1SDYA

Structure solution and molecular dynamics refinement of the yeast cu,zn enzyme superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase(superoxide acceptor)
molecule keywords COPPER,ZINC SUPEROXIDE DISMUTASE
publication title Structure solution and molecular dynamics refinement of the yeast Cu,Zn enzyme superoxide dismutase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 36
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1991-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1sdyA00
3ECWA 2Z7WA 4BCZA 1Z9NA 3QQDB 1PU0A 2WZ0A 1Z9PA 2R27A 3KM1A 3HFFA 4A7QA 1E9QB 2GBUA 1TO4A 5KBLA 2C9SA 1JCVA 1SXSA 1PTZA 2V0AA 1IBFA 1E9OB 1COBA 1L3NA 2AQSA 3F7LA 1HL5A 1YAZA 1BA9A 3KBFA 1OZUA 2AQQA 1HL4A 4BD4A 2LU5A 1F1GA 1ESOA 1U3NA 5CU9A 2AQNA 2AQPA 3KH4A 1UXMA 4L05A 1Q0EA 2GBTA 3CE1A 3LTVA 1OAJA 1SXCA 1CBJA 1N18A 3GQFA 3PU7A 1PZSA 2WWNA 1XTLA 2Z7UA 4A7SA 2K4WA 2GBVA 2WYZA 1SDYA 1YSOA 1FUNA 2ZKWA 2APSA 1SXAA 4MCMA 4A7UA 1OALA 1QUPA 3GZOA 3HW7A 1IB5A 1SDAB 4A7VA 2ZOWA 2ZKYA 3H2PA 1OZTG 1SPDA 1B4TA 2WKOA 4FF9A 3H2QA 1JK9A 2WZ6A 1BZOA 2E46A 2Q2LA 1N19A 4BCYA 1YAIA 2JLPA 2VR6A 1IBBA 2XJLA 3GZPA 2Z7YA 4U4IA 4A7GA 3SODB 1B4LA 1XTMA 5KBMA 3S0PA 3ECUA 4OJAA 2VR8A 1E9OA 4A7TA 1E9PA 3KM2A 3GTTA 3KH3A 2WKOF 3GZQA 1DSWA 1EQWA 1JK9B 1DO5A 2NNXA 2JCWA 2WZ5A 1CB4A 2WYTA 2AF2A 3RE0A 1SRDA 3L9YA 1SXZA 3CQPA 2SODB 2VR7A 2XJKA 4N3TA 2E47A 2AQTA 1SXBA 4A7GF 4OH2A 3MNDA 2ZKXA 1OEZW 3QQDA 1IBDA 3L9EA 3T5WA 1E9QA 1F18A 1MFMA 2Z7ZA 3K91A 3KBEA 1XSOA 1E9PB 1AZVA 4MCNA 2C9UA 1IBHA 2AEOA 1EJ8A 2WWOA 1P1VA 1UXLA 3CQQA 3GTVA 2C9VA 3ECVA 1TO5A 5KBKA 1F1AA 1SOSA 1F1DA 3HOGA 1RK7A 2AQRA 1S4IA 3MKGA 4B3EA 3F7KA 1KMGA 4N3UA 1SXNA
chains in the Genus database with same CATH superfamily
1PAZA 3G5YB 3O2DL 1SHMA 4DN3L 4S0TD 2A6DA 1NIAA 2CR0A 2CIIB 4OD2A 2GBUA 4HEPA 1S9YA 2BIOA 1J9SA 1J5OH 5C92A 4GW4A 1OQXA 3FQUA 1WWBX 1CTMA 3PAUA 2EACA 2WIIA 4NUGL 3ES6B 3CFQA 3NACH 5E4OA 4ZTPL 3GHPA 3RWEB 3MV7B 4LZKA 4HK0B 5DQDH 2QVMA 4MRBA 3BH4A 1U3HA 3G7TA 4HYTB 4D8PA 2FRGP 4WU5A 4A6YL 1UWEL 4FABH 3CDYA 3VD3A 3OZLA 4IRSC 1YSOA 5JPMC 5FO9A 2ZWKA 2F19H 2KYIA 4O2EB 3OKYA 5CKAA 3SE9L 5CD3A 2OMWA 1SMDA 2V7NA 3U4BL 4HF5L 1JERA 3OR7A 3G5XA 3T0VA 1CD1A 1QI4A 4U3HA 2IWEA 5DFTA 3TBBA 3NN8B 3VXPA 4B0MM 3GTNA 1TNNA 4OZIB 4RIRB 4XI5D 4QNPE 4Y2DC 3IMBA 4BZYA 2HG5A 3EADA 5E4IA 4XPHL 1MJ7L 2YFNA 3DV4B 2IANE 3GZPA 4FEMA 4PB0H 2FQGA 2I7SA 5CGBA 3T3PB 2CBOA 3VQLA 1OAKH 4PBWD 1O7DE 1T2QH 1CYGA 4FXKB 2FR4B 2ZCLH 4GXUM 1R4XA 1AS7A 2AEPH 3QQ9D 4HDIB 5LQBL 4XX1G 1FE8H 1P4IL 3DHPA 1BYNA 3VFRA 3UJJL 4EN3D 5F0MB 1LO2H 1TJHL 1WZAA 2NY0D 2WUBH 4LVNC 3IMRA 1KTBA 4TSAH 1EQWA 4W9DC 3IJ9A 1MJJB 3O9WA 1GS6X 2NYKA 2GAZB 2D0FA 4U1JB 3AZUA 4DEUA 2BP5M 5CMAA 3FC8A 4LLYA 4OZGB 1E4XL 3IDJA 2CO6B 4RAVA 1KGCD 2NY6D 3F05A 4GUPA 4Q97A 4PRAA 2CWRA 5F44A 4GG8A 3ARGA 4XO3A 5CLWA 1I7TB 2KUTA 4P0DA 1EVTC 2DV6A 3QPXL 3BKYH 5F97E 5ICXB 4M6MH 1TEGA 1L7IH 1NDMA 4PJAE 3QZWG 4GS7C 5F9OH 2AJVH 4AYFB 4XCYA 2AJSL 2JB5H 2VERA 3CQQA 5D2NE 4WK0B 5FO2A 3GS0A 3AG4B 4FQJH 1ZGLM 4TKWA 4FNPA 4OCRL 2A77H 3EOAA 5IHUL 2EYTA 3FFCB 3WIFB 4GP8B 1Z32X 1XIWA 4QOKE 3T1WA 4K23H 2BOCB 3UPRA 4OF0A 5HJBA 1Z3RA 1JNJA 1XGRA 5C0CB 3KLSA 3WHXB 2A6JB 3APMA 1ZANH 5F7LB 1Z3GH 5EUOF 5IV2B 3D69A 1L4IA 3LZQA 4G7QB 4JFUA 1J86A 5ITBL 5D70L 3C2SA 4J8RB 3SKJH 1X5IA 3QUML 2YC1B 3RA7H 1T0MA 4BD4A 2E76C 2Y36L 3P1VA 2X53A 3WNPA 2CKBB 1NCBH 4XN9A 3VO0A 5B8CC 3CX2A 4Y2NA 1CLOH 2JQZA 4XN4A 3UYRL 1OD9A 1Q0EA 5D93B 1E28A 5F0PB 4MKTA 3IDXH 2WQUA 1P1ZB 1NUFA 5E6ZA 3QWRA 5C70A 3PU7A 3TOPA 1SF5A 2GBVA 3QDME 1BM7A 4FLSA 5I6MA 5FF6B 4G7YL 2AXGA 3TX4A 4AE0A 3Q0HA 4TVPD 2G60H 4KH2A 3EYUH 4B50A 3HC3H 2M1KA 1UD5A 2AK4A 3O3EB 1GZPA 4N8VG 5D7JD 2EVFA 1B4TA 4R84A 5KG9B 3U2SB 1J9CT 3HG1E 5JUEH 3BIAX 2BY2A 1XAUA 3MOQA 1QBLL 5JW4R 4URTB 1CR9L 4ZI8A 1UM5H 5I5RA 5KSBB 1E5ZA 3KJ4B 1HHKB 3QUZB 4Y5YA 4JDTH 1JOIA 3GWJA 4P3CH 5DFAA 5IQMA 4HIEA 1VAHA 2C3GA 2SEBA 1A3RL 3G6DL 12E8L 1FN4A 1OCWL 2W07A 1IX2A 2WNWA 4EDXB 4IBLT 4X42A 2WY3B 1HE7A 1USZA 2CUHA 2LLNA 3MV8D 4FHBD 1J8KA 4U1IB 1TMCB 2DQGH 3OXSA 5B39G 4YLCA 1DUYB 4MD4B 3DPDA 4U6VL 4XCFL 3DXAB 3X2QB 1OARL 2BP0B 2X9YA 1X7QB 4KXZI 5SX4I 4ZMQA 2B2XL 5EWIH 2YHGA 3AU1B 1WS8A 3WXWL 1U8NA 2AK1L 4NDMB 5DI8B 4OD1L 3M7FB 3DA0A 3FUFA 1ANUA 1YMME 4I9WD 4WWKC 2X09A 5I75C 3JTSA 1FL6B 1TVHA 3QR1A 4UWQB 5AB9A 5DEGA 5TGBA 1M3JA 3NCJL 1WYJA 4IEFB 5IWLC 4GAGL 5CJ8A 2C3VB 1IC1A 4JBSA 4WTWA 4FYSA 1MG3C 2C9RA 3BLBA 4DZBB 3TEYA 3D25A 4XXDA 4DVBB 1F0LA 1G9NC 3K8LA 5KVEE 4M8QA 1OAUL 5GGRB 1DBAH 4JFVA 3RWIA 5EIVA 4EI5B 4P46D 3T2LA 1ZTXH 4NO0A 1CIDA 2NY2D 1FJ1B 3WENA 4W70A 5L2KB 4HIPA 3L48A 1ZT7A 4X4YB 1BLIA 5F1SA 4JM2F 1R3HB 4M7LH 2VLJA 4IU2A 4KK9C 2BIIA 3IAQA 2AQQA 5IY5B 2XPYA 2K8MA 5KTEH 4QGTA 5ILTH 2VMJA 4Q0XL 5CCGE 1F45A 4HK3N 1XR9A 4FNUA 1I1AA 2F54B 1WDAA 1Y07A 2WB1A 3VSQA 2R9HC 3PWNA 3BQUD 1RURH 2BIQA 2C9PA 2ZSVB 4R4BA 1DQML 4YR6B 4BRJA 5KYYA 1KT2A 3UMNA 3EH3B 4UDTB 2JK5B 1YJDH 3IK2A 3TVMD 1S2EA 5FGBA 4MCYA 2XBTA 5AALA 3OJDB 2YQ3A 4TSCH 2P8MA 3PLYA 1CQKA 5CJXC 4LCVA 2YEVB 4AIZB 4PJ8D 2XX1A 3QO1A 5DZ9A 5D1QE 2PPFA 5EA0H 1YEDA 4FLQA 4WFGE 3RWDA 1DCLA 2IH3A 4XMLL 4TUUA 4Y9FA 3BE1H 2YQBA 4EKXA 3GSXA 5IJKA 3A3YB 1QO3A 4ORZC 1AGCA 5K69A 2XI9A 1N10A 4UQ9A 4K3HA 5ADPH 4EQ2A 2XIIA 1MFAH 4XNMA 4H25B 1CK0L 5ACLA 2DMBA 5T3ZH 3JTTB 3KPQB 4BFJA 3A6BL 5C9JB 3TEUA 4WHTA 4NWTH 2E56A 3UTZA 1UWFA 4EPSA 3LZOA 3GF8A 4IJ3C 5GS2D 3BPCA 3ATFA 1XH1A 1H8NA 3MCKB 3ROOB 1CTNA 3LKPB 4ZAKD 4HD5A 5D9SA 2OSLB 4GAJL 3MV11 1WEJH 4KKNA 4W9EC 4PJ5D 3O45B 5JW4M 1CVSC 2XZCH 3P0YH 5DLML 1YYLH 1A2YA 2F8IA 3CLFL 3NVQA 4W6WB 5CZVH 1DDTA 5EZIL 3AGWA 1ES0B 2DBLH 3QDGA 4QRRD 4NQSA 3ZYOA 1L5GA 1R5VA 3RWJB 2CCWA 1IIKA 5IFAL 3QIWB 2PW2A 2X4QB 2HMID 1MCSA 1UCTA 2IQAB 4YSOA 4WUKH 1OE2A 1AGBA 3IBEA 2IWFA 3K7UA 1PU0A 3NIDB 5FOBA 3H7BA 4NQUA 5D1ZC 3E1F1 3LHPL 2NR6D 3ZQWA 4Z0XB 3F6IA 4WNQB 1CYWA 1NAKL 1J8HE 5GSVB 4BZ1L 2W81C 4AL8C 4F91B 5ENWB 3TBTA 2FBJH 2CDGA 3QJZA 4ADIA 2WN3A 2NSMA 3TASA 3DVIA 4Z7IA 35C8H 1U8HA 2VWEC 4X6CB 1G1CA 3QQ3A 1A0QL 4ONFH 1SMOA 4AVJA 1TQSA 3PS6A 5DHVH 2VAAB 2WMPA 1UG9A 2YIHA 4X6DA 4ZUTA 3OLEA 5BCAA 4C83A 5C6PB 1UJ3C 4FXLA 4TNFA 3TEXA 2EDJA 2CK2A 1EXHA 1M7IA 4RWYL 3MFFA 4BFGA 1DVSA 4P23B 1IB5A 3AFLA 1CF8L 4Y1TA 5B7EA 3FFDA 3M1BA 2Z31A 4PJBF 4XNZC 3K46A 4OGXH 3UTTD 1B0GA 2FEDD 3VWJB 2A9DA 2H0FA 3EOYG 3GI9L 1R3LA 4J4PD 1RQ5A 3N9GH 4UANA 1L9TA 1R3KB 4NKDA 5D2LA 3RX5A 2OMUB 3ARYA 2BY0A 2NY5C 1E6OL 3O6ML 3MOAH 5IVXE 3QJVB 2W8CA 3HG0A 4RGNC 2BNQD 2QDVA 2VDRL 5LGHL 1AZRA 4ZNEE 1OL0A 4KK5C 2P5EA 1OXYA 4X8XA 2APBA 5CJQL 4EVNB 2WB7A 4HGWB 3LJ3A 4JKNA 1D5IL 2BIMA 3FRPG 3MOBL 4O02L 5LN4A 3SE9H 3EXLA 1Z2KA 3FJTA 1LP9B 1PZUB 3W9DB 4DT2A 4X83A 4MJIB 4XMZA 3TCTA 5C2BL 5I1DB 1MI5A 2ZWYA 4XRCB 2D7QA 5SX4H 3OVUB 4X9BA 4PJIB 1JZ6A 3DETD 4MA7H 1RCYA 1NGWB 4HUWB 3OF6A 5JHLL 5ESAA 3N04A 2YD6A 3VRLF 3EJYD 1JWMA 2B1OA 3G5YA 2X2IA 4HOZA 3CN1A 3N41F 4W9ZA 4LOUC 3LB6C 4P4KB 1WAAE 3JWNG 5B7MA 1AVAA 4HCRA 1NAMH 4ZOEA 2HH0H 2P49B 5IIEB 5F7YC 3UJJH 1EJ8A 2ERJB 2GUYA 5LNGA 3RNKA 3ES6A 1QSFE 3DRQB 5E70A 5DZJA 1PW3A 4PIBA 5C07D 3WNKA 4HK0A 2JQMA 3VDAA 1TQBB 3MUGB 3B9VA 1U8JB 2V5RA 2YJQA 3FO1B 4KRPD 3VD9A 3FSOA 5LXGL 2IBZX 4XOCA 4JGNA 3F84A 1U92B 3GT6A 3KM1A 1TYEB 3QAZB 4POYA 3WJMB 3GINA 4Y4HA 2BMKA 1S5IL 2TRYA 3G9VA 4PRHE 5GS0L 1DVTA 2W1NA 4N28A 2IAMA 2WKGA 4FKEA 2V2TA 3VSUA 3UACA 1GC1C 5FYJU 3ZMRA 4ORGB 4NQDD 2QV2A 4P8QA 3VH8G 1G7QB 4OZIA 1S9XA 1IM9A 3ABMB 3TBVA 4XTRC 4OCRH 1UZ6E 3PAZA 3DV4A 2GTWB 1CE1L 1B2YA 4BKLB 5K93A 4CBZA 5HDBB 2WXKA 5FYKU 1JGIA 4JQIA 4WWOA 3D52A 5KEZA 4KHXL 3MRQB 4QIRA 2IOMA 4Z7WE 1T2JA 1GPOH 1QI5A 3ENEA 3GHEH 3UJIL 1O6VA 5C0EB 3OX8B 3DX6A 3QULA 1A21A 3SKMB 1ZTXE 3L5WB 4MLSA 1MJJA 1BAWA 2WC7A 2GAZA 4H88L 5EBWB 5FGCE 3VG9C 3RTQC 4ALAH 4FNRA 1RUKH 3ZHFA 1CGUA 3TJHD 2Z3FA 3O0RL 2VDLL 4OZGA 2ZCHH 2CO6A 4O4YH 4LQFL 1JP5A 1OTSD 3ILEA 4O2FB 3ZN6A 3FU0A 4YDMA 2IG2L 4XN7A 4F24A 3RGVB 3QHTC 2X3CA 3SJVD 3T65A 3TURA 2PPDA 5KS9A 3BOVA 3OD3A 1F02I 1FVEB 1ZS2A 1I7TA 3MRGB 4Z77A 3QNFA 4BFKA 2GIYA 5F70A 2ENJA 5JXEA 2BRRL 1VPOL 2D7MA 4LP5A 3EH2A 2BFVH 2CGRL 3ESUF 3SCMD 2BDNH 4P9MH 3VFMB 1QZNA 3FFCA 3WIFA 4JPWL 5K39A 1UEMA 4K3DL 4XP5H 5FA4B 5K59F 3QG7L 2VDPB 5C0CA 3RZCD 1QD0A 2ZJSL 4IRZL 5DHMC 1PD1A 1OTTC 5DJZA 3WHXA 2QSTA 2I9TB 2ENSA 3C75A 1MJ8L 2ARWA 1XIWD 3MA7B 5E51A 1UTDA 4LCYB 2RMNA 4OZHE 2X1OA 3FQYA 1M71B 1OAYH 2HFGL 1MY7A 4U0QB 5J8OA 3QRBA 2A6KB 1K2DA 2J8OA 2VLME 2AEOA 3H9SE 3LD8B 3LNHA 5F7UA 1ZHKA 1SYSB 1RL1A 3OG4B 2OA9A 4WAFA 4S0HA 2IQ9L 4XHJD 3CFNA 2WTRB 5F9JB 2HTLC 4Z0BL 3V0FA 2PXYB 3MBWB 1CYXA 1P1ZA 1FVCB 1INEL 3WEOA 5F6HJ 1SXNA 2X41A 2IGFL 3OAZK 2AK1H 4OI7A 3P2DA 1J1XL 4AGMA 4A7QA 5T3ZE 4B95C 1ZDQA 2Y5TB 3VI4E 3ZK0A 5IW1B 2WGNB 1NCCL 4PRDB 3S3CB 5E1AA 1A1MB 4KI1A 4AT6B 5KG9A 3RX9A 1FAKT 3QUGA 1DUZA 2OTWA 3NIGE 4WI4A 2E27L 1EUTA 1UXMA 4PS8A 1SBSL 2HSIA 1T21A 4LRIC 1KFGA 2YD5A 2JI2A 4GI9A 5MEOA 2VJ0A 4FNLH 3T8MA 1HHKA 2F58L 5I5MA 1YY8B 1KXVC 3TTYA 3VSVA 3S2AA 4OFDA 5E94B 3W56A 1PS3A 4B7LA 3C6LA 4YHZH 3HZYB 2UWEA 2NNCA 3OB8A 3APFA 4F5CA 5BMFL 3DBSA 5A16B 4AIXA 1EEUA 1NIDA 4JZJC 2VMDA 2XY2A 4MD4A 3S6CA 2PF6A 3DXAA 2VSDA 1X7QA 2E46A 2D7NA 4QJ3B 2OZ4A 1ACCA 3QUXC 1RP9A 4GAFB 4WO4B 2JLPA 3WNJA 4K9EL 3TC9A 4NDMA 1SZNA 4FYTA 2Q8AH 4FXGC 3W2DL 3BPOB 1YEEL 32C2B 3SPJA 4KKBC 4BK5C 1YEKL 1XTMA 4JKMA 5MP6L 5FS5A 3L3OC 4QXTA 4XNQA 3TO2B 4NSKB 1FV1B 3KM2A 4HH8A 4RDQF 3KDPB 3T6QC 4IEFA 4ELMF 1NUDA 3DX2A 4GW1A 4B9KC 4WTQA 1YC7A 1RK1B 1ZHNB 1O6SA 3VFPB 3L9YA 3A24A 4FP8L 1C5DA 3AB0C 4NZ8A 4WGVB 1JRHL 3MBEA 2A2QT 3HBGA 3BAEL 1M7XA 3CXHJ 3O3UN 4IRJB 4K94H 4R0LB 3UAEA 3HKFA 4EI5A 3TFKC 3BUBA 2A9CA 3CVBA 4KKAC 1NDTA 4X4YA 2D3NA 3LMJL 3ECQA 2F0CA 4IIQB 3PP4L 3HPLB 1R3HA 3PGCA 4NO0D 5AKTA 4ZXBC 3D0AA 1MQKL 2G3XA 4TUKL 3FNKA 2Z4QB 1W91A 2N59A 1N2RA 1AXSB 4WW1B 1MN4A 1ZXQA 2ZUVA 1QW9A 3QAQA 2VLJD 1XXFC 4Y4FB 4M02A 1X7TA 2W0PA 2F54A 2Y06H 3PNRB 5D7IF 3CZEA 2DD8L 3MLXH 3MUHL 4UT9H 1G7PB 1MCRA 2ZSVA 3GXIA 5I24A 5JXAL 4YR6A 1N3NB 3MRDB 3E6FA 4PJFF 4AEEA 4UDTA 5GZOA 2JK5A 4GAJH 3M1CA 1I1AD 4B53A 3V5HA 1KNOA 3SZKC 5C0NC 1E7VA 5MENB 5CZXD 5T1KB 5ID1B 3I84A 3KBFA 1PCXA 4ODSH 5K33A 3GMNB 5TF1L 4IU3B 3QRFM 5JOPD 4H26A 1E4WL 2ICEA 1FYTE 3LKOB 1FPTL 1NLBH 3SBWC 4MB4A 2ZXEB 4Z7NB 3MCLL 4GQ9L 1OKEA 3LTVA 1IGJA 1C12A 3LZNA 2H3NA 1ORSB 4YFDB 3UO1H 5HHVH 4C56E 1QUNA 4E5XA 2UVFA 3K71A 4GIAA 1D9KD 3F7VB 4M5SA 4NN5B 5TDPA 3SDAD 1D7CA 5FW8A 5I1LB 2QQNH 3VW3L 5JTWA 2UZYB 2FT8A 4UV4L 2ESVA 4KZDL 1HHJB 5FYLD 3SGJA 1X5XA 4H25A 1ZEAH 4ONGL 1AI1H 3JTTA 4HA1A 2Y1ZA 3EYSL 4MMYA 1LEIB 2NY4B 2KKQA 3ZZSA 4P5TA 2BVEA 2DIJA 5J5EA 1TZOA 2QQQA 3WTYA 1C1EH 4D9RD 1QSED 2YPLD 1JHKL 3ROOA 2K9FB 3AABA 3LKPA 3HI1A 4W4NA 1II4E 3HCVA 3KPSD 4QXGH 3WGVB 3LNDA 3ZYJA 3RFRA 4A7GA 1LM8V 3KR3L 3L9RB 3FK3A 3OQ3B 3NEXA 1J5CA 1GYCA 1N8ZA 5IQ7L 2VXUL 5JHMA 2XN9B 3CIQA 1MFUA 4G1MA 1CF8H 3VX1A 4AK1A 1NLDL 1I53A 3WBDA 2ZNXA 2VN7A 5EULV 1ES0A 4M5YH 2BK8A 3Q43A 1MFEH 1P53A 5EU6A 2DMKA 4LGRB 1NMAH 4LP4A 3RWJA 2D2OA 1E65A 4TM9A 1PDKB 2WXNA 4OLWH 4XMKL 4JO1H 4MAZA 3ZY7A 1MFBL 3BZEA 1RVFL 1W15A 2IQAA 5AFAA 2XXFA 1FCCA 3ARQA 5AYUH 3ULUH 1EJFA 1PKQE 1H6FA 3TL5A 3MLYH 1Q8MA 4F7EB 2ZXBA 3ASWA 1KEMH 4WNQA 1Z7JA 3S3SA 2WSDA 5MHSE 4D3CH 2C9UA 1Q72L 1F90L 2IANB 5ENWA 1D5IH 2Q7AA 3L17A 4BEIA 2BP3A 5AG9A 4RX4A 3VG0L 1AMYA 2WTPA 4X6CA 2MHAB 1D6EB 3ISWA 4PMEA 1XZ0B 4XB3A 3D7PA 1CGVA 5HGAA 1WPCA 2YZ8A 5J6GB 1R0AH 3HC4L 2GABA 4Z9KB 4GFXA 5E8PB 4EIZC 5GQBA 2EEDA 3C60D 2IOOA 4HFUH 5JIQA 1F3JB 5HDLA 4C4KT 5AZEH 1NOAA 3WIHA 1TVBB 4BELD 1I9JH 2GIXA 3S3DB 4F80A 1P5UC 4FQIH 1AR1D 4JN1L 4CRPA 1VZGA 2VE6B 3LKRA 1OAZH 4QTHB 4G8AC 5DD3L 1NFDF 5SWSE 3LNFA 4L48A 4N2FA 4R97B 4KQ3H 5C08B 3ZKND 5CLYA 1R3KA 4AYBA 1HAWA 2E74C 2Z31D 1ASPA 3AITA 1INQA 3EZ8A 1CT8B 1ZJBA 3L6FA 1EHLL 1V3LA 3MJ7B 4FQ2L 1NFIB 1OP9A 2ZE0A 4PJAB 5D2NB 2O6PA 3QC6X 4WKXA 1OGAE 4ONOA 4HHWA 4QLRA 1PZ5A 4A2EA 4EVNA 1S5IH 1D7DA 5CEXB 2NNAA 2ZX5A 2BSTB 1UKSA 4D94A 2ZAIA 2W38A 1F4XH 5IVZB 4YS4A 2X4SB 3HE7D 3JYBA 2P5ED 5I1DA 1H0DA 3EUDA 2ZQKA 3C8KA 3W39A 1XL4A 3LEXB 3WFCL 2X4RB 1SVCP 2CR6A 2V9UA 1N70A 4H1LA 2FATH 5J89A 2YKKA 1WV7T 1IAIL 3N1MC 3JV4B 5IBTL 1JV5B 4LAQH 3WUWB 4N2NA 1BJ1J 3OF6D 3QUHA 1V7NL 2QMJA 3I6GA 2W88A 3MUJA 1PIFA 4Q9CA 5B38B 3EO1B 1G9HA 5E99H 1HNGA 7FABL 4E9WA 5TFSH 1EFXB 2UZXB 1C5BL 4JPIA 2MMXA 3BW9A 3QDMB 5F0JB 3DMMB 1EA9C 3FW6A 3MUGA 4OZ4A 1QW8A 1H3PL 4DPBX 2X89A 3FCSB 5EMYA 5T1DL 5IREA 5ANMA 2NUTB 5E9DE 5KBPA 1LDPH 3NRQA 3MV7D 5CKGA 3HG1B 1MCJA 1U92A 4KXBA 5CBEB 5AYQA 2IG2H 4ZFZB 1ZVSB 2CR3A 2VDML 4Z7VA 4RZCA 1Q9WB 3GKWL 3QQ4B 2B15A 1OE1A 1XL6A 4HCIA 1P1VA 3INUL 1HHHB 4KUZL 3N40P 1FWXA 2JV6A 3BSZL 1UA7A 4UDUA 2GJRA 4FZ8H 2AJZB 1S7RB 1G7QA 4R7VA 2A0LD 5DJDB 1NCGA 3V6ZB 1IKNC 4RAUB 3RILA 2ATPB 3RDTC 3P0VH 2GTWA 2WBKA 3MRFB 4BKLA 5IMOB 4LLWB 4X98B 1YVLA 3QUYD 1OANA 1MW2A 3ZE2B 4IRZH 1FI8C 5D7LD 3V4PH 2B5IB 3NYKA 3TO4C 3TIEB 1E9OB 2Z1KA 5DR5H 4YC2C 5IOPB 3A21A 2O6CA 4LP8A 5IEHB 2DJMA 1VEMA 3FKUS 1WHOA 5CIPB 2J8HA 3RVVD 1S6NA 1YMMB 3APDA 4LSUL 4N8UA 5I15L 2V17H 5ALCH 4N86A 5EBWA 4R7NA 4ZS6D 5CS7A 3PUCA 1MVFA 5L8KB 3SKOB 2JJTC 2X40A 2GFBB 4TNVK 5BVJA 5FCUH 4GBXC 3CSYB 1XH0A 4F7PA 1BWMA 5HI4C 5J6HA 1PLAA 3IU4H 1I7ZA 1U33A 1UGNA 2APSA 3LN5B 3N1FC 2AV1B 3WDIA 5CBAA 3GZOA 5EZLA 2BSDA 5F7WC 3CVDA 3I9GL 4QHLB 4TVPL 4LCUB 5F89B 3QXAB 3CFJB 5HYSG 2WVSA 4QRAA 3MXWH 4EZKA 1WSST 4JHWH 4J12A 3HLKA 5J13B 3QORB 3QO0B 4EBQH 2OJEA 2VXVH 3AM8A 1IGCH 1SBSH 5I1IH 3HS0B 2L7JA 4OJEH 4LOEA 1FAIH 3HMWL 1F56A 1N0LB 4JFFE 2VC2B 4A67A 3IYLW 3NAAH 4NGHH 4ODXB 1KBBA 4KFMA 3FFCD 3G6JA 4OQTH 3RFZC 3OPZH 3GB7B 4LCYA 4PJEB 2GY5A 3W11C 4JVWA 5EEXA 5C0CD 1LO3H 2FGWH 2YD1A 2A6KA 1IBZA 5F8RC 4M62H 1DSWA 1ZLWH 4JB9H 5J9PB 4L8SB 2HFEA 2CGYA 3HRZC 3DOSB 5GGRA 2BXZA 4M6OH 3X13B 1QHPA 1T22B 2WTRA 3AWEA 4XP9L 5CGTA 1HQ4B 3IMUA 2A3TA 5FIEA 5AW3B 3F83A 4DFHA 1VDGA 1X6NA 3EO9L 2F8OA 3VMOA 4HGMA 1NDGA 4RBPK 2YD0A 4XXCA 1FDLL 4I7ZC 2PTUA 5IJDC 5MP6H 5IW1A 2XA8L 3GMLA 1AQKL 2FX8L 4PRDA 4AT6A 3FTWA 4WNJA 1QFWL 1J1PH 5BV7C 4M43L 1AFVL 1UKQA 3IGFA 2J2ZB 1G1YA 1NSNH 1F00I 3DX0A 1SOSA 3FQXB 2H32H 1H3UA 1BVNP 3TA3B 1PGRB 1F42A 1FSKB 4G1EB 4HPYH 3Q8EA 1YY8A 2WVUA 1I8LC 1D5BA 1XF4B 5B21A 1FFRA 1QRKA 2NCMA 4QT5B 4GP5B 3QUZD 4J6RL 1GMIA 2I27N 5HHPA 4OIFA 2FWOA 4IKIA 3ZE1E 3ZQXA 1DVFB 4PWIA 2G9HB 5FK9B 4AENA 3IKKA 1TTFA 4JRXB 1BFVH 1I1FB 2N0KA 4XZ4A 3ULUE 1A7QH 1FH5L 2Q7YB 4N2KA 4DWHA 5J06A 3GIZL 3T2QA 1KCLA 3DXAD 1DQTA 5F21B 4NKIH 3PF2A 4GRMA 4GRLA 2YRPA 3A47A 5ACZB 1HINL 2CK0H 1JDCA 5E5MB 3TO2A 3DX8B 1FNHA 4NSKA 4GUCA 3UMTA 6PAZA 1NCDL 3KPLB 5T5NG 1RZPA 5DHEA 3J07A 1Z5YD 4PJCF 4AKQA 4DPAX 1ZHNA 1SHXA 1E4WH 4Z7QE 3UBXB 1U8MA 4UI2A 1N67A 1WBXA 2NXZC 4PVNA 3Q6FA 2QJDA 1NL0L 1LE5A 1MCDA 1O9WA 4R0LA 3T6WA 2DKUA 4HUNB 4U4IA 2GI7A 2Z0UA 4TQHA 4DO6A 5KSUA 2X6AA 4F8TA 3PIQA 1JV2B 4UNUA 1JZJA 4X8JB 1FL5A 4AQ1C 4EI5D 1YN7A 3HPLA 4DK6A 4NM8H 4N0YL 4QCIA 4YVNA 5L2KD 1KJ2L 2CJUL 4N22A 3ETBF 1AXSA 4APQC 5GGTL 3REVA 3EYSH 1V7ML 3F7PC 3NJVA 4Y4FA 5IHZB 1GSMA 1BEYL 4NOFA 4N3TA 4KX7A 1SN5A 3L08A 1A5FL 1AY1H 4XPBL 3KLHD 1G7PA 4Z95L 4FQXA 1MJUH 5AVWB 3L4TA 5C09A 2MCMA 3MRDA 4BQBA 5I1KL 3Q9QA 5ISZB 4PEEA 3VTAA 4OFYA 5DUPL 4Z7OB 4ZFOL 2O61B 2F54D 4KVNL 1RKRA 1T6VN 1E50A 1X5MA 2VZ3A 2YAFA 3KR3H 2OCCB 1X9RA 1JIBA 2BJML 2K3TA 2H4EA 1U3YA 4WSKA 1JYNA 1DQIA 5GZOD 4N9GB 3CN3A 3LEYH 5EO0A 1U3ZA 3VRJB 3WNOA 1NLDH 5KUKA 2E75C 2ZX9A 1I9EA 1JVKA 5DS8B 1EAPB 3LKOA 1GRWA 2DQFB 1HILB 2PWFA 1GZQB 2F7QA 5CHNB 4EOWH 4X80H 5I1AB 2QGBA 3GXDA 1ORSA 3O2WH 3FH8A 4N3UA 3SPCA 4YJZL 2VDOB 5A2KH 3MJ9A 4XNUH 1RVFH 3T0EE 5I1LA 3RY6C 1HTYA 3RUGE 4HC1H 4EZMA 1RK0B 5EO9B 3MQIA 2UZYA 4YSPA 3TPKA 1HHJA 3LVTA 4WFFD 5EZOH 3FU9A 2VXTL 1XVSA 4JVUA 4MQTB 1HEZB 1KN4L 3O4OC 4ZFGH 1Q1JH 3GLZA 1G9NH 1ITCA 1FNEB 3QEQE 3QIBA 3STLB 4N5UA 1LILA 1QQDB 2YKLL 4NFBA 4NENB 1N59B 4UMGA 1EZSA 5FDYA 2Z7UA 4NXKA 1TJIL 4HEME 4ZBJA 4QRUA 2WZPD 1W72H 1FUNA 1YYCA 3WLWC 2DM2A 5INCB 1QSFB 4IBSA 4O00A 1WISA 2DQHH 4CJ1A 1NBVL 4MRCA 2VIRA 3MR9A 2XN9A 4P04A 4FF9A 1FFNB 3QZMA 4XVUD 5HHNB 3DUHA 1TEYA 2DYRB 1SJXA 4S1DC 3DO4A 4KZCA 5I9QC 1B0RA 3D12B 5DMIH 1UADC 4WWPA 2L7UA 4XMXA 5DD6A 3CZFA 5E08L 1PDKA 4PP1C 4AYGA 4QRBA 5H37G 4OCXL 3MV01 5I8EB 4FQ2H 2E59A 1WQVT 4CMHB 1FORL 1X3DA 4MX7B 4R2GB 4R7LA 4Z78A 1SLWA 2HAZA 3S36X 3GUTB 4TUOA 3QIWD 3NEOA 5L8JB 4PWHA 1MFNA 4IKLA 3NBNA 1CD8A 3QDHA 3NGBB 4Y1SA 5DRZB 5KVDL 2X9WA 4ZQKB 2JCCE 3BSHA 2MHAA 3AXLB 2D31B 4UV7H 1H15B 1D6EA 4JGMA 3TBSB 5BZDA 1ETA1 5A2FA 4TTDD 1PX8A 1CXFA 4NO3A 2AQTA 4KRLB 3SYQA 4JDEB 1MREH 4KC3B 4P5RA 5E8PA 1BM3L 3QDJE 3V0WL 2DQEH 2EUZA 5DJXB 5CGMA 3MVSA 3ARDD 5FX3A 3NCXA 2Z1PA 1YEGL 1BVKA 1PJWA 3KXFE 4CMMB 4QHKI 1LWJA 4EUPG 1SUHA 3PP3K 3UC2A 1V7NH 3BVWA 3QZNA 4MA8H 4QRPE 4GUQA 3QA3B 5HDRA 1IUZA 4AJWA 3BT0A 3AMLA 5F1IA 5IW6B 3O8XC 2CGZA 5C08A 1VGKB 4P23D 2N3JA 3FO0L 1T83C 4AGLA 3FTXA 3B1UA 4PR5A 1KF9B 4UUJB 1DBJL 3VWJD 3IJYA 3PCYA 1A7OL 1NC2B 1NFIA 1WITA 5HYQA 3JZYA 1I8KA 5T1LA 1JCVA 3PL6C 4S1SL 2Z93A 5AKSA 1E67A 3L7FA 2XLLA 2BSTA 2QGDA 5A2AA 4NUPA 3B5HA 5AWNL 3OZ9L 1DFBH 1MHPL 2ARJQ 3A6CL 3IMSA 4XWGL 3CVHL 4AY0A 4KMQA 4PRIA 4OZHB 1DO6A 2X4RA 1S7XA 3LRKA 4MJID 3OG6B 3EYVB 2VITA 1X7SA 2RTTA 3BX7C 3H9SB 3STZB 5D4QA 1JV5A 1WUZA 2YAQA 4NI3A 3ZRFC 5EOQL 4I0PB 4XN5A 3KYMA 4U6YB 3KL0A 1D5RA 4XPAL 1NCHA 4WTXA 4AL8H 2FUTA 2VZOA 5E8OB 2JH2A 1LO0H 2H1PH 2OMTB 2OMBA 3EO1A 3MDJA 1MDTA 3SDXE 2ZOUA 5KSAA 1UD6A 1I7RA 2VL5A 4P4KD 2NQDA 1WICA 1SNRA 4K8RC 4PRNA 3DMMA 4GQPH 5DHDA 2W0FA 3ATEA 3BPLC 3Q6GL 5B8CA 4N2OA 2BVTA 4QRQA 3VGGA 1A9EB 2IFFL 1LTXA 1AJ7H 4WW2F 4HT1H 1ZE3C 1MPAH 5SWZB 3NIGB 5BO1H 2A5UA 2EH7H 2X4PB 3S98A 4UOW0 1EBPA 3VXTB 4F7MA 3OHXB 2WZ5A 1HHHA 2PO6A 3EYQD 4KPHL 2W9EL 4LEOB 2DQCH 2WWKT 2H6OA 1SDDB 1G1KA 1DSFH 4HHAB 4G83A 3RAJL 1NC4D 1U8KA 4RAUA 4PJ7E 1EAJA 1WFNA 4NIKB 1J05B 4R3SB 3T4AC 4UTBL 3RL2B 2NW3B 1NGQH 2DL9A 5L0QC 5LWYH 3VI3E 2DQDH 4X6EA 3MRNB 1KPRA 3PNWB 2X4TB 3GSNL 2WSKA 1H8OA 4P2QE 1MIML 4W9KC 1BZ9B 5E6RB 4F2MA 2K6YA 2JI1A 1A8JH 5DUMH 2J1WA 1IQDA 3QJSB 1YMMA 2XTJE 3Q5TA 5DLLA 2UYLB 2G5BB 1E5CA 2BVQB 3MKGA 1SJEB 3HRPA 4K7PX 3ZMEA 3FT3A 3SKOA 3QCUH 1LQSR 2I32A 4PUBH 3HG3A 5DHVB 3BT2L 4RGMB 1BHGA 3U0PB 1A7PL 3PJSA 1OAXL 4PPTA 3NJXA 3BH8B 1ZA3B 2FSEB 2A4EA 2J71A 1BVOA 2DEWX 2R29L 4RFOL 5DD0L 4ZO8A 3X1NA 3L13A 1FDLH 4O51B 4K5NA 1OW0C 1TTGA 3IJHB 3QXAA 4P2RE 1LJMA 5F89A 5BPPA 4Q9RL 4JG1L 2AJ3B 2Q5BA 1QFWH 1ILUA 4GJTB 4PRPD 2G2RB 5E9NA 3RGVD 2OL3L 1JMXA 3FAXA 3HPJA 3QXDB 4MDJA 4XNYH 5BS0B 3IJSA 4KROB 3IFLH 4XC3H 4OCSH 2IPUG 5KVFL 5LG1A 5ECJE 1HEJC 1E5AA 4LIQH 3IS1X 4NUJB 4FTVA 3P4MA 4NAQA 1JYVA 2ETWA 5K5YA 1DTUA 4P5MA 1DQLL 1U8QA 5DJ0A 5JR1L 3GB7A 4PJEA 2N7AA 3D85A 4XNXL 3HMXA 3L3IA 3ABKB 2APFA 2D03H 3NFSL 1GC1H 1SLXA 4NLHA 5GRXG 1RZ7H 1DCEA 5C71A 3DOSA 4L1TA 4ZSOE 3X13A 2CLRA 1T22A 1LMKA 2H6PB 3JV6A 3NJGA 3O4LE 1E4XI 4ZUSB 4TNVF 3P3TA 1RIHH 3FB6A 2MCG1 3GMPB 4MA1B 2NQCA 4NZUL 5D1XA 5I0DA 4I77H 1HINH 2PXYD 2OR9L 2XFGB 5DJYA 3V4VH 4R8WH 4KV5E 4C56B 4F57L 1NAMB 4M6NH 5C0AE 2RFXB 5F72S 1KIRA 4L8BA 4LSRH 4WEBH 1BF5A 5EC2B 3WHE0 4I2XE 4YDIH 1AO7E 3BXNB 3HC0A 1JE6A 3WJJA 2FQFA 1SXBA 4HEPG 2Q2EB 4ANVA 3NT0A 4JQXA 1HFUA 4FRWA 2WD0A 4DKEH 4QMEA 1WD9A 4D0CA 1IIIA 5EDSA 5DDHA 3QJHA 4QYOB 2OXGB 2P3YA 4N0UA 5IUSA 2G9HA 3H3KA 3IFNH 1XGQB 1UFUA 1AKJA 1IAKB 4JRXA 1I1FA 3U6RB 4U0RB 1V7MH 4N0RA 1BPLB 3PWPE 5CEZH 3JXAA 1EHXA 1ZY9A 5EUOB 3I74A 1Z9NA 2I24N 4BSWA 4N1CA 5I1KH 1T20B 5ACZA 5K9JL 2XETA 4O58H 4WO4D 3D2UA 5E5MA 1A6VL 2EDEA 3F7LA 1UWXH 1VCBC 4YGVA 4H2AA 5T3XL 1C8QA 4Q52A 4Y2OB 5I6XB 2CDEA 1VZIA 4XPGL 4EN3C 1TSHA 4OFQA 3S35L 4LDOB 2X0VA 2WTOA 1UM4H 5E2WL 3UBXA 1PKQB 4WK4B 5BRZA 2CZNA 1NWPA 1REIA 5AUMA 1A6TB 1GYVA 2IGTA 1HNYA 2WLJA 4LAJH 1XTLA 2YOAA 1FZMA 5ICUA 1DBBL 3PHOB 3QDAA 4NQQA 1CGTA 4X9IA 1BFOA 3QJFA 4XVTL 4HLZG 4IRJD 1QWHA 4MS8C 2WNGA 1I7UA 3VYPA 2XWBB 5BW7C 1KWGA 4HUVA 2ZKHH 4JFYA 2N1TE 4LVOC 5FYLL 3KPMA 2Q76B 3NP4A 4MASA 4Q56A 4L9LA 4ZFFA 4X5RA 1UOWA 2EEXA 4OIAA 2QPUA 4G82A 4CC4C 1EXGA 4NQEE 1V5JA 4XBEH 2EKSA 2Q0ZX 3BD4A 3Q2WA 3WUWG 3LCYA 5D5ME 3CFDB 4XR8C 4HSCX 3ULVD 2WQAA 3PAVA 3PXLA 5ISZA 5SWSB 4Y4FD 3TN0A 4KDTA 2O61A 1NGYB 5GGSY 4EIBA 1PQZA 3FTGA 1E2ZA 2I5YH 2ZONA 1BMZA 3KLDA 5T5FH 1E4KC 3A4DA 4PFEA 4N9GA 1YPZF 3ZZ1A 2A6IB 1S7WB 3RPIA 5DS8A 3FB5B 4IMKA 5DO8A 3CFCL 4YBLB 5MEND 2DQFA 1HILA 1OGAB 1P5VB 1CBVL 5T1KD 2XVLA 1PFOA 4OW6A 1MCFA 2WWKO 3BH9B 4XB8A 4BH8B 1HL8A 3Q2LA 3KHQA 4OCWL 1IZKA 5JQIB 3S3JA 1HE8A 1P0SE 3AMKA 5I1CL 3Q9PA 3OQRA 2VWEE 5EUKA 2Q86B 2CXKA 2OMXB 4AYID 4JRYA 5A3ID 3GTVA 5G4OA 3ISRA 1HEZA 2ZT9C 3E8VA 1JNNH 3EJTA 2EDWA 2ORBL 4NYLB 3CHXA 3STLA 1FNEA 1WCQA 3K8KA 4EIGB 3MV9A 4K5OA 4PJ6A 4OB5L 1EPFA 3JYCA 2NTFB 4JO5A 2MIZA 4RMWA 1DZBA 1N59A 4HKXB 1KIQB 1MLCB 2XNAB 2NY4D 3BVNA 4LL4A 1QEXA 4HWBA 3N43B 4K3GA 1KG0B 5D7SH 5INCA 2Z0BA 4F9LA 1YEGH 3CFEB 3KPPA 3WKNA 5GRVK 4FI6A 2WO4A 2XACC 2HWZL 5AOIA 1UD8A 2EABA 4Y5VA 5HHNA 1KTRL 2AQNA 4RGNE 5E9DB 4K2UH 4BZ2L 4KXAA 4MAYC 4YE0A 1E30A 4X6DF 2QBWA 4KJQC 2CUIA 3V7AE 4YXHL 5LCVL 4YAQA 4KZEH 5FM5M 2XN9D 3CSPA 4CSTA 4F2EA 4DP0X 4A63A 4AE1A 1YCSA 3MLZH 3QFJE 5I8EA 5AZ2L 2C26A 2R1XA 1MWAL 2XQ0A 4KKCD 4MMZB 2UZPA 4IOSA 4KRMB 5IG7B 3BZ4B 3FZUD 2JKSA 1T2XA 4UF7C 1A22B 2XQBH 4KU1A 1GAFH 4U1NB 4YHKH 3D39E 5J11C 3MUUA 4W4OC 3BIBX 4PJGA 4DIXA 2Z6FA 3DX7A 3LQAL 3ZYIA 5CZRA 5D2LF 4AJVA 2A9BA 4UTAA 2P43B 1H3XA 4ZQKA 1T5XB 4G7SB 4YHIA 5HI3D 4C4BA 1JNLH 5KSVA 2NUPB 1H15A 3LS5H 4HUXB 4JFZL 1IGFL 3CU1A 4YHOH 2C8NA 2IAND 4WK2B 2DLFL 3EFFB 3LPPA 3UIYA 4J3WA 3X3GH 1H3TA 2WBXA 1F4AA 1FBIH 1ETZB 5I1HH 4I3GA 3CFIC 5DD1L 5AVYB 1MY5A 2DAVA 1G7IA 4IIZA 4XPAH 3VD0A 2J5WA 1NCWH 2XC8A 4LIQE 1W0WB 2G75B 3CPLA 2GSMB 2NYYC 4PVMA 3UROR 2X2HA 4QTIH 3FO2A 1A4JB 2YSTA 4H5SB 4DGVH 3Q6GH 4QXVA 1BG1A 3T6XA 1BZ7A 1AHWA 4UBDD 3T0XA 2Y1VA 2V8LA 4LSPL 3Q3GA 2PR9A 1Q9LB 4HJIA 3MPCA 1B4JL 2FBOJ 5IESL 1KACB 1A64A 4JFFB 4KPHH 5IJVB 3CH1B 3BCDA 5AVZB 3HR6A 1NH6A 4CC0A 4ZZKA 1K5WA 3B43A 4I18A 5IBLC 4QOKD 2J25A 1JNHB 3GNML 4UILH 2AV7A 3GXTA 5LBSL 1HT6A 1LD9A 3TYGL 5FDWA 4UOW1 1IGTB 5HVFB 3EYVA 4HWEH 2BSED 3IM1A 3RVTD 4AIOA 5IHLB 1XMEB 2OKMA 4I0PA 5AW7B 3AWFA 1N64H 2D7TH 4U6YA 5ERWA 4LBAA 5HHOE 5BZWB 4LSSL 5E8OA 4GSDH 1HOCB 4P4RA 3HUJE 3SGKA 1T04B 3CZSA 2WBJB 3SPHA 2DLGA 3V79C 4OZIF 4FYQA 1ZOXA 1G7MB 2P80D 3WNNA 4ZX6A 4WF7A 2LW3A 3R7RA 4MXVF 4WGWB 3SQRA 3T3PF 2O93L 3US1A 3GXMA 3TLRA 1EFXD 1MFCH 1JSYA 1EK3A 3QDMD 3SYPA 3DMMD 2JIXB 4NQCA 5DXWA 5SWZA 3AGVA 5HGHB 1YEJL 4TNEA 2XPGB 2X4PA 1HNFA 3RQ3A 1BQHA 4BE6A 1KB9J 2Y9RT 4PY7A 3SPGA 1FZOB 3VXTA 1OGTB 3OHXA 5I82A 3HG1D 1KB5A 3BMWA 2XWEA 2UY7A 4QXUL 5C0FB 5CEZE 3IAGC 1CGXA 1OPOA 4MNHA 2OL3H 3TTSA 5ESVB 1SDDA 3RWHB 4OZGF 3P2BA 1T5WB 3T6ZA 4Q6IC 3ZE1B 3C5ZA 4YSRA 3P4LA 1RULH 1NQBA 4R3SA 1JZEA 3LPOA 2HMIC 1AE6H 1MHHA 3BAYA 3GC3A 3MXVL 4IOFC 3RL2A 4HV8B 4JQVA 2G2PA 4EI6A 4LCWB 3DYMA 3AWGA 1I1YB 3DOHA 4N26A 1BZ9A 2VDRB 2X9XA 1UYWL 3SQOH 4G8GE 4UQ2B 4XNXH 2FK9A 4X2UA 2LTQB 2UYLA 4O02B 3UBFA 3VYNA 4BSVB 2YXFA 1DN2A 2J6EH 3K4DA 2BVQA 2ZX6A 3DO7B 3CBRA 1KCUL 4WU7A 5C0DA 4PV1C 3UAAA 3D6GA 3BUIA 4R4FL 5DHVA 4DGYL 5T33L 1YMMD 3K6SB 2FJHB 2CKBL 2HT2D 2J43A 3BH8A 1SHWA 4L3CB 3JUYA 1KBKA 2DWTA 5JPNC 2X5PA 3EJPA 3OZKA 4M5ZH 4HQQL 3FH5A 3VU1A 1H6TA 1QFUL 3BLPX 3QNYA 3F5WB 3O2DA 4G80A 3II2A 1JF1B 4O51A 5E0QA 3IJHA 4B97A 5FHBH 4QHMA 2EH8L 4POZD 2G2RA 5AAPA 3QRGH 3OKOB 3MGTA 4RFEA 3UBGA 1U6AH 5BS0A 4J4PC 1I9IH 43C9B 3BP5B 4RFNC 1KYDA 3OB0K 4U3SB 1PEWA 4AQAB 3QORD 2WINB 3OAUH 2L0DA 4PSPA 1IT9L 3EGDB 4P2YA 1KLUB 2PETA 3AQZA 4A6YA 1VESA 2HT3D 5I8OH 1ZV2A 2CO4A 4J7RA 1VJSA 4OLVH 4KVCL 5LKNA 1CURA 3KPRE 1HAUA 1A3LL 1NCAL 2EDRA 3FH7A 4AV4A 2FJFA 5JLZB 2J4WH 2HLFD 2WLMA 3EBIA 1JI1A 3CUPB 5KSBF 3QEHB 4IJTA 1JZ2A 1T1XB 2IFGA 3F58L 1M2VA 1R3IH 1C16B 1K3IA 2Z91B 3SKNA 1MCHA 1U8PB 3ELAT 3SDCC 4DP7X 4GW5A 5SV3A 1Z9LA 1SN2A 3NG5A 2OXHB 2FYYB 1OZTG 1DJZA 3U4EB 4ZUWB 4L4TE 2C4XA 1AIFB 4ZW8A 5T3XH 4BQ6A 2IWKA 4DZ8A 3EYOB 4OV6F 3H85A 3T0EB 5ESQB 3RUGB 3S35H 5EC2A 4BWTA 4U33A 3LEVL 1OAQH 2EIEA 3PV6A 4K0OA 4WFGD 5I73C 5GRJL 4HJTA 1NFAA 5EZJA 3T8XB 3VFOB 1F97A 3O41B 4PWKA 3GBMH 3WELA 1EJ6A 2VDLB 1BLNA 4ZS7H 3TA3D 3R18A 4U6HA 2YUXA 5D7EA 3IPBA 1QBAA 4KTEL 1J48A 3GTTA 3WIIH 1U3HC 2C4FU 4PG9B 3FONB 2A83B 5FLUA 3WN5B 2OXGA 3F6JA 4QY8A 4KJPC 1SRDA 4IDJH 2EAEA 3TZVD 4LO9A 1CD0A 5I28A 2BVYA 3ZGHA 3U6RA 2ZAGA 4Y1AA 1ECYA 1CPUA 3FCGA 1G43A 1DVFD 3U82B 2MQGA 5HI5D 3BKMH 1EHAA 3GIVB 1G6RL 5EUOA 1V55B 2H2SD 4JRXD 5IROA 4LE8A 1WS7A 4HUMB 5IK3A 4P2OA 3VFVB 3OXRB 4POUB 4Z3IA 1EAOA 3L54A 5K9KA 4P59L 1KYAA 5EF0A 3V4PB 4J3OC 4NC2B 4XMPL 2J21A 3FTVA 1UT1A 5PAZA 3WO4B 3NIFB 4Y2OA 3LKNB 3U9UA 1BGXH 4NZRH 1ET5A 3EF7A 2XKNB 3MUY1 2FTAA 3QUMA 3CFCH 5JOFB 1VRSA 1ID5I 3GMQA 3D18B 4KDWA 5JMOC 1WJ3A 1U91B 1A9BB 1TLKA 2Z7WA 3ETSA 3AREA 4F8QA 1RPKA 2WOBA 2R27A 1O0VA 3KYKH 3OAYH 4YK4C 4UOJA 3O9WC 1IJNA 1OTSC 1KUMA 1S7QA 2ATKA 4HCGA 4A04A 2XWBA 3VFNB 1J8HD 2V5SA 4DTGL 5BV7H 1IBGL 1HXKA 2Q76A 1VSCA 4ES9A 4H8UA 3PV7A 4OF5A 2VZSA 1WFMA 2W65A 2JF1A 4WI0B 1HIML 1T80A 1E2WA 4GKNA 3GQFA 3I50H 3MGOB 3KXFB 1CGYA 3ARGC 1WBZA 4D9LL 3ARBB 1DQQA 3A6OA 2V9RA 2VDKH 4Y9BA 3X1FA 1TVDA 1Y0LB 4G9DA 1D7FA 3GJFH 4HUKB 4ZTEA 2V2XB 4IRSB 2X6VA 3PABA 4G6ML 1C08A 5JPMB 5L4IA 2A1WL 3JWOL 1XIWC 2K45A 2QGEA 3IFOA 3DDGA 5ISZD 2CBQA 1ETB1 3ZHLA 1OHZA 2ADIA 1RUQL 1GHFL 1K4CB 2A6IA 4QYAA 3ZR5A 5HPOA 1GCYA 1P7QA 4FLRA 1JRHI 2AHIA 2FH6A 2BSRA 4YXHH 4Y4KB 4TRPL 4AEHH 5GJTL 3DRTB 2HTKD 2W9DL 4BH8A 1GCFA 4WLCA 5I0ZA 3S0PA 2GPZA 1KIPB 2XX0A 3FQWA 2EEFA 4O5LL 4GO8A 4WFHE 1MCPH 4B60A 4FZEL 1ZWIB 1R17A 2E4FA 5DQJB 5AW1B 3SQBA 3ZDWA 4JO4L 1FL3B 1RZIB 1YYMH 1Z5LB 2ISDA 3TWCL 4GQZA 5J1AB 2NTSP 2VXQH 7PAZA 4G70B 1XR8A 4LVNB 2HJKB 4PCYA 3ZU8A 2XN1A 4H8QA 1K8DA 1G0YR 1RZKC 1SXZA 2HJLA 3GUFA 2UY6A 1Z9SB 2TAAA 2ZUXA 3AXIA 1E6JH 4WJ5A 5G5DB 2NTFA 1YEIL 5DC9B 1MCWW 2H32B 4QF1A 1ADQL 5B3JF 3NIDF 2PCFA 4ZUVB 2EKJA 1A7BA 1DHKA 4RGOH 4YGAB 2DLFH 3L9EA 5DEFB 3WIAA 4ANKA 2QKIA 1M2OA 1D3CA 4JM2A 3AG3B 3BRGC 2AMGA 4OCYH 1THCA 1DL7H 3UJTL 2QSQA 3TPUA 2JKRM 3CFEA 4Q4IA 4WI2A 4XZUB 3U9PL 5GPRA 5ABAA 5GJSL 4Y5YC 1FGNH 5IFHH 1RI8A 3OKMB 1QSFD 1I3GH 5B22A 5E6IB 2CALA 3MYZA 5E00A 2DLIA 1I85A 2QHLA 3BVDB 1B3JA 3K81A 1HKFA 1IC5L 2X4UB 1LK2B 4HWZB 4HIJB 3KNBB 1CDHA 3J2PA 4FQ1L 4NRZB 4YX2H 5DJCB 4MMZA 2DYSB 1UXSB 3BZ4A 1X5JA 1CLZL 5IFJB 1N0XL 3H9HA 2OX5B 1TUPA 1HDMB 4FE9A 4LSPH 3QPQD 4X9GA 3CXDH 5CR1A 2XG4A 3NZSA 3TYFA 3QISA 1NCTA 3DIFB 3X11B 4AQOA 1EZVY 1IGYA 4R2GD 4CUCA 2EUXA 3P77B 4MS6A 2HKFL 3BFWA 4OLZL 2BHUA 1OV8A 4ODVH 4EXKA 2AFNA 2R69L 4K5MA 1AS8A 4P2QB 4N0CC 3GMMA 4E0RB 1Y1DA 3UPCA 3S8GB 3EFFA 2COVD 3VB8A 2G5RA 1MQ8A 1CICA 4AGQA 1HSBB 4U31A 5HTSA 2XWJB 1SM3H 2XTJB 3RVUD 3HW7A 2X7LB 4F58H 4ZRGA 3ZRCC 2DQUL 3DGGB 1MDAA 4J3SA 4MQXC 1KELL 4F7KA 1LP9F 2X70A 1S7TA 3DVGA 3WSQH 1T1ZB 3F8UB 4UT6L 4M8RA 1W0WA 4PJIF 3B9EA 2G75A 4OT1L 1XD0A 2D3VA 4M9OA 5LNDA 4JRWA 4OIIL 1QFHA 3UTQB 1NIBA 4FFVD 3T77A 4UM8A 1QATA 4GMTL 1JZ3A 3ZBMA 3CG8A 1A4JA 2E7LA 3K8MA 4ODHH 4ANWA 4FMKA 1P4BL 4L3EE 1IRAY 4S10A 5IR1B 3FBQA 1DE4B 2KMWA 3KCPB 4YSTA 4OJAA 3QPKA 4GG6B 5FUZH 5JNYA 1ZGLP 4Z3JA 1XF2A 2BZDA 2DZEA 3WG7B 1YEJH 2WYHA 1Q9LA 1NGXB 1I1AC 1NC2D 1CU4L 5TQ2H 3ZDXB 1BW8A 4N2HA 4OCMC 5CZXC 1XH3B 3VXNA 4NJ9H 4X4XB 2OJZL 2D2CC 2DQJH 4QXUH 3CFKB 2ZP9A 3CH1A 4G43B 4DVRL 1VKXA 5MEQB 2RCSL 2GYSA 4AYSA 5FGBC 1BX2B 3L1OH 1KJVB 1WBYB 3IEAA 1KBGL 1BQLH 3IXAA 3HB3B 4GSUA 4MNQE 4PWGA 3T0WA 4ENEC 4LU5H 3HG2A 2YD4A 1BZEA 1FNLA 4GKSA 4WWKB 5I75B 3UAJA 1J1OH 4ZSOB 4Q6KA 2QSCL 2OCJA 1IBHA 2IIJA 3TV8A 3O4LB 1HOCA 1NMBL 3H9SD 2QQLL 1KGYE 1OPGL 2FUQA 2WBJA 3CLWA 4RISL 3TBCA 1IGMH 4BZ1A 4I0PD 1G7MA 4YDJA 5IJKC 4E5XG 1NKRA 2P48B 2BVPA 1ITBB 4RA3A 5HDBF 2QVIA 2JQAA 5EOTA 5GRWA 5LGJA 5H94A 4L18A 5T33H 5DVMA 2UZIH 4LVHC 5HVGB 4DGYH 5T3ZD 1G7JA 5EF3A 2JIXA 2GHWB 3AG2B 1DN0B 1HH9B 4I3SL 1L3NA 2XPGA 4O2CA 4U3CA 5DVNA 3S96A 1JUFB 1AO7B 1QFUH 2IPKA 3AS3A 1FZOA 3BWAB 1TDQA 4PB9H 3WEAA 1ND0A 4LHJB 5SWZD 2E6PA 4L05A 5C0FA 3SDDA 2GBTA 1GMEA 1IL1B 2APVA 2J20A 5ESVA 4NRYB 1ZHLB 3MRPB 4WRLA 4DO4A 5LAXB 5IMLB 2W9LA 4Y2LA 1ERNA 3I6LE 3LH2H 1I8MA 3DJSA 4MJHA 2YXVA 1OHQA 3OPUA 1IAII 2WJ5A 4G8EB 4APXA 1UGKA 4YQXL 4LF3B 5IT2L 4JFDA 2DQMA 5DSCB 4D7PA 2R23A 4LCWA 3HE6A 1BMGA 4EDWL 4JFEE 4W9LC 3IFPB 1BJMA 2ITCB 2NSQA 2VCOA 2VDPL 2Q6WB 3GK8L 3PWPB 5G4NA 3T1FB 1JFQL 4I4WA 1R5WB 4FFYH 4YBQD 5IB1B 4KJYB 4O02A 3ZKMD 2X28A 3QEGL 1YAIA 1XEDA 2B0SH 1F5WA 2PLTA 1PZ2A 4PJBE 4XP4L 3W5NA 3DO7A 1N5YL 2QQKH 3V4LA 4HWUA 3B6SA 4I3RL 4BHUI 5D8JH 5FPIA 4PP2B 5DJ8B 1MRDL 4ZW5A 8CGTA 1W6LA 4XWOC 4JJHA 3ZHKA 3K6SA 1HHGB 1KN2H 1XGUB 1A14L 2FJHA 2YLHA 3B7SA 2ZUQB 4L3CA 5JHLA 4BM7A 1AGEB 1ZVHA 3TEWA 5DYFA 1XB8A 5AOJA 1BREA 1EGJH 2VO8A 4LSTH 4PSRA 4F1SA 1J9QA 2J55A 4A37A 4XP6L 3I3BA 3LSOB 3D2TA 3OKOA 4K8RH 5TQ0L 1MIEH 1DBMH 1KDIA 1ZLEA 4BCXA 4IGBA 5H35B 3U2IA 4U3SA 3ZKNC 4GIOA 5E56A 4IJ3B 5L7XH 4AQAA 5E2TH 2WINA 1ZHBB 1NGPH 2Z31C 4HH9B 2CPCA 5DRXB 3EGDA 4TQIA 1ZE3H 3O11B 3LIZL 3N1QC 3NABH 1KLUA 5BS0D 4KROD 3VE0A 4S1QH 4HLEA 3T04D 2MQCA 2F08A 2WWOA 2NYZA 3CSFA 4KTEH 1T0NB 1YNTF 4LPCA 7PCYA 4OIBA 1UD3A 3RTLA 1Z0NA 3QFDB 1FG9C 3TBYB 3ZMNA 2YPVH 5D5MB 3HAEG 1U36A 3ML9A 3V52L 3DNKA 3Q13A 5E2JA 3X1BA 1N7ML 1Q90A 5J1SC 2P45B 2VW4A 3N1PC 3QEHA 4WEEA 4OFPA 4XH2B 4KTGA 4FAAB 4KITB 1T1XA 2BRQA 3N44B 5C0BE 3GXUB 1A65A 4GKZB 4RLDA 1BD2E 2K70A 1IGIL 4FFZH 1U8PA 1JGUL 1WZMA 1WFIA 7TAAA 1M56B 4FNQA 1XMWA 2FLMA 4ABQA 3C6EA 3WL9B 3TV3L 2YR3A 1CZ8L 4U3XA 2OXHA 2HVKB 4P59H 5D1ZB 3MX0B 3DTDA 3U4EA 4ZUWA 4YXKL 1ESOA 1WFJA 1B6DA 1KB9K 2VYRE 4NP9A 1KTLA 2EJ1A 4NQVB 5FAAA 5FO7B 5EEVA 2MSPA 1H8LA 2UV3A 4H1LG 1MFDH 4LKCB 4XCNB 3ZKXB 2KLRA 4HG4K 3KGRA 4C56D 3SE8L 2LQRA 5JOEA 2K6ZA 1A1NB 4OTXH 3H4FA 4TMPA 1U41A 5T1MB 3T8XA 3GXNA 2X0WA 3O41A 3SPVA 2AXWA 3SOBL 2GJ6E 1UJ3B 2RQEA 3WNIA 4GSQA 1AG0A 3TT3H 1AS6A 3V0HA 1PG7X 4HX1B 1U8CB 4GEJA 3ARPA 2E9BA 3FONA 1XGTB 1CI5A 3E6HB 3GO1L 3RJOA 3FBKA 4F92B 1YRKA 1IKOP 1JGVL 3MN8A 4PWJA 2Y1AA 4S2SA 4U7SA 1ZT1B 2HRPL 5D7JB 1BBDH 1F2QA 2CMRH 4Y4HC 4NKQB 1EJOL 3QI9D 4D9LH 1Q0XH 2CHXA 4LMQE 3VXSE 2IAAC 2IAMC 3T2NL 4RGNB 1U58A 3QB7C 3WKPA 5KWYC 4OSUH 3C5XA 5CSZB 5KVGL 4IRZA 2DICA 2WKLA 3DSFH 3KVQA 3LKQB 1TZ8A 2A1WH 1QLEH 2YUZA 2NZ9C 4XPTL 3QFJB 1L9QA 3ULVF 5TDOB 3B5GA 4GQRA 3BD5A 2XKNA 1GHFH 4BBWA 3QYMA 2EIBA 4QHUB 3MNZA 2XJKA 5JOFA 2B9AA 1AZZC 3VA2C 2ZD0A 3N85H 5D7HA 2R7EB 5IJBC 2ZKXA 2YAEA 1QPXA 2V3DA 1NBYA 3CHOA 5I0WA 5SV4A 2R56L 2P26A 4R5VA 2WXHA 4FZEH 4GLRH 4S11A 2P5WE 4MJ6B 3VFNA 4JY6A 4E9XA 3D8MA 2EXTA 2N7SA 1UH3A 3L3GA 4L4VE 4YHYB 4Z7NF 5IMKA 2Y2WA 3KDMB 5I1JH 4M4RA 3NCFB 3L5XH 5HJ3A 3J27A 2D7PA 1JPFB 1RFDL 4DKFL 5E1IA 1TF4A 4PVBA 2Y6SC 3ARBA 2OMVB 5HPMA 2YEZB 5JXEC 2GSGB 1P4UA 1OSZA 3EH1A 5DURB 4NJAL 1A1OB 1PF3A 4Z7UF 3CDCA 3GPEA 1QLRA 3QUKB 5DQ9A 4G6JL 5ANHA 4Y5XA 5EORL 4ZD3L 1L9OA 3IPFA 4LSVL 2ZYIA 4NPYA 1LE9B 1RHHA 5E8EB 2HJFA 5SWSD 3CFBA 3KWVA 5IVOA 3ILQD 5F8QC 1NCJA 2H41A 5F7EL 4TL4A 4Y4KA 4FHJA 1G5GA 1AR2A 4PS4L 3LVEA 1UC6A 2IPTL 3BYTA 4JL2A 2ARJB 1OGAD 1AKPA 4YUEL 1KIPA 3GRWL 1TTCA 1TENA 3I6KB 3RG1C 2MOVA 1QR1B 3V4UH 3MU3A 2HKHL 2AS5M 3VWKA 1CLZH 1IAOB 1ZWIA 1N0XH 3MLSL 4ELMA 5IUCA 5D93C 5TK4A 1OE3A 2M2DA 3CX5K 3DV6A 2F53E 4JPSA 4XGZB 5HHXL 2YGPA 2HJKA 4CBPA 2UVEA 4YHML 4HS6A 1CFSB 1Z9SA 3QNZB 4MBOA 3VG9B 3RTQB 5HHOB 4MNGA 2H32A 4PJ8B 3THMH 1PZCA 3WE6B 4EZJA 2DQTH 2FX7L 4G9FA 4ZUVA 3HUJB 1N26A 3CU7A 5DEFA 1EEYB 2Y6TE 5F7MC 1GGIL 3ECUA 4BK8A 4U05A 2VR8A 3VU2A 1WZLA 4QNPF 5CWSA 5GZND 1I8IA 1JZGA 1ZK9A 1X4ZA 4XZUA 4UIMA 3MO1B 3QZWB 1KCKA 3L3DA 3OKMA 4U1GC 3WGUB 5E6IA 4P2CG 5D7IA 1KEGL 3Q5OA 1KJ2B 4PGBA 4OIIH 1EO8L 3C6LC 3SD5A 4LPWA 4NRXB 2NX5A 2X4UA 1LK2A 4WWNA 4GMTH 1WCBB 4HWZA 4PJFA 1GVIA 2QR0B 5E9DD 3KNBA 4KQ0A 5C0JB 1EANA 2R8SH 1LEKB 1NEUA 2DEYX 3O81A 1MFMA 4K3JL 4P3DB 4CAGA 1UXSA 3GSQA 4LSDA 6CGTA 5IFJA 1T89C 3BZFB 1W9XA 5E8DH 2OX5A 4AJ0A 1HDMA 1AP2B 3FOMB 5CCKL 1NM4A 3DPBB 4OZFA 1GGBL 2JJUA 4ZFOB 2VMCA 1CU4H 2XKSA 3I85A 5GRZA 3DIFA 1JL8A 3X11A 1N6QH 1F3RB 4DQOL 4HLJA 1NBZA 5EN2B 2BNRA 2LFGA 3KPOA 4PJAF 5I5IA 3KJ6H 2XZAH 1S7SB 3L9BA 4JE0A 3FMGL 5BXFB 5C9KA 1UCBL 3CN2A 1SGKA 4G8GB 3K5SA 3B9KB 4R5XA 3RKDD 1E5BA 2XWTA 1K8IB 1NUGA 4NHCH 1TOXA 2X7LA 1T66C 3W0WE 5I1EL 1IFHL 3DGGA 4MXWL 1O9VA 2P4AB 4PLKD 4N8VB 2QSCH 4P06A 3MBEC 2KT6A 1QKZL 4KY1H 4EI5C 2BXYA 3O6LL 4N5EC 2VGLM 3I3DA 5KUMA 2GK2A 4Q9BA 1OY3B 4WDIB 4LLMB 2ZAHA 3ARFA 3UTQA 1QEWA 4PLJC 3PWJB 2PABA 2DTML 4WHYG 2WSPA 3MACL 1JXJA 4TF4A 3S9DB 3QIUA 4PS7A 2VABB 3JWDC 3GSWB 1DE4A 5LVEA 3KCPA 1FRGH 2FQDA 4GG6A 4NUQA 5ACMA 5HDOA 1EHKB 3NK3A 1SPDA 1FO0H 1NGXA 4YHPA 1Y1UA 2YGNA 3REWA 5B39B 5I6LA 4G8FB 4H13C 4ZX3A 1XH3A 4OGAD 4CVXA 5J7CC 5KYUB 3MSPA 2WQSA 2EO9A 5GZOC 2IADB 4G43A 5DWUH 5H37H 4AMKL 5IB2A 1AIZA 1D6VL 1QFPA 3QUXB 1BX2A 3Q8AA 4JFFD 5E2UL 5E1QA 1IKFL 2ICEC 4U1LB 4EI0A 1EERB 4GINA 4JM4H 4YSAA 1KXQA 2JWYA 3BFOA 4FQQB 4FXGB 5I0YA 3G04B 2ED6A 2FNBA 1D5XA 1ZXKA 3PDOB 1XAKA 5DO2C 3RVWD 1WA1X 3CZKA 3Q1SH 4LCIH 3U0WH 5F96H 4PJXE 4JY5H 2XV0A 1EBAA 1P6AB 2LVEA 5ID0A 4NHUA 3V9CA 5ITFA 1M05A 1O9ZA 3AG1B 2XQYG 5HD8D 2AVFA 5HVWA 1QR4A 2OMYA 1N5YH 1UUSA 5A2JH 1A6UL 3FN9A 3ZE2F 4WEMB 2ZSWA 2WBJD 5GISL 4L4TB 3SGJC 4FL4B 3TT1H 3BEVB 1IBDA 1XBRA 2AQ2A 2FWLB 3S34L 2AP2A 2OMNA 2Y3NA 2WVTA 4EUPH 1HH9A 1E5UI 1UA6L 4P5TC 4XAWH 3MRMB 1HK6A 2ZOKA 5A6IA 2GKIA 2Z92A 3QW9A 4ZXBB 1OVZA 1NFDA 2YMXL 2JIXD 3DLQR 2NY7H 5EBMA 5FKAB 1RK7A 3H42L 3DOIA 1S4IA 4Z6AT 4NRYA 1ZHLA 1JVOA 3MRPA 3OAZH 3UYPB 5KVEL 1R6VA 3UTSB 1A7NH 3PHQB 5IMLA 1EEZA 1FA4A 2PYEB 3MRRA 3SGDI 5JZ7D 3DHUA 3EH5B 4G8EA 1WA2X 1QRNE 3P4OB 5DFVC 3VXRE 4HAGA 5C6WH 4BYHA 5LGKA 1SOKA 4NAJA 2WQVA 1F8TH 3FUEA 2DDQH 5E7FA 5CILH 2Q6WA 2VDQH 3CK0H 4ZUUB 1XCWA 1R5WA 1S9VA 2J12B 3K72A 4TQPA 4LCWD 1WC7B 3IJEB 2X6MA 3QXWA 3B3IB 4FQLH 3SY6A 1UH2A 3VXUE 4KAQL 2PCPB 3R7QA 1XSJA 4XO4A 4AM0A 2W91A 2WYZA 1KLFB 1UKTA 2FIKA 2CLZB 2W60A 1JF6A 1XGUA 2PCYA 3SO3C 4PJEF 2QMKA 3S5YA 1AGEA 3L1GA 1CD9B 4U2YA 1GZHA 1QWUA 2MFNA 3NZ8A 3DBXA 3FT9A 2BH0A 3OV6A 3QZBA 2GJZB 5CP3H 3UTPE 3TJEH 4EN3A 3AROA 3FT2B 1UOKA 4HAKA 1FNGB 1MVUB 3L3JB 5H35A 3IRPX 4LPVA 4P23C 3I75A 1J5OL 3DWTA 3DI2B 2GSIB 3JVFC 4H20H 1ZHBA 5GS2H 1MHEB 4HH9A 2D9CA 2ZOLB 3P9LB 3QCVL 4BHUA 5EPMB 4JJ5B 1E2VA 2FEEL 3NACL 3HI6H 1HI6A 3RI5F 5DQDL 4L1SA 1T0NA 5DVPA 2Z8SA 4RMUA 4AEIH 1G7LB 3BKJH 4W93A 5D6CB 1UVQB 1UWGL 2EYSB 2WCSA 1B6UA 1LQBC 1MZYA 2GVYA 2R1WB 3GS7A 3VXQB 4FABL 4Z5RB 1JGVH 3STBA 4F93B 4ETYA 1NWOA 4XH2A 3BSZA 2F19L 3BUYA 3SYOA 4GFTB 2MWCA 2WV3A 3NFPB 1A6AB 2V3EA 4K55A 4CVZB 2QVKA 1DJSA 2VMEA 2Y7QA 4MQSB 4MMXB 3LXBA 2WLNA 4NKMB 4K71B 3MX0A 4HKBA 4LPXA 4PBVC 4IBZA 3H3PH 4QRTB 9PCYA 4BJLA 3T8VA 4HVBA 2QADB 5HYJE 2QEJA 4NQVA 3ATDA 1MUJA 1OAKL 1NMCC 1G4MA 1T2QL 5F1KC 3QJRB 5DHYA 2ZCLL 4G5AA 4MJJA 5HDQH 1E3FA 5ES4B 2AEPL 4IMLA 3D48R 1FE8L 1JK8A 4HIHA 4PU2A 4HJ0D 2HRHA 1LO2L 1E0OB 3T0ED 2ERJC 3KVPA 1TZIA 5JYMA 2R39A 3G08A 3GPSA 4IS6B 3U6XS 2R0ZH 4HX1A 3CZJA 4OD3H 5I76B 4YXLH 2XFXB 1TQBC 2DLHA 2JTYA 1XGTA 1P5UB 3E6HA 1UT9A 2VQ1A 1AOZA 5CN3A 43CAA 3GFUA 5LB1A 1CS6A 3D9AH 5JA9A 5AKVA 3M07A 3QNXB 4NB7A 5AL8A 1CFTA 5D7JA 3VXME 1MW0A 2OQJA 3CLEH 3V6FA 2OL3B 4DKFH 1RXLA 4LBEB 1GOGA 4X5LA 3BKYL 1S78C 1A6WH 1KGXA 4M6ML 3GSVA 4N6QA 1L7IL 4LASH 5F9OL 2BNUA 1WHPA 1U8OB 2I7OA 2JB5L 5CSZA 1OTUD 3QXVA 4E42B 4FQJL 2XZQH 3R06A 3G5ZB 5A43C 2WUCH 4K23L 3UC0H 4OLYH 3VFSA 4ZD3H 4DP5X 5TDOA 3D3VB 3TBWA 4F8NA 5DGQA 2Y72A 5C6TH 1U2YA 4PJHB 3MV8A 1ZANL 1Z3GL 1TMQA 4QHUA 3RY5A 1TT6A 4TNWK 2FJSA 3SYAA 2OV0A 3KWXA 4XOAA 4KX8A 4X5PA 1K5NB 1RLWA 3SKJL 2F8XC 4Z7OF 1O7VA 4HJGB 3MRBA 1UURA 3RA7L 2COQA 2B59B 3ROLB 4C4UA 4YUEH 5C7XH 4FJYA 1NCBL 4PQXA 1R24A 3WY4A 1CLOL 3C5JB 3ZUNC 2JCWA 4LRNH 2DWDB 3FU8A 3IDXL 5LBGA 1QHOA 4FA8A 3F7RA 4ODBD 2E86A 1SJHA 1NCIA 5LN8A 5CP7A 5KN5B 4QWWD 2R2HA 5D6DA 4ZPVB 1UD4A 4DSYA 2OMVA 4DW2H 4F9PA 2G60L 3EYUL 3HC3L 3QDJD 1VHPA 5GGUA 1WA0X 2FX7H 1F18A 2ADJA 1EDHA 2GSGA 1A1OA 2VKWA 3FT1A 1DVQA 4C54A 3AM8C 4P46A 3KXFD 3OWRA 5JUEL 5FEBA 3ARBD 5J6SA 2VISB 4LSQH 1UM5L 5GXBB 4L3EB 4JDTL 1A47A 4X6FB 5E8EA 1JTTA 3VH8B 5K9QI 1WAAF 2FO4A 3IMWA 4IRSD 2WP3T 2H26B 4N9OB 5EO1B 3IXTA 1T7VA 2NZIA 2DOCA 3E9TA 4NN7C 1M9SA 5FW7A 2IALA 5AW0B 2QT6A 3SGDH 2F5BH 2DQGL 3GLEA 3I6KA 3EF4A 2OTUA 1VACB 2X4OB 3BQUA 4ZX5A 4C8XA 3MREB 1QR1A 4Y4KD 5JHDE 4J3OH 4NCC1 3OKKB 4Y2DD 5EWIL 3TO4B 4NZFA 1E8YA 2H1XA 2Z34A 3TVMA 4YC2B 2ALAA 5DZAA 1AD9B 4XGZA 4BUGA 2C1OA 4MNQB 2G4EA 3AAZA 2J1ZA 5BQDA 4FQHA 3VD2A 2WWNA 4WUUB 4XXCC 4A7SA 4ADGA 3MCG1 1SVZA 2WJ7A 4PJ8A 5SWQA 1RZFH 3WE6A 2GJJA 1XCQB 4HLZH 1BYPA 5A2BA 2B4CL 4GBXB 4ZW6A 3DSNB 4YHLH 5I71C 1YUHB 2I07B 1UZ6F 1F6FB 3U46B 1UATA 3WFBH 1H3GA 1EEQA 1V27A 3P9MA 4YH6A 3KLAB 1MNUH 4OLXH 4MXWH 3MO1A 4PWEA 3FU7B 3GMOA 5LO7A 1DBAL 2DYPD 4P9HC 8FABB 1QKZH 1B9KA 2G30A 1ZTXL 3APNA 4PV9A 3P3UA 2NNRA 2X2YA 3S4SG 4TPRH 2E9GA 3II3A 4JKWA 1KJ2A 3KWWA 2PWHA 4NPJA 5DZNA 4NRXA 4PJCE 5GGTA 4ERSH 4FX5A 1WCBA 3VRIA 4M7LL 5I2IB 3C08H 3WEXB 2YZ1A 5C0JA 5MEPA 2XWCA 1LEKA 3D0LB 4YZFF 4P3DA 7CGTA 2DM3A 5ILTL 2GCYB 4ZAKA 4WGKA 1GJIA 3ZPDA 1NIEA 5E5RB 4JY4B 3FOMA 3VFGL 1ZGLA 3DPBA 2BLFA 3X14B 4ZFOA 3MLTB 3CZUB 3UZQB 3MFGB 4PJ5A 1S9WA 4MZRA 1RURL 3L3HA 3ZDZE 3WNLA 3BPOC 3VDBA 4ZDHB 4GRLC 5F71A 1YJDL 3HRZB 3HS9A 4JFEB 5JW3H 2VUYA 3IKCB 1S7SA 4Q2ZB 4TSCL 5A40E 1R46A 3B9KA 1BP3B 2ZWZA 2R4SH 2YGOA 3ECBB 1R3JA 4YFEA 5I8CA 3WXVL 4P2QD 5DD5H 2KQNA 2CH8A 5BO0D 2BX5A 3RU8L 2XOTA 3QZOA 3GZKA 3L3KA 4R0LC 3WKMH 2NR6A 3NA9H 1BXAA 2XTJD 15C8H 2J8UB 4WDIA 1RZKH 4OZHF 2BWIA 3BE1L 3ESNA 4XVJL 3LV3B 3RX7A 2EP6A 3QCTH 4TVUA 4H40A 3P30H 4F7TA 4G6KH 1E9QB 4DP9X 5KJ4A 1RZ8A 5HVHC 2VABA 5CR8A 5T3ZL 3H2WA 3MZGB 3OKLA 1OCZB 2VDKB 1RJZA 4NWTL 1W80A 4EXPX 3ULVC 4CN6A 2YAPA 3GJFB 1FLRH 3BAKA 4Y4FC 4QRRE 3B3BA 3W3BA 1GGYA 1UOLA 2ODIA 4ISVB 1K6QH 4KOBA 4FQXC 4UZGA 5KYUA 3VI4F 2EILB 2RA1A 2F7PA 5CJOL 5FR3A 4BWUA 2FZ3B 1O5PA 1T7WA 3QK0A 3WFDH 5LJYH 1WEJL 1FVDB 3UTTA 3L5IA 4JS7A 2Z8VC 4NBXB 2ADFH 4PGCB 4I87A 2VH5L 3P0YL 3NIGF 3BEWA 3HFMH 5FM4A 4LPUA 5DMKA 3CFMA 5CZVL 1EXUB 4BSJA 5IBUG 4U1LA 1RUML 2DBLL 3VD5A 4FQQA 1UHVA 2ZKYA 4QJ5B 2YRZA 1KY6A 1SYVA 2BNQA 1MWAB 1HWHB 3NJKA 1G0XA 2G2NA 3DECA 5C0BB 2FE0A 3HB3D 4JKLA 2FIRT 5A3IC 1BD2B 1NANI 2JKNA 4WWKD 4V1DE 4WUKL 2H1LM 1KDJA 3BP6B 2CBMA 2GC7C 3ZHDA 3O4LD 2H8PA 3FQTB 4LFHD 4BIKA 1ILSA 3BKCL 3ZXAC 1GYWA 3LRGA 3JQOB 2B08A 5I8KH 2NY4C 2VQTA 35C8L 3QIBC 2X10A 3Q06A 3MRLB 1N8OE 3BISA 5B1KA 3AUWB 4M4PA 3DI3B 4UU9B 3V0VA 1PLBA 4HIQA 4JO2H 2C5DC 4MDIA 4YE4L 3QG6A 3U0TB 2GJ6B 4JL1A 3EFOA 3VDCA 4APQB 1QFWM 4LXFA 3UTSA 4B9IA 1AO7D 2EO1A 5IEKB 3VD7A 2DQIH 3QXUA 4ZTOH 3MNDA 2PYEA 4OFIA 1EMTH 1KTDB 1OSPH 4JRFA 5C07A 3H6AA 4OGXL 1XSOA 4HKJA 1RZGB 3QCVH 2XDHA 4L29B 4M7KH 4Z1PA 1U30A 1AZUA 1SEQH 3N9GL 4YDKH 4OGYH 4E2OA 2ZWSA 2R9HD 3SY0B 1JS4A 3DVNB 5DMYA 3VXSB 4K5LA 4ZUUA 3MOAL 1ORQB 1KB3A 4Y19B 1UWGH 4Y7MA 2OR7A 4UYQA 4WVRA 3SE6A 1WC7A 4YN3A 1TEFA 3IJEA 3L4WA 3T3ME 1DJGA 2BFGA 2R83A 3AS2A 2B20A 2MNUA 1A3ZA 1WT5A 5HI3C 2WP3O 3PWPD 3CVHA 2PTTA 3RRQA 2C1PA 4NQDA 3EBAA 2JKLA 5I74B 3RNQA 3AS1A 3K6DA 5FYJH 3DGDA 3H56A 1MELA 2R0LL 1K4DB 3O3DB 2Y4SA 3QQNA 2MNJB 5KANI 3QUYB 5GSRA 3LRMA 5D7LB 4MA7L 2EC8A 2O26U 4YFLF 3VVVA 5FYKH 2GJZA 1M6OA 1K85A 4QTFA 4HMCA 3O4OB 4AH2B 5AVQB 1KCRH 3E8UH 4DFIA 3E3QC 2P5WB 3RJQB 1NAML 4G42B 4WW2A 2GSIA 4HPOL 2HH0L 3ETBJ 5EU7C 4L4VB 2ZOLA 4C58B 1CGWA 2JJWA 4FDWA 5HGDB 4J5VA 4R97C 4RMTA 1UXWA 2OW6A 5ETUA 4UBDC 5IF0B 4AW7A 2DEXX 4FULA 3SJVA 1BYOA 5D6CA 1UVQA 1T1YA 2EYSA 3JV5A 3VXQA 1RSFA 1M1XB 3V0IA 1DLHB 3N42B 1YQVH 2H0PA 4M1GL 4N2GA 3L4XA 3OKDB 4NQED 4DK3A 5CEYB 5I0XA 2AZUA 3DTXB 4DOHE 3D4CA 3IDIB 4K7FB 4W9CC 3C87A 1P9MA 1X9LA 3M1OA 3H0TA 1U2CA 5FXCH 3SCMA 4OY9A 1J8SA 3FYIB 4JPQA 1BCIA 2YSSB 3NFPA 4FG2A 4WO0A 4CVZA 1PLCA 2DIBA 3OR6B 4K9JA 1OQOA 4MMXA 3RZCA 4HOWA 5BRQA 3RVTC 4NKMA 4UTBA 1CFVH 3TM6A 5IGXH 2PWDA 4P57B 3GSNA 4BFFA 3K2UH 3PWVB 5B1AB 4UQ3B 5KAQG 3LH8A 1BOGB 5D1ZD 4MAUH 4K7PY 2BVOB 1GPOL 3GHEL 3IRZA 4JANA 1CJYA 1ZD6A 2GUOB 3CVCA 3WS6A 2XZZA 3KYAA 1YNKH 2LABA 4UB0H 5GIRB 2W59A 5BRPA 4ANUA 4HS3B 2F53B 4AQZA 3HVNA 4NO2A 4PN6A 2IO5A 1EVUA 1JFHA 2YN5A 1CLYH 4TQEH 3KWUA 5KSAC 3DURB 3L4CA 4YNYA 3DMMC 2CSPA 3VD4A 4ALAL 4KY2A 1JZ5A 1RUKL 1S5HB 2AJXH 2APXA 3HR5A 1U0QA 2R29A 1YNLH 1ZLWK 2ZCHL 5F9DC 4O4YL 1PVHA 4JFXB 5F7HA 5BOJA 1GA2A 5L9DH 3O8XB 4N85A 4RMQA 3N50A 2OL3A 4LNVA 5BUPA 3CCHB 1A6ZB 1PLGH 2P8PB 2NY3C 1HN1A 2CM5A 3B8YA 1G7HA 4P05A 5CN2A 2PO6C 3OMAB 1BQHG 2Q10A 2D9QB 2ICCA 3UZVA 2BFVL 1CXHA 1ACXA 3GD1C 3PL6B 2BDNL 1N68A 1CDUA 3FRPA 4P9ML 3IBOA 4WY7H 1HKLH 3MRHB 2FX9H 5CSGA 4ZMVA 4RGND 4XP5L 1UT2A 3LHAA 3LKSB 3D3VA 4JHBA 4RMSA 4L5FH 4PJHA 2ZUTA 3R0MA 3GSRB 3FRUB 1ZSDB 3ESMA 3DYOA 4KK5D 1I8AA 5GGSB 2YPKA 3QFJD