q1SH 4MDIA 3JV4B 4YPGB 1QEWA 1BIHA 4FFZH 5KSUA 5EBWA 3TCXA 5EOTA 5D7JB 1HHIA 5FUOH 1AGEB 3IU4L 5GQBA 5JW3L 3WLBB 4ELMB 2FH8A 3PG2A 2VLKA 4HKZA 1S9YA 5SV3A 1X3DA 1P4LB 3CMOL 3RKDD 4R0LB 2X4PA 2JJSA 5C6TL 1JRHI 4OZGA 1JGDA 3HC3L 3ZT6A 3W39A 3G6JF 5D7JC 1JZ2A 1RAMA 3V4UL 1EFQA 5FF6A 3E6HB 1E4JA 2W38A 5HDBF 2D03H 5AZEL 1ZGLA 1J9CT 3DWTA 2ATKA 4NCC1 5CKGA 3HMXH 5C8JA 1I8KA 4NFBA 4R0LC 3B5TA 1CBVL 1U3HA 4HS6B 2YEZA 4NSKB 5CWSA 3WXWH 5DF0A 5DS8A 4JRXD 1YPZA 4I3SL 1S7UB 1F58H 2EO1A 4JFYA 5D9SB 4XAKD 4M6OH 5T1DL 2I27N 1KPVB 5C09B 4LK4A 4OZIA 1TVBB 1CFBA 4J2XA 3GUTA 2BSED 1D6VL 1NAKL 4KU1A 4NKIH 1ORSB 2IG2L 1G7IB 1VA9A 1AC6A 3QEHA 4LSUL 4ZAKD 2XWBB 3A0OA 3MRIA 1FC1A 5T5NF 2Y36H 4LU5H 5E5MA 3HFML 3MLTA 5DJ6B 3IXAA 5HVGB 3BPLB 4XGZA 4RMWA 4PGCB 1NGPL 4DQOH 2HLFC 4MNGB 4IIQA 4LHUD 5MEPB 3UYRH 4S1SL 2DTML 2Z8RA 5AYUH 1R6VA 1G7MA 1NC2D 5IVOA 3NZHH 1MY7A 5IHBA 4HWZA 4MVBD 1J0JA 4MZ2A 4O5LL 3OX8B 4DK3A 3P40A 4P46D 3LEVH 2G75A 3BPLC 1QO3A 3BX7C 1OAKH 3NABH 3N1PC 5C1MB 5K9QG 3BKML 1D5IH 1LE9A 4FG6C 4QOKB 1KIPA 4D2NA 1SBSL 3L5WA 1I9IH 2QSCH 5IHUL 1TJHH 3QDJD 4G6KH 4JR9H 5L6YL 1KACB 5KBNC 4LASL 1T1WB 4HUVB 1EV2E 3LEXA 2F5AH 1NAML 2XZAH 3VMOA 5INDA 1CDYA 1M7XA 2Y25A 4M6MH 1NFDF 1NKOA 1NCDL 2CD0A 3RQ3A 3ULVH 2EKSA 4TNVK 1UQSB 3QCVL 1IKFL 4TOYL 4JRXE 1U93A 2AXGB 4PP1D 5HYJA 3OAYK 2VR5A 4Z7WA 2JIXD 4XAKE 3K4AA 4TSAH 4I0KA 1IZKA 5AZ2L 4PJIE 2J6EA 1MQKH 3FFDB 4E42B 4LKCA 1CE6A 4OZGF 5EU4A 4OFYD 1VB9A 4LDLB 4PJAE 4JPIA 3HRPA 4U6VH 4WCYL 4UOW1 4R4FL 4G6AC 5T1MA 5EZIL 1MHPH 5CMAA 2BDNH 1LE5B 2BNQA 3MV9B 4G8GB 1MFAH 2QHRL 1QLEH 5J1AA 4OCLC 1YPZF 5T33L 3E6FB 4I0CC 1WSST 4X6DB 1G1CA 2HKFL 1EAPA 5E24E 4X98B 3EOYG 4N8VB 3EKCA 3MJ8A 4ZQKA 4OZIF 3MO1B 4GG6B 1J8HA 4WW1B 3MXWH 1DBAH 4MAYB 3N1QC 5GS0C 4N0FB 3RNQA 1T03H 1TJGL 4ENED 3HG1D 4HZLA 3KHOA 4BH8A 3VH8A 3FMGL 2R1YA 1XIWA 3W9DB 1AGDA 4NQDA 1LDPH 1UB5A 3ULSB 5C0DA 2X4SA 2VOTA 1G9NL 5FYJL 4MAYC 4UTAL 4YXKL 4RAVA 4P23B 1RIUL 1U8LB 3GK8H 4NQEB 1BZ7B 4ZTPL 2WBJD 3P77A 4D9RD 3TC9A 1IGJA 2APBA 1NLBL 2X4RB 1ZSDB 3SGJC 2PCPB 3AXLA 4ALAH 5FGCE 4ZFFA 2AXHA 3SE3A 1XT5A 3IKCB 4P23C 3RBGA 3O4OB 3WFHA 2Y72A 4FHBD 3QNYB 3TIDB 1JFQL 3LN5A 3IDUA 3FRPG 3KXFA 1CL7H 1LEIA 1EBPA 3CZFA 1E28B 4POZC 5SWSB 4LGRB 4MJID 4OUUA 1JTPA 1U91A 2R2HB 2OX5A 4TNWK 2CLVA 4MCZA 1JF1A 4J12A 4NO5B 3FQUA 3QXAA 3FJTA 3C5SB 3HAEG 3HI5L 3O4OC 4MQXD 4XPFH 2VDQL 3GBNH 5ANMB 4L8CB 4WFFD 1NH6A 2WUCH 1SY6H 3M8OH 5HHVL 5IBTH 4CN4A 1F58L 5E9DD 1GGYA 2BNRB 3F5WA 1JTOA 3RTQB 3V0VA 2DQEL 3EYSH 4FQXA 1IC4H 2GCYB 4Z7WF 4X5WA 4PRAB 4YGAB 1K6QL 1B2WH 1RURL 1NFIB 3QRFM 2C4XA 3BKJH 3REWA 4NKIL 4XMKH 1K4DA 5FYKD 3NN8B 2H45A 3HG1E 2VDNL 5DTFB 2Z93A 5J1TC 2A9MH 2NY4B 1KTLA 4P3DA 3RTQC 4AENB 1CR9H 5D71H 1YY8B 1D5BB 4JDVB 4BH7B 2J88H 5E00A 4PJ7A 3J8F7 3QDHA 3SKOA 4LLQB 5DRZB 3ZKND 5AYUL 1OAYH 4HFWA 2NY4C 2VZTA 4HIIB 4KJYA 5CSGA 1N0XL 4PLJD 2HJFB 4M3JA 1RZGB 4F9PC 2J12B 2FD6L 1ZHBB 3PP3H 4L29A 3H3PL 1L4IA 3MSPA 4LARH 1T20A 1A7NL 1FVDB 1U8JA 1QLFA 5EU6B 4QYOA 2ZCLH 5FIEA 5IFJA 3FRUA 4HFUH 3TT3H 3MYZA 1JHKH 4BJLA 1R24A 1XZ0B 1TJHL 3NIDF 4Q58C 1UM5L 3FOLA 5GS3A 4XCFH 1ZT7B 3HZVA 4MJIE 1S7QB 2QLVB 4XNQA 2XZAL 4M8VA 4RGOH 5E8DH 4F57H 3MZGB 2I60H 4FQQB 2P44B 1AR1D 1RZFL 4ODXA 4E0RA 2BERA 1C16A 3MRDA 4WFFE 4APQD 2E6QA 5C9JA 3TA3D 2DS4A 1S3KH 4LEXH 5E9DE 3BW9A 3SDAB 1BGXL 2UWEB 2XG5A 2OR9H 5EN2A 5JORB 3L6FB 1OAQL 4TSAL 3IT8D 1GC1L 3F62A 2DLHA 4ZOBA 4PY8I 4N1HB 3WNNA 4WHCA 1WZ1H 2GAZA 1EA9C 3CD4A 5FYKE 1ZHKA 4KHXH 3O6FD 1N5YH 3SDAC 3BP6B 5E1HB 3GKWH 4U1MB 1EIBA 1T2JA 3RGVB 2VJXA 3VFWA 4IRZL 3S7GA 3VFRA 1IBGL 4Y4HD 3UEZA 2VC2H 4NRZB 4Z7VA 5J3HC 3GJEA 3EGSA 4X6BB 2OZ4A 3ROLA 1JPFA 5DD3H 4O02H 2XOTA 43CAB 4AEHH 5KVFH 2NLJB 3DRQB 5HI4D 4ZTOH 2P1YA 3IKKA 4OGAD 2UY7A 3RGVC 2P43B 4TUOB 2W0PA 1YECL 2EYRA 3MXWL 1DBAL 4NJ9H 1UJ3B 1DUYB 4C56A 1T03L 2GT9B 3KR3L 3T1WA 4ZPVB 1B4JL 4RRPA 1FP5A 4KTDL 1HYSC 3CFEB 1QSED 2OL3A 4YHKH 3BZEB 4EVNB 1UJTA 1YEJL 3RL2A 4KJWC 5HGAA 3BAEH 2NMSA 2YD9A 5C0IA 4JPVH 4YX2H 1SVCP 1UJ3C 5GJSH 4PJ7F 3DVNB 4Z0XB 4PG9A 5ALCH 2NW2A 3K8LA 3MFFB 1XCQA 4LGPB 1OAZL 2BY1A 1PKQA 3MRMB 4RWYH 5CHNA 1NCNA 2AV7A 5AEAA 3N1GC 2P47B 4ALAL 1OSPH 3CH1B 4PJCE 3O45A 1A1MA 3DETC 4XCCL 5GPRA 1F8TH 2HTLC 2B4CL 1WCBB 1MSPA 4XPTH 4W4NA 2O5ZH 5EZJA 2XY1A 1EGJA 3SKJL 6FABL 3V4VH 2Z35A 5D6DC 1ZV5A 2EDRA 4DZ8A 1RZKL 1MI5D 4BKLA 1AHWA 4MS8C 4BK5A 3O81A 3DSNA 4PJGB 4K7PX 3ULUL 2KBGA 2AJ3B 5JO5A 3BRDA 2NY7H 2GK2A 2WUCL 4ISVA 1KCRH 4ZDHB 4OT1H 4XP1L 3HZKA 4ONHB 3MOQA 2AI0L 2AJUH 3P73A 2R2CA 1FNHA 5K33A 3SGDH 1S7RA 3EYSL 4MDJB 1IC4L 4Y16D 4PRPD 4KK9D 4UI2A 4P49A 1NKRA 1U9KA 3H9SB 3BKJL 3QEQB 3V5HB 3DBXA 2WWKT 1P2CB 3EZ8A 3D2UD 4P2CG 3QDGB 4XMKL 4FN0A 2FIRT 3BP4A 3LKSB 1KGCD 3LKPA 5IIEB 3PWUB 5SWQA 1SEBB 5IMKA 2A9ML 2RCSH 5D1XB 1NGWA 5L8KB 2JK5B 1CR9L 1CQYA 1SJHA 2YD7A 3L7EB 1S78C 2I25N 2MHAB 3PWVA 2XG4A 4FABH 1QSEE 4OIAA 2DIJA 3RWDA 2ZG3A 2V2WB 4JM2A 3QI9D 32C2A 4Z7VF 5KW9H 2NY6B 2VH5H 3FO0H 4S0SD 4FFVC 5DURD 3HE7B 1A7OH 5D1XC 5A16B 4Z7QF 5IQ7L 1ERNA 4KVNH 1FGVH 2A0LC 1CLZL 5D7LB 1HKLH 5EG6C 5M7QA 2H32H 3ARVA 4GFTB 4LP4A 2NY6C 2P8LB 1MHHA 4K23H 2XTJD 5FKPA 5HYIA 3KJ4B 3Q6FA 1BOYA 2ZCLL 3RX5A 4HFUL 3HE7C 5SX4H 4ZD3H 4EIGB 1C12A 1YMMB 3V52H 4J4PA 1KELH 4U33A 3OJDB 5DK2B 5FUZL 3MODH 5I1GH 1QHPA 2FJFB 4IMKC 2J8UA 4UQ2B 2DM3A 1MI5E 3N9GH 2WM0A 4YE4H 2B20A 4K94H 3RX7A 3KJ4C 5D6CB 2O93L 1MFNA 2R1WA 3TYGH 5I1DA 5JQ6L 1BF8A 5C3TA 1E6JH 5ENWA 5C0RL 1LO4H 3M45A 1NGXA 3TEUA 1LEGB 1NDMA 1S3KL 4OCMC 4WUUD 2OR9L 3C08H 1L0YA 4QRPB 4XTRD 1P5VA 4PRPE 1MAKA 4HBCH 3QXTA 2Q87A 3FFCA 2HLAB 4KQ3L 1JZ4A 3TCLB 2C3VA 4MA8L 2E27H 3QHFH 1WZ1L 2P42B 1AY1H 2GJZA 5I1EH 3R8BB 4ORGA 4RFOH 3ZKSD 3C6LB 1RJYB 1FG2A 5IG7A 5J6HA 1UB6A 1B0WA 4KQ4L 4PB9H 4P5MB 5A2LH 4U1GB 2EDXA 1AGCB 4MB3A 1HH9B 2VC2L 1MRDH 3SKMA 4Q9QH 4RX4A 4P9MH 3X11B 1T5WB 3VXSE 2QQKH 3VW3H 3LRGA 4HBQA 4O02L 3C6LC 2EDEA 2GJ6A 5F6IB 4F2MB 3S97C 4CVXA 5J8OA 4FTVD 5CILL 1ZWIB 4ZTOL 4U1GC 4ZODA 2EIEA 1T4KA 1T1YB 4UIKH 4HPOH 3BI9X 5SV4A 5SWZB 4OM1L 1MIML 4U1IA 4BK4A 3PGCB 5I18H 2YR3A 2XTJE 3S88H 2O26U 2J6EH 4MD0A 3JWOH 2WIMA 3UZQA 1G6RL 2QEJA 4KRPD 3Q5YA 4Y4FD 1NUDA 5F6IC 3RGHA 4XCEB 5E2UH 4JFEB 5JZ7D 3QNZB 4NO3B 4L4VD 4H26A 4ZS7L 4YX2L 3PWJA 4JM2F 5GJSL 1BBJA 2C3XA 1CXHA 1BIIB 3U9UB 1ND0B 5JHDD 5DQJA 1GXEA 3RVWD 3HC0A 4EI5B 2WANA 3ZHKA 2YXMA 5CJOH 4O58L 4JANB 4YR6A 4Q9CA 1RULH 3LCYA 3MRGB 4PJ8B 4J7RA 2B2XH 4K8RH 5I0ZA 2ZWLT 1RIVH 1F8TL 2VDOL 4WUUE 2ED7A 3IRZA 2IPUG 3BISA 3GMNB 5DJZB 1B6DA 5MERB 4EI5C 3ESVF 5C3LD 3ARFA 5IMMB 3BP5A 1QRND 5E70A 2F58L 1R3HA 5BV7L 4R3SB 1T2XA 1SMAA 1QSFD 1NAMB 4PJ8C 5L8LB 2J8UF 5IV2A 2G2RA 3QWQB 3VU2A 4H20H 4ONFH 3T3PF 3RWGA 5MI0B 3RWEB 3ZTNH 4RMSA 4U3HA 3BVNB 2AGJH 4PYGA 4RBPH 1EXUA 1KJMA 3OHXB 5CEXA 4UTBH 1CDJA 2ZSVA 4OAWB 3MLXH 4JO2H 4FFYH 5HHOA 5EORL 3S96A 4GMSL 3AU1A 4FTVE 4P4RA 2DL9A 5MI0C 1MCLA 3UJIH 3RVVC 1U8OB 3TFKC 1X5LA 4WI8A 5E94B 3C6SB 1U8HA 3CU1A 4HJGA 1A4KB 1RY7B 4G8FB 4WI5A 1KLFA 5EDXA 2RCSL 5ITFA 4KK6C 4CN1A 1EJOH 4PJBB 1FIEA 2ZG1A 4PGEB 3DMMB 3EFDL 2CXKA 1II4E 1J05A 2CIKB 1I85C 3VGBA 3VXPA 3CXHJ 2VH5L 3IXTA 1J87A 4TSCH 5C0GA 5D1QD 4F33A 5DMGC 1OARL 4JFZH 2A83B 1IQWH 3VXUB 3CFIC 1RK1B 5C0NC 3TVMB 3JUYA 3STZB 5BRZB 2AJXL 2X4NA 3DMMC 5D70H 4F7EB 1M7IB 2JCCA 2NY0D 4RAUB 2VXSL 4WO4B 3WFZA 4AL8H 2P7TA 1WFUA 3S36L 1Y0LB 5CD3A 1R5VA 5FM4A 3LPGA 2AK4B 4OV5B 5M94B 3MV8D 4ZXBA 3TVMC 3O9WD 5F6HJ 4PJ9A 1QRNE 5I76A 2YSSB 3U30B 1HSBB 1Q72H 3AS2A 1QSFE 2V7NB 1NL0L 1OF2B 4WO4C 3MRQA 3GRWL 3N9GL 3ZYZA 2JELH 1Q9WA 4XWOC 2W9DH 3MUJA 2XA8H 1J0ZA 4JB9H 3TYGL 5DVMA 3T4YA 4YC2B 1E6JL 4F37F 4PYHA 3A6OA 3VXQA 3SE8H 2YD4A 1AXSB 3U30C 4TUJB 2EDLA 4EQ3A 5HHNB 1T0PB 2VXTL 2EDKA 3WNMA 3LS5H 4FS0A 1DL7H 4NDMB 3C08L 4B5EA 4L1HA 4CMMB 3MUGB 4X7TB 3DX8A 3NFPA 1D9KA 4UV7L 1W72L 4DVRL 4YC2C 5I8KH 5ESVB 1MFBH 3MV7D 3ZSTA 1HILB 5I1EL 1A0QH 4LCWB 1YYMH 2BMKA 4HUKB 1JZ5A 1BFTA 1QNZL 5IB3B 2NY3D 4PB9L 3EHBD 3NZ8A 1FZJB 3IVKB 3BH9A 1R5IB 5T1LB 2DLFL 4MLIA 4Z76A 1G7LA 1OW0C 3BGMB 3DROB 1CFNB 3MLUH 4QTHA 5FO8A 3LH2H 2BY3A 1UYWL 2AEPH 2HG5B 4XH2B 5T3XD 5HHMD 2D7PA 2N1KA 3ME0A 3O2DA 4WDIA 3VXOB 3UTQB 1TVHB 1D3CA 1UXSB 3KNBB 4LLWB 5AG8A 5FHAH 5EPMA 4HPOL 5DD5L 1J1XH 4FQHB 4B41A 2D7QA 5ICXB 5I18L 2H41A 3O4LD 4XNMA 2C1OB 3S88L 2IEPA 1NBQA 1IE5A 4JAMB 1P7KA 4W68A 2R0ZL 1HOCB 2Y5TA 1WISA 1NCTA 2ARJB 4R4BA 3SDXE 1NCCH 1NGZB 5D7JD 4U1SB 2VLJA 4KZEL 1NCUA 4RMQA 3S98A 1S7XB 4JZNB 1NCBL 4OLXL 4M48H 1HN1A 4L4JA 35C8H 2CLZB 1E4XL 1OGTB 1E4WL 4JRYB 4NZUH 1MJUL 1H15A 2OZ4H 2PW1B 4XRCB 3O3EA 1RULL 3NCJL 4YHPB 3S35L 2JCCF 3LB6C 1A6ZA 4K8RL 3SBWA 3K4ZA 1VPOL 2F74B 1QBMH 4GSDL 1QPPA 1RMFH 5AUMB 3TJHC 5CUSH 4YNYA 3VFNA 3BIKB 4ODVL 2Y5EA 3MV7E 3TZVA 4JJ5A 1R0AH 5IB2B 3VXMA 1ITBB 4NGHH 4BM7A 3LZFL 3I6LD 4F7CA 3FHAA 4OLUH 4QHMB 2OL3H 5C09D 4H5SB 1M6OA 4R7DB 3ZTNL 1AXTH 2HLFD 4MQSB 1RUPH 4OLEA 1FDLH 1UA6H 1U8NA 3U83A 4UBDC 2PNDA 1AXIB 3RBSA 4Z9KB 4F9LA 5T3XE 3MLXL 4JO2L 4FFYL 1KG0A 5JNYB 4KI1A 2YA2A 3O6LH 5E56A 2BOCA 3BT2L 2FX9H 3O11A 4ODWA 3CVIL 2N7AA 4EN3A 1XH3B 1F3DJ 4FG6D 3UC0H 3E3QE 4MNHA 5E6YA 1KCUL 2JJTC 3ARPA 3MROB 5DJ8B 3O4LE 3CDGB 1K2DA 4HKJB 4PB0H 3SGEH 4JQVA 4KTYA 5CJQH 3OGCB 1EGJH 4P2QA 1CFQA 3HPJB 2G9HA 5TQ2L 1GC1C 1LO5B 1YN6A 1JZ7A 1P9MC 4QHKJ 1KUMA 5I17B 1PG7W 3UTSA 5MENB 5LJYH 5MEOA 2X4QB 1VGEH 2Q8BL 4N9GA 2R1XA 5GIRB 4QOKD 4ELME 3C5JB 1PX3A 4AEIL 4JN2A 3CSYB 3ULUF 3MA7A 1MFCH 2BVPB 2CDFA 2DAVA 4PJXB 2UY6A 4NRYA 1F4YH 2A6JA 4NRXB 2JB5H 1X5IA 4DW2H 1KB9J 3QQ3A 4LLUA 4LLMB 1PSKL 3IJSA 4A6YA 2CGRH 3ZDZF 2FR4A 3IFPB 3X13A 1BLNA 2W9EH 1INQB 2FYYA 2LTQB 2YN3A 1TETH 5CS7A 3QWRA 1FNGB 4QWWC 1CLOH 1DEEA 3F58H 3PHSA 4UAOB 5JPMA 1E4KC 1CU4H 1MQ8A 1MCSA 4MGXA 2FJHA 2FBJH 3IDJB 3I6LE 1RHHA 3U7YH 1TZGH 3BE1H 4G6AD 5B8CB 2W9DL 5HDLA 1GRWA 5C09E 5D2LB 1A6AA 2KQNA 4M1DL 5FGBC 1PLGH 2LTQC 5EH1A 4Y4KA 4X6EB 2E6JA 3RIAK 5DJ0A 4LCUA 4JKPH 4UAOC 4FZEH 3SQOL 1OQXA 3MRPB 5DFVC 5DD6B 5B8CC 2XZCH 3LKQB 2X40A 5A3IC 4CU7A 3P4LA 2A9NH 2GK0B 2AEQH 5GS0D 1JMXA 1MFBL 4MNGE 5E7BA 4LVOB 3MV9D 4G8GD 3MGOB 4KI5F 5F96H 4WEMB 1CT8A 2VLRA 5AG9A 5HVHB 5BVPH 1R3JA 2B4CC 3V4PL 2YZ8A 4OBSA 1BVLA 4QF1A 1WZLA 3KLAB 4C83A 1I4FB 3I84A 4Z7UF 4MAYD 4ODUA 3LH2L 4LVOC 2AEPL 4V2CB 1TCRB 3GBMH 3OKLA 4MQ7A 2AABH 4QOKE 2CXGA 5F1SA 1RZKC 1HHKA 4F58H 5IR1B 2C7UB 1ZXQA 2B7DT 5HVHC 5EBLB 4MB5A 4QXTA 1CI5A 4LRIC 5GGVH 4QRRD 3ESUF 3KYMA 5B39G 3HI1A 5DVKA 3CFBB 3OL2A 4P23D 1HZHL 4U31A 3L3GA 3SJVA 5GRYA 3S34H 3OKKB 4NQED 4B7LA 2IWGA 3TO2A 1X9QA 4POZD 1CFSA 3DV6A 4K3HA 4OGXH 1GZPB 3F7YB 1IGTB 1ACYL 3MR9A 5LKNA 3TBTA 1MCOL 1HI6B 4M48L 1U92B 2DDQL 1A1OB 1Y6KR 35C8L 3ARZA 1T1ZA 1ZEAH 4XPAL 4U6XA 2FWOA 1T89A 2DF3A 4NZUL 5SWSD 2HKHH 4O00A 1IRAY 1GGCH 3FONA 5KJRL 2ZOLB 4MLSA 2BVQB 4TYUA 4MA7H 3OBAA 4P5KA 3TBSA 4ZFOA 2ZP0T 2ZUQB 3ARQA 1LEKA 1KCLA 2BXYA 2XTLA 4U1NB 5CUSL 2RHEA 1JPTL 2XFXB 5FEBA 5IVXA 4JHBA 2LU4A 3MV9E 1R0AL 5F9OH 4EDXB 2BNRD 3RTQD 3ES6B 4X6DE 4GXUM 4HH8A 2XQBH 4G8EB 2ZUQC 5E95B 3TN0A 1QR1B 1MCDA 5ID0A 3BMWA 3EYOA 2R4RH 3GI8H 3GZKA 4GG6E 5ICYB 4YDKH 3IAQA 4JO1H 3TBYB 4Y1AD 1BZQK 3C8KB 4JKLA 5EUKA 3FQWB 2NY4D 4QRUB 1KULA 5EO9A 4HWNA 1I7ZB 1YEFH 1NFDE 1T80A 3O6LL 3HZYB 1FFNA 1ZHLB 2R9HC 4XVJH 4QRRE 4I2XA 4XB7A 4ZO6A 3VA2C 3VJ6A 3DV4B 1LK3L 4J6RL 2VZVA 3C2SA 1RI8A 3U82B 3UTTA 4NKOB 4OJFH 4NQEE 3QH3B 4PB0L 5DK0A 2BVOB 4Y2DB 3G04B 5GISH 1FE8H 4ETYA 5BW7C 4ZO8A 3CXDH 4NHUB 3ZSSA 4LNRB 2VDRH 3O8XB 2GTWB 1FAKT 1NMAL 5CFHA 1X7QB 1GL4B 5EU6D 4K55A 2X70B 1DDHA 5DQ9B 3L3KB 5C2UB 1MFCL 5DEGB 3OG4B 3PWNA 4ODHH 1JRHH 3LS4L 1ORQB 1LO3L 4PR5B 4Y2DC 1MHEB 5F9WB 3RPIA 5SWSE 3HR5A 2W91A 2XN9B 4DW2L 4N0RA 3O8XC 2DOCA 3U4BL 1IGCH 4D0BB 2WQRA 4NOBA 2EICA 1GZQB 8FABA 1UM6L 2BX5A 3R06B 5F6HI 1G6RB 4UQ3A 3B8SA 1F11B 1DVFA 4J3SA 3STBA 2W9EL 5ANME 3LRSB 5CEZD 5F9WC 4J3OC 5F3BA 3QUKB 3L5IA 2BNRE 3SDAD