1MFDL

The solution structure of a trisaccharide-antibody complex: comparison of nmr measurements with a crystal structure
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
b'QAVVTQESALTTSPGETVTLTCRSSTGTVTSGNHANWVQEKPDHLFTGLIGDTNNRAPGVPARFSGSLIGDKAALTITGAQPEDEAIYFCALWCNNHWIFGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLSRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-LAMBDA SE155-4 FAB (LIGHT CHAIN)
publication title Solution structure of a trisaccharide-antibody complex: comparison of NMR measurements with a crystal structure.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 52
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 1993-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mfdL01
1VACB 1MCFA 1HSAB 4JN1H 4WFGD 3H3KA 4P5KB 3OF6D 2IPTL 1NPUA 2BRRL 1L9NA 1HNFA 3MRMB 5DEGA 3DYMA 4OZHA 3NCMA 3Q5YA 1UH4A 2WMPA 4Y5XB 1Z6JT 2JK5B 3LRGA 4NRZA 1ZHBA 4LCCB 3HAEB 2J5LB 3T4AB 4OCYH 3HA0A 4A6YH 3FCTB 1ZLVH 5D8JH 3DUHA 2ID5A 1GGBH 1WIUA 4EZMA 2AEIT 5IFHL 3C5JA 4RFOH 1UJ3A 4WHYG 2F5AH 4L8SA 3UTTA 2YD4A 3SOBH 2IQAA 4RFEA 5IG7A 4PJFB 3MGOB 4XMLL 3FQWB 5D7JB 2P5WA 2AJ3A 5DJ8A 3EYUH 5SWZA 2EDHA 4MJ5A 4NZUL 1VFAA 1XGYL 4RISH 1KEMH 3QDMA 2ICWA 4BA8A 1JYVA 2BVQA 4LIQL 3RWJA 3ORJA 1DN2A 3HMXH 3QO1A 2G75B 5CIPB 1AR2A 2WV3A 4YEFA 5LG1A 4Y4HC 4HPYH 3T04D 4MYWB 4HCRH 4RGNE 2V2TA 4KI1A 3PV7A 3LQAH 1ZT4B 5GZOD 2D9CA 1II4E 2OZ4H 4JLRA 2OK0H 5C1MB 2CLVA 4P2QD 1S9VB 3VFGH 4NM4H 3BPOB 2J7LA 4YIQA 2VIRA 3MV8E 4HWBL 2GJJA 1M71A 2O5YL 4XCYB 3IJSA 1ED3A 5H37H 5LXGH 1WK0A 1BD2A 1XF3B 2NXZD 4DW2L 3LOWA 3I3EA 3TESA 1QR1B 1C5BH 1GL4B 1W72H 2W60A 3LS4L 2ZPKH 3WMSA 3DX8A 1G1CA 2CDEB 2LABA 5CGMA 4QEGA 1TZGL 3G6JF 5SWSA 1WAAF 2ZSWA 1X5GA 5FECA 4ZS7L 4HUUA 1IQWL 4ZSOB 1ADQA 1KIRA 5FO7A 3DETD 5E08H 2VSDA 4LCYB 4YNYA 1HHKA 3SDDA 1Z9LA 1YMME 2KPNA 3D1MC 4ELKA 1FVDB 3H9HB 4NCC1 4UINH 1CQKA 4MXQC 5EU6D 2LU7A 2D7NA 4PJDB 5SWQB 2HMIC 1WWBX 1P7KB 1KEGL 4K94C 1CD1A 5E8OA 3S7GA 5DZLA 3RVWD 3N9GH 4DTGH 1RZFL 2P43B 2HWZH 4G5ZH 5C0CB 2MHAA 3HNTL 4ZD3L 4FFVC 2P49B 3OJVC 1MI5A 3ET9F 4FTVA 4JAMB 3LRHA 4LDOB 4MA7H 1NGQH 4GS7B 2R9HD 3O81A 2CDGA 4WUUD 2HTLD 1J0ZA 1MFBL 3DUSB 4FS0A 1LMKA 3MBXH 3O4OB 1A6UH 4R9HA 2R29H 1FVCB 4PRHD 3CUPA 2IJ0C 4APQA 4H20H 2R4RH 5EUOE 3KPLB 3VDBA 3ARFD 3QG6A 1U8KB 3W2DH 3RHWF 3HZMA 3MV7E 3M8OH 1KUMA 2RHEA 1HCFX 3MRLB 1PKQE 3T65A 2WBJB 1RK1A 5J1AB 4LLYB 3TYFB 3W39A 3BMWA 5JIKA 4PJAA 2VE6B 4N1HB 4MXVE 1NCBL 2IWGA 4PTTA 5CS7A 4KKLC 3OBAA 1OM3H 4IOIA 4O58H 1JGEB 4I0CC 1NUDA 3E1F1 1Q9WB 2QR0A 1YDPB 2YPLA 1BEYH 2HFEA 3O2DL 4LQ1A 4JFEA 4O02L 3U0TB 5FYLH 3GMLB 1WSST 5DJYB 1JI1A 3F62A 1U8NA 5J9PB 3RKDD 5C2UB 1ZVSA 1FZKA 1I7UA 1RJLB 1IGTA 3MFGB 3TT3L 3S37L 1CDHA 1NCDH 3S35H 2E8ZA 4PJXB 4QTHA 5E6IA 5F96L 4CU7A 4PG9A 1JWUA 5GGRY 2Z8VC 4J6RH 3BEVA 3FRUA 1I7ZB 4KY1L 5F9OH 3LKOA 4NN5C 3ZKNC 1OAQH 3BDYL 3NABH 4HXBL 1PW3A 1JL8A 2UYLA 4RMTA 2YPKA 3FT4A 4N0UA 4AM0B 4CDHA 2YD1A 1I3VA 1IGJB 4PG2A 5DSCA 2WWKO 2DQDH 4K3EL 4E9LA 4PV9A 4NM8H 5FA3A 4CJ0A 5D7JD 5J13B 2VLJA 4OQ1A 3WIIH 4P23B 4RA0C 2DOCA 3MLSH 4JO1H 5T3ZD 1KBGL 4ZUSB 1F6AA 5ITFB 2EH8H 1RUMH 4K7PY 1CE6B 4NJAL 5TPWL 4YDIL 4F7TB 3RIFK 1X5HA 4UU9A 4V1DB 3MLPA 4LEXL 5A2JH 4MLIA 2A73A 5CILL 1CFNB 3QUKA 3LN4A 3U4BH 2IPUK 1T1YB 3P77B 4HK3J 4ZS6D 3PWLA 4K7PH 1EHLH 5C0EB 5CP7B 4HHAB 3BN9C 1G6RH 2ZOLA 5SX4I 4U1MB 1KPVA 1AHWC 4QHLB 3QIUA 3IXTA 2P8PA 3GBMH 5JNYA 3NIFF 4ZTPH 3ZHDA 4H0GA 2UY6A 3O2DA 1FORL 2NX5B 2DLHA 4IHOB 1T1XA 4GBXA 4WI9A 3MRHB 3G5ZB 1MCHA 2Z35A 4GFTB 5L6YH 2FJFA 4XBEH 1A6TA 3D39A 3O41A 4KK6C 4L1HA 1EFQA 5HPMB 1NJ9A 5C0IB 5HDBF 1S9XB 4MAYB 3RWIA 1FQ9C 1CK0L 4QRUB 3ARBC 4AG4L 3U30C 1YEFH 1TQCB 5F72S 1HDMB 1WBYB 3GRWL 4GXVL 2WNGA 5HD8D 1GGIH 2D9QB 5DD0L 2VABB 1A4JB 1CL7I 5I1KL 3IF1B 5IMMA 5J11B 2IH1A 4Q6IB 2VLRE 3L5HA 2O5ZL 4HIXH 4OIIH 5D7LA 3MJ6A 3QZWG 2FD6H 1CICB 5CBAA 3GSXB 1YPZB 3DYOA 4R4BB 2ATPA 4C54A 4DKAA 2CRZA 2DQUL 4XT1C 5IW6A 2DWDA 4PJIF 4AT6B 3NTCL 4EXKA 1X6NA 2BNQB 3QULA 2A77H 5C0CD 1T03H 3C6SB 2X89A 2Q87A 5E2VL 1AR1C 1T0MB 3O6FA 1PFCA 3BUYB 3ZT7A 4BSVA 1E6OH 1UZ8A 4K07A 4GLRH 4Z9KB 2P44B 3TNMB 5B8CB 4XNMB 3TM6A 4F58H 5KSAC 3FB7B 4WTZA 5C70A 4JFHE 3KLAA 2A6KA 5BW7A 4LPTA 3VCLB 4R96A 4OM0H 4HV8A 1QO3B 4NO2B 4PD4J 1I75A 2OTUA 2YA0A 3VGAB 3RWHA 3WHE1 1R5VB 1MF2L 5BVJA 2WBJD 3VFWA 1N26A 2Z92B 4UNUA 1GJIA 5AAWA 2Q86B 2IPUG 4NRXA 3RVUC 1YUHB 1IJ9A 1PEWA 5DMIH 5BO1H 1LP9B 1BJ1J 2F8XC 2BNRE 1AGFA 4ZO8A 3OG6B 3C08L 1LO0H 3FO1A 4TVPD 1Q9LA 5E8PA 5F71A 3SE9H 2HJFA 1B4RA 1OD9A 3GRWA 1AIFB 5DEFB 1IZJA 1RJCA 1PZUB 2X4QB 3VWKC 1DBML 2XWBA 2PF6A 5E2TH 5E9DB 3TIDA 2B4CH 1MCQA 4RQQB 2Q76B 5CINH 2MCPL 4ZNEE 1E28B 4XX1G 4KI5F 4EI5B 2VZTA 3V0VB 3BZEA 5DK0A 3QI9C 5GGVH 3ARZA 1UACL 4GG6F 3ULVE 5GHWH 3SKMA 2LAGB 5FGRA 5EUKB 3W9DA 4OLEA 1A7QL 1QSFE 2GK0A 4S0TD 2VKXA 4OSUH 1LD9B 4O2EB 3AAZB 1GGCL 2VISB 2CLZA 4P5MA 2LV4A 4ZO7A 3WXWH 1I8MA 3EDJA 4I48B 1BVZA 4JFXA 4W4OC 1QYGH 4FQHB 3MROB 1EAJA 3ULUF 5IVXA 5DWUH 4KWUA 1KIPB 1TVDA 1JCKA 4OCLC 4RNRB 4Z7UF 5GS2D 1QFWH 4P23D 1FE8L 4GW5A 4HJ0D 1D9KB 5D70H 3Q3GA 1FNSH 5FO8B 1IQDA 4UV4H 4Q74A 2A74A 5GRUL 2BC4B 1MREH 2HT2D 5FM5M 1MIEL 1NGZA 4V1DD 2H41A 3S5LG 5HYJB 3SDYL 4JDTH 1RVFL 4H26A 1RZKL 2P7TB 2E9BA 4NQCE 3WN5C 5I74C 2GT9A 2EKJA 3A6BL 3L95A 1YC8A 5CHNB 4HIIB 4U33A 3FB8B 2FJHA 5DD5H 5IHZA 5EC1A 5FUCC 5IOPB 1FGVL 3PWVB 2J8UE 2NX5D 1V3LA 3S4SG 4MDJB 4AK1A 1FN4A 4KTDH 4P48A 4TNWF 3BP7B 2JJVA 4P2RE 3CLFL 3BP6A 1T80A 3VXTA 4PREB 4LVHB 2HN7A 2DIBA 3VGDA 1U3HB 1IC5H 4JY6B 3QFDB 4ZTOL 4NZDA 1G9NC 4Z5RB 4QTIH 5DK3A 4QF1B 4P9HH 3R8BB 1BWWA 4MNQA 3D18B 1OF2A 1H3GA 4U3XA 4YO0B 2DBJA 3OKDA 5LGJB 3HNVL 3WD5L 3ARDB 5KSBB 4ORGB 4KKCC 5D9SA 4XCFL 1WZMA 4WTXA 3QG7H 3JXAA 3VH8B 1CICD 3PNWA 4P99A 5HHOB 4X4XA 3DROA 4WI4A 2V7HA 2VSCA 3BD3A 2OL3H 1OARL 3KYOA 1KJVB 3STLB 1Q8MA 3V7MA 3IRPX 4L4JA 1Z0NA 2BNQD 1Q0XH 2D7PA 5DVMA 3TO4A 1FNLA 3MR9A 2ESVE 2IQ9H 4F3FB 2ZCLH 3KWWB 3MLRL 1FIEA 1KJMA 2FR4A 3GJEB 3KYKL 3MCLH 4RGOL 2VQUA 5E7BA 3OAYH 2DLTA 4NOBA 1EEZB 2OR8A 5ICZB 1JHLL 1QZ1A 4LHUG 1H8OA 3MACL 2W0FA 3VDCA 1CF8L 3C60C 4LLUA 1JNNL 4C56A 3DHMA 25C8H 1DUZB 1P1ZB 5CJQH 5JOEA 3U2SB 2UZXB 4LU5H 2IFGA 4IRSC 1DBAH 2O26U 1BPVA 4FA8A 4Z7WE 1H3WM 3V7AG 5IMOA 3WSQL 3L5WB 2HT3D 4ODTH 1ETZA 3KYNB 1CXEA 3VWJB 2CMRL 1S8DB 3B43A 4RAVB 4Y4FB 4RAUB 1A7OL 1VFBB 5B39B 2APBA 3KPSB 4P46B 2VDNH 1OGTB 4QO1A 2E5EA 2VH5H 5E9DD 5JXEC 4ODUA 3BYTA 5KVFH 1EEUA 2AQ1A 3IDIB 4EI5D 3V4PL 4PRAB 4QHUA 3CD4A 4FQCL 1XH3A 5TH2B 2BXZA 3L3IB 3BKCL 5GSVB 2XKUA 1OVZA 2G9HA 4WGVB 3F5WA 4ZFZA 1FZOA 1YY8A 4HG4J 3M07A 4X8JA 3CU1A 4LAQL 1IT9H 5E2JA 5F1OB 1UZ6F 3GMRB 5C0FB 4BFIA 3P9WB 2ICCA 3U4AA 4RGMB 4M62L 4ETQA 3AU1A 2CIKA 4MVBC 2AVGA 4NQSA 2A6JA 3MSPA 3B3IB 3PV6B 3B4NA 1FFOB 1HWHB 4XVTL 2ED7A 5EB9A 5CEZE 1QG3A 1MFDL 2F58L 4I3SL 4HKZB 3V6OC 2PETA 4AMKL 3FB5B 4XGZA 4Q0XL 3EFDH 5E2WL 1U0QA 2LAAA 3C5ZB 1HZHH 4XVJH 3O0RH 4KKNA 4PPTA 3CX2A 3FKUS 5E4IA 3T0XA 4GW1B 3X3GL 1JPFB 4OZHE 5HYJD 3GIVA 1MLCA 5FYKD 1S7SA 4K3DL 4KVNL 3P0YL 4DVRL 3T2NL 2AXGB 3QISA 1L6XA 5K59E 2IFFL 4TQEL 1TMCB 3WS6C 1XR8B 3GNMH 3DSNA 4PJHB 3H2WA 5GRVL 5INCA 3GGWB 4YK4B 3BYYA 3WEXB 4F57L 2F15A 1N2RA 2I07B 4IIQB 5MEOA 2DD8L 4ISVA 4K2UH 4M8QA 5GISL 4M61B 5I75C 4XPHL 3G5XB 4MJ6B 4LP5A 3H3PH 4WV1A 1YC7A 2EZ0C 2MKWA 1U3HD 5EU6A 4LRIA 3SDXF 3O2WH 3EGSA 3ZSTA 4BQ6A 1CFQB 1IGIH 1SJHB 5GGQH 1QQDB 4JKMA 2ADJA 4Y7MA 5SWZE 1O7SA 3KG5A 3HE6B 4F37F 3ARDD 3QDME 4A2LA 5DQDL 5DFVD 1OCWH 4TRPL 3ULUH 4AEEA 3H9SB 2ZG3A 5BMFL 3KPPA 5AZ2L 1NL0H 3QDGB 5C71A 5HHOD 4GSDL 1X5KA 4R3SA 5ADPH 1W0VA 4LBEB 4EUPG 3SKOB 3Q6FB 5J1SC 3L5XH 2EC8A 1KCSH 1WCBB 5JR1H 4LLWB 5T3ZL 1FDLH 1W0WA 4PRHA 4UZGA 3UBXG 5CJOH 1E0OB 3VW3L 5E56A 3UJJH 4OZGF 4H5SB 2DQJL 1KTLA 1OB1A 1RURL 4CGTA 1N8ZB 1HIML 5F7WC 1RULH 1BD2E 1KYOK 1FGNH 2DWEA 5HY9B 3N1QC 2WUBH 2OX5A 4UIMB 1XGUB 2X7LB 4JM2F 1BQSA 3TFKC 4HUWB 1VACA 1VGKA 1M7DB 1EVUA 3MRCB 1FV1B 4R8WH 3PGDA 3UTPD 3PL6C 3WHE0 4XNYH 3ILPB 1H9VA 1TCRA 1SM3H 3GK8L 3MRMA 1S9YB 1Z3GH 2Y23A 3AY4A 2ERJB 4Y5XA 2XZCL 1CTOA 4HWZB 4ZDHA 4NWTL 3GMMB 4X4YB 2ZG1A 5EG6C 2HJLA 2I5YH 3VWJD 2FWOB 1F58H 1P2CB 1CDCA 2C7UB 4L3CA 3QWOA 4P0DA 4S2SA 4Y4FD 5C9JB 3RU8L 4P46D 5SV3A 3RWGA 4CKVX 1JMZA 4K3JL 5HVHB 3FN9A 4NNYB 3SCMB 3OAZK 1MI5E 4FTVE 1LEIB 4YXLH 2ITCA 1JPGB 5E00B 5L88H 4ZAKB 1XF2A 5FAAA 2X1PA 5JHDE 2J2ZA 1FL5B 3H9YA 5FGBA 3VGEA 4FQ2H 2HG5A 1CN4A 1X4ZA 2M8XA 3TBTA 1DFBL 3NAAL 4TUJA 5T1MB 5IEKB 4F15C 3CK0H 5H35B 3QPQD 3TCLB 2GSIB 1IC4L 4BFGA 1DBBL 3GMQB 4WEBL 4JO3H 4YHPB 3PJSA 2QHRL 3IJHA 4H1LH 5CEXB 2F5BL 1R5IA 3KS0J 4O51B 5FCSH 1T83C 3KDMB 4PJAE 5BRZB 1S7TB 3QAZC 4Z95L 2BSED 5AWNH 1IGFL 5KS9F 3WUWG 2NY6B 1MHHB 4ZYKB 1K6QH 2FDBP 1G7JB 4HMDA 4D8PB 3OR7A 5HGAA 5I15L 4NZTH 5D93C 1OPGH 3BPNC 1TJGH 2I26N 2YPLE 3C5ZD 3MUJA 4XCYA 3ARRA 3P3YA 4HIJB 5MENE 4JPWL 3X11B 4QWWD 3PE9A 3UJIH 4EDXB 2Q3AA 3OR6B 1A3LH 3WKMH 1BQHB 5IKCB 4LVOB 1CDGA 3PXJA 1JNLH 3QRGH 5IESL 1K4CB 1D5IL 3KXFA 4TVPL 1G9ML 5F3HA 4Z78B 4X7TB 5JA8B 3O45B 4J12A 5CUSL 2NZIA 3LQMA 1DQJB 2DTMH 2H32A 1MCPH 4C83B 1GCFA 4GW4B 5GGTA 3QUZA 5HSFA 5GQBA 1JVKA 4KZEL 5MEQB 5HHME 2Z0BA 1LK2B 4L3EA 4DOHB 5C0JB 1ZGLA 1FVDA 1XCQA 2MFNA 4Q9RL 5A1AA 5GZOC 1QNZL 3HC3H 4GAGL 4PRDB 3RWFB 2VLJE 5IVZB 1UWXK 1CGSH 5CZVH 2D7TL 5F7UA 5C09A 3MGAA 2YK1H 3VRIB 1CR9H 1RFDH 5ISZB 3V4UH 3HE6D 5AZEH 1T4KA 4LSTH 3F12B 3AS2A 1LO4L 3X12B 5DYOB 5FF6B 3H9SD 5F9JA 5FYJE 2NXZC 2G2RA 4QOKB 3UROR 3QDGD 2HLAB 5I0ZA 2AJXL 1RHFA 1WTGT 2FCBA 3T0EC 1BAFH 2X4PB 1IM9B 4ZQKB 4PD4K 1FVCA 4WIQA 4BSJA 1BZQK 2ZUQB 3MUHL 3RWCB 1RZJH 5TDOA 4PRIA 3RY5A 4MX7A 3TBSB 2J6EL 1RUAL 4NKQB 4F7EA 5BXFA 2YUZA 1XT5A 5DR5L 3VJ6A 3QQ9D 5JW5B 4X9IA 2WBJA 1FNFA 1IGML 3WFDL 4MA1B 3D39E 1A4KA 3HUJA 3N1GC 4J4PC 1HH9B 1KB5H 4X8XA 4JCMA 1F6LL 1Q9WA 2DAVA 2FJGB 3P9LB 4HPOL 5DJYA 4WY7L 4QYOA 4OZFG 4RIRA 5INDB 2AJUL 5E5MA 3SJVB 3K81A 1HHHB 3JWOC 1V05A 2ARJA 2R9HC 5B38B 2H9GA 4XAKD 1JGLH 5D7LE 2HTLC 3DLQR 3MJ8A 4Z0XB 1LE5A 3OKEB 3D3VA 4NO5A 1HXMA 1SQ2N 3ZYZA 4KHTL 3PDDA 4JREC 2H1PL 5EFIB 2XWTB 3SCMD 5K9KB 1ZTXH 5LAXB 3W0WA 5A2KH 2ZOKA 4HQQL 4HS3B 3UTQB 3H42L 5T3XD 5KSVA 4PB9L 4ZAKD 3X13B 1JBJA 1I9RH 5DURB 2OXHA 5DLML 2W9LA 1FO0B 4JFFA 1ZGLM 4WU5B 5GS1B 3WFCH 4UIKH 3ULVF 1UB5A 3V0WL 2GY5A 1MHCB 1JWMB 3RKDC 4CW1B 4UAOB 2RFXA 1BVLA 1VFUA 2PXYC 2CDFB 4LRNL 1IEAA 1MJ7H 5J4MA 5E5UB 1ORSA 4FMKA 3PHSA 5BRZD 2FLRT 1T1YA 3P77A 3H0TB 3F7PC 5DRZA 2CK0L 2XIDA 1MRFL 4HHAA 2J5LC 2NY6D 4XC1L 2LQRA 4M4RA 5EO1B 2FX7L 1C5DA 4ORZC 1JRHI 3U0WH 1UT9A 2XXCB 4OFKA 2YRZA 3K2MC 3G5ZA 3F7YB 4JFQA 4XTRD 1FYTB 3E6HA 1QPPA 4TUOB 3RAJH 1NDGB 1AXTH 5D7JC 3UJTH 3ZKXC 2BVPB 4QHNA 4R0LC 5FM5O 3P30L 5K9JH 1F3RB 3F58H 1KFAH 1FL3B 1CGTA 4ONGH 1HDMA 5BS0A 5TF0A 5C6WH 2VRAA 4AZ8A 4PJEF 5DI8B 5D7SH 3RBSA 3NN8A 3UBXI 5T1DH 5SV4A 4BUHA 5IQ7H 1P7QB 3OKNB 3G6AB 1YEKH 4HT1L 3MLVL 1CICA 1Q9KA 3BP4B 5F89B 1YPZA 3MRKB 3TP4A 2P1YA 3DVNB 5IT2L 5D7IB 1AGEB 1ZKAA 2QQQA 3SPVA 3GSUB 4HKJA 4WI3A 3E8UH 2ITDB 4O5LL 4YXKH 3WNLA 3U48A 4F9PA 3D0VB 1MQKH 2ZKHH 3BPOC 4XRCB 2BNQA 5ISZD 4YHZH 3C6SA 4OTXL 4X98B 4P3DA 3HI6L 2Y07L 4XMPL 4M1GH 2J88H 3BUYA 4QOKD 4DVBA 4XP9L 1UKQA 3EOAA 2ORBL 4W6YB 1FFRA 2DTSA 5C07A 3DGGB 2JTDA 1GZQB 2V7NA 1RIUH 1YNTA 3G08A 3RY6A 4FG6D 4JFZH 4FQXB 1IM9D 1AGCB 1P4LA 1KCRL 2FL5B 4P2OA 5D5MA 2XG4A 4LSPH 4GMSH 3VXUB 3D25B 3PG2A 1HN1A 1R24A 1M05A 4I18C 4YAQB 5EWIH 1QO3A 4PLKC 1NAMB 3MOBH 4KXZI 5FYKL 5HVGB 1JZ2A 2W9EL 3QNZA 4GG6B 1J87A 1QP1A 4XXDB 1BJMA 2AJVH 3FFCB 3CLEL 3OZ9H 2XY1A 1BJ8A 3T3PE 4KZDH 3HMWH 3NMEA 1H3PL 3EO1A 4PGZA 4FQ1H 3SY0A 3UAJD 3OKOB 3T0DA 2KKQA 1D6EB 1XF1A 4DKFL 4NKDB 3SJVD 5DRWB 3PGCA 3RVXD 4RQQA 4GS7C 5B3JF 5EOTA 2GTZB 1Q0YL 2V5RA 3O4OC 1LGVA 4LARH 1JK8A 1YYLH 2IAMC 2XQYK 2M1KA 1NGXB 1F8TL 2NY5L 1CU4L 4MHHG 5HDQL 1J10A 2R1YB 1KPRB 2Q8AH 5I18H 3U7WL 1DQDH 2XACC 5C7XH 5I1GH 3S34H 3ZE2F 1OP3H 4OB5L 4NQDE 1XGTB 2M26A 4XXCA 4RDQG 3I50L 1G6VK 3DRQB 4HZLB 4JR9H 1KIPA 3EYQD 3ZDZE 2VAAB 4RNRA 5DURD 2JB6A 2VQTA 2X6MA 3HS0A 4L29B 4LKXA 5E8DH 5EIIA 2WUCH 15C8H 3SO5A 1XGRA 3WFBH 5I1CH 4Z77B 1DN0A 4C56E 3IFOA 1P6AB 1RK0B 3EYOA 3X3FH 5D1XA 3GMNA 4Y8DC 1R3KB 4PY7A 4G7VH 5IB1B 4KV5F 1Q94B 2UWEF 1PY9A 1RQ5A 3LIZH 3PHOB 3DMMA 3TO2A 5B4MD 4WI5A 4BH8A 2A38A 3CNKA 4ODSL 3CXHJ 3PWVA 3MUGB 3OMZA 1JHKH 3UPCA 5I0DA 2EYTB 4RWHA 1M6OA 4KGJA 4AENB 2FX8L 3FQXB 3GO1L 5JTWA 5TDNB 4Z7OE 1FYTD 3DPBA 2AEPL 4DUXA 4ZUTB 2IBZX 5E1AA 1N64H 4FFYH 5J13C 4WNQB 4DN3H 4P23C 1A21A 4OZHF 1LO2H 3QFDA 4FQQB 5IGXH 4HJ0C 4Z5RA 2R0WL 5ILTH 1A64A 4M1CC 32C2B 5ACZB 4FQJH 5K59F 1WLHA 4X6CA 3VE0A 2X4NB 4M7KH 3ZL4H 4HBQA 5KSBA 2EIZB 4ORGA 3P0VL 3I84A 4P3WA 1KCVL 1P7QD 2R2BA 3BQUB 5DDHA 3HRZA 3VMPA 2SEBB 4M1DH 3RY4A 5J12B 4HXAL 4X7SL 2DI9A 2YD7A 5FA4A 1I8IB 1IEHA 2FGWH 4ONHB 2XQYG 1RY7B 4UILL 3IYLW 4LHUA 3VFMB 1MY5A 4I0PC 5ETUB 1IC7H 1URLA 3K8LA 4F3FA 4O2CA 4HK0B 1YEHL 4KDWA 2VXUH 4CVZB 2HKHL 3U7YH 3T77A 4MD5A 1EZVY 5HJ3B 3T2QA 4FQXD 2QQNL 4WWKC 4MAYC 4RBPH 1P5UA 4UDTB 1TQCC 2AABL 2FX9L 3AB0B 3ARSA 1FRGH 3VXUD 5HGBB 4LCWA 2VXVL 2GTWA 5GJSH 4OAWA 4KMQA 3T0AA 1FJ1A 5J11C 1NCWH 5DZOA 1X5FA 2PTVA 3DUUB 3ARTA 2AJZB 5AG8A 2D3VA 1S7RB 1U8MB 3FFCD 1QLEL 3WFHB 5I1IH 1GOHA 3KYNA 3SO3B 1OY3B 3QHFL 3UCRA 3ES6A 3ZTJG 1NGWA 4RAVA 4PGEA 4JG0H 1G0YR 5IP4A 3I9GH 1HH6A 1OGTA 4YDVA 4D3CH 4ZUVB 3QUYA 2W9DL 3ILQD 4YGAB 1FCCA 3QWQB 3BRGC 1A6AA 4NDMB 5B8CC 3FOMB 4M7ZC 1RZIB 5TE4L 5FGCE 2CUIA 3IXAA 4JZJB 5TH2A 4OLZL 5DVKA 5GSVA 1UQSA 1M1SA 4FN0A 3HC4H 2NR6C 4JANB 1QFUL 2K1MA 5CLWA 3H7LA 4MB5A 1R0AH 1E4WL 2O5XL 3QXDB 4OM1H 3VGAC 1NGYA 1DDHB 1I1AB 3LAFA 5H2BB 4DGYL 2DLFH 3ZTNH 3CSBA 1B0GB 4JM4L 1LQSR 3B3IA 1T7XA 5EU3A 3OKYA 3PV6A 2X4SA 2C1OB 3AFLA 3IETA 4NKOA 3D9AL 2FO1A 3GI9L 5FKPB 2NY1B 4RGNB 1A7RH 5JPNA 3CSYA 2PO6B 2VNCA 1MH5B 1UXWB 2WQ8A 1XZ0A 5FUZH 4HKXA 5TE7L 4LQFH 2AXFB 3QIBB 4D0DA 3R06B 3OXSB 4YXHL 1DL7H 43CAB 4Y2DC 1OLLA 4NN7B 1NBQA 4K94H 3C5ZA 5JW4N 4MCYB 3MV8B 1JFQL 1QEWB 2ZUYA 1F5WA 3KPNA 4J3TA 4JDVB 4EI5C 1CZ8L 4Z7VF 3SKNA 1TCMA 3V0AC 2H2PD 3GSNH 4POUB 4PJAF 3N1MC 1TFHA 4X6BB 3QUXB 1BGXL 5DD1L 5T5FL 3MJGX 4PJHA 5GRWA 5HHPB 2PW1B 1MWAH 2Q3ZA 4WTWA 3VFTB 1P6FA 2VDML 4P3CL 3KPOB 4IIQA 1OOAA 1L0YA 4G9DA 2JJSA 5DT1L 1KTKE 4M61A 5DGRA 3HZVB 3RDTA 1NUFA 1YMMB 2L4OA 1G7IB 1I8LC 3STBA 2BFVL 2YXMA 1D9KC 1U2CA 2Q8BH 5DC0A 3UBXA 4X6DF 3ARYA 1INQA 3PWJA 1YMHB 2NY2C 1HWGB 3MRFA 4L8DB 4BSWA 3HE6A 3V6OA 3NIDF 2DIJA 4U6TA 4G42A 3BQUD 1ZSDA 4QGYA 1F02I 3T2PA 4KAQH 3I6GB 4BH7B 2YKLH 1ZLVK 4JKWA 5BV7B 1I1YA 1T89C 1RZ8B 4K9EC 3L1OH 2R4SL 4LLWA 3NFPB 1TETH 1GGTA 4OD2A 2EECA 3MBEA 2WZPD 4R7DA 3TIEA 5EUOB 1QTYT 3MA9L 4OGYL 4PGCB 1NEUA 4WRLA 3L3OA 3OGCB 3QR2A 2V2WA 1IEBA 5D1ZC 2BSRA 1FAKT 3DSFL 3MRPA 5IUSA 1PKQB 5HHVL 3O8XA 1U3HC 4UIMA 1XGUA 1TJIH 4H0IA 2H2SD 3KXFE 1M7DA 3NCBB 5DJXA 5DMJB 2PYEA 1SY6A 4PJ7A 4WW2A 4S10A 4YPGB 4WHTB 2I9TB 5JDSB 1LDPL 3K4AA 2ZUXA 2X4RB 4KK8D 1S9YA 1VADA 3OJ2C 4J23A 4NNPL 5EZJB 1H0DB 5SX5H 4L3EE 3HC0A 1OD7A 4IS6A 4HWZA 1JNJA 3U0PB 3T8XB 2MNUA 1KNOB 3CH1B 2VDPH 5EBWA 3T09A 2ZCKL 3RNQA 4X4YA 3K74B 2JIXA 3C8KB 1FNEB 1T2JA 2VKWA 2C7UA 1P2CA 1U8LA 5C9JA 4M48L 4FQLL 4A2MA 4FXLA 5C09E 1RMFL 2X70B 4M7JH 2ZWLT 3BESR 3DX9B 1U91B 5ALCL 4QXGH 3FO9A 4JGMA 3K4DA 3QUMA 4YC2B 1VKXA 1W0YT 3WFZA 3DX7A 5C8JB 5F1NB 3DURB 5E00A 4WDIB 2AJYL 3LH2L 1A5FH 3NGBB 1REIA 3LKRA 5TDPA 3WUWA 1CLOH 3E3QC 3U1SH 5ID1A 1BFVL 1V8HA 5ERWB 2NTFB 3FQRB 1OQOA 4GRLB 4JFYB 4PRIE 1UG9A 1I1AD 4OKVA 3IU3B 4JN2B 4U1HB 1BBDL 5HI5C 1NFDA 4XB7A 1S3KH 4OGXH 1YQVH 3KDMA 2FBOJ 3G5VA 2EDQA 5KVMC 5ITBL 2NY1D 4RGND 5BRZA 4LF3B 2PO6D 1UH2A 5D7KE 1A6WH 1T7VA 2P48B 3LEYL 4P2CG 3QIBD 3VWJC 1MHHA 3HUJE 3LN5A 4AQOA 4Y4FC 1TTGA 3T0WA 2DLGA 4HJJH 3IDYB 2A6DB 3RUGF 1WBXB 2WSKA 3LKQB 4NJ9L 2JB5L 3MCKA 3QCVL 3HCVB 4PJ8B 3MV8D 1FIGL 1Z9OA 5I8KL 4EDXA 2BRRH 1MNUL 3B5GA 3BO8A 5IKCA 4ETYA 1DUYB 2Q7YB 4NIKB 1U3ZA 5I6XB 2H8PB 1K4CA 2QEJA 4BM7A 5EBMA 2BY1A 5HHQB 1QBLL 4XPBL 5FIEA 1MCRA 1DQLL 4PBVC 4PTUB 3OX8B 3QUXD 4BZ1L 3D3VE 2YXFA 4M3KB 3CJJA 4K3HA 4C83A 3QPQC 4RGMC 1JF5A 4KVCL 4ERSH 4P57A 1JV5A 3I6LE 4CBPA 1U8JA 4M9PA 4Y16A 4PJBF 1CGXA 5IFHH 4YDJA 2BSSA 4F7PB 1ES0B 4RWYH 1V3MA 2VLRB 3W0WE 5L0QB 3ETBF 1YMMD 5J3HD 4XPAH 3WE6A 3RWFA 3MJ7B 5BVPH 5I73B 1JGUL 2IBZY 5DUPL 4JFFE 3P4OA 3QO0B 1Y6MR 4XMLH 4J8RB 4HGWB 1ZHNB 1F42A 3O11A 4N1EA 1ZANL 1IAIL 3HR5A 4JFPB 5DYOA 1XGYH 4N90E 4U3CA 2F53E 4OCMC 2UZIH 3TA3B 3QNXA 1EV2E 3RIAK 1ORQA 2G60H 4NUGH 1HOCB 3BGMA 5ESVB 3TJEL 4DCQB 4LIQH 3VXPB 2MWCA 4YZFE 1BIHA 1FO0L 1AGDA 5E99L 4YHIB 1ACYH 1U8HA 4M00A 4ZFOA 2X4PA 4NP4L 4G6KL 1KB9K 2D4DA 2B5IB 4LDEB 2XXMB 4ZUWA 3HLAA 4GRMA 1DQML 1EO8L 2GFBB 3MNVA 5IVXF 2N7BA 1UVQA 3O3EB 1OSPL 1I3RA 1CXHA 4M03A 4MA8L 3JV5A 4OZFA 4NN6B 4HWBH 3G04B 3MV7D 3DO7A 4LSSH 5GGUB 3ZDXE 2VUOA 4DEPC 4LMQE 4JKPL 4LLQB 2IALB 1Y0LB 4D9LH 4DW2H 4I0KA 2JJTC 1T6VN 3TV3L 3VFPA 3M17A 4ONFH 4Z7QE 4HFWB 3LS4H 1NLDL 2BNRB 1EBAA 3LZFL 4DZBA 5KANG 4MQ7A 1R5WB 2YA2A 5BS0E 5JOFB 3IFLL 1MHEB 4LGSB 5FYKU 2BVYA 4P5TB 5MEPB 2BXYA 5DFTA 4ZS7H 1IQWH 5B38A 5BOZG 3GSQB 2JCCF 2K7QA 2QKIB 2I60L 4XPGL 2NY7L 2XTLA 6FABH 4Z76A 5D1QC 5ADOL 2XZAL 4L9LA 4HS8L 4X7EC 4GRWF 2G5BB 1J18A 1QSFB 2OXGA 1NUNB 3AM8C 4JY5L 3T0EA 2DI7A 2CKBB 4OLWL 4PLOB 1Q72L 2JJWA 4LSQL 1S7QA 2FEEL 2RAMA 1T7WA 1EXUA 2ARJQ 3QQ9C 5DHVH 3QQ3B 3WL9B 4ZD3H 3MZGB 1SJXA 5C07E 1AXSB 3U36A 5CCKL 1FO0A 2APTA 3O6LH 4YHOL 5GGRB 4XH2A 3WS3B 1HILB 5D5ME 1J0HA 4GRLD 1LO3L 4B41A 1T2XA 2EEAA 5I1LB 3ROOA 8FABA 3KYMB 2CDFA 1ZLUH 5EN2B 3DV4B 4WENB 1EAPB 1S7XB 3QEUA 1FFNB 5AD0B 1NCBH 3BH9B 4NQCB 1EMTL 4YFLF 1HHGB 3MLWH 4PJ8D 1NAML 5HVHC 4OLVL 4O02H 3SCMC 2J8UB 4PY8I 2HT4D 1QLFA 5GZND 5EO0B 2XFXA 3C87A 1JP5A 1VEPA 3D48R 4P2RB 1B4JH 4ZAKC 5EC2A 3TT3H 3S37H 5F96H 5C3LD 2BMKB 1IGYA 4CNIA 2YEZB 4I5BB 1MIML 3DXAA 2D0HA 4OJFL 4KY1H 2LU4A 5DI8A 4OLXL 3LV3A 1MCIA 3BT2L 4KDTC 3BDYH 3UZQA 1HHJB 4ELME 3V4VL 3SE8L 4O4YL 3FMGL 3G6AA 1I1FB 1MFAL 3GSRB 2D03L 3BP4A 2VLRD 1H3UA 5FHBL 1C16B 4PB0L 1SYVA 3CFJB 2PXYA 1TZIB 2X5PA 2ADIB 4K3EH 3GSUA 4PRNA 1ZS8B 2NY6C 2OP4L 1RJZA 3FQTB 3RWDB 9CGTA 1ZHKA 4W6WB 1D5XB 1F4YL 1B2WH 4U7SA 3TA3D 3U6RB 2ESVB 1G7PB 4NJAH 1YJDL 4MLSA 4XTRC 5TPWH 4YDIH 2Y9RT 4LVOC 2R1WA 1GZQA 3EYFA 4G43B 1NANI 3NVQA 5CILH 3MA7A 1JRHH 3DECA 1JN6B 1GC1L 2BVOA 5HHNA 4JFHD 5K9QG 1BBJA 3AS0A 4KGLA 1ZLSL 1E4KC 3RZCB 4OF3A 4KTEL 4R0LA 3C6LA 3LKNA 2XV6B 3DX6A 1KXTB 4N8VG 2BOBA 3CX5K 4Q58C 3UYRL 3GMPA 4PJ9B 1FORH 3RHWK 4FABL 1T2QL 4EUPH 4X4MA 2NY0B 4UDUB 4XWOD 4ZFGL 4Z7WB 3WIHL 2APXA 3KLHD 3L5JA 1HHIA 4JE4B 2BNRD 2DQCL 2HRLA 3CPLB 1KV3A 2XI9A 1CK0H 5DVOA 4AG4H 4P5TD 4X6CE 4EOWL 2X9XA 4MB3A 2JKXA 4JJHA 1AY1L 2VZUA 5DD0H 5HGDB 4AL8L 1S5HA 2GCYB 4UQ3B 5I1KH 1VGEL 4OCRL 5IJKA 3R0MA 3IDJB 4XHJD 3BJ91 2ZUQC 3ULVD 3WNNA 5JIIA 4R90L 2DQUH 4F33A 1LEKA 1QSFD 4WGWB 2QADB 5IBLD 1KPRA 4HMEA 5T33L 1NGPH 1OT1A 3NTCH 1LNUB 2Z9TA 3SQOL 3QJFB 4EN3C 4NC0B 5LCVL 3MXVL 5E95B 4GUPA 1QPXA 5E2VH 4HIHB 4YDKL 1TQBB 4YBLC 2BVTA 4YFEA 5FUCE 3BKJL 3ZO0A 1BQHG 3V7AE 1RSFA 4O2FB 2IC2A 4PP2B 4N0CC 3SGEI 4RCAA 5L7XL 3WXVL 1DLHA 5HI3D 2NLJA 3ZDYE 1HQ4B 3UAJC 1WISA 4LCWE 3GHEL 1KG0A 4AIZB 1ROWA 3B2UC 2XN9E 3C9NB 4FZEL 3RVXC 3NACL 5C0ND 5LQBL 2X1WL 4S1DD 3VGGA 5DEGB 3DHJA 2CJUL 4OZHB 3MRRB 3Q1SL 1CXIA 1RU9L 3GKWH 4NQCD 4PR5B 4D0CA 1ZA6A 4J3WA 3VXSE 1TTUA 3OAYK 2C9AA 1ZHBB 5IR1A 1S7VA 4KQ4L 2B8OT 4ZUTA 3SBWA 1DBMH 2VWEC 3EYQC 4P2RD 3C5JB 2AEQL 1UJ3B 5CKAA 2MCPH 1EGJL 4L8SB 4GRWH 1WEJH 4WEUD 5GS1C 3HRPA 1UACH 2IQAB 4RFEB 5IG7B 3CDFA 2VC2L 4DKEL 4M93B 2P5WB 1R3LA 2AJ3B 5MHSE 2VZSA 3MODL 1T7YA 5DJ8B 4UAOC 2EIZA 5SWZB 3V52L 1PYWB 1GGCH 4MJ5B 1VFAB 1QRKA 3QDMB 3TBVA 2SEBA 1MHPL 1PQZA 4OZ4A 5IB5A 3FZUC 4TSCL 3JWDL 3T3ME 1LILA 5FO9A 2HFGH 2ZCHH 3RWJB 3QO1B 2BY2A 1VPOL 1FZMA 1AC6A 1P9MC 1YNKH 3ARUA 1F97A 3VFMA 2R69H 2Z31B 5B4MC 2HRPL 3CVHH 4PJFF 4PRPA 3CFCL 3VA2C 4DGVL 1R3HB 1NCCH 3A6CL 4Y5YC 4JLRB 3IRZA 1MCWM 2VXTL 4V2CB 1A7NH 2ESVD 3Q2CA 5KANI 4YIQB 5GRUH 1KJ2H 1QBBA 1MIEH 5D4QA 3IJSB 1ED3B 4U6YA 1BD2B 1H5BA 4MCZA 4UDTA 1F3JA 4YDLB 2W60B 3EO9L 1RVFH 4PBXA 4XWGL 1RZKH 4RRPG 4NC1E 1OWRM 3FAWA 3RZCD 2A2QT 3QH3B 5CSZA 3DX8B 1TITA 4KJQD 1LDSA 2OM5A 3HB3D 5E1HB 4NO3A 1CBVL 3K8MA 3GJFH 4PJ9D 4I8DA 4XAWL 5IK3A 1FGVH 3AUVA 1MCDA 2ZSWB 3O3DB 4U1JA 5FECB 3AGVA 4I3RH 1SEBA 2NY0D 3LMJL 4HUUB 3RA7L 2WIMA 1OLZA 5DUBA 1KIRB 5FO7B 3CLFH 1F4HA 2Y7QB 1EGJA 5F9AC 2Z8WC 1HHKB 3SDDB 4ELKB 3RL2B 3WJJA 4LNVA 4ZTOH 2Q6WA 2A1WL 1U93A 4YBHA 2HKFL 1CD1B 5E8OB 12E8L 3IDGB 3MX0A 3V6OE 1UADC 1U8PB 1J5OL 3WD5H 1A22B 2MHAB 1IRAY 5EBGA 2VN7A 4XCFH 3ELAT 1U3JA 4ODVH 3LKSA 1MI5B 1J05B 4X5WA 1TENA 4FTVB 4FMFA 1A9BA 3OAUH 3RJDA 5C2BH 2DM2A 2CDGB 1RZ7L 4Q7DA 2QADD 4U7MA 1OARH 5JHDB 4WWKA 3VFOA 3NPZB 3O9WB 2ENSA 2P24A 4PJDF 5F9DC 4UTBL 1DDHA 4APQB 4CN6A 1JNHB 2RGSA 4KI5C 3I3DA 3QG6B 5I66B 5BV7L 3UPAA 1KN2L 1YN6A 2HP4A 3TN0B 3HZMB 4YQXH 3MLRH 4I9WE 1EJOL 3MRBB 5DZNA 3VD9A 1AI1L 1RK1B 3MYZA 4RGOH 2IEPA 4Y4KD 2I27N 4PJAB 2IMMA 2EDLA 4C4KT 5CEZD 3C09B 1VENA 4PTTB 1JHLH 3HFML 2FHCA 4IOIB 4NPYA 2IG2L 2PYEE 4PJ7E 3MACH 4KHXL 3ILQC 1CF8H 2YPLB 1JNNH 2HFEB 3EFFA 3ULUC 3ZKSD 4QRQB 2Q1EA 5MENB 3P11L 1L7IL 1ZVSB 4HUXA 5JXAL 1FZKB 1I7UB 1IGTB 3V5HA 3CVIL 4QTHB 5E6IB 4PG9B 1JWUB 3WSQH 2FO4A 1EO7A 1MCOL 3BEVB 1A9EA 4OI9A 4KMTL 1KCKA 2APWA 1UM4H 4MJ2A 3BZ4A 3LKOB 2CMRH 4H0HB 4R2GB 1LO5A 3WO4B 5J1TC 1YJDC 2XTJC 2UYLB 4TNWK 2YPKB 5HHMB 4OV5A 2EC9T 3FT4B 5A40E 2IBBA 4GXUN 1FNGA 3V4PH 5DSCB 1GC1C 4QNPE 2X4OA 1B3JA 5KOVC 4PV9B 4PJXF 3B5HA 2QBWA 2VLJB 3T08A 5HI4D 3OXRA 4MD4A 4L8DA 1J8HA 3I75A 3SGKA 1F6AB 4LAQH 4W81A 3A67H 5K9QI 3DWTA 1U2HA 2H6PA 3QDMD 1RUKH 1T22B 1CLYL 4M62H 1G7HB 5BCAA 3MYJA 1NFDE 4UU9B 1GGBL 2ZSVA 4AIXA 3O3AB 4OD3H 2AI0H 3F6LA 2A73B 1X7QB 3QUKB 3LN4B 3FT2A 2Z31D 3TVMC 1A3RH 2VDKL 5IEHB 2R2EB 4CN1A 3PWLB 4I3SH 1MFDH 1U58A 2F58H 3I2CL 3L9RA 2ZOLB 1HKFA 2Z4QB 5EUOA 1KPVB 4G3YL 4KK5C 1GRWA 2Z91B 4PGCA 5CMAA 4AMKH 3QIUB 3IXTB 2P8PB 4Q0XH 5JNYB 5K33A 5E2WH 1QSZA 1KGCE 1U9KA 3MV7A 5FDYA 4YLQT 4FQIH 1T1XB 2O61A 3J8F7 1BD2D 4GBXB 2Z35B 4PJGA 2FJFB 3S36L 4HPYL 1A6TB 3TBWA 3Q5TA 4K3DH 4KVNH 3P0YH 4YZFF 3D39B 5IHLB 4DVRH 3LQAL 3CCHA 3O41B 4LLVA 3T2NH 2IFFH 1NJ9B 4TQEH 1EHNA 1I7RA 3RWIB 4RMWA 5F7NC 4YPGA 5FM4A 4UT7L 4WHTA 4LGRB 4D94A 4BKLA 3BQUC 4OFYA 3ULSA 2OK0L 3VFGL 4F57H 1E4XL 1UXSA 4GKOA 4MSWA 4QRPA 5IMMB 2IH1B 2DD8H 5LXGL 5D7LB 4XPHH 2NNAB 3SDDD 3QA3A 1FNEA 2ATPB 3SE3C 2Y06L 4LPXA 3L5IA 4IMLA 1PG7L 3HAEH 2DWDB 3KAAA 4WFFE 3HN3A 2PYFA 1NBZA 4OCWH 4A6YA 2W07A 3OTTA 4JO2L 4TRPH 5BMFH 4M6NL 3EJYD 4BSVB 1MCNA 1MI5D 5AZ2H 4FTVD 3NIGE 4BFEA 2H2SC 1X3DA 3MLYH 1YPZF 4MB4A 4UINL 5JHDD 2B1AL 4NBZB 5T3ZH 3O9WD 4HJGA 2X1QA 2GAZA 3VW3H 4APQD 2A6KB 4R96B 4KK8C 5F88A 2DQJH 2BK8A 1RURH 4U3HA 4DTGL 3DVGA 4G5ZL 2KH2B 3TN0D 4HV8B 5CIPH 2OTUB 1U95B 3ZE0E 3RGVC 4N9GA 5I1JL 1HI6B 1HIMH 4HBCL 4OT1L 5BVJB 4QT5A 3SO3C 1PKOA 3HMXA 4MA7L 4R4FL 1NGQL 2EDFA 4HCRA 1AGFB 2YA1A 3MBXL 4E42A 2A6DA 2Z8SA 3FO1B 1Q9LB 1KJ3H 4F7CA 4PJ8A 5E8PB 5T5NF 5MI0B 2HJFB 2EE3A 5EDXA 2YPLD 2OZ4A 3VGHA 3V79C 2R4RL 5MEND 1ZLWH 1NKOA 5BZDB 1CD0A 3NZHL 4JZJC 3TPKA 1ZVHA 2XWBB 1G84A 1F11A 2BNUA 1A7PL 1EH9A 3QEGL 3KYAA 3QP3A 5A2FA 5E6ID 3EYVB 3T1FA 4LCUA 4DFIA 4UI2A 4ZXBC 3BZEB 5DK0B 1PDKA 3EBAA 4I77L 4C57C 4NWTH 1W72A 3SKMB 3W9DB 1LP9F 1RZJC 3MO1A 2GK0B 4M6ML 3T0EE 4R2GD 1PSKL 4O58L 3RQ3A 1NH6A 1FL6B 3DI2B 4MGXA 2CLZB 3BDXA 4P5MB 5HHMD 4HC1L 4MDIA 1A6PA 4K3JH 4KUZL 1I8MB 1NDMB 3ZZ1A 2NY1C 4JFXB 3QNYA 3QHZL 2DBLL 4BZ2H 1NCDL 3H6JA 3QIBC 3S35L 2VLJD 4LDLB 4NT6A 2CKBL 5M95B 4HGWA 1ZHNA 4S1QH 4MNGA 1F00I 1K8IB 4MA3B 5KZCB 4NC2B 4GW5B 3R1GL 4KH2A 4DWHA 1RHHA 5IROA 2DYPB 5FCUL 1DFBH 1OAQL 3Q3GB 1B0RA 4F37K 5FYJD 5A2LH 1IC4H 1NMCC 1DBBH 4DCQA 2YUVA 3QYCA 4WEBH 2CUHA 2F5BH 2Q20A 4AEIH 1CCZA 1ZHLA 2CD0A 1MFEH 1IAII 2XZZA 3QUXC 4H26B 4NM8L 1IAMA 3FB6A 3WIIL 2GT9B 2R0ZL 3O3EA 4X80H 4F9LA 4TTDC 2IBGA 1UYWL 5IMKB 4HAFA 3MLSL 3QIUD 5I15H 2FJHB 3MJ9H 2NYYD 5EC1B 4HZAA 5HYFA 2LFGA 4JPWH 1FN4B 2IALA 3Q48A 4GBXD 3KVQA 4NQVB 4G8EA 1GAFL 3BP6B 3MTRA 4YHYC 1MY7A 3VXTB 4HIEB 1R6VA 2IH3A 2QL1A 3D39D 3U4BL 2HN7B 1LK3H 1D5IH 4IBLT 4HWNA 1G9MH 3DJ9A 3DXAE 2CRIA 2E7LC 4K7PL 3QXTA 1F4WL 4P5TA 1KIUA 5MEPA 3LHPH 2YD9A 2VDOL 1OF2B 2APVA 1NAKH 4KPHL 5JZ7C 1TZHA 3MV01 5BV7C 3OKDB 2KQNA 4ZPTA 3NFNA 3T0VA 5D7LD 2VQ1A 1KOAA 3PNWB 4X4XB 1WWAX 3DROB 4Q9RH 4XBEL 1WZ1L 2V7HB 4PLJD 3EJZD 1DBJL 1QSFA 1QSEA 4GAGH 1QRNE 1CGWA 1SMOA 4K23L 1BP3B 3V8CA 3KYOB 4CADA 3TT1L 1YEFL 5TJWK 4L4TA 3TO4B 3MR9B 2X89D 2G5RA 1YEIL 3B9DA 3RVTD 3RTQB 2L7JA 4NQDB 3MRJA 3ARWA 3IDXL 5KSBF 2HA1A 3L3JB 1U8IB 4HMCA 4LP4A 2FR4B 1MAJA 4OIIL 5CJXC 1I1RA 3WDJA 2OSLA 5EIQA 3MRDB 3ZTJH 5GS2H 2C3GA 4WUKL 5F7HA 2DJUA 1AD0A 4OFIA 3LDBB 4LLUB 2J6EH 2A77L 4C56B 3E2HC 5F7FA 5DR5H 2OI9B 3GBLA 4X4ME 1ND0A 5F7LB 1C1EL 3BAEL 1EUTA 3LSOA 5AD0A 4C59B 5IMOB 4JJ5A 1A1MA 4NQCA 2IPKA 1FBIL 4X9GA 1B0WA 3WFDH 3ZSSA 4G6MH 1HHGA 4JQXC 1ETZB 5D1QA 4U31A 3FTGA 3D69A 3KJ6H 5JW4Q 3IU4L 4XI5D 1G6RA 3QIWC 4HPOH 4WY7H 4YC2C 5EO0A 3IDNA 2AJUH 3LD8B 4ODUB 1HNGA 3U9UA 3NGBC 3TBYA 4QHUB 5FHAL 3FRPG 2YEZA 1XH3B 1NMBL 2B39A 5BO1L 5DMIL 2VDRL 5CBEA 4U0RC 4GRLC 2G9HB 3F5WB 3LKPB 2X41A 1MCEA 4ZFZB 2B20A 1FZOB 1YY8B 4NFCA 2V5SA 5TQ0L 3SE9L 4Z7NE 4X8JB 2FSEB 1UKSA 4KHTH 4BFIB 3CGTA 4ETQB 1BZ7A 1Q1JH 3AU1B 4ZSOE 2CIKB 1SHMA 4ZPVA 4NQSB 2K3TA 2MSPA 1TZIA 2ADIA 5E8EA 3H42H 3K1DA 1DVFA 3T1WA 4ALAL 5DLMH 5KOMC 5KZCD 4LSUL 4HWEL 2V9TA 1D5XA 2DYPD 4N8VA 1XCTA 4OSUL 3V0WH 4XGZB 5D71H 3SHSA 2LVEA 4G43A 4EIGB 3WXWL 1ZVYA 4LRNH 4RSVA 3SDAA 4L1DA 3PDOA 1QYGL 1R3JB 2DDQL 3GIVB 3RVVD 1MLCB 4IMKC 1S7SB 4AY0A 4P9MH 5CEZL 2LTQB 5GSRA 5D2LA 2CK0H 3RZCA 5T1KA 1QFWL 1MRFH 2YWYA 4XC1H 4HUKB 5JA9A 5TE6L 1XF5B 5D70L 4PJ9A 5INCB 2WINA 5EIVA 2DQFA 3G6DL 1N2RB 4UDUA 1QVOA 2VDQL 2CH8A 4UBDD 5MEOB 3OPZL 5DC4B 2DMKA 4ISVB 4M8QB 5I73C 3JUZA 4JDTL 4WV1B 4KQ3H 1EEQA 3EGSB 1W8NA 4GT7A 3G6JA 3TA3C 3AVEA 2BHUA 3VI4F 1HEZA 3Q0HA 5E2UL 1GOFA 3ZE1E 4UQ3A 4PJHF 3QEQA 1HINH 4IRJC 1L6ZA 2NY4B 4FZ8H 4HT1H 4ODHH 2BX5A 3KPPB 2B5IC 5FGCB 4R3SB 2WLYA 1W0VB 1PD6A 5C3TA 4XPTL 1ZV5A 4PV8A 1IC5L 4XZUB 3EOBA 4PRPE 1W0WB 5LGHH 3C2AL 3U4EA 2ZUSA 4GG8A 4PRBA 4QTIL 4NN6C 5E03A 4YR6A 3TO4D 4DGIL 4Z6AT 4OTXH 3HI6H 1OB1B 2Y07H 2EH7H 3RTQD 4NQDD 4XMPH 4KRPB 5GPRA 4XWOC 1NEZG 1G7QA 4XP9H 3L7EA 2ORBH 1K2DA 3FO0H 4QHKI 3D2UD 3KLHC 5E6ZA 3T4YA 4FFZL 1MJJA 3V6FA 2DWEB 4Y4KA 3ZHLA 1IFHL 1A1OA 1XGQA 4EXPX 2AW2A 5DQJA 1VGKB 2EXWC 5DD6A 1TNMA 5IB4A 5H94A 4AIZA 3C9NA 4LCIL 1CFTA 1Q0XL 3PGDB 3ZT5A 4C56D 2ZNWA 4QXTA 2IQ9L 4YH6A 3WDIA 3V8OA 1TCRB 4QRRA 1J88A 5DJ2A 1MCBA 3MRRA 3I02A 5FYKH 3ULVC 4QXWA 1AO7D 4PR5A 4U2YA 3LVEA 4K9EH 4ZDHB 3FOLA 3O3BA 5IBLC 4OF5A 2DLEA 1MAKA 3B9KD 4JPVH 4RBPK 4KJPD 2HJLB 1AQDB 3PQYE 5EULV 1UENA 4L3CB 3QWOB 4S2SB 1U41A 1CTNA 1ADQL 4X6FA 1HYSD 4GKSA 4PJ7F 3RWGB 4EN3A 25C8L 5CGTA 5CJQL 4NZRH 4C4KO 4L4VE 3P4NA 4CAGA 4LU5L 5CLTA 3DYPA 1DBAL 2BVEA 1Q0YH 2ITCB 4WCYH 5HI3C 5D6DC 3MRIA 3BHBA 1XF2B 5IVOA 5B3NA 1CU4H 1RPQA 1I9IH 2HG5B 1PYWA 1SBBA 3TBTB 4TUJB 5HPOA 4ZUUA 3U7WH 5C0NC 2XICA 3SGEH 2GJZA 4S1DC 4OB5H 2EO1A 1V3KA 1ZT1A 2VH5L 4Y1AA 1F4XH 4N5ED 3PJSB 4L8BA 3IJHB 1R5IB 1T1WB 3HTLX 2Z31A 2KDGA 3ISWA 4G9FA 4QNPF 1R3HA 1IARB 2OL3A 2C1PB 1J1OL 1NCAL 3OR7B 4HGMA 4JHZA 1UCBH 5HGAB 3JTTB 3BD5A 3BRFA 2KUTA 4B0MM 4LPVA 1T5WA 5BOPA 3IS0X 4WO4C 4OFVA 4GJTB 5A16A 2J3SA 1XIWA 1EHXA 4DQOL 1P7HL 4QCIA 2CIIB 3DIFB 1I3UA 4OF0A 2EYRB 3QH3A 3MFFA 3KXFB 4JZNA 4MQXD 5F3HB 2E9WA 4Z0BL 2YMXL 2V6HA 1AJ7H 4LSRL 4ODSH 3JVGC 2H32B 1QFWM 3O3DA 4BQ9A 3EFDL 3RRQA 2E6PA 3RZWA 4UTAL 3QUZB 4XVJL 3FL7A 2FX8H 3GO1H 2PKDA 1X5ZA 3MLTA 2AEPH 4L3EB 2Y7QA 5AUMA 1KLGA 1CDYA 1ZGLB 3RL2A 1XCQB 2QTEA 3QPXL 2PW2A 3HR6A 2MPAL 3QXAA 4MXWL 1YN7A 4MZ2A 1SVZA 2R0WH 4LASH 1KACB 3CU7A 1J8HE 5C09B 5CJ8A 3IDGA 3MLZL 3UZVB 1U8PA 1M4KA 1T4KB 3P0VH 4TPRH 5DJCA 4Y5YA 4YPJA 4HAGA 1ZOXA 5F9JB 2IGFL 2NY4D 2ZUWA 3L3GA 1J05A 2G2RB 1V3JA 4IRZL 4HXAH 5EBLA 1KC5L 5EU4A 5KTEH 1X5LA 1J0JA 3H3PL 5I16A 1CFVL 4OGAD 4HD9A 4PJIA 5JHDA 3WKNA 3O9WA 4XMKH 4KJQC 5BJTB 4ACPA 3W81A 3HB3C 3P9MA 4Y5VC 1JNHA 5TDOB 3WIFB 4PRIB 5I66A 5FYJL 4MX7B 2DQTL 2NY0C 4KRPD 3TN0A 1MQ8A 4F7EB 5BXFB 1UM5L 1OCWL 2X9WA 3VJ6B 2NXYB 2XWJA 3MRBA 2ED9A 1WFNA 2HKHH 1NL0L 3UYPA 1CXFA 4YBQD 1DQQA 5ADPL 1E6JL 4PJGE 2QQNH 2A9MH 1KCSL 1OTUD 1NQBA 3N1PC 2AV1B 1A4KB 5JR1L 1AXIB 3HUJB 1A8JH 2AABH 4UUJB 1G9EA 1AKJA 3HI1A 1FDLL 1KYOJ 5KJRL 5CJOL 2EKSA 2VXVH 3UJJL 3RPIA 2J8HA 2BY3A 4M6AA 1EERB 4QRQA 4O00A 1I85C 5MENA 1PAMA 3CSGA 4QYOB 4DN4L 4RIRB 2NTSP 3DV6A 4LVEA 5E5MB 2HLFC 4QRPE 1BWMA 2ARJB 2PN5A 2H9GB 3WNMA 3EHBD 5A2IH 1SBSH 2IANA 3MJ8B 4KROC 1QLEH 2QADC 1OAUH 1LE5B 3RI5F 3QHFH 4JFDE 3D3VB 3V2AR 5LKNA 4NO5B 3IJYA 1HXMB 1KENH 1XR9B 4GH7B 3SE4C 4R8WL 5JO5A 1BOGA 2GK2A 4CMHB 1TQBC 5IIEA 2XRAH 3K80A 5HYQB 1FAIH 3ALWA 5A43C 5GS0D 1SM3L 3F6IA 2E7HA 1JGVL 1K4DB 1OAYH 1Z3GL 3W0WB 4LKCA 2ZOKB 4YHNA 5TE4H 2ADFH 2XY2A 5SX5K 5KSVB 2BVUA 3L7FA 4OLZH 5MP6H 5IWLC 3ZLQC 3K4ZA 4JFFB 4KJWD 1QFUH 1YY9D 1IAKA 2X40A 3RL1A 4M6OH 2O5XH 4JHBA 1UB5B 5F7YC 1TDQA 3HPLA 4KKBD 1T22A 2F53B 1G7HA 3QJHA 4DGYH 2RFXB 3O3AA 1BVLB 5EZLA 3VXNA 1UB6A 4G8IA 1X7QA 4U7KA 1IEAB 1U6AL 4XP6L 1JHTA 4Z7UA 1ORSB 4NO0B 3JV4A 3D9AH 3GI9H 5IEHA 1JE6A 2R2EA 5L88L 5DRZB 5TE7H 5CEYA 2Z4QA 1JUFA 4YXHH 2Z91A 4TNVF 5FFLA 2NMSA 4F7MB 1X4YA 4NKMB 5GRXG 3WDHA 1C5DB 3L3DB 3QDJE 4LLMA 3BKML 3BN3B 4FXGA 1WIPA 1UJ3C 4NN5B 3DTXB 3RWEB 4L8SC 2PR4H 3S97C 4JFQB 4X7DC 3E6HB 1CZ8H 4S11A 2GI7A 2EDNA 4QHNB 3KXFD 1I8KB 5HI4C 5TFSL 3MCG1 1C08A 3MV9A 1FNHA 1BGXH 5T5FH 4YHML 3KR3H 5BS0B 3UPRA 3MXWL 4JHWH 5KVDL 4NZTL 2F54D 3NN8B 2FHFA 3E3QE 3VXMA 3QUZD 2VDMH 3H3BC 2JJUA 1G0XA 1UWEL 4L3ED 5DT1H 3SGDI 1E27A 2GJ6A 1EHAA 2NNAA 5KN5A 1QBAA 3O3UN 1Q9KB 2AGJH 4OI8A 1M7XA 3SPVB 2BFVH 4HKJB 3KPRA 2W38A 4MNGE 5D2NA 5C09D 3TVMA 1IL1A 4P3DB 2AXHA 2EEDA 1AHWB 5BZWA 4DVBB 3EOAB 4GKNA 3TNNA 2WBKA 5I1AA 5C07B 5T3XH 4POYA 2V7NB 1WT5A 4G7YL 1YNTB 4G8GA 4OZIA 3G08B 3WO3B 1VFOA 5I30L 2IADA 2R4SH 1J1XL 4M43L 5I8CA 3HC3L 1OGAA 5I9QB 1P4LB 3VFRA 5D7IF 3U9PH 1WBZA 4P2OB 5D5MB 5FOBA 1N5AB 5EORL 5ACMA 3WHXA 4PRID 2YK1L 1CR9L 4JQVA 1R24B 1M05B 3V4UL 1I4FA 3MA9H 4PJ5A 4OGYH 4HEME 1U95A 3U30B 2NXYD 1HI6A 1QHPA 4MAUL 2VLKA 1OAKH 2YUWA 3SDDC 2E8YA 3CFKA 3MRQA 4H1LA 3QNZB 5HHVH 5D7KD 4JKLA 1GOGA 3RX8A 5DA4A 4OD1L 1BAFL 2WK2A 5CSBA 5GGVY 3EO1B 3SY0B 5FOJA 4X4ZA 3EYSL 2HMID 3P4MA 1LDPH 5BZDA 3S3JA 3AMKA 4NYLA 3ROLA 4I2XA 5I76A 4NNPH 3PGCB 5FYLE 4TUKL 4XCNA 1J0YA 1N5YH 3EYVA 5E0QA 5EOTB 4YHLH 4S1RL 2ZCKH 1JK8B 1KIQA 1QSEE 3WLWC 3D3VD 4APQC 1ZWIA 4M48H 4FQLH 4QXUL 1RMFH 1AH1A 1FL6A 4BQBA 4L4TE 3PHQA 2VO5A 4ELMB 1WJ3A 3WBDA 3ZYOA 3I6LD 3STZA 5ALCH 1PVHA 1NDMA 2C4FT 3AROA 3W0WD 3UTSE 1FLTX 3BZFB 3AXLA 1CXKA 3C09C 1NC4A 2N7AA 3LH2H 1K8IA 1IBGL 4JFFD 4MA3A 2Z8RA 2R39A 2JB6B 4R4NC 3HS0B 4LKXB 5EIIB 1AC0A 3SN6N 2DIAA 1XGRB 2DYPA 1KELL 4N90D 2F53D 3S4SB 1DN0B 2WQRA 3IFOB 1BBDH 1BM3L 1G7LA 3AC0A 1KLUA 3EYOB 5D1XB 1DBKL 3GMNB 4YWGL 5E6IC 2UZYB 2MJWA 4NO0D 4PY7B 3VXOA 5HVWA 1I9RL 2MQ0A 3DMMB 4P4KA 3TO2B 4R2GC 2FNBA 5IMKA 2GIYA 1T21B 4XCCH 4ZXBA 3MUY1 4BH8B 3WO4C 2JB5H 3QCVH 4HS6B 4FP8L 3BGAA 2VYRE 3O6KH 3ZKND 1FIGH 1M6OB 1LEGA 4NQVA 5I8KH 4PG2C 4XP5L 1I9JH 5KSUA 3OG4B 3KJ4C 4DK3A 1ZLUK 1DSFH 3LRSA 4HIEA 5E1AB 3Q5OA 5KVEL 1XMWA 2A6IA 1QHOA 1AE6L 5GJTL 4R6UA 1DQLH 1GPOH 5BS0D 4RAHA 1J11A 5ANMA 1KB5A 2Z93A 3PABA 1RAMA 4X6CB 3VE0B 5IQ9A 4ZOBA 4KVCH 4LVNB 2DLIA 5ICXA 3HE7A 3SDCC 2R2BB 5DDHB 1FH5L 3HRZB 1BECA 4XVUC 2OTWA 1N7MH 4NZJA 2XPGA 3SDXA 5FA4B 3RAJL 3K2UH 1JGUH 5DUPH 4YJZL 4LHUB 3QIUC 4W4NA 3BE1H 1CLZH 2F74A 2AK4A 1ZANH 5D7SL 1IAIH 4O2CB 3RTQA 4HX1A 4NQDA 1A14L 5C0AE 4GBXC 5ESAA 5T1DL 4X9FA 3VGFA 5IQ7L 3L3JA 3ZE1F 3D2UA 1FFPA 1U8IA 5C07D 1GZPA 3TJEH 2VAJA 1JIBA 4CU6A 3MRDA 5E6YA 3T77B 4MD5B 3S96A 3QCTL 5E99H 3N85L 2XA3A 4NP4H 5D2LE 1DQMH 1EO8H 4OZGA 4P2OD 4ZO9A 1JWSA 4LCWB 1MQKL 1MJUL 2BDNL 2GTWB 1FFQA 1OSPH 1BJ1H 1EEYA 4OAWB 2XN9B 1UEYA 4MA8H 1FJ1B 3KNBA 1MELA 3MREA 4M1GL 5DO2C 1F45A 1YEEH 4EJ1C 4LAJH 1CDIA 1AO7A 3EJZC 3FRPA 4JM2A 4O9HL 4JFZL 2R2HA 3TV3H 1KPUA 5FKAA 5I1DA 2CR3A 3LZFH 3B9KA 3ES6B 1FC2D 4U6XA 4NQTA 4BFBD 1NGWB 3G6JE 4YFDB 4PGEB 1WAAE 3IFLH 4LSPL 4GMSL 3FAXA 1S7UA 4CMMB 4WWID 5J56B 4U1IB 2V9RA 3O6FC 1HH6B 4MS8D 2C3VB 4YDVB 3QUYB 3QEQE 3JTSA 2VLLB 5IM7A 1K85A 1A6AB 2FEDC 4UB0L 4MWFA 5DMYA 1JI2A 2I60H 4XPGH 2NY7H 3IXAB 5DJ0A 3CMGA 2WAHA 1CT8B 5ADOH 1AD9A 2XZAH 1UQSB 3OZ9L 1CL7L 2C3WA 4HUVA 3O4LA 4HS8H 3LKPA 4LPUA 5BW7C 3VXRA 2ZZUT 3FT3B 3UC0L 3HMWL 2FSEA 3TZVC 1AFVL 4OKDA 2ENYA 4LFHD 1RUPL 1KN4L 1OHQA 1NGYB 2YRPA 1MRDL 5DJAA 1BX2A 5HDLA 2W65A 1PBYA 3C60B 4HKBA 1DLFL 5EU3B 1DE4B 3RP1A 2BOCA 2X4SB 3IETB 4E41A 4NKOB 5JPMA 1Y6NR 5CCKH 3K1KC 5JPNB 3CSYB 4YHOH 5A3IC 1ZEAL 3D85A 4F8TA 4LARL 1XZ0B 1YYLL 4HKXB 3IFNH 4D0DB 3S98A 1C5CH 1VESA 2R0KH 3QQ4A 3FN0L 2VXSL 4LEOA 3BH8B 4TULL 4QRRE 5D1XD 3U82B 3KPNB 4OCSL 5DMKA 4LK4A 3MLXL 1R3JA 4JDZA 3UYOD 4JR9L 5HYSG 4CVWA 3W9EA 3SKNB 1CGUA 1C8PA 5KS9A 3DMMD 4DFHA 1T1ZA 4FNLH 2WUCL 15C8L 7FABH 1XF5A 4U1KA 4AH2A 1NAMH 3U46B 1RUQH 2X1OA 4OLVH 4K8RD 3D0LA 1JPTL 3JUYA 3TJHC 4G9DB 4UOW0 2NW2A 5J6GB 3RDTB 2GHWB 4EUPB 1MIMH 4WTZG 3UBXB 1T66D 1QSVA 4UT9L 4Q9QL 4OJFH 5ABDE 1INQB 3PWJB 4OLXH 4U05A 3IVKA 3UMTA 3EDEA 3MRFB 3BT2H 2VL5A 4BSWB 2FECI 3V4VH 3SE8H 5CFHA 4O4YH 5GS0L 3QDHA 3ARGA 1JF1A 4G42B 1NEZA 1ZSDB 2GUOA 2QQLL 2EIEA 4Y1AE 2D03H 3BISA 35C8H 5FHBH 3BPLB 1TVBB 2OJEA 4PB0H 3BIBX 1B9ZA 4ENEC 1I1YB 4FFYL 4DN3L 1YEJH 3OJDA 3HI5L 3CFDA 2OP4H 1LO2L 2EDBA 4XZUA 4LHUD 4G9FE 4OD2B 1S9KC 4ONOA 1K9TA 3MBEB 5EO9B 4FQJL 4R7DB 1F4YH 4M7KL 3TIEB 4PGDA 5I8EA 1YJDH 3L3OB 3ZKQD 2V2WB 1IEBB 2K7PA 2BSRB 1S5IL 3MRPB 1B6UA 3O8XB 2VWEE 1GC1H 3ALPA 5GRJL 4BQCA 2DRUA 5FYJU 3FO2A 2B0SL 1FVEA 2ICWI 2EIBA 5I75B 1UFUA 4PS4H 5DJXB 2DF3A 1PG7X 2ZG2A 1YECH 4KTEH 4LCWD 3NIFE 4OFDA 1IC7L 2PYEB 4OQTH 4WW2B 3O2VL 4PJ7B 2XN9D 3NFSL 5EZOL 2R1XA 4NCDA 3E6FB 3NA4A 3UYRH 1QR4A 3OGOE 5DTFB 4FABH 5EUOF 3BI9X 3H9ZA 1T2QH 1VADB 4I3GA 1P4IH 3HC0B 5C6TL 4KKCD 4IS6B 2CRMA 3P2TA 4ZFGH 1SVCP 3WIHH 4JY4A 5EBWB 3MOAL 5HDBE 3RNQB 5CGYC 4JZOA 2JIXB 3VXSD 4MXVF 1AQDA 1EJ6A 1U8LB 5HGHA 4K71C 1I9EA 5GGTL 4FXKA 4LPCA 5GJSL 3AREC 2VZ1A 3QUYD 1AY1H 3GZKA 4AL8H 3FO9B 3GJFK 1VGEH 4PY8J 3QUMB 4G80A 4NQUA 1VKXB 4U6HB 5HDOA 1F90L 3DX7B 4WI7A 1GHFH 3GHBH 3TWCL 3GBNL 3UTOA 5IB3A 2P42B 4NQEA 1RZKC 1Z9MA 1FPTH 3LKRB 4PJIE 4TOYL 5TDPB 3H8NA 2C4FU 3WUWB 5MHSD 1QLRA 3CFEA 3LDBC 1HXYA 5ID1B 2VZVA 1OTTD 4N8CL 5M94B 4JG0L 3SQOH 3G5YA 2J8OA 3CH8A 3S88L 5ESQA 4OKVB 4LGPB 5I8OL 4D3CL 2RBLA 2CLRA 3C60D 5I19L 4YDKH 1NFDB 1T1WA 2LU3A 4ODWA 3G5VB 3HHRB 3LS5L 3PIQA 1A0QL 3WLBA 2YD3A 5L7XH 2BCKB 2C1PA 3HC4L 4KJPC 3LN5B 3WXVH 5IV2A 1HK6A 4HUMB 3JTTA 1R0AL 3MCKB 3GHEH 5IF0A 4AEHL 4OM1L 3WYRA 3QFJD 1PEZA 3WNOA 4FZEH 4D0BB 5J89A 3VG0H 1L7TL 3NACH 5LQBH 4FFWD 4I1NB 5IB2A 5JOPE 3BO8B 2CIIA 2CJUH 3DIFA 4JG1H 3BEWB 2EYRA 2P8LB 2IANE 4WU7A 1A7RL 4POZD 5EBMB 1RU9H 2XKSA 4BJLA 4E5XA 1V7NL 5GXBB 1NFKA 4W68A 3NCFB 5E4EB 3VU2A 4HH9A 1DL7L 5F8QC 2F54A 3BFOA 5F1SA 4P57B 4EI6A 4RZCA 4ZMAT 1JV5B 4N5EC 4HLZG 5JMRA 2AP2A 1U8JB 2AKRA 4Y16B 1P5VA 4KI5E 2BSSB 3QBTB 4YDJB 3RDTD 1EGJH 4LLDA 3MNZA 1H8NA 3FQUA 2CR6A 3WE6B 4HF5H 2DM4A 4J3SA 4Y4HA 3P4OB 1ZA3A 4YE4L 4KFZC 4PJEA 4XNUL 3BPCB 3O11B 1RD6A 3V52H 4JVWA 3GSVA 4X0KA 3HR5B 1X9QA 4N0RA 1Q9OA 3QNXB 1VHPA 1ORQB 1BMGA 1MHPH 3ARQA 5D93B 3T0BA 3JWDH 3BPNB 3BGMB 2FZ3A 2DQIL 3SEPA 3ULUE 1OP5H 1A7BA 4WO4A 1VPOH 4Z7UE 1AGDB 1H15A 4G6JL 4E0RA 4P4RA 1U8HB 4MQXC 4ZFOB 4DZ8A 5BJTA 3MMEB 4XVSH 2HRPH 3HLAB 4GRMB 4ZUWB 3MNVB 3MBED 1FSKC 3CFCH 3WIFA 4DGVH 1UVQB 2R23A 3A6CH 3JWNC 1I3RB 2VXTH 1EPFA 2V17H 3DETC 4WJ5A 4OZFB 2PUQT 5JIPA 3JVGA 1EK3A 3LEVL 4KAQL 3DO7B 5I71B 4I9WD 5LWYL 3PWPA 2XTJE 3O8XD 2UUDH 5F7EL 1INEH 1GXEA 4LRIC 3VFPB 2AV1A 3M17B 4UUJA 5DVLA 3VMNA 4PLNC 5JQ6H 4TSAL 3RVWC 4DZBB 3GB7A 4MQ7B 3MV9E 2PYED 4NKIH 4WI8A 5LBSH 1CBVH 3AS1A 2NY4C 2OTPA 4XAWH 5IFAL 3VXME 2JELL 3R8QA 1WVZA 5HYEA 3EOTL 3LMJH 5D6CA 5F93C 1L4IA 4JPKH 2GJ6E 2H45A 4OGAC 1T04A 4Z76B 1HE7A 1DCLA 1LVEA 2B2XL 2JIXD 4L9LB 3KPRE 4Y0GA 2COQA 2R0LL 1XR9A 3GSNA 3ARFC 5D2NE 2A1WH 3T0EB 3Q6GL 2HKFH 12E8H 5HYQA 2XQBH 1S7QB 3KLDA 1MWAA 1EXUB 2NQCA 5EU5A 2KQMA 2OBGA 1K4DA 1ZXQA 2KL6A 5GRVK 4YBQC 2OR9L 1QBMH 2ICEA 3CMOL 1NLBL 4G8GE 4OZIE 1UH3A 3IGAA 3U36B 1OTUC 1NCUA 5IHUL 1RZ7H 1OGAE 5JW3H 4XH2B 3C8HA 5TQ2L 3ECBB 2FB4L 4QRTB 5DUML 1O0VA 4MD0A 4BYHA 2F53A 4UTBH 3HG1E 3ROOB 3HNSL 4PJ5E 8FABB 1TJHH 2VXQL 2VN4A 3AY4C 4QXGL 4Y5XC 5BV7H 5J6HA 2VLKE 3EHBC 1YEDA 2J4WH 4NO0A 2D2OA 1CG9A 1EJOH 2F19L 1AI1H 5CP3H 2AJSL 3GSOA 2UY7A 4LCCC 1H3XA 3QEUB 5C08A 1OTSD 4F7MA 1CLOL 4NKMA 3HFMH 5MERA 3CDCA 3PDGA 3L3DA 2VB5A 3K46A 2X44D 3EUUA 4M7LL 1NBVL 4XNQA 1KGCD 4KJYA 5GS0C 3DTXA 3RWEA 4JQIH 4I2XE 4ZOEA 1L7IH 1QLFB 1VA9A 5JXAH 2XFXB 3QZWA 2UWEA 2MQ3A 5EC2B 1WZLA 1I8KA 2F9BT 3FJTA 1L9MA 4KJWC 5I1EH 5FGBC 1IGYB 4CNIB 3KPQB 1MCOH 3DXAB 3HZKA 5J8OA 4GAYA 1UM6H 3IKCA 4HJJL 4J3VA 3LV3B 5EOQL 1DEEA 2C3HA 5H8DA 2J8UF 4Y16D 2JF1A 4V2BA 3GMOA 1BIIA 5C92A 3VG9B 1ZLWK 4ZS6C 2F8OA 1MCJA 1SYVB 2PXYB 4WFHE 4PRNB 1EBPA 1RJZB 3L6FA 4RMVA 4BUGA 1QRNB 3BWUC 2VITA 2W59A 4WFFD 1D7FA 1UZ6E 3GIZL 3QT2A 1ZHKB 2ATKA 1T3FB 4ERSL 3C2SA 2UVEA 1AHWA 4C58B 3P73A 1CLYH 5IHBA 2R1WB 2QSCH 4PJCA 3REVA 1BLNA 2XZQL 3D5OF 3EYFB 1EDQA 4RWYL 2E7MA 3MA7B 2BVOB 3LB6D 4U1LA 4XPAL 1T0NA 5HHNB 5BVPL 1BQLL 1H3TA 5DMGD 3TEUA 3W11D 4EIZC 2VDKH 1BBJB 1N5AA 5F3BA 3TYGH 3ZKXB 5HD8C 3I2CH 4R0LB 3C6LB 3LKNB 4X99A 5ID0A 3HAEG 3DX6B 4G3YH 5JLZA 4OV6F 4OIBA 3QUZC 4DJMA 2BOBB 1KB9J 3ARBA 3B2VH 3ESVF 1XF4B 3GMPB 2UZIL 1JGDA 2G60L 4NUGL 3REWB 1QA9A 1U8OA 3S36H 1ACYL 1HHIB 5D72L 3SGDH 4GKZA 4U1SA 5ENWA 1K5NA 5D2LF 4UT7H 1KLFA 5ANME 4K8RL 3JV6A 1WITA 1QUNA 1S5HB 1E4XH 4LSSL 5CWSA 4OUOA 3MRNA 4HGKC 3FHQA 4D9LL 2EDYA 3SDXE 4Z7WF 4ONFL 2Y06H 4F33B 1LEKB 5KSAA 1PG7H 3T0ED 1NC2D 2FLBT 4ELMA 2GSGA 2YC1A 2BHZA 2AK4E 5BQ7B 1F13A 2NXYC 1OWWA 3PP4L 1TVHA 2WBJC 4GUPB 5DQ9A 4JO2H 1J0KA 3S5LA 3BZFA 4I18B 4M6NH 4S0SD 1JZ3A 1YEGL 2FBJL 3LQZA 2X4TA 4HDIA 6FABL 4WVRA 1G9MC 4PUBH 2FATL 2B1AH 1DLHB 4U6VH 1EFXD 2NLJB 4OZGE 4JFOA 4JPIA 4JB9L 4YX2L 3BVNA 1KG0B 4J4PD 3S4SA 4OLUL 4Y8AA 2W91A 2A9NL 5I1JH 1P53A 3DOSA 3FONA 5GRYA 3VWKA 4HBCH 1T5XA 4OT1H 1AO7E 4R4FH 5K9OB 3O6LL 4D0CB 1T21A 1ZA6B 3QI9A 3KLSA 3NCCB 4CMHC 4HS6A 1G9NL 1H3VA 2IAMB 2EE6A 4M7LT 5IR1B 1NSNL 1S7VB 4OIAA 4YFLI 5F6HJ 4NOFA 1S7WB 3NZHH 4HWBA 4YEEA 4Z7VA 1F3DH 1A7PH 1QKZL 3QEGH 3B5TA 4W4OA 3DARA 4I77H 3DXAD 3VDAA 3O4LE 3W82A 1N4XL 3VXRE 3EJJX 4JO4H 4M6MH 1DEDA 1CD9B 1R3LB 1IM3A 5EU7C 4NHCH 1PSKH 2HT2C 3MLWL 1Z2KA 4U49A 4QY8A 1CDUA 1MCCA 2ICES 5L2KA 4Y19A 3TBVB 4HC1H 2OJZL 1PQZB 4OZ4B 5B22A 5IB5B 4XCEA 4KUZH 3R4DA 5FO9B 4NRYB 4TYUA 4W70A 1B4JL 2PXYD 1CVRA 4E41E 3ULVH 1FZMB 1A6ZA 3QHZH 2DBLH 3I6KB 3LEXA 4X6DA 3LPWA 1QRND 3WFEL 2CKBH 4TSBL 2X4UA 4N9OB 4PRPB 4WW1A 3R1GH 3WN5A 2E27L 4YGVB 5FCUH 4G6FB 4HWUA 1AQKL 2EYSA 5DHVA 5KVGH 3TPUA 4MJIE 4U6YB 1MFCH 3QEHB 1H5BB 4MCZB 2Y6SD 5DRXA 1F3JB 3MLUL 2KZ1B 2BY0A 5KS9E 3C5SA 2FRGP 2R0ZH 5CSZB 1ZT7A 3C6LD 1UYWH 5E8NB 3NCJH 1OAZL 2XN9A 2ZP0T 4NO3B 3WNKA 4Q6IC 1KCUL 1B2WL 3KGRA 5IK3B 2XKNB 5C0BA 3KPTA 5HYIA 4U1JB 4X7FC 1CICC 1SEBB 1T20A 3BIKA 3QWRA 5DUBB 2AV7A 3SDCA 3CX5J 1GAFH 4K3GA 1JRHL 3NA9L 4F9PC 3VXSA 2Q6WB 2VZOA 1F4WH 1U93B 2HTKD 4CMMA 2D7MA 3BZDA 3PQYB 1INDH 4N68A 4U1IA 4CVXA 1AP2B 2C3VA 2Y36H 2VDOH 4XP1L 4I0PB 4KPHH 1Y18A 2VLLA 3PGFH 4G8FA 1J8KA 5F7DA 3VI3E 8CGTA 4J1UA 3RY6C 3LKSB 4L4VB 2PTTA 4X5WB 1VEMA 5I9QC 1CT8A 4M5YL 5IJVB 5FDWB 1A9BB 1X5AA 1WZ1H 2CXKA 4P2OC 1DBJH 3FT3A 2VJXA 4K23H 3VMOA 3BIAX 4Q9BA 4WWKB 3VFOB 1OL0A 2P24B 3TT1H 4AIOA 3V5DA 5EOCH 2HH0H 1R3IL 1YEIH 1FNAA 3C60A 1GIGL 4Z8FL 4UMGA 2YD6A 1YN6B 3IDXH 1DE4A 4PLKD 3VD4A 5HYSA 3S37X 2HT3C 4EBQH 1MAML 4IRSA 2R8SH 2DI8A 3IDMA 4WUKH 2RCSL 5AAMA 5CD5D 3CZFB 2B1HL 3WCYA 2CK2A 1NGPL 2P5EA 4NPYB 2V5YA 4MS8C 2V2XA 3QFJA 3BH8A 3EFFB 4HUXB 3V6BR 1C1EH 3BAEH 1SJEA 5JXEA 1CFSA 3V5HB 4PIRF 3HPJB 4OUUA 1FBIH 4M7ZB 3F7VB 3RUGA 2FO4B 2JLLA 1A9EB 1SY6L 3VFNA 2A0LD 3VRJA 3SGJC 2IAMD 3BZ4B 3U46A 3IU4H 1LO5B 5F1IA 1BFOB 4XXCC 3MRGA 4QHMB 1MLBA 3TZVA 1YNLH 3EO0A 5DK2A 3CFBB 5J6GA 1CGVA 4OV5B 1JYWA 4BZYA 4EUPA 1IKNC 1FNGB 1FG2A 3IKKA 4RFNB 4NQEE 2X4OB 2YBRA 5FHAH 5TGBA 4GMTL 1NMBH 3GKWL 4H88L 2VDRH 4ODXB 2ZUTA 1WC7A 3OHXB 5T5NG 3OXRB 4MD4B 5DC9B 1J8HB 5TQ0H 3I75B 1D5MA 2HFFA 2ED8A 1I7TA 2H6PB 3M1BA 1U92A 4PJBA 4Y2DB 5D1XC 3QUML 4NSKB 1OT2A 4XBGA 3MYJB 3TGXA 1TVBA 2ZSVB 2FGZA 1CFBA 3DMMC 4GQ9L 1A1NB 1WEJL 3FT2B 4C55A 4ALAH 3OKLA 1NMAL 5KBNC 1QFPA 5EO9A 4PRPD 5J57B 1G7MA 4LSUH 3BWAA 1U58B 1J12A 4HWEH 2WW8A 3L9RB 3BKYL 4K8RC 3K8KA 4G6FD 5CMAB 3WS6A 3BSZL 1TPXB 3QXUA 4OCXL 1PLGL 3V6ZA 3MV7B 4XC3H 4LVHC 2O61B 1CYGA 3OJMB 2HFGL 5DJZB 2ZCHL 2PCPA 2DDQH 3UEZA 4PJGB 5I2IB 4JRYE 3TBWB 3D87B 5CEZH 1YNKL 1CI5A 1T66C 5AYUL 2I25N 2NY5C 2R69L 1MUJA 3CCHB 4LLVB 2OQJA 4N0YL 1EO5A 1JTTA 1I7RB 3CVHL 1LE9A 1FLRL 3ARDC 4LVNC 1NCCL 5DFVC 3E6FA 5TE6H 4BKLB 2F54E 4M1CD 5DTFA 1Y6KR 3IS1X