3B2MA

Crystal structure of the major pilin from streptococcus pyogenes
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
294
structure length
294
Chain Sequence
GPGSATTVHGETVVNGAKLTVTKNLDLVNSNALIPNTDFTFKIEPDTTVNEDGNKFKGVALNTPMTKVTYTNSDKGGSNTKTAEFDFSEVTFEKPGVYYYKVTEEKIDKVPGVSYDTTSYTVQVHVLWNEEQQKPVATYIVGYKEGSKVPIQFKNSLDSTTLTVKKKVSGTGGDRSKDFNFGLTLKANQYYKASEKVMIEKTTKGGQAPVQTEASIDQLYHFTLKDGESIKVTNLPVGVDYVVTEDDYKSEKYTTNVEVSPQDGAVKNIAGNSTEQETSTDKDMTITFTNKKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion, structural protein
molecule keywords Putative uncharacterized protein SPy0128
publication title Stabilizing isopeptide bonds revealed in gram-positive bacterial pilus structure.
pubmed doi rcsb
source organism Streptococcus pyogenes serotype m1
total genus 66
structure length 294
sequence length 294
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12892 FctA Spy0128-like isopeptide containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 3b2mA02
2.60.40.3050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3b2mA01
2XICA 2X9WA 3B2MA 3GLEA 2X9ZA 3KLQA 1D2OA 2XIDA 4BUGA 3RPKA 2X9YA 1D2PA 2XTLA 3GLDA 2Y1VA 2X9XA
chains in the Genus database with same CATH superfamily
3JWNC 4WK4B 1UA7A 1UJ3B 3DPBB 3C6SB 4I8DA 3GMMB 4EKXA 5IJVA 1U8LB 4LBEB 3DV6B 1HXYA 4FJYA 4P2YA 3NCYP 2YQ2A 3ULSA 4G8IB 1EZLA 2XV2A 5F6IC 4FYTA 4JFXA 3O6LL 1P5UB 2YD4A 4GSQA 4MA7L 4U1GB 1MFEH 4X6BA 3MRNA 4ODHH 3K6OA 2QELA 1QSZA 2DMCA 2FNBA 4DPBX 2CHWA 4JM2F 2EH8H 4P5RA 1M53A 5T1KA 2FGZA 1UOKA 5GRJH 3B5TA 2GTZB 3P9MB 3KBPA 4GKNA 5CEYB 3STBA 2W60B 4AYBA 4MJ6B 3AGWA 4C4KO 2X0UA 3I6LD 3FOLB 4F80A 5E1AB 2G5BA 1HVXA 2AW2A 5IOPA 5E2JA 3RWJA 1CXKA 1KDJA 2AEPH 2CKBB 2HT2D 3EO9H 4DH2A 1KJMA 1QUNB 5AZ2H 3HZYB 5DJ0A 1B2YA 1HE8A 5HI4C 3ZKQD 4D3CL 5IJKA 1HSAA 4YXKL 2IV8A 3QEQE 4IRSA 4WNQB 5IY5B 1MLCB 1DYZA 4PJIF 4X4ME 3EYQD 2NXZD 1CDGA 2ZAGA 2QKIC 4DUVA 4UQDA 2CNYA 4HEMA 5SX5K 2FUTA 5FW7A 5KSBF 2DKUA 4F20A 4YC2B 5IEKA 4ZD3L 2YPVA 4HJ0C 3HHSB 2RH0A 3W9EB 4BQ9A 1OSYA 4KGJA 1F41A 4FQIL 1I1FA 5HGBB 4MA8L 3U2JA 4PJCE 3W0WD 3BQUA 3Q6GH 1FNEB 4NYLA 4FI7A 4O02L 4X6DA 1GGBH 4RWHA 3D30A 4OCWH 3BT2L 4EZKA 3L4TA 3MRLB 4OJFH 3IFPA 4PJ6A 4JKLA 3KJ6L 3LEYL 3DVNB 4PCTA 3IDMB 1AMYA 3O4LD 4KOCA 2B2XH 2Z31D 4LRIC 2BP5M 4NO5B 1G7IA 1LK2B 3VX0A 1WFJA 3GEFA 3SPJA 3OAZK 2WSKA 3PWPE 3SGDH 4MMYA 2E7CA 1JZHA 4HWEH 1A6UL 4JPIB 2BW4A 4IDLA 5HI5D 1OWRM 4H8WL 1ERNA 1S7RA 4X5WA 1L3NA 3AREB 4G9FE 4NRYB 5AW3B 1U8QB 4MNQD 3QVAA 4DP0X 1IC7H 5J89A 1BG9A 2DBJA 5KYUA 4DFHA 4XMLH 5D7IF 3SE3C 3D7PA 5BV7B 1ZA3B 1SOQA 1T03H 5EFIB 5SWSA 4J28A 1TQBB 2CR0A 3QUZB 4JY4B 5E5LA 1JFQH 1U8OA 1SLXA 2WYHA 3F7LA 4M03A 3ZHNA 5BVJA 1PMYA 1X6NA 4O2EA 4OKDA 3ZL4H 4ETQA 3ZDZF 1N2RA 1D5XA 3DI2B 5EZJA 1SBSL 1TQCC 1A6AB 3DX6A 4P23B 3HNVH 4YL9A 3T3PF 3SCMB 3VSUA 5IWLA 1XDTT 2UXVA 3F7VB 4KK9D 5KSAA 1VEMA 1F90H 2NTSP 2WNXA 3GK8L 4GJTB 2NNAA 3MUHL 3CVHB 2O6FA 3ZO0A 2X4NB 3L5IA 4TTDC 3KVDD 1QSFA 3GXIA 3PWPB 3Q8BA 2NY5H 2B9BA 1OL0A 2Q7NA 3QFJA 1F45A 2KQNA 1T1WB 2AQQA 4OM1H 1XQ4A 3G6DH 4RDBA 4G9FB 5FUOH 3Q06A 1CFVL 2COQA 6FABL 3N40P 2QT6A 2DQTL 1RUML 2XHNA 1QHPA 3QUMA 1CVSC 4N0UA 5DMGC 3TONA 5LCVL 3QJXA 1FDLH 5T8IA 1AGEB 2FECI 4L5FE 1J5CA 3C2AH 2NW3B 2UZPA 4W9JC 1E28A 3W11C 1HSBB 2ICWJ 4AVIA 4PGBA 5IJDC 1PZ5A 3KL3A 3ZTNH 5KYWA 1VKXA 4DGYH 2XIBA 3LKNA 4P2QA 3V79C 1NGYB 1IO4C 2BSDA 5LAXA 1B4JH 4WU7A 1EX0A 1XGPA 4TYUA 2AQ3A 1IMHC 4F58L 1ZHNA 3ZGHA 3U36A 2Y7NA 4WHTA 5FV1L 3FUFA 3O6FD 3IU4L 2B16A 2C1PB 4XPBH 5CSBA 1A9EB 1RK7A 4IBZA 2J55A 4QHNA 4OI7A 3L3KA 2X4PB 4H1LB 4YK4B 4ODXA 1EXHA 4G42B 2DYSB 4PS7A 1KCUL 3VRJA 3G5YB 3IETA 3WIFB 3RIAK 3VA6A 3STLB 5ADPH 1JPTH 3CUPA 1K5NB 3NIDB 3BDYL 4RCAA 4OUUB 1IIIA 1RUAH 1O0VA 3P73B 3X1GA 1TZHB 2PWFA 2DZEA 2V7NB 4MB1A 4U3XA 5FGBA 4DGUA 1TYRA 1XGTB 2EUZA 3E8UH 2FR4A 3FUIA 1MFBL 5KAQF 2R4RH 1LK3H 4ZUSB 4YHNB 1BSIA 2X7LA 4GI8A 5KSVB 5EO0A 4Y89A 3CFMA 3IB4A 2C3XA 3S36X 3QDGD 4RMTA 1JZ7A 1EAPB 5C9JB 3ZTEA 4FZ8L 1UA6L 4JRYD 3RWHA 1AQHA 5DUBA 2JSFA 1CLYL 1MDAA 5I5RA 4BDVA 1KCLA 4UQAA 5JPMB 4ELDA 4KTEL 1Q9WA 3ORJA 3BRGC 2R4SH 1AR1B 1EGJH 1GMEA 2WVVA 2X4OB 2WVTA 4JN1L 2VAAB 1C5CH 1Q94B 2OZNA 4CVWA 3BGFB 4HDIB 2QADD 5CP3A 4GB9A 4Y4HB 3QE5A 1F3DJ 1OE1A 2G3ZA 2GUOA 1B2WL 3LHPH 4XN9A 5CGTA 4Y2DC 5FO7A 5DJDB 5JHDA 3D05A 2VM3A 4M6OL 1D9KB 4YHML 1MCFA 1CLCA 4HFWB 4YXHL 4D0CA 1S2EA 3ZR6A 1NIAA 5L8JB 1HNGA 1FFOB 4AQ8C 1RUKH 4KZ0A 2BVTA 5E5MA 3SYOA 3DROA 3AM8A 1JNLL 2I07B 4W9ZA 4TN9A 3DV4A 2W88A 5INDB 2UYLB 5GGVY 3M17A 1LGVA 1J7VR 1BLNA 1FVCB 2QEJA 4M62L 2FVNA 1BA9A 4R7VA 3TA3D 2EE9A 3KM1A 1MQ8A 4KQ4H 1G6RB 4U2YA 1R0AH 4JQXC 2AKRA 5H94B 2X4UB 4HUMB 1MUJB 3DIFB 1QSVA 2AGJH 4TKWA 2IAMD 3KJ4B 4IJTA 3HE7B 5F3FA 3VWKC 3PJSA 4ORGB 3ABKB 2EDDA 3EOTH 3O2WL 3DIVA 5I74C 2L04A 4BWUA 3LRHA 2ESVA 3SDAA 5T1MB 4HUKB 4KITB 3CFBA 3RVWD 5BOZG 4DKFH 3BKCL 3Q1SL 3VI3B 1NDMB 1M71B 4G43B 4JS7A 4ZS7L 3ZHDA 3MV8D 4ZFOB 1DQKA 4P46B 4QRPA 2Y25A 3TS8A 2OMUA 3DARA 4KI5D 2ZKHL 3ES6A 3EUDA 5L9DH 3WXVL 4YNYB 1N64H 5FO9A 1XGRA 3ETBF 2EDWA 1ZHBA 4RFOH 2Q2EB 3CDCA 1NIFA 3NCFB 1OK8A 2KPWA 3OXRA 4E9XA 32C2A 3FU8A 2Y1VA 3L3HB 3ZDXB 4U6HA 2IBBA 3DSFL 5JNYA 3K72B 3VRLE 1ZPLA 2Y3NA 1XF5A 1I1YB 2QFRA 1CC3A 2GFBB 1GZHC 3GB7A 5JIHA 1IILE 4O2CA 3HCVB 4LOUD 4FXTA 1TTUA 1UCTA 2IQAB 3OHXA 2ZF9A 3QUXB 1QACA 5E0FA 3NFPA 5DHVA 4YLBA 4ZMWA 1CBJA 3Q1EA 3TT3L 1IEBB 4J39A 2W0KA 1QBBA 2J1WA 1JERA 3S96B 4XB3A 4OZHE 4HZ1A 3L5HA 5HYSB 3PAVA 4AM0Q 4MA7H 3I6KA 2YAPA 4DEPB 1XXFC 2FO8A 3H2QA 3EH1A 2M8XA 3R0NA 4EDXA 2DIBA 1N7ML 4O2FB 5J11C 4XBGB 3FQXA 3LEVL 1HDMA 5BJTB 1K5WA 3OKKA 2NY6B 3EG9A 1WAPA 4L4VD 1X4XA 4DKAA 3O0RL 3TCXA 2E6JA 4JEGB 3MLXL 2K4AA 5KANI 4ZZFA 4F33B 3O3EB 1JNHB 3CFEA 4PJAE 1JPST 1V05A 1Y6KR 5CZVL 3S7GA 4KJYB 2LLLA 1G9HA 4NZ8A 2X40A 4V1DE 5FO2A 3RGVB 2FYYB 4G6FD 4GKOA 4YXKH 4D3CH 3OZKA 3KH4A 1T66C 4Z7UE 3DX8A 2ODHA 5D96B 4IHBA 3SPGA 5TK4A 1JPEA 2JMRA 5I15L 2J1YA 4EQ2A 4YDLC 3OAUL 1MCEA 4R2GB 1AZNA 1HYSC 1M3JA 1YNTB 4ZD3H 1FG9C 1M7DB 1AVAA 4GRLD 5BMFL 1XF4B 2OSLB 4I0CC 3EYVA 3QZOA 4NM4L 4FQIH 1C12B 3ECWA 3L7FB 1C5DA 4MA8H 4MJIE 1V3JA 3CSTA 2J57A 4UT6A 4L37A 3KGSA 4HIQA 4O02H 4GAYB 4JM2C 1JHKH 2XV6B 4E9YA 5IVXA 3BT2H 3EJPA 4MMXA 5DJ6B 4X9BA 5DFVC 4YDVB 2BP0B 4ZRGA 3KJ6H 2WMPA 3DO3A 3LEYH 3RX5A 2VC2B 43C9B 1YN6B 1XB3A 4K73A 4RGMC 1ODUA 3AB0C 5EO9B 1W0YT 4PJAB 1CGVA 3T0EC 3MV7A 4U1IB 1OKEA 4KX7A 3ARVA 3NJHA 4EN2A 3KPQA 3UXFA 1CICC 4KNTA 5C92A 2ZWLT 4H8WH 3NSCA 4WCYL 3A22A 3BN3B 4V1DB 3U9UA 1N59A 3S37X 3LD8C 3VI4F 2NZ9D 1I8IA 5FK9A 5D2LB 2G75A 4WJ5A 3N0PB 4MSWB 4B7LA 1F6AA 3NSYA 1M7IA 1NGWB 2NOYA 2G3MA 4NXSA 2NY5C 3DUUA 3O11B 4P3DA 2YKLL 3VTAA 3MRQB 4EUPG 3CN1A 3V0WH 4QRRB 3X11B 4Q89A 4Y16B 5HDLA 1EV2E 1NOFA 1KCVL 5FM4A 1WFMA 5CHNA 5D93C 2P4AB 5KANG 4UT7L 4TSCH 3MCLL 2RJMA 2WGNB 4TNWF 4BYHA 1UXWA 3RWFA 5D8JH 3ISYA 1RPQA 3HMXA 5J1AB 4S0TD 4NQCD 1BJMA 4Z3FA 1VA9A 4P5KA 2P80A 5KYXB 3IJSB 1UB6B 4CKVX 2PPFA 2CBOA 3FQNB 2UX6A 3A4DA 4KXZI 4XPGL 5T1DL 3VQ1C 5B1CA 5SWZB 2VSKB 2QPDB 4ZI8A 3NZHL 2W80C 3UTSA 1SYSB 4NUMA 3MX0A 3ZDYF 1Z5LA 2CDFB 1T21B 2PO6B 2W0PA 3ZDWA 2P43B 2YA2A 3WNKA 1HAUA 4YX2L 5DJAB 1NC4A 1CFVH 6FABH 2D0FA 4PH8A 2DQTH 1L9OA 1RUMH 2K0RA 5KOVC 1TTGA 3C60A 5LCVH 1P6WA 4OGYL 2WBWB 2B3RA 4OVVA 5HGAA 2FEEI 1T7WA 2ZXGA 4L4TE 4XRCA 4CNIB 2R0LL 1YUKB 2ADJA 1XGYL 3F7YB 4RZCB 3V9CA 3VM7A 4Q4IA 1BVKB 3UABA 2Y7OA 5CU5A 1MW3A 1G7HB 4EJ1C 4K7PL 3POCA 3F65A 1T7YA 3ME0B 1BXXA 2YPLD 3RDJA 3B2DC 5DRWA 1A4BA 1DLHA 1RK1A 1WIUA 4AGLA 4B60A 4F58H 1XD0A 1LDSA 2DQFB 3Q0HA 4JKKA 4MD0A 2PW2A 3GJFB 2V2TA 5B8CB 5AAWC 5B3JE 4I9WD 1KZQA 3WDHA 4EUPA 4NQDA 2EADA 2GK0B 2B4CL 2CHZA 3QRBA 4FTVE 1MZZA 4DZBB 4L18A 4HOMA 4FKHA 5F1IA 3VTTA 1KCUH 4PR5A 1GCYA 4HCGA 3DYOA 1I1AB 1F6LL 5TDOA 3G6JA 2OCFD 2O5YL 3BDYH 3QO1A 4X7SH 4IBWA 3CHXA 2CJTA 3BSZL 2C9XA 4F37F 3L9BA 4WJG3 2ED7A 3S2AA 4WI0B 1MFBH 2WZAA 1JTPA 4AKPA 4LEXL 1OW0C 4I87A 2F1BA 2FWSA 4K3HA 4L4TB 1MJJB 4GXFA 4H8HA 4NQXB 4IU2A 4FZ8H 2PWGA 2WKGA 3CFDB 1FNHA 1S4IA 1UA6H 4QXTA 1UA3A 3W38A 3QZPA 4JDVB 3QI9D 1CLYH 3RZCC 5C1MB 3F64A 3AXLB 4MQ7B 3T4AC 4IS6A 5T1LD 1VZIA 1MHEB 4UTBL 4KTEH 3NIGE 2ILLA 1SFHA 1NCCL 4LCCB 1JN6A 2PPDA 3AMLA 4UMGA 4JGNA 4JN1H 4QHPA 1WBXB 4LLUB 4PJ8B 4YBLB 5I17B 2J20A 1F58L 2NX5B 1ZT4B 1ZD6A 5LBSL 3T8XB 3DECA 4GG6F 1G84A 3GBNL 1U91B 4P0DA 1BP3B 1NFDA 4FLHA 1JZEA 4M6OH 4YHMH 3TP4A 4PLNC 1UZ6E 4YXHH 1RL1A 3W39A 1NCAL 1NUGA 1OE3A 4RQQA 1UEMA 2WXNA 5FYLL 4R96B 3BW9B 4U6XB 3QA3B 3HC2A 2H26B 2OCJA 3D2UD 1WUZA 5B3NA 1JNLH 1JVLA 4Z7NB 5CD5C 3WLWC 4P5TA 4BSVA 2WP3O 4GS7C 3I6LE 3QDMA 4AQ1B 4NOBA 2WINB 4M62H 3SEPA 3ECUA 3HN5A 1RIVL 5JIIA 3FAXA 1MI5D 2XVKA 5C09D 5DJ2A 4X7CC 4R3SB 1P4IL 4AZUA 2IV9A 2VAJA 5IIEB 3BHBA 3NQKA 4ODSL 4OFYA 3D85D 4YO0B 5F1NB 5DTFB 4GO6B 5C9KA 5AW4B 1RV6X 3FULA 3O2WH 4N9GA 1IEAA 1S7VA 1ACXA 4JZOB 2VSCA 1DUYA 1QBAA 2ERJC 4UB0L 4YR6B 5EEZA 5IB5B 3P4NB 2XFXB 4ZO7A 4NUJB 3BKCH 4Z7VE 5B7FA 2WTRA 3IJHB 3Q1SH 1Y1DA 3BH8B 3L3IA 5JPNB 3TN0A 3W0WE 5LXVA 1USQA 4GW4B 4JFEB 4M61A 1FZKA 4BELD 2ZKHH 5DMKB 3RURA 3WXVH 4B7IA 5SX4H 2YXWA 2BNQD 3O4LE 2KS0A 4QCIA 1AC6A 1J8HD 3B2VL 4GQZA 3GSQA 3FFDA 3RL2B 2WLLB 1K8IB 2GSGA 3BP7A 3QH3A 2JK5B 5H37A 5LDSA 1KT2B 4YMPA 1R5IB 5D1ZD 3DSFH 3O2DL 3MKGA 3VFUA 4XC1L 4OZIF 3AAZB 4CMHC 2OMVB 3KYNA 4OZFB 5IMKA 2YFNA 2AEQL 4EZJA 2X1WL 4MNQE 3RKPA 3UTOA 2YBRB 1JGDA 2GAZB 3FO2B 5B1JA 2NXZB 1M05B 1PYWA 4X4YB 3VVVA 2AFNA 2BCKA 3NZ8B 2MH4A 4DW2L 1P1ZB 3ILQC 2JH2A 3X13B 3MRDB 3IGAB 4PRPA 3SDDA 2WQSA 3TT3H 2H41A 4HJ1A 3DURB 5IUCA 1CYWA 3TBSA 1G87A 4Z7VB 3DETC 3K0YA 1KTLA 4NWTL 2I27N 3W0WB 1U93A 2ORBL 4OT1L 3GLAA 4OLVL 1N7MH 4BQ6A 3LEVH 1EBAA 1DJXA 3NJKA 4DOHE 1FI8C 4Z7AA 5F2FA 3O0RH 4KDTA 3GSRB 1E4XL 3MLXH 5B39B 2Z31B 1M6OA 1S78C 4V11A 5HI3D 2C1OB 4GUOA 5CZVH 1PQZA 1UADC 4KKLD 4G7YL 4LP8A 1KGUA 3T4YB 1A02N 4PG9B 2LT9A 2WWMD 5KVGL 3FT2A 5CLWA 2QLVB 2Y23A 4IU3A 2H3NB 3AS2A 3PAZA 2NSXA 4G2AA 3PGCB 2C4XA 1ED3B 4YE4L 1E3FA 2RQEA 2DM7A 1IC5L 2Z1KA 3QJOA 4NO0D 5I15H 4Q14A 3EYSL 3KPPB 3OAUH 2CBMA 4S2SA 4AMKL 1Z9SB 3E38A 3GS7A 3HLAB 4S1RL 2ADIB 2A9BA 4H8WC 4X0KA 5BMFH 1KTBA 1WICA 3AG4B 3DMMD 4HJTA 1WBYA 5HYQA 4UILL 3NCWA 4IKJA 4XAWL 3QORB 3L9YA 4NM4H 2D7QA 3S5ZA 2WXHA 3MLUL 3MYJA 4J1UB 5E9DA 4KNQA 1DUZB 3Q5TA 5D1QD 1X7TA 4MLIA 5IBUB 4G8FA 4QHKI 3MJ8A 1ZXKA 3E9UA 5IG7B 3SDCA 5IUSA 3AABA 3KGTA 1R3JA 4HVBA 3WJMB 1F13A 4WTQA 4R5XA 1TYEB 3MUGB 3O3AB 5AALA 4MQSB 3L3OB 1E8XA 2YAMA 2ZXQA 4WCYH 5DJZB 3T71A 3L3GA 4PJEE 5TTRA 1DBAL 2R1WA 2DLGA 2BSCA 3UYPB 2A9DA 4AENA 3UERA 1J48A 1PKQB 2WKOF 1K8DA 1N6QL 1ZVSB 3GNML 4QAWA 4KKBD 3BYYA 3QDGE 1O9WA 5L4IA 2YKLH 1TO5A 1TT6A 2XTSA 3H3BC 5I0WA 4JRYE 1KCVH 2D3JA 1XCQA 3GSVA 4LPTA 4PJ7B 3QHZL 3KLAA 1NM4A 4UT7H 2QQLL 3BWAB 3MCLH 5C0DB 1CFTB 4AOFA 2A9NL 2KDGA 1G0XA 3KW8A 5KBNC 3X14B 3D0AA 4LF3A 4LKCB 4JFFD 4WUKL 2Q2LA 2XWJB 3TVMA 3Q2LA 4TQEL 2QGBA 3MNZA 1EAJA 1ZT7A 4XPGH 3BDBA 4TNWK 5T1DH 1PZAA 4ONHB 4PV9A 3ZRCC 1ROWA 1G7MA 5CXPA 1HHKB 1RFDL 1UURA 2XPZA 3NZHH 3NPSB 4KPHL 4YHOL 2XOTA 3EDJA 1OXYA 4GNKB 3S3SA 3VNYA 3L5WB 2E8ZA 3C5SA 4KK6C 4PLJD 1FC2D 4YX2H 4Q58C 2KUTA 3RWCB 2UWEE 3HS0C 3FO0L 5FDYA 2AANA 5DWUL 5FXCH 1UWGL 4PGJA 4Z6AT 4OGYH 3PGDB 3L3DA 2YN5A 2R0LH 1A8ZA 3MNDA 4OGZA 1GZPA 1XGYH 1ZHKA 3LZNA 4GAJL 4X2UA 5CEZL 3CBJB 4R0LC 3BH9B 3T0WA 4BH8A 4PP2B 4K7PH 5FKPA 4F8LA 4XX5A 5A3IC 2O72A 4X7TB 4PGEB 4BFIB 4JJHA 1HU8A 3VXNA 2EDKA 1A3LL 4FKEA 1P4UA 3FW6A 3BXNB 2R2HB 1J1XH 4FG0A 4F2FA 5KS9A 4HKBB 5F0JB 3OZLA 2B4CH 3RUGB 2X3AA 3VGAC 1E0OB 5ICUA 5ITFA 2WCSA 3ZKND 1ODAA 1T3FA 3EO1A 2OJZL 3P9WB 1TVHA 4NNYA 1PNCA 1NL0H 4BZ1A 4YSAA 4XNBA 2BP8B 1QLFB 3MV8E 3EYUL 2AV7A 2O5YH 3JV4A 2BRRL 1AD9A 4KXAA 3MRPB 5AAMA 3ZTJG 4QRQB 3D4CA 3N43F 4KI5E 3BSZH 3GSNB 3FUJA 4XO9A 1TMCB 1QEWB 4P9ML 1WAEA 2J5LB 4KVCL 2Z7ZA 3K6NA 4LEXH 1R9FA 4AX3A 3KPLB 3PCYA 1WHOA 1WZKA 4F37K 3LV3B 5CJXA 2L0DA 2MOGA 3TA3B 5T3ZL 4JVUA 2V4LA 3NJJA 3OJDA 1A65A 5D7KD 1IM3B 4ODTL 4IMKC 1T22B 1KN2L 3LN4B 1NCCH 1BEXA 5DR5L 3HJEA 4AYMC 1KNOA 4OFPA 4A7GA 1S7WB 3E1F1 4ECNA 4LEEA 4Y5VB 3O2VH 4NENB 1F58H 2Q86A 1U8HB 1KMGA 3FQUB 5J13B 2ZTBA 5AWNL 5LBSH 1U4EA 1P7HL 3BZ4B 4JM0A 1LL1A 3GBNH 4ZPTB 5IBTL 3W37A 1E9OA 4MVBD 3CFJB 3MBWB 4NKMA 4YGVA 1UVQA 2PLTA 2CM5A 3I84A 4XH2B 4CILA 4FI6A 1NCAH 3FU7B 2OMZB 4N5ED 3MJ9H 2PPCA 4QT5A 2B08A 4JZJA 4L4VE 4HD9A 1WBZB 4XCEA 2OSWA 3OX8A 4L9LB 1JS4A 1G7QB 4NUPA 3VFTB 4EI0A 2ZUQC 1NDTA 4KO5A 1MVFA 2BNUA 2BSSB 3I02A 4YSSA 1XL6A 3O3BB 1MWOA 1YMHA 4ZOCA 5I76A 1HIML 1RIVH 2BWQA 2EIBA 1ETZA 2P48B 5HHMB 5GQBA 4AXWA 6PAZA 4L3FA 1OARL 3RB5A 4JN2A 1YAIA 1P4IH 1R3KB 1Z3RA 2BLFA 5DZJA 5E8PA 3TZVA 4CSSA 3CSGA 3WAKA 1W72L 2DLTA 4ODSH 2N1KA 4WO4C 4JDEB 3WFEH 1WDAA 3DUSB 3ERXA 3L4YA 1SHMA 2FYVA 2Z91A 1OGAD 2WXMA 2Y7LA 1MZYA 4MDJB 5CFAA 1UJ3A 1G1KA 3C6SA 3DPBA 4UB0H 2FBRA 1QHOA 3HVDA 1R5WB 1FPTL 1WFOA 3GMMA 5JQ6L 1U8LA 3FH5A 2GABA 3DV6A 3PWJA 5A16B 4DPCX 1XB6A 2OMWB 3DX2A 2F54E 3L9RB 4FF9A 2KZKA 1FC1A 4EDWL 2D2CC 2YA1A 5E6IB 5FWQA 1QLEL 2VZ1A 3AVEA 4G8IA 4RAVB 2Q8AL 3WNNA 2C9AA 3AY2A 4L4VB 3T2LA 3V6OC 1YY8B 1P5UA 3B2VH 1WWBX 4N4YB 1NANI 1D7FA 1VFBB 3WEXB 5KW9H 2ZIDA 3O2DH 4WAFA 4W9IC 4XC1H 4E41D 3MODL 4YGAB 1TFPA 2GTZA 4M1CD 5CEYA 5I1JL 2W60A 5HGAB 2AEQH 2ICEB 4GIAA 3A0OA 3FOLA 2XYCA 5E1AA 1X3DA 4HX1B 1NCGA 1CIUA 3BH4A 1T04B 2CKBA 4DW2H 1QUNA 2UY6B 4ZX6A 1Q38A 1DCEA 3HZYA 1M1XB 1IBZA 4QNPE 4GRLB 4WNQA 4OLXL 4RX4A 2AXGB 4UQ2B 4WI7A 4P4KD 1XBDA 3AMKA 5IQNA 2ORBH 2YR3A 4OT1H 2BWIA 1BXUA 3ZIMA 3EH3B 3JZ7A 4OLVH 5EU3B 4N22A 1C5BL 4NQCE 4AIEA 2VERN 3HHSA 4CVXA 3W9EA 5FS5A 4LMQE 5HGBA 3NDYE 1E4XH 2L7UA 1SHWA 4LVHC 2K78A 1FNEA 3FMGL 5IMOB 3IWUA 3U1SL 3DJSA 2FECL 4JFVA 4WQOA 5IESL 3HS8A 3L3JB 2WB1A 1AXSB 4GI6A 1DBML 5KVGH 3OAWA 1K6QL 4ZODA 3ULVD 4GXVL 3DVNA 4P9HL 2WBJB 3IDMA 5DJCA 4BD4A 3MRHB 3VW3L 4NO5A 1LK2A 3D18B 4S11A 5D1XC 5E1HB 4C58B 3W5NA 3EJZC 3CH8A 3HAEB 5KN5B 4XGZB 4YE4H 1U3HD 1IC5H 2V2WB 4G6KL 1IUZA 1JMZA 2CCWA 3MNWB 1Z66A 3EYSH 4JPIA 2G3XA 4BFOA 4AMKH 1FO0B 4S1RH 5KUMA 4Z7OF 5HVHB 3AREA 4W70A 4NRYA 3G5WA 1U8QA 5D7JD 2CLZB 4UILH 4XAWH 2VOTA 3IJ8A 2O6DA 4K7FB 4UT9A 3MLUH 2YPLE 2J4WL 1ZK5A 3GYRA 1DQTA 4K23L 4CU7A 2ZX9A 4YPGB 5EFIA 3ARFC 4XX1G 4MS8C 4PJ9D 2O6CA 4WV1B 3QUZA 4I9WE 4H1LG 5ECGA 4JY4A 1A9VA 1A5FL 1PLCA 2PYFB 5M7QA 2CO6B 1UG9A 4NQVA 1VENA 4CJ1A 1ETB1 3V7AE 1A6AA 3SCMA 3FQWB 3DDGA 3F7VA 1FV1B 4NZDA 5J5EA 1PD6A 4J3SA 4S1QL 3ARGD 5FECB 1J5OL 2PXYC 3CVHA 2JV6A 4ZMXA 2XZAL 5IROC 3X1NA 2X4NA 2WW8A 3PWPA 4LLDB 2F61A 4B6ZA 2VN7A 4LDCA 1UD8A 1N6QH 3GNMH 1T1WA 1KIRB 3H9ZA 4Y9BA 5F7DB 4S0HA 3WNLA 4G9FA 2YMTA 2V5YA 1GGIL 3I3EA 2H2SC 3UBXI 4N9OB 1OCZB 3QHZH 2KERA 2QQLH 1IBHA 3LSOB 3Q5OA 3WTSA 4MA1B 1ORSA 2A9NH 2X6MA 1QSED 5AVTB 5E08L 1AGEA 1TLKA 1G94A 2NW3A 4PJGF 1HSBA 3UO8B 2EECA 2O1AA 3LN9A 4WUKH 4R7DB 4MQXD 4TQEH 3BKJL 1NGYA 5C0BD 1NAML 1UOLA 3T2PA 3D0LB 3IKCB 4KK8C 4KJPD 1Z7JA 3KYKL 1RFDH 2XA3A 4YSQA 4L3CA 3FQ4A 2DDQL 2C1PA 4KPHH 4YHOH 1A9EA 3MQIA 1HYRC 1F18A 2X4PA 4H1LA 3DO7B 3MTXA 2B4CC 4G42A 4G7RB 1KEML 4B3EA 4GIPD 4WEMB 3FO0H 3G5YA 3GIVB 1MCWM 2IDCA 5GGTA 4NM8L 3CDFA 5DWUH 1WK0A 1TZOA 3WIFA 1UWGH 2QVIA 3OVUB 3IPEA 4OUUA 3P73A 4GAJH 1TZHA 2E7HA 2V7NA 1ZIBA 4TQIA 5E8NB 4WFFD 2XXFA 5CEZH 1XGTA 1MI5E 2CA4A 5C09E 3SGKC 1BVNP 1KJ2B 3TA4D 4ZUSA 4YHNA 5KSVA 4POZD 4JQIL 4LSVL 1A3LH 1EAPA 3IDJB 4N2AA 3SOBH 5C9JA 1EJ6A 2Y72A 2ZOUA 3ILPB 5FM8A 3BN9C 2HZHA 3BO8B 1XSOA 2H0PA 1T2QL 4KX9A 2AJSL 4PRID 1DSYA 2OJZH 5JPMA 2MPAL 3C6LC 5DEJA 3GZOA 1JXDA 3X17A 4ENZA 1I85A 2VCOA 2X4OA 3V4PL 4ZW8A 5F7HA 2VDKB 1I9JL 2VAAA 3EYUH 2Z8SA 3QHFL 4IK7A 1Q94A 5BS0B 5IHLB 4HDIA 1H15A 1YEFL 1ZE3H 4Y4HA 3O9WD 2YXFA 3APDA 3D2UB 4PLKC 5DJDA 2BNQE 4P9MH 5IQLA 4KVCH 1S7UB 5I66B 1BQUA 1J8HE 1D9KA 1JPSL 4JUSA 1DBKL 2A5UA 4HFWA 1WFUA 4MYPA 2J5WA 3ZMEA 1FFOA 4AVJA 5DURD 1W8NA 3GXDA 5T3ZH 4MX7B 1AGBB 5C09B 2I07A 2ZJSL 1L0QA 1YEHL 4ODTH 1KN2H 1FG2B 2UYLA 5INDA 4Z8FL 2YEVB 1ZLDA 1EH9A 5DR5H 5IHZB 1FVCA 3BAKA 3D85B 4DIXA 1BHGA 4XAKD 3GMLB 3N04A 2C4FT 2VZOA 4C56D 1G6RA 1X5FA 4J12A 4OLWL 3VQLA 4Z3HA 3PPEA 5H94A 2KMWA 2X4UA 5HYSG 2JIXD 1MUJA 5AWNH 3IS1X 1OV8A 3DIFA 3EJYC 1AD0A 3Q8AA 4X6FB 4GQRA 3EJTA 3HE7A 3P3TA 5IBTH 4ORGA 3VFSB 2CRZA 1BOGB 3OV6A 5T1MA 3QRLA 4QJ4B 2WO4A 3FB8B 2HLFC 1N3NB 1I3VA 5ICYB 3VI3A 1NDMA 2PETA 2VKXA 3HNTL 2IG2L 4FFYA 2BNQB 4G43A 4G8EB 4NI6A 1PAMA 4H2AA 1J8HB 1F3JB 4ZFOA 4P46A 3GLZA 1FQ9C 1YEIL 1LO5B 1HIMH 2ADFL 4DHLA 1H5BA 4YNYA 3P30L 1DVFC 3B83A 4Y19D 1OARH 5AUMB 3ASWA 3RVVD 2Y07L 3SGJC 4MAYC 1YEWA 3L3HA 2IO5A 3AITA 4FA6A 3K72A 1IE5A 3QFDB 4L1HA 5C0JA 1N0XL 3NMEA 3PS6A 4HIIB 1I1YA 4FQQB 5CP3H 2GFBA 4D9QE 1JF5A 3QB7C 1BYNA 3OWEA 1FPTH 5ACLA 5JQ6H 2JKLA 1W6LA 1KBWA 5FYKD 4S1DC 5ACMA 4L8SC 1RXLA 3QUXA 3ECQA 4PJXF 4ZFFB 4N1CA 5D1QE 4AJYV 1HOCB 4IRJC 3DGCR 1YNKL 4TUUA 4EDWH 5I9QC 3DVIA 3DX4A 1QLEH 1IEBA 1P5VB 4PWHA 3LXBA 2Q8AH 5C3IA 3S96A 3QCTL 4G1EB 3VXQB 5HYSA 4YH6A 4AEEA 1TPXB 2VTFA 1MRCL 1IQDB 4JVWA 4HAKA 1RZQA 3NRPA 4O2FA 5AKTA 4QEGA 4XBGA 1T2JA 4YAQB 4WI9A 1T0NB 3MODH 4BQCA 2Y5QA 2EO9A 2GG1A 1HQ4B 2A4ZA 4U0QB 2EEXA 2L7QA 5I1JH 4F33A 3GXUB 3LPPA 3O3EA 1JNHA 5ABAA 5CKAA 2UXFA 4KJYA 4NO0B 1KSRA 3H9SD 3GO1L 2Q6WB 3PL6D 1N70A 1HCFX 4UINL 5T5NG 1IFGA 2FYYA 2NY1C 3GGWB 4OLXH 4PMEA 1G0DA 3DMMB 4JANB 2O5XL 2IDTA 5FF6B 5EU7E 2CM6A 1P6AB 2X53A 3HBQA 4GUPB 5D1QB 4UANA 2EEDA 1C5BH 1YNTA 1M7DA 1XF4A 2OSLA 2DV6A 4KRLB 3WENA 4JFFE 1CYGA 4YDZA 3IE9A 4HV8B 1H3XA 2A0LD 4AV4A 3FMGH 2FEEL 3L2LA 4JCLA 3U1SH 4GAYA 1E9PB 5IESH 1WFNA 4UQBA 2X4TB 5DJ6A 1I9RL 3D08A 5CGMA 1A0QL 2BP0A 1DBMH 2EDMA 4YDVA 1K6QH 1LEIB 3F2LA 4GXVH 2WXJA 4BKLB 5J3HD 3VW3H 1KCWA 43C9A 1YN6A 2PR4L 3TJEH 1RPKA 5EO9A 3KWWB 4PJAA 3HE6D 3VG9B 5J6GB 1HX0A 4U1IA 1VRSA 1FSKB 4G6KH 2VDLB 3FSVA 4WHYG 2FLBT 4Y4FB 3ZBMA 2H32B 2CUMA 1NBYB 5DHVH 4V1DA 1ETJA 5D4IA 1HJBC 2E59A 3CHSA 3O6ML 3CE1A 5LLIC 4BWWA 1B9ZA 5DRNB 5D2LA 4G9DB 4MSWA 2VR4A 1II4E 4KBPA 2BIQA 2D3NA 2J4WH 1OAZL 3N3EA 5FGCB 1NGWA 3HC4H 4LKXB 4ZFZB 4AEFA 3MJ6A 4K23H 4Z3GA 3O11A 5JHBA 5CSZB 3MRQA 4KKCD 4QRRA 4Y16A 2LVCA 4XT1C 5B4MD 1E5AA 4JFFB 1A5FH 1DEDA 1KTDB 2R69L 1ECZA 1L5GB 4MJIA 2PW1B 1DR9A 4L0PB 3ATAA 4ZAKC 2YD9A 3UAFA 3ARDD 1URZA 1R46A 5J1AA 4KY2A 2Q8BL 3A21A 4U6YB 3FKUS 5KYXA 3IJSA 1UB6A 3QPQD 4JGUA 4S1QH 4J4PA 4DAGL 1J5OH 2AQ2A 4HWNA 4LPXA 3HRZB 2XZAH 5SWZA 4UBDD 5AKVA 4E0RB 4DK6A 1J11A 3QNZB 4HHAB 4XNQB 4GT0A 5FX3A 3UH8A 1ONQB 4PS8A 1SYSA 3Q2VA 2CDFA 1T21A 1TQWA 4B97A 1C8PA 2K7PA 3U30B 5DJAA 5GGVL 2YAQA 1GGIH 2QPSA 5EH1A 2AEIT 1T1XB 3II2A 4NQUA 2DKSA 5H4ZA 5C3TA 5D7KE 5E08H 1JF1B 1NCOA 2J88L 1XEDA 4CNIA 3QWNA 4U1JB 1F42A 4RZCA 3F7YA 4L1TA 2VDRL 1E5BA 1BVKA 5EUOE 2QQKL 1VGKB 2VDMB 4KJWC 4BE5A 5G2NA 5F7YC 5L8LB 5I23A 3ME0A 3BKJH 4FXLA 4BFGA 1NAMH 3AQZA 2CJSA 4FQ1L 5DHXB 2M83A 3KYKH 4HH9B 1PLAA 2DQFA 4FQHB 3GJFA 2VLKD 4K3JH 1G43A 3OLIA 3PU7A 4QDGA 1SEQL 5FFOA 2DDQH 5B8CA 3CFCL 4ABQA 2LR4A 4DZBA 3L95B 2Z35B 1VADB 5FHBL 2JJSA 3DRTB 1KEMH 5DO2D 3B9KD 1GAFL 2X09A 4NM8H 2OL3B 4N8CL 1I1AA 2Y3AA 3BAYA 4IRZL 1Z3GL 1L0XA 5DVKA 3QDJD 3FL7A 4FCAA 2K45A 1ZE3C 3G6JF 2CBPA 4WI0A 2IDUA 5GZOD 1LE9B 3P69A 4PU2A 2XQBL 5ID0B 1R17A 3OMIB 4JQIH 5AVUB 4L4TA 2P24B 3EOYG 1MJJA 4NQXA 4V2CB 2X42A 1CTMA 3CFDA 5EUOB 1C9SA 1X7QB 1TVBB 1FE8L 1T2QH 4D8PB 3AXLA 4MQ7A 2AJSH 1OGAE 2Y22A 1YPZF 3BKML 1MHEA 2VLMD 2MPAH 1BM7A 2X89D 4YOKA 5AYTA 1N5AA 4AJ0A 3V4PH 3HN3A 1I9JH 2BMKB 1WBXA 4LLUA 2P26A 3QHFH 4PJ8A 1UM6H 2FHFA 3CV5A 5I17A 3PGFL 3ZE2B 1YEFH 4HOWA 1DN0B 2NX5A 1ZT4A 4PPTA 1QQDB 1JYXA 2VERA 3T8XA 1QPXA 3PWVA 4WI3A 3TJHD 1QI4A 1U91A 3NJFA 2XFGB 1NOAA 3ZYOA 4R5VA 3EYOB 5BVPL 1KG0B 1MQKL 2X5PA 1G5AA 1JPSH 2NLJB 2MMXA 1DBKH 4KHTL 4AYFB 4KROB 4R96A 3CC5B 3BW9A 4U6XA 3QA3A 1NFDF 4OZFG 2VR3A 2H26A 4E41E 2VDQL 5GRUL 1E2VA 2GBUA 2ZJSH 1YEHH 5KOMC 4M93C 4Z8FH 4EEEA 5D55A 4AQ1A 4DQOL 4HU8A 2WINA 2DQGL 1N68A 3AW5A 4X98B 4A7SA 3V10A 5AVWB 2VL4A 4G1MB 1ICTA 2YQGA 4R3SA 3O6KL 4OLWH 4XVTL 2VJ8A 5IIEA 5KVEL 2FLRT 3P1VA 3HG4A 2Z8RA 1JUFB 1ND0B 4LGSB 4YO0A 3I6GB 5DTFA 5F1NA 4BZ1L 1WSST 5LKNA 1LNUB 1SNRA 3ARTA 3O4OB 3NAAL 2UVFA 2Y24A 5A2CA 2XETA 5DHEA 4ZMPA 3JT2A 4JZOA 5AW5B 4YR6A 3QXTA 2BVEA 2A83B 4Y4KC 3P4NA 5IB5A 3M46A 3RFZB 4NUJA 5B39G 1ILSA 3IJHA 4MNGE 3HNTH 5BZZA 1QRND 2IG2H 3BH8A 4NZFA 3RRQA 5JPNA 3SPCA 3JVFC 4GW4A 4JFEA 2BVQA 3OZ9L 4UNIA 1R33A 2E0PA 5F9JB 5JW5B 1YEIH 2GIYA 4L3EB 2ADFH 5DMKA 2KYIA 2R27A 5B22A 3RPIB 2P45B 1Y6MR 3P30H 3ULVE 4BUQA 3RKDD 3ZSTA 2DQEL 2BVYA 4N1EA 3KWVA 3CVBA 3AM8C 3RL2A 2WLLA 1K8IA 2Y07H 4QKXB 4BWTA 1GYWA 5ITBL 1KT2A 4FQXC 1MCRA 1R5IA 4MLSA 1V7NL 4WEBL 4X6CB 4FULA 1N0XH 4HD5A 3AAZA 1PZCA 2DPKA 2OMVA 1JZ5A 3WIHA 2J21A 3MRGB 4OZFA 3CU7A 3Q48A 1PCXA 3LMJL 3LNGA 4FXGC 2HMID 1J87A 2TRHA 1VFOA 4K8RL 4AQEA 5I18L 2YBRA 1B4LA 2GAZA 3FO2A 4N1HB 1M05A 1PLBA 3SPVB 5IBUG 3WO3B 4X4YA 3OG6B 4OCMC 4ADGA 3NZ8A 1CXIA 1U4FA 5T1KD 5IHUL 1YNKH 3BPOB 3MRDA 3IGAA 5F7LB 3X13A 1CUOA 3QIUC 3DURA 2RR3A 3K6SB 4WTZA 1KPUB 4LVOB 3MBEC 4OCNC 4R6UA 2GI7A 4Z7VA 2HFTA 5D7LB 1MRCH 1KY7A 3W0WA 3W56A 1SZNA 3IMBA 1EO7A 5E4OA 3UGXA 1XIWC 4L23A 2AQ1A 1A47A 4W4NA 2CK2A 3IAPA 3ATFA 5JOEA 2EUXA 1RZFL 3MRMB 4J23A 3DYPA 3LB6C 2AK4B 3GSRA 3C8DA 2Z31A 5DO8A 1I7UA 5DHYB 2C1OA 3ZKXC 2HFGL 1WA2X 3E3QC 4HUCA 4W9FC 3K1DA 4UMSA 1ID5I 3OC5A 3L6FB 2OR9L 1OGTA 4I0PC 3T4YA 2WQVA 3GO1H 3W11D 3WGVB 3V0DA 1P4BL 5FEBA 4FADA 4UINH 3VA2C 4B96A 5TH2B 4P9HC 1JDCA 2H3NA 5D7JB 4MNQA 3SKJL 1A2YB 3QJVB 2O5XH 4LSUL 3ULAB 5L0QB 3VE0B 2GKIA 2EIMB 3KPPA 1QSEE 3CZKA 5J12B 1RULL 3LKRA 1Z9SA 1KGIA 3HLAA 3OHXC 2RB8A 1J0ZA 2ADIA 4FJ6A 4M3JA 1E5YA 3BUIA 4GP5B 1GW0A 2C9UA 2EIJB 3FU3A 1B4TA 3KXFD 3QORA 1ZV9A 5C0BE 1KFAL 2OPCA 4J1UA 1DUZA 3KD4A 5AW1B 3DVFA 5DXWA 3F84A 15C8L 2AVFA 5H37H 1RH8A 3GXFA 1V3MA 3TM6A 5E0QA 1I9RH 2V3DA 3UBHA 1A0QH 1XF2B 1XF1A 1A8JH 1CI3M 1L9SA 2XBDA 2PR4H 3SQOL 4DN3L 3WJMA 2ENPA 2BCMA 2RA1A 3J27A 3GSOA 3OTTA 3MUGA 3O3AA 4DWHA 4PGDB 4OZGB 1K4CB 4ODVL 3Q8CA 3VACA 1UT2A 2I5YL 3L3OA 4YN3A 3ZUCA 3FF8A 5DJZA 1WWAX 2MQCA 3KEDA 5LGJA 4WFFE 2EDYA 3O6MH 3UP6A 3UYPA 3L9EA 1CYXA 3GWJA 1EMTH 1I8LC 1PKQA 1EK3A 1Q72L 1OAZH 1ZVSA 2Y1YA 1NBCA 5KSAD 3V0EA 2RACA 2ZWNA 5HYJB 3R1GH 1BXVA 3UYOD 1JDDA 1UC6A 3KPMB 4PJ7A 3UCRA 5E6YA 2NT0A 4DVBB 2IPKB 1TIUA 2WLIB 3BWAA 2R69H 3RDTC 5C0DA 4Y2DD 4ELMB 5C0BB 1RSFA 4PRIE 1CFTA 1G7PB 1KYUA 4K07A 1CL7I 4GUQA 4LLVB 3D06A 4NB7A 1G1YA 1RU9L 2H8PB 5HVGB 3GD1C 1W8EA 3X14A 2Q8BH 3BVDB 4L0YA 1BW8A 1Z9PA 4LKCA 2XWJA 5C0AD 5I6MA 5K59E 4MMXC 2W9EL 1QPKA 4N6RB 3QAZB 3QEGL 4DAGH 1IGIL 1BWMA 3QQ4B 5EPMB 4ONHA 5F0LB 2EC8A 4JFQB 4MCMA 3FS9A 1HHKA 3UYRL 4B95C 4N28A 1G7LB 1KGJA 1TG8A 4GFXA 4HCFA 5B7MA 3OR6B 4CJ0A 4HK3J 4R7XA 3L5WA 1E5ZA 2HPTA 2CLRB 3RWCA 3PFQA 3ZE0F 2YA0A 2Y7SA 4MCNA 1H9VA 3PGDA 4PREB 3KEHA 2J88H 1BLIA 3L54A 2F8XC 1AFVL 1UQSB 2VDRH 4NZUH 2QQKH 4XAKE 3BH9A 1BREA 4PP2A 2IQ9L 4BFIA 4X7TA 4BZ2L 4PGEA 1F6FB 3MLZL 4PRIB 3CQPA 4FQ1H 4IIQC 4PI2A 3BXNA 2R2HA 3UG3A 4HKBA 4LPWA 1SEQH 3CFCH 4OFIA 1JGEB 3RUGA 4M8QB 3RY4A 2DWYA 5FHBH 3G6AB 5J06A 1ZY9A 2NSMA 2SODB 4XBPB 4GSRA 1GAFH 2BP8A 1W2KT 3F12B 1NFAA 4N8CH 4HLZH 1QLFA 1WA0X 3FT1A 5DEGB 3S3CB 1BZOA 4F8QA 4J3TA 2EP6A 4J3OF 4WUUD 2JVUA 4IRZH 2IFFL 1Z3GH 3MRPA 1AXTL 3CWGA 1JV5B 4QRQA 3Q2NA 3GSNA 2R59A 2ITDB 3K6FA 5DURB 5J0BA 1FF5A 3RWGB 1QEWA 4KKQA 3GI9L 4Y19E 5IM7B 3N55A 4NJAL 1IVLA 2PN5A 3G5XB 3MNVB 3KPLA 1WIPA 4HZAA 3LV3A 1CLZL 2X3BA 1MCHA 1E7UA 1KYFA 1FE8H 2DD8H 4TV3A 2R2EB 3TA3A 3I50L 2E6QA 1S5HB 1RZGB 2DQJL 3F5WB 3BKMH 4C56B 1IM3A 2YLKA 5IQ7L 4F5CE 5C6WH 1T22A 2JIXB 3LN4A 3P4OB 1HNFA 3NCJL 4B3VA 4OF3A 1R6VA 2NY0C 4UAHA 1XCWA 5FYKE 1MY5A 5F9AC 5CN3A 5GZNA 4MB3A 1S7WA 3OR7B 2VZSA 1JIBA 4KTDL 4Y5VA 4JG5A 1Q9OB 4NENA 3PGFH 5GS1C 2E5EA 2ED9A 1U8HA 5D9SB 3BZ4A 4FQLL 4UTAA 1SN2A 2D3VA 2VWEE 4ZPTA 5I75C 3MV8A 1OGPA 3CFJA 5BVPH 3MBWA 1WJ3A 1MQKH 1KBPA 2OM5A 5LDUA 1THCA 2D7OA 5E2UL 4KHTH 3FU7A 2OMZA 4I2XE 5HVWA 2VDOL 2R8SL 1FGNL 1XTMA 2VDQH 1WBZA 3KS0H 4LMQI 5GRUH 3VFMB 1MDTA 1NJ9B 3AT9A 1GYCA 4L9LA 3MLVH 5HHVL 1OLLA 5GRYA 3VFTA 1ZA6B 1SLWA 5IB4B 1OCOB 2BSSA 1D6VL 4L5FL 4DQOH 3O3BA 4Z7WB 2DQGH 2F7QA 2D03L 1SUJA 1EFXB 3O6KH 4H44C 2B15A 1R3KA 1S5IL 3D50A 2OJ1A 4V33A 4J3OH 5KVEH 5I6KA 4RETB 4CN6A 3P4LA 4NC0B 4BZ1H 3OQ3B 4JDEA 1BCIA 3PHQB 4PBXA 3VXSB 3NAAH 3DUSA 1E67A 1QFPA 4MDJA 1NUNB 5AOMA 5AB9A 2H47C 1A25A 2JI1A 2NY3B 1R5WA 3WNMA 2WSPA 1BYPA 5A16A 1MRDL 3FK3A 4C4BA 3UAAA 3L9RA 3OB0K 1E6JL 3QDHA 3UTTE 3KGRA 3N85L 1B4RA 5E6IA 3OZ9H 4WIQA 4OLZL 4O9HL 3CCHB 3V0IA 2EE2A 4L4VA 5I0VA 1A6ZB 1M7UA 1YY8A 4P5MB 2KZ1B 3HAEG 4HETA 1X5HA 3FB5A 1JXGA 3NEOA 4K5MA 1ADQA 5F7BA 3OKLB 1SDDB 5ITBH 3H6AA 1VFBA 4JO4L 5EZPA 3WEXA 4A2GA 4WEBH 4HWZA 1UZGA 3H9SB 3N06B 3ZVVA 2DYRB 4KXDA 5AOKA 3CN2A 4QF1B 5G5DB 3LMJH 2ICEA 3QWOB 4A63A 4JFSA 5I18H 4HX1A 4K8RH 3WTYA 4WNJA 5I5JA 2XC8A 1T04A 1MHPL 4KV5F 3GC3A 4MXQD 5IHUH 1LEKB 2UY6A 3LZRA 1M1XA 2V5MA 4GRLA 4JE0A 2CO2A 4FEMA 2AXGA 4UQ2A 3CMOL 4Z7QF 1OHZA 1QFWM 4P57B 4UQIM 4NQED 1PY0A 4NN5B 4FFYL 3VO0A 3FCSB 4EF3A 3BRDA 2GJ6D 5DT1H 5EU3A 5LGKA 5KVDE 4MB5A 4QRTB 4LVNB 5KYNA 3N0AA 3DBXB 4PY8J 1SXBA 2AQNA 1HILB 3B7YA 3AUWB 4ISVA 4XMWA 2FATL 3CX5J 2D7PA 5IMOA 2HFGH 3HE6B 3ARWA 4DGIL 5E99L 2OR9H 5E9AA 4ACTA 3L3JA 1AXSA 3HPJB 4JPWL 2D9CA 2KLRA 2XZCL 1P4BH 1M7XA 3UDWA 2WBJA 4I1RA 3QSKB 5DQ9B 3MRHA 3WSQL 5JIMA 3CLWA 2HRHA 1PIGA 3D18A 3PDDA 4G82A 1JXFA 3HAEA 3SKJH 3DX9A 3VYPA 4XGZA 5KN5A 4LSUH 4UQ3B 3RJOA 2V2WA 1FN4B 2PWDA 3CXHK 4MNHB 4BK5C 3MNWA 1KXVA 3VAEA 4QYOB 4F2ME 4ZZKA 5AG9A 2K3TA 4AL8L 1CB4A 3AU1B 4AITA 5B1JC 3H54A 3GLEA 1J5HA 2HT3C 4G72B 1QW8A 2PP7A 3LKPB 4PWGA 2JCCB 1JZ3A 1A3RL 2CLZA 1IGML 3WCYA 4K7FA 4ZNEE 4APQB 4QRAA 1AQ8A 1KFAH 4GBXC 4M8VA 4ZO9A 3QR2A 1PJ9A 1D7DA 2LVEA 2EKJA 4YPGA 1D2OA 1WFIA 2BNRD 3CGTA 4AIZB 3CJJA 4LEBA 4PIRF 4WV1A 1PAZA 2R56L 1CFBA 2PYFA 1NZRA 2CO6A 4XE0A 5ABZA 3SQOH 4DN3H 3S88L 3ET9F 4TNFA 4ODVH 3FT3B 1OTUC 4PJCF 2I5YH 3FQWA 4R7NB 5JO5B 1FV1A 2AJUL 2FH6A 2EACA 2XVBA 4P99A 3QDJE 3D8MA 3EFOB 3RQ3A 1FA4A 3FNKA 4FFWC 3LQAC 4EIBA 3HA0A 3IJEB 3JWNE 1ZLSL 2MPVA 3TU6A 4LLDA 2BS9A 3O3UN 1U8MB 1Q72H 5GPRA 4F2MB 1KIRA 2PTUA 2XXCB 5IQMA 5D1ZI 1Q9KB 2ALAA 4NN7B 3GINA 3ML9A 3KVPA 3L1FA 3LSOA 1I4FB 2ICWB 1LTXA 2VLME 3R4RA 2V5TA 5D6CB 1CDYA 1RU9H 2NY7H 1TF4A 3EXLA 1SVCP 3L4WA 2VLKB 2KC0A 2VXQL 4R7DA 2W9EH 3C60D 3QEGH 1IGIH 3D0LA 4GSUA 3SDCC 3IKCA 1KB9K 3WLWD 3B9KB 1JMXA 4W9DC 1WAAA 1TQSA 3SJVB 3UYRH 4ALAL 3L48A 5FFLA 4B53A 4A68A 4WVRA 4XOCA 2HKFL 4PJHE 5GGRY 3QDJB 8PAZA 5JR1L 3DO7A 2RTTA 3MO1A 1BZDA 3FN9A 1IQWL 3S3DB 3FBQA 3GIVA 2RFXA 5G4NA 4OQ1A 1OSZB 4HUXB 1FYTB 5F3BB 1CU4L 4FXKC 2IDFA 2CRYA 1Q0EA 2A1WH 4E9QA 1SBBA 5E8NA 1AFVH 2FQGA 3QUKB 2MFNA 2VSDA 4URKA 1DJSA 1HZKA 2IQ9H 3ARRA 1KJ2A 3D2TA 3MLZH 5F6IB 4DFIA 1MXGA 3BZFB 3DA0A 3IDJA 4PGZA 3ILPA 3HIZA 4DK5A 1KLFB 3QEUB 3BO8A 1FJ1B 1PZSA 3A4FA 3ABZA 1FYHB 4G8AC 4KRPC 3D09A 4TUJB 2BHFA 2TAAA 1QX1A 3WDJA 1YQVL 4KO9A 1L0PA 1JZ6A 4PG2A 1MCDA 2C5DC 1QRNE 3EKCA 3FDWA 4XCCL 5HPMB 3JUZA 3ZE1F 5BS0A 3K4ZA 5IW3A 1NMAL 4RIRB 5DJXB 4E68A 3VG0H 1AXTH 1EZVY 2CDEB 2A7BA 3UFIA 3N91A 4L29B 3D2UA 3DVGB 4WW1B 3V0JA 1U0QA 3GI9H 4NJAH 5DJ8B 4WLCA 1S7UA 3RVXD 5I66A 3EO0B 4JRLA 4LCWB 4I77L 1EA9C 1U8CB 4UCFA 5AOLA 1AMXA 4A67A 2QKIB 2XXMB 1CLZH 1MI5A 2HSIA 2X6VA 3I50H 2WXKA 4MX7A 1AGBA 3QEHB 3M8OL 2DQJH 4GMSL 5CJBA 5C09A 3I3DA 3T1FA 4Q9CA 5CBEB 5I6XC 5IQ7H 1CGWA 1GKOA 4PJBB 2YEZB 1FG2A 2EXSA 3QISA 3NCJH 3U79A 5IHZA 2XQYG 3D85A 1X44A 3A4EA 5EHFA 3GMLA 1OCCB 4KTDH 1P6FA 3E2HC 2OTUB 2ZUYA 2EYRB 4I5BB 4X6FA 1USZA 4FLSA 3U6XS 3OGCB 4FQLH 4J3OC 5TGBB 1QRNB 3VFSA 4XNZC 2EYTB 1OD9A 5E2TL 5IB2B 1QPPA 4DPRA 1BOGA 5E2UH 5DUPL 3WJLA 3FB8A 3G3LA 5FW8A 1N3NA 5T3XD 3HG0A 1FGNH 2EO1A 4RESB 5AAMC 5ICYA 2R8SH 1H3UA 2BNQA 1C1EL 4G8EA 5HHVH 1J8HA 1F3JA 3SKNB 2K3HA 1D6VH 3GMQB 4L5FH 4NKDB 1LO5A 1D7BA 3NUKA 4TQ8A 4TLSA 4ZX4A 4FNSA 2D03H 4QO1B 5D5ME 3BUDA 4QWWD 5AUMA 2FO4B 1BMZA 1NGPL 2N3JA 1UWYA 1S5IH 1FL5B 1ZS8B 2NNCA 3VTMA 1VB9A 2E46A 4FERA 4PD4K 3CC1A 2JKNA 4YHPB 2DQUL 2OXHB 4LBAA 5C2BL 3IDIB 3QFDA 1WC7A 2K1MA 2VO8A 4HIIA 1CT8B 3KLHC 3QC5X 3LPWA 1TQCB 1MJ7L 1ZEAL 5AQ0A 3HBZA 4FQQA 5DU7A 5A2BA 2HAZA 3H85A 3QRGL 2P5PA 2D7MA 3VU2A 3KXFE 1IC1A 2C4FU 2DI7A 3WKQA 1HT6A 2EIZA 4G70B 1MRDH 2XQYA 4K8RC 1OHQA 3V55A 1GIGL 4ZFFA 1E6JH 1HOCA 3UAJC 4RRPG 3RX9A 3T77B 5I24A 1OQXA 4OLZH 1P5VA 5B1KA 1CFSB 2WQRA 4J3VA 4O9HH 2BS71 4G1EA 3VXQA 3U1QA 1OTTC 4YZWA 1IQDA 2IWFA 3M45A 3NCBB 3BC9A 5ESVA 3IMTA 2GEQA 3SDDD 1IGJB 3REVA 3QO0B 3CXDL 4FMVA 4YAQA 4JO4H 4OD3L 2GT9A 1T0NA 1BPVA 1D5RA 5D5MB 3V6FB 1HQ4A 3IFOB 4JZNB 1CFQB 3LNEA 1AI1L 1OSEA 3RJQB 3WFDL 4HH8A 4Z78B 1F11B 1AQDB 3GSUB 3P3SA 1U3NA 4P48A 5EWIL 4NO0A 5LJYH 4HUWB 5DLLA 1JL8A 1MHPH 1A7PL 2Y4SA 2Q6WA 3VXUD 1G1CA 3SBPA 3WTTA 2NYYC 4EKJA 3GGWA 3T3ME 3DMMA 4JANA 2FH8A 3OJMB 3CMOH 3KXFB 5D4JA 5FF6A 5J57B 2BP3A 1GRWA 3HTLX 3EGXB 4FFYH 5IJBC 1CXEA 1A6PA 4ZK8A 4GUPA 5CBAB 5D1QA 3L1EA 4K7PX 1KLUB 3VWJC 4MWFB 2R1XB 3MLWL 1OT2A 5C0AE 4KK6D 2XTJC 4HV8A 4N0UE 1G1OA 2EXWC 2V8LA 1JZ4A 2FATH 5TF0A 1IAII 3KYMB 4U1GC 1C7SA 3F3HA 2FEDD 1E9PA 3VFGL 4DGIH 5E99H 4OZHF 2OYMA 2KT6A 2X4TA 4RRPA 5F6HJ 2OX5B 4JPWH 4KFZC 1MLBB 1LEIA 1KWKA 2XZCH 3WSQH 4BKLA 3DO4A 4GG8B 3KPOB 5A3ID 1YEEL 5HDOA 5BOPA 3KWWA 2G4EA 2P5ED 4Y9CA 5J6GA 4AI7A 5LBVA 3HKZA 4DP7X 5EC2B 1N26A 5H2BB 1P7BA 3CH1B 4Y4FA 4AL8H 1BVOA 4EN3D 2H32A 1NBYA 1BJ1H 2IH9A 3SGEI 2Z93B 3Q44A 3T3MB 5DRNA 1JXKA 5F21B 2LW3A 4G9DA 1IGMH 4Y2DB 4HGKC 4ZFZA 1HHIB 3QZLA 4LKXA 4XMKL 2JCWA 3FONB 4Z7UF 4ZXBC 2DWXA 4IHOB 3MRFA 5AVZB 3GTNA 3FZUC 1UM5L 2Q76B 3MN8A 4JFFA 3MRKB 4DQAA 1KTDA 4AMXA 1L5GA 2PW1A 4XWGL 4QTIL 2F68X 2ZUUA 3S88H 5KG9B 2WAHA 3AY4C 1EANA 2EIKB 3H9YA 3LH8A 2Q10A 4O51B 4U6YA 4NQSB 4HIJB 3U9PL 2GTQA 2CG9X 4G5ZL 2CMRL 5E8DH 3T6ZA 4RNRB 1JDAA 2AJUH 3D52A 4N2GA 4CDGC 5BOJA 3J07A 4P3CL 3Q9PA 3HG2A 3KBFA 3LY6A 3MRCA 3HRZA 4L1SA 2YAOA 1ZLSH 3ZY7A 3MVSA 1UUNA 4XOAA 3HB3C 2KBGA 4E0RA 2O30A 3QNZA 4HHAA 4XNQA 4CN4A 4D7PA 1ONQA 3VWKB 2CNZA 4YFDB 3ISWA 5I74B 1UXSB 3QAQA 1T1XA 5C71A 1OP5H 2R9HC 1VGEL 5F1OB 1CD8A 4FE9A 1NKOA 1JF1A 3MZGB 4PVBA 2OSXA 3FQRB 5DK3A 1L6PA 4X5QA 1VGKA 5K33A 1P9MC 3SE4A 2VXQH 2ITEA 3X1FA 2VC2H 4HK0B 1UYWL 1TU2B 3FTGB 3NBNA 2WYTA 4HH9A 1ZRUA 4L05A 4FQHA 4ALAH 1I7TB 3OAYK 3ATBA 1KYOK 3K8LA 1H6FA 3TWCL 4WUUB 3L95A 1T83A 2Z35A 2HKFH 1MWAB 3KGUA 4CW1B 1QOKA 4HEPG 2GBVA 1VADA 1RY7B 2FCBA 4OCXH 4CU6A 5JR1H 3DRTA 1IQWH 1SJMA 4TF4A 5E7FA 2XBZA 1O7VA 4AGPA 5DJYB 1N5YH 2OL3A 1XB8A 4K5OA 2CO7B 1CU4H 3RE0A 5IHWA 1BF8A 3SD2A 1LWHA 1ZS2A 2QTEA 3U2SB 2GHZA 1U95B 2XWRA 4S0SD 3NP4A 5DSCB 2AXFA 1LE9A 2V3EA 1HN1A 5ID0A 5MEOB 1U21A 4Y9EA 4QRPE 2XWTB 2P24A 3FPYA 1QKZL 1QMUA 1R3LB 2YHGA 4YHKL 5JA9A 5H4YA 5EUOA 1EUUA 1KIUB 1X7QA 2QGCA 4P2OD 3SYAA 1LWRA 4DP6X 2DQIL 4D8PA 5IHHA 4L3AA 2HJKB 5EBMB 3H0TB 1GH7A 1IBYA 3SBRA 2P28B 1YQVH 1OIOA 2IIJA 2XG4B 1UEYA 3FUKA 3JV5A 4XCCH 4H8VA 2BMKA 1WWWX 3TFKC 3MCKB 1NMAH 4HHGA 4H40A 1OTSC 2CPCA 2XWEA 1DN0A 4BFJA 1IGCL 1KWGA 1QQDA 5B3JF 3QYNA 2Y5TB 3LHAA 1ZVHA 5F93C 4AQAB 1H3WM 1KG0A 4I77H 2NLJA 5CF3A 5KSBE 3QIWC 2QGEA 4X5PA 4YDLB 4AYFA 2XRAL 2DJ4A 2NXYC 3CC5A 4HEPA 1BPLB 2N0MA 4GMTL 2HUEA 4LGPB 1PG7L 3BIKB 3RP1A 3V4VL 4GMSH 1IT9L 4UQCA 4X4XB 4PJ5D 1UT9A 2I24N 2KPNA 1E3XA 5C6PB 3PP4L 1LO2L 2LAGB 4X98A 4JM2B 4B9GA 2MJWA 4G1MA 4OAWB 5BRZB 1RJLB 1JAEA 2AV1B 2JJTA 2QBWA 5DI8B 3WEMA 1PD0A 1TZIB 3H3PL 2P5WB 4RGMB 1JUFA 1ND0A 2J56A 5JPMC 3I6GA 3AB0B 4NQEE 4JJ5B 3T0EB 1LNUA 2ADYA 2NUTB 5E2TH 4BCYA 1I85C 5ID1B 3NIGF 2GJ6E 1CICB 2BM3A 5DQDL 5AZEL 2V9UA 3B9VA 1GL4B 3TZVD 5DUPH 4PWFA 2A83A 2VZUA 4UM8B 3RFZA 2HG5B 5KBPA 5D1XD 3V5DB 3Q43A 3WN5C 3L17A 5KSBB 3S3BB 5F9JA 5JW5A 1D9KC 3B5HA 4L3EA 5F70A 4AUYA 3FYIB 3RPIA 4E41A 4JM4L 5EV7A 2WJ7A 5D93B 4AGOA 3B3BA 2IEPA 4I1PA 4AGMA 2QV2A 2DQUH 8CGTA 5C2BH 4GUCA 3OKDB 3A6BL 4X6CA 3T3PE 3VGGA 2Z4QB 4J5VA 3SO3C 1MJ7H 1ZEAH 3MRGA 4WFED 2UZIL 2X3CA 2OQJB 1S7XB 3QRGH 4NS0A 5E23A 4BCZA 1RSYA 4KUZL 3BAIA 1MG2C 1F4YH 4FA7B 4GRWE 4NQEB 3SPVA 3ZZLA 1J0JA 1GIGH 3BE1L 3NIFE 4W68A 2GJ6B 5FAAA 1GMIA 1GGTA 3OXSB 3K6SA 2BNRE 1KPUA 1L0YA 1WVZA 2PXYD 4LNVA 1GS8A 4GQQA 1W9XA 4G11A 5D7LA 1P1VA 5D7IB 3TCLB 2XQ0A 3F58L 3WE1A 5E24E 4HCRA 5EB9A 2I69A 3CXDH 3GRGA 4GW1B 5EU6D 5EZOL 1KIQB 4RX4D 4OD3H 8FABB 2V17L 2J6WA 1H5BC 1SGKA 2ARWA 4XP1L 3WELA 3MA9L 1AI1H 1IGTB 5DHYA 3WFDH 3ZDZB 1IBFA 3CHOA 1B0RB 2K4WA 3L6FA 4YZFF 5EWIH 4AYGA 3T3PB 3AJ7A 3BVWA 1A7PH 1VZGA 1ECYA 4A04A 2ZYIA 5FA4B 5EF2A 5TH2A 3QQ3B 3K4AA 4N0RA 5D7JA 4YDIL 4AM0B 1A2YA 1EEYB 1VF5C 1NPJA 5I1DB 3APMA 1FNLA 1BD2B 4HBQA 2P46B 3VE0A 1WUNT 1TO4A 4AL8C 4RA0C 4PJFE 3MLWH 4XPHL 3KLDA 4XXCA 2BNRB 5KSUB 1CFNB 1BQ5A 1S6NA 3BAJA 4XZ4A 4JY5L 5I8EB 1EVTC 3QJZA 1ADQL 1DVYA 5L2KB 4TSAL 1RJZB 4KRMB 3VFGH 2LLNA 4JHBA 4PVNA 3H56A 4AJWA 5I2IA 1XF2A 3CU1A 1F4XL 5TK2A 3LNHA 4XVUD 3IMWA 3RZCB 1YEEH 4LSTL 4PGDA 1EERB 4OZGA 5HHPB 1K4CA 4E9SA 1SYVB 4JR9L 3QUZD 4NUQA 5I1EL 3STZB 4DUWA 1TJIL 1G9NL 1R3HB 4AV0A 1HH9B 2AXJA 1NFKA 2DJMA 3WKPA 3C6LD 4P23D 3IN0A 5BW7A 3O45B 5D96C 4XMKH 5IMMB 1JWUB 5K9QI 1BFOA 4U31A 2OLDA 5HYJA 1D3CA 4PJFB 1XBRA 4MZ2A 4K4KA 4HJGB 1OGSA 3KPMA 1UM5H 3LKQB 1JRHI 4DVBA 2IPKA 4YLQT 2WLIA 2W0LA 2CPUA 4ELMA 5C0BA 2HKHL 2WV3A 1G7PA 1YYLL 4XWGH 2P47B 4ZTOL 4LLVA 3L4ZA 3NCYS 2H8PA 4FD0A 4GS7B 3U9PH 2CMRH 2F58L 5F71A 4QIRA 3EGDB 4N6RA 1SMOA 2A2QT 2WVSA 4HIXH 4QGTA 4A7UA 5FYLD 4P3CH 4U3HA 4BA8A 3QQ4A 1SVZA 5EPMA 2ZCLL 4Q9RL 2AMGA 4JK0D 2ZF8A 4JFQA 1BVNT 3L4UA 4K5PA 1J9RA 4G6AD 2YGQA 3WFCL 1G7LA 4ALAC 5GIRB 3OR6A 1X5AA 2ZZUT 3DPDA 4BZYA 5HSFA 1E4JA 3RIFF 4KOBA 2CLRA 4UNVA 2ED8A 3CPUA 3TO2B 1CGSL 1EBPA 2ERJB 1VGEH 3WJJC 3EJYD 1QNIA 3WNOA 4PREA 1A7BA 2JJWA 4PJEF 3GMNB 3SYCA 4AKQA 5JW3L 3NCXA 1CI5A 4PM1A 1UQSA 2MEJB 5IKCB 4WWOA 2X12A 4RBPK 1O9ZA 3WS6C 1JZDC 4PRIA 1UYWH 3BJLA 1M4KA 4LB8A 1YC7A 2F6AA 3X12B 2IGTA 1S9XB 1JVKA 4NFDA 2IC2A 2A74C 3TWCH 4KUCF 1JGEA 4M8QA 4BRVA 4FN0A 4CMHB 3G6AA 1P2CA 1REIA 3W3BA 3E6HB 4MKMA 3D3VD 1NUDA 3O9WA 4IEFB 4J4PC 4XBPA 5T3XE 2WXLA 5DD1L 3VFNB 4A39A 1NBVL 4ZYKA 3F12A 2ZKWA 4G71B 4MAYD 5DEGA 2BY1A 1DQLL 4Q6IA 2KKQA 5EN2B 5E2VL 3I6SA 1JV5A 2ZAHA 2Y06L 2ITDA 1AR1D 4I3GA 3RWGA 2J8UE 4K15A 5IM7A 5PAZA 3G5XA 3UTPD 3MNVA 2ZP9A 4H8PA 4Y4HD 2C3WA 2CCVA 2UWEF 4ILDA 1CGUA 1HCZA 1QKZH 4KKAC 4LXFA 3HJ0A 3CLEL 4GEIA 2GC7C 1QG3A 4YHKH 3N40F 2R29A 2R2EA 4NWUL 4Y9GA 4H26B 4Z0XB 1S5HA 1RZGA 3C5ZC 3IGUA 3N1PC 3F5WA 2Y6SC 4C56A 4KNUA 4F57L 3RYMA 1U2YA 3CPLB 1KN4L 2G3NA 2JIXA 3IF1B 3MHZA 4WZ9A 2NNRA 3VJ6B 4NN6C 3PHSA 4N2IA 4IOIB 5CEXB 1PZ3A 2G60L 3OR7A 3BIAX 3OKEB 4O02B 3VGBA 1Q9OA 3RVUC 3RWDB 2OA9A 4HS3B 3OC8A 2NCMA 4Z7IA 2I26N 1IGCH 2CGYA 2YWZA 5D9SA 1A9BB 1MNNA 3BVNB 4HJUA 2F8OA 2PWEA 1BF2A 1TZ8A 2E6PA 1I1AC 2IF7A 4A2DA 2M26A 3HG3A 3GI8L 2XRAH 3CSYB 4GMTH 1ZV2A 1THAA 4LU5L 2J8UB 3V4VH 3VFMA 1IT9H 1NJ9A 1Y7VA 1KJ2L 3Q13A 1ZA6A 4KI5F 5IB4A 1A7RL 1DQJB 2EC9T 3RTQC 2QPUA 4O00A 4ZMQA 1QASA 2CRIA 3PP4H 1LO2H 4Z7WA 2X4SB 1FNGB 2PCFB 5FIEA 2VLJB 2WXOA 2FBOJ 1EFXA 3VXUE 3ZW3A 2ZOKB 4JFZL 3H3PH 3PHQA 3VXSA 5I8CB 2E47A 2VDKL 5AZEH 5FHAL 3K2IA 4HLEA 4ZW5A 3JTSB 2W9DL 4WFGD 5EIIG 5LGHL 1SXCA 4PWJA 5JIPA 1XEUA 2WIIA 2YARA 2IPUG 2ICWI 1RZ7L 3QJFA 4P04A 4QHMB 3EYFB 2WJ5A 4XTRC 2YZ1A 3APNA 3V5HB 2OW6A 4F7MB 1NPUA 3V2AR 4OF5A 3CCHA 1PF3A 4GI9A 1J18A 4NHUB 3T5WA 4JM4H 1A6ZA 4P5MA 4KKPA 4LCUB 1VDGA 3ETSA 3QUXD 5E9DE 3P0VL 5IBLC 4YSUA 3OKLA 2DL9A 2P5EE 1SDDA 1WEJL 1RJCA 4Y0GA 4ACPA 5LG6A 3A6BH 3LRSB 3VUAA 1SVBA 3FFCD 3H9SA 3VX1A 1TTAA 3HOGA 3VXUB 3IFNH 4I7ZC 1Z1WA 3PL6A 1XZWA 4JRXD 2UZIH 3ZUNC 4I88A 3GXMA 4QF1A 5G5DA 3QWOA 1JI1A 2BIHA 4KUZH 2DAVA 3K46A 1NBZB 5JHLA 5BUPA 4ZAKD 2BDNL 1JZFA 2N01B 1BEYL 5KTEL 3BE1H 1LEKA 2C26A 3H8NA 3UZQB 3MV9B 4M29A 5IQ9B 4P06A 4Y1SA 5TQ0L 2E7LA 3VI4B 3VD3A 4QR7A 4JFOB 5J6HB 1YDPA 4P57A 2YUZA 3EDDA 1WGOA 3FCSA 3HS0B 4PS3A 3F58H 5I1LB 4LAQL 4NKQB 3RGVD 5EZOH 4QRTA 1KY6A 3DBXA 4F3FB 2V17H 1IC7L 1S7TB 1HILA 2DIAA 3BESR 4XP1H 2BZCA 4R0LB 1CURA 3MA9H 4R2GD 2E4TA 3V9EA 2P5EB 3HE6A 4E2OA 3QULA 4YHIB 1BJ8A 5ACZA 1JK9B 1EZUA 1YCSA 3ZYJA 3B8YA 4U6VH 1GZQB 4DT2A 1XH1A 4KJWD 1L7IL 4WDIB 2HJLB 1O7DC 1WCBB 3HS9A 4UDTB 4PRBB 3VGAB 4YDIH 4AJVA 1YY9D 4OZ4B 1PD1A 4JG9A 4UQ3A 3RTLA 1GGYA 4Z18A 2EJ1A 3QS2A 4MNHA 2VXVH 3HNVL 2DI9A 4QYOA 5FC9A 1EDYA 3AU1A 1I8UA 3EYQC 3ZDYB 4LAJH 4XPHH 4PRAB 1GKEA 3LKPA 3CFUA 2I25N 4MHHI 3C09C 2WZ0A 4APQA 2YD8A 4MZRA 4JY5H 2EYSB 1Q8MA 3UROR 5IREA 3GXPA 1ADQH 3LYRA 3MCYA 1XTLA 4MCZB 5BQ7B 1EHXA 2I9LB 2HTLD 4PBWD 4Q8BA 2P49B 2ZG1A 3E8VA 4H88L 4AIZA 5KZCD 1F4XH 1N10A 2G9KA 5AZUA 4TL5A 3SOTA 1T6VN 1OPOA 5AW2B 4GKSB 4GKZB 4LSTH 2Z31C 4N90D 4LHUB 5CJOH 3VFPB 4MCYB 3N41F 1KCKA 4QRRD 3FT3A 1BQKA 4Y16D 4E42B 4U3CA 4JR9H 5I1EH 2JQMA 4R7NA 5JO5A 1TJIH 1JHLL 3EDEA 1G9NH 3CNKA 3EFOA 2IPUK 3WDIA 5HI5C 1B4JL 4YSOA 4OQTA 2RMNA 3IJEA 5HPOA 2QVKA 2XKNB 4JPVL 1FBIL 2WTOA 3OWRA 1U8MA 3WUWB 4GH7B 4F2MA 4N2HA 3X1EA 2Z0UA 4ESKA 1FZOA 5JW4R 2VQTA 3MROB 3E80A 4NCDA 5MHSD 2EDQA 5SWZD 1FZJB 1AO7D 4JFYB 2WN2A 1I4FA 2C8NA 2ICWA 4WKZB 4ZDHB 4ZNEA 2HKHH 1AHMA 1YYLH 4NC1E 4ZTOH 2RIKA 1AC0A 3QXDB 2PO6D 3A23A 5D6CA 3U0PB 4FNUA 2ZUQB 1Q1JL 1B0WA 2VLKA 2FJHA 2X44D 2F58H 3AC0A 4J3WA 3NJVA 4JX0A 2EKSB 2JQZA 4DKDC 2ZCLH 4LRNH 3F8UB 3SBQA 3PG2A 3VXRD 3B9KA 1GTNA 3SJVA 2WKLA 1LEGB 3ZJAA 2J1ZA 5KBLA 2FB4L 2GJZB 4BHUA 1BQLH 3P54A 3FRPB 5GSRB 3QDJA 2A99A 4N8UA 3EOBB 4A7QA 1CGSH 4DEWA 5GZOA 2DWEB 3PLYA 4I4WB 1OSZA 1YJDL 4HUXA 1FYTA 4PJ5E 4F1SA 2ZP0T 5JW3H 3KE0A 2WANA 5J56B 2PP9A 1EFQA 3RIFK 2EDTA 3QUKA 1GW6A 4TRPH 1M6UA 2XWZA 3DX1A 4R26L 3QIBC 4HS6B 5ALBL 4HKJB 3AWGA 2VL5B 1O5PA 4LLWB 2BSEA 3MRJB 2X89A 3BZFA 4MXWL 3RNQB 2VR9A 4G8GB 4DNLA 4YHYC 4KH2A 5EEYA 1KLFA 3QEUA 4UOW1 1FJ1A 5CJQH 1GJUA 1AKPA 2J6EL 3O6FC 1WYJA 2YEQA 4TUJA 5JYMA 1CR9L 4QRUB 5DZAA 3CZJA 2BY2A 2VR7A 5DD1H 2FQFA 1NBVH 1T20B 5D1XE 3CHRA 4FCHA 2FHCA 4YIQB 5FV2A 5HPMA 4Q2ZB 2IDQA 1ZLWH 4FQXD 3RB7A 5C8JB 1IRAY 4W9GC 4U1SB 2FSEB 4GAGL 4KQ4L 4RIRA 5DJXA 5E2VH 3SZ6A 3U1PA 1JWSB 1BFTA 2CDEA 2Y06H 2IWKA 4MJ5B 5GS0D 3V6BR 2AGJL 1L6XA 2H1PL 3DVGA 4WW1A 2BZ7A 5DJ8A 2APSA 5KYWB 3EO0A 4LCWA 2HP4A 3M7OA 1IJNA 1HJCA 2QKIA 3C8HA 2NX5D 2OZ4A 3CLEH 2VN5A 4ZQKB 1ADWA 4NWUH 2YPKB 3EH2A 3QIUD 3QEHA 4XP5L 4WFEE 5CBEA 3MBED 4F57H 1RHHA 1KN4H 4PJBA 2YEZA 3MLYL 3F7PC 3DJ9A 4LVHB 5JW4Q 3FCBA 1XIWD 1N64L 2G60H 4OZIB 2FWOB 1TENA 4KDWA 2OTUA 3PV7A 2D8KA 2EYRA 3LB6D 2DIEA 3VU1A 2QADC 3D39D 3OGCA 3QCVL 1COBA 5D1XB 5TGBA 1QRNA 3MAWA 2EYTA 2VXUL 4ICXA 3ATDA 5IB2A 4I0PD 4HCIA 1H3TA 1A64A 3SODB 4HW6A 2X10A 3GI8H 5EU6E 4XCYB 4YLCA 2O5ZL 2G5RA 4LU5H 3A6OA 1KJ2H 2VJXA 4LL4A 4LVEA 4M4RB 4ZS6C 3SKNA 1A7RH 5DDHB 4ERSL 3GMQA 3SE3A 4NKDA 4A2MA 1FIEA 1SJHB 1E2WA 2CXKA 1MCSA 3LNDA 3PFUA 4ZFGL 4QO1A 3OQRA 4PY7B 4QLWA 4I3SL 2FO4A 1NICA 4UOW0 1UGNA 1I8AA 1FL5A 3TA3C 1ZS8A 4JFZH 1B0GB 3EF7A 4MZ3A 4JFED 3H4HA 1KB5B 1XCXA 4YHPA 2OXHA 3FUEA 3PHAA 1CT8A 2VDKH 2IAMC 3T65B 5A43C 3FTUA 5FHAH 5ERWA 3NSJA 4OLUL 1KEGL 4X5LA 2W9DH 5LGHH 1BOYA 4IK6A 2PXYB 1ACCA 1YRKA 4RGND 1G9MC 3UL4A 1A4AA 5KJ7E 1RZ7H 4TL4A 4N0YL 3G9AB 1EVUA 2PCPB 4YSPA 3T77A 3VMOA 3KWTA 3TEYA 1SPDA 4IDJL 5EU6B 5I28A 5BPPA 5I0YA 3VFWB 5AW6B 4JPQA 4KI5C 4AMWA 3VD5A 2VW7A 3P0VH 3RVTD 5FO8B 5BQDA 3HC0B 4XVSL 1IGJA 1WEJH 3QO0A 1DL7L 4FA8A 2YZ8A 2QHRL 4M48L 2K6YA 2FWUA 3CDGB 5D5MA 3V6FA 3IFOA 1HZLA 3NCMA 4IYKA 4JZNA 1CFQA 2E74C 1F11A 1AQDA 1JHKL 1UH2A 3DHPA 1A7OL 3GSUA 3TIDB 4Z78A 2BDNH 4HUWA 3NTCL 3QC6X 3B6SB 1OT1A 1AHWC 4LOUC 1BEYH 5KTEH 2Y0SA 2EUWA 3TBYB 2Z4TA 2G2PA 4X6EB 2VN4A 1PJWA 5L6YL 4AV5A 2ZSVB 5TQ0H 2VDNL 4OJYA 1T7ZA 4ONOA 4F7EB 3KXFA 3F04A 5F7EL 5PCYA 3GJEB 5IVZB 3EGXA 1IKNC 2H2PD 3F05A 5CBAA 2GTWB 4LAQH 1QFWI 4MWFA 1J9TA 2R1XA 3RL1B 4M6ML 2DWSA 1CQYA 3OPZL 3WIAA 5IV2B 4Z23A 2WNKA 5AENA 3IAGC 4MXVE 4MTMA 3G08B 5FYLE 5HTSA 5C0IB 2OSYA 2X6AA 3M07A 1G5GA 3CHQA 4NHCL 2NNFA 3GUTB 3V0WL 3TBCA 1HXMB 2OX5A 2HVJB 3QR0A 2Y7QB 1MLBA 3QORD 2EABA 3W2DL 4TSCL 1L7IH 2H0FA 4ENEC 4GG8A 1B90A 3KPOA 3TEWA 2C3GA 2DOCA 2MOVA 5D8JL 1SOSA 3C6LB 3CD4A 5EC2A 1DVUA 2PKDA 3FC8A 5FGSA 2Z65C 5TD4A 4DGVL 1DZ0A 4XX1E 4KHXL 2OYPA 5CD3B 3T6VA 3SGDI 4R90L 5C86A 2Z93A 1OAUL 1G9NC 4PI0A 3WN6A 4TVSa 5T5FA 5FGRA 4QPEA 3QZWG 1MXDA 3U46B 2XV0A 2PTVA 2XWXA 1J5DA 4Y2DA 2QSTA 4I89A 1HHIA 2WNWA 4LFHG 4XNAA 2BVOB 3NIDE 3QJRB 3FONA 4BSJA 4U3SB 4DVRL 1BBJB 4NPKA 2EDFA 3CIAA 5B1AB 4NZTL 4IHOA 1UWFA 4M56A 4D0BB 4H88H 6TAAA 2Q76A 2BRQA 5C0AA 1U92B 1NCBL 1U41A 4KKRA 3WG7B 3ULVL 1FNFA 4AQ8A 1TFHA 4ZUUB 1WT5C 5EEUA 1Z9OA 4F8OA 3GEWB 3D3VE 4L9DA 5DCCA 3WXWL 5KG9A 1QYGL 3IJ9A 1A3ZA 4DP9X 2GCYB 3QT2A 4O51A 3HZMB 4NQSA 4HIJA 4Y1AD 4UOJA 3FB6B 5CCHE 4RNRA 4DP4X 9CGTA 1JHLH 5GRVL 2XBTA 4WWKC 1K9TA 3MXVL 1JV2B 1Y1UA 3POHA 1X5ZA 2AAAA 4FEIA 4JQXA 1FCGA 4CBZA 4JPVH 1FBIH 4PN6A 3Q2WA 3KPNB 3UTPE 1D5ZB 2ZUXA 3VWKA 3Q7JA 3P4MB 3SKMB 5FOJA 5I19L 4AEIL 3N43B 1ET5A 1UXSA 5HVHC 1BMGA 4ZO6A 2DTSA 1S3KL 5DYFA 3FQRA 4X7SL 1J0HA 1Q1JH 3M1BB 5I6PA 3S37H 1NCWL 1O6SB 3BAEL 1ZWIB 3B7RL 3RWEB 2WLMA 4UIMB 1MY7A 4HK0A 2NYZA 1MH5A 3VNZA 1TU2A 2DJUA 3FTGA 1AYOA 3D3VB 4NAQA 1E65A 4IKIA 2JKTM 1I7TA 2FB4H 1S7QB 4MAYB 1T1ZB 2R51A 4Q4EA 4WUUA 5D2NC 4ZJ9A 4BH7B 1MWAA 5I0XA 4CW1A 2QR0B 1DDHB 1CDUA 1MCOL 3WKNA 1PLGL 4OF8A 5KVGE 3LEXA 1RZIB 1GZHA 5EOCJ 5DJYA 2EILB 4W4OA 4KI1A 1YJDH 5AW0B 2CO7A 1EHLL 1Z2KA 3ZRFC 4KMTH 4L8SB 4NCC2 4IRJB 2Z34A 2C9PA 5I9QB 1B9KA 4R26H 3U2SA 1MSPA 1OWWA 1U95A 5ALBH 3VI3E 5DSCA 3N1MC 3BUQA 2ISDA 3CQQA 1SJVA 5IFHL 4ZMOA 5MEOA 1SJXA