4OB5L

Ontogeny of recognition specificity and functionality for the broadly neutralizing anti-hiv antibody 4e10
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
MEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPSTFGQGTKVEIKRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ontogeny of Recognition Specificity and Functionality for the Broadly Neutralizing Anti-HIV Antibody 4E10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords 4E10 antibody germline precursor 7 heavy chain Fv
total genus 26
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ob5L00
3G5ZB 5DR5L 1MHEB 3FB6B 1YDPA 1QKZH 2NYYC 3MGOB 4WDIA 1NCBL 2DQJL 4TTGA 5DDHB 3ARWA 3F5WA 4FS0A 1WAAA 2E9JA 5KVEL 4ACPA 4L8DA 1FGNH 2WZPD 1OB1B 1JWMB 2NY2D 1FDLH 2P5WD 5HDLA 5SV3A 3VD3A 3DVGA 3PWNB 1UWXH 2PO6A 1WCBB 3B9KB 3NCCB 3UYOD 3RZCB 5F7UA 1OTTD 1OSZA 4ONHB 4QRSB 1EJ6A 1NBYB 5GS1B 4ODXA 4LCCB 5E1AB 3NZ8A 3BGMA 3V4UL 3NIDE 5C2BL 2GSGA 3GSVA 3T0WA 3FT3B 4GAYB 5GGTL 3AFLA 2F54A 3ARGA 3HTLX 2Q8BL 5EU7C 2IAMD 2SEBB 4X6CB 5BMFH 4Z7VB 4JAMA 4U6YA 3ZTJG 2E6JA 4RQQB 2RB8A 4L8SA 3KPNA 5BQ7A 1I1YB 3VWKB 2H9GA 3R8QA 1E6OH 3MV8B 3D85B 3TESA 4PJEA 1HCVA 1NGYA 4B50A 1JYWA 2A6IB 4LLUA 1BJ8A 5D1ZA 2I26N 3VDBA 4O2FA 1AD0B 4GMTH 1CR9L 1A2YA 2XI9A 4DUVA 3IJHA 1EPFA 4NPYB 3KLSA 5IEHB 3O2WH 3E6FB 2BVOB 3QRGL 4P23A 3EOBB 1MAMH 2ZOLB 4KKCD 4PJGB 2E9WA 5E00A 4MAYA 4M62H 3VCLA 4ONOA 3V52H 4AEHH 3ROOB 5I73C 2FL5A 2J8UA 2AXHA 3HAEB 1U8HB 5BJTA 2ZG3A 3U0TA 4OCYL 5J8OA 3LD8C 2B0SL 3BIAX 5JIKA 3MXVH 5C09E 2UWEA 4JFXB 5DTFB 1WT5A 2OTPA 5TH2B 3WSQH 5I6XB 3MBXH 3AREB 2KZ1B 3RWHB 3P0YL 3KWWB 1C5DA 3ARDB 4MAYD 4OV6F 1HHIB 4ODUB 3QUXB 4TVPE 1G7LB 5C0NC 1OHQA 4PG2C 2FR4B 1NH6A 1OGAE 2XA8L 2O61B 1HYRC 3ILPB 4NQEE 1JNHB 1KLFA 2NY6B 4L3EE 4N90D 4I0PB 1UZ8B 2NY5C 4U0RC 3LCYA 5DD3H 5FKAA 4R3SA 3T0ED 3SY0B 4K3DH 1JNHA 1NCCL 4NDMA 3O3DB 4ZPTB 1HYSD 5FOBB 3BOVA 3LRHA 3CH1B 4LLMB 4R7NB 1RJLB 3CPLB 4HPYH 3MJ6A 4YQXH 4KDTC 2Q3ZA 1GZPB 4HHAB 1MUJB 1A6ZA 2D7NA 3C8HA 1Q0XH 2NZIA 2DAVA 3HG1B 5KZCD 3BWUC 4JFZL 2VLRE 1L7IH 2UWEB 3P3YA 4JFXA 2VNCA 4E9LA 1U36A 3ULUD 1VADA 2MTPA 4O02L 1AHWA 3L3GB 1QSFA 1TCRB 3L6FB 2Z4QA 4WHTA 3LHPH 5HHOB 4YHOH 2CLRB 5JUEL 2DI8A 1YQVH 2X41A 2Y6SD 4CW1B 5C8JA 4PJAE 5DD6A 2GK0A 3C60D 5C09B 3ET9F 3D3VE 1K8IB 2VLJB 3RVWD 1Q38A 3W2DL 4LKXA 5T1KB 4Y8AA 3VD5A 4Q6IC 3WEXA 1GIGL 3Q6GH 3TVMC 5FYKL 4HJ0C 1NFDA 4XBPA 5D7IF 3OTTA 4HULB 4KMTL 4R8WH 1RU9L 4QHUB 3I6GB 1V5JA 2CIKA 1R3IH 3BH9A 5A43C 3GI8L 4L3CA 2DQCH 5F1OB 4Z7OF 4EUPH 4I18B 3GB7A 4I1NB 4YO0A 2YN3A 4BUGA 5BCAA 3BMVA 2WWKO 1MIML 2HTKC 4C83A 2FZ3B 3P0VL 3FQUB 4G9DB 2YA1A 4XMPL 3QDJB 1GAFL 3QXVA 1VPOH 4MJIA 3QXDA 3JBG7 4J1UA 5E9DA 5HI3D 1K4DB 1NC4A 4LCYA 1I1CA 2V2WA 1HQRB 3GMMB 4XCCH 1FO0L 4WFFD 3WNNA 3TV3L 1MJUH 3DVFA 5CWSA 3QZWA 3VI3F 1U42A 4JM4H 1XGTA 5FO7A 5HHNA 1OP3K 4P3CH 2MQCA 5DC4B 4ZSOE 1PKOA 4NO5B 4GRLC 1IL1B 5IB4A 1V3KA 2IPUG 3UTQB 1LK3H 2VKWA 2Q76A 3FQTB 5JHLL 1ETZA 4GXVH 4X4XB 3U4BH 4D0BB 4NJAH 4JPKL 4OLXH 3BDYH 2QADC 1TLKA 1RAMA 3VJ6A 4PY7B 3DX6A 2YPKB 1BQLL 1QYGH 2VLRB 2FX7L 2X4OA 4XPFH 5SWSE 5JOPE 2N56A 1R3JB 4KK6C 1DTUA 3C6LA 4PGEB 4LSUL 3O3BA 3PE9A 1TJHL 1A14L 4HH9B 7FABH 5E2TH 3KWWA 1XR8B 3FT2A 4QT5B 5JOFA 2I60L 4LLAA 1JHTA 2PTVA 1UGNA 1S78D 4PR5A 5EO1A 2J5LB 4R26L 1UB5B 3EYOA 1RULL 3ARDD 1GGIL 5DRZB 5IFAL 2E9IA 2DYPB 4FZ8H 4LFHD 1AFVL 1XCTA 4XPGL 4NRXB 5ENWB 3MROB 2UVEA 4M93C 4L5FL 1NMAH 4YHIA 2DDQL 5FYJH 4FHBD 4PJ7E 1H3WM 2AS5M 1FFNA 4DAGH 4LPUA 4EBQH 3WKNA 4IS6B 4NUJB 1TJGH 4X9GA 4P49A 1MLCA 4M5ZL 1G9MC 3LQAC 3MJ7A 1X7QA 3MODH 4FTVB 5JA8B 5C0ND 4K8RC 5JW4M 2VUYA 2IG2H 2CKBL 1BVLB 1E6JL 2ZJSL 4HIIB 1MCWW 4JHZA 3O3AA 2R0ZL 4NZJA 3ALPA 3K3QA 2PUQT 1L6XA 3REVB 4LNVA 3U7YH 2XKNA 2APXA 4G8IB 3BPOC 4XNZC 3LQZA 4M3JA 5KSUA 2VLRA 1XGTB 3EOBA 5T3ZD 2WIMA 3OKNB 4U1HA 4PPTA 2GT9A 4ORGA 3EFDL 5AG9A 2MSPA 1JPSH 1FNSL 2VXTH 4LIQH 2AQ1A 2P42B 2C4FT 2ADFL 2V2WB 1SYSB 1X4ZA 5F7DB 3RFZC 4XPHL 1RZKL 4OF3A 4LU5L 3SKUD 4NQDE 2O5YH 4RIRB 1MFDL 4WO4B 3ZZ1A 5E5UB 3MREA 1JJUA 5F8QC 1CLOL 4V2CB 3VFGL 1SQ2N 3WIHA 4OZHB 5D7KD 4XAWL 5I1JH 1EGJH 4PJFB 2XPGB 5I8KL 5I18L 4HKJA 5HYJE 3FMGH 5IJVA 4PJAA 2XV6B 2CO7B 3V5KA 1IGML 4OGAC 4OLWL 4G7VL 2CLZB 3QFDB 1BZ9B 4BSWA 4FQ1H 5ALCH 5CEZD 4G80A 1H0DB 3A6CH 4LLVA 1ZWIA 1U58A 3O3EB 4ZD3L 4YFEA 1DUYB 3TN0A 3LRSB 4NWTH 5MEQA 1CDYA 3MLXL 4QOKE 5IVNA 4FQQA 5DSCA 4G80B 3MCLH 1LE5A 2DQEH 4UT9L 2XRAH 5CZVH 1CWVA 5D2LA 3TIEB 3IDXL 2V17H 4PRPE 3AXLA 2Z8SA 1NMCB 3CSPA 1CD8A 3GJEA 4JKKA 2KH2B 2EEAA 3O8XD 4EOWL 5E4EB 4BZ2H 3LH2L 5JW5B 3VH8A 3F7YB 3U9UB 2P24A 3TZVD 2I9LA 4HXAL 4XCNA 3SDYL 3NMEA 4PRID 4CVUA 3QIWA 4Z7QF 3VFPA 5D2LF 1JZ5A 2EKSA 1BEYH 1D5MB 1XIWB 1MCJA 1F2XK 3ILQD 3V6OA 3HMWH 3UO1H 1I8MB 4S0SD 5JDSB 2ZP0T 5LGKA 1H3XA 2F54E 5C09A 2N4IA 4G6ML 3QHFH 4Z78A 1F6LL 3RVTD 5IB2B 3IGAB 4S11A 3T0EB 4M7JL 2J8UE 4GRWB 4PTUA 4KGJA 2XYCA 3QJHB 3X12A 1KB5H 5E70A 3HMWL 4GQPH 4GRWF 3UO1L 1CVRA 4APQD 2RAMA 2NXZB 4YHMH 4RGOL 1G6RA 2P5ED 2BP3A 3QEQB 4HH8A 5FHBL 1LO3L 2D7PA 5LGJB 1I8LC 3ULVD 1MCEA 1EO7A 3LQAL 4AJ0A 2BK8A 1QPXA 2QL1A 1PLGH 4LSTH 4TULH 3LDBB 1DVFA 3FN3A 5EBWA 1JK8A 1HQ4B 2FWOA 3PJSA 4UQ3A 2MKLC 4S1SL 5HGBA 2VXSL 4TUKL 3L5WA 1MQ8A 1MF2H 2FBJL 4FP8H 1HILA 4HS3B 4PJEE 3HNTH 1NL0L 3UTSA 2FJHA 5L2KA 3NA4A 3UAJD 4AEIH 1E27A 3EHBC 1GPOL 2C4XA 3BZ4A 3FCTA 3PGCA 5JLZA 1RUPL 3UTPE 1T21A 1WT5C 1ZS8B 4L8BA 3QDGA 1YEIH 1AY1H 3ROLA 3SOBH 3QIUB 1D6EA 3BEWA 3ARFC 3W11D 4L8CA 2ADJB 5J6GA 1ZGLB 3UPRB 2YPLA 4UQ2B 1CBVH 4FA8A 5KTEH 1B2WL 5FM8A 3TWCH 4OGXL 3GMNA 4CMMA 4D9RD 4YNYA 1MHCB 1QA9A 4Y19D 5C9JB 1EO8L 2ZUSA 2A9NH 4N9OB 3QUYD 3QWOA 4ZFGH 5I1LA 1NBQA 5IG7A 1ZHLA 1S7XA 3SDXF 4F15C 4X6DB 2H26B 1YPZA 4ZYKA 3FO0H 5IB1B 3MJ8A 1WFTA 2G75B 5DGQA 1MVUB 5E8OB 3IVKA 4JDZA 4X5WA 5E8PA 4GMSH 1JWMA 2YRLA 1FFQA 4DFIA 1JK8B 4LIQL 2COQA 2CMRL 3VWJA 3IDIB 3U30C 3KPNB 4M6OH 2IMMA 4MB3A 3MLRH 3S36L 1NUFA 2V9QA 4PLKD 3FT2B 4HGKC 1BBDL 1KCKA 3GHBL 4FQJL 4QT5A 2BRRL 3MV01 2R69H 1VGKB 1OT1A 4PV8A 4C4KO 4AIZB 3VH8B 2F54B 2QQKL 2NY4B 2YEZB 3VE0A 1I9IH 3EUUA 1OT2A 4GBXD 5DUBA 1MFEH 4K71C 4ETQB 3BGMB 1JRHH 4NUGL 3QZWB 4F8TA 4MDJB 5GS1C 5KSVB 4PJ9C 3B2VH 4NZDA 3IFLL 5C0BE 3QEQE 3UC0H 5F6HJ 4QHNB 4NNPH 4YX2L 3QAZC 4DAGL 2FZ3A 1FYTA 3MNZA 1KC5L 4KROC 1BQHB 2OP4L 4JPVH 4P57B 4OZIE 5IW3A 2F74B 5KG9B 2R4SL 3D18B 2LU4A 5F9AC 2A6JA 3JTSA 4UUJB 4YAQB 4W4NA 1JGLL 3QP3A 3LRGA 1N6UA 3CU7A 3PWVB 2DQDL 3OG4B 1T03H 2WMPA 4IDJH 1RZ8B 3B9EA 4JDZB 3DHMA 4HFUL 4WUKH 3HNSH 2OZ4H 3EOTH 3RGVB 2C7UB 5IHZA 4WWKD 3BKCH 3A67H 4JR9H 4LSUH 4N5EC 4Q6IA 3C08L 4KQ4L 4NO0A 4DZBB 3VD9A 2WBJC 4K71B 5TPWL 5CAYB 2FX7H 4OAWA 2VO5A 1KGCE 1YEKL 5TGBB 4HUWB 5F7DA 4UDUA 3NFPB 5E6IC 3NFSH 3C9NB 3V5KB 2YBRA 2Y72A 5DHVB 3BDYL 4JFDA 1LO5B 1SM3L 3HMXH 4H20H 3OB8A 4XCEB 3G9VA 1FIGH 3VMOA 3WFCL 2XN9A 1DBML 1OY3B 2EKJA 1AGCB 5J1AA 3D18A 4KJYB 4MSWB 5IWLA 5JIPA 3REVA 1EXUB 3ARBD 4OFPA 4FQCH 1FORH 4GW4B 3VFSB 3C2AL 4P3CL 3UTTB 1I7ZA 1IGCH 1A1NB 1A3LH 1MWAL 1YEDA 5SWZB 3TV3H 1G1YA 3WMSA 2L7JA 1BP3B 2FEDD 4MCYA 1IGTB 4U2ZA 1FAIL 5FDWB 3RVVD 4PJBA 1JZ6A 3P4MB 2QSCH 4IDLA 1YN7A 1MREL 1GAFH 3W0WA 3U2SA 1N59B 1FFPB 2VSCA 3RTQD 1ZANL 4M1CD 2XXCB 4ZO8A 5ADPH 3IDJA 4CAGA 4P23D 1SEBB 4Z76B 4R4FL 3WFBL 4NGHH 4HJJL 1OW0C 2ZUVA 3DURB 5GIRA 1UWXK 3B9AA 3QEHA 5BZDA 1SVZA 4I48B 3O3UN 5MERB 5D7LA 1W72A 2HKHL 2I5YH 3GSNB 4JZJB 3FB8A 4WV1C 5T3XE 5FEBA 5D2NA 3DV6A 1IBGH 1KT2B 2GFBA 3WL9B 4JKWA 4YHLH 2AXJA 3UTOA 5FYKH 4I5BB 5BS0B 3VJ6B 1Q9OB 3H9HA 4OGYH 4OLZH 4EVNA 3NFNB 3G6AB 4X9HA 1GGYA 3QJFA 4HF5H 2WBJD 4D9LL 4LEXH 1FL5B 1LEIB 4A6YA 3LHPL 3DVNA 5LCVL 4HLZG 5AWNH 1ZEAL 32C2A 4HD9A 4NO2B 1LE9A 4UOW0 3RUGB 4P2QA 1IC5L 1YC7A 4P48A 1PFCA 2A77L 3ULVC 2RR3A 3F6LA 3B83A 5EZJA 4WUUB 4XBEL 3K4DA 5J12C 1F3DH 5FM4A 5LGHH 5IMKB 3PGFL 3P4MA 4E41B 2YPKA 1IC1A 1XIWC 1S7WB 1QRNB 1U3HA 3AU1A 2W1NA 4LHUG 4JQIL 1NCCH 4KAQL 4PLOB 2GJZB 4NKMB 1MJ7L 5EORL 2CLVA 1QBBA 3CK0L 1EHXA 3IDYC 1YY8A 4L9LC 4JN2B 4LEXL 1F4HA 4MJID 3UTZB 3IYLW 3VRLE 1NSNH 3Q2CA 2X09A 2PXYC 3ILQC 1V7MH 1RZ7H 3E8UL 2IH3B 3LD8B 4NZUH 4CN1A 3BW9B 2NY4D 2HLAA 1NFKA 5I73B 5AD0A 2A1WH 1IGFH 2P4AB 2CPCA 2D31B 3AS0A 4GKZB 2IWGA 2IQ9L 4JJ5B 1FNEA 1MY7A 3OZ9L 5ILTH 1M7IB 1WFNA 1IQWL 3MRGB 5D72L 3SBWA 4LSVL 1T5XB 1BVKB 4OCLC 1XIWA 4HJJH 2ZCKL 4NHCL 5E2UL 3U4EA 3MYJB 2VLJA 3VWKD 1UZ6F 2AJSH 3T04D 2ADGB 5C3LD 1Z9LA 3WNMA 3TBTB 2CRMA 3O2VH 4OGAD 5B39A 4YAQA 1DEEB 4JE4B 3LIZL 3U36A 2Z91B 3GSNH 1NBZB 1R3HA 1MCSA 4P9MH 2EDHA 2YZ8A 4BQBA 2XPGA 4L4TE 4RMTA 2YZ1A 4TTDC 1KLUA 1FNAA 4LCCC 1LDSA 1WISA 7CGTA 5I2IB 5MENE 4MX7B 3HUJB 4R97C 5E94B 4FQLH 5DRNA 5GXBB 5C86A 5JZ7C 1QR1A 3MA7B 4YDJA 4ZAKA 1DN2A 1KOAA 5EC2B 1B0GB 4JQVC 4AENB 4HWUA 3C5JB 4OLUH 5EOCJ 1M4KA 1S7RA 1QVOB 1YY9C 3DYOA 2PF6A 4XGZB 1VFBA 2WBKA 3WFCH 4K7PL 4AG4H 2BVUA 1GH7A 1Y6NR 2PNDA 2DIJA 1NFDF 4WNQA 3C2SA 2EYTB 1FGNL 4JB9L 3QULA 5DLML 5I71B 2XACC 1I85C 4MHHG 1A6WL 2Z93A 3ZYIA 1MRFH 5I8CB 4X0KB 3MCKA 1ZVSB 1N5YH 3TC9A 1QKZL 4ISVA 5EIVA 4K94L 1B4RA 3LAFA 3C6LB 4PGEA 4MLIA 4HLZH 3QIWC 4XHJD 1RZJH 2VDKL 3IU4H 4OF7A 3ULUL 2OZ4L 3I2CH 1Q1JH 1YEGL 4YIQA 3QFJE 2K7PA 1YNLH 3RI5F 4GAGL 5BO1L 4MCZA 3GUTB 5HGHA 5AAMA 1BOGA 4M5YL 1JGLH 4NKOB 3EYQC 3REWA 4YIQB 2YD2A 2FR4A 1VSCA 3RU8H 1GVIA 3Q3GA 1SYVA 2YMXH 2WLZA 5INDB 4IRSC 4WFHE 4F37K 2FH6A 3MLVL 2JTDA 3BRFA 1OCWH 1I3RB 1X5FA 2EE3A 1AQDA 5DD1L 1CDHA 4X80L 3SEPA 4JPVL 3LEYH 4OKVA 1L7TL 1QA9B 5D1ZD 5H37H 1QLRA 1AO7E 3PWJB 3OJ2C 1JTOA 2Q1EA 1VESA 4P4KC 5KVGL 1R24A 2NY6D 4MNGE 1KNOA 2ZSVA 3LKOA 5EO0A 3B2VL 4WTZG 2VDNL 4QHMB 1QVOA 1NKRA 4MQ7B 2NTSP 1WWBX 1JRHL 2Q20A 1U8OB 1C1EH 3CLEL 1CE6B 5FKPA 2MPAL 2FCBA 1SMAA 1R3JA 5MP6H 3QWRA 2Y25A 3NZ8B 3VH8G 4YPGB 1FL3A 2BRRH 2Y06H 1A6AB 2A6DA 4FQJH 3ARBC 2J6EA 3F8UB 1A0QL 1RZ8A 1N8ZB 3BWAA 3FHQA 3FRPG 3L5XL 3SE3A 4Y1AE 2CD0A 4X4XA 4MMXC 3G6JF 1N3NB 5EOTB 1I1YA 4Y16D 3VWKA 3OSKA 1J12A 2HG5B 3HCVA 2BVYA 1EEYA 1AGFA 5CBEB 3AXLB 3P40A 4V1DA 2R1XA 1SEBA 4Z76A 4KI5E 5IFHL 5TGBA 1I7RA 3RGHA 3QHTC 2AXFA 3BYYA 3GMRA 5MEOA 3SCMC 1C1EL 2XTLA 3L3HB 1JTTA 4ODXB 3ECBA 3MR9B 3ZHLA 1UT9A 5I2IA 1BHGA 3MUGB 2A9NL 2VDNH 3TFKD 1TTFA 2Y1VA 2CUIA 3MRFB 2D4FA 1PDKA 4P2YA 5HGAA 2BVQA 5IEKB 3WS6A 3OBAA 2C3VB 5T33L 1Z2KA 1FPTH 4CGTA 1RK1A 3RWEB 1KEGH 5DD1H 5BS0E 3IRZA 2H1PH 5T3ZE 2OL3A 2C3VA 2OK0H 4HIEA 4AEIL 5DXWA 3CH1A 1WTLA 4LVHB 4X6CE 4QHNA 3PDGA 1EHLH 5CSBA 3UTZA 3H9SE 3IKKA 5C0FA 3V5DB 4LCWA 1MF2L 4N0UE 1E4XL 5FCUH 1BZ7A 4S1SH 2HP4A 3ULUH 4KI1A 1RZJL 3NCFB 3QIBC 4XI5D 4DK3A 4K8RD 4G9DA 2FB4L 3UBXG 4CVXA 1TPXB 4KKLD 4LHUB 3I50H 3MLSL 1U8OA 1KPUB 1L6ZA 4LSRL 5GJSL 4PRAB 2AEQL 1CK0L 1JF6A 4RGMB 5DWUL 2FIKB 1BAFL 3JWDC 2BZDA 5DLMH 1KXVC 3RA7L 1HXYB 3LN5A 3S5LB 1T66D 2QSQA 3TJEH 5DT1H 4YEEA 3EYVA 3P77B 4E0RB 1IZKA 4EDXA 3MRBB 4N8VG 3CFEB 5CLWA 3KYAA 4JO1L 3F12B 3U6RB 5ISZD 3UBXI 1CFTB 3WYRA 4MA1B 4IEFB 1HEZA 4OBRA 5D6DC 2VDOH 2X7LB 3UJJH 2ERJC 4UU9B 5I1HL 4LPWA 5TF0A 3V6OC 4LCWE 1I8KA 1VFOA 1CS6A 1S78C 3GRWL 3CXDL 2DWEA 4YHZH 5FYLD 1LHZA 3TBSB 1DBAH 4P9ML 1CG9B 4Z7WF 4UNVA 1P4LA 3TH4T 1JWSB 4YHYC 5EFIB 5D1ZB 2EYRB 1N26A 4KXZI 3P4NB 2YK1L 4PJEB 3S35H 4FXKB 3TYFA 5CZVL 4LAJH 2CJUL 3HI1B 2XRAL 4UT9H 2XG5A 4PRIB 3V0AC 5DI8B 5IMOA 2D7TH 1Z3GH 4LSPL 5E2UH 3TT1H 3FCTB 1G6RB 4ZD3H 1I1RA 5J9PA 3HHRB 5KOVC 3TZVB 1IQWH 2AJXL 3ME0A 5DGRA 4ZS6D 1Z0NA 3VDAA 3QUZD 5IB3B 3VXQB 2FSEB 3OZ9H 4DVBB 5L8LB 1KTLB 4OM0H 5GQBA 4HWZB 1OAQL 5I1EL 4DJMA 2EXWD 1G0YR 2J12B 4P2OD 4RA0C 2FSEA 1X5IA 1SJEB 2A1WL 3BIKA 4KRPC 5GGUB 1T3FA 4Y5XA 4K07A 3GGWB 3J7HA 1EGJL 3FTGA 3ARDA 1TVBA 4XAWH 5I1JL 4NZUL 3QPXL 5DMJB 3I3DA 1CFTA 2W07A 4ODTH 1V7ML 5LJYH 4Y1AA 5FYKD 4RFOH 1MAKA 2IANE 3MACH 1MFDH 3LSOB 4H26B 4C57C 5HPMB 1VB9A 4HQQL 3SGEH 3QFJA 4ZTOL 4PRHB 1T1ZB 2Z8VC 3IAPA 1CGSL 2ADFH 4X9IA 4YHKH 2X1OA 3TN0D 1UXSB 3WO4B 3MV7D 4N9GA 1IE5A 1JPSL 4DGIH 3NPZB 3NFPA 1ZVHA 1IKNA 2XKUA 3PGCB 5JLZB 5MEQB 3PGFH 1CFNA 2W0KA 5DJ6A 2GJ6B 3SPVA 4KJWD 1IC5H 3EO9H 3QFJD 1NGWA 1T6VN 2ED8A 1EZVY 1HHJB 4O5LH 2CKBH 5LCVH 4PB9H 1CIDA 3JV0A 1GGCH 1GCFA 3PWNA 1X4XA 4XVJL 3QUML 4ZUVA 3JWOL 3VXUE 2QHRH 1S5IL 1Y0LA 1HE7A 2XZZA 1ITCA 4YFLF 1S7QB 4NQCE 4WRLA 3BQUA 3OJDB 2K9UA 2E27L 4M8VA 4YHLL 4UV7L 4G42A 5J57B 5BZWB 1C12B 2DTMH 5K9OB 3MRJB 1IARB 2G9HA 4ONHA 3HPJB 2CLZA 3L3KB 1CL7L 3CFCH 2V7HA 4FNLH 4CW1A 1KPVB 3WIFA 2F5AL 4JDVB 4Y4HA 3BZDA 3L3HA 5D7IE 2I60H 1Y18A 3MV11 5KOMC 4OV5B 2YEZA 4FQXB 4XZUA 4Z0XB 5BV7C 4OZGF 2MJWA 3GB7B 4YO0B 1WIUA 4JDTH 5AZEH 1INDL 4WJ5A 5I74B 4J4PA 4PRBA 4NO2A 1QYGL 4M7KH 4WO4A 1D5BB 5SX4H 1NDMA 4KVNH 4Y4KD 5D7IB 1IAOA 4QHUA 5E7FA 3RDTB 4QXWA 5GRYA 1CFQA 1Q0YL 1QHOA 1U8LA 4OLXL 5CFHA 2BOBB 5T5NF 3MRFA 4KI5D 1ZT1A 4EVNB 2CDEA 1K85A 3TT3L 1LK3L 3QDGD 4KK6D 3RWFA 3VXMB 4ETYA 1IEAB 4TUJB 3NIFF 1EVUA 4ZYKB 2VOTA 4HZAA 4JPIB 4HBCL 4ZUTB 4X6FB 1QFOA 1N2RA 4L1DA 1MFAL 2VLRD 2NY7L 3GKWL 4N9GB 5CINL 1J9CT 3TIDB 3PL6B 4PJHE 5D8JL 4BFIB 3U46B 5DQ9A 3QFJB 5TH2A 4KJWC 4H20L 4Z7UE 1QHPA 5DK3A 1QSEA 1ZHBB 5BVJB 1FVEB 5F21B 1DN0A 3OB0K 4QNPE 5I75C 4RISL 3JV5A 1FAKT 3TH2T 3QZWG 2EE2A 4ZFZA 3SE4C 1D6EB 4GRWH 5LQBH 4U1IB 5EG6C 3GI9L 4NT6A 5E6ZA 3TLRA 4KQ4H 5IIEA 5CEXA 3P0VH 4PJGA 4D0DB 5C2UB 3OGOE 2WUBH 4FG6C 4KTYA 1U41A 3VXRE 3C5ZC 4OF0A 4HFWB 3AMKA 5A2IH 2C3XA 2OQJB 2PN5A 1FZJA 4YXHL 1T03L 4XP4L 4HS3A 4QHMA 4OIIL 1Z0MA 4HUVB 5F8RC 3KHOA 1UA6H 1RK0B 4G3YL 1V3MA 2AV1A 4NBZB 3MRPB 2GQHA 2R4SH 5CLTA 4L9LA 4R8WL 3EO0B 3O8XB 4O51A 4G8GD 3QIUA 1VFAA 2JJVA 1U6AL 1OGAD 1KC5H 4MD4B 5IMMB 1AGBB 4RFEA 4YX2H 4M7ZC 2A73B 1F90L 1GIGH 1HHHA 4NQDB 1WQVT 4MWFB 2D9CA 3LKSB 2BJMH 2CXKA 5HD8D 4UDTA 5F6HI 4DEPC 5DJCA 5GS1A 4WHCA 1DBJL 1BJ1H 1UEMA 3EBAA 5FYLL 5EUKB 3FQNB 1P2CA 4HIXL 4NUGH 2IPUK 4P3DB 1S7TB 3E6HA 2BNUB 1MFEL 1LMKA 4JFEE 3MJ9A 2HT3D 2CK2A 3FN9A 4UU9A 4L8DB 1A9EB 4ENED 5MEPA 3QHZH 4EIZC 1ZKAA 1OQXA 5HYSA 5IB4B 3R0NA 4Y5VB 4XWGH 4AQ1B 3S36H 4U1IA 3MLRL 2P5EB 2AXGA 5DFWH 1T0NA 1P9MC 2HFEA 4NRZA 4KZEL 3IKCB 5D7JD 4TSBL 4CMHB 4Y2DC 3MNVA 4O00A 3ZKXC 2R0WL 3T3PF 4TRPL 5HHOD 1OSPH 3PHSA 5MENA 1OL0A 1I7TB 4TUOA 5DD3L 1VFBB 4LRIA 4ZMAT 3IXAA 2AABL 2ATKA 3H7BB 1U8JB 3T0VA 1WTGT 4LLWB 4F9LC 2ZUWA 1J05B 3BGFC 2H2SD 3MRDB 4PTTB 4Y88A 1GZQB 4FTVD 1XGPA 4EIGB 5C1MB 1KIQA 4KV5E 5DUPL 1MRCH 3CXHJ 3OXRA 5F9WC 1PKQA 5I1GH 1IEBB 1RZGA 1J05A 4NQVB 2C3GA 5JPMB 3IS0X 3MXVL 3QPQD 3RPIB 4YWGL 5KTEL 2MCG1 4KTDH 3DO7A 2YXMA 1OD7A 4KKLC 3RDTA 1D9KD 3C8KA 1CI5A 1BWMA 3KNBB 2ARJQ 4GG8B 3DECA 1KJ2A 2NR6C 2QQLL 3KYNA 5JXAH 4KHXL 1BM3H 3L7EA 4LFHG 3ZDYE 1M05A 1GPOH 5IV2B 3MYJA 1A22B 1OOAA 2XTJE 3DXAB 3EJZC 3MGTA 2APFA 3QCUH 4NO0D 1B0WA 3HG1E 4OZGA 2MCPH 2YHGA 5HVHC 2GJZA 4LF3B 1C16A 3MR9A 4YHPA 5F7MC 3Q1SL 1TENA 1E6OL 4Y4KC 2ZUYA 4BQCA 3LQAH 5EN2B 1PG7X 4L4VE 2XN9E 4HPOH 5LAXB 5I8OH 4NQTA 3W82A 4PRDB 4OUUA 2VH5L 4BELD 2HG5A 4DGVL 2KL6A 3OF6A 4UTBL 2GUOA 3SKNA 2KZWA 5DO2C 3BH9B 3HN3A 1QFWM 5IM7B 3T4AB 3WFHB 4RBPK 1UH3A 1N8ZA 3BWAB 1NGPL 1P53A 2EE6A 3QHFL 3STZB 4PGBA 3MJ7B 2OS7A 3T3ME 4X6BB 2B2XH 3H2WA 1NFDB 4E5XB 5F88A 1LP9A 3C6LD 1CGTA 3V0VB 1KIRB 2XA3A 3FOMB 4JO3H 5DC9B 1YJDL 3GSWB 2JB6B 2XWBA 3CZJA 2H32H 3MSPA 1HHKA 2R56H 3BZFA 2DM2A 3M1BB 2APWA 4GO6B 3KPRB 4MB5A 4PD4J 1UKTA 1KULA 1NLDH 3V6FA 3DVNB 2A6IA 4R0LB 3SDAD 2IAMA 3IDXH 5A16A 3M1BA 3CSYA 3ZDZE 5DYOB 3S5LA 1GC1L 2X4QA 1ES0B 2NX5A 5DQDH 3MLXH 3QEQA 3MOAH 4Q9QL 5IEHA 1ULVA 4FQ1L 5AYQA 4K55A 3PV7A 3DX6B 4OLWH 4NM4L 3FB8B 3O6LL 2HT4D 1MHHA 4PS4L 3G6DH 4OCSL 4IJ3B 3PJSB 4UQ3B 3QCTL 3T4AA 1ZLWH 4XVUC 3MRQB 4X99A 2EDRA 4OLVH 4ODSL 3A6BL 3BD3A 4M43L 2UVFA 3MBED 2I9TA 2VDPL 2IAMC 2D0FA 3KS0H 4Y16C 4LDLB 2X4OB 2D9QB 5FO7B 5HHNB 3PQYA 3EJYD 4Y16A 1XF3B 4JFDD 4XGZA 2OI9C 5C0AD 4PY7A 2P1YA 4LF3A 5EA0L 5E6YA 3N1GC 2HFFA 4RWYH 3GSXA 2CR6A 3RHWF 4I18C 1JBJA 1YNKL 4Z9KB 3BVNA 3BZEA 3NIGE 4TNVF 3H42H 4X7CC 3DUUB 1F5WA 3AGVA 3KYNB 2X4TB 1D9KB 3MRBA 4H8WL 2G60H 4Q0XH 5D6CB 5C0BB 5TQ0L 2CIIB 1T0MB 2DOCA 1JPGA 5F6IC 5FO9B 5CJQL 3D85A 3B5GA 4JKPL 3GMQA 1F11A 1FE8L 2DICA 4IRJB 5HGDA 2WNGA 1NGWB 1CZ8H 3RUGE 1FL3B 4ALAL 4NQSA 3AS3A 1T6WA 1ZGLP 3HC0A 4YR6B 1TETH 1QEWA 1TZGH 3P73B 3TBVA 4A2MA 4JM2A 3IB4A 2F8VA 3ZT5A 3Q6FA 5ISZA 3TNNA 2G5BA 4MGXA 1BBJB 2B5IC 3G6JB 2E7MA 3NH7L 4IHOB 5EZOL 4PRPA 3NACH 5EIIB 1RJYB 4PREB 5DMKA 4QHKI 1R24B 5FA3B 2HTLC 4HGWB 2B1AH 3L6FA 5L8JB 5IOPA 2CGRH 1FRGH 5JDJA 1U3ZA 2GTWA 4WI5A 5E2TL 5HPMA 1A6VL 5C70A 4LVEA 1NCTA 1P69B 1Z5LA 3MLTB 5HI5C 4I0PC 4OFKA 4QRPE 3CLFL 3KPMA 1JCKA 1BQLH 3MOBL 4RIRA 5EUOB 5F7WC 1WVZA 1FRGL 1TZIA 2YA2A 2CGRL 5JORA 3KAAA 2B1AL 4C58B 5CGMA 3P0GB 4O2EA 4PJCF 3CFJB 3QG7L 5TE4L 5T3ZH 4WEBL 1U3HB 2V5RA 3HZKB 1ZLSH 4JANB 4ERSH 3DROA 1HKFA 4Z0BH 5C0CE 3TNMB 3OKEA 5B8CC 1G7QB 4AEFA 4Z5RB 1M1SA 2BSSB 2NY5L 1W0WA 1EAPA 5JNYB 1F6FB 1DFBL 3GO1L 1S7XB 3H6JA 1IAII 3C5SA 3UX9B 4H1LH 5IBTH 4HZLA 4A2LA 4CRPA 3MROA 4HK3N 1LE9B 1MUJA 5HXMA 2FJFA 2UWEF 4HXBH 1QLEL 1U8KB 4F7PB 4OT1H 4N8VB 3MRRB 1A7PL 5T1MB 2NZ9C 1P4BL 2IBBA 2DF3A 2VN4A 4PUBH 5FOBA 1WF5A 1A7BA 4G8EA 5CCKH 1VACA 4EEEA 5EFIA 4XPTH 3GK8H 4NUJA 4WEUD 3MNWB 4AENA 3LEXA 4H8WH 1PQZA 2AKRB 4XMPH 5DZOA 4F7CA 4EQ2A 1I3UA 2W60A 2YPLE 4B41A 4U1NA 4I9WE 1G7LA 2NXYD 1YPZF 2IANB 3L7FA 2VZ3A 3KPOB 4YHNA 1A6UL 1KUMA 5D5MF 2EC8A 4JQXA 1FH5L 1MFNA 3TM6A 3WIIH 1HK6A 2Y5TB 5ANME 1NUDA 5EO1B 3X13B 2GITA 1J1PH 1DEEA 3E1F1 5ACLA 1M6OB 1KN4H 4C55A 5JMOC 1YYLH 4GSDH 3L1OH 4Z77B 1GOFA 2EH7L 1NC2A 2F19L 4KMQA 4Y0GA 4OM1L 3VCLB 1N0XH 4OUUB 1OTSD 3QISA 4BSJA 2R29L 4GH7B 5I9QB 4I0KA 2J1KA 3FKUS 4J3SA 5JW3L 4K3JL 3EGSA 4X5XB 3DX8A 4WTXA 4PRPB 5FDYA 1C16B 4N8CH 4YHOL 2VISB 4IMKC 1F58L 4Q9CA 5LVEA 1G7PA 1II4E 4G8FA 1JWUB 4ORZC 2D7MA 1I8MA 1SEQH 4QGYA 1L7IL 5JPNA 2DQGH 5C92A 5I30L 2KQMA 3PV6A 4X4ME 2VR4A 4OLEA 5KANI 5J6HA 1PX3A 4BZ1L 5I8EB 1MEXL 1GC1H 2EYTA 5F7EL 1DE4B 3X12B 2VIRA 1IC7H 5GPRA 1FYHB 2GKIA 1DDHB 1UADC 4QCIA 5J3HD 2NY0D 15C8H 4HT1L 4M6NH 1NLDL 1N64H 4OZ4B 5CEZH 3WNOA 4YK4C 2R56L 1J0HA 1LO2L 4Z95H 4AT6B 1N7MH 4J3TA 3BD4A 5F89A 2EZ0C 4P4RA 1DJSA 2DLGA 3H9SD 1U58B 5C07B 1LD9B 1BZ9A 1FFRA 2B0SH 3EYUL 1IGYB 1I85A 2R4RL 5D71L 1BLNA 4JFEA 1UM5L 1G9NC 2L7UA 4YZFE 5B4MD 3CXHK 4HMCA 5SWSA 3V52L 4BZYA 2H45A 4DGVH 4HHAA 3V0WL 3EFFB 2C1PA 4TSAL 2VH5H 5HBBA 5L0QC 3AM8C 5GS0D 4NN7C 3O4OC 1Q72L 5TFSL 1F97A 2X5PA 4YE4H 4U33A 1IAKB 4PJHA 1DUYA 3TN0B 3O9WA 3BP4A 3SGJA 4ZOCA 2YA0A 1F4XH 4XMLL 2BFVH 3QUYB 2JIXA 1ACZA 4HEME 5SWZD 1F8TH 3PHOA 1KCSH 1A9BB 1ZV5A 5B39G 4F7TA 2BY3A 5JIHA 4BM7A 4MVBC 4XMLH 5SX5K 2FX9H 4JO4L 3MJGX 3FZUD 4RMVA 5E9DD 2ZSWB 4RFNC 4FZEH 1KGCD 4ZSOA 1KCUL 4PV8B 3UJIH 4KUCF 3IKCA 3T0EE 4P46B 2DQTH 3N9GL 5TFSH 3DYPA 3V0WH 4OZFB 4ODHH 4RAHA 2XXMB 2Q7NA 1CDUA 3VA6A 3VXSD 1MLBB 5BV7L 3ULUF 1YNTA 1IC4H 5F9OH 3ZKSD 2CLVB 1IGTA 2XZCH 1TJIH 3HZKA 4QRRE 1ORSA 3OQ3B 3G04A 1A47A 4XC3L 4XP1H 4YWGH 1V8HA 4JHWL 1KBGH 4KZDL 4X5XA 5DJCB 4Z7UA 5DJAB 1GGBH 4YDLC 3UTTA 3IF1A 2NXYC 3CCHA 4NSKA 3KPMB 1G7HA 4KRLB 4WI3A 5DR5H 2VAJA 1LEKB 5CEXB 1N7ML 4BQ6A 1LO2H 1YZZA 3MBEA 4ZXBB 3NPSC 5C0EB 4J8RB 4PJ8D 4CVWA 3QXAB 2EDFA 2IGFL 5CEZL 3CIQA 1K4CA 2AABH 5FK9A 3B8YA 5J1AB 4P46A 4HT1H 2X70B 5J89A 4UNTA 2PTTA 4DVRH 2ZOKB 4U6XB 3DBXB 3F58L 1IC7L 5BQ7B 5KAQF 1UM6H 4TSBH 3THMH 43C9A 5DJ8A 3C9NA 4Z7WE 3BMWA 1AIFB 4PRAA 3D9AL 4YDVA 1KELH 4OAWB 2ENYA 5D7SL 4U1NB 1EAPB 3SO3B 5I30H 1CIUA 1JPTH 4YFDB 5DD5H 3WUZA 1QR1B 4EN3B 5HYJB 5IIEB 5KSBA 3CMGA 3CFEA 3J8F7 3GJFK 3GSNA 1R5IA 1FLRL 2Z8RA 4H0GA 5E08H 1TTUA 1HDMA 2HWZH 1YA5A 2QR0A 5BVJA 1U8LB 4P9HL 4Q7DA 5EBWB 1H5BA 1NGYB 5KN5B 1NMBH 4HS6B 5E5RB 5ABDE 5CUSL 3MGTB 3DUSA 1G84A 4JRXB 5F97E 4AM0B 4MNQD 4ZDHA 1XF4B 3MV9B 2EC9U 4KVCH 4W4OA 4CJ0A 1UVQB 2PYEB 4FXGA 5D7JA 5SX5H 3L1OL 1DEDA 2XTJC 4P5MB 4ZSOB 1TQBC 5C6TL 3SGKC 5T3XH 4S0TD 1KXQE 3VFWA 1IRAY 3AS1A 1AKJD 1KB5B 3S36X 2AJZA 4QRPB 1UA6L 3BEVB 3L95B 4XHQA 4XPAH 2AAVA 2DTSA 2NY3C 1FH5H 4M1DH 5ESVA 5I0DA 5GGSA 3BP4B 4XP4H 2A74B 2WUCH 3KPLB 5DMIH 3IFNL 1BFVL 1X5GA 4MJIB 2HVKB 3W0WD 3P30H 4HS8L 1NUNB 2R2BB 1RHHB 1QEWB 2CRYA 2HVJB 4PGJA 3GSUA 2A9MH 4GBXA 1TMCB 1MHEA 3ARSA 3T0XA 3D3VB 3LKQB 4EJ1C 3RRQA 5B21A 1FZMB 1QLFB 2HVJA 2KQNA 4RISH 3GK8L 1OP9A 2ITCA 3QO0B 4OCXH 4Y4HB 1BD2B 1PVHA 3WNKA 4PUBL 3RVVC 2KPNA 1T5WA 1KENL 4OT1L 5FECB 4HXBL 4TN9A 3KPRE 2VISA 4LCYB 4HK0A 2XNAB 4WW2B 2G5BB 3LEVL 1A7QH 4JKMA 4V1DE 4YZFF 1OAKL 5F89B 1GZQA 5CINH 5BRZD 4LBEA 3QIBA 5IBUG 3WDHA 1CE6A 5FKPB 3JWNC 3HE7C 3D48R 4UBDD 2B1HL 4ZAKC 1X5LA 1WC7A 2Q6WB 3VGAC 2OJEB 1HH6B 1JHLH 4WY7L 3S35X 1F11B 5F9WB 5I1AA 2WWMD 2ZPKH 3UMTA 3ORJA 1QSFD 2BVPA 3HFMH 1TQBB 1Q0YH 3V6ZA 5GJTL 1EJOH 4GRMB 4OB5H 4G6KH 5F9JA 3SDDB 3UPRA 4LDOB 4NQDD 5FA4B 1N4XL 1RUQH 4IBLT 1ONQB 4NJ9H 3SJVD 4OZHA 4TQEL 4FQIL 1CXLA 3AM8A 3QDGB 3ZTNL 4EXKA 1P7QB 4APQC 4C59B 3BSZL 3JWDL 3UJTH 1QBMH 2EEBA 2GCYA 1GHFH 3MFGB 4MVBD 4L29A 3VFNB 4JQVA 4G7YH 3FQNA 1MI5A 2VC2L 4S1RL 4Y5VC 1T22A 2PW1A 3CFCL 4I4WB 2R8SH 1HI6B 3LZFL 1T7WA 1KB5A 2KBGA 3NH7H 1AR2A 1XZ0B 3WKML 3I75A 5F7NC 1BF2A 4EUPA 1S9XB 2PYEE 4PJFF 1KG0B 4WO4D 3O0RH 4UV7H 1NJ9B 1WZLA 4FFZH 1ODAA 1FC2D 5D1QD 3GHEL 4H5SA 1YMHB 4RGNB 4XB7A 5TDPA 3IDJB 1AXTL 1KCRH 2JELL 2AV1B 1HH9B 1QSEB 5IMLB 1FFOB 1YEEL 5F96H 3E2HC 2OBGA 5D96C 2RCSL 4PJ5A 1A7OH 3OXSA 4G5ZL 1GGCL 3SE8H 5EU4B 4N1EA 2BC4B 2ZCHH 4MJ5A 3TBSA 4Y4FB 2P48B 2UWEE 5EC2A 1I1AB 2NXYB 3EO9L 4HWBA 3O9WB 4TOYL 2OR9H 1VFMA 4L4VD 5JR1H 1U8MB 2CKBA 1OGTA 3OX8A 2BY1A 5KSBE 5EUOE 5F88B 4R2GC 5D5ME 4OCRH 1G7MB 1BQUA 5E6ID 5FB8B 2LFGA 3D25B 3ZKQD 4PP2B 2BOCB 1X9QA 3MQIA 3KS0J 1ZHKA 3HPLB 3BQUD 2P44B 3GSRB 2V5YA 4WNQB 1YN6A 3RKDC 3W9EB 5GRXG 3U0TB 1TTGA 4XVUD 1U8HA 5BJTB 3TEUA 3QUKB 4P5TB 1J1XL 2LU3A 3WCYA 5DO2D 3CUPA 3R4DA 5FYJE 1SMOA 2FECI 3EZJB 3IJSB 4EDWH 4I4WA 5HHMB 3H9SA 4QHLA 3KPSB 3HZVB 2VWEE 3T0AA 1DQMH 3UTPD 4X6CA 5K9JH 5HSFA 2JB6A 4M48H 2AEWA 4NSKB 2WM0A 3EYSL 4RGNE 1T83C 1XF5B 2NZ9D 3IDMA 4OLVL 2VSDA 5GS0C 4M03A 1PAMA 5B8CA 4NQSB 1ZT1B 3HLAA 3QCTH 3H0TB 4FMKA 4FMFA 1XFPA 3ARZA 4PS4H 4NKDB 5B4MC 3STZA 3V4VL 4E0RA 2HMIC 2HN7B 3UTQA 3R06A 2A0LD 2FYYB 2J7LA 4OM0L 3X3GL 1AI1L 4OD2A 4DOHB 2HKFL 3OPZL 2A2QT 3V5HB 3KPRD 4PJXB 2B8OT 1RVFH 4IRZH 1ZLUH 2P5WE 4LSDA 2HJLA 1Y0LB 1Z3GL 5IK3A 4GKNB 5GGVY 1K5NA 1T5XA 1WAAE 2YUWA 3H9YA 3FJTA 2ZCHL 5F1NA 3FQXA 1J8HA 4ZUSB 5FFLA 1CFBA 25C8L 3GBNL 1YEJH 3N1FC 3HE7D 1OB1A 12E8H 3M8OL 1EFQA 3MGAA 1KXTB 3QCVL 3H9ZA 1RZKC 5IW1A 1U91A 4PB0L 2JCCA 1WUNT 3T2QA 4S1DD 3LKRB 4GKSA 3VE0B 1X5ZA 1JVKA 1K8DB 3JWOC 3WUWB 3VXME 5I1HH 4Z77A 5E4IA 4L8SC 4N8PA 5TQ2L 1AGFB 1UJ3C 2DQIH 3NCYS 5CBEA 4K94C 1HNGA 5A2FA 4NN5B 1ACYL 1IVLA 2HVKA 2R8SL 1RPQA 5DT1L 4F9PA 2WBJA 2BNRE 3CJJA 3BT2L 5JQ6L 4U3CA 1MLCB 2K7QA 2R9HC 4OF6A 4UTBH 5DWUH 4UV4L 5CS7A 3DPBA 4LVOC 4MMZC 1JFQL 3FTGB 1QBML 3MJ8B 4JFHE 2CKBB 5EO9B 1N6QH 2AV7B 4ENEC 3WNLA 3S3PA 3DLQR 2GI7A 4NJ9L 2X1QA 1DQQB 4LOUD 3HZVA 3Q1SH 4R7DA 2BMKA 3H7BA 5DJ0B 2NR6D 5BVPH 5C8JB 1P84K 1WIPA 2BCKA 5FCUL 1XGUB 3KDMA 1FFOA 3W9DB 4UIMB 2IFGA 1ZHKB 1PX4A 2H2PC 4QRRB 2VITA 1INEL 5H94A 4KHXH 3T1WA 3QSKB 4HX1A 2RHEA 4U1GC 4D9QE 4F57L 4F33A 2FGZA 1CLZL 3K46A 3T4YA 3U79A 3WN5A 1JWSA 2NTFA 5DS8A 1R3LA 2D7OA 3EOAB 3BRDA 3C6SB 1D5XB 3PP3H 1UWEL 4UOJA 4JREC 4M4PA 4LLYA 1BFOB 3QT2A 3RY6A 4PJBE 4H0HB 4BJLA 1FVCA 4ISVB 5DTFA 2FNBA 1ZVSA 1MJJA 3P30L 3HNVH 1AGCA 3T1FA 4ZS7H 5HHVH 3VFUA 4P2CG 1BFVH 1FP5A 1I1FB 4HUXB 4ZPVA 3S96A 4IOIB 5CWSB 2OYPA 2R0WH 4M1DL 1RUMH 5KVMC 1T22B 2FLBT 2LVEA 2PW1B 5GZNC 3CVHL 3GUTA 1S7RB 3C60A 4MZ2A 5ICYB 2FO1A 3WFDH 1FZJB 2VWEC 5TE7L 3SE3C 1D6VL 3ARED 3ULSB 2FGWH 3I85A 3M17A 1A7NL 3MJ9H 4F58L 3LB6D 3EZ8A 1GOHA 3L3IB 1T1YB 3FRPA 3TGXA 3OJDA 2VLLB 4X6BA 5FUZH 3O41A 2FX8L 5L6YL 2YPVL 1WZ1H 1T4KA 2J4WH 1QFWH 3ZL4H 4OCWH 1XCTB 2O93L 1LK2A 5CUSH 4H88H 2DKUA 3ULVL 2NY1B 3HA0A 5DRZA 1HSBA 5JQHC 2HWZL 3U36B 3T65B 1NCDH 4JRWA 4L8SB 4JY5H 3HZMA 5GGRB 1O7SA 2EDOA 1J0KA 1L7TH 3LEYL 2HJKB 3SE9L 1UCTA 2JCCB 4EUPG 4MJ6B 3CDFA 4OSUH 1FHGA 4HC1H 1H3GA 4LKXB 4XXCA 3TA3A 3MV7E 3GMOA 3X14A 1CXIA 1DVFC 1A6PA 1XGQB 1ZAGA 5C0CA 3Q48A 3TBYB 3KPSD 4I3RH 5EBLB 1P5VA 4W81A 5FM5M 3ECBB 1YEGH 5E99L 4GW1A 3IU4L 1VADB 3O2DA 4PJAF 5KG9A 4W6WB 4PRBB 2YD3A 4MD0B 1S9WB 2JK5B 2X1WL 4F2MB 4P99A 3QUZB 2R1XB 1MELA 1PEZA 1UACL 4Z8FH 1U3JA 3SDCC 1GGBL 4MA7L 4FFVD 3OR7A 2BNRA 2OSLA 3DX7A 5E7BA 4EI5A 3ARYA 3BKYL 3FN0H 2CKNA 1TJIL 5EH1A 4WI7A 5E0QA 3N85L 4NKDA 3T2NL 3WJJA 1RZGB 5F9OL 1IC4L 4DKFL 5BV7H 1Q9LA 3TA3B 4FQ2H 4OLUL 4CVZA 3D39E 5EOQL 5CBAA 3RL2B 1S7WA 3RX5A 1C12A 4RAVB 4HBCH 2CR3A 2EYSB 2JCCE 5H2BA 1C5DB 1F3RB 1KJMA 4ELME 4PBXA 2NY0C 2R0KL 1VDGA 5DJ8B 1KCUH 5CP3A 1JRHI 1KCVL 3QUKA 4P5TA 1YPZE 1J8KA 4JN2A 4XB8A 3RWIB 5I0ZA 1HDMB 1UC6A 4KVNL 3EDFA 1YUHB 4G43A 1H3VA 2BFVL 1RIHL 3O2VL 1F4XL 4F37F 1E4JA 1MCPH 2QJDA 3B3IB 3L9RB 5H35A 1D9KA 2NCMA 1KEMH 1H15B 3SKMA 4YE4L 1DLHB 1CXKA 2BVOA 3BKML 1FBIH 5E8NA 4NHCH 3W39B 2F5AH 1FGVH 1H15A 3KPTA 2JB5H 4PJBF 5DK2A 1FQ9C 1TQCC 2W9LA 3MLZH 2HRPL 5ILTL 2XZQH 4WU5A 2Z4QB 4WHTB 5L0QB 1MVFA 2GITB 4YXKL 3UPCA 4LLUB 1XEDA 1FNLA 4OTXL 3RY4A 4ODWA 5A2JH 2AGJL 5IMLA 4ZTPL 4MD4A 1UB5A 4ODVL 2FO4B 3DURA 3PQYE 4OD1H 3NN8B 5FB8A 5DFVC 5D7KE 2X4SA 5DI8A 3GSOB 4LPCA 1L0QA 3CPLA 1A1MA 1S5IH 5EZLB 4PJIF 4R0LC 3VG0H 1FFPA 1S3KL 4XH2A 4RAVA 1T3FB 2BERA 2WSKA 3V2AR 4A6YL 1PZUB 4OZIA 2WP3O 2VDMH 4RAUA 1CG9A 1MJ7H 3TBWA 4JG0H 5C07D 3QDJE 2FJGB 4EI5B 3F7RA 3EOYG 1A1NA 5F7EH 3OR7B 3WE6B 2OXHA 3RY6C 4FABL 1HH9A 2VAAA 5EUOA 4OZFA 5A3IC 4EN3D 5HYJD 2OJZL 5H94B 1IFHH 4JN1L 2V7NB 2F58H 3QUZA 5LGHL 4FRWA 5TE6L 5HI3C 1RK1B 4WU7B 2DQGL 4W6XB 1ZA3B 3OGCB 2P8LB 5IGXL 3QULB 2XG4A 1N59A 3L3DB 3OKKB 4YHKL 3WXWH 3KDMB 3QI9D 4RMRA 1G7QA 2FIRT 4PJ5E 4F7TB 3BYTA 1A8JH 4HQQH 5E2JA 4AH2A 3TIDA 3QRFM 3BP7B 4HF5L 4WFHD 4BKLA 1K8DA 4K3JH 4LHQB 5JW3H 4X6FA 3OG6B 2FECL 4JVWA 5CGTA 4J3WA 3KXFD 3E6FA 2WINB 4NO0B 4DZBA 4TNWF 2Z31A 1C08A 3OR6A 1P7QA 3ESUF 5TDOA 3BPNC 5D2LE 1XCQB 3S97C 4WUUE 5GGSY 5HHOE 1J1PL 3BKJH 4DZ8B 4PG9B 1OAQH 5I1EH 2I5YL 3KNBA 3RWDB 1I7TA 4TUOB 1UXWA 1UM4H 4L3CB 1RY7B 2VUOA 1JGUL 2AJXH 4ZUVB 5JHDE 2HLAB 2VDQH 3TIEA 2EDEA 3WLBA 3SDCD 1Z9OA 1FZKB 1Q9WB 3TT1L 2G2RA 2PETA 2Q7YB 1BIHA 4NGHL 1V3LA 4CUCA 5EN2A 3ULVE 5JOEA 4MA3B 3GMLA 3O6KH 4B53A 1SVCP 5E24E 4G6JL 2E7HA 4DOHE 4NRYA 1G7PB 1DQLL 4OD3L 4KQ3H 1L4IA 4BSWB 2BNUA 3IDGA 3TJHD 1DSFH 3QDMD 1I3GH 1PEWA 4WHDA 1SJHA 2ESVB 1SBSL 1DBAL 1P4BH 2RQ8A 4LMQE 1P4IL 1T2QL 3TFKC 1WFOA 1LO4H 4XXCC 1X5YA 3AUVA 5KSBF 2W9EH 1M05B 4WFED 3WS3A 2HJFB 2PYEA 4FXGB 3BQUC 2P5EA 3RKDD 3MV9D 3UJJL 5E2VH 1QFUL 3VFRB 1FORL 2I9TB 4GBXB 3MREB 1OLZA 4NBXB 4NCC1 4BQ8A 3IJYA 1JN6B 1EEYB 5ITBL 4ERSL 1IJ9A 2ESVE 3SDAB 4ZUUB 4K23H 1DBMH 4DUXA 3SDDD 1MCRA 1S7TA 3E6HB 3ALXA 4JFQA 4TVSa 5TE4H 3QG7H 3BP6B 3UTTD 1UB6A 3G6AA 4ZNCD 3SBWC 2GJJA 1BAFH 2VRAA 4NQUA 4J3XA 4XP5H 4LLQA 3HAEG 3L3JB 2DM3A 2PXYB 4R9HA 5GSVB 2AEQH 4LSRH 1RFDL 1RZFH 3I50L 3MLSH 2O5ZL 3C8DA 5HHXH 5TPWH 5B3JE 2R23A 2H8PB 3PWPA 4HWBH 5IVXE 3C08H 1UVQA 3NCBB 1QFUH 2XKNB 4X9FA 5SV4A 3A67L 4JR9L 5DEGB 4S2SA 2ATKB 3G5VB 2X4SB 5ECJE 2P7TA 4HFUH 4ELKA 1E4XH 2B20A 1FCCA 5D7LB 2ZOKA 4H26A 2FDBP 3U0PA 3MRRA 4W4OC 2OZ4A 3NACL 3I84A 1I3GL 2E3VA 2NNAB 2WK2A 2ZUQC 4I2XA 2AXGB 4HKBB 4LEOA 3FFDA 1NCWL 5A3ID 3ROOA 3O41B 1E4WH 2KUTA 2EC9T 2J8UF 2NMSA 4G6JH 3WE6A 3VRJB 5AZ2H 1EERB 4PLJC 4ZFOA 5INDA 1CZ8L 2X4PB 2J88H 4OZFH 5DJYA 2H3NB 3RJQB 1N5AB 4I77H 1MCLA 4IMKA 3HAEH 3TYGH 3QG6B 2DYPA 3CSYB 4ZUUA 3LKSA 2Z31D 2Z91A 4JO2L 4NOFA 1CGUA 5TQ0H 3MX0A 2WANA 5DQ9B 5EBMB 3CX5K 5ITFA 4KRPD 4Q0XL 1OTTC 3DXAD 4PP1C 4XTRD 4LP4A 2GUOB 3LN5B 5C0EA 1HHKB 2WWMC 4H25B 4O2CB 5KSAB 4JFFD 3BH8A 4FQXA 1OF2A 3NCJL 3V6OE 3EDJA 5IFHH 5JNYA 1CD0A 4DUWA 4NO3A 1SYVB 2YD6A 4JKLA 4WU5B 4UBDC 3LB6C 3DETC 1P4LB 4M6ML 4UINL 1P1ZB 1RJYA 2CMRH 4PREA 5DMKB 1I75A 1Q9LB 3L5XH 2A38A 4PJCB 3RVUD 4OJFH 2JIXB 4KC3B 4M9PA 5E8DL 1F4AA 5DEFB 4LOUC 3DGCR 4G9FE 4N0UB 1XH3B 2Y06L 5DQJB 1BJ1J 3X3FL 5L88H 5IJKA 2X89A 1TNMA 3QUXD 4NN7B 1FVDB 3RBGA 2MPAH 2VDPH 3FQWA 1IFHL 4JN1H 4WIQA 5FUOH 3BW9A 4OIAA 3RGVD 4PJGE 4ZODA 1A1OA 1G6RH 1GYAA 3PP3K 3VA2C 1QUNA 1A4KA 3I9GH 1Y6KR 2YUZA 4KY1H 2I07B 5FYKU 3QB7C 2VLKE 4P2RB 4G8GA 4R96A 3ALWA 4G6FB 4U3HA 5BRZB 4X98A 3SQBA 3QXDB 1RJZA 1XGQA 1AY1L 4JM2B 2VLKB 5GGVH 3V95A 1BIIB 3MUGA 4X80H 3CU1A 3ES6A 3NZHH 4HBQA 2VXVL 4C83B 1OCWL 4Q9QH 1RUPH 4UILH 3LRSA 1YYML 3PDOA 4E41A 3UYRL 4H1LG 5F1SA 5D96B 1NCNA 1U8JA 5GRUL 4NN6C 4KHTL 5IFJB 4AH2B 4ZG1A 1J8HD 1S7UB 1XT5A 4U1SA 3ETBF 4NHUA 2FATH 1YNLL 3VXPA 1GJIA 4UZGA 4TUKH 1DANU 2YUVA 5FYJD 2IJ0C 4JFEB 2HH0H 5IT2H 1JF5A 3I3BA 2DKMA 3D3VA 1NEUA 2EICA 1TFHA 4CBPA 4YGAB 5TDOB 5HVWA 3H9HB 3OJMB 3VGHA 1EEQA 2GJ6A 2PKDA 4U1KA 3BAEL 2QV2A 4Z18A 1MCIA 1KIQB 1I9JH 3KHQA 3QQ3A 3MRDA 4PJ5D 3ARGC 2VDLH 2VLKA 3GZKA 3QDMA 3SJVE 2BC4A 1ADQL 3VXUD 2AJUH 3EDKA 4OFVA 5EUKA 3FO2A 4P2OB 5D1QA 1ZT4B 4MD5B 3HKFA 5FO8B 1A64A 5T1LA 5AD0B 3QEHB 5BZDB 3IAGC 3BQUB 1A6TB 1P6AB 1B0RA 3BH8B 4JRXA 2O26U 3SDYH 4GAJL 3O2DH 4TYUA 3D39B 3U2SB 3LKNA 1JNNL 2PYED 5ICZB 3TCXA 4BZ2L 5ACZA 4FQ2L 2HLFD 5B8CB 3BXNA 5A2LH 4DKFH 2DLHA 3T2NH 2J8UB 3VRIA 5CP7A 4U0QB 4Y4KB 4KRMB 3UZVB 3VXTA 3MV8E 2AJSL 4HUUB 3O6ML 5IB3A 4K3EL 3SPVB 4Y5YB 4R2GD 3FO9A 4NFDA 3MCLL 1AGDB 5AG8A 1XF5A 3IDMB 4HIJA 3D69A 4U1HB 1QQDB 3SKOA 4Z8FL 2ZCKH 4NWTL 1UACH 1W8NA 1FCGA 1RD6A 1I7UB 1IKFL 2MWCA 4OFYD 3CMOH 4F7MB 4LVNB 5KSAA 2HA1A 2IADA 3OMZA 2FO4A 3KYMA 4G7VH 1INQB 3MLUH 3IU3B 3FAXA 3W9DA 3FMGL 3M07A 3MV8A 1U8QB 3OKLB 4LGPB 3K74B 3PL6D 1IGFL 3FZUC 4XNUH 3S37L 4PP2A 5CJ8A 1FZOB 5CHNB 4DCQA 5LGJA 5JOFB 1HH6A 4HC1L 4JFHD 2AI0H 5DUPH 2OR8A 2IANA 3L7FB 4P23B 3V0VA 4LAQL 3BPCB 1T7YA 1LP9B 1C5CL 5IHZB 3ZDXE 2MKWA 1YJDC 4Z78B 5EORH 3VU2A 2ICWB 4ZOEA 5ANMA 1KLUB 3V8OA 4JQIH 4NN5C 5ICZA 5IM7A 3QQ3B 3ULVH 2Z8WC 1X4YA 1WWWX 4GS7C 5DMGD 3MZGB 3E3QC 4DKDC 3RWGA 3RIFF 3BO8B 5CILL 1IGJA 4C56E 4X6DE 2VITB 3ZYJA 3ZT6A 5DZNA 3AB0C 4MJIE 4X7TA 4FQXD 3QHZL 5DEGA 3MO1B 4N0CD 1PG7L 3QUMA 4CVXB 2BSSA 3I75B 1I4FA 3WFDL 1FO0A 5IQ7L 4M5ZH 2NPLX 4C4KT 2F53E 3V4PH 4DFHA 5DSCB 3T2PA 1NLBL 4BQ9A 5L7XH 4OGYL 5EO9A 2GCYB 2C26A 5DDHA 1NEZA 4NNYA 5IBLC 5CEYA 1IM9B 4PTTA 3S4SA 5MEOB 2C1PB 1BGXH 3MGOA 4KI5C 5ID1B 3STBA 4AIZA 4NQEA 1JZ7A 5FA4A 5JW5A 1UG9A 1Q9WA 2M2DA 4P4KD 2VJXA 4G3YH 3ZYOA 1QFPA 2A6KB 4O9HH 1N3NA 2RBLA 5EOTA 4FZ8L 1H5BB 4QYOB 4G6FD 3TBYA 1V05A 4LGSB 4YXHH 5DA0B 1LE5B 1X6NA 3QO1A 4F7EB 3H0TA 1NAKH 4RBPH 3OXRB 4HV8A 4D94A 7FABL 1C7SA 3H3KA 5HYFA 5KS9F 3Q5TA 2XWJA 5JHDA 3CX5J 3QQNA 2VZVA 3GI9H 2QSCL 1ZLVH 4Z7OE 4P3DA 1FAIH 4PJCA 3IAQA 3SGDI 1K3IA 1FZKA 5CJOL 3H9SB 3AAZA 5E1HB 4NZTL 3PABA 4JPKH 2C5DC 3CVIL 4NJAL 2CLRA 3KJ4C 4P2QD 4Y16B 1B90A 3JVGA 1T0NB 5GRVL 4L3EA 3MTRA 4FTVE 5IROA 2NY7H 3ROLB 2A6DB 3K8LA 3O3AB 1T1YA 1D5IH 3T3PE 4PRPD 1LNUB 1JWUA 5BS0A 3TA3C 4KJQC 4NQCB 4UV4H 5B38G 1EUTA 5L2KB 4X7EC 3CVIH 1D5XA 3VXUB 2ICWA 5ANMB 1R5VB 4QRPA 5FGSA 4QXTB 1ACYH 4CN6A 1RHFA 4RAUB 1JI1A 2DQIL 2W59A 5J56B 1ED3A 3FONA 5AZEL 1QRKA 4ODUA 5ERWA 2X4RA 4HKZA 3MMEA 4ZFZB 3CGTA 4ZXBD 4I2XB 4KRNA 1IGJB 3LKPA 1YQ2A 1FVEA 4IDJL 1UFUA 5GS3A 3M8OH 3QDHA 3QJHA 4MAUH 4ZOBA 1KPRB 1E28A 5FV2A 2BSTA 1IQDB 4U1LA 3GBNH 1JHTB 3SY0A 4XAKE 1DL7H 2P43B 1JTPA 1IAIM 1UJ3B 4QRQA 4CNIA 3U9PH 4FQHB 4IRSB 1BQHG 1UKSA 4RMSA 2ZOLA 4YK4B 1BGXL 2YSSA 3MRIB 5J9PB 3Q6GL 5TDNB 2XTJD 4NT6B 2PXYA 3GSOA 4PFEA 3SKMB 2FEEL 2E8ZA 1TNNA 5EU6E 1A4JA 1NLBH 5IW6A 4FQPA 3JWOH 4RZCA 5IQ7H 5IESH 5BXFA 1AI1H 4PGBB 3X3GH 1YUHA 3QUMH 1WICA 5JUEH 5FYJU 3V4VH 5KVDL 4GG6E 1U93B 4MNGA 5CZXD 5FV1L 3PWJA 4O5LL 3WFZA 2BVPB 1XR9B 4Y19A 3DRTA 4PJXF 1I9IL 5JO5A 5D5MB 3AS2A 1PG7H 4R7DB 5L9DH 4NCDA 1CFSB 3VGAB 5IKCB 2XWBB 1Q0XL 3EYSH 5H2BB 2V6HA 2NX5E 1EMTH 3FT3A 3VWJC 2FJHB 1ZWIB 4LLQB 1HIML 5C7XH 4U7MA 3CZFA 2WIIA 2H32B 4YHPB 3X11B 5SWZA 5C0RH 4Y4KA 5SWQB 4K3DL 1CF8L 4XCYA 1J1XH 4MQTB 1KFAH 1Q94B 1A7RL 2DN7A 3UYPA 1NBZA 3GIZL 4PJAB 1KIPA 4U05A 4E42B 3HS0A 1R5WB 4QYOA 1JN6A 4U49A 4URTB 3ZKNC 4RFOL 1NC4D 3FB7B 4RDQF 4LAQH 4UT7H 2UY7A 3GBML 5K9KA 3GMPA 4ZFGL 3MRCB 3FB7A 2OR9L 3MBXL 3WSQL 5DRWA 1U8IA 3KJ4B 5D1QB 5D93B 2CDGA 5I1AB 2BVQB 2UYLB 4I0PD 1P6FA 3FB5A 3HR5A 3CVHB 1FNEB 3DI3B 1DLFH 1UKQA 3FFCB 3CZFB 1PJ9A 4M62L 2JELH 3O4LA 1IKFH 1T7VA 4R2GB 1WBYB 1F3DJ 4XRCA 4L4VA 2D7TL 5J7CC 4WUUA 2I24N 1FL6B 1JHKH 4K3EH 4PIRF 3MO1A 2ZG2A 1I1AC 1NL0H 2CJUH 3O6MH 3PWVA 3F7PC 3BHBB 1CQKA 3KYKL 1T1XB 4PRHA 3RWGB 4QOKB 3GKZA 1YN6B 3W9EA 4NWUL 1BLNB 4PG9A 3JV6B 2J8HA 5INCA 1OPGH 2VZSA 4G6AC 5BXFB 4YHZL 1H3UA 3O2DL 4IM8A 1CXHA 3CXDH 4LSTL 2WBWB 4TULL 3ZE0E 1G7IA 4RGNC 2APBA 1S5HB 3U4EB 3GM0A 1AQKH 2WINA 1RV6X 3O6FD 2W60B 4LLVB 5DQJA 3MRNB 4FQIH 3WNPA 5GGSB 3EDEA 5FOJA 5DEFA 1CT8B 5DC0A 2KDGA 1MAJA 5ESQA 1DQJA 2QKIA 5BRZE 1EJOL 4KFZC 4Y8DC 2D31A 3TJEL 3HFML 3TPKA 5IJVB 1P1ZA 3HC3H 3NCEB 1U8IB 1E28B 1JYNA 3QXWA 1I1FA 1UQSA 2YPLB 1A4KB 1U2CA 2UUDH 1KN2H 1KIUA 1BEYL 2C9AA 5GJSH 3BAEH 3LPGA 3NFNA 1NCBH 3FRUA 2IADB 1VEMA 1EBAA 4FXKA 3TYFB 2ARWA 1I3RA 2IAND 3MZTA 2L0DA 3W5MA 5FGRA 1XH3A 2HH0L 2AJVL 4HIJB 4MJ5B 4PJFE 2FD6L 2R1YA 5E00B 4GG6B 2LAGB 2DQEL 3B8SA 3RAJL 2OK0L 4Q97A 1LNUA 2UZYB 3MV9E 4PV9B 4M1GL 3C5ZA 2VXQL 4QRPD 5D1QC 3AMLA 3A6CL 2X4QB 3AREA 1ZLVK 1JZ3A 2NY6C 2DMKA 2A9ML 3VG9C 3HI1A 2DI7A 5A16B 2BNQA 2CRZA 4HS8H 1G9NH 4W70A 2LE9A 1JZ4A 2LAAA 4P2QE 3U0PB 5FK9B 1RK0A 2H9GB 3RY5A 4LSQH 1QBLL 2AK1L 1XMWA 3IGAA 3I9GL 1A9BA 3QUYC 1G6RL 1KJMB 3EOAA 3IS1X 4WFFE 1QR4A 1H3PH 2DJSA 2IH1A 3U1SL 5ADOL 2H8PA 3PWPB 3MXWL 4CL7A 3EYQD 2GYSA 4F3FB 3RL2A 4KVCL 1IAKA 4CU6A 2O5YL 1ONQA 4I8DA 1IM3B 3K8KA 4UB0H 4DN4H 4U7KA 2PO6B 3HRPA 2F5BH 3G5XA 2GTZA 3GNML 3O4LD 3MLYH 1T7XA 1X5XA 5IHUL 5ICXA 4P9HH 3D39A 4FFYH 1XGRB 3EFDH 4JFDB 1GGUA 2A6JB 2F8OA 5IVXF 5C0CD 4UTAH 3SE4A 3QQ4B 1YDPB 4WDIB 1CGWA 1XR8A 2XTJB 3MA9L 2X4RB 4HW6A 3G5ZA 5DD5L 4ELMF 5MP6L 2IBZY 2BNQE 3LKRA 4GKSB 2W0LA 3G08B 4XXDA 2R2BA 4L4VB 3BVNB 1KELL 5D7SH 1E6JH 2ZJSH 5JOPD 4WWKC 5JHDD 4P5KA 3P9WB 4JGMA 3K1DA 3CFBB 1R5VA 3PWUA 1M7IA 5KVGH 3DVGB 2AJZB 2E8YA 1K4DA 4I77L 1EZVX 2WBJB 4ONGH 3I3EA 2G9HB 4EBQL 2J88L 5CKGA 5IP4A 2YD4A 5B39B 2Z35B 4R90H 1IZJA 4JFFE 4JFYA 5FYJL 3JV4A 1NMAL 5IVZA 4HLJA 4L5FH 4MSWA 1GZPA 2YMXL 2ORBH 3BN9C 3W81A 5EC1A 3KJ6L 1JMZA 3NABL 5I1IH 4XCFL 1BVKA 3DO7B 3DX9B 3SKJH 4HKXA 1LEGB 1S7UA 4XC3H 5DJZB 1NCAL 2EDKA 3DSNA 5CSGA 4R26H 4JHAH 3KR3H 1Q94A 4NN6B 4YXLL 1NC4B 4XNYH 3I2CL 2ICEB 4HWNA 4J1UB 5E9DB 2VDKH 3MCG1 4Z7VE 5F9DC 5HVGB 3EAKA 4GBXC 2NX5D 5I9QC 3UAJC 2D7QA 1J1OH 4K94H 2O5ZH 3HE6A 1H9VA 4OLYH 1RZFL 1RFDH 3MV9A 3V8CA 1MRFL 5D7LD 3TCLA 4PJ9B 3UJIL 3BP7A 4P2QB 3RP1A 1F6AA 4P2RA 5GHWL 1KJ3H 4GXVL 2YWZA 4R0LA 4BH8B 2XICA 3HS0B 3V7MA 3S34L 3MRHA 1F8TL 1FL5A 1LEIA 2DLIA 2AEIT 4MS8C 4WU7A 4OKVB 2AJ3B 2PR4L 1HHGA 2PXYD 1A4JB 1FVDA 2GSIA 4PJIB 2NY0B 3GSQA 2YN5A 5F3HA 1QP1A 4WW2C 4QLRA 4TSAH 2A83A 1CTOA 2YKLH 3KGRA 4JM4L 5EWIH 2ZCLL 1LO4L 4ZOAA 1KB9K 4RFNB 1P4IH 1K6QH 1T2QH 5HGHB 2CDFA 4BFEA 3T09A 2VQTA 1UZ8A 4NFBA 3LIZH 3PQYB 3F7VB 1OAUL 4JFED 2A73A 4D0DA 3EYUH 1ORQA 4H25A 2P7TB 3SCMA 4DK6A 3SDCB 1LEKA 2V9RA 5DFVD 1NGXA 3NN8A 4OFYA 5MI0C 3R1GL 1U8MA 2DKSA 1KG0A 1JGUH 1W0WB 2V5TA 3REWB 1Y6MR 1CGXA 1UM4L 1ZSDB 4NDMB 1R3IL 3V7AE 5E8PB 4MDIB 1OSZB 3KPOA 4YHNB 4IS6A 3WIHH 2EIZB 2ICWJ 4D0CB 3K4AA 1RU9H 2GEEA 4FOMA 4QRTB 2XKSA 5F7YC 4MA8H 5KJRH 2V5MA 5KS9E 4F33B 1REIA 2AV7A 2X42A 1DVFB 3EJYC 2HTLD 4HJGB 4YHIB 4NKIH 3RKPA 5T5FL 3U0WH 3KLHD 4MA1C 3MNWA 4U1KB 3T0DA 3NAAH 3QA3B 4IOSD 4WTZA 2V9TA 1IAIL 4UIMA 1MI5E 4WENB 1SEQL 2X1XR 4L3EB 4KJPC 5HHPA 4LCUB 4XBGB 4PLJD 3FOLA 4LNRA 4RX4A 2IQAA 1CDGA 4N8CL 5FUCE 3G5VA 1QO3A 3D39D 1B6UA 2C4FU 2NY1C 5IGXH 1G7JA 5F3BB 5D1XA 3BRGC 4JCMA 4CADB 4X6EA 2F58L 4M4RA 1GXEA 1ZT7A 2BDNH 1QQDA 3SKOB 2R29H 3UTSD 4XBEH 4LP5A 2FEDC 3MRGA 3QIBB 2A77H 4JPWL 4LLWA 3EJJX 1HHGB 5LG1A 1KN4L 3FQRB 5DVOA 4QTIL 5AWNL 1HSAA 1X3DA 4GW5B 1EBPA 5C0JA 4QRRD 2AK4A 1WFUA 1QPPA 2VIRB 3SDAC 4N0YL 3HI5H 5SWZE 4LGRB 2XA8H 1P7KB 3PABB 1IL1A 1S3KH 1A6UH 3VG0L 2LTQB 2NLJB 3R1GH 2XY2A 1CCZA 1J8HE 5JXEA 1WC7B 2J8OA 4YDLB 3WJJC 4KKCC 1P7KA 5BOPA 5JW4R 2EZ0D 4OD1L 5ID1A 3OR6B 1IBGL 2IF7A 1JNLL 2AGJH 1H0DA 4BA8A 5HGAB 2ADIA 2AK4D 1KCLA 2RJMA 4YXKH 3ZDXF 4Y19E 4NKMA 3G6JA 4H8WC 5I1DB 5DA4A 1YEHL 2HKHH 5E95B 3IDGB 1J8HB 5J3HC 4XWOC 2K1MA 5FECA 3AU1B 4AEHL 4RMWA 3HG1D 4UAOB 4WWKA 3FAWA 2ZCLH 3F5WB 3QIUD 3DMMB 1FBIL 4NO3B 1UCBL 3TP4A 3QRGH 3WFBH 2E7BA 3O2WL 4RRPA 1FZMA 4QGTA 5IBTL 1ZANH 4XCNB 1BFTA 1DFBH 2BVEA 3U9UA 4PYGA 3LVEA 5K59E 4Y19B 1BECA 2XQBH 1HN1A 4I3GA 1IAMA 5ESAB 1ZLSL 4HK3J 4HS6A 1X7QB 4FTVA 1DCLA 1NKOA 3MRQA 2QQNH 5GHWH 1E0OB 3SGKA 2H32A 3X11A 5FIEA 5E8OA 3IVKB 3Q5YA 3KPQA 3BPNB 2R0LL 4MNQE 1KLGB 2P5WB 3C2AH 3HR6A 1CQYA 3CLFH 1WV7T 3GBLA 3KLDA 5C0GA 4YUEL 3QUZC 1FC1A 4FQCL 2XQYG 1G7JB 1A1MB 1SBBA 5EZLA 2JJTA 2QSTA 5F3BA 5F93C 3BJLA 4KDVA 2UY6A 5D5MA 1EV2E 5C0BD 5I1LB 2DJUA 4WCYH 3I6KA 3D1MC 3N85H 1U3HC 2WW8A 3V6BR 1FIGL 4LCUA 1QOKA 5AAWA 4XC1H 3HPLA 2DLFL 3OHXB 3BPOB 4XNZB 3UXFA 3GDBA 3P9MA 1CXEA 3KJ6H 3HUJE 4HIHB 4GJTB 1T4KB 2ZNWA 2DQJH 1MVUA 1B6DA 4GQ9L 1NJ9A 3C60C 3QEQD 5DMGC 1TZGL 2EDQA 5MEPB 2DMCA 4HJGA 3BKCL 4JM2F 4ALAH 3CCHB 4N0UA 3QNXA 1E27B 5E99H 1JF1A 2Z92A 4Z7UB 3CSBA 4LARL 4I3RL 1XF2A 3OKDA 1IQDA 3L5WB 1PYWA 2D03L 1W2KT 1N6VA 5ESAA 4IOIA 2CH8A 5T5NG 2VDRL 2FWOB 4PJCE 5KANG 3R8BB 4R4NC 1XF1A 4M93B 2RIKA 4POUB 4WTWA 3MLTA 4E41D 1IGIL 3NGBC 3PIQA 4QRRA 3MCKB 3MA9H 4XP6L 1YNKH 5TF1H 2W9DL 4PJBB 5T1LB 3ARFD 3W11C 4B7IA 4Q9RH 3DROB 1AGDA 3PQYD 5FA3A 3CD4A 4FFYL 4X6CF 4JLRB 4OZHE 4HUVA 3WXVH 2CDFB 1C7TA 4Y7MA 1ND0A 3WO3B 1X5AA 1TQCB 4UDUB 4JCLA 1QFWL 5L6YH 4WI2A 5E8NB 3EYFA 3ZMRA 1D9KC 5ACZB 4PJIA 2BNRB 1AXSB 3CFIC 3MXWH 1D5MA 1OWWA 1F00I 1S5HA 2OL3L 5EDXA 1EXUA 4IIQC 2EO1A 4M43H 4D8PA 3NIDF 2AJYL 5TE7H 1B0RB 3CNKA 3VFMA 2GK2A 3CVHH 3D0LB 4X83A 3ZLQC 2M26A 4BH8A 4JREB 2AK1H 5JA9A 4LSQL 3INUL 4GMSL 5J1SC 4S10A 3DMMC 2Q8AH 1HXYA 2XY1A 5KW9L 5BOZG 4N5UA 3T0BA 1TXKA 4K9EH 4ZS7L 3LS4L 1MFCL 2XFXB 3PHOB 1HWHB 1A5FL 6FABL 3WUWA 4WI6A 2GAZA 2X1PA 4P9HC 1HWGB 4S1DC 4YBQC 2DMBA 3RVTC 5FXCH 3BGFB 4YBHA 2EKSB 1KLGA 1NAML 4L9DA 5HGDB 3GSXB 2AEPH 3RBSA 4QXGL 1KJ2L 1WEJH 4BKLB 4M00A 3VFVB 5E6IA 1FJ1B 5MHSE 1C5BL 3F7YA 1B2WH 4JFQB 2LTQC 4NQCD 1CBVL 2BXZA 2I27N 4NC2B 3G08A 1T0MA 2AJVH 4AK1A 1CLZH 1U8PB 1SHMA 5CD3B 4UNUA 1FNGB 1YEIL 2P8LA 2ADGA 1VGEL 4GG8A 4OUOA 1CGYA 1FLTX 5HYQA 3QA3A 4V1DB 2J6EL 1U8PA 1INEH 4JO3L 4JVUA 1RHHA 4NP4H 1T83A 3QEGL 3GRWA 4JDVA 4UIKH 3HNTL 2AK4B 4G8FB 3HC3L 3S3SA 1EO5A 3QQ9C 4B7LA 1JYVA 3BUTA 3PUCA 1AD9A 3DXAE 3HZYA 2IALA 5BZWA 3QUMB 1PLGL 4D3CL 3SJVA 3LY6A 4MXWL 5FHBH 1AQKL 1XF4A 1GRWA 1A6ZB 2BVTA 5CGYD 1WWCA 4X7FC 3L5IA 1KB5L 2GY7B 3O11A 4U1MB 1EEZA 1YEFH 2R1WA 5HDQH 5JQ6H 3GMNB 3SN6N 4LNRB 1OD9A 4JVPA 4MNGB 2Y5EA 3F7VA 5GGTA 2ADJA 5J6GB 1ZGLA 4U2YA 2BNQB 2X9YA 2MCPL 4I9WD 1R5IB 2R2HA 3KYKH 3T77A 1DBKH 4G9FD 3B6SB 4LMQI 5JTWA 5GRZA 1ZS8A 4L8BB 1YECH 4UIKL 3BZ4B 5DJYB 3I02A 3MRIA 1KIRA 3FOMA 4JRXE 4L4TA 1U3HD 5JXAL 1NFDE 1OM3L 3HE7B 2QQLH 5DJ2A 4PJIE 1HEZB 1BOGB 12E8L 5MI0B 2APTA 4E41E 1CDIA 4MCZB 4FQHA 5DJDA 4GXUN 1AD0A 4EOWH 3P77A 4FFVC 2M1KA 3RDTD 3WD5H 5T1DL 2R1WB 4PR5B 4JRYE 1K9TA 3ARRA 5IR1A 3VD7A 1T21B 4UI2A 4MYWB 1JGEA 4LVNC 1MRCL 4XVTH 3GBMH 3VXMD 1CICB 1DQQA 3KG5A 3OPZH 4LPXA 3QEUA 1OARH 1T7ZA 5ALCL 5ELIA 1MOEA 6FABH 4Z5RA 1NBYA 1A5FH 4F7CB 5DEZA 3GIZH 1IGMH 4C56B 3KPQB 1A7RH 5KW9H 1KTLA 2VERN 1OSPL 3BXNB 3WUWG 3DI2B 5C0RL 5DJZA 1WWAX 5JDSA 2LABA 5JXED 2DLEA 5MERA 5JIIA 1HIMH 1I8IB 2D0HA 3G9AB 5C7XL 1TVDA 4KJPD 4N8VA 1D5BA 1B3JA 4MXQD 1J0IA 4ELKB 5HHMD 2EIDA 4XWGL 1OGAA 5K9JL 2WP3T 1A6TA 4MD0A 5CEZE 1FNGA 3TF7C 4XZUB 1ORQB 4PRHD 5D2NE 1XAUA 3DGGB 3DMMD 3PP4L 1ED3B 5IWLC 1NDGA 5DHYB 4K7PY 1ZA6B 3Q5OA 5KVDH 4NNXB 1CDJA 1W0VB 2B4CC 2CQVA 3CC5B 5FYLH 5DJDB 4G8GE 2EXWC 4HCRL 2DQUH 3VI4E 1EHAA 2BJML 5C0GB 4GUPB 2W9DH 2OTWA 3T3MF 2BNRD 4ZAKD 1DBBH 4X8XA 1Q9KA 3FQUA 3QDAA 1YC8A 4TOYH 1U6AH 5HYQB 5GZOD 3NA9H 5SWSB 4KXZH 4O2FB 3UP1A 4H1LA 3HCVB 4AMKH 3MODL 1MH5B 2RCSH 4ZQKB 1O0VA 1C8PA 3OKMA 4J3VA 4PRNA 5JZ7D 2EDBA 3ZKMC 1EEZB 5D2LB 4KUCD 1UYWL 1KCRL 4LARH 4NQVA 4F80A 4P2RD 1QSVA 3TO2B 3UDWC 4KROB 2IH3A 1AO7D 4R4ND 1AJ7L 2P8MA 4CDHA 3B2UC 3S3JA 4F3FA 1XIWD 3BZEB 4WWKB 5FGCB 3VXSE 1CFNB 3FO1B 4GQ9H 5E03A 5LQBL 3MRMA 3P2TA 4XPGH 4I0CC 1SY6A 1ND0B 2APVA 1Z6JT 2NY3D 5DUML 3L95A 1JZ8A 2DLFH 2FRGP 4S1RH 1GGIH 5K9OA 4XC1L 3KLHC 1KF9B 4MZ3A 4G7YL 3S8WA 1ZA6A 1F4WH 1CD1A 1RIVH 3MLWL 2B7DT 1A1OB 1JUFA 1SJXA 1MJJB 3BSZH 4JFPA 1NAMA 1A14H 3U82B 1TJHH 1EVTC 2PO6C 3LKQA 1B4JL 2BNQD 2H2PD 2V7NA 4YUEH 4XPFL 1ZXQA 3DUUA 5HDBE 1AP2A 4LRIC 4P46C 3ULVF 1MCDA 3TT3H 2X10A 2P5EE 2ZZUT 5GJTH 5EB9A 5KN5A 2VABA 4Y2DA 4WHYH 3NCMA 1CICC 5BW7A 4TVPH 1FJ1A 4F9LA 3QXTA 3JZ7A 2HFFB 1B9ZA 1D5ZA 1U95B 4N1CA 1QZ1A 5D1XD 4NNXA 4MDIA 3N0PB 4M7KL 5DHYA 5IB1A 1FIEA 1CDCA 1OAZL 5J06A 4G8IA 2BSRB 1INDH 3Q0HA 4XH2B 1H5BC 2ZG1A 3TN0C 1OAKH 3UZQA 5KSAC 5C71A 1H3TA 1NFIB 2MMXA 3VG9B 2YD8A 1W72B 2OXGA 43C9B 1F4WL 1RIVL 1T1ZA 3WJLC 1BD2D 2Q3AA 4PGDA 4Y4HD 1KENH 1XGRA 4X99B