4OB5L

Ontogeny of recognition specificity and functionality for the broadly neutralizing anti-hiv antibody 4e10
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
MEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPSTFGQGTKVEIKRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 4E10 antibody germline precursor 7 heavy chain Fv
publication title Ontogeny of Recognition Specificity and Functionality for the Broadly Neutralizing Anti-HIV Antibody 4E10.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ob5L00
3DHJA 5GS0H 4Z7VA 4LPXA 1CGSL 1EO8H 4NCDA 1ZKAA 3ZKSD 5J13C 1MFDL 1QYGH 4PLJD 5C0BB 5IVXB 1IQDA 4NQCD 1FL5B 1MQ8A 3PWVA 1QPXA 3SDAC 1S7WA 1G7JA 1U8QA 3R0NA 3SJVB 2IJ0C 1ACYH 1A7NH 5E8OB 4MJIA 2QADB 1S9WA 3O2DL 3VFGL 4Y19A 5KSAC 5E6ID 4L8DA 4XCEB 4IOIB 3H9YA 5C0DA 2HFFA 4D0BA 3H9HB 3DMMB 3K8LA 4CN1A 4HGWA 5F7HA 2R1XA 4XMKH 2WQ8A 5HYJD 2OTUB 2R8SL 4X7CC 2XFXB 1DVFA 1IARB 1IEAB 3VH8B 2VLJD 3RIFK 3LKSB 3MNVB 1J87A 5ISZB 4XBPB 4MAUH 2F53E 4FNLL 2R0LH 1AR1D 1SY6L 4JFFB 3G5VA 3WUWA 3HN3A 1TZIA 4I4WB 3CXDL 4HWBA 3SDXA 4J3TA 4M3JA 4MNGB 1R5WB 5E4IA 5J6HA 5DR5H 2YPLE 4PJEB 4POZD 5HPMB 1FBIL 3LAFA 5HI4C 2A74B 1JWUB 2G2RB 2BSTB 3O6MH 3OF6A 5IF0A 4BH8B 4JKPL 1UXWB 1S9XB 4ZOEA 2B1AL 2QKIB 3VXRA 3RX8A 3CVHB 3D0LA 4PRDA 3ARGB 3GSWB 4MJ6A 4KJQC 2BNQA 3LQZB 4AQOA 4E5XA 1HN1A 3Q6FA 1DQML 1H3PH 3UTTE 1IGTB 4ALAH 1VESA 3OAZK 5FXCH 2I07B 1C5BH 4NN6B 5E8EA 1BHGA 1J8HE 4HMDA 1FH5L 4I77L 2C7UA 4Y5XA 1OTSC 1T83C 4RFOL 4OCXL 4XP1L 5I8KL 3X13A 3HPJB 4H5SB 3OAZH 2XN9A 3UJIH 4S0SD 4ORZC 4M93C 5E2VL 3OXRA 5T1LB 3MXWL 1TPXC 1E0OB 1Z2KA 1FVEB 4JZNB 1NGWA 2OL3B 2Y07H 4I3GA 3F7YA 3QJFB 1WFOA 2OR7A 4EI5D 3EO1B 1T0MB 1JBJA 2O5ZL 1ORSA 5F93C 5HDBF 5AG9A 2VOTA 5HYSA 1YECH 3EYOA 1A0QH 3VGAB 3W0WD 2ICES 3SDAD 3STLB 2DOCA 1ZGLP 2EDQA 1E4WL 5KW9H 4FQCH 3OJDB 2X1PA 4WU7B 3EYSH 4NZRH 1KJVB 4JFEA 1R5IA 3MRKA 3BZ4B 2Z9TA 5T1KD 4OZFA 1TZGL 1BIHA 4YHLL 5KSBB 3VCLA 2AJUH 3OKLA 3FO9A 1DE4A 4RGMC 4LPCA 2C4XA 3IJHA 3VWKD 1NAML 2WNGA 4G8FA 1K5NA 2ZKHL 3BGFC 5IVNA 1FVCB 3RDTB 5J8OA 4P57B 4K7FB 2G9HB 1I85A 4U6VH 3FQXA 1I9IH 3L3GA 4M9PA 2VIRB 1MREL 3DTXA 1MVUB 4ONGL 3IDIA 4HKZB 4L8SB 3VFNB 4L8CA 4G7YL 3S37L 1AI1H 1R24B 3X14A 1KELL 3T0ED 5HI4D 4OFDA 1FZJA 1P53A 1KPUB 1WWWX 1JYXA 3G5ZA 2P46B 2HT4C 4GMTH 2A83A 5C9JB 2R2BA 1T89A 2J2ZA 2H3NA 3GMQA 3O6LL 4KDTC 1KCSH 3VRIB 4YH6A 5AYUH 1A1OB 1JK8A 2VZ3A 5IP4A 4UTBL 2EDYA 4B5EA 2QR0B 4RCAA 5CJ5A 5C09A 1IC1A 5IVXF 2CRIA 2I26N 2WIMA 3MRFA 5ABDE 3NFPB 3LKNB 4G8GB 4ZFOB 5EZIL 1IM3B 4PRHA 4DTGH 2B4CL 3FL7A 4J23A 4PJBB 3IDXL 5GISH 3ZE2F 1INEH 4CW1A 4QXWA 7CGTA 1T1ZB 1EFQA 1OTSD 1CVRA 1N4XH 2OZ4H 1A7OH 1FCCA 4MVBC 3OKEA 5KG9B 1CTOA 4X4MA 4IS6B 3LS4H 3B9KB 4Y4HB 1R3KA 1FNSH 4UB0H 5FF6A 5GS0C 1CGWA 2W60B 1PZUB 1F58H 2FECL 4FP8H 3F6IA 1VENA 4JFXA 5DYOA 3SGJA 3QIWC 5ALBL 2HP4A 1A21A 4OJFH 3RL2A 3U7WL 5A40E 3O81A 5I76A 4PJEF 1HKFA 1RZGB 1N7MH 1SJHB 3BP6A 4N0FB 1QKZL 1U92A 3VFPA 5D1ZD 1U8HB 1LEGB 3U79A 3MGAA 1U3JA 1H5BC 1U91B 2X10A 3STZB 3WFEH 5HHMD 2AJXH 4C57C 1EFXB 3BUTA 3IF1B 3WS6A 3GJFK 4KK6C 1A1MA 1I4FB 3RWDB 1NFKA 3DVGA 2HFGH 4MD4A 3KR3H 3QUZA 4OCYH 3LEVL 5DD0L 4XNZB 3BSZL 1ZLVK 3MYJA 5D2LE 1PGRB 3OAUH 2AQ2A 4W6YB 1U8KB 3GJFH 1WAAF 3ZDZE 1OGTA 3AVEA 1HK6A 3PDOA 1UYWL 1W0VA 1ZS8A 5HHQB 3V4PL 4UIKL 5DK0B 5EZJB 4KUCD 1ZLVH 2E6QA 3NPZB 2JK5A 1HDMB 4NBYB 3V52L 3QUYC 2BHZA 3CDFA 2DLTA 3A0OA 1U3ZA 5SX4H 1N5YL 1A7BA 3BYTA 1CE6B 3AREB 1HNFA 5D9SA 1A6VL 5J12C 3MRCA 4UILL 4FFWD 4ELMB 1MI5E 4FQHB 5EBLA 3C6LB 1LE9A 3CSBA 4M3KB 3K1KC 5F3BB 3KAAA 5E7BA 5F7EH 3BPCA 3MGTA 1H15A 4N5EC 1N2RB 4DVRH 2EH7L 4TSCH 1OPGH 2DWEB 3S34L 3RZCA 3IYLW 1HQRB 1Q72H 5I1AA 2NX5B 3MRHB 3TH4T 4LDEB 3GBML 4OSUH 1NANI 1K4CA 1YY9C 3I6KA 5KSBF 2OL3H 3O2WH 4OFKA 4HKJA 1E4XH 4MVBD 3ARFC 3G6DH 3SGDH 1RQ5A 3D0VA 2LTQB 2UYLB 2E9WA 4MQ7A 2HMIC 4N8CH 1W8NA 5IMMA 5GS0D 4NDMB 4YIQA 3N1FC 2YSSA 4JJHA 3QPXL 3FTGA 3M8OH 1QR4A 2LAAA 3QIWD 1BFTA 3WEXA 4D0DB 5DD1L 1IGYB 1K3ZA 4Y2DD 2NPLX 5FOBA 2C9AA 5DFTA 4LFHD 1QP1A 2WLZA 1F4WL 4OGAD 3UDWC 1RMFL 4P49A 1KLUA 1RUAL 1T21B 1XF3B 4JM2A 2O93L 1QSFD 3HB3C 1LWRA 3VG9C 4WI6A 4OLUL 5FDYA 3VE0A 1I3VA 4K2UL 3FOMA 3D85D 4M6AA 3HZKB 1J10A 4R0LA 4D3CL 4KK6D 2BHYA 3E6FA 3Q3GB 5I1DA 3TP4A 4V1DA 5D70H 4DKDC 1HH6A 1GIGH 1Z5LB 5FV1L 3JWOL 4B0MM 6FABH 2AEPL 2FO1A 1I7TB 4G8IB 5ELIA 4WNQB 1S7SA 1GGBL 2EYSB 2FIRT 1WVZA 1BVKB 2PR4L 4PV9B 3BIKB 1U41A 4TTDD 3NMEA 4JFZL 1JNLH 2ZOLA 4QT5A 4M9OA 1NL0H 4OM0H 2E9JA 2DB8A 1EV2E 1QOKA 4P99A 4WFFD 3DURA 2YKLH 2NY2D 4L3EE 3BDBA 1M7XA 3L3KB 1MCHA 4LLYA 1FO0B 2ICWB 3L3OA 1CL7L 1YMME 1MOEA 1WFNA 3EYVA 4N9GA 4PB9L 3MRQA 2H9GB 3L5IA 4X9IA 4PG9A 1RAMA 1GGUA 3WXWH 5I6XB 3MACL 1AE6H 2J88L 1ITBB 1EIBA 2VDRL 2N56A 5GHWL 4PGEA 3FB8A 3IDNA 1VPOH 5A3IC 1YPZA 3KWWA 3RPIB 3BRFA 2FEEI 3GHBH 5JXEC 4KMLB 4ZD3H 1YY9D 2C1OA 3TBVB 3OAYK 2GAZA 5HY9B 3E3QC 5LXGL 1V7NH 4FA8A 4WI5A 4LCCA 2IEPA 5JPNA 3U0TA 2HMID 2NLJB 3ARRA 4PJFB 4ODVH 2ADIB 1QPPA 4GS7B 2PN5A 2QADC 4JFQB 5D6DC 2GTWB 5KZCB 3O41A 2DLIA 1FPTL 4GKOA 4KKCC 1TETH 4HWBL 1V7ML 5EZOL 3DMMC 5J6GB 2CLRA 4NRXB 3AM8A 4CVZA 4E0RA 1FFPB 1QFWL 2P1YA 5CKGA 1I8KA 3W9EA 3P40A 1I1AB 3QEQA 3HB3D 3I6LD 1CYGA 2X4PB 1VFBA 1WSST 4J7RA 1G0YR 3DUUA 3NA9L 5E2UH 3D2UB 1T7WA 4ELMF 1Q94A 2BP3A 1R3JA 4U1HB 4PJAB 2NY6D 3D9AH 5J1SC 3QH3B 1WZMA 1MCJA 2KZ1B 4ODTL 2B0SH 3REWB 4OIAA 1F90L 4X4ZA 2YA2A 3QSKB 1BPVA 2AK4A 3MRPB 1MCBA 1JE6A 2X4OB 1OP5H 4CNIA 1D5XB 4RX4D 1MIMH 2VN4A 4O00A 3ARGC 3D18B 3MZGB 4LSUH 3VA6A 4WFHD 1RIUH 3EJYC 5FHBL 2W0PA 3IS1X 4LP4A 3VI4F 3FN3A 3VXME 2P24A 4NN6C 4NZTL 5DQJB 4F2MB 5HYEA 1WIOA 1ES0A 1SM3L 4RAHA 4K7PL 4JQVC 4YXKH 2E7LA 3SE4A 1U93A 4EEEA 3U2SA 1A47A 1EO5A 1MHEB 1X6NA 3BH8B 4PY8I 5LQBL 5DEGA 4OZIE 2WM0A 1MLBB 4IBLT 5D1XA 1A3QA 1ND0B 3E6HA 2Y72A 3L3HA 5KJRL 3VA2C 1G7LA 3SE8H 1F3DH 4PLOB 4PJ9D 3RY6C 3G6AA 5FUCE 5JXED 4LHUB 3LN5A 4HW6A 3WL9B 3I3EA 4AL8L 15C8H 1JHLH 2BFVH 3LCYA 5DJXB 5C0BD 1NCWL 4OF8A 5T3ZL 3VGAC 4HMEA 1BOYA 4X99A 3U7AA 3SJVD 1XGUB 5E9DB 2QADD 2FB4L 4KWUA 3G9AB 3MX0A 4S10A 3T2NH 4TSAL 4E9LA 5CMAA 1SJVA 5DLMH 4NM4L 3DMMD 1QFHA 2ARWA 1S7UB 4FFZH 4M6OL 4U1KB 1LO2H 2VABA 1T5XA 3RDTC 1BX2B 3WNNA 4YO0B 2Z35B 1CFSB 3H42H 1NFIB 1PVHA 1CFNB 4UMGA 5HGGS 1JP5A 5ISZD 1SYVA 1D5IL 3A6OA 2VE6B 3QYCA 3HC4H 1KIQA 4MXVF 2UVFA 3H9SE 1D5MA 4JFFD 4U0RB 4L8SC 3GMRA 3MJ9H 5E8DH 2OYPA 3LKPA 1KBGL 3SQOH 2V5RA 3DXAD 3IXAB 4EN3B 2F53B 4XB7A 4F7PB 4ELKB 2AABL 1CVSC 2FIKA 5DXWA 5SX4I 3PF2A 4NQTA 3FQTB 2YUZA 4C83B 1OSZA 4MMZC 4OCSH 5B38B 1FC2D 1MRDH 3RWEA 2YPLB 4BQBA 2AEWA 1NAKH 3FQNB 2QSVA 1FO0H 3BKMH 4UZGA 2C26A 5GJSL 3WDJA 5LGHL 2H32A 3MRMB 4U1MA 5DT1H 4NC2B 3V79C 3OR7A 1HQ4B 4PJFF 3LV3A 5GSRB 1H3WM 2I9LA 5EN2A 2IBBA 4XCCH 1SQ2N 4KC3B 1ZLSH 3FQUB 2NXZB 5F70A 5FA3A 3UTQA 3UTTB 2WQRA 1S9VB 3IU4H 1E28A 1JZ3A 2Q6WB 3O11A 1J8HB 5T1LD 1E4XI 3B9KC 1RVFL 3BH9A 3F6LA 4Y4HC 3SGDI 1GZPB 4HUNB 2V5MA 3MLSH 3LPFA 4R4BA 3QHFH 3BJ91 3KPSB 4HLZG 3Q48A 1HIML 5I1GH 1OLZA 4G43B 3F58H 3P4LA 4PS4H 4O58H 1EVUA 2V17L 1REIA 4GAYA 4TTGA 4X5XB 1IFHH 3F5WB 5CEYA 4PJAF 1ONQB 1EUUA 2EYRB 2V9QA 3HE6A 3NACL 2ZUVA 2GSGB 4H0HB 1AY1L 1YYLH 2JB5L 5D2NA 4HIJA 1FZKB 2ZWLT 3M1BA 3S9DB 2AXHA 1NBYB 5DJ6A 4JZOB 2DQFA 4RFNB 3KDMA 5BMFH 3MJ6A 5D1QA 2Q7YA 3S36L 2EYTB 1MPAL 3RDTD 3IFLH 4KZEH 2V2XB 3UJJH 4XNZC 5EPMB 4K9EL 3KLSA 4L4VE 1QQDB 1FLRH 4NYLA 2DQEH 2FNBA 4JPWL 1M71A 4O9HL 3VXSA 4H0GA 4WO4B 1BMGA 1CT8B 3PQYE 1UFUA 1FNEB 3ZT5A 2DM7A 4Z7VE 4FQXC 2EICA 3SDDB 4KHTL 5FKPA 4G6MH 3EO0A 3L95B 2XICA 1T2QL 4BSWA 1GSMA 3DV6A 1Q9OB 2BHUA 3CFJB 4HKXA 3WFCL 2WINA 3LPWA 4MJIE 1CXLA 3P0GB 1IZJA 3GKZA 5FO8B 2Q1EA 4Y19E 3BP4B 1DBAL 3C6LC 3BEVB 3UYOD 3DX9A 3VWJA 3QG7H 3KYOA 4G8GD 1DUZA 2BVYA 3LB6C 4U1GB 1XGRA 3EOBB 1GXEA 4J6RL 2NTFA 1MFNA 1J1XH 2QQQA 1NMAL 4YHNA 2ATKA 32C2B 1Q1JH 2H1PL 5IB5A 1HKLH 4OD1L 5I66B 1RJYB 1KN2H 1WV7T 4R7DB 1WTGT 3ARXA 1JPFB 3MRGA 4X7FC 4XRCA 1OOAA 1MCOL 2LTQC 5MI0B 3B9KD 2FGZA 3AAZB 3GSVB 4Y4HD 3SDXE 3DUSA 3MLVL 4G42A 1WZ1L 3QWOA 1FGNH 1UJTA 3TT3L 2QV2A 4G9DB 5EU3B 2PYEA 5I17B 2IANA 1YQVL 3QBTB 3IU3A 1F97A 3RKDC 1JN6A 1BEYH 4HUXB 3VXRE 4ZUTB 4YEFA 5IJVB 4HHAB 2R2EA 3C08L 3MMEA 5T1MB 2EECA 4Z77B 5IQ9A 3QXUA 4FABL 5TQ0L 4DK6A 1FSKB 1INDH 2BNQE 2JE8A 5HVWA 2Q8BL 5TGBA 3CDCA 5IM7B 4PJXA 1P6AB 1CZ8H 4QRRA 2EE3A 2MSPA 5MEQB 3QNXB 4P23A 1EFXD 1LE5B 5I1CH 1LO0H 3KPRD 2IQ9H 4NNXA 5I1HL 1BF2A 2HG5A 3GSNA 3DX7B 5KSUA 2BOBA 2XN9E 4M5YL 1ZLUK 3D39D 3Q1SL 1KNOB 3QB7C 1E4KC 1TVBB 3T77B 5DJYA 3LHPL 1SMAA 1IAIH 5E00B 1YJDH 4WV1A 1RZFL 4YDIL 1FFNA 1OAKH 1IC5L 2DQHH 3E0GA 4R97C 3CJJA 3QI9B 2HKFH 5CIPA 1IEBB 1ZLUH 3FO2A 5DUBB 2XPGB 3GSQA 1MRFL 3P0YH 5D2LB 3DYMA 3NBNA 1YN7B 5JOPD 2R39A 3V4VH 4HUUA 5C0IB 3EOTL 3ARED 4DGVL 4XWOC 4LLMA 4P4KB 4MA7L 2EDRA 3S35H 2V5TA 4PGCB 1CS6A 5DZOA 4JFEE 3MRIB 3C6LD 1J11A 1X7QB 4FQ2H 2P8PA 4PRID 3TZVC 1DDHB 3ULUH 3P11L 4UT7L 4KK5C 4YHYB 1NBZA 3LB6D 1FZMB 4K55A 4NUGH 3EYFA 1A6ZA 1MI5B 1ZA6A 2E9BA 2NX5D 4L9DA 4D0CB 3CDGB 3T3PE 2EE9A 1M7DB 4APQA 3MLUL 1N6VA 3FRPG 4FFYH 4M1GH 4OGXL 2CIIA 2CLZB 4YE4L 5JIPA 1EO7A 3SKJL 5IV2A 4JGJA 1R3IL 3PABB 4GS7C 5CEXB 3ARUA 1SYSB 1UKTA 3QDJB 3GNML 5B3NA 2MJWA 1TCRA 5BOPA 1QBMH 3U0PB 2ITDB 1IKFH 3V4UL 2A9NL 5C09E 4IRJB 4GW1A 3UTPE 4P2RA 3MLXL 1I1AC 3A6CL 1EEUA 2ILLA 1X4XA 3DVFA 4X80H 2C3VB 3PGFH 4PRHE 4XXDB 1FL6B 5IEKA 4F33B 3BKYH 4MHHI 4FMKA 2X1XR 4PGJA 4HG4K 1LK2B 3R1GH 4Q2ZA 5ACMA 2FGWL 1JV5B 5CD3A 1BBDH 1EJOH 4HJJL 1ETZB 1LEIB 5LCVH 4PJHB 4X4ME 5FYKL 1IGFH 5C2BL 2IPTH 5DDHB 2Q7NA 4CVWA 5M94B 1A7PL 5FAAA 3RNQB 3DRQA 1MQKL 2VAAB 3HE7C 3X11A 1OWRM 3GBNH 1FG2B 2F8VA 4X9GA 4XWOD 4LU5H 3U9UB 3FMGH 3FZUC 4I3RH 1R5VB 3DGGA 4F7EA 1J0HA 1PG7L 4NC1C 1MHCB 4LK4A 2FJHA 4MDJB 3QUKB 5GGQH 4J3UA 4L3EB 3SCMA 4KK5D 5JHDA 4ZFFA 3JSSA 4YGVA 1T2XA 1YMMB 2DIJA 2HVKA 1DANU 5JW3H 3TN0A 5CP7A 3TJEL 4X6EA 3O0RL 3FB7B 1KC5H 4PJ7A 2AKRB 5IMLB 2DD8L 1NFDA 5BXFB 3N9GH 1SEQL 3PHQB 5LWYL 5TDOA 2VZVA 3W39A 5JHLL 1S5HB 3UBXG 5J3HD 1YY8A 1ZHKA 4JRWA 3W2DL 1YEIL 5ACZA 1OLLA 3REVA 4JR9H 1DSFH 1F4AA 5DQ9A 5GPRA 4AH2B 2DTSA 3IDGA 3IDMB 2RHEA 4K8RH 2WBJA 3IFOA 1ZHBB 4DN4H 4DN3H 1V3KA 5KZCD 4FFVC 4DW2L 3TNNB 3DECA 4OI7A 2VXQL 3MXVH 4CN4A 4YBQC 5IQ7H 3HMXA 3I02B 1ULVA 3QEHA 1NAMB 5D2LF 2V9RA 1AKJB 1HXYB 4WHYG 3CFBA 2ZCHL 1WBZA 1I1AD 1CDIA 3VW3H 3ZDZF 3HI1B 3L5HA 4U7KA 3I75A 5FYLD 2GYSA 2YZ8A 2R15A 5ANMA 3V5KA 5B4MC 5A16B 3MCKA 1JTTA 3D2UD 3WS3A 1Q9KA 3HC0B 3GRWH 4KV5E 4YUEH 4U0RC 3QCTH 3T0AA 1BJ1H 3ROLB 5IR1A 2AEQH 1A2YB 1OW0C 4LEXL 5DMIH 2E3VA 1R3LB 5EWIL 4O02L 1WJ3A 1YJDC 5DJAB 1LD9B 4EN3C 3IFNL 3FB6B 4LSDA 2BVOB 12E8L 2GJ6B 4LVOB 2OR9L 4ENEC 3AXLB 2JB6B 3CVIH 5IMOB 5D7LD 1QACA 3CFDB 3KLHD 2V2WB 1CLZH 2C1PB 1U8NB 4GRLB 3WNPA 3B9EA 4ODHH 1AGBA 3B2VL 4ZUUA 3OGCA 2Y4SA 5DRNB 1OTUD 1BZ7B 2GT9B 3VXNB 4PJCA 4X6FB 4QCIB 4OGYL 3UPCA 5FHAL 4WGVB 1UWEH 1F00I 4JG1L 3ULUC 3RX5A 2Z92A 3INUH 3N1PC 4H20H 2NXZC 4JY6B 1DCLA 5TFSH 3EDEA 3HNSH 3VXMB 1UQSB 2YPKA 3O6FB 2QL1A 3ECBA 1MFDH 2YA1A 3SY0A 4V1DE 1IBGL 4NO3B 4P0DA 4LHUD 3PGCB 3V7MA 3KPNA 1TIUA 5FA4A 4YHML 3V8OA 1W72A 4KROB 2DTML 5C0AD 4PR5B 4ONFH 3VFGH 4D9QD 1IM9D 5EFIB 3X12A 1VEMA 5E9DD 4PJHF 4KKLC 5CHNB 2KUTA 1VFUA 3OSKA 3NZ8A 1KTDA 3CZJA 3RTQA 4FFVD 2JCCA 2R8SH 2I9TB 4M8QB 4RFNC 2D7QA 2CXKA 3W11C 4YR6B 2JELH 4AJ0A 2NY1C 1AIFB 2UWEA 1ZVHA 2FX9L 1YC7A 5B39G 2E6PA 3MCG1 5B4MD 4KZDH 2F74A 3JXAA 1FBIH 5FYJE 3HG1B 5H35B 2AERT 4Z7QE 1YPZE 3ARWA 3P9LB 1NSNL 1IAII 4DOHB 2DQCL 3WE6A 1CLOL 1G9MH 4U1NB 4JKPH 4M61A 4OFVA 5GGUB 3SDDC 2B1AH 4EN3D 4A2LA 2F53D 3H9SB 1C12B 5FOJA 3TCLB 3VJ6A 5ETUA 1DQMH 4F9LC 2YPLD 4OCMC 4EVNA 4OLZL 3V6FA 1J5OL 5ESQB 5HYFA 4LLUA 4OD2A 5EO1A 1FH5H 4I77H 3RVUC 3WD5L 5T3XE 43CAB 1FDLL 5AZ2L 1ZVSB 5HI3C 3AU1B 4GKZA 4RFOH 4U1GC 4OCXH 5I8KH 3VFMA 1RJLA 1B6DA 4BH7A 5KSAA 3QEQE 1EUTA 5BW7C 2NXZD 4OCWH 3UTTD 1GCFA 1J8HD 5MI0C 5F1NB 2X4UB 4PJ5A 2BOCB 1Q0YL 4KU1A 4OLWH 1U8OA 4KTDL 1A6UH 2WZPD 4YXLL 3LVEA 4WHCA 4Z76A 2V7NA 3QXWA 5EIIB 4TNVK 2X7LA 4J8RA 2AK4E 4F58L 3RY5A 4Y4FB 1BM3L 1XZ0A 4LHQB 2BY0A 2W9LA 3L7EA 4K8RC 2VRAA 3O3AB 4YHLH 4J3OC 3GMPB 3VFUA 4KKLD 1FSKC 1XH3B 2XKNA 3U36B 1NAMH 4NHUA 1FRGL 1LNUA 5FYKE 3VMOA 3WJLC 4WVRA 5D7JD 3P9WB 4GRMB 3LKRA 1G7MA 3QQ9D 4MCYA 1MREH 4N68A 2ADFL 4OM1L 1A9EB 4ONGH 3MRRB 4K3GA 1UG9A 4YHOL 4PY7B 1EBPA 4G7YH 3FQWB 4OZ4B 3S37H 5FUOL 5KOVC 4CU8A 1KELH 4WO4D 5MEPB 3TWCL 2W9DL 1WICA 1OSPL 4WW2A 3VFWA 1BWWA 2CDGB 2MKLC 2EDKA 3QI9C 3MBEA 4L4VB 4XX1E 2X9XA 3SDDD 4S1DC 5MERA 2VZ1A 4PGZA 1T1WA 2VMFA 3UMTA 5D7IA 1Q9LB 4JVPA 5E95B 5E8NB 3QNZB 4JPVL 5ERWA 4Z7VB 1WWBX 5EZIH 3SE9L 2D31A 1OQOA 3U9PH 2B4CH 3OKYA 3IDXH 2WUBL 1YNKL 2A77L 4W4OC 1G7JB 1U8QB 2G5RA 4NWTH 4YHYC 4MJIB 1S9WB 4M4PA 3CU7A 1PBYA 4Y19B 5IG7A 1BOGA 4K94L 4FXGA 4L8DB 1G0XA 5DTFA 3AB0B 4D0BB 4ZMAT 2EIEA 2GJZB 1PDKA 1DVFB 1KJMA 4HDIA 5DHYA 1BZ9A 3MUHL 2I60H 3JV4A 3U7WH 5IBUG 3G5VB 4JFDE 3WUWB 2DM2A 1TZIB 2ZOKA 3CX5J 3SDXB 4G6JL 4K8RD 4WCYL 4X5WA 2IGFH 1JIBA 4WI9A 2ADGA 3WIIL 2LU7A 5J11B 1A14L 4IRJC 4EDXA 5IF0B 4X8JA 1XIWD 3BZDA 5I1JL 1AGFA 3MLTA 5F6HI 3VXRB 3T0DA 4LKXA 3FN9A 3LEVH 4KDTA 5DD0H 3D0LB 4PRDB 4E5XB 1JTOA 3Q6FB 2Z93A 1UYWH 3V4PH 4UIKH 1EBAA 2EC9U 4JDVA 5F9OL 2Q20A 1G9MC 3HAEG 3IDUA 3CIQA 1PX4A 4JCMA 5JA9A 3UO1L 4Y5XB 1N5YH 5D8JH 5CUSL 1A6VH 3B3IA 3RWIA 4S1DD 3V8CA 4PPTA 2ARJA 5F1OB 3OG4B 3OKOA 4KXZH 1ZGLA 5GRUH 1NEZG 1NGWB 2FZ3A 4LMQE 3IKCA 1RU9H 4P4KD 4JFPA 5D2NE 4EQ2A 5J56B 5C0EA 4XGZB 3TV3L 5C9KA 3R06A 3S4SA 5HYSB 3EYOB 1QEWA 2BVUA 5B3JF 2EH7H 3HCVA 3S34H 1LDPL 3O9WA 4X98B 3GBMH 5BZDA 1CGVA 1J0KA 1MI5D 4JFEB 1R5IB 1RY7B 3MRKB 4XAKE 3VCLB 3OKLB 3FO9B 1DE4B 3HMXL 3VXSE 1H5BA 4OLXH 4H25A 5JA8B 4GH7B 4LNRA 4G8FB 1K5NB 2D7OA 1UADC 4M6NH 4RMVA 3FQXB 1JWSA 1U8PB 5DD1H 2GK2A 3L3GB 1KUMA 3DTXB 3RAJH 5E2TL 2P5WA 3IETA 1F4WH 2H2SD 5GIRA 5EULV 1RMFH 3IDIB 4B41A 1RUAH 4L8CB 1QTYT 1UKSA 3X14B 4I0PD 3AS2A 2XWJA 4OLUH 4B50A 3QUYA 1QHOA 3G5ZB 4Z7WA 2A83B 4D3CH 2R2BB 3QRFM 1QLRB 2H3NB 4JHWL 2H45A 1CGTA 1RZKL 1JK8B 3K2UL 3LZFL 4Z7VF 4S2SA 2NW2A 2K3TA 3JWOH 4HIXL 5C09B 1FL3B 4P3CL 2AEPH 3MRFB 3UP1A 2B1HL 3L7FA 4OCRL 1GGBH 4PRHB 3KNBA 4N9OB 4AM0A 3EDJA 2PR4H 3GIZL 2D7PA 2IADA 4JFZH 4CW1B 2FL5A 2FBOJ 4S0TD 1N0XL 4F8TA 2K7PA 3SN6N 3OKEB 4HV8A 1F4HA 2PYEE 3ARFA 2IANE 2XTJE 3DSFH 4GRLC 1CL7H 3ELAT 3G5YA 4Y1AA 4MSWA 3ZTNL 3R4DA 4PB9H 5FF6B 4AEFA 3V7AG 1KYOJ 5MENA 1KLGA 4HUVA 2B4CC 3MACH 2J88H 2QLVB 2D2OA 1UB5A 3BVNA 4JFXB 1AD0B 4BQ8A 4IMLB 5DYOB 3KYKL 1IQWL 4PJXE 3SDXF 4QRRE 3RL2B 4L3ED 5I76B 5DGRA 5L9DH 1LMKA 5DO2D 3BHBA 1YMMD 3BP6B 5SWQA 1U92B 3O6FC 4F7CA 3VFPB 1UVQA 5K9JH 5LXGH 5HVFB 3SO3B 4CUCA 2GSIA 2HLAA 4RQQA 3RWJA 5L8JB 3E1F1 1A1MB 1ZXQA 3DVGB 3B9DA 4MD4B 4U6XA 3QUZB 1B4RA 4OFYA 4HWZA 4C55A 1FPTH 3MNWA 3MYJB 1A7RL 5FUCC 1V7MH 1NCAL 2D9QB 2HLFC 3IFPA 4C56B 4D2NA 1AXTL 2VDLL 1OGTB 1S7TA 3MUGA 5BZWA 2PW1A 4WUUA 3U1SL 4TVPE 5GRVK 2JK5B 1YN6A 4LIQH 3PXHA 3GMNA 3NA9H 2XWBA 3WFBL 1QHPA 1UXSA 4ZQKA 5D9SB 5EORL 4ISVB 3V95A 5JW4M 1HNGA 3EYUL 3MRCB 4HIHA 5HHXL 3EO9L 3HZMA 4V2CB 4ODTH 5AEAA 4Y16B 5EBLB 1D5BA 3QZWA 4TOYH 1F90H 2H6PA 1DJSA 1IKNC 2VWEE 3I9GL 3MGTB 4P59L 4BZYA 1H15B 2VXTL 4DQOL 4DVBA 1LQSR 1B9ZA 5F1IA 3MFFA 3FQRA 3RZCB 1RIVL 1WUNT 1I8MB 1CD1A 2ITCA 4N90E 5I1AB 2A2QT 2R69H 1X5AA 3TPKA 4JN2B 5F96L 3D0VB 1T6VN 2NZ9C 2VL4A 3AROA 4M03A 4M1DH 2FDBP 5DFVC 5IMMB 1KPRB 4K7PH 2OP4L 1MRCL 4YIQB 4FQ1L 1MAML 5DQDH 1DN0A 3T3PF 2YSSB 3K74B 3FTGB 2X89D 5LQBH 4IOIA 3WEXB 2Z31B 4UNVA 5FOBB 2QBWA 3DX8A 1NBQA 4XVTL 2JIXD 3VXMD 3SKMA 1KLUB 3BKJL 3O6FD 4JM2B 4LRIC 2FECI 5T3ZH 3L3DA 5H37H 3LKSA 1ZWIA 3WHE0 3VD7A 3VE0B 3FOMB 3P77A 3D69A 4R0LB 1T03H 1DN2A 2FB4H 4KROD 4Y4FC 3CPLA 3E6FB 1U8JA 2P4AB 2XQBL 4WTZA 4V1DB 1MCNA 4TSAH 1HH6B 3GJFA 3GSXA 4NM4H 3T09A 4D9LL 2A74A 1JWUA 2FWOA 4MQXC 4OKDA 2BSTA 1CN4A 4M6OH 1S7SB 4BH8A 5JW5A 1MF2L 2QKIA 3VXQB 4E41A 1YC8A 1TJHH 2ZOLB 4GW5A 3ARGA 5TPWL 5D93B 4QT5B 1X4YA 1S7XA 3S96B 3DURB 3QAZB 1H0DA 1JMZA 3ALWA 1OD7A 5JHDE 1H3TA 4LLYB 3PG2A 4Q7DA 4XHJC 3JWOC 3L3OB 2KPNA 3EYVB 2HH0L 1RIHL 4N9GB 3WSQH 4HSQA 2WK2A 3CFCL 1CICA 4F57L 5CWSA 1CU4L 3JWDH 4PG9B 4HBQA 4PJ7E 4RSVA 4H5SA 1NFDE 1MAJA 3EHBD 3BPNC 4PGEB 2H8PA 3IDNB 1I9EA 3H9SD 5SV3A 1YPZB 3KWWB 5GJSH 5LGHH 4JZNA 2OL3A 1S5IL 5CILH 4KXZI 5D4QA 2R0WH 3NZHH 3RY6A 2C1OB 3NCJL 1NGQL 3RIAK 3EO1A 2H2PC 2VZOA 2GAZB 4MAYA 4FS0A 2Q87A 2NZ9D 4LCCB 5JPNB 3U0TB 5FM5O 1A02N 5JPMB 4PRAB 4RMTA 3S5LG 3STLA 4X7TA 4J4PC 2YD6A 4LPVA 3MLZH 1DL7L 2KH2B 3E8UL 3GK8L 4TQEH 3O41B 4Q6IA 5JXAL 4XTRD 3AB0C 1D5ZA 5ANME 3TIEA 2CLRB 4MCZA 2DQGL 1HIMH 2YMXH 1CXEA 1I8KB 1IGMH 2HT2C 3F8UB 3W9EB 2EXYC 1DVFC 1JVKA 3TVMA 4K7FA 3SKUD 1V05A 3DUUB 2FEDC 3RNKA 1AY1H 2JB5H 1Q94B 1R3JB 3VXUA 1OAYL 4YX2L 1CDBA 1AGCA 4GAJL 3EW3B 5EOCL 5EOCJ 5J11C 1PW3A 4W81A 5J0BA 1DBML 5TE7L 5TH2A 3S36H 4PJCE 1YNLL 4CNIB 1JPGA 1FFOA 4K9EH 4GBXC 4XNXL 4XZUB 1A1OA 4UDTA 3TO4D 4RA3A 1RUML 1Y6MR 4O9HH 5IB4A 2P24B 3VXPA 1QYGL 3KYMA 1RD6A 4PJBA 1NEUA 2YD4A 4Y5XC 4F7MA 1T2QH 2X9WA 1ACYL 1A7NL 4PV8A 3WFCH 3U2SB 1Z0MA 4L4VD 3BXNB 5D7SH 5KG9A 5DEGB 3UZVB 3T3ME 1GZQA 1IC4L 1I9JH 1BQHG 4RAUA 5D1XB 3PQYD 4JM2F 1JTPA 3E6HB 2A6IA 3L3HB 4LLAA 3TNMA 1CL7I 1G7LB 3DVIA 43C9A 3G6AB 3T0BA 4I18B 3LN5B 4KI5E 2E6JA 4OQTL 2VERN 4J6RH 2YBRA 4R90L 4EKXA 1BAFL 1NMAH 2P45B 4X99B 1UM5L 4MAUL 3S7GA 1HXMA 1OWWA 2H1PH 4MJID 2R0LL 1WFTA 4Y19D 5K59E 4NQEB 3CH1B 1MCOH 1U8HA 2UWEE 5CMAB 1LEGA 2DDQL 3C8DA 3MLVH 1BREA 1JF6A 4NO0A 4XPFL 1PX3A 2LV4A 3O6ML 3QA3A 3WIHL 1T5XB 5IVOA 3RWDA 1DVFD 1I85C 5J7CC 1FYTA 3U4BL 4LSTL 1SYVB 4ZO9A 1KIQB 2MMXA 3C08H 1L0QA 1U8KA 2ZUSA 2CO6B 1D5MB 4YFLI 5C8JA 5IBTH 5TQ0H 4FABH 4R8WL 5IW1B 1H3PL 2ZUXA 4ALAL 2Q8BH 4LP5A 5HHQA 3G5XA 4LLQB 3GMRB 3LKPB 3CCHB 1UWGL 1HDMA 1EA9C 4FQXA 1LEKA 4EXPX 2JF1A 1B90A 4WI2A 5CS7A 2BDNL 4G6KL 5DC0A 2FIKB 3WKML 4X6CB 4Z7QF 1YPZF 3UJIL 3VXRD 1CF8H 3DO7B 4M5YH 2FEEL 3Q1SH 1DQQA 5KSVA 3AC0A 5I19L 3D3VA 3FT2A 4AIXA 2BNQD 2H32B 4FQHA 2HTLD 3LHPH 4U1MB 3RFZC 4JANA 5I1LA 3HI5L 3OR7B 3BPOB 1EXUB 4WGWB 1IC5H 2AQ3A 4TRPL 3LV3B 3WNOA 2I9LB 5EN2B 1YECL 1NCCL 1MRFH 3JWDC 4OI9A 4UU9B 4PJ5E 4M48H 3JBG7 1F4XH 5D7KE 5FA3B 3UTQB 2IFFH 5FM8A 2XN9D 2YD9A 2UY6A 3EOTH 4FQCL 4OLVL 4UT6L 3O11B 2OCFD 5GS2D 4MA7H 4NZRL 1C16A 3EAKA 3BH9B 1XT5A 5ITFB 1JZ6A 8FABA 2G75A 4NDMA 4XMPH 5AAWA 3U4EA 5F21B 4HK3N 4GAYB 4R9HA 1HH9B 3SGJC 1L6XA 5CEYB 4LKCA 5J4MA 4LASL 3HE6B 4JY4A 5DK2A 1U58A 5D2NB 3VMPA 3L3JA 4HIJB 1NPUA 3M1BB 3MLUH 4JFED 4OGXH 5L2JA 3SO3C 4MXQC 5L2KA 4FOMA 5DJ6B 1R3IH 2DQFB 3L5JA 3FAXA 3RWFA 1FGVL 4EQ3A 2Q7YB 1ZEAL 5DJZA 1Y0LA 3GNMH 3QUZC 3B5HA 4ZNEA 1NCNA 1RJZA 5AYUL 4HS8H 4YEEA 4NYLB 1Z5LA 3UX9B 4WI3A 1FORL 1M71B 5GZOC 3VXSB 3QEUA 3VI3E 2WUCH 3P4OA 5GGSA 4RGOL 4DKFL 2CUMA 5D7IE 4WNQA 3MJ9A 3MLXH 2EYSA 3SE3A 3BIKA 3DI3B 4WIQA 4BYHA 2WMPA 1U8IA 3OR6A 3EO0B 3VDBA 4BSWB 3BAEH 5FKAA 4HKXB 4PY8J 1N4XL 2WINB 4K9EC 1A7OL 4NN7B 5JUEL 3UYPA 5GGRA 2FGWH 5DD6A 4J2XA 4HJJH 4Y16C 4KJWC 5FYKH 3IAPA 5C09D 4D94A 3UTPD 4P5MA 5C2BH 3DX9B 3VWJB 3TZVA 2X5PA 4JREB 4YFDB 3ARTA 4GLRH 2BVQB 1F58L 5IK3A 1DUZB 4PREA 1A7PH 5D72L 4FP8L 4PRHD 4JFYA 2NTFB 4O51A 3TA3A 1RUQH 1MQKH 4MD0A 3RZCC 2ATKB 1RK0A 2LVCA 4FZ8L 5IB5B 4NKDA 4URTB 1N7ML 3TBVA 1BFVL 3MRGB 4GKNA 2HVJA 4XRCB 1IGJB 3I6GA 1YEHL 2CKBH 4LCIL 2E7BA 3P73A 2DQTH 3WFEL 3VFTA 3QWOB 1UWXK 1YEEL 1J05A 2XYCA 1VDGA 2IANB 2XTJB 3CZFA 3IU3B 3MA7B 1I8IA 2Z31C 4KQ3L 5GRYA 2R2EB 3OAUL 3TJEH 1CD9B 1FJ1A 1UWXH 3O0RH 4WHYH 1T3FA 4P3WA 4JM2C 1SEQH 5LWYH 4U7SA 5TGBB 5JHLH 4X6CF 2MOVA 4MXQD 4PJXB 4QRRB 3RY4A 1BF8A 4U4BA 2DI8A 4R0LC 3AMKA 4NNXB 2HG5B 3CX2A 2VQ1A 3QUZD 5IHLB 2BOBB 5FCUH 3QH3A 1HHHA 1PKQA 2A0LC 2OI9B 3KPPB 3VGDA 4JDTH 5LJYH 4WV1B 5JORA 1FFNB 5D96B 2ZCHH 4ZTPH 4QTIL 5CIPB 2J8OA 1OT2A 3FO2B 3I3BA 5D93C 4C4KO 3HE7A 5DWUL 4HUUB 3QAZC 2FH8A 1Z6JT 4KK8D 4HX1A 2Z0BA 4LLMB 3G6DL 4LEXH 1CFQA 4QTHA 4O02H 2FLBT 3K8KA 4OFPA 5KVDL 4HJ0D 3U0WL 2P8PB 1KGCE 3IFNH 12E8H 1WZKA 2OR9H 1G9EA 1P2CA 4CBPA 4U1IA 2CIKA 3M8OL 5HSFA 1A6ZB 3K3QA 3R8BB 3RZCD 3K81A 1ZA6B 3B2VH 5DVKA 2KKQA 2R0KL 4U2YA 4APQB 1WBYA 2P5WE 4OGYH 2CIIB 4JG1H 5IV2B 1T1YA 1AXIB 4P2QA 4Z7WE 3NOIA 1TCRB 1ADQA 1T6WA 5D70L 2AK1L 3U30B 3AM8C 1IBGH 2APBA 1S7UA 3QISA 2FATL 4P2RB 2AJYH 4JM2D 4YHMH 2DTMH 3I84A 2HRPH 2DRUA 3C87A 4XPAL 5IEKB 4RZCA 1U3HA 5GGVY 3TCXA 2EC9T 2YKLL 3H2WA 4Z7UB 4NRZA 3RI5F 4Q2ZB 2VN7A 4OKVA 5F9WB 2APFA 3LRGA 4GW4A 4V1DD 5CD3B 4BSVB 3I3DA 2A0LD 2NW3A 1P7QA 1SJEB 1WISA 1AQDA 4Y1AE 2N7BA 3VU2A 2BY1A 3VGBA 5MENE 3RI5K 2AJSL 2E5EA 5L8LB 3DRQB 1DQDH 5F3HA 2ZP0T 3X11B 2DLHA 1JRHL 4PLNC 1OTTC 1NSNH 2DQCH 5BO1L 1CLOH 4U6YA 2IH3A 3WFDL 5A2KH 5HGAA 1EZVX 3DGGB 3MRLA 4U49A 2FJHB 4ODVL 3GEWB 3FQUA 3SE4C 4ZFFB 3UZQA 4JPIA 3O8XA 2HVKB 5FYJD 1TETL 1A4JB 2PUQT 3TN0B 4TUKL 3O3DA 4I18C 4PJXF 3KPSA 1MH5A 4X6EB 1FDLH 4PJ7B 5AZ2H 1VKXB 4LSQL 4OV5A 5TDOB 5IW6A 2Y25A 4JVUA 2IBZY 1YY8B 1ZHKB 4ZOAA 4DFIA 4X5XA 5ACZB 3UTZA 3X3FL 3I2CH 4QXTB 2HN7A 4WUUE 3REVB 5E2UL 4AIOA 5DQ9B 2YUVA 3IFOB 2LE9A 3QWRA 5F7UA 5E56A 5FB8A 3P4NA 3T0XA 5T3XD 1HSBA 1FFRA 4NOFA 4KTDH 4YXLH 2IBGA 3CFBB 5JW4Q 1WBZB 2ZPKH 1ZSDA 3QEQD 4DUXA 3ULSA 4F58H 3LSOA 5C0ND 4UNUA 1BM3H 3MOQA 3I75B 5EPMA 5ANMB 5E5UB 3V5KB 1T22A 4WY7L 3MCKB 4YHPA 3BISA 3WS3B 1Q9KB 5EC1A 2CRYA 3QDAA 4MA1B 4ORGA 5IR1B 2BVPB 3NCBB 1FRGH 2OR8A 3G04B 3QHZH 4HIIA 1UEMA 4DWHA 4YXKL 2AK4D 2ADFH 4OM1H 3V6ZB 2XWTB 4F9LA 4YHOH 2VLLB 5H8DA 2C3WA 1AGBB 4ZUUB 3TWCH 2W9DH 5IROA 4MMXC 3BPOC 2ZUQB 1IGIH 1OTTD 1OSPH 4QRUA 4GLRI 1JHLL 3PP4L 2F58L 2Z92B 3BN3B 1GJIA 1HWHB 2YD2A 5E1AA 3BYYA 1RJYA 4R7DA 4JPVH 2R23A 3DOSA 1RZ7L 3SE9H 1UM4L 5D1XD 3SY0B 1RUPL 3UBXI 1IJ9A 1ZTXL 2WUBH 1YNKH 1U3YA 1DBJL 2A77H 5J1AA 2NY7L 4KVCL 4GUPA 5FA4B 2E7MA 4HXAH 3DYPA 5KOMC 5AWNL 5IFAL 4J3VA 4Z7UF 3T1WA 4K94H 3ZT7A 4HUXA 4MB4A 3HE6C 4E41E 1DEEA 1UH4A 4HHAA 2FD6L 2V5YA 4Z77A 4KJYB 3EOAA 3NZ8B 2VYRE 1KTDB 1CFBA 2ZUTA 3OV6A 2JCCB 5E8DL 5L88L 3F12B 5FM5M 5EA0L 1OARL 3KPTA 5MEQA 1OAZH 3QNXA 1A3LL 4NBXB 1JZ8A 1JGVL 3BWAA 2EKSA 4IRSB 4ZAKA 4G6JH 5EOQH 2AP2A 3GRWA 2F74B 1KNOA 3BKML 4WCYH 5ESVA 5KVEL 1VFMA 4OUUA 1S8DB 5E00A 1A14H 5IBLC 1KTRL 4HXBL 3WE6B 2CJUH 4DK3A 1C5DA 2VDNL 3FO1A 3QI9A 2IPUG 4M61B 5I1JH 4QRTB 1KULA 4HMCA 4DGYH 4HD9A 4KDWA 4POUB 1VFAB 4JFDD 1BD2B 3R0MA 3VJ6B 3DUHA 5C0IA 3N06B 4X4YA 4MZ3A 3IU4L 4NN7C 3MO1B 4PJ7F 5DRXB 4EVNB 5HXMA 1Z9LA 4LLUB 3VWJC 4JREC 1DDHA 5T5NF 5KSBE 1LP9A 4GKZB 3EIFA 3ILQC 3WCYA 4O58L 1RJLB 1JJUA 5CUSH 4RWHA 5CAYB 1IFHL 4BH7B 4RISL 3S3JA 1TVHA 3BUYA 2C5DC 4TUJA 1NDMB 1KXVC 1L0YA 3CDGA 4RRPA 3QDMA 4UV7L 3VXUE 3TV3H 3CH8A 4NP4H 1EZVY 1U8OB 1ZV5A 1H8NA 5BMFL 2V7NB 5CJXA 1SYSA 5T5FL 4R2GB 5I71B 3QDJA 3HMWH 3IFLL 4KZEL 3GHEL 2F5AL 3UJJL 1RURH 2WIIA 1QBAA 3L7EB 4YZFE 1O7VA 3HE6D 3U0PA 4OAWA 3VFUB 4OBRA 2ZG1A 4KMQA 2XKNB 2VXUH 4IRJA 4EOWL 1U2HA 3H3PL 4NHUB 5EIQA 2VXVH 1FLTX 3RHWF 1J12A 3OKNA 3GMMA 4JO1L 4PJBE 5D1QD 4F33A 3LKRB 1G7MB 4MCYB 4KRMB 5E2TH 5DVNA 2B7DT 4CDGC 4MYWB 1BQUA 4XAKD 2OI9C 1LEIA 1T66D 4PJHA 2BCKA 2I27N 4XNMA 3B2UC 3VXSD 3HZVA 5F8QC 4WV1C 3H7BA 5D96C 4WW2B 5IBLD 1BGXH 3MBEB 2Z4QA 5C07A 5MERB 2X2YA 1RZKH 1T1WB 1FZOA 4UNTA 3PDDA 3LZFH 5EU6A 4NJ9H 4C54A 3C60A 1VA9A 4P3CH 5JLZA 5TQ2L 5ERWB 3RWCA 4OCRH 5EUOA 4LLDA 2D31B 2VQUA 1F2XK 1VERA 3T3MF 1WCBA 5KVMC 2ZSVA 3VWJD 1FNFA 4OQ1A 1FGNL 3WXVH 4LVNB 1FN4A 4G6AC 1KYOK 1A4KA 4KI5F 4Q74A 2W91A 5IG7B 3TH3T 1BOGB 1AHWB 2OSLA 4FXGB 2HRLA 5DS8A 5JR1H 3U4AA 3LPGA 3GIVB 1FYTE 1ADQL 5DTFB 2JCCF 4NFCA 2J12B 2VWEC 1ZLWH 2WP3O 3QNZA 2X40A 4N0RA 2AKRA 5F7MC 4APQC 1FVDA 1CDHA 5IMLA 1E6JL 1FIGL 5BXFA 1EEYB 3QQ3A 1X3DA 4HCRH 5F97E 2Y6SD 1X5KA 5TJWK 4AEEA 5K33A 3ISWA 1KJMB 4HDIB 3DV4A 1BZ9B 1W0YT 1IQWH 1QA9A 3WMSA 1XR9A 4NKQB 1CDCA 1UACL 2PYED 4K94C 2IAND 2XTJD 2Y7QA 3PL6A 2V6HA 4JE4B 5DUML 5F89A 4JZJB 2ZOKB 3TNNA 3QIUA 3KPOB 4X5WB 3U30C 3O6KL 2ADGB 1AP2A 4GAGL 1JCKA 3BRDA 3ZMRA 4WFGE 1NAMA 3D3VE 25C8L 1AKJA 4CU7A 4M7JL 3ZKMD 4X8JB 1FHGA 2CDFA 3BI9X 3MLTB 4LKXB 4QRRD 1KCVH 1A7RH 3JV5A 4P23D 5A16A 4PYGA 1NCAH 5J9PA 2AXFB 5CJ8A 1AXTH 2Z93B 3BQUA 2VDLH 4P3DB 1CXKA 5F9WC 3ROLA 1PLGL 3U1SH 2XNAA 2HJLA 4OLYH 5EOTA 4JDVB 4XVJL 4KMTL 3ZDXF 2M2DA 3X3GL 3FB6A 1CR9L 2GJ6A 4XAWL 1N6QH 2JB6A 3WFBH 4N1CA 3B3IB 5EORH 3CFDA 3RWIB 3GO1L 2DQUL 5I9QB 5HHXH 4IRZL 3OKOB 3EO9H 2C1PA 4NQVA 3IXTA 1VADB 2FZ3B 2GT9A 1BZ7A 4A2MA 3IKCB 3O2VL 4TVPD 3I9GH 4X6FA 3RWHA 5C0EB 4FFYL 4P59H 2FSEB 4L29A 3R06B 2VXTH 4LOUD 3S4SB 1QEWB 1NGPL 3HCVB 3GSUA 1RIVH 5F9JB 3O9WB 5L2KE 2ATPA 4G6AD 3RVXC 5BZDB 5JZ7C 2GIYA 5I1IL 1IEHA 4NZDA 2EIDA 2YHGA 5HYIA 3TN0C 4ZNEE 4DEPB 1JI2A 3CLEH 4NO3A 1EJ6A 4H25B 3H3KA 4APQD 3CMOL 4FQ1H 1MAMH 4LAQL 4LNRB 4EI6A 2G5BA 3D25A 4G80A 3HI6L 1FQ9C 3OB0K 3PGFL 2LVEA 4TN9A 4N90D 2J4WH 2IG2L 1JWSB 4XMLL 5F1SA 3BKYL 3TBSB 4XVTH 1PSKL 1UCTA 3IETB 3QIBA 5DC9B 2JLLA 4LQFL 1G7PA 4NNPH 3OB0H 3BKJH 3D87B 4WW2F 5FGBA 1BBDL 1EJOL 1AXSA 4M8QA 2KL6A 2XWJB 2VNCA 3QUYB 2ZUWA 3EFFA 4HG4J 5DSCB 4HWEL 2X4NB 3MCLL 4Z7WB 4HK0A 4H1LG 1KIPA 4YR6A 3VI3F 5GZNC 2YD8A 3PP3K 2XQBH 5KAQF 3MLRL 4MA8H 5FCSH 4EUPG 4UQ2A 4S2SB 2NW2B 4X9FA 5ALCH 3HG1A 4PTTA 4D9LH 5H35A 2P44B 1KJ2L 3ILPB 4MA1C 1OGAA 1OCWL 2A73A 3P9LA 1G7IB 3RJQB 2ICEA 4MLSA 4U1NA 3PP3H 3L7FB 3FMGL 4I3RL 3KNBB 1MF2H 4AM0B 5ILTH 2EO9A 4ZFZA 3FKUS 5TPWH 1C12A 2FL5B 2PTTB 1RZKC 4Q9QH 4HV8B 4U3XA 3PWPA 3WNLA 3G5YB 4Y1AB 5JW3L 2HT3C 4MSWB 2HH0H 1EH9A 4KGJA 5HYQB 1D6VH 3CFCH 2ZUQC 3LN4B 43CAA 5DJ8A 4F57H 5MENB 1I1YA 1KLGB 4HUVB 4X7SL 2OS7A 5BJTA 1UB5B 4WEUD 3BVNB 1JFQL 5C70A 2VDQH 4GKSA 4JFHE 2GY7B 1RI8A 1VEPA 3SCMD 5JHDD 1S5IH 2IMNA 1DEDA 2DM3A 3BHBB 4DN4L 4DN3L 5K9QG 3NCJH 1NGQH 3FN0L 3BO8A 4BFIA 4F7CB 1UVQB 4HKBA 3NCCB 4QOKB 5IW3A 3TN0D 2X4SA 4LRIA 1PKQE 1V3LA 2GSIB 1PQZA 2HLAB 4JLRA 4RQQB 3RWJB 3ZSSA 3VW3L 1DL7H 4BZ2H 1YEFL 4Y5VA 4Y4FA 3E8UH 3GK8H 2QQLL 4U6XB 3V5DA 4HWZB 5FUZL 3Q6GL 1GGCH 4PRPA 5JXAH 2CXGA 4G6FB 4KI5C 4NPYA 4ODWA 2WBJD 3IFPB 2RR3A 2DQGH 1BJ1J 2DLEA 2AEQL 3U36A 1S7TB 3MRDA 3MUGB 5BZWB 1R3HA 4WUUB 1CXHA 2DKSA 3IDYB 3T1FA 1TVDA 2MCPL 5F9AC 3GMNB 2NR6C 2XWBB 1Q38A 4NC1E 4CMMA 1UXSB 3CVIL 1T4KA 5GZND 1KIUA 4ZQKB 3LEXA 2EDNA 4IRSC 2GJJA 4GAJH 4HIHB 3BD3A 3QXAA 3HZMB 4I5BB 4OZ4A 1OL0A 4A6YA 4MB5A 4CADB 1D5BB 3QZWB 2QHLA 1DBMH 2H6PB 3RL1A 1Y18B 2EDJA 1WITA 2BNRB 5EC2A 5E5RB 3DIFA 4JFOA 1IMHC 1Z0NA 4DVBB 4QLRA 5F1IB 4XNXH 3MFFB 3FQRB 1RUMH 2ITCB 5HDQL 4ZFGL 3KPLA 4P2QE 5LGKA 5IESH 2F8OA 2WV3A 4MNHB 4YHKH 2GY5A 5GS3A 1YEDB 4L5FL 2W07A 4J4PA 5DEFA 1DN0B 2GQHA 1GGIL 4ONFL 4B7IA 1IC4H 1P69B 3NFNA 5CSGA 3RIFF 2PKDA 5KS9A 1B0GA 5C08A 3DX8B 1UZ8A 2FHBA 3VD5A 3FAWA 5FV2A 2GJZA 3SKMB 5CEZL 4RWYL 4Z7WF 4JKKA 4OQTH 4Y2OA 1I1FA 4R90H 1BAFH 2MCG1 3L3DB 4H88H 1ZWIB 1RFDH 1UM5H 4K3DH 3P77B 4R2GC 5I71C 3D69B 3KLAA 2BSRA 2JELL 2DWDA 4QYOA 2SEBA 2UVEA 3CPLB 1U8JB 4K23L 3C6SA 3C9NA 2NY4B 3TH2T 2COQA 4KZDL 2DDQH 3GJFB 3GSXB 4KI5D 5CLWA 1IC7L 3IJSA 4XPFH 2FWOB 2VDPL 5C2UB 4E42A 1G9ML 1H8OA 3RTQD 3WIHH 5JW5B 4KY1H 4M43L 4LL9A 4E41B 4YNYA 3U4BH 4AK1A 4DUVA 4LSTH 4GBXA 4GW5B 3ULUE 1TCMA 2NR6D 1S7XB 4X8XA 3NCEB 1H0DB 1SMOA 4R8WH 4NJAL 5DI8A 5CJOL 2X1WL 1I1RA 4XBGA 1UWGH 4R4FH 3IRPX 1CICB 4WW2C 2BDNH 4G6KH 3IGAA 5CWSB 2Q86A 3WKMH 1I3RA 3FT4A 3HNVH 3KPSE 3MBEC 1YMHB 4LFHG 3T2QA 2H8PB 3OJ2C 4OCWL 5I19H 3U7YH 4XPBL 3HI5H 1N26A 4KAQH 2QEJA 4MAYB 4TRPH 4XGZA 1S3KH 1NCCH 4OLWL 1A6UL 4WENB 1A6TA 1X6LA 1XMWA 4LVNC 4X7TB 2XY2A 4X98A 3MJ7A 2Y5TA 5HGBA 4OLVH 4UT6H 5KSAD 1AHWC 2IALA 4Q6IB 4NCC1 4GQPH 4OD3L 4HEPG 4EBQL 4WWKA 1D5ZB 3TIEB 3MODH 4MCZB 4OF5A 4GG6A 3QHTC 2WBWB 5IEHA 4PJ5D 1TNMA 3TVMB 5D7KD 3KG5A 3K80A 2DI7A 1MCQA 4FQJL 4KKBC 2XQYK 5EO9A 3RUGB 1U8PA 4LASH 3RNKB 4R2GD 1MCDA 3WKNA 4PJ8A 2JKXA 2JJTA 5HGDA 1CK0L 4NO2A 5F7DB 3VXUB 4JZJC 1KJ3L 1AGCB 2YD3A 2P43B 1FGVH 5TH2B 5IB1B 1KT2A 1ZEAH 4LGRB 5FM4A 1QLRA 3VFVA 1JPGB 2R0ZH 1FFOB 4HULB 3ROOA 4MD5A 3SGEH 3K7UA 4UDTB 4LHJB 1FORH 4KJQD 1FL3A 3GI9H 1NC4B 5HHNA 3VMNA 4RGOH 3DYOA 3C5ZA 4DKFH 5IB4B 5EBWB 1BVZA 3VXPB 3U9PL 3KYMB 3OHXA 2QSTA 3JV0A 3PDGA 4F7MB 4NWTL 4PV8B 3QJHB 3MBED 2Y23A 4BZ1L 1DUYA 5JUEH 4KTEH 1B3JA 1GZQB 5I9QC 2QTEA 5C7XL 4RAUB 1WT5C 3TNMB 2A6IB 4ZS7H 43C9B 2VSDA 5FO7A 4RGNB 1TNNA 2F15A 1S7RA 2FCBA 5D72H 4W4NA 3VFOB 2D7TL 1AD0A 2YBRB 4IMLA 1OT1A 1TZHA 3BDXA 1P1ZA 2I60L 3IVKA 3O9WC 1AGEA 1K8IA 4FZ8H 1HXMB 5HHOA 3CLFL 1BFVH 2VUYA 2RBLA 3ARZA 3P9MB 2ENYA 1YEHH 4JKWA 3RVVC 2IGFL 4DEPC 3BMVA 4LCIH 1NUDA 4Y89A 3LD8C 3L6FA 7FABH 4NO0B 1MCPL 1UCBL 4ZOBA 1YEEH 3QA3B 4HT1H 2P48B 2V5SA 5L7XL 2MHAA 5E1HB 1NH6A 1FYTB 2HYMA 3ZTJG 3VRLE 3MGOB 3ORJA 4KKBD 2A1WL 2O5XH 4KQ3H 2OXHA 1GAFL 2EDTA 5C8JB 4GXVL 4C56A 4JKMA 1DTUA 5JNYB 4M62L 4KJPC 3G5XB 2KBGA 5HDLA 2VO5A 1T0PB 4LCWB 4YXHL 4NUJB 4FQXB 1LEKB 4N0YH 4YDVA 1A64A 4M7LL 1G0DA 5D8JL 2HT4D 3MLPA 3QXDA 5ID1B 1LP9E 1X5JA 1XEDA 2DQDL 4ISVA 5MP6H 3WUZA 5KSVB 1DQQB 3DGCR 5GRUL 2X4QA 3D3VB 3FT2B 1TTGA 4Y16A 4JANB 5I1LB 3DLQR 5MHSE 1RU9L 4QTIH 3QDME 1OF2A 4Z7NE 4QHNA 2NNAB 4O4YL 5DWUH 5FIEA 1I8MA 2WANA 3RQ3A 1O7SA 3P4MA 4U33A 3N50A 1G6RA 2E7HA 1MFEL 3QDJE 4DKEL 4JN2A 1IGCL 1C16B 3OG6B 3VDCA 5SX5K 1D9KA 5KVDH 3U0WH 1KPRA 8FABB 2G75B 2WWKO 4OLXL 3VH8G 3RUGF 1VACA 5CEZE 3U4EB 3PWNA 4M6NL 2R2HB 5SX5H 4FQLL 4LKCB 3ARPA 2Z31A 4WTZG 3O9WD 4XT1C 4JY4B 5DK2B 1U58B 4YBLB 3RAJL 5HHPB 2YD5A 2XV6B 2F5BL 3L3JB 2R0KH 2CSPA 4I0KA 4F7TA 2NXYB 5L2JB 1KGCD 1MWAL 2G60L 4YZFF 5L2KB 4PJHE 3RWFB 4O2CA 4XVUC 3LEYL 4GT7A 2YRLA 5DJZB 3OZ9H 1Y0LB 3K4DA 5DHVA 3NIGE 5SWZA 5B8CA 1PG7X 5HGHA 3QO0A 1UH3A 2RIKA 1RJZB 5C07E 2AK1H 2W9EH 1EAJA 4BQ6A 4JHAL 3QEUB 2P5WD 4QHUA 2WSKA 1C5CL 4PJBF 5EU6E 4A6YL 1FYHB 3P4OB 3MV8A 5GGSB 4OI8A 2FATH 4KJPD 4R97B 3IDYC 4GRWE 5EUOE 3VXQA 5DVOA 1CDGA 1U8IB 3QUYD 4XPAH 3T4AA 3OR6B 3GJEA 3HRPA 1JZ7A 2YUXA 5FKAB 2VQTA 3S96A 1MCLA 4JEGB 2AV1A 4N8VB 4QHKJ 4TNWK 1B6UA 5GGRB 5DD6B 3DSFL 5C0AA 5BQ7B 4PFEA 4P5MB 3QFJA 3TZVB 3EKCA 1Z9OA 5ACLA 5DMYA 5IK3B 4PREB 3K4ZA 5L8KB 2MQCA 4JFYB 2AJSH 4HLJA 3MYZA 3F7QA 4N5ED 4O51B 1RUKL 4LPUA 3TA3B 4MD0B 1ACZA 1RK0B 1A3RL 5FFLA 1JRHH 4NKDB 5L9DL 4HUWA 3BEWA 3FRPA 4GKNB 4R4NC 2HVJB 5BO1H 1U6AL 2XXCB 3ARFD 3BKCH 3I6GB 5K9JL 3I85A 3WFDH 1U95A 2R1WA 4Y1AD 1ZHLA 5JPMA 3P73B 4PRAA 5EH1A 1MCCA 2VLRB 1V8HA 5MEND 3VFTB 3AGVA 1J05B 2FBJL 3OAYH 1JF1A 1I7ZA 3LIZL 2PXYA 3CZFB 1I8IB 3U46B 4I2XA 2R4RL 4TUKH 1KCRL 1FJ1B 3GMLA 3BP7B 3GSOA 4GAFB 1YEJL 3HUJA 5I8CB 1T3FB 4OV6F 4LSQH 2AS5M 3QFDA 4MLIA 3X3FH 4LIQL 3LKOA 3K46A 2M1KA 4P9HH 2GJ6E 2ZG3A 4G7VL 4H8WH 2VQ1B 5GJTL 3TF7C 1OY3B 2NY4C 4OFYD 5GRVL 1GL4B 1HHHB 1PKQB 2XA8H 1PYWB 4G6FD 1RZJL 4TOYL 4FTVB 3CD4A 4KTYA 5JORB 4OF6A 4WUUD 5C0CA 5I1EH 2XACC 4XZUA 3AS0A 3A6BH 4MZ2A 2BJML 3HE7B 4WY7H 1I3GH 3SGEI 4MXWL 3DSNA 2E9IA 4L3CA 4ACPA 2R69L 1WK0A 4HX1B 4IJ3C 5C0JA 1CFQB 2HA1A 4QTHB 1QRNA 2X6MA 2A6DB 1FNHA 1HI6A 2FX8H 3G6JA 4M1DL 5IOPB 1CICC 1RK1A 5DQDL 4JO2L 1P2CB 2ADJA 1I75A 3N1QC 2EEBA 4U1IB 5EU4A 2CIKB 3MV7A 1SBSL 3BXNA 4XPHH 3DWTA 5F1KC 2K9UA 1IVLA 1JF5A 3TM6A 5A3ID 3VD3A 2VC2L 4Z0BL 4TUOA 1Y6NR 4I18A 5D7JA 4R4ND 3UBXA 2CKBA 2DBJA 1WBYB 4MAYC 4P5KA 5DMGC 2ORBH 3PP4H 2BVEA 1I7UA 2F58H 1JPSH 1HYSC 1T1YB 4YDKH 1P9MA 2DICA 4P2QB 1T03L 3EBAA 4JM4L 1QSEA 4NQEA 4Q6IC 3CH1A 1C08A 1HSAB 4KKCD 1RZ7H 1UM4H 4JQIL 1RUPH 3O45A 4ZODA 1MELA 1ZTXH 1CI5A 5F7LB 1DBJH 5A2LH 2I5YH 3HG1E 2NY7H 3CNKA 4ZXBA 4KVCH 1OGAE 1KEML 4DOHE 5AWNH 3TVMC 5IFAH 1CG9A 4Q9CA 2IPUK 1TJHL 2PYFB 2VXSH 4RZCB 1U3HB 2FD6H 3THML 4NRZB 1IL1A 5IW1A 4OKVB 4GW4B 4LLQA 4YK4B 5L88H 2NW3B 1P7QB 3CCHA 3RGHA 4QF1A 3PWPE 1FC1A 1S9YA 5E6IB 1AQDB 3WSQL 4IHOA 5EA0H 1OARH 3MV11 3JWDL 1A3LH 4X6CA 1JGVH 1UA6L 4E41D 3DO7A 1HHGB 5HYJB 5F3HB 3O3BA 3ARGD 3UC0H 5KVEH 4EIZC 5F8RC 5CILL 2R0WL 3EJYD 3NZHL 2EIZA 5IFHL 1EXUA 4HXBH 4U6YB 2IH3B 2K7QA 5D5MA 5HGAB 2VDNH 1B2WL 4ZPVB 3MRLB 2LAGB 2FX7L 4UU9A 3NTCL 1CICD 3LQMA 2IFGA 1JI1A 1MEXH 1KIRB 3MLZL 1OVZA 2RQ8A 1UC6A 2OK0L 4JPIB 1IAKA 3O8XB 4ODUA 4TQEL 2HJKA 5B3JE 3IAQA 4NBZB 5GSVA 3UTOA 1QLFA 4PRPE 1BFSA 5ITFA 3O3DB 3OXSA 1MH5B 4MWFB 4RGNC 2YMXL 3BGMA 1IGML 4MAYD 4OV5B 5DMGD 5IW6B 3QDGA 4GG8A 1HH9A 2JJSA 3UTZB 4RISH 2HN7B 2GCYB 4MHHG 4WUKL 5JMOC 1HYSD 4JDZA 1U42A 4HFUL 1MVFA 2ZCLL 4PLKC 4UV7H 5FB8B 3P4NB 1HSBB 1K85A 4ZUVA 1F13A 2P8LA 5E5MA 3PWJB 2O26U 2VDMH 3OKMA 1KPVA 5T5FH 1V3MA 1ZSDB 2NY1B 3ULSB 1YDPA 3GHEH 3TVMD 2DQJL 1C1EL 2F5AH 3LSOB 4HQQL 4EUPB 5ADPH 5CGYC 1A1NA 1T22B 5C6TL 4YHPB 2BRRL 4XP9L 1PFCA 5EC1B 1KFAL 3VXUD 4ORGB 3RGVA 4AEHH 3L3IA 4EOWH 3H3PH 4N0UA 1N59B 3TYGL 5DJDA 5E99H 4JO1H 4Y5YA 2N1KA 2R4SL 4HIIB 3H7LA 4IOFC 1N64H 1YZZA 1UM6L 1FNLA 1YA5A 5D7SL 5KTEL 3VWKB 4L4TA 1G6RL 1WCQA 1I9JL 1KJ2B 2GITA 5KS9E 4F80A 5C08E 2DYPA 2BVQA 1QNZH 4QRUB 2VR5A 4RMUA 1I8LC 4L8BA 4RMSA 5C0FB 1M1SA 5HTSA 3PUCA 4XNYH 5DJ2A 5E1AB 4I0PA 1GH7A 3T0EB 2F8XC 1JPST 1JRHI 1QBLL 5TQ2H 1IGJA 4HEME 4NWUH 1X5HA 3ARDA 2R23B 1EHXA 1WC7A 5J1AB 3OX8A 1P4LA 4GUPB 4HPOL 3GSRB 3GDBA 3LMJL 3MA7A 4LIQE 3W81A 5CGTA 1DEEB 1ADQH 4YBLC 1IAMA 4HJGB 1HHJA 5GGVL 5IBTL 4XB8A 1MCIA 3EOAB 1EHNA 1E6JH 1FIGH 1A5FL 3GM0A 4PLKD 5C1MB 2NXYC 2V7HA 3QRGL 3OKKA 4QRPA 5D6CA 5IUSA 2VDKL 3N0PB 2X09A 4NO0D 1B0RB 4HS6B 2FO4A 4QHMA 2RAMA 3BWAB 1UACH 5IWLC 4JKLA 3CSPA 3KLDA 1WFUA 1CF8L 1FYTD 2EKSB 4LQ1A 5DUMH 4QRSA 4ZAKB 2NQCA 2O5YL 4GJTB 5ESVB 3KPPA 2W0KA 3O6KH 5SWSA 1AH1A 3DO3A 4GAGH 4OUUB 1KG0A 5INDA 3ULUF 25C8H 4K3JL 2YC1B 1P84K 3K2MC 1UH2A 4M7JH 3QO1A 1C5DB 3SE3C 3ZKQD 3FO1B 2BXZA 3PE9A 4LSRL 4FQXD 3QNYB 5ECJE 3ZYJA 5J57B 5D1ZB 4M48L 1F4XL 3ES6A 3LKQA 3W9DA 3K1DA 2IFFL 4CL7A 4KHXL 2CLVA 5FDWB 4IOFD 3ZT6A 4X4YB 3CGTA 4FXKB 5HHMB 3H0TA 5TDPA 2BERA 1PLGH 4DJMA 4LHUG 35C8L 2P47B 2P5EA 2Y9RT 4WFGD 4OUOA 3D3VD 3ALXA 1J7VR 4XVJH 4KMTH 3M07A 4EXKA 4FQQA 3X3GH 1CR9H 5BVJB 5CJQL 1LP9B 4XAWH 4LSVH 3RZWA 4XMPL 1AC6A 1I1CA 3SPVA 3NIDE 4GG6E 3T0VA 2AJZA 4M8VA 3TA3C 5AUMA 5T3ZE 3GO1H 5ICYB 1TVHB 2DQUH 3BUYB 4IRZH 4TUJB 4HF5L 1HCVA 3O2VH 3QDMB 3OQ3B 3ARBC 1NGPH 3TLRA 1QVOA 1Z9SA 3L5WA 4AQ1B 1NMCB 5DC4B 4Q9RL 1AR2A 1ORQA 2L7JA 3DARA 4P46A 5I1IH 2O61A 4HAGA 2IMMA 2IWGA 5DD5L 2P49B 4QNPE 1FIEA 3RKDD 2WIIB 4HS8L 3SDYL 2WW8A 2VDOL 3MLWH 4BUHA 4OAWB 2WUCL 4F3FB 2ICCA 3CMOH 3U83A 4LAQH 1WZLA 3OKNB 2NXYD 1GHFL 1BIIA 3GMMB 3HI6H 4P2CG 4HWUA 4IOSD 1JUFB 5L2KD 1CD0A 5B38G 2IG2H 4EUPH 1MFAL 4XMLH 4DFHA 1BLNA 3NABH 3BAEL 1CGUA 4LSSL 4Z7UA 4LRNH 3WDIA 1PSKH 3BD5A 5HD8C 5M7QA 4LQFH 2YXFA 4BSVA 3HAEA 2BCKB 4XNMB 1SJEA 5I0ZA 3HZVB 3PV6A 3H7BB 4HC1A 1SVZA 2D03H 2DN7A 4HWEH 3MCLH 2FYYB 3I50L 1II4E 1KXTB 1Y6KR 4BK4A 4YPGA 2A9ML 2BNUA 2Z4QB 5KANI 5C07B 1BP3B 1NEZA 5J1TC 1RUQL 3TO2A 4LPWA 1FZOB 3MLRH 3JZ7A 4QKXB 5EU6B 2W59A 1JNHA 3C60B 1HHIA 1F2QA 4KUZL 1KJ2H 1OCWH 2DF3A 4R3SA 5HHOE 3RWCB 5JLZB 4GRWB 5EUOB 2CKBL 4LLDB 5C3TA 4UIMA 2YEZB 2WAHA 1WCBB 4HFWB 2DQTL 4IIQA 1QO3A 2ZSVB 3TZVD 2OXGA 4XCFH 3EJJX 1BJMA 2ED9A 3NPSC 4U05A 1FN4B 1A4KB 3NCMA 5DD3L 1H3XA 4Z78A 3TA3D 4JRXA 2OSLB 5DS8B 1QZ1A 5BV7L 1A4JA 2FRGP 1IRAY 3BPLB 4RNRA 1KN4H 5E08L 4AMKL 4OB5H 4ONHA 1FVDB 4NKMA 1VKXA 3JWNC 3QQ3B 4C56E 4X7SH 5ITBL 2Z8VC 1JFQH 1EHLH 3DV4B 4QXTA 5GRJL 4XI5C 4FMFA 1QA9B 3MRJA 4RBPK 1XR9B 1H9VA 2XTLA 1KEGH 1MJ7L 2M26A 2Z91A 2Y7QB 3PL6B 3FN0H 4OCLC 5DUPH 5FCUL 5F89B 4PGDA 4JB9L 3QIUB 1AP2B 4JDTL 4RBPH 3VRLF 3GUTA 1P7KA 4ZTPL 2DM4A 4JFHD 2FLRT 2CDFB 3DBXA 1YEFH 3TBWA 2QQLH 5ICXA 4ZOCA 5FUZH 3Q6GH 4PLJC 4LF3A 1HINL 1U3HC 4OFIA 5J9PB 3BQUB 2BVPA 4YK4C 1LP9F 5KVFL 1LO4L 2XNAB 2HJLB 5E6IC 1M05B 5EOTB 3G04A 2MCPH 4QY8A 3SOBH 3S88L 3NCYP 4UV4L 1HOCA 3QUMH 3V6ZA 3NFSL 2XWTA 5F7NC 4NQDA 1HWGB 2VLLA 4Z7NF 3HE7D 4NQVB 3CC5B 5TE4H 3IXTB 5HI5C 3P3YA 1R0AL 1JHKL 2BC4A 3RWHB 2VKXA 4L29B 3FZUD 1XF5A 1KB5L 2NY6B 3C2SA 2PNDA 5E2WH 4RFEB 1KF9B 2YK1H 3EDDA 4NOBA 5GRZA 3GSUB 2OTWA 1M6OA 2ATPB 5HDQH 1X5XA 3O8XC 4ZFGH 3NA4A 3U6RB 3PIQB 1A6AB 1K2DA 5SWZE 5HJ3A 2J7LA 1BZQK 3NIFE 2GKIA 5ID0B 4HCRA 4L5FH 2AJYL 4EI6B 2G5BB 3MV8E 3D25B 4G80B 1ZK9A 1GGIH 2HRPL 1VB9A 4G8EA 4RAVB 5FK9A 5HPOA 2E27L 3LH2H 2OJEA 4P2QD 1ZT7A 3T2OA 2XKUA 4KJYA 5DMJB 3QIBB 5DURB 5LVEA 1G7PB 5CEZH 4RWYH 4IDJL 3HFMH 3NIGF 4NCC2 5I30L 3V9FA 4GMSH 1AXSB 3F12A 4LPYA 4YBQD 3T2PA 5IHBA 4Y8DC 1W0WB 3EFFB 3PQYA 4HK0B 1KIPB 3QFJE 3WV0A 5J06A 4GXUM 4PJ9B 5DK3A 3O4LA 5INCA 4K23H 4M00A 4JPKH 4IRSA 1DQDL 3RU8H 3QCUL 1U3HD 4GRWF 4UQ2B 1UJ3B 4KPHH 5EUOF 4PTTB 1IC7H 2H41A 1S8DA 3BWUC 2MNUA 1OGAB 2A73B 3C5JA 2VDPH 4WU5A 2ICEB 1XGQA 5IFJA 2IPKA 1P7QD 1T7VA 4NFBA 2N4IA 4M43H 4QRTA 3C8KB 2PW2A 1F02I 3D48R 4ZFZB 3BP5A 4ODXA 4ENED 1VFAA 4I13B 1BD2A 3B9VA 5I15H 2EDLA 3VWKC 4OBSA 3RPKA 3MO1A 5DRXA 3PWPB 4RRPG 1JGLL 1UEYA 4NJAH 4AENB 5CJOH 2X9YA 4GRWH 5HI5D 4I2XE 3RBGA 5IROC 3GB7A 1LVEA 1P5UA 5DJ8B 1I1YB 3HUJE 2PCPA 1F6AA 5BJTB 3EGSB 5IHZA 4Z95L 2GI7A 4GKSB 3ULUD 3I2CL 4U6TA 3RX7A 3IB4A 3T0EC 1NDMA 3PHSA 3DXAB 4TNVF 4XPBH 1KTLA 1NCTA 3L1OH 5BVPH 3O8XD 3BO8B 4BFIB 3L9RA 4HKBB 1DQLH 2X4SB 4J12A 5JW4R 4U7MA 3ULVL 3KPSD 2W65A 1IZKA 2BMKB 1PQZB 3FB5A 3OTTA 3BZEB 5AYQA 4JLRB 1JYWA 1BBJA 2ZPKL 3HLAA 1OAUL 4Y5VB 3V5DB 4YDLC 4HAFA 5C0CE 1S78C 2OMBA 4PRPB 4OD3H 2MPAH 4EBQH 1MJ8L 3FRUA 4NPYB 4ODWB 4UINH 3BT2H 3QWRD 3MRDB 5JDSA 1MWAB 4PBWD 1R3HB 1PJ9A 5GQBA 1QRNE 3T1FB 5J89A 2VJXA 2W0FB 3QHZL 5DMKA 1MUJA 4FQJH 3G6JE 3MUJA 1HEZA 3RA7H 3W11D 1OQXA 4BFEA 4NM8L 4CMMB 3G08A 1T4KB 2NY1D 1CK0H 3LEXB 2V2TA 1KJ3H 4ZAKC 3MV7E 1SJXA 2J8HA 1XGPA 2QQKH 1T20A 4I48B 3QXAB 4PP2B 1QLEL 1INQA 4A6YB 1DLFL 2LU3A 1IGIL 4UT9L 3RL1B 1RZ8A 4P4RB 3DI2B 5EC2B 4ODSH 3DIFB 4JFOB 4BKLA 2H26B 5D1ZC 3BPNB 5H94A 3MTRA 1VGEH 5DRWB 1CBVH 4X0KA 5HDOA 5I75C 3KPLB 3KJ6H 4F9PA 1QSEE 3UPAA 4NQEE 3S5LA 4XP5H 3RVUD 2V9TA 4FG6C 1JNJA 2D4DA 5HI3D 5DEFB 4HXAL 3CFEB 4MJ2A 4CKVX 4PB0L 4NKIH 5K9QI 4M7KL 5ICZB 4BZ1H 1X44A 5TF1L 1AHWA 4XVSL 4M7ZC 1ZVYA 3NFNB 4OZGB 5C7XH 4S1RL 2ZUUA 5KS9B 3GIVA 1B0GB 5C08B 3ZYZA 1X5GA 3JTTA 1UZ8B 3QUXA 3EOYG 3TESA 1EEYA 4JY5H 2HJFA 2D7TH 1I1FB 2VISA 3ZTJH 4FFWC 1LDSA 4P2OA 1OAZL 1NMCC 2X1OA 4AEIL 5CJXC 2BX5A 3MOBL 3KLAB 2AEIT 2PO6A 2BSRB 2DWDB 4QYOB 2SEBB 3CLFH 4X6CE 1TQCB 3C6SB 4JZJA 2R29L 3C9NB 5EOQL 1S78D 1ZANH 3KPOA 5C92A 2BK8A 1F42A 1WEJH 3IJSB 1MCPH 1UCBH 4HGMA 4HC1L 4E42B 2CJUL 2Y06L 4M6MH 3FOLB 3T8XA 4X9HA 3UTSA 5L7XH 4WW1A 5D5ME 3B83A 4YNYB 4GBXB 4DGYL 2A1WH 1GAFH 3MV01 4X6DB 5D71H 1Q9WA 2AXFA 4GXVH 4BJLA 4P3DA 4U31A 1WLHA 4M62H 4ZAKD 1G9NL 5CINH 5DI8B 4CGTA 4XBGB 4YXHH 5EB9A 1AGDA 5L6YH 1GRWA 4M7LH 3IGAB 4Y2DC 2Q86B 1I3RB 3FT4B 5K9KA 4N1EA 3QI9D 4OGAC 1BQHA 2DQDH 3QDGE 4BM7A 1XF4B 4N5UA 1WT5A 3C60C 4OLEA 1VADA 1IT9L 4X7EC 2L7UA 3KPRB 4WJ5A 5CSZB 2FSEA 3RRQA 3FCTA 4NP4L 3PNWA 1A6TB 3D39B 4O4YH 4FG6D 4OTXL 5F9JA 1CDYA 3QP3A 1MFBL 3MJ7B 3ZHKA 4FQPA 3HMWL 2Y5TB 5HGBB 2VZUA 5IKCA 1MFEH 1RURL 2IALB 4DKEH 1IGCH 4Q9BA 5GRXG 3BPLC 5MHSD 4TTDC 4WWKB 2P7TA 3OPZL 3NAAL 2P8MA 3CVHH 2VXUL 3QDMD 4OQTA 3M45A 4GG6B 2W38A 2VXVL 4OF3A 2NY2C 5IEHB 4N0UE 1S7VA 4FQLH 5I8EA 5EO9B 1CCZA 2CO7B 3TBSA 3QQ4A 2XI9A 3T0WA 3QDJD 4PRIB 4PJ8B 4YWGL 5I8OL 5HGDB 3PL6C 4NO2B 2F5BH 4G9FA 1A9BA 2YZ1A 3QIUC 4XCNA 4L4TE 1MWAH 2G60H 3AUVA 5CEZD 4LCUA 5DSCA 4ZDHA 5JMRA 2X4NA 4IRJD 3WIHA 1KT2B 3LEYH 3V6OA 1BGXL 1MCKA 3VFVB 4U1LA 3PJSA 3ROOB 4MD5B 1YYML 4LVHC 4NJ9L 5F7WC 3TBTA 3EDKA 4JHAH 3UXFA 3BQUC 5HHNB 3ILPA 1C5CH 4A6YH 2YWYA 3T4YA 1G7IA 3C5ZB 3IS0X 4G3YL 2IAMA 1A6WH 4Y7MA 3H9ZA 1F5WA 3OHXB 3NGBB 4J1UA 5DJ0A 1B4JL 1T0NB 1NGXA 4OZGF 3WXVL 3BMWA 2XKSA 5KS9F 2PTTA 5C07D 1DUYB 1CDJA 1IAOB 4NGHL 1XAUA 5JR1L 4IMKA 3UPRA 1EEQA 5EU6D 5IHUL 3C60D 5HYQA 3FO0L 4O2FA 3LN4A 4M02A 5FO7B 2OJZL 4F15B 1S7RB 4HCRL 2XA3A 2NY6C 3FJTA 4P9MH 3ULVE 2D7MA 2PTUA 1RUKH 1TZHB 4QRPE 2XG4A 3ETBF 1P1ZB 3IVKB 4YFLF 1AGEB 1A3RH 1A7QL 1K8IB 1XFPA 3LRHA 2HAZA 5HHOB 2F54A 1PZ5B 1A22B 3ZE0E 1BVLB 1U6AH 4G5ZH 5B21A 1KENL 4OZHA 4HPYL 4IEFB 4QOKA 5C6WH 3P0VL 4OT1L 1W2KT 3L6FB 1MJUL 1TTFA 1DQJA 1WWCA 5SWSE 2DIAA 2FBJH 1Z3GH 1C8PA 4X6DF 2MHAB 3F7VA 3LIZH 2VR9A 3ARVA 2HTKC 4WDIB 3ET9F 1KCVL 4N0CC 1JHTA 2AJVL 2R4RH 1CWVA 1KCRH 5E0QA 1F11A 3QIBC 1YEJH 2DLGA 3PL6D 5FGBC 3QIUD 3ZDYF 4OLYL 2P5EE 1MFCH 1DLHA 4YDVB 4LAJH 5IGXL 1AKJD 1N6QL 4Z9KB 4PJ9C 3QXDB 4G7VH 3BX7C 1ED3A 2W92A 3J8F7 3MR9A 5GJTH 4M7LT 4Q0XL 5HBBA 1CGYA 1UJ3C 4I5BA 2UZXB 2OLDA 2X4QB 1RZJH 4CADA 3VXTA 1ZT4B 1S7QA 2I24N 3BQUD 3DROA 4ZPTA 1Y18A 1PY9A 1HYRC 2BNRA 4ZYKA 5C0RH 2GFBA 3IDJA 4NRYB 1OF2B 3RWGA 4QHNB 3B8YA 1J0JA 5EZLA 2GJ6D 4HH9A 5ESAA 2BJMH 3TIDA 4MXWH 3P4MB 1G6RB 1M7IA 2AXGA 1F3RB 3NIDF 1P4IL 4GG6F 3WLBA 5FGCE 4GRLD 3B5TA 1D9KB 4HGKC 1EEZB 4MNHA 3CLEL 1P6FA 3WNMA 2UZIH 5KVGH 1YEDA 1VACB 1NJ9B 1U2CA 4JO2H 4MX7A 2HWZL 4Z0XA 5JDJA 4P2RE 1SBSH 3PWNB 1G7QB 4NZJA 3WJJC 2OQJA 2FR4A 3KS0J 1OP5K 2J4WL 3WUWG 2VC2H 4Z0BH 4QRQA 1P4BL 5C6PB 2M8XA 4Z7UE 4NNPL 4F7TB 3LDBB 3WHXA 5D7LB 4QNPF 4N1HB 4O2CB 1PG7W 4MNQA 3PGDA 3KPQA 2ERJB 5DHVB 5SWZB 4Y5VC 5B8CB 4JM4H 5TE6L 3CSYA 5HGHB 3QO0B 3SKNA 3WNKA 2HTKD 3QULA 3VXOA 4QHLB 3S3PA 4N0CD 1FAIL 4MA8L 4JQIH 5ALCL 4QHUB 2HLFD 3QIBD 5DURD 3MV8B 2JJVA 2APTA