3B2MA

Crystal structure of the major pilin from streptococcus pyogenes
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
294
structure length
294
Chain Sequence
GPGSATTVHGETVVNGAKLTVTKNLDLVNSNALIPNTDFTFKIEPDTTVNEDGNKFKGVALNTPMTKVTYTNSDKGGSNTKTAEFDFSEVTFEKPGVYYYKVTEEKIDKVPGVSYDTTSYTVQVHVLWNEEQQKPVATYIVGYKEGSKVPIQFKNSLDSTTLTVKKKVSGTGGDRSKDFNFGLTLKANQYYKASEKVMIEKTTKGGQAPVQTEASIDQLYHFTLKDGESIKVTNLPVGVDYVVTEDDYKSEKYTTNVEVSPQDGAVKNIAGNSTEQETSTDKDMTITFTNKKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stabilizing isopeptide bonds revealed in gram-positive bacterial pilus structure.
pubmed doi rcsb
source organism Streptococcus pyogenes serotype m1
molecule tags Cell adhesion, structural protein
molecule keywords Putative uncharacterized protein SPy0128
total genus 66
structure length 294
sequence length 294
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12892 FctA Spy0128-like isopeptide containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 3b2mA02
2.60.40.3050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3b2mA01
3GLEA 3B2MA 3KLQA 4BUGA 2Y1VA 3GLDA 2XICA 2XIDA 2X9WA 2XTLA 3RPKA 1D2OA 2X9XA 2X9YA 1D2PA 2X9ZA
chains in the Genus database with same CATH superfamily
3FPXA 3A6OA 5AB0A 4JZJB 3VFWB 4XN4A 3V7AG 1TTAA 1RUAL 2WIMA 4HWBH 1BXAA 4UT7L 4YDJA 4GQ9H 5GZNC 3V4UL 2BSSA 4PRIB 3TXAA 2Q76B 3OKNA 4LCIH 4D0CA 4BQ6A 3US1A 4JFOB 3TO2A 5BV7L 1OAYH 3OX8B 4ZS7L 5CJ5A 3BEWB 5EF3A 4PJ5D 4DVBA 4YSTA 4PV9B 3GD1C 1EXUB 4FKEA 5D5MF 4Z1PA 4LRNL 2QADB 2R59A 5ETUB 1YEKL 3HC0A 4XB3A 3QUZC 4XX5A 2DDQH 1L9TA 1W8OA 4JO1L 2XWJB 4ODWA 4NOBA 2VLRA 4TS6A 4LARL 2NCEA 1U92B 1A64A 1MCSA 3AREA 2LT9A 3P4LA 4Y2DA 3MZTA 1PX3A 4O2EB 3UMNA 3GNMH 4ZFQA 1IM3D 3ILPA 2E47A 1T1ZB 4D8PB 3NSXA 3ZL1A 2G30A 1TT6A 2LQRA 1CO1A 4XGZB 5IMLA 5K1JA 4MAYD 1KIUB 5HYSB 1UWFA 4M29A 4MNQE 5JYLA 4H26A 4G7SB 3SCMD 4F8OA 5HD8C 5KSAB 3RGHA 5AD0A 2XU9A 1MY7A 2XIBA 3FFCE 5F21B 2XN9B 1H6FA 5AW3B 1E8XA 1FZKA 2YRLA 4UYPA 2YSSA 3QORC 5AQ0A 3QFDB 2D0FA 4C56D 3LJ3A 4DP1X 2HFFB 4LLDA 1UB6B 1YN7A 4YWGH 3ZSTA 4I85A 1LHZA 2XLLA 4LLVB 3FTWA 2VQTA 1CDGA 4XOEA 2NNAB 4HIPA 5C0ND 1WAAA 3MRIA 5F3HA 5HHPA 3NAAH 5HYJD 5AENA 4PLNC 2ARJA 3WY4A 3DETC 1X5ZA 2HT2D 2OS7A 4PG9B 5GS2H 1U8KB 3KPOB 4PJDA 2F5BL 5ILTL 2D3LA 2O5ZL 4FCHA 1M7IB 1F8TL 2IDSA 1QSFD 2NTFA 3JV6B 3OGCA 4JFQB 3EYSL 4MA3A 3WS3B 1MCHA 1A8JH 3N1GC 4OUOA 4TVUA 2QQNL 2C7FA 4NO5A 3ATFA 1G5GA 2IANE 5GGVY 3Q7JA 5K39A 3APCA 2DI7A 2J6EH 5IJVA 4EIBA 3QEHA 1R5VA 3N1QC 2QSCH 3FF8A 4ODTL 1NCWH 2W9LA 1KLFA 2OYPA 5C0RH 4PYGA 3D0VB 4JO3H 1JPTH 3K74B 4J3OF 2OZ4A 3WEXA 3V6ZB 2VZ1A 1QPKA 3MLXL 5D2LB 5FYJE 2OXGB 4MCYA 1ZTXE 2WBJD 1EVTC 3G5XB 2DF3A 5DO2D 1NOFA 4OGXH 4E9QA 1I3RA 2VDMH 3D69B 2PPCA 4ZSOA 4PLJC 5D1XE 1H8OA 3QA3A 1AACA 4NENA 2J1ZA 2AJXL 3OHMB 5JW4N 3MLPA 3GZOA 4M3JA 2ILLA 1ZK9A 2EIEA 4WJ5A 4LIQE 4NM8H 1IBHA 3HNVL 4GO9A 4WWOA 5ISZB 3MNWA 1KYOK 2V9TA 3OVUB 4XVUD 4EVNA 1M56B 2VGLM 3K4ZA 5FDYA 3TA3A 4HIIB 3UPCA 4QJ4B 3K2KA 2JQMA 5HYQA 5DHEA 4HAGA 2VH5H 1GVIA 2WJ7A 4DERA 1AMYA 3IWVA 1QTYT 3O6FB 5B7FA 1HKLH 2K45A 2NY2D 3WIFB 3ME0A 2OW6A 3FSOA 4N90D 4LPYA 2UWEA 4PVLA 3CZKA 1A66A 2CCVA 3TIDA 5G2NA 3TNMB 3UTSD 1CIUA 3AQYA 4BWTA 1LO2L 1KGCE 1JZHA 3OR6B 3SN6N 3F7LA 3BYYA 3HC0B 3BDYL 3PQYD 3LD8B 2IDCA 1XSOA 2C4XA 3CSFA 3DTUB 3GYRA 2BZDA 3BXNB 3JV5A 5GZOD 1CF8H 3QIBD 1MCJA 1RZGA 3LVTA 3MRRB 1ZA6A 4MD5B 2KUTA 4PWGA 3BP7A 4AI7A 4F5CE 4YPJA 1CTMA 2AEQH 2Z4QB 4ACPA 2ISDA 5FYLE 1AQKL 4L8BB 2F8XC 3S96B 5DEFB 3DARA 5CINL 1HKFA 4NPKA 3UROR 3QFJE 4DP5X 1XV8A 4XMKH 2BWIA 4BDVA 3I9GH 1NDTA 5LN4A 3BD4A 5B7MA 2VKXA 1TITA 4BXVA 3CUPB 3RDTC 4ESKA 2K4AA 3A0OA 3T0EA 3FDWA 2PMZA 1TTGA 2NZ9D 2WQUA 1G6VK 3H7BA 3BUBA 5CGMA 1QATA 3V5DB 1KJ2L 1M4KA 1MH5B 2IG2H 4M93B 4E5XB 1MUJB 1QP1A 2BOLA 3POHA 2LU7A 4PS4L 1I1CA 3SKOA 3GSXB 3MLZL 4PTTB 1VZHA 2PCPA 1NPNA 3FKUS 4NN7B 4WI7A 5BV7H 2CUAA 3GM8A 5DZNA 2V7NA 1MIEH 1ET5A 3UADA 3X17A 5JHDD 5MEQB 4I4WB 1HAUA 1ILSA 3QIWB 1E5ZA 3LKRA 2YA1A 2K7PA 1JTTA 4JLRB 4OLUH 2QGCA 4G1MA 1PBYA 1A1NB 4XNMB 3KLKA 1EBAA 3R19A 1NLBH 1EZVY 1FL6A 1F58L 3GHEH 4A1RA 4B0MB 3DRTA 1O5PA 4TSBH 4XCFL 3INUH 3IF1A 5GS0H 4BRVA 2A83A 1UACL 4J3TA 2EDWA 4UV7H 2IV9A 4B7IA 3MROA 5DZVA 4ZUVA 3HKFA 4MCYB 1YNTB 4PY7B 4XZ4A 3TBWB 1OPOA 2FSDA 4H7VA 1KLGB 4YAQB 3NRQA 4X7CC 3UAEA 4UB0H 3VE0A 3B6SA 4JDZB 5DHYA 4RDBA 2JE8A 4BINA 4XAWL 1TKWB 2GT9B 3GS0A 4IIQA 4KK9C 1HILA 5A43C 2ALWA 3LHPL 1A9VA 2VR7A 3CNKA 2AJSL 2WBKA 4P3DB 1VPOL 1S7UA 1CGTA 3I6GA 3LKQA 4E5XA 3UTQB 3AG2B 4OT1L 5K33A 4N85A 4LHQB 2G2NA 2GJ6B 3Q48A 5EU7C 3U1SH 3IYLW 1RD6A 4UMSA 3QI9A 5CJBA 1LVEA 4LNVA 4MAYC 4RWHA 4M5ZL 2IANA 1M7XA 2OR9H 4K23L 4PIBA 4AVIA 3H3PH 1GMEA 2HRGA 3SDAC 3BGFB 2CG9X 4NN6B 2WQSA 4K5LA 3V6OE 2BDNL 4Q52A 1KTDB 5KSVA 3T0EC 1S9YA 1NCJA 3M88A 4MXQC 3CZEA 3UJIH 3D87B 1W6WA 2DQEL 4HWEL 1I8KA 1JZDC 1YRKA 2APFA 3PJSB 2R1WB 1C7TA 3UZVA 1CZ8L 2HUHA 4LPCA 3BP6A 5D7IA 2AQ3A 1ACZA 2GI0A 2RB8A 5LBSA 3PNRB 3BAYA 3GO1L 3FYIB 4YO0A 3MJ8A 2VDOB 5SWQA 2E7CA 2QZ5A 3TPKA 4N0UE 3DO4A 3QC6X 1X4YA 1IL1B 1XGTB 4HIXL 1EO7A 2GJ6D 4H4NA 2YC1B 5L88H 5EBMB 1AXSB 4W9JC 1URZA 3E6FB 2BC4A 3TO4D 1NJ9B 1ZDQA 3AAZB 3LSOB 4TMPA 4Y4FD 3DIDA 5ADOH 1TYEB 2Z6FA 3DRQA 2BK8A 3QG6A 3HE7B 3TA4D 3M6DA 1BJ8A 2V9QA 2YD2A 1L9PA 2P5PA 4HIHA 4LCUB 3QXDA 4KRPB 5KS9F 2W9DL 3RPKA 3FOMB 3SY0B 4M03A 1A6ZB 2R15A 2WLLB 3B9KD 4XPGH 1PD1A 2K78A 4YSAA 3BVDB 3O8XB 4J3OC 1YQVH 1ZLVK 4RMTA 1E6JH 2DWDA 2ICWI 4KVCH 2CQVA 5HI5C 3CN4A 3QQ4B 2GHZA 1JS4A 1CLZL 3C2SA 4NBYB 4TVPL 4P5TC 2CO6A 3BD5A 3JTTB 5GRJL 4POYA 3K72B 4I8DA 3WFCL 5TDOB 3ZKMD 3N42F 4OGYL 2VDPH 1FV1B 1Z9NA 3Q1SL 1HH6B 1PFCA 1N5YL 1HINL 5FW6A 5KBMA 4DN3L 1IJ9A 1SYVA 2NZ9C 4JPIB 5E24E 4LSTH 4U0QB 1GTNA 1E9OB 2DIEA 4LHUD 5KSAC 4PGZA 1USQA 2A99A 5FCUL 1I9JH 2GSGA 3D3VA 5I1HH 3K6NA 3QUZA 3RVUC 1TPXB 3UO8B 3FRPB 1JPFB 3L7FA 2GTZB 3QUXB 4C4KT 3S6CA 4A2LA 4PJGB 1G0YR 4IRZL 2XZCL 1MJ8L 2Y6TE 4MJID 3FTUA 1MCEA 3MFFB 3RG1C 4K9JA 1MCNA 3Q2LA 4RMBA 3II3A 4WHTA 4KI1A 3QJQB 4JFYB 3FO1B 3KWWB 2C3GA 3CSGA 3MR9B 5LUMA 5DS1A 1Z6JT 3F7YB 4CC4A 4DW2L 3NCWA 1OGSA 4DKEL 3VXSA 3U0TA 5C0IB 1DLFH 1QFUH 4G6JL 4ZXBC 2WZPA 5IB3A 2NXZD 5IHZB 1A1MB 5DFWH 1A6AB 4QD2E 2H6PB 4ONHB 3QJSB 1E50A 3DGDA 3VTTA 1MAMH 5AW2B 2PR4L 1TPXC 4G2AA 2GJZA 3P0VH 3FW6A 4LSUH 5HDBE 5KWYC 4BK5A 2QKIC 1KELL 2G3NA 3S35X 4W70A 3D2UB 4FA7B 1YY9C 1Z9LA 1WICA 1KB9J 3LPPA 2RMNA 4AT6A 5EUKB 2I60H 4M6OH 4OF3A 2ORBH 1RK7A 1SOQA 4Y5YB 1N2RA 3RZCD 3F7YA 5F9WC 5H4YA 3TVMB 3D1MC 3MC0A 1KTLA 4DNLA 2XWDA 1IGFL 4MQXD 4ZG1A 5CSBA 1IC5L 2BM3A 1F90L 1T83C 4G8FB 3E8VA 5AOLA 3WN5C 1PG7X 4XP5L 3KZ8A 3N41B 3VJ6B 3VQMA 4BH8B 2YUVA 1XVSA 4PREB 4PGCB 5LBVA 3QFJA 2XBTA 2KQMA 1UKQA 2Z31C 4MNGA 3N3EA 1DQTA 4ODBD 3C5ZA 3EBGA 3QEQA 1UB6A 3KXFA 3IFOA 3L3OA 3GIZL 4Z7VE 1BQUA 1T66C 2IADB 4A6YL 1R3KB 4DO6A 3SOBL 2V2XB 4WHTB 2FEJA 1BVKA 3KCWA 4GRWB 2X4RA 3BUQA 1SXAA 3EXLA 3CLEL 1O75A 2ARJB 4FYTA 2H2SC 2N56A 4M61A 3UTTD 4JANA 5B38A 1BFVL 3IJ7A 3KYOA 3RAJH 4AV5A 3LS5L 4DZBB 1BZ9B 1EJ8A 3U4AA 1DVTA 4GBXD 2DLHA 3ABMB 3RKDD 4KKRA 3QW9A 4M7LL 1INDH 3ZU8A 4DW2H 1QOKA 1MNNA 3Q0HA 3NRPA 4DP0X 4EI6B 4EE2A 3PHQB 3VQ2C 4NP4L 4XE5B 2IH9A 4R3SA 1UUSA 2J3SA 4WNJA 5TDOA 3SKMA 4K4KA 4X5RA 3QO1B 3A47A 4WI9A 4P23C 1Z9MA 2B14A 5IROD 1N6VA 4I87A 4JJOA 4OBSA 1ZGLP 2YBRA 3ZMRA 3V4LA 2HT4C 3IMWA 1BVZA 3ZRSA 3UPRB 2R4SL 5B7EA 4N68A 3TBSB 1CT8B 2FL5A 3CFMA 2RAMA 1QSFB 1AOHA 3VWKC 1K6QL 3BIBX 1G7IB 3ZDXB 5TD4A 2F54D 4K3JH 4ONFL 1EGJL 4YGVA 1I1FB 5D7LE 2JELL 4FQCL 5CIPH 4TOYL 2X9ZA 4J1UB 5EZJA 3W0WB 4F15C 2J1XA 2W0PA 1HL8A 4F3FB 4R6UA 1WD8A 4XNXH 4ICWA 2VE6B 3UO1L 4KZDL 2Y36H 4FYRA 5J13B 4KKZA 1Q1JL 2BNUA 2LAAA 3VI3B 1DJYA 1IFRA 1NMBL 2DMKA 3G5ZA 4CNIB 1B90A 3FUMA 3VFRB 4LSVL 3QIWC 1CT8A 5IV2B 1LE9B 4A7SA 1FO0B 2ADGA 1CBVH 2J2ZA 5JQ6L 5AVTB 3C8KA 4FFTA 3VWKB 1YJDH 1RZKH 3J7HA 1TCRA 3HE6C 3ETBF 4TSBL 4QRTA 2C1PA 3HNSL 4G6KL 4ZDHA 4LSPL 1R3LA 2OSLA 4JK0D 2FD6H 3LN5B 3FZUC 4RSVA 3VFUA 4P2CG 4WV1A 4DZ8B 3FCTB 2ZJSL 4UU9A 5CEYB 1CIDA 4NZ8A 5DD0H 1HNGA 2LLNA 3FO9B 3BW9A 3MV7A 2J8OA 3CXDH 1TFPA 2X4NB 1XXFC 1QABA 4PP2B 2Q8AL 4A7QA 1FFNA 3V9EA 1ZS8A 4GH7B 3GI8L 3S37L 1HDMA 5J5EA 2H9GB 1FVCB 4JPKH 1LP9B 4NHUB 5F3BB 3HPJB 1YECH 4OJYA 1JUFA 4AQ8A 3P54A 3D34A 4ORGA 3CXFA 5C3IA 1TKWA 2GT9A 4Q6KA 4TNVK 3A67L 4Z77A 2CE6A 1IGIL 1MI5E 2BMKA 4K07A 5DJ8B 6TAAA 3H4HA 4POZC 1X4ZA 1VSCA 4Y5XB 1KPUB 1P69B 1EO8L 2ZX6A 4JY5H 4X6CE 8FABB 3S35H 1GYVA 2E9GA 5DEJA 3AG4B 3PL6D 5GJSL 4X7EC 1WYJA 2J4WH 4DEUA 2G4GA 1SLXA 3BISA 5DFAA 1X7QA 3BKYL 4M61B 4HUVA 3VFNB 3NK4A 3WEBA 1ZLUK 4FCAA 2ZWYA 5ANMB 4IHOA 5DZJA 3VX0A 5DK0A 3U7AA 4R4BA 2ZYHA 4G8FA 4JFFE 1SJEB 2PO6A 1FAKT 3CU1A 5L7XL 1T2JA 5FO9B 3BT2L 3NCMA 1QEWA 1YEHH 2B2XH 1TUPA 2H0PA 2R0KH 1YUKB 3QDGB 4W4OA 4XMLL 3F2LA 4R5XA 1PW3A 4YBLC 5F7KC 1C9SA 1M1SA 1D5BB 3B7UX 5CMAB 1QO3B 2EIZB 4HXAH 5D70L 2XV0A 3QI9C 1OCCB 1H3VA 4NQEA 5T1LD 4BUGA 1FIGH 2XTLA 1U8MA 3QE5A 5BRZE 5JHLA 2IGTA 3IDXH 4EF3A 2YMXL 3LEXA 4O02L 5F7DB 3CFJB 5CBEA 3OAYK 5I0VA 1TJHH 2EH8L 3WL9A 1WD9A 4Q9BA 4TLKA 5ALBH 5BJTB 4D0DB 1KTCA 4ZPTB 4GQPH 2JB5L 2H1PL 1KCKA 4YC2B 3D0LB 3PPSA 1JHTA 1WLHA 4TVPD 2GIXA 5D70H 4LKCB 2LVCA 3EHBC 1KBWA 3DTXB 5DSCA 1TTFA 2ZP8A 1UZ8A 2VR5A 3DTDA 2XC8A 5AALA 1FZMB 5D72L 3DI2B 2XV3A 3NEEA 3FZUD 4HXBL 1XIWA 3ETTA 3NOIA 5CSZA 4HSAC 1BV8A 1RPQA 2PUQT 3C09B 3REWA 2HN7B 3W9DA 2X70A 4QGTA 2ATPB 5EBWA 4Q7DA 5JPMC 4XZUA 3ABKB 3PWPA 4LSVH 3DXAB 3TX4A 1SYVB 4TNVF 5I0DA 1BBDL 1TZIB 3H56A 1UWEH 4MZ2A 1HE7A 4KUCF 5DJDB 2YPVL 4YHIA 5EZIL 2XICA 3CMOH 5F9AC 4JY5L 5I1KH 4UOW1 5CZKA 1WEJL 4M1GH 2ZF9A 4WJ5B 1JPFA 5FYKH 3WIIL 4XAKD 1XTMA 2IAAC 1ET7A 4P5TA 4F8QA 3OKKA 3ZSSA 4LESA 3A4AA 3NFSL 4J3BA 3AU0A 2FQDA 4ODHL 3ZTDC 2BP5M 3CDZA 4P5RA 3GSVA 5KSBE 4JFUA 2HSIA 4GG8A 1WBXA 4LGRB 3QNXB 1N8OE 5FUCE 1CYXA 3O9WA 4HJSA 4B6ZA 3WTYA 2C4FU 2Z4TA 1BVNP 1YEHL 5KVDE 1JN6A 1NC4B 2RH0A 4NP9A 3RUGA 3V0VB 1IKNC 4RBPH 3T04D 3B5HA 1AKPA 15C8L 3FT9A 5L9DL 4X5QA 3QZWA 2CXGA 3BH9A 4ZJ9A 1EHLH 1HNYA 1ED3B 3BAIA 5EF0A 3GZKA 2VMJA 1KBBA 4P23D 2OJ1A 5H35B 2APXA 3PAVA 3IDYB 2PYEA 5DRNB 4Z0XB 3HAEB 3EGDA 1ZGLB 2EUVA 2AQQA 2W92A 1A7RH 3BVUA 3RJQB 3BIAX 1X3DA 1FNFA 3D0VA 1QSVA 4OB5H 2ZOUA 1QLFA 2BSBA 2OTUA 5F9WB 4CC4C 4PRHA 2JFCA 5HYFA 1M7DA 3OZLA 1WO2A 4LLQB 2R1WA 1T7ZA 4APXA 3MRGB 5C07E 2O4EA 2X12A 1SM3H 3UZQA 1MWAH 5ACMA 4WRLA 3L5JA 4N2FA 4L8SC 4Y4HA 5DJAB 5EFIB 5FB8A 2VDLB 4KI5F 4PJXA 4Y88A 5FO8A 2NTFB 2XZAH 3OGCB 1P53A 4B60A 3H8NA 1SLVA 1T03L 2NOYA 2CIKB 5CGYD 3RVVD 2ADIB 2HKAA 5CIPA 1PAMA 3UIZA 5HDQL 2QKIA 1JPTL 4I0PC 4BKLA 1CLYH 1ZVSA 3HZVA 4NPYA 2WXGA 3UTSE 4R7VA 1EGJH 3TBYA 4X6FA 4EAEA 3KPRB 4PIRF 2MCPL 3LEYL 4J28A 5EBLB 4HZ1A 4IM8A 2AK4B 3W0WE 1UT2A 1V7NH 4F57H 2DQCH 1F4HA 4X99B 3QIUC 1L4IA 1BXUA 2MOVA 4HWBL 4YHZH 4R97B 3ZRFC 5IB3B 4TQIA 3MLUL 3U2SA 5J06A 3G5VB 2BVOB 3C6EA 4NAQA 4MHHI 5FYLD 3RVXD 3GRWL 1IQDB 1ETJA 1OP4A 1QKZL 3IDGA 1ORSA 1TU2A 3N9GH 4XP4H 3S5LA 3Q9PA 4HU8A 3U46A 1FGVH 2CLZA 5F9DC 3ULAB 1JZ2A 4APQD 2VDLH 3ZDXF 1IGMH 2R1YB 3H2PA 1W72H 1EUTA 1OAUL 1MWAB 5HHPB 4ZW3A 1MVUA 2RACA 4F33A 2X89D 1MW2A 4PJ6A 3AXIA 1X7TA 1HZKA 5EIIB 3S97C 3T3MF 1UUNA 3CBKB 4KNSA 4NC1E 4BDVB 4O2CA 1AC0A 4P2RE 2QPUA 1HJCA 1KLUA 4JREC 4ZODA 2A4EA 1F1AA 3HAEH 2IVFC 3X1NA 2YRBA 4BCXA 4BFIA 4Z7UA 2BZ7A 2MSPA 4GYBA 5EO0B 2WGNB 4YGVB 4KX8A 1G5AA 2HTKC 4Y8AA 5A40E 1RU9L 2PWGA 1DE4A 1KGXA 3GMNB 3EW3B 1AY1L 1JERA 3HC2A 4GUQA 3QCVL 4PJ8D 3NCCB 3P11L 4HPYL 3HMXH 1ZAGA 1ES0A 2H3NB 2OTWA 4CRPA 4BFRA 2JKLA 2LAGB 4HJGA 2Z7WA 2W9EH 3VG0L 1EDQA 1KB5B 3RVTD 3RZCB 4LBEA 3WTXA 1Q90A 5D7JA 2Z0UA 1PSKL 2F7IA 2FAUA 4PYHA 1HCVA 4AK2A 3FB6B 3T65B 4S1QL 4TSAL 4EI5D 5FYJD 1NIFA 1SXBA 4UTAA 1CBVL 2WYTA 3GXUB 1AP2A 4M48L 4PTUA 3DV6B 1OV8A 2VLJE 4RESB 3O11B 2H4EA 4Z23A 4TL4A 3KVPA 5C0CB 5DYFA 3KWVA 1JGDA 3D52A 2XKNB 5HGHA 3BN3B 1T66D 1P4IL 2QDVA 1MFBH 3IRZA 3NFPA 3EJSA 3KS0J 1UWGL 1G6RL 4DGVL 3RGVD 5EUOE 2VLJA 4TTDD 5C0GB 5IWLA 1L9NA 1JF1A 5SWSE 3WKMH 1PG7W 4LGSB 3GSNL 4MJ5A 4K8RL 1KPVB 4KO9A 4XWGL 3NJLA 4XP6H 2Y23A 3S2CA 2CJSA 4NQDE 3G08B 2P46B 4KMQA 1PLGH 1K6QH 2X1OA 1SQMA 4AX3A 1S78C 4HLZH 3VFMA 5F70A 4G7VH 3EJCA 3QUXD 1KYAA 4HS3B 3WSQL 3QDGA 5EEUA 3A22A 4X6BB 5F2FA 1FZJB 4X5XA 1YYML 4WI4A 1NKRA 1QI4A 3DIFB 2VABA 4NQUA 3LQMA 5E08H 3EBHA 1OLLA 1X5MA 1KCSH 3NVQA 4WZ9A 3QUYC 1MHPH 2K9UA 2R4SH 4P4RA 3BO8B 2V2TA 3HKZA 2GKIA 2EP6A 2AITA 4N8UA 1OTSD 1ZY9A 1OB0A 4MNHB 4PLOB 5JW3L 2QSTA 2IPKA 1VKXB 3W81A 3WDJA 1CLZH 1SUJA 1U3HC 4TVPH 5GRYA 2WVVA 1ZVYA 2W81C 4XR8C 3B9KB 4G6KH 3VCLB 2LTQB 3PAYA 4IDJH 1MCIA 3RWFB 3SE3A 4UTBA 1UH3A 4HS6A 4LLMB 3AWGA 5HVHC 1C5DA 4WFFE 4XP9L 1ZVSB 2HVJA 3HG1E 2I7OA 3MUGA 4FOMA 1QRNB 3E7JA 1MFEH 2QSQA 4GIOA 4N6RA 4OLVH 4OFPA 1JZ6A 4MQ7A 1EHKB 4NZTH 3BN9C 5KUKA 3GMOA 5DD6A 4WWPA 3QPQD 3G3LA 4JY6A 3N1FC 4WI6A 3U1QA 5EZOL 2WQ8A 1N59B 5IF0B 4H8PA 2XWCA 4HHAB 2B7DT 4RCAA 3MXWL 3OBAA 2YRPA 1U21A 2Y7LA 3B3IA 1U3HB 4P46C 3V0WL 3B7SA 1JHLH 4DK3A 3VXUA 2W60A 3QZNA 1HI6B 3PPEA 1IE5A 4RAVA 1AXIB 3L5WA 2W9EL 3LH9A 1R33A 4OQTA 3C9NA 1SXZA 3CZJA 1JNJA 2WKOF 3I2CH 4JGMA 5DFTA 3QCTL 3K0WA 3VFNA 2H6UA 3EFDH 1IT9H 3NIGB 1JG9A 1M2VB 2DWYA 2Z35A 3BPOB 5TE6H 1NAMA 5E94A 3O9WB 3D0AA 1JZEA 4NDMB 4N2IA 4RGOH 4P0DA 3GRWA 5HHNA 4EJ1C 1W0YT 3UL4A 1JPEA 4WW2F 1I8LA 5A2FA 1FDLH 3O6LL 4ZUUB 3WKQA 1OP9A 5KS9A 5GS0C 1DQQA 1NGYB 1I7ZB 3D85A 3FOMA 1WZMA 2O26U 3RX8A 5DHVA 3I9PA 4MX7B 2XVBA 2X6BA 2ESVE 1T0NB 4Z5RB 5ACLA 1CWVA 3S34L 2H0FA 4LSQH 5HTSA 3EJYD 1MOEA 2E46A 2NT1A 2YOAA 3LS5H 5HY9A 5HI4D 1D9KB 4H0LC 2OP4H 3OXSA 4HIXH 4DGIL 1Y07A 3L3KA 2E75C 2BY3A 3V5HB 3CSYB 5D6CB 4CAGA 2OFQA 3J07A 2WNGA 3H3KA 4KAQH 3D39E 3BPOC 4WCYL 2SODB 4R7XA 1S7QB 2IAMA 1CJYA 1OE1A 2Y1AA 2I7SA 3IU4H 5KSBA 5LVEA 4QLRA 5FGCB 2XWBA 5HJ3B 1CK0L 5JZ7C 4GKOA 5J12C 2R56H 3MV11 2RFXA 1VADA 3RL1A 3E9UA 4PG2A 4YSRA 5I17B 2KQNA 1AZRA 2Q9OA 3I6LE 4LQFH 1KEML 2A74B 3ZTCC 2WWOA 4LVOC 4A55A 5CAYB 2NQDA 2HH0L 4U1SB 1AGEA 1GGCL 4L4TB 5ESVB 2VC2L 1A7PH 1U8JA 2YN3A 5T3XD 1H3GA 2BSED 2FVNA 3CSYA 1XSIA 1SXSA 1N0LA 1C5BH 1GZQA 4XO9A 4QHUB 1PU0A 4KC3B 2X7LB 3V55A 2YXMA 4K5PA 4E42B 1NKGA 3P2DA 5C0AD 2IXQB 1SJHB 1Z5HA 3S4SB 2P26A 1AGBB 1EA9C 2CM5A 2R1XB 3EHBD 1L6PA 4HX1A 4PB9L 3X12A 4RFNB 3P30L 1OK0A 5DTFB 3KPQB 3KL5A 1GKOA 1A1OB 4IGBB 5C2UB 4M1DH 3T0AA 5I5MA 4N2DA 2A74C 4LVOB 5AVXB 4CA4A 3FUNA 2YQ3A 4QRUA 2R29A 1IM9D 4YHNA 2HMIC 1D7FA 4JG1L 2NY6C 4KVPA 2CKBA 1M9WA 2LLGA 4XXCC 3LNEA 1HSBA 2GFBB 5DEGB 4X7FC 4OVUA 2XYBA 4MYWB 1JWSB 1OM9A 5I73B 1WIPA 4HKBB 4J27A 4LEXH 2B59A 1I1RA 4J2QA 4J4PD 1A65A 2VN7A 3KL3A 5GGQH 4NFCA 3UEZA 3V4PA 4HISA 1EHLL 4PFEA 4IJTA 1H9VA 1V54B 4GS7C 4M7JL 1TZGL 1FZOB 4WEUD 2WYZA 1IGML 4ZUSB 3CFCL 1EAJA 3TS8A 3B9KA 1ITBB 1YMHB 1JPGA 2V37A 4K23H 1J8SA 2ODIA 4NQSB 2E7LC 2J8HA 1YPZE 1YY9D 1A3RL 1F6LL 4AG4H 5D7KD 4Q0XH 2YEVB 5DJYB 4AQ1A 1QLFB 2EC9U 2OTUB 1BM3L 3T4YB 1MLBA 2AEWA 2E76C 5IIEB 1HU8A 1VA9A 1DJIA 3CDFA 5BRQA 2DH2A 5IVNA 4OF6A 5KSAA 4W9ZA 3DRTB 3WFCH 2O5NA 2JKWA 2VISA 1KFAH 3N44F 1UURA 4WSJA 4K7PY 4PJHE 5GSVB 1GSKA 3BP5B 4AYID 1T03H 3MOBL 4L0PB 2E6PA 3JYCA 3VI4E 4JHAH 3I50L 2BW4A 2VSMB 2V9RA 4WI3A 3TA3C 3VH8A 3T71A 2V7HA 2X2JA 4IKKA 4OKDA 3NYKA 1KXQE 1RUML 4RRPG 5IFJB 4AUUA 3LHPH 5FGSA 3DX9A 3IPEA 3RTQD 2YEZB 2ZOKB 3SPVA 2Q86B 2WXOA 3RWCB 2B16A 4H8UA 4ZQKB 2VRKA 2CDFA 4KI5D 3D18A 4OM1L 4NO0D 2WBJC 3L81A 2O5YL 4JHBA 4MD0A 4K8RD 2FK9A 4HJ1A 3MROB 5DR5H 4ZUVB 3OKKB 1PZ5B 4MQ7B 2IO5A 1GC1L 2Y06L 3T3PB 4MKTA 3N0PB 1HH9B 3DV4A 2X88A 4ZPVA 3QDHA 5HDOA 1NBVL 1NCTA 5F88B 1D2PA 3NDZE 5DJ0A 3D25A 1AGCA 5A2JH 2W59A 1A14L 4FFZA 1K4CB 4X5PA 1X5XA 5FKAA 2FE0A 2FQGA 2YSTA 2A74A 4G83A 4RVBA 2DWEB 3SOTA 3MCLL 4L23A 3H42L 4KTEL 3MRPA 3UCQA 3ZE0B 1OTTD 1YEKH 2DYRB 4MQXC 3BPLC 5EWIL 5I71C 4PS4H 4PJ7A 1RJLB 3R7RA 4N8CL 3CQFA 5K9OA 3ML8A 1IB5A 1BIIA 4AUJA 5A16B 5DJCB 3MUY1 3D7PA 4M4RA 3RWJA 1XAKA 3O2DL 4WKZA 2YD4A 2A9MH 7PCYA 1KPVA 2IFFH 3IGUA 1YQ2A 1AGBA 5B4MC 4LDEB 4XBGB 2OM5A 2FIKB 3DECA 2Z34A 3V4UH 3L4VA 3UAFA 2C4FT 2I07A 3WHXA 5C0FA 1KGIA 2CUMA 2V5TA 3D0LA 5D7SL 3A6CL 2BJMH 3QDME 4GRLA 1XCQB 4F1ZA 5KVFL 3FU8A 1O5DT 4PJ9A 4LEOA 4A6YB 1NA8A 2ZZUT 4MAYB 3WFBH 4YHKH 4KITB 3FHEA 5EZIH 1X5LA 5I1EH 2GBVA 1WCBA 1UWEL 2A6JA 2ICEB 4R4ND 1O9WA 1IM3B 3OMZA 4PB0H 2K3HA 5AKVA 4QOKD 4YFEA 4L18A 1WZ1L 5TF0A 5CD3B 3T0BA 3EOYG 1XH3B 1A0QH 3BEVB 3WIHA 4A7TA 4ZOAA 4ZMZA 1RZIB 2XG5A 3QUGA 2EXTA 1QFHA 4LARH 2F58H 1UM5L 4JKPL 3LN4A 3VRJA 2DI8A 3PJLA 1PY9A 1IQDA 5I26A 4MXVF 4TKWA 3V6ZA 4JHWL 4UAOB 2WV3A 4XB8A 1KN2L 1ADWA 1BEYH 5BS0E 3T4YA 1EZSA 2NY6D 1NZRA 3ZN6A 3HS9A 2V8LA 4KTGA 1C5BL 4D2NA 5DD0L 3A5VA 1KGCD 2ZSVB 2ICEC 3MUZ1 3HE7C 4IKIA 2VUKA 3JXAA 3T77A 5IF0A 1Y1UA 2HRHA 3D39D 3HFML 1LEGB 4LDOB 4ABWA 2FJHB 1LO5A 2CGRL 4RGMB 5E7FA 5BS0D 4ZZKA 2XV2A 4HC1L 4EO5A 4FNLH 1EEYB 2VM3A 3MRCB 4EN3D 4LLUB 3X1BA 2VDKH 4QHKI 5A6IA 4R96B 3U0WH 1DSFH 4H40A 3SE3C 3V5KA 1FNAA 3V4VA 1S8DB 4EN2A 3WE6A 4XOBA 3TC9A 2NXYB 1FA4A 2BCMA 1QAWA 1RMFL 3MODL 2GTQA 1E8ZA 2WB7A 3UZEA 4B3VA 2I9TB 1FFNB 4N0FA 1TR7A 2R83A 4AL8C 4I2XE 4D7BA 3RWGA 4L3EE 1SY6H 3EFOB 3QIWA 5JO5B 3L3GB 1A6AA 5TH2B 3B7RL 4P8QA 3PUUA 3WN6A 4QRPE 2Q0ZX 3CDGB 4PRHB 5DVLA 4BFJA 2IPUG 1FZKB 1EK3A 2O5XH 5K59E 2PCYA 3ENEA 1QFWM 4IIZA 3FO0H 2BLFA 3U79A 3W2DL 2YXWA 4UOQA 4HIEA 9CGTA 5GSVA 3B56A 1E9QB 3P3SA 4L4TE 3QDJD 2LV4A 3QUXC 5I19H 4CGTA 3OZ9H 4Q0XL 1N6QH 4W9DC 3U4KA 2EECA 2EYRA 3LH2H 2QFPA 5T1LB 1WAAF 3K71A 5EZPA 1AE6L 1FFPA 1X7QB 4PRHD 1S9KC 1IIIA 4WEMB 4YHYC 1J0HA 1MFAL 1FFTB 3WY1A 4ELME 1AGEB 2NZ1A 4R7DA 4E9YA 1LQSR 1NICA 1ACCA 4W9LC 3S9DB 4JHWH 5EEZA 2N01B 2NNCA 3LIZL 3AC0A 4U0RB 4N90E 3ZQWA 1BYPA 3ARFC 4NP4H 1H3XA 1B0GB 1QSED 1AI1L 4E68A 3VA6A 1AO7D 5D1QA 4EN3B 3S7GA 1WG3A 1T5KA 3O0LA 2X44D 3UJJH 2DS4A 1XL6A 1IC1A 3G9VA 5H35A 4M7KL 1TQBB 1TSHA 2F68X 2WLZA 3VM5A 4G42B 2HYMA 3D48R 1NMBH 2HLAB 3HNSH 5KYUA 3U7YL 2XT1B 1R5IA 2ICWJ 2ZX5A 4Y5YC 4X6BA 3ILPB 3KAAA 3QPQC 2X3CA 1ZCRA 1BFOA 3VFGH 2ZOOA 5KVFE 4AE0A 1WVZA 4QRSB 2CDEA 3GSVB 5F9OH 2O6DA 1WBXB 3RL2A 4Y16C 4J3OH 2C3VA 3DPBA 4WI2A 1G9MC 4JKWA 4ODTH 5CGTA 4XMTA 2ZXBA 3MKGA 1UTDA 1EBPA 1OLZA 1OARL 3ATAA 3RUGF 2B1OA 3FT2A 4U6VL 4RFNC 1V3LA 1T1YA 4NQTA 4YSDA 5BO1H 3WHXB 5C0FB 3D05A 4PI2A 5ESAA 4M4PA 4IGBC 4NKQB 3KW7A 4X50A 3LVEA 1XCTB 4H0GA 4N2EA 3GGWB 2C9XA 4NKOB 3DLQR 4MJ6B 1RVFL 2IQAA 4JQXA 4YHOL 5JXAH 2G3MA 1PKQA 3SO5A 4N28A 5KJRH 5GIRB 4PJEA 1HEZA 3B83A 3PWLA 3QEGH 3NSDA 2IGFL 3O4LA 4C4KO 1L9OA 5CJQH 1YECL 2ZNWA 3NAAL 2XVKA 4GNKB 4LCYA 3MU3A 4PJ7B 4KWUA 5D1ZB 1G7JB 5EOCH 4X6DB 4NLAA 2VXVL 2C3VB 3DPBB 5FLVA 2A6IB 3TYGH 1I4FB 1FVDB 1A14H 4WSKA 2AQSA 4PGCA 4HK3N 4JR9L 4DP2X 2K70A 3DO7A 3OXRA 4F1SA 1U4EA 1S7TA 4MKMA 5IJVB 32C2A 1N70A 2VW6A 4N0UA 4PJIB 4Z7WE 4RISH 2IQ9L 4HEPA 2BWDA 3DJTA 4G42A 3I6KA 3EYOA 2WXMA 2QHRH 2CHDA 4JW3A 3RWIA 5T5FA 1HHKB 4XVJH 2EYTB 4JFPA 4BSJA 3TIDB 3TNMA 1KTBA 4WDIB 12E8H 2ZUVA 4PBVC 4A6YH 4HU2A 1BZOA 3Q01A 4TL5A 5I1IH 3UAJD 4G43A 1YEGH 3V6OA 3S5ZA 5EOTA 5F6HJ 3QPKA 3KVQA 5DVNA 5GZOC 1HOCA 5DUML 3GUTB 3AVEA 2J72A 3ZBMA 4ILDA 1P6AB 3QHZL 2DQGL 3TA3B 1R24A 2F5AL 3L9RA 3G6JF 1OGAB 3FOLA 1EAPB 4F15B 2PCFB 4G8EB 4LKXB 4XNAA 3U4BL 2WN3A 3EH1A 1S8DA 5JW3H 4Y5YA 3IDJB 3RY6C 2XTJE 1KBGH 4G8GA 4OQTH 2EIMB 4PI0A 3ASWA 3F62A 4OCRL 1S9VA 4PGBA 4U3XA 2FX9L 5IOPB 5IROA 4RGNC 4EUPB 1I3UA 4IIQC 1U95A 1OOWA 2LE9A 4Y4HB 5EFIA 4NFBA 3WUZA 4LRIA 5IQ7H 2CO7B 2DQGH 2ZSVA 3HUJB 3AABA 1I9IH 3U2JA 1KEMH 2WTRB 4AKOA 3WYRA 2O61B 4MMZB 1E4KA 4ZX3A 2BNRE 2L7JA 4KXCA 1FPTL 3FB7B 3MO1B 3OKDB 1FUNA 4W9IC 3JWDC 1BOYA 1JVKA 5D4HA 1OSEA 1MFMA 4WCYH 4RQQA 4JJHA 3TVMA 1NCAH 2PR4H 2APTA 4RX4D 3V0IA 4CC1A 5KW9L 2X7LA 3ABLB 4A2DA 5I71B 2WTOA 4DO5A 4GSQA 1JN6B 1SF5A 1I7UB 2ZXDA 3SE4C 3V0VA 1OM3H 3ORJA 4Y4HC 2EADA 2NYKA 1EH9A 3QYCA 3UTOA 5SV4A 3PNWA 3RKDC 3BWAA 2VZ3A 2NQ3A 3FNKA 4HFUL 5I15H 3EO0B 1EXGA 3NACL 4PG2C 1A2YA 1YC7A 5DS2A 5KVMC 4XCNB 1CFSB 2VDLL 3DX7B 5I1HL 2RGSA 1XZWA 1GJUA 3VFMB 4Y2OB 3FQXB 3HAEG 4UINL 5DRWB 5L2KB 4PJCB 1NFDB 4FLOA 2UY7B 3SD2A 4JHUA 4PJFB 4RGOL 3SZ6A 3P4OA 1I3VA 3B2VL 1YYLL 2DW5A 4UZGA 1WUZA 4K94H 4L3CA 3QWRD 3SYAA 3MYZA 5F0MB 1DO6A 3A4FA 4BKTC 1IM9B 3W9EA 3DURB 4WENB 3EYVA 1JZ4A 1LO4L 2MIZA 1HQ4A 1R46A 3K3QA 3RJDA 3ULUL 1BGXH 4LAJH 1X9RA 3H9SA 3LEYH 1FYTE 3MZGB 3FRPA 2DMHA 4JDEA 3BQUD 4KQ0A 4OAWB 3IM1A 5GISL 1W80A 1OAQH 2W9DH 1SDDB 4NZUH 3U4BH 1BLIA 1IBGH 4U1IB 5EOQL 2WN2A 2D03L 3BZ4A 5F3FA 4WF7A 1BG1A 1KELH 5FO7B 3TFKC 4NPJA 1BWMA 4MJIB 3STLA 1PJWA 3B2MA 1Y1DA 1DSYA 2D4FA 3TTSA 1MFBL 5I1CL 4B7LA 4UQ3A 1DQKA 5FKPB 3M1BB 2ZCKL 3UPRA 3CVCA 4JQIA 4ALAC 5L2JA 4FD0A 2CIIB 2YHGA 1A3QA 2FL5B 3OXSB 1BD2D 3ES6A 5C3LD 3TNNB 4QOKE 1SMOA 3F7QA 2V9UA 2FWOA 2WLLA 1YMMA 5C0CA 2UWEE 4OVVA 1BAGA 1C12A 3IK2A 4N2BA 2XPGB 4NNXB 4AIOA 1P7BA 1X5AA 5L2KA 4Y19E 1GY1A 4GXUN 3EYUL 3KPRE 1BDYA 4S1RL 3H0TA 1ULVA 4MDJA 4OI8A 4N2CA 1JPSL 3TO4A 4Y9FA 3BDBA 3FRUB 4ERSH 3V9CA 4FG6C 4QF1B 1P5VA 4YHPB 4YFLF 1I85C 1MLCA 5DMJB 4ZXBA 4ODSH 3DC0A 2BHZA 1U95B 1G7LB 3OF6A 5KTEL 5E2JA 3DBXB 2DL2A 4V2CB 1D9KD 1PX4A 5EOCL 4HOZA 4KJWC 3GMOB 5DD6B 1RLWA 2CDGA 2DQTH 3UC2A 1EFQA 4FG2A 1N10A 2F53D 4FXGC 4KRPD 4Q6IB 3PIQB 3NZHL 3PQYE 5HD8D 5EORH 4U3SA 1MIMH 1JDCA 2B1AH 3HE7D 1LP9E 1UD2A 3BP6B 1KJVB 3SBWA 4AOFA 3LRKA 1E6OL 1FC1A 5GGUA 3WAKA 3RWHA 1G7QB 3TPUB 4OJFH 1WP6A 2SEBB 5A2KH 4EKJA 4UYQA 5IWLC 5JPNA 2CKBH 1QASA 1QMUA 2WUBH 3BRDA 1D5XA 4P05A 3SJVB 4F2MA 1IFHL 1I1YB 3FQNB 3FT0A 4I3RH 3NEXA 1MQ8A 4U3SB 4UB0L 1FFRA 2APBA 1KV7A 4AIZB 3LH8A 1B0IA 1OSYA 1EXHA 4FNLL 4YH6A 5IBTL 5DA4A 3O3AA 1AFVL 3MRQB 4HS6B 4D94A 1UCBL 2OMYB 1TYJA 5FB8B 4H8QA 3QUXA 1B4JH 1F5WA 2DH3A 3N42B 3WD5H 3KLHD 3GUTA 5T3XL 3WJLC 4ZS6C 4XO3A 5DZPA 1USZA 3H7LA 2J8UA 1JNHB 3FRUA 4E41B 2V0AA 1OTSC 1TJIH 3QUYA 4X4KA 4BGDA 1X5YA 1MFUA 4B3EA 4U1HA 3BVWA 3QEUB 2OMWB 1U2HA 4MWFA 5KYNA 1NDMA 2NTSP 1DCEA 3ECWA 4LEOB 3VXSB 1TQVA 3ARPA 1YYMH 3P02A 1XH3A 3BEVA 4M6NL 5D1ZA 3GBNH 1M53A 1FIGL 5DWUH 3WG7B 2Y25A 2DQMA 3CLFL 2UX7A 3BH9B 5JIHA 1BQ5A 5D7EA 3QWOB 5FF6A 5MHSD 4HUWA 1J8HE 3WUWB 4J2XA 4M7ZC 2FEDC 5HYJE 4J6RL 3JZYA 4FXKA 5BO1L 3OZ9L 4L0YA 4MJIA 3STLB 3UGEA 5KYYA 3KYNB 3M8OL 1VENA 5ESAB 2ESVD 1PLAA 3WI9A 5ESQA 3MREA 1CFVH 2E6JA 5K5YA 1SDYA 2BOBA 4RDQF 3UBGA 2ZKHL 2X4QB 4RMSA 3IFLH 4BWWA 4HQQH 1XR9A 4FJYA 4HUNB 5FOBA 4HJTA 4YSEA 4XPTH 1JXDA 3AUVA 4YBQD 5J11C 4BSWA 4A66A 2IJ0C 3IS0X 2ZX7A 3QIUB 3K4DA 4UQBA 4LCYB 3LXUX 4IS6A 4PJEF 4H25A 4OCWH 5HHOE 4X4YB 4X2UA 2BIOA 4HKXA 1BYOA 5DUPH 1FSKB 4O5LH 4O00A 3QRGL 1G94A 2YXVA 2YQGA 3EZJB 3ZT6A 3C6LD 4PBWD 2UZXB 4TSAH 4OZGB 4BFIB 5E9DD 3VD4A 1QYGH 5HY9B 1DBKL 1UJ3A 1DBMH 2GEQA 1DQIA 1LEKA 4AMXA 1WK0A 4EZLA 3GDBA 5GS3A 2Z8RA 2DM4A 3QC5X 2BFVL 1KB9K 5HHOD 5FDWA 4ALAH 1NPUA 2VW7A 4L9LC 4WAFA 1JBJA 4B9ZA 3COOA 2CBTA 4IRJB 4XXDB 4DKFH 4JL2A 2X89A 4JJ5B 1LO3H 1XGRB 3RX7A 1A22B 1N7MH 3VGHA 4W81A 5JMOC 2FQFA 3NCBB 3U9WA 5IQOA 2VAJA 2YAQA 3BKJL 5K1VA 4ZMAT 5TF1H 4GUPA 4G9DA 1L9SA 1O9VA 1AE6H 3H2WA 4YHIB 3HVDA 4OI7A 1S5HB 1IC4H 2WWMD 3M17B 4KKAC 3P3TA 3BP5A 3Q8EA 1RPUA 43C9A 1FSKC 3H3BC 3KM2A 3QUKB 4MCZB 3S5LB 5C9KA 5HSFA 5D5ME 3HR6A 2YS4A 4CDGC 4HIEB 3SEPA 2UWEF 2P48B 1OXYA 5AAMA 1RZ7H 3OTTA 2PCFA 4LKXA 2XRAH 3SKMB 4ZMYA 1N0XL 1TEGA 2X0VA 1GPOH 3NH7H 4FULA 3ATEA 2R51A 4G80B 1G7MA 1I1AA 1OP3H 1X5HA 3FBKA 4DJMA 3ULUC 2QEJA 4NKMB 2A9BA 4CILA 2KI6A 4BEIA 5IW1B 1JL8A 1BREA 4B96A 4FI7A 3MUJA 1ZKAA 4QXTA 5JORB 3NFNA 1XEDA 4UM9A 5IMKB 2CO7A 2GBTA 3HUJA 3G6DL 2IAMD 1R1CA 2EDJA 2JH2A 3GSUA 3FQWB 4H8WC 4R26H 4GSRA 4Q4EA 5GZOA 1QFWL 3NDYE 4A67A 5E8OA 2WXPA 2EINB 3QWQB 1NGXA 3TGXA 3IF1B 2AI0H 5AB1A 3TCLB 2F5BH 5ILTH 3PFQA 4E0RB 4XHQA 3SDYL 4QRRE 3SE8L 4XMWA 1DQVA 3K1KC 4QRUB 2AEPH 2R0WH 3IETA 5C7XL 5LGHL 2E7DA 4POZD 4R0LB 1ZS8B 3UABA 4WTZG 4PJGE 2XWRA 4HKZB 3NJHA 1XD0A 5EU4A 1LO0H 4A2EA 2J1KA 1XL4A 2JJSC 4KY1H 2A3TA 4LVHC 3Q5TA 1MCDA 3CXDL 1KNOB 5ISZD 2OZ4H 1RZJC 1IAMA 1HHJA 4CSSA 2QZQA 2XV6B 1E3ZA 2PW1B 3APNA 2P5EB 3EYUH 1A6TB 3MCLH 3BQUB 4P2OC 5H37G 2Z92B 5AEAA 4C83A 4AEIH 1DBKH 2BVYA 3NSFA 1AYOA 5BXFB 4N6RB 4QHKJ 3K6SB 1YG9A 3KLAA 3PDGA 5I2IB 3C6SB 3FTVA 4OR1A 5CEYA 4Q74A 4N9GA 1OGTA 1C5DB 5D7HA 3I85A 5C8JB 2Y9RT 1C5CH 3GWJA 4LVHB 4XI5C 5DQDL 1UA7A 4ETQB 4KKLC 2OPCA 2YKLL 4FQXC 4YDLC 4UWQB 4HH8A 2EXSA 2P3YA 4RFEA 4U1GC 4XPBL 2J88H 1ZHKB 4HH9B 4JO1H 1I9RH 3ARZA 4JPQA 3ZKQD 4YOKA 5L2KD 3PP4H 1R9FA 3E1F1 5E9NA 2ZWSA 4DCQB 1PCXA 3T4AC 4I13B 3B9KC 4FKHA 1J5CA 2Z7ZA 4NXKA 1RZIA 2XG5B 5EORL 2OMUB 2YPLB 3IJYB 3WTWA 1PD0A 1MUJA 4QXGH 1I53A 4PJ8C 4R5TA 3CQQA 5T3ZH 2E7LA 4IDLA 4YVUA 1T3FB 1BJ1J 2ZXWB 1NWPA 1ASPA 1LK2A 2FD6L 2UV3A 4EUPH 1IGCL 3US9A 3FB5A 5DVPA 1CU4L 5D4QA 3IDXL 2NY3C 3SDYH 3QEUA 4HV8A 1TQCB 2KC0A 4U6HA 4YDLB 5F1NB 1U8OB 3HE7A 4XO4A 3CZFB 5KSAD 4ZFFB 1G7IA 2O6PA 5J89A 2VYRE 4XCEB 3EO0A 1KEGH 2VL5B 5DC0A 3DOSB 2OAAA 4FP8H 3P2BA 1KDIA 3Q2CA 3VGAB 4AQEB 2JSFA 1DANU 4HEME 4LSSH 1U42A 1T7XA 2X4SA 5KVEH 4Z7WF 4FXKB 4PS8A 5TFSH 1MN4A 3V5HA 2ZCLL 4CW1B 4KKQA 2X2UA 5ID1A 1P7KA 3NH7L 2WUCL 5HDWA 4O51A 3ULVF 1LK3H 4MS8D 3BLPX 3LS4H 3TU6A 4Y7MA 5CBEB 3Q8CA 1AGDB 5FOBB 1A7QH 5KN5A 4JRYA 3VD3A 2OXGA 2QADD 1UD3A 4ZUWA 3WNPA 4UT6L 2JXMB 4DT2A 1JHKH 1KJ3L 1ZHKA 2PP9A 3FB7A 4KDWA 4H44C 3ULVH 3MPCA 1I1FA 3TJHC 5I0YA 4UT6A 5AVWB 1JGEA 4L37B 5ERWA 4Q9RL 2HKFL 2N3JA 3RY6A 4F7MB 2OMYA 1BXXA 3E38A 2GSIB 3ARDC 4HBCH 3VGAC 4G6ML 3VB9A 4WLCA 2R23A 3MOBH 4Z3TA 3P30H 5EU6D 1KJ2A 4X98B 3WE6B 3VSQA 4DKFL 5HYQB 3QP3A 1XGTA 4KDTC 3RNQA 3VO0A 1GHFL 5JQIB 3ESUF 1W0VA 2BFVH 5C08E 1C8QA 2NZIA 3C9NB 4XPAH 1TVBA 2FQEA 3PDDA 4PRDB 5IVXA 4I5BA 2HJLB 3HB3C 2IWKA 3DV4B 4ZPVB 4B9CA 4MXVE 1QZNA 2DBLL 3ROLB 5T33L 4YL9A 5E2TL 3U2SB 5BUPA 1N18A 4WW1A 2WNKA 3FQNA 5AVUB 4Z3FA 2B20A 3O2WL 5IVXF 1GGCH 3NCJH 5DVOA 4ODSL 1BHGA 4OI9A 5DQ9B 2HPTA 2BXYA 2CHZA 1O0VA 3CVHL 4Q4IA 3D30A 3ZE2B 3AMLA 3UBXG 4PWFA 4YJZL 2EO7A 1J1OH 1TMQA 1JAEA 1U58A 1XIWD 2Z8VC 3MLYL 4WFGD 3R18A 1MWAA 3DMMC 1NDGA 4AW4A 3PGFL 1OB1B 2DQIL 4GG6B 5B3SB 3DIFA 3HIZA 1H3WM 2AXGB 3MRBA 5E9DA 1E27A 1N19A 3VXRB 3IVKA 1CE1L 3U36B 3E2HB 1JZ7A 3RFZB 3VAEA 1MG3C 1EEZA 3A6BL 4O51B 4LFHG 1LILA 3GUFA 4DTGH 3SO3C 2NY5L 1PMYA 3MRIB 5CWSA 3E9TA 5F97E 2EC9T 3FN9A 1AKJA 2X4UB 4DGIH 4YSUA 4AM0A 4Y89A 2WK2A 5FUZH 4GAJL 4EMZA 1H5BA 3STZB 3MJ7A 3VJ6A 3QDGD 2J20A 4WY7L 1WBYB 4HK0A 5C0BD 3KGRA 3HG0A 4OZHF 4TN9A 4YL4A 1JF5A 1PIGA 5E5MA 3GKWL 2FUQA 1JZ5A 2PYEB 4NUPA 4IBQA 2ZKMX 5D4IA 4GP5B 5DRNA 5DQJA 5E2WL 2ZUUA 4KFZC 3FXIC 3CAFA 3MSPA 2D0GA 2N7AA 4NN5C 3GB7B 5DMIL 1DQMH 2CJUH 4OGAC 4E9RA 5LAXB 5E6IB 3ES6B 5MEOA 3UTPE 3NIFE 1BFSA 1MWOA 2WQAA 4FFWC 3VFRA 2FWOB 1N0LB 1UZ6F 1F86A 2PXYC 4MA8L 5J11B 1IU1A 1G43A 1DBBL 4WIQA 2XUWA 3WOVA 7FABL 4HF5H 1BAFH 3CLWA 3EIFA 3GMLB 3SDDB 1MZZA 3VXQB 5C6TH 4HS3A 3TH4T 1QFOA 2BVPA 1E42A 3RL2B 4MDJB 5IMMB 1OW0A 2GSGB 3D3VB 3OPZH 3GINA 4JFEA 4L29A 4OT1H 3BI9X 3QUML 2A1WL 2Y69B 1JWUB 2B5IC 4NWUH 1G87A 3CBJB 4BBWA 2OJZL 4KHXH 5L8JB 2G2RA 4JRXB 3QNFA 4F8LA 2WW8A 1I3GL 5F89A 3L2LA 3KW8A 1M6OA 3BIKA 3OKMB 4L4VE 4NN6C 3BAEL 4YEFA 2IQAB 1W91A 4G3YH 1QWUA 1OGTB 3NACH 4L9LB 3ZZ1A 4HT1H 4OY9A 1L7TH 4AXWA 6FABH 2P24A 1FORH 2JCCB 4RISL 1B0GA 3MCYA 3ESVF 3KBFA 4WUUA 3VRLE 5GJTH 3ZDZF 3UJJL 2WPGA 4HWNA 4J4PA 5DLLA 5KZCB 4A04A 4AH2A 3HE6D 5FYKD 1OO2A 1ML0A 2VDKB 1G9HA 4FDWA 5EBGA 4CUCA 3LKOB 3VXRD 5D2NE 5E1AA 4BD4A 4IBSA 5GS0L 2OK0H 1NGWB 4OZGE 1Q72L 5JOPE 3JYBA 4FI8A 1DDTA 1XIWB 3IRPX 3DMMD 4MJ4A 5ESQB 1XCWA 2YC1A 1GHFH 1NBZA 3S5YA 1PLCA 5BOJA 1DHKA 1NCGA 1F90H 3II1A 3AAZA 3LSOA 1VF5C 1JI1A 2X1XR 4KJPD 4AMKH 1DANT 4YHOH 4NO0A 3TBCA 4D9QD 5F96H 1UH2A 2XZQL 1WS7A 3KEHA 5AL0A 2VISB 1OT1A 1FYTB 1RU9H 1I3RB 2VUOA 3BSGA 3D69A 4KROD 4MXQD 2APVA 5CILL 1JYNA 4ANUA 2I24N 3D85D 5DDHA 4RMQA 4XMPL 3OJVC 1ZV5A 3SY0A 1WH0A 3I02A 3W0WD 5AW6B 2W60B 4OZIA 4M5YH 1TLKA 5GGVH 1B0RB 3MJWA 1C1EH 4R7NB 2DPKA 2ED7A 4UQIM 4EI6A 1JHLL 4MNGB 1KF9B 1A02N 1TSRA 4Y1TA 1IAOB 1LK3L 3OKDA 2ZYRA 1VEMA 3MJ9L 1B2WL 2C9QA 3DSFH 4QYOB 5TQ0H 3ARDD 4OF8A 3VFGL 3INOA 3LZLA 5HHME 4AQ1C 4N9GB 4DGYH 2H1XA 4DKEH 5E00B 1AZNA 5E94B 4C54A 4DTGL 1R34A 1FLRL 1XR8B 4JMNA 5B38B 1S9WB 3VA2C 1L5GA 1IBGL 1UXSB 2RCSL 5FO8B 1FPTH 1AJ7L 3QJOA 1DUZB 1TVHB 3VFOB 2ROYA 4CJ0A 1OHQA 3WFEL 4PJIA 3A24A 5JIMA 3P4NB 3VGGA 2DKMA 4YHLL 4RETB 4ZX4A 2EXYC 5F7LB 2VMEA 4HJUA 3BH8A 3NK3A 1KCRL 3HFMH 3QIBA 3PWNB 4GRLD 4U6XA 1EX0A 2H3XC 1V8HA 3F7KA 1CFTA 4HJJL 1H0DA 4I88A 4TTGA 5JHLH 1YNLH 2CRYA 3F7VB 1SHXA 4TTDC 1W15A 4LOUC 2NYYC 4RZKA 1X44A 1YEIH 3T5WA 3T6XA 1L6ZA 1QPPA 3L1GA 2B9BA 4BZYA 5IFHL 3ZYOA 1MJJA 5HGBB 2NQCA 1MZYA 1I9EA 3B8YA 3EDEA 5I6NA 2Y0SA 3N41F 4ODUB 5KJ4A 2XX0A 1DEDA 2BO0A 2CDGB 2OYMA 3GSUB 4Z7NB 1A7QL 3DX6A 4AV0A 1QG3A 4Y2DB 5T1MA 1ZXQA 4YDKL 4UT9A 2OX5B 1VFBB 1FYHB 3D2UA 2V4LA 3B2UD 5F1OB 3L3OC 4L1SA 2LLLA 2Q8BH 4N1CA 2FSEA 4IRJA 4MRCA 4XXDA 1L9MA 3HG2A 1MW3A 1OALA 2NY0C 3ZE1B 1W2KT 4OZGA 4X6DA 5J6GB 1F6FB 1WF5A 1JYXA 2VRQA 4WKXA 4JM0A 4GRWH 3NA4A 4OJCA 2JCCA 2EDQA 2EUZA 1TEFA 1JK9B 1TQCC 1AS8A 2HCZX 3QUKA 4MCZA 1M6UA 2OMVA 4PR5B 1WWCA 3CZSA 4OLZH 5CZXC 2B4CL 32C2B 5FX3A 3HLAA 4WO4D 4LSSL 3CFIC 3MQIA 3OLDA 4TVSa 3TYGL 4MBRA 3JWOL 3BX7C 5I75B 4BV1A 2P8MA 1WITA 4ATWA 4H88H 4NUJB 2ATKA 3VSTA 5D1QC 2OSXA 3WHE0 1GZPB 3GRWH 2WLJA 3LQAL 4OCRH 4ZRGA 3B9DA 5ECGA 5J6GA 3ZR6A 2VDPL 3ZL4H 1I85A 3Q1EA 3RP1A 1JXJA 3AY2A 4LP8A 5HI3C 4OZHA 1OVZA 3VNYA 2HWZH 3TBSA 2IH8A 5IQLA 1NMCB 4JHVA 4XNUH 2MFNA 4XBMA 4GRMB 4DK6A 1M7UA 4NJ9H 4OD3L 5AKRA 1UENA 4FQ2L 5FHBL 1MWAL 1IC7H 1ZEAH 4Q9RH 3RVXC 5F0LB 4B95C 1RSYA 4PRIA 1JJUA 3N2JA 2K6YA 5I75C 4G8GD 2XBZA 3H54A 5KANG 5D1QB 4AW7A 4EBQH 2CSPA 5HP5A 3OZKA 2VZUA 5IEHB 2Q20A 3CN0A 3V6FA 3IMSA 1UZ6E 2A9AA 4ZMVA 2G5BA 5BOPA 2P8LA 2UVFA 4PSRA 3VXOA 2NUTA 3H9HB 2O72A 4LP4A 1MJUL 5IT2H 1C5CL 1A8ZA 4HETA 4NO3B 2A0LC 3NCXA 5EU4B 5ISZA 4A2HA 4N24A 3OJMB 4LCCB 4U0RC 1A4JB 2YD0A 1SY6L 2MWCA 3L5XL 3OAUH 5C1MB 3CCHA 2WINA 5KVGL 2ALAA 3B37A 1A7RL 5CGYC 5IZ7A 1FCGA 2L8AA 3C6SA 1AQDA 2EH7H 3V4VH 3UG3A 2XYCA 2YA2A 1TOXA 3DKHA 4GXUM 1KB5L 3ZMEA 2BNQA 2GBAA 3L45A 4UAHA 2FBJH 2EDXA 4AM0Q 1WCQA 3LY6A 1F4YH 1U8QB 1CU4H 5D7JC 3TYFB 3QQNA 4ZS7H 2XN9E 4FMFA 4YNYA 3FFCB 4Z7QB 5EZLA 3GM0A 1WTLA 4V33A 3ZPDA 3PHSA 4MNHA 1OF2A 3T08A 1MF2L 1S7RB 2BPBA 4PJ5A 3L6FA 5T1DH 43CAA 3BGAA 4QXGL 4HOXA 3W39A 3RVVC 2Z7YA 4AIZA 4JCMA 7TAAA 5I1LB 1B6UA 3LN4B 4KY2A 2VLKB 4EOWH 2JNZA 3VG9C 2XG4A 4YSQA 1FE8L 4F92B 2JI3A 1F18A 3FF7A 1HYSD 3BJ91 4YHPA 1OKEA 4YPGA 4I3SL 2H45A 3GXFA 3P77A 2J4WL 2J43A 2VQ4A 4G7YL 4FQXA 3FO9A 3MV7B 1IKOP 4WU7A 3SDAD 2AXFA 3FCGA 4L4TD 1R6VA 4U6TA 1U4FA 4NQXA 5GRXG 1U8LB 4XB7A 1YEEL 4WI8A 1AIFA 1MJ7H 3BKCH 3U30C 4JDZA 3MODH 4X99A 1WHOA 4PB0L 1E30A 3PP3H 3JT0A 5D71H 2VDOH 5J3HC 1M2OA 3GXIA 4WTQA 5GGRA 3AS3A 3JBG7 2J44A 3I50H 3TH3T 4DEPB 2AMGA 5DZOA 2ICWB 5AVZB 3C8KB 5C0DB 2XN1A 2CUIA 1PTZA 2XN2A 3EADA 4OCNC 4F7PB 3AS1A 2BJML 3ARBB 4BZ1A 4E9SA 3ZZQA 4IMLB 4NO2B 2FGZA 3K2UH 1UJ3C 4ES9A 3K6FA 5DC4B 3LKRB 3MA9H 1IM3A 3DO3A 1M6OB 3BIKB 3KJ6H 2BX5A 1XF2A 4OGAD 1N6QL 2HH0H 2HWZL 2DQ6A 3HMXA 3NP4A 3QNXA 1VFMA 4JJ5A 2P43B 3OQRA 2A6IA 1F4YL 1G4RA 4F2EA 2CLRA 1PGRB 1Z66A 4P49A 4TQ8A 5BVPH 3IGLA 5DDHB 4X4XB 3JUYA 4K2UH 1SYSB 3QR0A 4XC1L 2EEBA 2XQYA 2ZYIA 2ZXGA 1HIML 3OG6B 2WXQA 4E41D 3TBVA 4JZJC 2WSKA 1T4KA 2CHXA 1RQ5A 4NKDA 1XIWC 2GG1A 1D7CA 2Q76A 5E8NA 1GR7A 3QIWD 3OR6A 3GFUA 4QTFA 3SDAB 4N2HA 5FK9A 4XN2A 5JHDB 4XNQA 1OQXA 3DSNB 4HUKB 4GMTL 4LCUA 3VMNA 2R2BB 2WGXA 5DS8A 3VD5A 4BQCA 4XC1H 3VXMB 4OZHB 5AW4B 1INQB 4QNPF 1GC1H 1OCWL 3OR7A 4PJCA 3SDDA 1Q4NX 3MNDA 5LBSH 1XGQB 2VLKD 3VVVA 4DVRH 3J27A 1CFQA 1MDTA 2DQTL 2W0KA 2OR8A 1A4CA 1Y18A 3BKML 4FG0A 1U41A 2R0LL 5IUCA 1LMIA 3FFOA 2WLNA 5G5DB 5KYUB 1P4BL 3WTUA 3DGGA 1LO2H 2PKDA 4JKKA 2NX5A 4CKVX 3ARGD 4PGBB 5LG1A 2Y2YA 1FH2A 2X4RB 4BFEA 3P4OB 3QQXA 5L4MA 1QRND 2AXGA 4K9EH 1HC1A 1ND0A 4KXDA 4ZOBA 1Q72H 3MJ7B 1OF0A 3B5TA 4XNBA 1ZT4A 1IX2A 4IHBA 1U9KA 4RIRB 2P42B 4WU5A 2FJGA 3ZKSD 1E3XA 1Z0NA 3K8LA 1NFIB 4E36A 3QGVA 1K4CA 1JNHA 4I77L 5E03A 4Y9BA 1U8PA 2LU3A 1HN1A 3F3HA 4MA7H 1VFBA 2Y7QB 3CX5J 5F8QC 5BZDA 3FCBA 4Y1AE 4YXHL 1UT1A 3ZIMA 4DPBX 1OAZH 1RZJH 2BFGA 2XBDA 4OF0A 4Z18A 4J3UA 5I1AB 3BN9D 4Z8FL 5IROC 1HSBB 4NHCH 1UXWB 5J9PB 2X28A 4N8PA 3U6XA 1KYUA 2NY2C 2A6DA 5LGJA 3MJ6A 2XWXA 2P5WA 1C08A 3CFKB 1XDTT 1NGZA 3A6CH 2OJZH 4M1CD 3L3DB 4XMXA 2H26B 3ZGIA 2YO3A 2CALA 2X4PB 3WJJC 1UM6L 4MAUH 4OD1H 4QDGA 3F64A 4LLDB 4AGMA 1FZOA 2BIIA 5JIDA 4R7NA 2BSRB 4YDKH 2AQNA 3TOPA 2XTSA 3S98A 1ACYL 1JNLH 3T9WA 4Z0XA 4Z78B 1XF5B 3QIBC 2GITB 3EYOB 4NLHA 5B39G 3IKCA 1DEEB 2FBJL 3VD2A 4AT6B 4D3CH 2YK1H 1TZHA 7PAZA 3MRFB 3NJVA 2R23B 5LQBH 2A9DA 1OANA 3R1GL 4YXKH 1YDPA 1AG6A 5ITFA 2FB4H 4OTXH 2XNAB 3CPUA 2G9HB 4WO0A 4CL7A 1QUNB 1JWSA 1G0XA 2BNRB 3F6IA 5K93A 4S0SD 3FCUB 5I16B 3ROOB 5HYSG 2P28B 4GG8B 1OF2B 3QJTB 4OLZL 1MFCH 4H20L 2JIXB 3V52H 4WO4B 1AZUA 2HLFD 1ZTXH 3HR5A 5DJZA 2VL5A 5F7WC 1XF3B 4CGUB 3NCYS 3OC8A 3MBEB 4JZNA 5AKSA 5EU6A 5AAMC 5KYXA 1BVOA 4LEXL 1OOAA 1VIWA 1B4LA 1N3NB 4FFZL 5DURB 3CHSA 3T0VA 2P52A 2VDMB 2RJMA 3RYMA 3T0DA 5JQ6H 4S11A 5FK9B 5JHDA 1A5FL 4K8RH 3CFEA 2VABB 5I23A 3AXHA 3L1OL 2MPAH 4NRXA 3O4OB 4JN2B 2K7QA 4PP2A 3EGSB 4J4PC 3D6GA 3KPLA 4GBXC 5I1CH 3FUHA 2R4RH 2IMNA 4Q6IC 5LNDA 2A7BA 4QXVA 2EIJB 2NY1C 1E8WA 4WEBL 4UT9H 1U8OA 3OSVA 3RA7H 3DSFL 4LXFA 3VRLF 4PP1D 1MREH 1NFDA 4LAQL 3HG5A 3FTYA 5DHVH 4LASH 5F1IA 4FFYA 4UIMA 5DK2B 3Q05A 1AC6A 1I7ZA 4W6WB 3T2QA 5ITBL 2JELH 1OCOB 1WT5C 4TM9A 4V1DE 1LWJA 3F7PC 1N5YH 1BECA 1KY6A 2AJUL 3LKNB 3TM6A 3W1ZA 2FX8L 5F6HI 2NNRA 4Y16A 1JFQL 1MRFL 4LSRH 2B0SL 3WTVA 3O4OC 5HYJA 4K3DL 1TVDA 4LSUL 3CC1A 3GZQA 5D6CA 5I66B 4JDTH 4E2OA 1YYLH 5GSRB 4KK8C 1Q8MA 3D12B 3X3GH 1T6VN 4CMMB 3BGMA 1GS7A 5FUZL 4ZMLA 2CJUL 3ZGHA 4M02A 2MCMA 4CMHB 1Q0EA 4LPVA 4Y0GA 1ZLEA 4N26A 1W0WA 3QCUH 5FYLL 3GKWH 4ELKB 1D5BA 5FM4A 4BFBD 3GJEB 3B2UC 2IWEA 2Q1EA 3NPSC 2X2IA 3W57A 4AE1A 2HA1A 1QLRA 4WSGA 4HGMA 4XX1E 4DZBA 3BAWA 2HMID 2JQZA 2OCCB 5GPRA 1SVBA 2JWYA 1HT6A 3FC8A 5DEZA 3B5GA 4NENB 2I9LA 4L05A 2A9NL 2VN4A 1BJMA 3EGSA 4UCFA 2EVIA 5DC9B 3S34H 2C7UA 3BHBB 5IEKB 1ZLDA 3OKOA 1PD6A 1MEXH 4IHOB 4O4YH 3KYAA 3PV6A 5EU5B 4R3SB 3WU1A 1EAPA 2H2PD 4M7ZB 1B2YA 2WP3O 1NGYA 3D85B 5E7BA 1NC2A 1S7XA 3FHAA 2XZQH 2YOCA 4Z3HA 4FQ1H 4JE0A 2YGQA 5FAAA 3VXUB 4U1KA 4MA1C 1YNTA 4PY7A 4E41A 3ULVD 5IHLB 4KXBA 3ULUH 1TO4A 1TENA 2WMPB 3NPSB 4PHZA 1M05A 3MRHB 4ENEC 3V8CA 1FL5A 2V5RA 2YD8A 4F7EB 1VDGA 1X9LA 3W37A 2ENJA 4BZ2L 4L5FH 1LP9A 4OLYH 2HT3D 2AJSH 2FJHA 2APWA 5IB4A 5FM8A 5CEZE 2UZYA 3PQYA 5E0QA 4WNQA 2QGBA 5DMIH 4PUBH 5GJTL 1HQRB 3HE6B 1RP9A 4FS0A 3P40A 2Q6WA 4FNUA 3SPJA 2HFEB 2F5AH 4YSOA 2DN7A 2NSMA 2GK2A 1KPUA 8FABA 4TNWF 1KPRB 3T8MA 1ZMYA 3F58L 1E0OB 4H2AA 4KU1A 2DICA 2FH8A 1ORQA 2L7EA 3MVSA 4KUZH 2NX5D 3WFZA 5TQ2H 1QFUL 1VACB 1U6AL 3EYQC 4UV7L 3CK0L 4M56A 3BHBA 5IEKA 4NWUL 4J39A 1BG9A 1O7VA 1YMME 4YX2L 4RMUA 2A0LD 4A7UA 5J7CC 1EEYA 2CJTA 2X5PA 3F85A 1MNUH 1JCVA 3MRCA 1TDQA 4HKXB 3P9LB 4K9EL 3D3VD 2DQIH 3FSVA 2E4FA 2E7BA 3VCLA 2UZPA 4UU9B 1B3IA 4RSYA 2MOQA 5I76A 1WFTA 1RIUL 2E8YA 3HS0B 1IGYB 3TCTA 1H15A 4LSRL 1CGWA 1U2YA 2A4ZA 3C5JB 1AO7B 4PRBA 3AXLA 3D33A 3QARA 4OTXL 1DSWA 4FFWD 2E56A 5JNYB 1D6VH 1IAIL 3D4YA 3ZR5A 2JXMA 5H94B 4WUKH 3EJPA 4PJDF 4UANA 4X7TB 5B1KA 5LBSL 3A4EA 1E7UA 4OCSL 4OJDH 2E9BA 2J1YA 1BCIA 3V5DA 4HS8L 3WLWD 1YVLA 2V3EA 3WUWA 5C0BB 1H8NA 3ISWA 5FWQA 1O6VA 4LCCA 1BP3B 5E4AA 2WXNA 3GSQB 4JZJA 3RGVC 2QR0B 1G7HB 1WAEA 1T0NA 4PJAB 2FT8A 1SM3L 4UIMB 5DK2A 2EDLA 4YDJB 4QIRA 1YLBB 5IVZB 2H6OA 3A6BH 4OBRA 2X70B 4ZTOH 1X5IA 1ID5I 3L7EB 5BCAA 1NTDA 2DI9A 5AG8A 4X42A 1XWVA 1MEXL 4Z7VF 1GGBL 2DIAA 4TNWK 2Y7SA 5GGTA 1S78D 4ENZA 3WFDH 1KJMB 4L1TA 1JRHL 5JLZA 2EDOA 3BXNA 4HCRA 1HZLA 4IOFD 4IRSC 4PRNA 4Q97A 2YD6A 1VFAB 3F5WB 1PZAA 2DIJA 2WCPA 3TFBA 4CU6A 4NC0B 1J1XH 2ZQKA 2ODHA 4BCZA 2YXFA 4MB4A 1UQSB 5F89B 4FFVC 3VXUD 1J0KA 2JK5A 2R29L 5JOPD 5L0QC 3HS0A 3NCFB 3HMWL 4NQCA 1XR9B 1FJ1B 2NW3A 5E08L 5CP7B 4B9KC 4NCC2 1RZFL 3LEVH 2Y2WA 1OQOA 5D2LA 5EHFA 3F6JA 1GZPA 1CFTB 2DQFA 4BCYA 3VGBA 4HPYH 3EH4B 1G0DA 3PL6B 4MMXC 3SE8H 2ATAA 1J48A 4WHYH 1AKJD 5LWYL 3D39B 1QYGL 1QPXA 3CHRA 1QUNA 2BNRA 4MHHG 4JQVC 4ZYKB 5DD5H 4AKPA 2E3VA 5ANHA 1AQHA 3JWDH 5SWQB 2C5DC 1UM6H 5A7BA 4QRBA 1KJ3H 1TETH 3HC4H 2ARJQ 3T4AB 4UOW0 4ISVB 2Y24A 5EO0A 4X0NA 1E4WL 5F7EL 4D8OA 4KJQC 1WFIA 2OI9B 4YDVB 3U46B 2WLIA 5JPNB 5KVDH 2ICWA 4FQQB 3WHE1 5DUJA 1CDHA 3JWNE 1FO0H 1D7BA 1MREL 2OQJA 4DOHB 3R8QA 5FECB 1LDSA 1UA3A 1PZBA 2ZXQA 2CDFB 4BUQA 5JOFA 2UXFA 3ZXAC 4K71B 3HI6L 1PQZA 2Q7YA 3MRDA 3UAAA 4APXB 1YEJH 3UOAB 3WN5B 5IHZA 4WFED 2BMKB 1HHHA 4H0IA 3VD7A 1SDAB 3PWUB 4XXWC 5T3ZD 1CLOH 3RNKA 2D2OA 1GAFH 1WGVA 1Y7VA 2ENQA 3MRQA 2FECI 3MMEA 4TRPH 4KGJA 3BVNA 4IOSA 3EYSH 3SQOH 5BZZA 4ORGB 4ORZC 4ZFOB 5CIPB 3FK3A 3VWKD 2AJ3B 1QTPA 5GRVL 2FO8A 4AWJC 2QHLA 2YPLE 1DDHA 1UKSA 1NLBL 1T5XA 3PCYA 4N8VA 4GUOA 2GJPA 3U9UA 2MQGA 3GI8H 4JKPH 3NIGF 3BP4A 5EULV 4FQPA 4HBCL 2A6KB 1CTOA 2QLVB 4OH2A 3NFNB 3VI4B 2DWSA 2VN3A 3PV7A 4GMSL 4IEFA 3VXPB 3JTSB 1R3JB 4JRYD 3L3DA 5JOEA 4DUVA 2VW4A 4QKXB 4MZRA 3RHWF 1SPDA 2XETA 4U1JB 5I0XA 4PRPB 2QV4A 4ODWB 4WK2B 4PW9A 5ENWA 2VZVA 4L8DA 5ADPL 3SDXB 2WO4A 2ZONA 3JT2A 2IG2L 2XHNA 1XCTA 4L1BA 1ACYH 1JNLL 2X4SB 4GKZB 3VRJB 5BZWA 4YHKL 2DTSA 4JFYA 5DURD 3IMTA 4HWUA 5HGHB 4P59L 1NWOA 1EJOL 4AGPA 1VGKA 2PP7A 5D7KE 4AGNA 1T1ZA 1OT4A 3OKNB 3OLGA 4NQVA 3AGVA 2IPTH 3QIUA 2Q87A 3ECQA 3Q2NA 3F83A 4OCYL 5JW5B 1IKFH 4TXVB 2EO1A 1MY5A 3D9AH 1WSST 4NJ9L 5IB2B 2D4DA 2WXIA 5EF1A 3IXTA 4F2FA 4N9OB 3SYOA 3S8WA 1IRAY 1DBAH 1GYCA 3IMUA 1TMCB 2MKLC 3PWVB 3QQ3B 4NAJA 3CZLA 3TV3H 5I66A 3RWEA 1C12B 1ZPLA 3IFLL 4UTCA 5CU5A 4JO3L 1RIVH 2P5ED 4HA1A 2WNWA 5DWUL 2WZ0A 2WXLA 5FA4A 2Z3FA 5EBMA 2OZ4L 4Q9CA 1OW0C 3M8OH 3FUKA 3ILQD 2HRPL 4TUOA 5E0FA 1ETA1 1X5GA 3N40F 1RZFH 3CJJA 1D6VL 1IAIH 4Y1AA 3KLLA 3PF2A 4DK5A 5HI3D 4DUWA 4AYDC 3N50A 5BPPA 3VFWA 4FLHA 4H88L 4WTXA 3VGFA 2VWEE 2Y7OA 5I1GL 3Q3GA 1J9RA 2ZOWA 1NEZG 2IV8A 3QXDB 2WSPA 3L7EA 3SO3B 4IRSD 3CUPA 1U3NA 1ECYA 2EDMA 5TK4A 3W9DB 5IMMA 1CLYL 4N20A 1AP2B 2V3FA 4P9ML 4ZNEA 4KDVA 3LZOA 4YDNA 3WIHL 4S1DD 1NM9A 4Q56A 1WFJA 5FUOH 3DETD 3IJEA 3KPNB 2OCJA 4P9HC 5KSBB 3B3IB 1IBZA 2ATKB 2VRAA 4XPHH 3MRRA 4MD5A 4KOCA 5DQDH 4FFVD 2WHVA 4EKXA 4L9LA 3EJZC 2DM3A 4NAMA 2VERA 3HHSB 4UOJA 2NYZA 5SX5K 4L3CB 3G5WA 4FABH 1O7DE 2FNWA 2BP8A 2Q3XA 1HWGB 3O41A 5DXWA 2WXKA 2HG5B 2EDRA 4UDTA 4W9KC 5DZLA 5F7HA 1XSJA 1YO4A 5K9OB 3IKCB 3SJVA 3WFDL 1J12A 1T04B 4F2MB 2P4AB 4G1EB 5TE4L 4OUUB 2ZUXA 2NW2B 2QVFB 5E8PB 1Z1WA 3MRNA 3GIZH 2D3VA 4HPOH 4XNDA 3AU1A 3GSRA 4EOWL 2R2HA 1CLCA 1U3ZA 4HLJA 4HG4J 5D7SH 3QORD 4ODXB 3UPAA 3OJ2C 3QEHB 4Y5XA 3PU7A 2H1PH 1XF1A 3D25B 4ONGL 4EUPG 1FFOB 4HJJH 1IFGA 1CQYA 4QT5B 4MJHA 2AJYH 3RTLA 3G7TA 4N3UA 2FCBA 5LAXA 1IGIH 5BW7A 1JXFA 1GJWA 3TN0D 3L5WB 1F45A 3X1FA 4KX7A 5HHOB 1BD2E 1K8DA 2OMWA 4M7JH 4LO9A 3HPLB 2VDPB 2E27L 1FP5A 4NNPL 4OZFA 2Z8WC 2FZ3B 3KEDA 3MX0B 1QLEH 2EEXA 2IBZY 4PG9A 4UQEA 4ZAKC 4AVJA 4MJJA 4YZFE 3ZQ9A 4LOVA 1IGTA 3C6LB 1KENH 3G6DH 4UTAL 1JGEB 2R0ZL 3Q6FB 4L37A 5E8DH 1WAPA 4L4VB 2Q7AA 1K8IB 2CMRH 4DPAX 1G7QA 3TPUA 4AMWA 1EHAA 4HVBA 4P59H 1BPLB 3C87A 3MV8E 1EEZB 1MCPH 4G7QB 5DJ2A 5F7MC 1EFXB 2KT6A 4NRZA 1NAKL 3V0AC 2BP8B 2XRAL 1HSAA 2ZKHH 1KIQA 1CTNA 4PJEB 3C12A 3BGFC 1TLMA 5KBPA 3NZSA 1HL9A 3CH1A 4B9JA 3T0EB 1A21A 5EMYA 4JFFB 4N5EC 2X6CA 1OSPH 1ZT7B 4YXLL 1HHHB 1E28B 5DQ9A 3Q6FA 2W0FA 2MKWA 4ZK8A 1P6WA 3QUZB 3BMVA 2Y36L 3NIFB 2Q6WB 3LKOA 4YN3A 3DOHA 3Q5OA 5IM7B 4DZ8A 4F93B 4XNUL 2EVGA 4AY0A 2PCPB 2GYSA 4O58L 3R8BB 4GAGL 3ARBD 5ID1B 2V7NB 3HG1B 1N12A 4YHMH 5AYUH 1LL1A 4LZKA 1TQWA 1I8MA 2G3ZA 3ELAT 4PW4A 5G5DA 2DQDL 3VXSD 3Q3GB 5IVOA 1XGPB 3KPTA 3MR9A 1GW0A 3TIEA 1UOVA 3U9PL 2P5WD 3U82B 4FQLH 4WTWA 4WFGE 1EJFA 4OLEA 4BZ1H 2Y2TA 1F4AA 3CCHB 4XGZA 1EWHA 3V0WH 1FNGB 1Y0LA 3OV6A 2WLMA 4AJVA 3OKLA 3R4DA 4KRPC 5D6DA 1INQA 4I48A 1BBJB 4JRWA 1L9RA 1RULL 4V11A 3B2VH 3PRZA 4PMFA 1GXEA 4HX1B 4LT7A 2KPNA 2QTVA 2ZOLA 4YZWA 4Y2OA 4K3GA 3T2PA 1ES0B 2H3NA 1H6TA 2OTWB 4G6JH 5IOKA 1FNEA 4X8JA 3SYCA 4XN8A 3E6FA 4DESA 1OL0A 4C57C 1MQKH 1TJXA 1U91A 4KAQL 2OMZA 2C1OA 2DYSB 4WEEA 1FAIH 2QVTA 3N5AA 1L0XA 2A1WH 5C0JA 4JFOA 1JGVL 3S35L 1J88A 4KO7A 2E86A 4P3CH 1DO5A 1J18A 1UGKA 5HVGB 5EDSA 3O6MH 2X2YA 3W9EB 4LMQI 3T8XA 1FG9C 1Q9LB 3BPCA 4HKJB 2DJ4A 2VR6A 1H8SA 3C2AH 1M71A 2ZCHH 4GQRA 2ZYSA 3BPNB 4N2GA 4EBQL 5ALCH 4K3DH 2I25N 3DHMA 3IDYC 4JRXA 3FUIA 3P69A 4KJYB 1PG7L 4TULH 1SBSL 2OI9C 4AVKA 5AVRB 3NJGA 3BMWA 4HLZG 1XB6A 3SDAA 4AGQA 3RTQA 3BZEB 3TT3H 4TUUA 1D7DA 5EA0H 4MS8C 3WAJA 1N4XH 1UATA 5MP6L 3UC0H 5DGRA 1PNDA 1CXHA 4AL8L 1BYNA 5ITFB 1SJEA 2D7TL 2PO6B 2NDGA 2FWSA 3HZYA 1CD1B 3V0FA 5KVGE 2ADIA 3DYOA 3KS0H 4MX7A 3P1VA 1WRFA 2IEPA 5FC9A 3BPNC 4M6ML 3DOIA 4NJAL 5DJZB 2MCG1 1AO7A 5D1QD 4G9FE 2P8PB 3DVIA 2ADFH 3EZ8A 4J8RB 4JG0H 4LASL 4RDQG 5I1IL 1U8MB 4A7VA 1YPZA 2MMXA 3DX9B 5AB2A 2L4OA 5EC1B 1G7MB 1KGUA 2WD0A 1WQVT 1GYWA 2GQHA 4N8VB 4OJFL 4WFHD 1T4WA 3BZ5A 3CSBA 3IKKA 2KERA 3NEOA 4WDIA 1ZSHA 4QJ3B 4PM1A 3P73A 5IUSA 4ZD3L 4Y7OC 4R97C 3IGAB 4NZTL 5HPMB 1E6OH 3CPLB 4U1NB 1NIDA 4BH7B 1F2QA 5FV1L 4JO2H 4EI5A 3IDGB 4ZZFA 4S0HA 4NT6A 3T77B 3W56A 1HEHC 5T3XE 1U8PB 3OGOE 3AZUA 3QUHA 4Z76B 1A4JA 1KCVH 4ZMWA 3GHEL 1NQBA 4ODXA 1KCSL 1U8QA 1GGTA 4OV5A 4ODVL 4YK4B 5D93C 3CWGA 2FT7A 4LLVA 3ZMNA 4G9FB 3NIDF 3UBXA 2VLME 2OV0A 3EFFB 5FCUH 4JPIA 5IOPA 2VJ0A 3FU7A 1IZKA 1NGZB 2P47B 2PP8A 2QQLH 2YFNA 4DGWC 1RK1B 4FNQA 3SY6A 4MAUL