1SDYA

Structure solution and molecular dynamics refinement of the yeast cu,zn enzyme superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
b'VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER,ZINC SUPEROXIDE DISMUTASE
molecule tags Oxidoreductase(superoxide acceptor)
source organism Saccharomyces cerevisiae
publication title Structure solution and molecular dynamics refinement of the yeast Cu,Zn enzyme superoxide dismutase.
pubmed doi rcsb
total genus 36
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1991-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1sdyA00
2AQPA 1S4IA 2C9SA 2GBUA 3F7KA 1HL5A 1OZUA 3H2PA 3KM1A 4BCZA 1JK9B 2AQTA 1Z9NA 1Z9PA 3MKGA 5KBMA 1IBHA 1DO5A 3ECWA 5KBLA 3QQDB 1SPDA 3HFFA 1E9PA 2WWOA 3GZQA 1JCVA 1FUNA 1N19A 3HOGA 3KH4A 2WYZA 3H2QA 4A7TA 1HL4A 2WWNA 1SXSA 4FF9A 1CBJA 3ECVA 2WZ0A 5CU9A 4A7SA 2AQRA 2WYTA 2AQNA 2Q2LA 3LTVA 2C9UA 3F7LA 3SODB 2ZOWA 2V0AA 1TO5A 2K4WA 2WKOF 1IBFA 1IB5A 3KBEA 4BCYA 3GZOA 3L9YA 3GTTA 3MNDA 4U4IA 1XTMA 1KMGA 1YAIA 3L9EA 2ZKXA 1Q0EA 1SOSA 2AF2A 1JK9A 4A7QA 4OH2A 1DSWA 1BZOA 2E46A 1P1VA 3KBFA 1E9QA 3CQQA 1PZSA 3ECUA 2NNXA 1SXNA 1YSOA 1E9PB 2JCWA 4OJAA 1E9OB 2WZ5A 2VR8A 1QUPA 4MCMA 1BA9A 1SXCA 1COBA 1E9QB 2JLPA 1B4TA 3GTVA 2GBVA 3RE0A 2AQQA 2WKOA 1OALA 2C9VA 2Z7YA 2Z7WA 4MCNA 1XTLA 3GZPA 1EQWA 4A7GF 1F1GA 1MFMA 1SRDA 1UXMA 1F1AA 3KH3A 3PU7A 2R27A 1ESOA 4BD4A 1CB4A 1B4LA 1PU0A 2E47A 2APSA 3T5WA 2Z7ZA 1IBBA 4N3TA 4A7GA 4B3EA 3GQFA 1N18A 1XSOA 2XJKA 3CE1A 2ZKYA 1PTZA 1EJ8A 1SXBA 2ZKWA 1IBDA 1SXAA 1OAJA 3QQDA 2LU5A 3KM2A 1SDYA 3HW7A 4A7VA 1AZVA 2AEOA 1U3NA 1F18A 2SODB 1F1DA 1YAZA 1OZTG 1OEZW 1E9OA 5KBKA 3K91A 1TO4A 2XJLA 1SDAB 2Z7UA 1L3NA 1UXLA 2WZ6A 3S0PA 2GBTA 4A7UA 2VR7A 3CQPA 4N3UA 2AQSA 1SXZA 2VR6A 4L05A 1RK7A
chains in the Genus database with same CATH superfamily
2O6DA 4F37K 5G2NA 4GXUN 3QDGB 2EADA 2C7FA 3LZQA 4GRLB 4NPKA 4JFFB 4X99A 4XVJL 4QRPA 5CEYB 1FIGL 4KY1L 4YDNA 5KAQG 2X4QB 2VNCA 1TCRA 2VDLL 4QKXB 2Z64C 3MKGA 1P84K 5KBMA 4GG6E 3V2AR 4HIIA 2J25A 2NUPB 5C9JB 3AB0C 4APQC 1JPTH 3QO1A 5DA4A 5MENA 1E4KA 3T0BA 5D1QD 2VDPL 3NQIA 3VA6A 4LVOC 1JYWA 3KYMB 2G3ZA 1IQWL 1LO5A 3HZ3A 5C9KA 3D85A 4I9XA 5IV2A 3MNZA 3S5LA 1JGLL 4UYQA 5IMOA 2D3NA 1E4KC 3L9RB 2DQFA 1CI5A 3P0YL 4U4IA 5DFWH 2NX5A 1PSKH 3FQWB 3RTLA 7CGTA 3MNWA 1AOHA 3MOAH 4YL9A 3S2AA 2B5IC 2AERT 4FQHB 5J6GA 2IEPA 2ARJQ 2WWMC 2HMIC 4G9DB 4PB0H 4ZX3A 5MI0C 3D0AA 2WKGA 5GRVK 4NNYA 5E9DA 5E6ID 1YSOA 2X1QA 3KLHC 3PHQA 1HCFX 2VDOH 5EO1B 3TA3A 3UTZB 1AKJA 1DQIA 3FFDA 3NSDA 5FGRA 4BQCA 4WI3A 3RWGB 4CC4A 4QHKJ 3KS0J 1A25A 3EAKA 5I1LB 1RCYA 3F04A 5B38G 1C5DB 2CGZA 1H9DA 3LKPB 1BLNA 4FI7A 1YA5A 5KSBF 2VERN 1BSIA 1EZLA 3MCG1 4ZJ9A 4F15B 3V6OC 4F1SA 1M3JA 1NGZA 3LY6A 3Q8CA 4L4TB 2H8PA 3CSFA 2IOMA 5BW7C 4MXQD 4NRXA 4P2AA 2VGLM 4X4KA 4L8BA 2V9TA 5CGBA 4R7XA 3HC0A 3V6BR 3O2WL 3LRKA 5CEYA 3NCJL 2HG0A 2NNRA 1AJ7H 2D2CC 2IBZX 4LB8A 1XIWB 2IWKA 4MDJB 3B6SA 5AZUA 3UTQA 2ZSWB 1H3WM 3QDMA 2W1NA 5DI8B 3MNWB 4C4BA 2ATPB 2AJVL 4H8WL 5H8DA 1FSKC 2ZKHH 3A47A 3G9VA 3UBXI 1C12B 1K3ZA 3RIKA 1I1CA 1HXMA 1ZGLB 1INEH 3KJ6L 3SE3A 2JKRM 1ND0A 5F93C 1WZKA 5MEQA 1M1SA 1FZOB 3J2PA 1JUFB 1CD0A 5F1IA 5HHPA 1HCZA 1YPZB 1ZE3C 5EPMA 1BQUA 3RFZA 1O6SB 1IARB 2NNCA 4L8SC 1YQVH 3AREB 1R34A 3WG7B 3JUZA 3OM3B 4U1IA 4WHCA 2EXYC 2BW4A 4G9DA 5KS9B 4JANB 1JV5A 2VIRB 1EAPA 2J6EA 3BKYH 1KEGL 1WQVT 5F7NC 2LU7A 3ZVVA 3SDCC 3QQ3B 5C0CD 1EO5A 1QEXA 1UWGH 5FYLD 3AWGA 5C0BD 1J12A 4LU5H 2WCGA 3MYJA 3S5LB 1LO4L 3ELQA 4W4OC 5F88A 3ZDZE 3HLKA 4KHXH 4OKVA 3BOVA 1F11A 1IC5H 3VGEA 2FH6A 2X4RA 4MNGA 4K7FB 1UWXK 4PS8A 5MERB 3QEUB 1NLBH 4L4VD 5EDXA 3OMNB 3LDBB 5JOEA 5ESVB 4XPHH 4JZJA 4Y7OC 5HDBB 3WD5H 5AWNL 4PG2A 2HLFD 5EZLA 3VFPB 1VDGA 4KXZH 5DJYA 4AVIA 2GHWB 1BXUA 1JRHL 4JO2H 4YHNA 3QFDA 3L5IA 3WKYA 1WA0X 3EBGA 5MEPB 2RMNA 4Y1SA 1UXWB 5CU5A 2FJSA 5ID0B 5K69A 4OKDA 3ALWA 1B4RA 1E9QB 4AG4H 1R3KA 2ATAA 2BZ7A 2GVYA 3QFJE 2P5WE 4LKXA 3MJGX 4FX5A 5J13C 3BRDA 3SE9H 3FT1A 5TK4A 1IU1A 1MG3C 1CYXA 3BW9B 2CUAA 2BY0A 1FNHA 2MOQA 4Y2DA 5EBWA 4YR6A 2DLHA 1CUOA 2C26A 4AEIH 3ZMRA 3P4OA 4MJ6A 4NQXB 5CGYD 1FVEB 2QKIA 3FDWA 1TF4A 4JFOB 5TGBA 2ZXEB 1Z3GH 2PW2B 3CN4A 4PRPE 4HWEH 1DEEB 4KJYB 4G8IA 5LGHL 1U6AH 1PKQA 1OTSD 4H4NA 4HIQA 2F58H 3TPUB 2GSMB 4K07A 5FF6B 4FMVA 4HV8B 2NQCA 1USQA 2I24N 5CEZH 4F7KA 1RERA 4ZUSA 4C4KO 3DOSB 2Z8RA 1T7YA 1FCCA 2IQ9H 2JKTM 2V5MA 2YUWA 5E6SB 3NIFE 3UO1H 5I1LA 1WEJH 4HEPG 5DJ8A 5I8CA 3CG8A 2EDMA 1OZTG 1ZWIB 2IANE 4HWZA 5FCSH 4G3YL 4KY2A 3IPFA 2KS0A 2GIMA 4KVNH 3NT0A 2HYMA 3DK2A 4NOBA 3T6QC 2DDQL 5DJ0A 2VSKB 3TS8A 4MJ4A 1E6JH 3QGVA 3LIZH 3I6SA 4G83A 1YC7A 1HL5A 5EZPA 2I9LA 4ELKA 1L9SA 5HGBB 1T4KA 1E8ZA 1MHPH 1EAOA 2XLLA 1T0MB 3L4CA 4FG2A 5B22A 4AIZA 4CVZB 3QYNA 1PPIA 4LCWB 2P7TA 3K6IA 4CU7A 4OZ4A 5FOJA 1Q1PA 4ZFGL 3MRKB 3MOBH 2L7QA 2BVPB 3CX5K 2FX9H 2ED7A 2NUPA 4W93A 3U36B 4KO9A 3CFDB 4NENA 3X12B 4TQ8A 3QRFM 3QDHA 3T3MB 1U8PA 4JKPL 4ZFZB 1VF5C 1AGDB 1L9NA 4N0UE 1KBGH 5F89A 4YSTA 1FP5A 4JJ5B 2EDLA 4LL4A 1MZYA 5KBNC 3MNDA 1M05B 2G75A 3MNVA 3GHEH 2BDNH 3GEWB 4Y4FB 3L48A 5GHWL 3HLAA 1EHLH 4PJBB 3W39A 4U3XA 2XHNA 1IVTA 3SJVB 2YGPA 4LCUB 2FEEL 2KDGA 4PWEA 3V0VB 1MWAA 5FFGA 2AJSH 1XCXA 4Y4HB 2BDNL 1KCUL 3GSWA 4XVTH 1FC1A 1X44A 4KX8A 4TYUA 1RUQH 4OD3H 3VDAA 4CU6A 3ZTNL 1U92B 2BMKB 4ODSH 5DO2D 1KCBA 1YEEL 4G7RB 3FQ1A 2X88A 2W65A 1CF1A 4OLYH 2WLYA 3T0AA 2DQDL 1N3NB 2IV9A 4MZ2A 1EEYA 1K6QH 3UP6A 4CRPA 5F6IB 3DX7A 2B20A 3GXMA 5CSZA 4LSDA 1QW8A 5D7IF 2X4TB 2DLEA 4FHBD 5EIVA 1OIOA 3EH2A 3E80A 4J3OD 3QA3A 2QHLA 4PRDA 5C0IA 4L5FH 3UTTE 2E6QA 1P7QD 4PW3A 3N50A 3RX9A 3KLHD 2ZKYA 4X9YA 3X1NA 4ADIA 4DP7X 4KK6D 1VESA 3W9EB 4B9CA 1MFUA 3OKDA 2CBTA 2O26U 2OV0A 3CDCA 4JM2C 4ZI8A 1BZQK 2Q5BA 2F8XC 2QPSA 4N0FB 1YEEH 1SMDA 4OB5L 1YCSA 2EYTA 3EF7A 5D1QB 5E8OA 2JQMA 4XC1L 2IFGA 2NNFA 4XO8A 5E5RB 2NW2B 3QUYD 3FAXA 2OYLA 1YY9C 2OQJA 2WXKA 2B14A 2V17L 3ARUA 1I4FB 3QDMD 3PL6A 3VWKA 5IVXB 4RZCB 1CFSB 4OB5H 1L9QA 4XMUA 3P2DA 4LIQL 2HLEB 3B1UA 1A7PL 2WUCH 2XVKA 2VKXA 1GGYA 1DQLH 4PUBH 4I0PC 3TFBA 1A0QH 2VLRB 1O7DE 1UEMA 1TJIH 1CK0L 2UY7A 4GG6F 1P9MA 2BP0B 5C6TH 5CBEA 5EFIB 3CDZA 5A2IH 6FABL 3WNIA 1SJXA 2JTYA 2UWEB 4HK3N 2O6FA 4GRLC 3DNKA 4X6EA 4OQTH 1U8PB 3ZKNC 4HPYL 1UJ3A 4UQBA 3WTYA 1R0AL 4XZUB 1UM6L 4Q52A 4LOEA 1HL4A 4YS4A 5HGHA 1TEFA 1LO3L 4WEUD 3EZ8A 3K46A 5CIPA 1NUFA 3WFZA 2YPKB 3MRKA 5JXEC 1E2VA 3QFJD 4J3BA 1MLBA 2YQ2A 3B9KD 2A6IA 4OCYL 4YXKH 3RRQA 3CPLB 3T4AA 5EORH 3GJFB 2Z1KA 1VRSA 1IRAY 4Q9CA 5KSAC 3STLA 2V33A 5F9WB 5KSVB 3D2TA 4HOZA 3S88L 4FFZL 3B7YA 3EYVB 1KZQA 4AIZB 2FYYA 2L7UA 4GH7B 2AEPL 4XBMA 1G7IB 4LOVA 4X8XA 4RA3A 1MCRA 2VOTA 1I85A 3IJHA 3JV6A 2J21A 2GJPA 1GYWA 3JUYA 4JFHE 5EIQA 5T3ZH 1ZK5A 5C7XL 3KR3H 5BZWA 5C3TA 4JMNA 1TMQA 2WZPA 5CZKA 1AY1H 2LOEA 1AOZA 1A6TB 2G0LA 1D5MA 5HYSA 1S7UA 2WC7A 2GTZB 2DW5A 2EDQA 3FU7A 3ZHLA 4Y1AA 2VZVA 3FRUB 2FECI 1YMMB 4PJGE 4K3HA 5I5JA 3ZHDA 5KJRL 2OFQA 1TJHL 3T2OA 1A6UL 4LEOB 4BD4A 2NDFA 4UT6A 4GG8A 3TYFB 3MXVH 1YMMD 3VWJC 3H85A 2WLMA 3LZLA 4JFEE 2XXMB 2XC8A 4U49A 4WUUD 1OSYA 2MWCA 1H3VA 4PJIA 5FHBL 3QBTB 3TPKA 2A4CA 3BVTA 3UTPD 3KYKL 2XVGA 3QORA 2Q86A 3BP7A 3QS3A 4G1MB 1GYCA 4YZFF 3GSWB 4X2UA 1OSPL 4R0LB 1KC5L 5KW9H 1LEKB 3C6LD 3EJQA 3SDDB 3VXSA 1WHOA 2M26A 3ULUD 5FEBA 3BAYA 2C9RA 1SN2A 5I0VA 4AQZA 1FNGA 1D9KD 4LCCC 3PPSA 4Y4FA 1YNLL 4LPUA 5AVUB 1CFSA 4EZKA 3IYLW 1S7QA 5AYTA 1AQ8A 1CBVL 3VQMA 4AC4A 1PJWA 3HUJE 2NW3A 4QRRE 4S1QL 4BFGA 5K9QG 1K4CB 4I9WE 2VDNL 5HHMB 5A6MA 2YXFA 4XCCH 3DV6A 5IROD 4DP9X 2CGYA 5DVLA 2MCG1 1VSCA 4WTQA 5ISZA 2WZAA 3A67H 1T7WA 5KOMC 1SMOA 2P7TB 1OP5K 4KZ0A 2BNQB 3FB6A 1NMBL 3GFUA 2YAFA 4X9GA 3O3AB 4RNRA 3SDCB 1EDQA 3PQYE 4WEBL 4RFEB 3C5JA 1NIAA 2DWDA 4FD0A 4RWYL 2X2JA 3UO1L 2R1YB 4P06A 3QR2A 3QUKB 4M1CC 1CLCA 4ENED 5G4NA 3UFIA 2W0FB 5SWSA 3U6XS 4XZ4A 3PJNA 4AH2A 3HNTH 4WW1A 5ISZE 2QLYA 4AXWB 2JCCF 4PJEA 4TOYH 5I16B 1TSRA 1P5VB 1Z5HA 4ZXBD 1TZAA 1U6AL 4AQEB 3GI8L 1HIML 3HIZA 5DFVD 3LKRA 4QHNA 3IJSB 1AR2A 3NQKA 5ADPH 1B4JH 1Y6NR 4ZDHB 4HJSA 1DLHB 2EABA 4JKMA 4AMKL 1B4TA 1ZPLA 3II1A 5HGAB 1YMHA 4MAUH 1T2QH 1J1OL 2VDRH 4DN3L 2ITDB 3KWXA 4HU8A 1N4XL 3WNOA 2V6HA 4HCRH 2YMTA 4B9JA 2BJMH 1FL6A 1PQZA 2Z3FA 3I3EA 3DI2B 1RHHB 3B5GA 4X9HA 5KVDH 4N22A 1S9KC 2EUWA 1NC4B 2O5ZH 5HPMB 5IFHH 5AYUH 1B90A 2JK5A 3OR6B 4R83A 3VM5A 3I6LE 3PS6A 2QSVA 1KCVL 3VXQA 2CCWA 1CQKA 2YBRA 4U4BA 2E6PA 3MTRA 2A9BA 1IIKA 2H1PL 2DEXX 4N1CA 3SQBB 4UILH 2HKHH 2E74C 4WUUE 5HDBF 1Z9SB 5C8JA 4RFNC 3BP6B 4TL5A 2CGRL 3IJ7A 3NK3A 3T3PE 3D9AL 1LE5B 5D1ZB 4Y4KD 4W9HC 3BPLC 5F8RC 3V0FA 5AZ2H 3V0WH 3RGVC 4FFYH 2HFFA 2XG4A 1EA9C 1HHGB 4JPVH 4WV1B 3OX8B 2UXTA 2FIKB 2NPLX 3TBYB 3OKYA 1DLHA 1G0DA 2WLLA 4KK5C 1IFHL 5E99H 5AW7B 2AVGA 4OLWH 2D3LA 5IEHA 4LLQA 3VMNA 3L3KA 3MQIA 2KLTA 4D3CH 4K3GA 3T8XB 5JOPD 4JZNA 3ZKMD 4ABUA 4C54A 4AXWA 1NFIA 4BE6A 3EDEA 4JQIH 4Z7VE 2QJDA 2NYZA 3RGHA 2VDLH 4M7KL 1RU9L 3V4UL 1UA3A 1F5WA 4JHVA 1NGWB 4UT7L 5AB9A 2J2ZA 4AV0A 5ILTL 3HS0B 4I18B 1MJUL 3ZKXB 1NCAH 3VQLA 5KZCD 3CXHJ 3P9LA 3F00A 1HKFA 2NMSA 5BVPH 3GHEL 4UBDC 5IMOB 5LLIC 3VD0A 3EOTH 3ROLB 3Q9QA 1NEZB 1OF2B 4DGUA 4F9LC 4OGZA 2CPCA 4PD4K 1PZ5A 4I9WD 5HSFA 3SBQA 3MRGA 3ZE2E 4ODBD 4OCMC 5ACMA 3V0AC 4ZMWA 5F0LB 2VERA 2VUOA 2QKIB 4JFOA 2PW1B 2O61B 1DDHB 3D50A 1TTUA 4GRLA 2D7OA 2E75C 3KPSE 2WP3O 3QHZH 3X1EA 5KSAB 2N7AA 1URIA 4GP4B 5AAPA 3UAEA 3ULVH 1JNHA 4HH8A 2F53A 1FNGB 5MEQB 4OZHF 4MYPA 4RQQB 1BD2D 1MCDA 3FCSA 1G87A 5I1GL 1BHGA 3DSNB 5HYJE 2IGFL 2X3AA 2E9IA 1HOCB 4IRSC 3VFMA 3VI3E 1IZJA 1CK0H 3RKPA 1AQDB 1X5GA 4POYA 1YEHL 4X5WA 4Z0BH 3VI3F 4ZTEA 1ECZA 4P2CG 3UTPE 2F1BA 2J71A 3DX8A 4URKA 3TEWA 1QFWL 2UZIL 2FQGA 2VDPH 4M7ZC 4OLXH 4PJAB 4WZ9A 5FO7B 4CU8A 1KN2H 1MN4A 1PLCA 2DD8L 3D39A 2CLZB 3FN3A 1SY6A 1AO7D 4H88L 1CFVL 4F9PC 1FH5H 3EFDL 4JDZB 4L4TA 4L5FE 2CK0H 3V52L 4P48A 3LHAA 3E38A 1QRND 1DN2A 5EOCJ 3IU4H 3DJRA 4NQEA 2R1WB 3BKCH 3NRQA 2N7BA 1C7TA 3QIUD 3PXHA 2ENQA 4MD0B 4U6XA 3NH7H 3QAZB 3QHFL 1ZVSA 4GAGH 3MC0A 2NR6C 1IBGL 3X3GL 2HLAB 4UQEA 4HCFA 1KB9K 2WLJA 3HS0A 2NY7H 3I6KB 4I18A 4M03A 4NUGL 4PJ5B 4PREA 1F1DA 1QLEH 4YFLI 1R5VB 1YAZA 1ZDQA 4TN9A 5IWLA 3QZBA 1WAAE 1FL3A 5I18H 5IF0B 3OSKA 4QXUH 3MO1B 1U21A 3WEXA 4NN6B 4OLVL 4Z7OF 1AHKA 1RK7A 5BQ7B 2PPCA 3QAQA 2NW3B 3N40P 4GKSA 3SDDC 1KLFA 1NANI 1I1AA 3FQXA 3TWYA 2VDNB 4FNLL 5EPMB 1SLXA 2BVOA 1PLGL 1HCVA 1S6NA 4BCZA 2OMZA 5IVNA 1HZLA 2MCPL 3MUUA 4IU2B 4Y9GA 2FYVA 5J7CC 1M9SA 3CBJB 4KTDH 1UFGA 1KIRB 5KEZA 4HEMA 3UMNA 1FZMA 2GJ6D 5D1ZA 5H94A 4XNUL 3S4SA 3GRWA 3MV8A 4PJGA 1JTOA 5JOFA 2XWXA 3SPHA 4W9KC 2E7LA 4G1MA 5C2BH 5DUPH 5CU9A 1N0LB 1J1XH 2ZPKH 5I18L 4GUQA 5CJ8A 2DQUL 4N2GA 4HXAL 3VXQB 2DQJH 1HQRB 2UZXB 3DIVA 3K2MC 5CP3H 2GEQA 2HT3D 1H3TA 3ZOAA 1NAKH 1XCTB 3FFCB 4X6BB 5SX4I 3HAEH 2QPUA 3NZHL 4PJXA 4WWOA 1CTNA 4KH2A 2ENJA 5AB0A 1UTDA 4UTCA 1FZKB 2DQUH 2K8QA 2PABA 3UCQA 4XAWL 2J44A 3GLDA 4U1JA 4LLDA 4RAVB 5GIRA 1UWGL 1VFAB 2VAJA 1P2CA 4LVHB 4K2UH 4NLHA 4B95C 1BVKA 2R1WA 1TQCB 3X1GA 3FOMB 2DH3A 3OQRA 5I26A 1KTJA 1R17A 4DEWA 4TNVF 1EJFA 3T0EA 1YQ2A 1IGYB 5DRZA 3GSUA 4G7YL 3CFBB 4FTVE 1NGPH 4JFTA 1T1ZB 5TE6H 1BM3H 4YUEL 5FO7A 4ZMAT 3EIFA 3KNBB 4M8QA 3IVKA 2J72A 1YRKA 3MV8E 4UI2A 2BJML 2A83B 2B1AH 4FQJL 4WK2B 3UX9B 1QYGL 4QNPE 4YEFA 2GY7B 1JI1A 5HVGB 1H6UA 4IHOB 4MA7L 1HAWA 3EJJX 4LNVA 3VFUA 2H3KA 5ADOH 1N2RB 1FC2D 2BOCA 3C8KA 2VQTA 4OJCA 3GHPA 4PP1C 1O5PA 3WS3B 3Q6FA 5TF1L 1XSKA 1OTUC 1I8KA 2V2TB 1QNZH 4GSXA 5D4IA 1W0WB 4WWKA 4WF7A 2FT6A 4OT1H 5MP6L 3LSOB 1FF5A 5IBTL 2HTLD 5E6YA 4DZ8B 1HT6A 4FFYL 2UUDK 4TSBH 2FJFA 4KKCD 3U1QA 4F2EA 4PJ8C 4YDMA 1U92A 2BMKA 5K1NA 2NSXA 2C34A 1DUYB 1AGEB 1FYHB 4ZPVB 5DTFB 1Z32X 5C0AD 1A6AA 1HDMA 1MQKH 2IOOA 4ONGH 2HJKA 4N0RA 4NKMA 3ZRSA 4WRLA 3S4SG 4B9KC 4GEJA 1QX1A 2Y7QA 5D8JH 1E4WL 4L29B 1JZHA 3AS2A 5F9DC 4PS7A 1NGXB 3C6LB 5AAWC 1GCFA 2GI7A 1MREL 3AMKA 3TCTA 4AZ8A 4OFDA 4I48A 4XVUC 4PY7A 3RURA 1LK2A 1J5OH 2DTMH 3HHSB 5BXFB 1S9YA 1UOKA 4R97B 1WWCA 1BAWA 5E4EC 3TBYA 3QJSB 1KGXA 2QV4A 4OZGA 4BHUI 1YNKH 1XDTT 1Q0YL 4MNGE 3R8BB 3JV5A 3U83A 1AH1A 5T5NF 5B8CB 3MA9H 4EVNA 2WW8A 3WTXA 3ARBA 3BE1H 3TYFA 3GB7A 3ME0A 5I15H 3MLXH 4NOFA 2OI9B 2CRYA 1BLIA 2Y25A 4O9HL 4KX7A 3IGAB 3SZKC 3DV4B 3NJGA 1JGDB 5IB3A 3WBDA 1JS4A 1M57B 1YYML 3ARBC 1JXKA 2ZOOA 3D05A 4RSYA 3HB3B 5CF3A 2L8AA 5JW5A 3EJTA 5E1HB 5KVEE 1T3FA 1TJGL 4GS7C 5FS5A 2E27H 1X5AA 3GIVB 1A9VA 3OSVA 1KXHA 5F9WC 3EYOB 4R2GB 5DJ8B 5I8CB 1GZQA 1UM4H 4UM9B 1D5XB 1Y1DA 1PX4A 1SEQL 2KYIA 3GSQA 3KL3A 3VGGA 1QTSA 5E99L 4TQHA 4RMTA 3ZBMA 1ZIBA 3DYMA 4LHJB 3CNKA 5C6TL 3P0YH 4LLDB 4O5LH 4RAVA 5GIRB 3TJEL 3WUWB 4HFWA 2OTWB 1X6LA 3RKDC 3VFTA 1E6OL 3V5KB 1JZ5A 2IGFH 5E23A 4CVWA 1XCTA 2NQ3A 2CKBA 2N1KA 3BUYB 3FZUD 3QNXA 1CN4A 4JRWA 4YQXH 5BJTA 1Q9LB 4G8EA 4Z95L 3SE4C 4BFFA 4IRSD 1Q8MA 5KYXA 3JWDL 1AD9A 1H5BB 2ZP9A 2ZYHA 5TDPA 5C1MB 2XBZA 1ADWA 2X70A 4AEHH 1UT1A 4HWBH 2B3RA 2VC2L 4ZUTA 4RX4D 2JCCA 2AANA 1X7SA 1KTBA 1LEGB 4ALAH 5F6HJ 1MFBL 2CIKA 2Z7UA 3QIUA 5D7IB 3ZZ1A 2YFOA 1F90L 4OGYL 4H8QA 2VXVH 4M6NH 2WNXA 3PHAA 1SXZA 4WWKC 4ZOCA 4YHIA 2NNAA 3M46A 3EJRA 1IEBA 3SDCD 4A1RA 2P8MB 3FF8A 1RZJH 3JZ7A 5DT1H 5ACZA 1MCEA 3EFFA 1J11A 2RJMA 3D25B 2AQTA 2PXYA 3L3DA 1R6VA 1RZIA 2A6JB 4OLUH 2GI0A 3GMPB 3FH7A 4KHXL 4PGZA 1OGTB 3NK4A 1K3IA 3REWA 4YSRA 4D2NA 3UJJH 4J5VA 1EPFA 4UNUA 5E4IA 4HFUL 4F7TA 2ICES 2VXQL 4HALA 1FFQA 1KTLB 4HKXA 4D9LH 4PGBB 3P0GB 5C0IB 3MRHA 2ICEB 1S2EA 1FNSH 3KYNA 4MAYC 1D5BB 3GB7B 3ME0B 5B1CA 1IC4L 4GKNB 1TQSA 4ZZFA 3DX7B 2B9BA 4HIHA 3FOLA 3O2DH 2Q6WA 5EZIH 3ZZLA 5C0FA 1DN0A 4R4NC 1KTRL 3BESR 5KS9A 2FJFB 2CLZA 3HS9A 1D7BA 3X17A 1VGEH 3ZTCC 1IC7H 5E9NA 3OXRA 5EIIB 1YEHH 3SN6N 2FBRA 1DE4B 3UC0L 3V0EA 1HNYA 1E9PB 5TF0A 5ICYA 3OG4B 3EDFA 3TBBA 4ZSOB 2B15A 2F61A 1KSRA 5L8LB 2IFFL 3BWAA 2Y7QB 3CBRA 4TLTA 3KL0A 1X6NA 1DVTA 2Z65C 1TJXA 4TL4A 4GAJL 1WCQA 4N1HB 4TUOA 1U3YA 4ZW7A 4LBAA 3KH3A 5LAXB 3WTSA 1PF3A 4UZUA 5CP3A 3VFGL 4MSWA 3WXWL 5I6OA 2CDFB 3R19A 1RZPA 3QUXA 3G6DL 5D6DA 3SJVD 1ITCA 4YHNB 5HJDA 2P5EA 3PNWA 3HPLA 5EO0B 1CS6A 5IQOA 4PJ9A 3TX4A 4OVUA 5DWUH 5AAWA 2FLRT 4LSPH 1F3DH 2ZCHL 1A7NH 3UYOD 4C83B 3PF2A 1HESA 2G2NA 4JK0D 3DA0A 3V5HB 3K81A 1ETJA 2J1KA 1AGBA 4I5BB 2NY2B 5K9JH 4QAMB 4R90H 5D7IA 2VSDA 3G5WA 4XO4A 5B3NA 2VDKB 1MVUB 3KAAA 3Q05A 2BWDA 4DKFL 4RCAA 4WV1C 3MXVL 2IBZY 2RB8A 1KGWA 4GAFB 1J5CA 1RMFH 1Q9OA 1QSVA 3KVDD 2VR7A 1AQHA 4ZMYA 2DY2A 1UZ6E 5DD0H 1I1FB 3MRBA 3P11L 2OL3H 3LS5L 1EZUA 3MUGA 5H37H 1N64L 3MRPB 2CKBB 2XZCL 3KWUA 1U58A 3KCWA 5HYQB 3DX1A 4IIZA 1Z9PA 2NY1C 3LKSB 3HG1D 2PYEA 1MXDA 3DDFA 1RZGB 3NJMA 3R7QA 1DQDL 4MS8D 3GZQA 1YUHB 4YC2C 4MRCA 1RAMA 1PW3A 1VEOA 4DFHA 4LSTL 1U8OA 4DKFH 2PXYD 1JXDA 3EYOA 5JORA 1KTKE 3VWKB 5DC2A 1S7WB 3SKJL 2OJZL 1ZOXA 2EVIA 1BG1A 3WKNA 1P4BH 3IT8D 1USZA 4JFUA 1NZRA 4V1DB 2G30A 2G5BA 5TGBB 3S36H 2Q20A 1X9LA 5GS0L 4XCCL 1W72A 3ZDYF 4G6ML 1KLGB 3ARTA 3BWUC 1BBDL 1JGVH 2HVBA 3FB5A 4KNSA 4LKXB 3S2CA 3H53A 4LLYB 3BP5A 1WBYB 4XXWA 2Q7YB 4LDOB 2QADD 4BZ1A 3EF4A 2WQVA 1SOQA 1I1AD 1Z9MA 4X4ZA 3IGLA 3NSYA 2P26A 5CZRA 3ZTDC 4YO0A 1AE6H 2FJGA 4NYLB 4L3AA 1MHEA 1UG9A 3ZE2F 1TMCB 6CGTA 1OANA 1GCYA 1GOFA 5IBUG 2A0LC 5T1DL 4IBUA 2F6AA 3GSRB 1HWWA 2WGXA 1U4EA 3N85H 2ZONA 3CJJA 4W4NA 3BZEB 4U2YA 3BUPA 3C60B 1UENA 4XNYL 1I3GH 3PXLA 3THMH 3C6LA 4HWNA 3RGVB 4OY9A 4WDIB 2F1AA 4LOUC 4PV9B 5HHME 4OZHE 1TJMA 3K8MA 5IQ9A 3NJKA 4HJ0C 5F7HA 1CO1A 1RZ8B 3SZ6A 1K85A 2WXFA 1KIPA 2ESVA 3F12A 1UJTA 4UQ2A 4O2FB 5EA0H 4QHLB 1NIFA 1JPTL 4EQ3A 3IAGC 5EEUA 1KLGA 5I1DA 2A6DB 1JPEA 3MR9A 1WFJA 1ZT1B 2AEQL 3PGFH 2BCKB 4PRBA 3M8OH 3RVTC 3VFVB 2YS4A 1EGJL 2HUEA 3EOBB 3OKMB 1MELA 2JB6A 5E2WL 3T8XA 1MAML 4XNQA 1D2PA 1KPUB 2ERJC 3CU7A 1P9MC 4HS8H 3WIHH 5BS0D 1BMWA 4KZDL 3BJLA 4XP6H 4ZFOL 2FJGB 1E3XA 5F96H 5IMKA 4H26B 1MJ8H 2LAAA 1MCPH 2EKSB 3ARZA 3B9KA 1ZV9A 4BDVB 3IDIB 1VJSA 1U2CA 3FQUB 5IVOA 1DVXA 1UHVA 4EBQL 4ODVL 2OSLB 1JIBA 4JPQA 2O93L 1JDAA 4PTUB 5INCA 1CZ8L 3BP5B 5KVEH 1P84J 1KY6A 4MWFA 1XB6A 2JV6A 2WD0A 1X5MA 1PD0A 2I5YH 2EDTA 1T20A 4OCWH 4JKWA 3LPGA 3RWJB 3HI6H 5IK3A 4M5TA 4XOCA 3MRLB 3S5ZA 4OCYH 3NA9L 1KB5L 4YHML 5GSVB 4IBSA 3IFNL 2YBRB 5CD5C 5EZOH 2LW3A 4OFYD 2R2EA 4ZUWB 2JJVA 1DDHA 4BA0A 4KXAA 1UACH 4WUKL 2NRDA 1MCWW 5I8EB 3O8XB 3QDAA 4MNHA 4P2OD 5JZ7D 2OYKA 2ZZUT 2HT4C 2LT9A 3GJEB 4M7LL 1KEMH 2X44D 3IEAA 3RL1A 3UXFA 5AOJA 4PG9B 3ZYIA 1IFHH 1ZT7B 3MV9E 4JFZH 4UWQB 3WU1A 1DJXA 5IKCA 2WB1A 4BWUA 1AFVL 5LBSL 3L6FA 4F7CA 1MCCA 1P53A 4K9EC 4Z77B 3QXAA 4U7SA 3LXCA 5C0CE 2OMVB 4W81A 3NAAH 4CDHA 1I82A 2P46B 3NABL 5EN2A 1HQRA 2YEZA 4WY7H 5CS7A 1SUHA 4K3JL 4Q9RH 4WNQA 5F7LB 5I1CL 1X4YA 3I02A 1UXMA 1BZ7A 4MQTB 1GTNA 1UD6A 3FQWA 3QWQB 3RWCA 3QJHB 4NSKA 4WFED 3VJ6A 1P69B 1T20B 2XFGB 3V9EA 1KN4L 1U8OB 1HHHA 3QJFA 4ZNEE 4HT1L 4O00A 4WU7A 5I2IB 1ZVYA 4LVOB 3NTCH 3BPNC 4R7NA 4L3CB 4P57B 2FHCA 4AITA 1A8ZA 4NO0D 4O4YL 4NZRL 3SYOA 2OMZB 3V6ZA 5EBLB 2VAAB 2ZKWA 2PWEA 3G6JB 1BG9A 2VLRE 3LKSA 4H1LB 4HS3A 4NZUL 4ZDHA 4LE8A 3QO1B 3F7YB 5MENB 1KCWA 1IO4C 2A74A 3C6LC 5DYFA 1F3JB 4BKTC 3LH2L 4CILA 4XZUA 4YSSA 4KRPC 3UZQA 1VGKB 5GGSB 5EF2A 4PJ9D 3NCEB 1ZJBA 5KVFE 1HE7A 3GNML 2ADIA 4LCCA 2BC4A 1JXJA 4QTFA 5CLXA 4L9LB 1CVRA 4Q97A 3HG5A 3GF8A 1MCOH 3QCVH 1TYRA 2NXYC 4I2XA 3SGJA 3ZPDA 3ZKSD 1HXKA 3LH2H 1I8IA 5AVQB 2VCOA 1DYZA 4HSCX 1H15A 4JFFA 4X99B 5T5FH 4DW2H 3HVNA 2AQPA 3G5XA 5EF0A 5F7KC 1JDCA 1G7HA 3VG9B 1KUMA 5D55A 2WSPA 5DJXA 2GITB 5HYJA 3UBXA 4JFPB 3O2WH 2MNWA 3TFKD 1KN2L 1JZIA 3QQDB 1NDGB 2VL4A 1FFOA 3V8CA 1F6FB 4YX2L 4X6CB 3X3FL 1T21A 2VXSL 4FYRA 3BQUD 4G72B 5D1QA 3VI4E 4BZ1H 3K71A 3AGWA 5HHQB 1C1EH 3RZWA 2P42B 4XAKE 3I9IA 4LSPL 3C6SB 1QP1A 1BYOA 1DP0A 1NBZA 3LZNA 4WO4A 4A7SA 4ORZC 3QPQC 4NQDB 2HH0H 3LTVA 4XPHL 4AC2A 3OB8A 3FO2A 3QJRB 4NYLA 4UTBL 1ADQH 3CH1B 3V6OE 3T0EE 4G7SB 4BCYA 1MCNA 2MMXA 4TUOB 1BVNP 5E00A 1C9SA 4I87A 4FYQA 4WKXA 3WXWH 1UB6A 3NCCB 3STZB 3UAFA 3L9EA 3QZWA 1R5WB 3CZFA 5KVGL 1A7QH 4LP8A 1AR1C 4HQQH 3II2A 2FB4H 2C3HA 4F58L 3MRNB 5HVFB 4LNRB 4HF5H 1PVHA 4O51A 3RI5K 1QLFA 1T7ZA 3MRRB 1Y07A 3B6SB 2VLJA 1D5MB 1R3IH 4L4TD 5EN3A 5HYSB 4LFHG 3TO4B 3DBXA 1RVFH 1ZHLA 4G9FD 4MCMA 4NBXB 2V7HA 2Q8BH 4WIQA 4TULH 1VACB 4LASH 2GUOB 2VABA 3DUSB 4XOAA 2NYKA 3T6VA 4LHUA 1T7VA 3L4XA 5BRZA 3TYGL 3QDJB 3PDDA 1ZTXH 4WSKA 3VG9C 1OARL 4AIXA 3ML8A 2H8PB 3POCA 4H1LG 1NOAA 1JZJA 2OMUB 4LMQE 1QNIA 2LU4A 4MNQE 1U8NB 1YJDL 5D1XD 1NBVH 2G9HA 4IGBA 4JY6B 1C5DA 2J56A 1YEKL 2EC9T 1NCGA 2IMNA 4YVNA 3SKNB 5GS1B 2KDYA 4I3SL 5T33L 4G42A 4GW1B 1W72L 4JKPH 1ZKAA 4P2OB 3N42B 4F93B 2V3FA 2MQ0A 4NNYB 1QSED 1XGTA 4ETYA 3D8MA 3MLVH 1RZIB 1H0DA 3FULA 4GSQA 1QWNA 5BZWB 3TP4A 2OI9C 3OWEA 4U1SA 4JO3L 4OFIA 5I1IL 2OULB 5IQ7L 2UWEA 4Y8DC 5KVDE 4BFRA 3FBQA 4KK8C 4H8VA 3M17A 1MQ8A 2UYLB 3ARBB 4Z78A 4JZOB 5D7IE 1OLZA 3RLSA 4TS6A 4PGDB 5DQ9A 1NL0L 2X2HA 3L5HA 3BHBA 3DX6A 2N0MA 4X80H 3Q06A 5H35A 4N3UA 4PWKA 2Y7SA 2XXCB 3L3OA 3SO5A 2FD6L 4N2EA 2WMPA 2V2WA 4C8XA 1FYTD 1ZK9A 3L1EA 4GLRI 5BV7C 4HGKC 3I9AA 4KRNA 3RWEA 3ARWA 1YYMH 3QI9C 4U6HA 5D5MA 3SGKC 4BV1A 2BHYA 1DSFL 1M7UA 1G43A 3IMBA 3MX0A 3QCTH 4KKBC 2F68X 3NN8B 1G7JB 3C87A 3Q2VA 4GMSH 5I1JH 5HGGS 1SBSL 3Q5YA 1KCUH 2DF3A 3ETBJ 1TIUA 4NCDA 4NQCB 3VRLE 4C47A 2VMFA 4G6FB 2E7HA 3VMPA 1E30A 1ZV5A 3D7PA 3EOAB 1SBBA 1YEFH 3Q8FA 3RIFF 3WUWA 3IBOA 3QDGD 3FTYA 1LGVA 1KBPA 1B4JL 2DEWX 4JPVL 1ZA6A 1ZTXE 3CIQA 4KV5E 4M1GL 1AHWA 2RD0A 5E9DE 5FECA 3QEQB 4Q6KA 1ZGLP 1ZS8B 5JHLA 5A2LH 2D4DA 5L2KE 2W38A 4UQ9A 4R5VA 1N10A 1EHAA 2DMHA 2Y06L 3TO4A 3WKMH 2XDHA 4YHKH 3QSKB 3VO0A 1R75A 2ZUWA 2XVBA 4JHAL 4PP2A 3LQAH 5F3HA 5K59F 5BQDA 3Q8AA 2ZF8A 1RJZA 4B7LA 2HMID 2MPVA 4PJAF 4HIEA 4EKXA 3M7OA 4KI1A 4LCYA 1KCSL 4NLAA 4KZEH 1K8DA 1T6BX 3JWOH 5CD5D 1BVOA 5DEFB 1IQDA 1RFDH 4ODWB 4BSWA 4YK4B 1J86A 3E6FA 4KXCA 1FVCA 3FNKA 4HIXH 1U0QA 2Q10A 2IG2L 3IBEA 3OC5A 2AK4A 1FRGH 1AMXA 4OZFH 1JFHA 3O0RL 1B4LA 3DVGA 2ROYA 2H9GB 3HKZA 4NQDA 4M7KH 2AJ3B 3N04A 2K78A 5JQIB 1MJ8L 5LGJB 4IOFC 3ZIMA 2A99A 2VDOL 3RUGB 4Z1PA 3D25A 2HFGH 4K5LA 4XP9H 4J3VA 4JFPA 4PB9H 3NCJH 4YDIL 1PMYA 1R19A 1GZPB 1OW0A 2X3CA 2X9ZA 3WY2A 1R3LB 2DIBA 5LBGA 5I66B 5FCUL 2V5SA 4XRCA 4OI7A 1G1KA 5E4EB 4Y4HA 4NN7C 1OAZL 4NO0A 5GRUL 1OF0A 3TH4T 1IKOP 5E08H 2RACA 2H32B 4Y8AA 32C2A 4PTTB 4ZUTB 1CTMA 1G84A 2R0WL 4F33A 1E8WA 4OZGF 2H47C 5SX5H 2J3SA 2C9SA 4Z23A 3O45A 4JJOA 4P5KB 1CL7L 3O6MH 3BUYA 2KZWA 1N8OE 3CV5A 4ORGB 3ULVD 3I6GA 1FAKT 5CEZD 4H1LA 2XNAA 2EE3A 3MGOA 3NIDE 1MEXL 3KGSA 4JFVA 2VUKA 4JEGB 3V0DA 2WYZA 4YIQA 1JOIA 5KTEH 1GGCH 2X1OA 2OMTB 2PP7A 4R84A 4G8FA 2K7QA 4FMKA 1DJIA 4O2EB 5DRNA 1CE1H 3O0LA 3QUXC 1CLOH 4URTB 4M4RB 1RUPL 3O3DA 2HJLB 3CZUB 4RGMB 3PWUB 1CDCA 1OV8A 5I1AB 4OSUH 1KB5A 3V4PB 2E7CA 1CGSH 4ZOBA 4JDEA 3AM8A 2VLLB 3CN2A 5C97A 1TYJA 5IJVB 3RY6A 2AF2A 3VGAB 1KYFA 1RKRA 2Y1AA 4ZTOH 2J5WA 3MRJB 3QAZC 4GAGL 1LP9F 4CKQA 1PY4A 3JYBA 1K4DB 4OGYH 2MNJB 2VXSH 1NCCH 3TNNB 3HA0A 4XVSH 5L2KA 4PWGA 3REVB 4YXKL 1OGAA 1BX2B 3BQUC 4J8RA 1DANU 4FG6C 2F5BH 1FH5L 2AQ1A 5PAZA 5KVFH 3DO3A 4UQDA 1T0MA 4DNLA 2EDEA 3DUHA 5DDHB 5ANHA 2QKSA 1IKFH 4JAMB 4NKOB 4ZG1A 4E41A 1NKGA 3TH2T 3AUWB 3DECA 3UJJL 4A63A 3MO1A 2P80D 5ESVA 4NUGH 4M8VA 2WXNA 1IX2A 1N0LA 2DLGA 2QL1A 1XGTB 2IAMD 5I71C 3HUJA 4APQB 3V79C 3RHWK 2Y2TA 4PBXA 4XNZB 5J6HB 2QGDA 2EICA 2DQFB 4ZMLA 1IJNA 1FLTX 4HJ1A 5AZEL 1V05A 3HC4H 3NSJA 4X9IA 3G6JF 4HUWA 3H9ZA 4UQCA 3CHSA 3U9PH 4YXLH 3HW7A 1TZGH 3NJIA 4PGEB 2CHDA 5IJKC 3JZYA 3K72B 1QW9A 1T66D 4Y2LA 1ZXQA 4NO5B 1JZ6A 1I4FA 3WJJA 4KQ0A 1GAFH 1IMHC 3OKEB 2VN6A 1P7BA 1BOYA 2BVYA 2E5EA 5HGDB 3S7GA 2CLRB 5EIIG 1G9MH 4BELD 1ZA3A 2AXHA 2BCKA 2C5DC 4OGAD 5EV7A 3HNSL 4H20L 1UB5B 2ICCA 3EOBA 3D69A 3ML9A 3BZFA 4GMTH 4BGLA 1FBIL 2XWRA 2BCMA 3CN0A 2E6JA 3WEOA 4LSUL 5GJSH 1IM9D 3U2IA 4BK5C 4Y89A 4N6QA 2Z31D 5JHLH 5EBGA 1N5AA 2E86A 3E7JA 4XPBL 2DTML 2ZD0A 3L5WA 5DHVH 3U48A 5FIEA 3VFOA 3ULUE 2WWNA 5FW6A 3U0PB 2Z9TA 5IMLA 1ZLUH 3LDBC 3WIFA 2IH9A 2PPAA 2YEZB 5FAAA 4W9IC 4JM2A 3IVKB 1NMAH 2WK2A 2VDQL 1MHEB 1SVBA 1E4XI 4AOFA 2EH8H 4KKAC 4RIRB 4TSAH 5DK2A 3GSRA 2OS7A 3A22A 1A64A 3AGVA 1N68A 4GQPH 2HAZA 2DLFH 2YD4A 1QLEB 2C1PA 4HIPA 1NMBH 2KI6A 1JUFA 4H2AA 3TA4D 1KY7A 3FOMA 5HDOA 1B2WH 4A37A 3BAXA 1BMZA 4HSQA 1DVFC 4LSVL 1NGYB 4RBPK 1ZTXL 2XYCA 3QCUL 4QJ3B 1RURL 3RB5A 4N5EC 3HBGA 1UATA 3V9FA 3KYOB 3MA9L 3L4WA 4J3TA 3Q8BA 3E2HB 1TENA 4D3CL 1LO0L 1TVDA 2OJZH 5IR1A 1U8KA 1OSZA 2F53D 5HXMA 4W9EC 4OF3A 1TFHA 3BSZA 3Q44A 1AS7A 4PLKD 2VDPB 4WJKB 1KNOA 3QUML 4RAUB 4Y1AD 4IRJB 3H2WA 1KCRH 2DIEA 3QIBC 2PMZA 4YMPA 5CLTA 1CXIA 2C3VB 4N5UA 3RZCC 5B3SB 5FXCH 1T2QL 2WQXA 3I2CL 4PTUA 3KXFB 5INCB 1YN6B 3M8OL 3TEUA 1YUHA 5E8EB 4XC3H 2D0HA 5E03A 1TETH 4HUWB 2NYYD 1DFXA 2EKSA 3IJEB 5K9KB 2WXGA 3P3UA 1I7TB 2A9ML 4HXBL 4EIUA 3FJTA 5DF0A 4MXWL 1RZGA 1KOAA 4OZHA 3UDWC 1C5CH 4RETB 1PS3A 5ALBL 2ZSWA 3QDMB 4NQCD 3V9CA 3SY0A 4DZBB 3BPCA 4KK6C 5I6LA 2CJUH 2WXPA 3DSFH 3FCUB 3INOA 5EF3A 4N8VG 3BH4A 3MR9B 3US1A 2D03H 3NFNA 3DMMD 2BHUA 4YJZL 2XPZA 5ES4B 2IPUK 5A6IA 1FORL 3H9SB 2D9QB 3QZMA 1HH9B 2X9XA 3ZDXE 4A38A 1XR9B 3F8UB 5FO9A 2PN5A 5AAMC 3ULSB 1KWGA 3BQVA 1MH5A 2XA8L 3SY6A 3PFQA 3TBSB 1H6FA 2YRZA 3CLEH 3K4DA 5L2KB 3VRLF 2HP4A 2EILB 2H4EA 3RVUD 3GXIA 1KEML 5EO1A 5GGSY 3V95A 2JQZA 4CW1B 1AQMA 1XB3A 3O9WA 1QR1A 5JIQA 3QYMA 3CXHK 4XXCA 2OXHA 1JWMB 4Y19B 4XHJC 4ODXB 5AUMA 4EI5D 1BYPA 4F37F 5E7FA 4XP5L 1IBZA 2B8OT 3E6FB 43C9A 3NCFB 3OGCA 1QO3B 1ICTA 4GBXC 1LYQA 2GAZB 5LAXA 4YFEA 2HWZH 3MHZA 4YDKL 3L9RA 4WI4A 3AG1B 4E0RA 3UC0H 4DJMA 4GUPB 5F7UA 1GS7A 3NJJA 4PJ7F 1QOKA 4BDVA 3KPSA 5JYLA 2Q86B 5IMMA 5D1XB 2LU3A 2X41A 3QO0A 1N70A 1WJ3A 2DLTA 4R8WL 4YLQT 1BM7A 1MRDH 1HCYA 4K15A 2DL2A 4WFHE 2P5ED 2R0KH 3HE6C 5EZIL 1Q9WA 4G59C 2JH2A 4ODHL 1EAQA 5FM8A 3KPMA 3WNMA 1ZA3B 4YDJB 4OZIE 2ZUQB 4AENA 4TQPA 1WFTA 3K72A 4X5LA 4LU5L 1XTLA 1D5BA 4C56B 1SLUA 1UH3A 4XBEL 3VH8A 4FN0A 3PUCA 1FAIL 3VGBA 1F13A 4PJ5E 2H32A 5DD6A 1H9VA 3QUZB 1CL7I 3FO0H 4R4FL 3BVVA 3P9LB 3VXSB 2A9NL 4FNPA 4XMLL 3TWCL 4MYWB 4P4RA 2WLIA 4JRXA 1DBBL 1TU2B 1VPOH 2VDRB 1KYOK 1IBBA 5EF1A 1XGPB 3RTQC 4XHQA 3IFNH 4Z18A 1DEDA 2AXFA 4L37B 3L7EB 5AYQA 4RDQG 1MIEH 3BSZL 1BQLH 4OF0A 4OTXL 3HUJB 4APQA 1SXBA 1V3MA 2GQHA 4L23A 2H0PA 3EHBB 4DSYA 2CUMA 3V5DA 1FGNL 4ZD3H 1OM9A 1TSHA 4LBEB 1QSEB 2IAMA 4HZAA 1AD0A 3SJVE 4WW2F 3L8QA 4MNQB 4FZEH 2NUTA 2GJJA 3W9DB 4N87A 5EU6A 3GWJA 4NC0B 2MEJB 2AJZA 3KW7A 5DHVB 2IADB 5CUSH 3FPXA 2PO6B 3IE4A 3CQPA 3ZE0B 3OKOA 4NERA 5A43C 4AYBA 4K3DH 3DETD 1A6WH 3OG6B 2FSDA 4RWHA 2KC0A 2EYSA 3MRDB 3QG7L 5TJWK 1QD0A 1WBZA 1HYSD 1LNUA 3MUZ1 1UYWH 1MEXH 1GGIH 4G7QB 4N8CL 2GEEA 1ADQL 1Q9LA 4G8EB 5KYXB 1W2KT 1H0DB 3CDYA 3N1QC 3GRWH 1Z3GL 4YPJA 5F3HB 1AD9B 1H5BA 3QUXB 5KN5A 1U93B 1ZCRA 4P3CL 3BWUF 1DSYA 3G5YA 4DTGL 4IGBC 1VGEL 1EJOH 1ACXA 4JQXC 3U7WH 4BH7B 2AMGA 5T3ZE 1J5DA 1NIDA 4YBQC 2NX5E 1S46A 1JI2A 1W9XA 3H42L 5IROC 3WIIL 1MFEL 4G70B 2WSKA 2P5WA 3BWZA 4KAQH 3U1SL 5EOTA 2R8SH 3AG2B 4LASL 4FXLA 4PVBA 4YSUA 5CCJA 1J8HD 3H56A 1XWVA 1PJ9A 5I8KL 2XKUA 5I1HH 1U58B 5HYQA 1IVLA 1NGQL 2UY6A 4TVPE 4FI6A 1I1AC 4N90E 1XGQA 1RJLB 4OUUB 1X4XA 5EUOE 4QXGL 4ZRGA 3UDWA 3PWNA 5L0QC 3M1CA 3OKDB 1GOHA 1F56A 2IPKA 1LWRA 1HHIB 2UY7B 2IWGA 4WU5A 4CKVX 3L3OC 1UUNA 2P5PA 1QRNE 1MVUA 2OK0L 4JDTH 3C5JB 3ERXA 4KV5F 5BV7B 3KXFD 4X7CC 3EXJA 4IDJL 4PY8I 4HZ1A 5FKAB 3BLBA 5D93C 3DLQR 4IOSD 1DVFA 3LX9A 3NFSL 1G9NH 3MSPA 3T1WA 4WAFA 3WY4A 2YPKA 4KDWA 1EZSA 2R56L 3MI6A 2X89D 2NY0D 1MCSA 3TZVB 5D7EA 4YE4L 4HJGB 2EINB 5E1GA 2DI9A 3GMMB 3DVGB 2CLVB 5ACZB 3S35L 2VZOA 3B1TA 1ETA1 1VB9A 4JFDA 5ERWB 2FJHB 1A3QA 3T9WA 5JA8B 4YFLF 1NGXA 4UV7L 5DRXB 5HJBA 2X4UA 4OIIH 3ZDXB 1S9XA 1SYSA 2FX8H 3ARQA 4FL4C 3H9HA 4JRXE 3FT0A 3VH8B 2W07A 4MJIB 1JXFA 3QIBD 3DRTA 5IG7A 1RJZB 1SDAB 5AVRB 3DOIA 1PZCA 2W80C 4LCYB 4YHOH 3EH5B 1CXKA 1TQUA 3QDME 4PJIE 4Q89A 2UXVA 4WWPA 1E28A 3LRSA 3NFPB 4LSRL 1CG9B 4KXDA 5D7HA 1TQWA 5EU3A 5EUOB 5LN4A 1ZS8A 1ZLDA 2AGJL 4XXWC 3WFEL 5B4MC 2P5EE 2ZWNA 4QRAA 2QFRA 1LJMA 4LSVH 1BJ8A 3N9GH 5IMMB 1HN1A 1JGEB 1CTOA 4NC1C 2BSSA 3AY4A 5DJCA 2XYBA 3ARDD 3NG5A 1TQBB 3IDNA 3UTTB 1FL5B 4TNVK 1ZAGA 3D4GA 4KUZH 3CK0H 2O5YL 4GEIA 4MNQD 1RUML 5D1ZD 3RNQB 4M8UA 4GW4B 4AUYA 1I9IL 2FD6H 4GS7B 1L4IA 2NLJA 2RR3A 1FO0A 3ULUL 3IFOA 3FRUA 3ABMB 3OHXB 4PJBA 4J6RL 1IIIA 4NP9A 4DKDC 4UBDD 2BVQB 1KJ2B 2VLJE 3FRPB 2W60A 5FUOH 2F7OA 1Y6MR 2LAGB 1U8JB 1UH4A 2C4XA 5CHNB 1CXHA 3KWVA 2WIIB 4QRRB 1GYAA 2WQRA 4WI0B 3TBSA 4A6YL 1BZ9B 1NC4D 3NIDF 2VSMB 2ZF9A 2KZBA 3IDMA 2EC9U 1J8HA 1WSST 3LKNA 3BIAX 1T7XA 2IADA 1PSKL 1N5YH 1BVKB 4GFTB 3H3PH 1TOXA 5AKTA 4GAYB 4HD9A 5FYJD 1OAKH 1F4WL 3OKLA 4XWGL 3C08H 3Q1SL 4H44C 3ARGB 1JVOA 1SQ2N 1KB5H 1WAEA 1XCWA 4YHMH 1AI1H 3MRIA 4ZYKB 2XZAL 1CFMA 4HBCL 4PJXB 3V4UH 4X6BA 1MCKA 3GBEA 4NJ9H 5E95B 2D2OA 4NS0A 1BFVH 2A38A 3MRLA 4XGZA 2YAMA 4AL8L 1S7XA 4ABVA 3LKOB 3KLSA 3ZY7A 4KMQA 2D7TH 4NGHL 3KPRB 3ZDZF 3IN2A 1EVTC 2XX1A 4P5TB 4JY4A 4CJ1A 1TU2A 2I7OA 3H6AA 4Z7UA 3CHQA 2QTVA 4KRMB 2ADFL 4EXKA 1MWOA 2P44B 4R5TA 2R9HC 4G6KL 3VE0B 4YDIH 4Y4FC 2GK0B 4ZX4A 5JMRA 3I9PA 5CFHA 1LO2L 4X6DA 5FYJU 5HI5D 1ZANL 2AMUA 3MU3A 3OF6D 4PBDA 2ORBH 1P4IH 3QRLA 3ZR6A 2XI9A 3TEYA 5GRVL 3T08A 2JCCE 3EYFA 4G6JL 1HSAB 4TV3A 2J57A 4RVBA 3P4NA 3H0TA 2QSCL 4NHCH 5L2KD 5HHMD 4NN5B 1BAGA 1IGJA 3C60D 5E8OB 4QOKA 2GBTA 4IMKC 4XCNA 4XN9A 1IC5L 1MHCA 3ZL4H 3Q13A 4X4YB 3MGAA 4QY8A 1QLRB 1MW1A 5F0JB 3S88H 5EN2B 3NCYP 2VWEC 3P2TA 3SE3C 2XKNA 1NCDH 2X6VA 5SWQB 1TZIA 2W9EL 1A4JA 1VFBB 3X2QB 3SBWA 4E0RB 4MTMA 4LAQL 4E41D 3VD5A 2OP4L 1L6ZA 1VPOL 2FO1A 5F1NA 2Y24A 2DD8H 1JAEA 3EGDB 1QEWA 5I1CH 3RWIA 3UO8B 1XF2A 4G8IB 3FTVA 4IEFA 4A7TA 4JG0L 5DD1L 5EU6B 3QORC 2WUBH 4TVUA 3VNZA 2YAOA 5ANMB 4RMVA 4G9FA 3IB4A 1U3HC 2JKWA 3O3BB 2BOLA 5DR5L 5FYJH 1J05A 3RDTB 3RFZB 2HRHA 3BXNB 1RK0A 2PTVA 4NXKA 4JHWH 5LG6A 1RLBA 1PG7W 5IESH 4YFDB 4FQIL 1RZQA 5GSVA 3CFEB 1HL8A 3KR3L 1H5BC 4K7FA 1GZHA 1WUZA 4YHLL 1S7TB 4AEIL 2G60H 1F8TH 1T89C 4BKLB 3DKHA 1E9QA 4KVCH 3TCLB 4GP8B 1H15B 4CSPA 4WKZA 4HHAB 2PPEA 4WSJA 4XX1E 3UPAA 1CGUA 5C09A 1AIZA 5SWQA 4JRYD 1LE9A 3FS9A 1J5HA 4DUWA 3AACA 1PLGH 4LLWA 2DQHH 4DW2L 3VU1A 3SCMC 3CN1A 5IVXF 2Y0SA 3K2KA 1A3RH 2AK1L 4FJZA 4ZTOL 2CR0A 4TUJB 2YD7A 2ZCZA 5JNYA 2Q8BL 3VXRD 1GY1A 1YPZA 3VM7A 2UZYB 5BZDB 3CAFA 2ZJSL 1TXKA 1R1CA 4K9EH 1CWVA 4XI5C 3V0IA 1HC1A 4H0GA 3K6SA 4N2AA 1TG8A 3A4EA 4NDMA 3UBXG 3ARVA 4F58H 1RZKL 3KXFA 4XN1A 4TTGA 1DLFH 1U3JA 2RIKA 4M48L 4QRTB 3ZE1B 2IDTA 1KT2A 3JWDC 3L3IB 4AV5A 3KPRA 3C8DA 4JUTA 1JHKH 2VLKE 1HZHL 3GEFA 3DGGB 1RMFL 3NDZE 1A7BA 2PCYA 2ZCKH 4S1SL 4N85A 3U4BL 2A77H 2LVEA 1QKZH 3ZT5A 4BZ2H 1ZV2A 1N6QH 5IEHB 2KUTA 4KAQL 2FHFA 1RJYA 3S0PA 2YD5A 1B2WL 1PLBA 1YJDH 3HFMH 3MAWA 1SN5A 5DMYA 1JZFA 3A67L 1M2VA 4J8RB 2H26A 2WTRA 5F7DA 3GJEA 1HWHB 2HTKC 3OZ9L 3JWOC 3HMWH 3RWGA 1XR9A 2DBLL 3ZE1E 3BT0A 4S1RH 4F2MB 4UIMA 4U33A 4WI0A 4P9HH 5DI8A 1MCIA 5C8JB 3CVHB 1IGCL 3CSYA 3S8FB 1CLZL 2LV4A 3DGDA 4MJ6B 3UYRH 5MHSE 3DWTA 3EDKA 2XWZA 5DVPA 3PWPA 5IR1B 5C70A 2AQRA 2CR6A 3GD1C 2BSED 5CWSA 1J1PH 3B37A 3WNJA 3OXSA 2CJSA 4RX4A 3SDYL 1A5FH 1OLLA 4JGJA 4Y9EA 3RY5A 1M2OA 3FT3B 5C07B 3ZW3A 5D7KE 5FDWA 2XTJD 3U4EA 4GI9A 1YAIA 2BP8B 4DP2X 4ELME 1QYGH 5EU5A 2EXYD 4WI8A 4YGVB 4CN6A 5KG9A 1J88A 5BMFH 2CKNA 2TSBA 3RDJA 5C0GB 3CHOA 1DL7L 1DSWA 1WFUA 3MLWH 3QP3A 3FUJA 4QCIA 2YGVA 4TOYL 4K3EL 3VMOA 1L6XA 3BDXA 3GI9L 2Y1VA 4KZEL 2O5XH 4IBQA 2OJ1A 3G08A 4KJWC 4OJAA 5HY9A 4U1LA 2NY4D 4IBZA 5B39G 3BIKB 5IIEB 2FWUA 4J27A 4Z7OE 3ARFA 3E8UL 3MRFB 5BV7H 1WHPA 4AWJC 3LNEA 1HEZA 1J87A 4XTRC 1P5UA 5GS2D 1QFWM 2EE0A 1NJ9A 2GJ6B 5E8PB 5T3XD 4QRBA 1SM3H 2P28B 3RX5A 2R1YA 4J8QA 3TT3L 4LSSH 5D4JA 4QJ5B 4XO9A 3QG6A 4B7IA 2EO9A 1G5GA 2F1EA 3IN0A 4N9GA 4RMRA 4HWBA 4IM8A 3DX9A 3D2UA 3ZUCA 2XQYG 4HCIA 4WFHD 2VO5A 3BZFB 5D7KD 5F3BB 2XTJE 2L7EA 3SPGA 4GG6B 3F5WB 2B4CH 4PLNC 4PJHE 3K6OA 2HKAA 1OD7A 1MIMH 2DLFL 4HIIB 4G9FB 1O75A 1NFKA 2AQ3A 4POUB 4DOHE 1SGKA 5JQ6H 5KUKA 3OJDA 4QHUA 2FIKA 4QPEA 3X14A 2QQLL 4AZUA 4NJ9L 2OZ4A 4Z76B 5L8JB 1G4RA 3HE6B 3A4FA 2E9BA 5IJCC 2VC2H 3N41B 2HVKA 5A3ID 1HOCA 1EFXB 1O9WA 3VFMB 5CN2A 1X9UA 2AJUL 2P43B 4X50A 1EBAA 3IDXH 1YNTF 2I69A 5IGXH 1DJWA 1SHSA 3CZLA 3D30A 4Y5YB 3KCPA 5AOLA 3DVNA 2CQVA 1OZUA 3NABH 3KLAB 1DQKA 5JMOC 4W9JC 4DVBB 2G4EA 1KELH 1B0RA 1FE8L 3PAVA 6FABH 4NHUA 1UWEL 1HZKA 4N0YL 2AXJA 3SGDH 2J5LC 3S36X 3OXRB 5EIIA 4IKLA 1BQHA 1IL1B 3QXDA 4KZDH 1NCBL 4YWGH 3WL9B 3SKOB 1BEYL 4E41E 2DQDH 4YC2B 1FLRH 1YEJH 2X2UA 3DI3B 5C07E 4BH8A 4JR9L 3OKEA 5SWSE 1ZA6B 3SDAC 5HD8D 1A9BA 3GO1L 2FWSA 3PGFL 3EGSB 4HJJH 1JYVA 4EOWL 3ULVE 3ABKB 4Z7WF 2CBOA 3GZOA 4JY4B 4XR8C 1IAIH 1MI5A 4EDXA 2ZOKB 3ISYA 4OGXH 4ZUUA 3T3PF 5E94A 1INDH 5I76B 3QK0A 4UTBA 2ZXWB 3NA9H 4HUVB 3OJ2C 2UZPA 4A7QA 1UVQA 3VD3A 4OJDH 1T5WB 3O3EA 4TQIA 4XB3A 3VXME 1JGUH 2AXGA 2DMCA 5KS9E 4DOHB 2K6WA 2WVTA 3W3BA 3L3DB 2EDDA 4N2DA 4I8DA 4UNTA 8FABA 1HSAA 4XPFL 3RI5F 4UDTA 2FYYB 1X4ZA 4D0BB 2JQAA 1LNUB 2JWYA 4JO5A 4M3JA 5D5ME 3G7TA 3G6DH 1XH0A 3GTVA 3IMTA 3NIGB 3EH3B 4N2HA 4QTHB 3BAEL 5DS2A 2F8VA 1AKPA 1V7MH 2XIIA 5JIHA 2GSIA 4IRZH 4Z7VF 4QRSA 1MLBB 3NIGE 4UOW0 5DWPA 1CE1L 1RJCA 3MJ9H 1A2YA 2LE9A 4Z78B 2AJZB 4PSRA 2EO7A 1YEDA 4NB7A 3LNHA 4OLZH 3KYMA 2VLKB 5F9JB 4HDIA 1V7ML 4H8HA 3OKNA 4UIKH 3PLYA 3NZ8A 4M62L 5FA3B 4NQSB 4DO4A 4X6CE 1D6EA 3DUUA 4EDWL 4NZUH 3N6YA 4HPOL 2J43A 2HH0L 4PIRF 3EO9L 2ID5A 2X4QA 2HG5A 2Y07L 3RU8H 5I0ZA 2BP0A 4WEMB 2VXUL 4FG0A 3OL2A 2VZ1A 1K5NB 5D71H 1IAIM 4WLCA 3RNQA 3BWAB 3QQ9C 4G6FD 4RA0C 5FKPB 4G8FB 3QUYA 4Y16B 4ELMB 3UZEC 5AALA 4M5YL 1DBBH 4AQ8A 5AVWB 2XJLA 1HU8A 3BP7B 3MREA 4WGKA 2JI2A 8PAZA 1RD6A 2LR4A 5E2VH 5IHZB 2ZT9C 3WLWC 3GRBA 1E5CA 1HOEA 2IF7A 4LGSB 5DC4B 4RRPA 1WWBX 4E9VA 5LGJA 5JXAL 4KNUA 5DGQA 3FT2A 3D4CA 1J9SA 4XMVA 5FLVA 3OZ9H 4Y2NA 5ITFA 3EUUA 4JFYA 5C7XH 3DVNB 4ZMOA 5D7LE 4PGJA 3TO4D 2VN3A 3QI9B 4G8GB 3N0AA 5I1HL 1FBIH 3QC5X 4OM0L 1JGIA 1YHPA 5D93B 2X4TA 5C07D 2BY1A 1YY9D 5DK0A 3T65A 3QA3B 3KDPB 4KTGA 2DWEA 2X42A 5KANI 1MFEH 4NN7B 5FB8B 3L7FB 5FA4A 1VLXA 3MYZA 4PM1A 3RGBA 1XFPA 15C8L 1CG9A 4BINA 3EBIA 2QLVB 4JNXA 4N5ED 4JO2L 3EFFB 5E6IA 4LHUG 4PRHE 1ZXKA 2OYPA 3VXMA 1WAAF 1A02N 3MV9D 4PJEE 4G8AC 4U1HB 4DWHA 2ZXCA 4DQOL 5GQBA 3HG1B 5EUKB 5KSVA 5JHLL 1SXNA 1O6VA 1CBVH 3D12B 1N6VA 1J0IA 4OM1L 3ULUF 5AW3B 4NKMB 4UNIA 4TTDC 4WHYG 2K9UA 4B9PA 3G9AB 3EOAA 2WKOA 4M7ZB 5DHDA 2R29A 1JZ2A 4F91B 1CGTA 4L9LA 1IGML 5I1KL 3RGVD 4Z7OB 3OWRA 4P2RE 5KSAD 4AQ1C 3ZHNA 3PU7A 3OKKB 4X4XB 3NCXA 4O02A 2OKMA 4KQ3L 1CDBA 2A3TA 4X0NA 5D9SA 5DK3A 4E5XB 1QATA 3F64A 1CFQA 5C6WH 3G6JA 4ONHB 3SOBL 3MBXL 4WEEA 4DPRA 1BPVA 3ZKMC 1OAXH 2BHZA 3E0GA 1BJ1H 3BAWA 2NY4B 1UQSA 4HLZH 4O9HH 3QUGA 4IQHA 1ZT4B 1AZCA 3FT3A 3T09A 2QKIC 2E7LC 4TULL 4F8TA 4FHKA 4LSSL 4D9RE 5LO7A 3WHXB 5HDLA 3PWPB 1WV7T 1TO4A 1UOVA 2JJUA 2O30A 1UVQB 3T4YB 5I1KH 1SVCP 2CE6A 3R0MA 5B7MA 5FA4B 2QPDB 3C5ZC 5IQ7H 5FDYA 3WUZA 2WLKA 3IJHB 1NC2B 1MAMH 1XMWA 4L1HA 1KULA 2BS9A 2DQGH 4QGTA 4HUXA 1IGCH 5FO8B 4GKZA 3WFDH 1VAHA 5TE7L 4J6RH 4G8GA 5AVSB 3BKJL 4PG9A 3RIAK 4S1DC 5AW5B 1U2HA 4BH8B 3TO2A 3UBGA 1XF3B 2D3JA 4BHUA 2CWRA 2QVTA 4NPJA 3RNKB 2V8LA 3UJIL 5A2JH 5KYYA 2X12A 1OSEA 3NMEA 5BVPL 1ZHKB 4FLHA 3MVSA 1EJ6A 1JGEA 4XAKD 3BMVA 2NZ9D 4L3ED 4GBXA 5ALCL 1JMXA 3RVXC 5A2CA 5CJXA 5LN8A 3TURA 3SDAB 1ZTMA 4BUQA 4ZMVA 1RIHH 3SGEI 4JL1A 4Q2ZA 2FL5A 3FU6A 3MLUL 2IC2A 4N0UA 5EU6D 3WFEH 4N2KA 4L9LC 2HT2C 4PFEA 2WINA 3D39D 4HJIA 4AJWA 3N85L 4Y5VB 5INDB 1Q0EA 2CHNA 4ZFFB 3DXAE 4HAFA 3K6SB 3T0XA 4Z5RA 3U7YL 4Z76A 4XBGA 1XGRB 3O6LL 4HKBA 5HYJD 1TVHA 5ITBL 3VXOB 1QUPA 2YBGA 4M93C 1CIUA 3UG3A 5DFTA 2AEIT 4GLRH 3V0JA 4P46C 5LKNA 1IE4A 2EAEA 5F7WC 4ZFZA 3UG4A 4E9WA 4MCNA 3ZGHA 3TV8A 4F7PA 4AUJA 3OKNB 2P8PA 3B7RL 5MERA 2CNZA 2E7BA 4MJ5A 4BQBA 4ELDA 4M5ZH 1KGIA 1TDQA 4PRNB 3MODL 3IFLH 4GRMA 1RUAL 1I53A 2F5AH 3VDCA 4M1DL 4I4WA 1P6WA 5EBLA 1NICA 1OTTD 2HKFL 4CBZA 2JVUA 4LPVA 2W0KA 2BSEA 3MYJB 2I9LB 4ELKB 5LJYH 5B1JC 2XN1A 3QEQE 3AQZA 4HUKB 2CR3A 4PCYA 4YHKL 4UDTB 4TSCH 4IBWA 4MMXB 2OMBA 4YQXL 1K8IA 4YHZH 1DJYA 4I2XE 2R29H 3CWGA 3VYOA 2RGSA 2VWEE 1LK3H 5I76A 4D9RD 1AS6A 2VDQB 4XPFH 3OLGA 4AT6B 2N59A 4KTEH 4ERSL 4G43B 1HK6A 4G71B 1KTCA 1HX0A 3OZLA 4A7UA 2WUCL 1MZZA 1J9CT 1GOGA 2E0PA 3ULSA 4GT0A 2HT3C 5E5MB 4CMMB 1YN6A 1KG0A 3I9GL 4RESB 1EEUA 1NMCB 3US0A 5IFAL 3IKKA 1PKQB 1MWAB 2WBJB 1IV8A 4LCUA 1KGCE 2Z4TA 4ODUB 4Z7QB 3ILPA 4DEUA 1YQVL 2CALA 1J9TA 1JNHB 1QSFA 1YY8A 3I9GH 5IFJA 4Z7QE 3D3VB 1F8TL 2AAVA 2H6UA 5CD3B 1FN4A 3P1VA 4PW4A 4CC1A 1IKNC 2E76C 2JTDA 1KZYA 1PFCA 4KK5D 2ALAA 5H94B 4QYOA 1L7IL 5GRUH 5A7BA 1AXSA 3SODB 4WY7L 3I6LD 4FNQA 1ZSDB 3IJEA 2AV1B 4W6XB 2IGTA 3ENEA 1OF2A 3LN4B 1IKNA 4KRLB 1E3FA 5FO9B 3QW9A 2R4SH 3CTTA 3VE0A 2XQBH 4EUPG 4MMYB 4XBPA 3SPIA 3BO8A 2MTAA 4ZXBA 3LAFA 1J0JA 4JQVC 3ZQWA 4UAHA 4J1UA 5E5UB 2C9PA 4KQ4L 2ZJSH 5D5MF 1UZ8A 1WP6A 4JHBA 4AE1A 1NCDL 2APVA 2IDSA 4NKDB 4IDJH 2IJ0C 4Z3IA 1KJVB 4MJJA 2I07B 4PREB 4EJ1C 3HNVL 4KO6A 3QDJE 3U9UA 3AXLA 4A2MA 1U2YA 3RIAF 2FUTA 2NY0C 4G5ZL 5IOPA 1TFPA 3KPOA 1ANUA 3JV4A 3VQ1C 3WDHA 4M7LT 2H0FA 1BZDA 3MJ6A 3EJZC 5F6HI 1MCLA 1M42A 2B7DT 3F7VA 5FYKE 2IQ9L 1QKZL 4EIZC 5AOKA 4B3EA 5GZNC 1F86A 3BCFA 5D7SH 2N7SA 3HC4L 3HZYB 2FTAA 1FPTL 3FYEB 3D39B 4NI6A 3T1FA 2R23A 4P3WA 2Z34A 2PTTA 1TCRB 2Y9RT 5HY9B 4AE0A 4JDZA 1K4CA 3VU2A 3WDIA 1M7IB 3MOBL 2D31A 4R7VA 4HGMA 1LE9B 3P77B 3UADA 1UURA 4LSQL 1ID5I 1BREA 4QHLA 4ZW3A 4YSOA 3IM1A 4AMWA 1MWAL 1WD9A 4JFED 3LOWA 2Q76B 2YPLB 4X6DE 4HZLA 2IVFC 1E3ZA 3ARDB 3QUMH 5F9AC 5ICXA 2JKNA 3ECBB 3L4ZA 2PWGA 4L05A 4DEPC 1HE8A 1GC1L 2WINB 4MQSB 1EHKB 1M4KA 4CDGC 4OCNC 3NEXA 3CVHL 2OM5A 5E0FA 1TLMA 2O61A 2WJ5A 4PJHF 3WFDL 2QR0A 3T2NH 3NPSB 2QV2A 4IHBA 5DJ6B 4NM8H 3TM6A 1GC1H 3U30C 1WE5A 3CX2A 3KPSD 4V1DE 1FO0H 1N19A 5FK9A 4W6WB 2F15A 3TOPA 3QRBA 5JORB 4JO1H 3BUTA 1KIQB 4ATTA 1SUJA 4GG8B 5IG7B 2VXTL 1UCTA 2DPKA 4FQ2L 2XWTB 5DUJA 2V7NA 1FVDB 1PZBA 2HLFC 1PD1A 5EBMA 4O2FA 4S0SD 5KJ4A 3ESUF 5C0AB 2TAAA 2E7DA 5I1IH 1OB1B 1RZ8A 1NC2A 2FO4B 2F8OA 3CFMA 2AAAA 2CGRH 3I3DA 3G04A 5JPMB 3D6GA 4JANA 4UV7H 3MBXH 4V1DA 3BIKA 1G0XA 3AWEA 3WHXA 3MLTB 1TJGH 2QHRH 2DN7A 1IT9L 4XCFH 5IVZB 4PGEA 1ZT4A 4B9IA 3F01A 3TU6A 3KPRD 5K93A 2PTUA 1BJ1J 3T6ZA 2I9TB 3MRMA 4FA8A 4FYTA 1MCBA 1U30A 1ND0B 3HN3A 5IHHA 4WO4D 3MA7B 1HYRC 3AXHA 3N1PC 4PJ7B 4D7BA 5DHYB 4OZFG 7FABH 1HNGA 1MPAH 2YA1A 4PRID 1NL0H 2HRPH 5C9JA 1SLVA 1XAUA 1ITBB 1OQOA 5FHAH 2VW7A 3C9NA 4Z6AT 4PH8A 3Q6GL 3WEMA 3NEEA 1MPAL 5GRZA 5J56B 1XSJA 3QJXA 1XHHA 1P0SE 2ED6A 4L8BB 3MGTA 5DEGA 1MNNA 2LGNA 4F20A 1MVFA 4HOWA 5EFIA 4QJ4B 3KXFE 4QIRA 5L2JB 4NO0B 3NESA 5DUBA 5LNDA 4EQ2A 4NRZB 5TQ2H 4NRYA 1Y0LA 3HVDA 1CC3A 3LKPA 3IFLL 1BZ9A 2AFNA 5C09D 3ZDYE 3EYQD 1YPZE 1N0XH 4EUPA 1J8HB 4BH7A 3LV3A 1X5LA 4ICXA 3E1F1 3JTBA 1RSFA 5E5MA 4EAEA 2D3VA 1KJ3H 4K3JH 4PHZA 3SYAA 1W91A 2O5YH 4HD5A 5DHXB 5K39B 3RILA 4X6CF 2HB0A 3DHJA 3QDJA 5AW2B 3TIDB 2VDLB 2W95A 2XZQL 5I0WA 2VLLA 1MRCL 2F54A 2W60B 3RQ3A 2BFVH 2YRBA 4FHJA 3LNFA 1TETL 1P5VA 3BUIA 1QLFB 3FONA 3B7TA 3FO0L 3L3IA 4MDIB 4P8QA 4CA4A 2WGNB 3B9VA 4RMWA 5BCAA 2AHIA 3JWNC 5D4HA 1WISA 3GHBL 3VFNB 1NH6A 1SFDA 1FL5A 3MDJA 3AS3A 4LAQH 25C8L 4HW6A 1T5XA 1GR7A 3ZK0A 1KYOJ 3QQXA 5DUMH 4TUJA 3P73B 4IIQB 1NBZB 2DIAA 4H1LH 4A2LA 2MOGA 3SGJC 4JG0H 3W0WA 3DJZA 1GJWA 1XMEB 2ZKXA 5EU3B 5EUOA 4DP6X 1LD9B 1MW2A 3PNWB 1TTFA 3O4OB 5LQBH 1CZ8H 1SN0A 4XOBA 5K9OB 3F3HA 3BKMH 3PABA 3H9HB 4PJDF 2DRUA 3CDZB 4G1EB 4DK3A 4ELMA 3WELA 4BBWA 3DRTB 4XVUD 2WYIA 2A73A 5AG9A 1T6VN 3QIUB 3T0ED 4AW4A 3AFLA 2NZIA 3CMOH 3GGWA 2GBVA 3P3TA 2VZTA 4IK7A 1A1MB 4FC3E 2YQGA 3D18B 1JPST 4GSDH 4J4PD 3QXVA 2AZUA 3ECQA 3RZCA 2PCFB 5BS0A 4HG4J 5I6MA 2C4FT 1S3RA 3MCYA 1P4IL 4FQIH 4C56D 3HG4A 1UA6L 1XGYH 2V2WB 1DQJB 5DSCA 4NQCE 5HJGA 3HHMA 4DHLA 2D7MA 1RIUH 3KE0A 5C0RH 5K9QI 1JZ7A 4PRHB 1J1XL 2ZPKL 1CDGA 1HHJA 1G6RL 1YDPB 3M1OA 4UB0L 2J55A 4BFOA 3TESA 1INDL 3HNVH 1DQTA 4JFFE 3MCLH 4W70A 5T5FA 1GJIA 2CU9A 2X0WA 1XSIA 4H20H 3UJTL 1N6QL 3QI9A 2V2XA 2VDKH 3SGKA 4YHYB 3RFZC 4WU5B 1SY6H 3JT2A 1CICC 1PYWA 4F7TB 4Y1AB 5KJRH 3E9TA 5AFAA 5H2BA 4NNXB 3I02B 1OE1A 4I0PD 1AIFA 1T5WA 4JO8A 2NOYA 1MJ7H 4CGUB 3CVCA 5F0MB 2HX9A 5JO5B 4F92B 1QBLL 3GK8L 3P4NB 5GZOC 1S7RA 2XN9E 4AI7A 4O02H 2F18A 2D0GA 1XX9C 2QT6A 3ASWA 5I75C 4Z77A 4W9DC 2VL5A 3VXTA 4L1TA 3LKQA 1P4LA 2G9HB 2WN3A 2NZ1A 4OGAC 4HMCA 4R6UA 5FW7A 1JK8A 1Y18B 4Z7QF 3UPCA 1DFBL 4KROB 3H9SE 4G6MH 1GRWA 1ZLUK 3X11A 4QXGH 4W9CC 1XH3A 5FUCE 3JVGA 2OMWB 1B9ZA 2EUZA 5KVGH 1ED3B 4HUCA 3BRGC 4QAWA 2ENPA 1NCWL 4PR5B 5JW3H 1GPOH 3QJTB 1M05A 1QPKA 2G75B 3MNVB 4TVPL 4KUCD 4E5XA 4PW9A 1AZUA 3F62A 3U6RA 4EUPH 5CNHA 3JVGC 3EXLA 4ODTL 1GJUA 3FXIC 3OKKA 4X4XA 5HDQL 1GYUA 5G55A 5B1BB 3PAUA 5D2LE 5F9JA 4WTZG 5PCYA 1ZSHA 3B2VL 3F2LA 3RG1C 5I9QC 4OH2A 2PCXA 4KKAD 4QKTA 1JPSL 2IXQA 3TA3C 4LCWA 2XX0A 4CBPA 5C3IA 3WTWA 1U8MB 2EIDA 4LLMB 2J6EH 1SMAA 5ESQB 2A77L 3SOTA 3UMTA 3W0WD 1HTYA 2VN7A 1K9TA 1WITA 1A21A 2FT7A 3O4LD 2VL5B 4J3SA 4OZGE 3VXTB 1WA1X 1M71B 5GGVL 1EDYA 3SD2A 4C55A 1ETZA 2KZ1B 2CO3A 4FXKA 1EWHA 5DJ0B 1NKOA 2V7HB 3GIZL 3FCTA 2Q2EB 2Z0UA 4Y1TA 3FBKA 4OF5A 2OAAA 3P73A 1L6PA 4E9SA 4HX1B 2H9GA 2GITA 4FI8A 1I8LA 4GW1A 4YE4H 3TVMA 3L7EA 1G94A 2WXHA 1XAKA 2E47A 2F19L 1LEIA 1FVCB 5D7LD 3QUHA 1B0GB 2IIJA 4PLKC 4Q6IB 2ZX7A 3T5WA 4XPTL 4K0OA 4KO7A 1ZGLM 1MDTA 4H8PA 1N18A 2FUQA 3KEDA 4PJXF 3TT1H 5GS0H 5JDSB 3C5ZB 3FB7B 1ZIAA 4PCSA 2AP2A 1F58H 5MI0B 5AKRA 4ES8A 4G11A 4X7EC 1OO2A 1TEYA 4V11A 3SKOA 4HS6A 3K1DA 5FK9B 4S10A 3QULA 4MXVF 2DOCA 1W0WA 4WWKB 1LXMA 5CJQL 2GJRA 1JTPA 1V55B 5JHMA 4KRPB 1NEZG 4E68A 3NZSA 1XR8B 1Q0XL 3NACH 5J9PB 2EVFA 4XN4A 3NJVA 1I3RB 3OGCB 5DZLA 7TAAA 1NUDA 5ITBH 4KKLD 2HT4D 4U1JB 1G1YA 1NFDB 4OQ1A 4JBSA 5CJBA 1OGAE 3AM8C 5HD8C 4PJ8A 4CSZA 3VD2A 5CCGE 4ZZKA 1XF5A 1E40A 1VEMA 2UZXA 5KJ7E 1EHNA 4KI5D 1MFAH 2V3DA 4WTWA 5I30L 1EGJA 1DQML 3GSUB 4LCIH 5CGMA 4LVEA 1T04B 5AVXB 4JRFA 1CLYL 4D8PB 1MJJA 3KGUA 4CSTA 5AW6B 1AXTL 1D9KB 1J8HE 4AUUA 4B0MB 4AMXA 3DO7B 4APXB 3IF1B 4OF6A 3UIYA 3ZDYB 3R18A 2VDMH 4DKEL 4MBOA 4XN2A 3UJIH 3GSNB 5LXGL 2W9DH 1QSEA 2IAMB 2H41A 5J6HA 1T2JA 4LPWA 4XC3L 1PZDA 2PWDA 4Z3FA 3U7AA 5JIIA 4JN1H 5DMIL 3IDYB 5EHFA 1YNKL 1L9OA 3LS4H 4Z8FH 1G5AA 2ADGA 3OMIB 3RWJA 3RVWD 3QIWD 1UWFA 2Q1EA 1YEGH 2GJ6E 2AQQA 3W2DL 3TIDA 3CVIL 3WGUB 1TZ8A 1TTAA 4Z7WE 4HWZB 4B41A 3FHQA 1EQWA 4JKLA 1MFMA 3D06A 1I8UA 1ONQB 1FWXA 1I7RB 2WPGA 1RP8A 1QABA 1KEGH 3OHMB 1Q94A 1MOEA 2PYEE 2XPGA 1LP9A 1T0NB 3M86A 3N44B 4JHAH 4KROC 3R4RA 4N2CA 4D8PA 1KLFB 2JJWA 3D07A 2MCPH 3WFCH 4QLRA 4GSRA 3UPRA 3VW3H 3INUH 5D71L 1PZ2A 3LEVL 4DVRH 1F02I 4Q4EA 2XVLA 4NHUB 1AG0A 1KFAL 1MIEL 2I5YL 1I8LC 3J8F7 5IJVA 5HYFA 1ZT1A 3CZJA 2DZEA 5A6LA 5I75B 1GIGH 1IC4H 1CR9L 4OLVH 1HKLL 2BZCA 2FATH 5MEOB 1HQ4B 1N5YL 4HPOH 2ZG2A 3DX4A 5SV4A 3Q2WA 4RDQF 3V10A 2VISA 1NGZB 4PJCB 1KG0B 1VIWA 1E5ZA 2GK2A 4GQZA 2D0FA 4P5SA 5HP5A 1YMHB 1LO2H 2WVUA 3B9KB 4UV4L 3PJSB 5ANME 3P9MA 5IZ7A 5JUEH 3RGVA 3OGOE 4YDVB 1V7NL 2C1PB 4LMQI 4ORGA 3BH9A 5EZLB 3TO4C 4P2QB 1VZHA 2PPDA 4PV1C 3QFDB 2R1XB 4U6VL 5I6XB 1SY6L 1ZLSH 3K71B 1DBAH 4XPAL 1BXVA 3ZKQD 2FHBA 4HS6B 4I77H