4DN3H

Crystal structure of anti-mcp-1 antibody cnto888
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
217
structure length
211
Chain Sequence
ELVQSGAEVKKPGSSVKVSCKASGGTFSSYGISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CNTO888 LIGHT CHAIN
publication title Structural basis for high selectivity of anti-CCL2 neutralizing antibody CNTO 888.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 211
sequence length 217
ec nomenclature
pdb deposition date 2012-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dn3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dn3H01
1G0YR 3QEGL 4MZ2A 1N4XL 3AU1B 3ARBD 4RA0C 3C6LA 2J4WL 2J5LB 4PLJD 1A2YA 1AY1H 5DUML 4G3YH 4OBSA 4M93B 3PF2A 2ZOKB 1YNTA 4Q6IA 4AT6B 2Q20A 1YPZF 2AAVA 3T77A 1FNEB 2P43B 3VXMB 1BBJB 2YMXL 3WD5L 1PX4A 3D39E 4RFOL 5A2IH 4KVCL 3QR2A 4P2RA 1OAKL 4L9LC 2FWOA 3EUUA 4U1LB 3RKPA 3ILQC 2DYPD 3VFNA 4JM2A 1S9KC 5HHMD 3MOAL 2G75B 1EGJH 5TH2A 4U6HA 4X6FA 1B2WH 3VXRD 5D1ZB 1FGVH 3RHWF 4NQSA 4R9HA 1IM9B 5IIEA 3OJ2C 1J0YA 1IGCL 5ADOL 4NO3A 5JOFB 3KYAA 3DX9A 3T0VA 2VITA 2VN4A 3EYVA 4MHHG 4RZCB 4YGAB 1BFOA 1ZT1A 1NSNH 4WWKD 1F90L 1Y0LA 1HILA 4JQXA 4ORGA 5L7XH 3GSUA 1MAKA 2Z31D 3PP3K 3MRRA 1J0IA 1U8KA 2CUHA 2JJSC 3VH8B 1PX3A 3U1SL 3GM0A 1JRHL 3B9KD 3MFFB 4M7LT 1SYVA 3FN0L 1RZKL 1EVUA 4WHTA 2A6KA 1W0YT 3QDMA 1F3DH 2JJTA 4Z7NF 1S78C 5ERWA 1K8IA 3OG6B 3VU2A 2QSTA 3WNPA 2FGZA 1AGEB 5I8EB 1NCUA 4HDIA 4KQ3H 5EN2B 4GS7C 4WV1B 3RWIA 2ZJSL 5L2KE 2FX9L 4ZG1A 3EFFA 4JREB 2R0LH 1TLKA 2CRZA 5KTEL 1DVFC 4Y5VC 5L9DH 2V2TB 4HLZG 3VRJB 5CIPH 3NIDF 3EDDA 1LEKB 1I4FB 3VGEA 1T7ZA 5JW4M 4JGMA 2FR4B 2NX5B 2E7MA 4S0SD 1A6WH 3KDMA 1A3LH 4ZUVA 1XIWC 2KH2B 1INEL 3L3HA 5JNYB 4ZAKA 2DMKA 5JW3H 1OTUD 1HIMH 2RJMA 5JORB 1G0DA 1ZLWH 3GSWB 4M5YH 1X5HA 2DQIH 4AM0B 4KV5F 3GI9H 4ZOCA 5DMJB 1DL7L 3MV7A 4NKDB 3SPVA 1QLEH 3ULUF 1RUQL 3W9EA 1LK3L 1EGJL 2FJGA 3IXTA 5ETUB 3GMMB 1MCCA 5E8DL 2YN3A 1RK0B 1X3DA 2JB5L 1T1YA 3SJVB 3L9RB 4YHYB 1HZHH 1KC5H 1VFAB 3QUXC 5EFIA 3BHBB 1TQCB 3NFSL 3Q3GA 4GAYA 3V5KA 1SBSH 3PIQA 3E8UH 1GRWA 2ZPKH 4ZFZB 4XP4H 4IHOA 5DJAB 3ZDYE 4OLZH 4JRXA 2BX5A 3PG2A 1WLHA 3BD5A 1XCTB 4WWID 5GS0C 5L6YH 4D0CB 3DETD 4F3FB 2J8UE 1E6OH 2P5EB 5IB2A 2ZUQC 4PTUB 1LMKA 1F4WH 4OM0L 2Y06L 3MRPB 5EU4A 5EOCJ 5C0RL 4W70A 5J8OA 3GO1H 3RTQD 1BBDL 1DR9A 2CLRB 2ZOKA 3D85A 4LCIL 5DHXB 3CK0L 3ZHDA 4M1GH 1WT5C 2AJVH 4QRSB 5FO8A 2QTEA 3HZKA 4FFZH 4ZD3L 2X4QB 1U8PB 1FC2D 4RA3A 1G7HB 4XPAH 3G5ZB 2VLKD 1L4IA 3C9NB 1JL8A 2P49B 3GBMH 3D69B 4MGXA 3F7VA 4TTDD 1H9VA 5B38B 2FB4L 5AEAA 3BIBX 3GSXA 1SJHA 2XTJB 3RUGA 4ONHB 1INQA 2V5YA 1CXHA 1ITCA 3HNTL 1A3LL 3U9UB 1YYMH 2YPVL 4NPYB 4PJCB 3DMMB 2APFA 4IM8A 4NQXB 1S7TA 5CD3B 3MV01 1XGYL 3O9WB 3WCYA 2CIKA 3VJ6A 2R9HC 2FNBA 1A1OB 2ITDB 2DQIL 4P49A 1QLEL 2DQCH 5ITFA 3VH8A 1D5BB 4YHIB 1IC1A 3VGAB 4RGMB 5HGGS 4BZYA 4FXGB 4X9BA 1DUYB 1MJJA 2QV2A 4HUUB 5T1KB 1HZHL 1X9QA 4JFYB 5FO7A 1ULVA 5HGBA 1NMBH 3BGMA 2RAMA 1S9YB 4NUGH 4EOWL 5I30L 4JAMB 3BVNA 3RWHA 4HPYH 3S3PA 5C0EB 5I8EA 5I1KL 1TQBB 4F58L 1FSKB 1NGQH 3EYSH 2ORBL 5EUOF 1U92B 2EIBA 1W0VA 3LQAH 5T1DH 2DJSA 4P57B 3KPNB 2DIJA 3VRJA 5DRWB 1U8IB 3UBXI 1I4FA 4LCUB 5I1CH 3SQOH 1X4XA 4HG4J 3VRIB 2FR4A 2C26A 3HPJB 5CLTA 2X4NB 1UM5H 4XP9L 3UZVB 1RIVH 5GIRA 5JNYA 1BM3H 3BP5B 4JGJA 4JN2B 5DHVB 3QAZC 5E8EA 2B5IC 4PJHA 1KG0B 4OD3H 3PQYA 3GSWA 4ODBD 1CD8A 4MS8D 4PJ5E 3RNKB 2AQ3A 4HULB 4UUJB 3HUJE 4OGXL 3PNWA 3T0DA 4X9HA 5KS9A 2EDHA 3GMMA 5IHUH 4KRPB 4PYHA 5GRVL 3ZL4L 5TDNB 4D8PB 3P4NB 2QSCL 5GS0L 2RGSA 1CD1B 5DXWA 3WNKA 3PV7A 4ZFZA 3LKRA 1QFWM 4X7TB 5DJAA 2CD0A 2F54D 3VXSB 5GRZA 1DEDA 2VR4A 5CBAA 3QHFH 3H3PH 3WHXA 3W5NA 3MRIB 1XCTA 1CU4L 3PP4L 4EN3D 4POZD 1YEDB 4UIKL 1UKQA 4L4VA 1M71A 3FAXA 3V5DB 3L5WB 3W11D 5IJKA 2P5EA 4P4KD 3O6ML 4PTUA 4LPTA 3MRPA 5GPRA 1KJ2B 4ZXBC 4LVHC 2I27N 1ED3B 1KCUL 2R29H 4QRSA 2AABL 2CKNA 2IAND 1FDLL 5JHLL 1JF6A 3P40A 4Q9CA 3GZKA 2E6QA 5KSUB 1VGEH 1FH5H 1U3HD 5I74B 4YFLF 1JYNA 1L0QA 4NRXA 3C9NA 3UTTD 4I5BA 4ZOAA 3D69A 2XZAH 3HAEB 5B38A 4FS0A 3W0WA 4P4RB 4P2RE 3P11H 5I1IH 4TSAH 1VEPA 2GK2A 2W38A 2NNAB 4MXQD 2EH8H 4AMKH 5JA8B 1TVBB 2G5BA 4JZOB 1BX2A 5KAQG 2UWEB 4QXUL 4XX1G 5DTFB 4NQXA 1T66D 1WISA 5C1MB 3K0WA 3ZTJG 1JHLL 5C0BB 1F5WA 1SJVA 3JTTA 4X7SL 5IW1A 1Q9KB 1S9WA 4Z78B 5GHWH 4XP5H 1X5LA 3OZ9L 4D9QE 3MA9H 5K9KB 4Y2DC 2C1PB 1D5BA 4YHIA 5DEFB 4PJ9D 4XAKE 5E8OB 3SKJH 2AJ3B 3X3FL 4PTTB 3UPRB 5D96C 3GI8H 3UYPA 3QXUA 2AJZB 3BZEA 1DUYA 1QFUH 4JDVB 1GGUA 2FH8A 4JFYA 3JTSB 3H7BB 4PJGF 1S9YA 1XMWA 2A6IB 1BZ7B 5HVGB 2YRPA 3ULUD 1J8HD 4ZO6A 5CWSB 5ID0B 3KLHD 4ODHH 3QDME 4D9RE 3HMXL 1P4IL 2Z91B 4WU5B 1OARH 2ZCHH 2OR9H 1VA9A 1KBGH 2R56H 5M95B 1XF2B 1PY4A 1AHWC 3WFEL 4LCUA 1W2KT 5BO1L 2H26B 5E2TH 5IG7A 4X6BA 1MIML 5FYKE 3MRKB 1U42A 4AQOA 3U6RB 1NCCH 2DLTA 4NP4H 2APVA 5JDJA 1UCBL 2X4NA 2AQ1A 1EAPA 3ARUA 1MFDH 2E5EA 4GG6F 2ZCLH 1CK0H 5EOCL 4UT6H 2Z93A 1NBVL 1A6UL 4F15B 4AEIH 1VGEL 4JRYE 1FL5B 2GTWB 4L8DA 3ZZ1A 4HFUL 3DGCR 4HZAA 4R97B 1QACA 3RNKA 4R2GB 1C7TA 1FFNB 2FEDD 3GSNA 2R8SH 4HBQA 1UJ3B 5EG6C 5JW4Q 4QRPB 5GGTL 5IROC 2XZAL 4TN9A 3I2CH 1ZE3C 4XGZA 3V0AC 3GJFK 5DDHA 3OKKB 1KT2B 5TPWH 3FB8B 3AVEA 3PWVA 4XZUA 4D8PA 3BISA 3UX9B 3CU1A 2ICWB 1T89A 3MV7E 3H0TB 4I9WE 1U8HB 2J5LC 1SEBB 4P3DB 3KYKL 4FNLL 1QQDB 2APBA 1X7QA 4X7TA 5GRVK 5A16A 2I07B 5D2NB 1R3LA 5IW6B 4LLUB 4PJFA 3BPOB 3X3GH 2UY7A 3V6FB 2B7DT 5HI5D 5GHWL 1ZTXL 1IM3B 1WFTA 2CK2A 2GCYA 4HUWA 4S1SH 4XP5L 5EU7E 3L5WA 2DQTH 3UAJD 2H32A 1CGUA 4JRXE 1T4KA 1Y18B 1JNJA 5T5FL 4IRZH 1CBVH 2PXYB 3QWQB 3TPUA 3X11B 4IRSA 3VXNB 3GRWL 2X42A 2OTPA 1I7RB 4DZBA 3LZFL 5F7EH 2WP3T 5KSUA 4HS3B 3LB6C 2FGWH 2OLDA 4G6ML 2YXFA 4Y0GA 4C83A 1QYGL 5JXEC 1I1CA 1BQLL 2Z8VC 2AXFB 3BKMH 4KQ4L 1EHNA 5C0AD 4A6YB 2LTQC 2FATH 4BH7A 2FECI 4HKJB 1U93A 1JWSA 3F12A 4W4OC 5TJWK 3H9SA 4FMFA 5E2TL 3M17B 4OCRL 3P30L 4U33A 5MENB 3ZT7A 1MRCL 4N0FB 4NRYB 5JIKA 3EYQC 1I85C 2GTZB 2HRLA 4DGVL 2I60H 3BYTA 2UWEA 3RUGE 3RGVD 4JR9L 5J57B 3IDYC 5AG9A 1KELH 2VISB 3KPRB 4ETYA 4TUKH 1Q9KA 3DUUA 5IT2H 3ALXA 4M8VA 4WV1C 2I9TA 5F9AC 4ZDHB 5ICXB 5CD5C 4JREC 3UZQA 1A4KA 3GSVB 2GSIB 5E8OA 5F1SA 5HGDA 5TPWL 3MBED 4M7JH 4MDIA 1F58H 2X5PA 2X4UA 4DKFL 1N7ML 4JDVA 4YPGB 3SDCB 3JTSA 2XWJA 4J3SA 4ZQKA 2CGRL 3ES6A 5HBBA 3FQXA 5CJ5A 2KZ1B 4HKBB 4ZUUB 4H25B 1BZ7A 3WE6B 2PR4L 3L3OA 3O3DB 1AGCA 1FZMB 1SHMA 2E3VA 3ALWA 5IB1A 2I9LB 2A9MH 2Z8RA 2Z91A 4WU5A 1QR4A 3GSOB 1S5IH 1OT2A 2Q8AH 3EOTH 3GMRB 3BD3A 3NFPA 1QP1A 3OXRB 3C08L 4K3JH 4LAQL 3JV4B 2BOBB 2X44D 5EBGA 2R0KH 3SDAD 3EFDH 3U6RA 4IRZL 4ZSOE 1FGNH 3FB5A 5K33A 1S3KL 2X4TA 2ZUXA 1S7QB 3IFLH 1FV1B 5BOZG 4R96A 2NLJB 4M48L 5JW4N 4YHYC 3MZGB 1AKJB 4KU1A 3VFMB 1TQCC 2FGWL 3NVQA 3VXUE 1UEYA 4BZ2L 4IBLT 1V7NH 1GSMA 1E4XH 3KLAA 1MQ8A 1NC4D 3MFGB 3OAUL 5HVFB 3BN3B 1CFBA 1RIHH 4OUUA 3EO0B 5C0CE 2Z4QB 4PJHE 3ULVD 3LKQA 3FOLA 1LE9A 3FB8A 3TBTB 3BUYA 3FOMB 3FN3A 2MKLC 1T6WA 2ICWA 4DCQB 4LBEA 4AIXA 3T4AA 2WUCH 1QQDA 1OAXL 5KS9E 3TYGH 4CNIB 5FYKU 3BDYH 5IFJB 2ZSWB 4U1HA 1XFPA 5D2LB 4OV5B 1MI5D 3WSQH 5IMMB 3QO1A 3RDTD 3V6FA 5F7FA 1ZXQA 5F7HA 3MJ8A 4F2MB 3SDXA 4XBGB 4MNQE 1A7OH 5E2WL 1IC7H 5MERB 2XRAL 1Y18A 4ZS7L 4F8QA 5FHBL 4M7JL 4ZFGL 4L4VE 3NFNB 1MCJA 4Y5XB 2XTJC 3C6SB 5LBSH 2Z92A 1XF3B 3NCJH 4KROD 2R2EA 5GJTH 6CGTA 2BZDA 3BZDA 1CN4A 1HHJA 3RIAK 4PJ8A 4EUPG 2IAMA 4CL7A 5J9PA 3KHQA 3O9WC 4A6YA 4C57C 4LLDA 3CDYA 5KSBF 3NACL 3PJSB 4U6VH 4HS6B 5I1EH 3QFJB 2CDFB 2HT3C 2W0LA 1FGNL 4WJ5A 3D2UA 5B22A 3RBGA 4WI8A 1CG9B 3VGAC 2XNAA 4RGMC 3H6JA 3BIAX 4JO2H 3W0WE 4GKZB 4ERSL 3O8XA 4LHUG 4QHKI 1DE4B 5C71A 3L95B 4M1DH 1Q72L 4EEEA 3HE6C 5EU6A 3KPRA 5C2UB 3LN9A 3GB7B 4NO5B 5KG9A 2CRYA 4MD5B 3C5SB 1LQSR 1GHFH 3BPCB 1WWBX 4QKXB 1S7SB 1U95A 5ICXA 4DW2H 3MLSH 1GYAA 1KPUB 3GSVA 1FG2A 2GSIA 4I4WA 1KIPA 1ZVYA 1BQHG 2MCPH 4LKXA 2OYPA 3VXOB 5DWUH 1RHHA 2ITCA 3EJJX 5GRJL 5L2JA 2DIAA 1DBJL 4PV9B 1B0RB 1CVRA 2PO6C 4N5EC 3I85A 4O9HL 1AXSA 3O4LB 2DQHL 4NO2B 3WE6A 4Y4HA 2NY6B 4JPWL 3BDYL 3QJHB 4WFED 4G8FA 4JFED 4BFIB 2NY4B 1KGCE 5TE4H 1I8IB 1QNZH 4JO1H 5HGAA 4XNYH 3X14A 3IJSA 5JLZB 2OJEB 3OXRA 1I8LA 4R0LA 1QVOB 3QEQA 3JV4A 4IRJD 2BOBA 3NH7H 4JO4L 4YAQB 3MRDB 3N1PC 1CFTB 3BPLB 2JB6B 4GAJL 4HEPG 1P2CB 3V6ZB 5M7QA 4OCWH 4KRPC 1P6FA 4FQ1L 4OLVH 1S7QA 4WGVB 3T0EA 3U36B 4GAGH 5LBSL 2PN5A 2OK0L 4HXBL 4ZPVA 1MH5B 3OB0H 1DQLH 1AKJA 1MWAB 4DVRH 1G7PA 1JGEB 3OXSA 2IG2H 2KQNA 2XKNB 4PJ7E 1JHKL 2VH5L 4YHZH 1IRAY 4Y19D 3H9YA 4EI6A 4HWEH 3TBTA 4FP8H 4E41A 1CR9L 1TITA 1J88A 1TNNA 4DCQA 1IGJB 3ZDZF 3GSRB 5DHVH 1LK2A 4MAYA 1J0KA 3EO1B 3ULUL 2VZTA 5IFJA 2HJKA 4UQ3A 5D2LA 4OV5A 1L0YA 1RFDH 1JN6B 1MNUL 5DUPH 5DMGC 5K9JL 2H2PD 5IV2A 2Q76A 2IF7A 5T1LD 1C1EL 4ZFOB 5CAYB 4RFNB 4PUBL 2R2HB 4PJFE 3LH2L 3WIHL 1JE6A 3BQUB 3JVGA 5DWUL 3H7LA 1IEBA 2LV4A 4XP1L 4LNRB 1UM6H 2YK1H 5D1XA 3RVUC 4X7EC 4BYHA 3C6SA 5LGKA 5KW9L 2D7TH 3PDDA 2OZ4L 4LCWB 3TV3L 1CICB 2JJSA 1RZFH 8FABB 3FQWB 1OVZA 1H15A 1OAUH 1QNZL 4NQVA 2FJFA 1N26A 1Z9OA 5EBMA 4XNYL 1DUZB 2D7PA 4WFFE 6FABL 5KN5A 2RBLA 2UZIH 3ARBB 3MREB 2JIXD 1CD9B 4KUCF 5FYJD 2GY5A 4HS6A 2PYFB 3QQ3B 3K1KC 3NH7L 5BV7L 5TQ0L 4QRRD 1TJGH 4JFPB 4GW1B 1CG9A 1YQ2A 3BP6A 4M7KH 3WDHA 3MLVH 3MJ9H 4XWOD 1EEZA 2G60L 4J23A 3H9SE 4LF3A 2Q6WA 5F96L 5F9JB 2J6EH 2ENYA 4Z7WB 4N1HB 4NO5A 5DFWH 1NFDF 4K94C 3C5SA 4RNRA 3HAEH 3BPCA 4OTXH 2AJUL 4LLMA 2DYPB 5C0JA 1MCWW 5HHMB 4XNZC 3RHWK 1XIWA 3IETA 3NPZB 3VXRB 4DGIL 2P7TB 2UY6A 4JY6B 1P9MC 3I9GH 4PJAA 4PV9A 2VDPL 2YOCA 3MBXH 1OQXA 3O4LA 4NO2A 1OAQL 2DLEA 4BFIA 1PJ9A 2O5XL 1IL1A 4WWKB 1CE1H 1UXWA 1OGAD 4F15C 5DUPL 1ORSB 2Z31B 4MA8L 2IGFH 1OQOA 3O41A 5F9DC 5CEYA 4I2XB 4H0HB 1MREH 5FECA 5DD3H 3WNNA 2EE2A 4NUJA 4PJBB 4R97C 3U2SB 4R2GC 3B9KB 1QVOA 1PYWB 5E4IA 2YPLD 4YAQA 3TBYA 4OIIL 4I0PB 5JO5B 1Q94A 4BH8A 2JB6A 4ZFFA 2Y07L 3S37L 1FC1A 3AXLB 4U3XA 3P73B 4MSWB 3BE1H 4TOYH 3OGCA 35C8H 4D9LH 1MH5A 1SQ2N 1G9EA 1MWAA 4JKPL 4PY7B 3SO3C 4BJLA 5BJTA 4NQDA 5EZOH 1AGDA 5D2NC 2XZCL 3ROOA 1M05A 4L8SC 3MO1B 1KJ2L 3ZKQD 3HB3C 4QOKB 4HIJA 4KK5D 1PVHA 3EOAA 2ATKB 1WCQA 4GRWF 1OSZB 4OFPA 5C0DA 3GDBA 2V7NA 4WI7A 5E2UH 4OT1H 2EDNA 4KDTC 5CKGA 5D93B 5HHOE 4O2CA 3D9AH 1AD9A 3PXJA 4FMKA 3VFOB 3AFLA 3PXHA 3T2PA 4EIZC 2AI0L 5BZDB 4XB8A 3CFCH 5HJ3B 2K7PA 4OTXL 1N6UA 1KCVL 1FYTD 1CFQA 3V0VA 1J1OH 4Q2ZB 2R2HA 1NMAL 1EMTL 3DVIA 3MODL 1A3RH 3N85L 3WXVL 2FJHB 2OX5A 3I9GL 5ESAB 5BRZE 1WGOA 3SDXE 3JV6A 3TFKC 3CFEA 3O0RL 5ABDE 4H8WC 2VKXA 3TCLB 2FL5A 1T21A 2J8HA 1RV6X 2GJJA 1P84J 4G5ZL 3FQWA 1D5IH 3DVNB 3EOBA 5D72L 4AH2B 4RAHA 1NBYB 2AEQH 3IF1B 2H41A 1E4XI 1WZ1H 4JFOB 2HN7A 1A5FL 2FHFA 5LVEA 1BIHA 3ARBA 3MREA 1LE5A 3U0WL 3QQ9C 3QQ3A 4KXZI 1NCBL 4JFQB 3ET9F 2DWEB 3RTQB 4FQIH 4H1LG 3RNQB 3T2NL 1G7MB 2X10A 4K94L 5I17A 4S10A 1IGFL 1YQVH 1XH3A 3BE1L 3MRNA 4TOYL 4UNUA 4K71B 2BY2A 3QDJB 3SDCC 3FQNB 3RIFF 4PJIF 4CW1A 5E8NB 4Z7WA 1UQSA 2VLKB 3BH8B 1T5WB 1QSEA 4A6YH 4HS8L 3DYMA 4ZTPH 2XA8H 3CH1A 3J7HA 3LRSB 1WIPA 4L3EA 3DUSA 4K55A 2DWDA 3C5ZC 1NFKA 1LO3H 2R4RH 5CEXB 2ATPA 1J12A 2GT9B 4OAWB 5EU6E 1U6AL 2HFFA 4OF5A 2WLZA 4JCMA 1JI1A 4J1UA 5I19H 3STZB 4NNPL 2Q7NA 2VDQH 3RVXD 4LCYA 2X4SB 4G9FD 1AD0A 3C60C 4OB5L 1XR9B 4MXVF 4MDJA 1UA6L 5C07D 1B3JA 5H37H 5H35A 4P46D 2RCSH 9CGTA 5D7KD 2EC9T 2CLZB 1T80A 2NY0C 3MV8E 3QIWC 1UYWH 4M00A 4HIXH 5J1AB 3VFVA 1RAMA 4U6YB 3QI9D 1RVFL 1AQDB 1NLDH 4I2XA 5DO2C 3TJHC 1NGZB 4PJBA 3B8YA 3GK8H 4PRHD 1JWMA 1RJZA 4PRPD 5HYQB 5JO5A 3ZT6A 4NSKA 3UROR 3KXFE 4LEXL 4MSWA 1UZ6E 2QKIA 4PJEE 2OR7A 3QEQE 1FIGH 1LDPL 2A74A 3CLEH 3N50A 3T3MF 3WO3B 4DQOL 3IAGC 3BT2L 3GMOA 5DK3A 5HHXH 1UB6B 3F6IA 4RMSA 4YHLL 3T0EE 4RISH 3I02A 4WFGD 5LG1A 5L8JB 4QHNB 3EOYG 4OGAD 2V7HA 1OW0C 1I3RB 1XZ0B 2ZCKH 4CMHB 4HQQL 1DEEA 3TT3L 3LEXB 2UUDH 2YC1B 4JFDE 3H9HB 1WIUA 1UKTA 1YQVL 4JQVC 1TZIA 4PJDA 3DO7B 1JGLL 4NJ9L 4E41E 4QCIA 3VFOA 4KKBD 5JOEA 1QFWL 2NW2A 3LS4L 5BZDA 3IS0X 2GK0B 4YR6A 4K8RC 1EHXA 4Y89A 4KHTL 3S34L 5J3HD 1MRDL 4NKIL 1I9IL 1JYWA 2R4RL 4H8WL 4Q2ZA 3C09B 3KYNB 2FJHA 2VXUH 4H5SB 2B2XH 4KKLC 2HKHL 4NN6C 5ACZB 4G6AD 1Q0XL 4YXHH 2XICA 3BSZL 3P9LB 3LHPH 3B5GA 3QQ4B 3TCLA 2NY2D 4LPWA 2F54B 5TE7L 5TE6H 2FBOJ 1LO2H 3UTPE 2E7CA 5SWZD 5B8CC 3CXDH 3N1QC 43CAB 2E9JA 2P8MB 3DVNA 3VA6A 1IZJA 4EN3B 4MCYB 3ARED 3MGTB 2OL3A 4NOBA 4HKZB 5EU3B 5JOPD 4P4KB 3QIUD 4MNGE 3U46B 4KMLB 4Z5RA 3GBNL 4XCEA 3EZ8A 1B6UA 4LSPL 4MX7B 2DL2A 4MD0A 4LLQA 3RTQA 1G7QB 1LGVA 2G2RB 5EZJB 1FZOA 1A1NA 2DTMH 4CU8A 2PTTB 2X1QA 2BSTB 2IANB 4K8RH 1R5VA 3F65A 4ENED 1RK1B 3DX7B 5DI8B 1SY6A 4OZFG 5I1GH 1U3HB 5EO1B 3S6CA 3TP4A 4HT1L 3PL6D 3ZTNH 3LEYH 4UB0H 3UTTB 1WAAE 3HG1D 3U0TA 3E6FA 2Y7QA 3B2VH 3FFCA 2NY4C 5FUZH 3RVWC 1L0XA 3NZHH 5CEXA 2GT9A 4OAWA 1C5DA 3TBSA 2FO4A 2Y5TB 1G1CA 2XZQL 1QSFB 1NGYB 5KZCD 3C8KB 4ETQB 5DZOA 1HHKA 5F7NC 3OJDA 4IJ3C 3U48A 2BNUB 1MEXH 4K3EH 1CZ8L 2C5DC 3BPLC 1BAFL 2YPKB 4UI2A 3MTRA 5I0DA 1IGTB 2HH0H 2CLZA 4R4ND 3K2UH 3V9FA 3DUHA 5E9DD 4JG0L 1P4LB 3E6HB 2DS4A 4OUOA 4PJ9B 3SGDH 2D03H 4R4BB 2DLFL 1WK0A 5DMKB 4RGNC 2XG4A 5F70A 2VXUL 4MXWH 3A6BH 3FHAA 4C59B 2VR5A 1V3KA 2PETA 1T1WA 3IJHB 4BZ1L 4PS4L 5D70H 3ZDXE 3SDDC 1IC5H 2J8UF 3MRMB 3P0VL 2VXVH 1HH9B 1J8HB 1WFOA 1MHHA 3CC5B 3WEXA 2F19H 3ZKND 3RL2B 3LS5H 4UTAH 5F9WB 2ED7A 5SX4H 3A6CH 2X9WA 4QHNA 1XZ0A 3ARFD 1CXLA 4QXTA 3VFSB 5FB8B 2HLAB 3GBLA 3KHOA 3GMQA 5EZIH 5H2BA 3AMKA 4NQDE 3H3KA 2YC1A 1MCPH 1BZ9A 4RFNC 2AW2A 4Q74A 5I18H 1KB9J 1EHLH 1MWAH 3TH2T 4NHCH 4ZUTA 3BQUC 4K8RL 1U0QA 3WNOA 3U7WL 5JR1L 3MLTA 1J1XL 2CRIA 1X5XA 3BKYH 3SE4A 3SGEH 4OJFH 3LEYL 4P3CH 2GK0A 2AJYH 4P59L 4G43A 3HC3H 4I18C 4D0BB 4M6OH 1W0WB 3SCMD 1YPZA 2JCCF 5E8PA 5CMAB 4DOHE 4S11A 3UC0L 1QBLH 1DLHA 5I66A 1B4RA 3DXAA 2IPTH 7FABL 3VD4A 1CGWA 2APXA 5IFHH 2NTSP 2BY3A 1JPSL 5E7BA 1QUNA 4NZUH 1YY9D 3QQ4A 5CFHA 4PRDB 4K3EL 2VQ1B 5JZ7C 1GC1C 3X13B 4X5WA 3WIIH 4X7DC 1UXSB 1FLRH 1U8OB 3HCVA 3KLDA 5FUCE 1Q1JH 5IK3B 3MGTA 2ESVB 4ELKA 1MJ8H 4HKZA 2WNGA 4EZMA 1CFVL 1D9KC 4O4YH 4BA8A 3PWNB 2VDKH 2BNRD 5T3ZL 4BFBD 3HE7D 1MHCB 1JZ5A 1G7QA 1NC2D 2H6PB 1RZ7L 2I24N 2BSTA 4JANB 4PLKD 4YDIH 3G6JB 4PPTA 3OQ3B 4XNXL 1Q0YH 4CRPA 4TTGA 1VFMA 2VXVL 2F5AH 1U3HA 1YDPA 5EO1A 3B5TA 3LKNB 5E7FA 4X5XB 3UTTA 3F58H 5JHDA 2EDTA 1MFCL 4HH9B 5DD1H 3QZWB 3INUH 3VI3E 3A6CL 2P8PB 5DJYB 4PYGA 4RDQF 5C0AB 1B9ZA 1ZHBA 3HR5B 3HMWL 4XAKD 3HRPA 1TXKA 2DL9A 1H5BA 1GC1H 4YHMH 1NCWH 1NAMA 1QSEE 4XC1L 4PGCB 5D1QD 5HYFA 3L3GB 3S96B 1NGYA 3ARDC 2FX8L 1V7MH 1D6EA 3DX6B 4K7FA 4L3EE 1ZHLB 2BOCB 2ICWI 4L5FH 3QIBC 4I0PC 1U2CA 2O5YL 5B4MC 4GBXD 1GOHA 5CEZD 3ARRA 3CLFH 1KJVA 1I3GL 3HC4L 3RGVB 1IGTA 3QRGL 1F4XH 5E6ID 2J88H 1G9MC 4OJFL 3D39D 32C2A 4M6NL 1CXEA 5IB5A 1HSAB 4YIQB 1U3ZA 2WUBH 5IP4A 3SN6N 4X4YB 4E9LA 3IFNL 5HY9B 4PJ9A 1OM3H 4O51B 4QGYA 3MBEB 1N5YH 2FHBA 1C16B 3VG0H 5C3LD 1T0NB 4YDVB 2PYEB 2B20A 3BWUC 3FFDB 5EOTB 4W4NA 4B7IA 1XGRA 3PGDB 2ZKHH 4F7PB 1XCQB 1NEUA 2MQ0A 3HHRB 4QGTA 1IFHH 2X89D 3RL2A 4K7PL 4TULH 1NUFA 4UDUA 4XVSH 5GGVY 4AIZA 3RZCD 4EUPA 1H3GA 2UYLB 4URTB 3TT1H 5IOPB 3MCKB 1PG7W 1SM3H 2HLAA 3CUPB 5ENWB 4S2SB 3SDAB 1YEHL 2A77L 3QG7L 3REVB 1FO0B 1JPTL 2V9QA 3WIHA 3QXDB 4X5LA 1G9MH 1P84K 2E27L 3SE8H 3CSPA 1TCMA 2XACC 3BWAA 4JZNB 3RWFB 1TZGL 1Q0YL 1T2XA 2VRAA 5FF6B 4S1DD 1VFUA 4J3TA 4LHUA 1X5FA 5IVNA 1JTOA 3DVFA 3VE0B 1NC4B 2OSLB 3F58L 4ZOBA 4MVBC 2ZOLB 5F8RC 3INUL 4PJDE 5I76A 5B3JE 5L2KD 4HXAH 5HVWA 1W0WA 2BRRH 1PKQA 3V0WH 3S5LG 4XX1E 1HH6B 3QULA 1FJ1B 1GC1L 5D9SB 3WV0A 5IMOB 1BQHA 3O6KH 5I1HL 4WHYG 4M4RA 4NFDA 5F7KC 3QPXH 3BMVA 4XMLL 3IU4H 2JTDA 4K71C 3RDTB 3PABB 5IK3A 4MD4B 2EDXA 3I75B 4NM8L 5LQBH 2HRPH 4RMVA 3ARYA 1E4KC 3FAWA 4HHAB 4K23H 2CUMA 4X0KB 5DLMH 4G8IB 4IDLA 3HRZB 3QRFM 2PO6A 4TRPH 4LQFL 5FGSA 5I8OL 3V8CA 2Y6SC 2EZ0D 4KMTH 2H6PA 4LU5H 5ISZA 5CZXD 2P44B 2UV3A 1YEJH 4HUXA 5JPNA 4WO4C 5E99H 1Q9OB 1MCNA 4KROB 1LHZA 4G9DB 1IFHL 4WEBH 4X5XA 5DJ6A 2OL3H 4PB0H 3VWJB 2XWBB 4Q97A 3K1DA 1EDQA 1JFQH 3KLSA 2P8PA 1HXMA 1II4E 5DJYA 5C0AA 4KTDL 3HR5A 4WCYL 3F7YB 1T1XA 1G7IB 1NFIA 2GQHA 3FT4B 4KZDH 2WZPD 4PGCA 2Y4SA 3S96A 2BVPA 3IKKA 1G9ML 3U0PA 3FFCE 4POUB 2BOCA 2C3XA 1SY6H 5A2FA 5EUOA 5A2LH 5C6TH 1MRFL 2VJXA 1K6QH 3EKCA 5INCB 4EDWL 2DD8H 1KJ3H 2YEZB 1X6NA 4U2ZA 1QD0A 4OI9A 3TYFA 4MHHI 1HSAA 4UT7L 4YIQA 4H88L 3G5VB 4WTXA 3QUML 5DZNA 1EBAA 1D5MB 4K3GA 4N0CC 4XCFH 4YUEH 2O26U 1C16A 1Z5LA 1T20B 3AC0A 3H3BC 3KJ6L 5T1MB 3MNWA 2DICA 5C09B 1HQ4A 3D0LB 5DYOB 5TF1H 2R0WH 5EOTA 4H0IA 4JFEB 4P2YA 2CR6A 1HK6A 4QHMA 4XTRC 5ITBL 4FTVB 3L1OL 1K4CB 2VC2H 4M1CC 1DDHA 3AY4C 1U91A 4HC1H 1V05A 4CVXA 5I6XC 3CUPA 4Z7QE 4IRJB 4YDJB 5ENWA 1GVIA 2MPAL 4BELD 4XAWH 2KL6A 1IKFL 1NEZG 1IGYA 3QWRD 1RIUL 4Y4KD 3C09C 1RJLB 3AAZA 2IH1B 2J12B 4MNHA 4YHKL 4JDTL 2W60B 5HYSG 4JN1L 5F97E 4LVNC 5T3XL 1YNKH 2Y36L 1S5HB 3AUVA 3LMJH 2ZOLA 4XH2B 1L9NA 3V95A 3D18B 3MC0A 3NAAH 4OD1H 5IHZA 3BKCH 4TPRL 3MR9A 5I2IA 5LWYL 4OQ1A 4F7CB 3QYCA 1FJ1A 2A2QT 1OTTC 4LOUD 4G7VL 4KJWC 3W39B 2AQ2A 4X4MA 3QEHB 5AYUL 4HMDA 2VOTA 1JNNL 2NY7L 2WBJC 3SE9L 2EDBA 2VL5B 4KJPC 4O58H 4QEGA 2HKFL 1YPZE 2VKWA 1AO7E 3A0OA 5EZLA 4W6YB 1QR1A 5JIHA 5KANI 3SY0B 1AGFA 3DXAE 1MI5A 5DFVC 5KVFL 2DD8L 3P4OA 5CBEA 4HJJH 3SGKC 1PZ5B 4RMQA 3I75A 4BSVB 2W0PA 2VZ1A 3MLUH 4XBEH 5T1LB 4MA7H 3DV6A 4OKDA 1E4JA 4PJ5D 1YUHA 4LMQI 5SX4I 4GRMA 4DKEH 4NO0D 1A9BB 2XG5A 4DUXA 1NAKH 4KTEH 3EHBC 1BHGA 4OZ4B 4NZTH 3E1F1 3M07A 3VGDA 1CDGA 4CAGA 3TNNA 5J1SC 1RULH 1MFAH 4G9DA 5DJ8A 3JWNC 2XWBA 4M8QB 4Z7UF 4HJGA 3N06B 2RIKA 4HC1L 4E42B 3KR3L 3RWJA 1G7IA 2F58H 2X70B 4PJGA 2A0LD 1GPOL 4FFWC 4LRNL 5JHDE 5DRZB 3FONA 4QRRB 4RSVA 4PB9L 5FOBA 4NKQB 5HHPA 4J4PD 2VYRE 5GJSL 4PBXA 4Z7NE 2VWEC 3QCTH 3SJVE 3EDEA 5DC4B 2DM7A 3EW3B 2HJLA 1CT8B 5JQ6L 2QBWA 2YEZA 4GT7A 3DSFL 1AR2A 2R2BA 3SDYH 3G5VA 1F13A 1MJUL 4YGVB 1D5MA 4LSVH 3O2WL 4Z7VF 3WS3B 4LVOC 1UKSA 5F9WC 3NIDE 1KN4H 4KDTA 4GG6A 1L6XA 3PHOA 5J12B 1T20A 2ZUSA 4BUGA 4XPTH 5T1MA 3ROLA 5GXBB 5AZ2L 3IXAB 2EXWC 3BGFC 4P99A 4JRWA 1GH7A 3GSQA 3V52L 1MCOL 1PSKH 4YBQC 2AK1H 3KPTA 1YMHA 4JM2D 1K4CA 4Q58C 5I16A 1OGAB 5CP3H 1WQVT 4R26H 5D7LA 1P7QD 4PY8J 1RZ8B 2GFBB 4KV5E 5BZWB 4LSTH 1FORL 5IM7A 4U6XA 3ULUE 3T0XA 1EFXB 5EA0L 2YPLB 4DKEL 4ELMB 4D9QD 1KTLA 4M62H 3GM8A 4FQCL 4UQ2B 1M7DB 1YY8B 3FRPG 4H1LA 3VXPA 2HVJB 1AQKL 3LRHA 1BJ8A 4FQHB 4XWGH 5MP6H 2XTJE 2NMSA 4ZTOH 4D3CH 1GGTA 4NFBA 4GO6B 5MI0C 2W60A 5MEPB 1TPXB 2NY3B 3TO4C 2X4PB 5HDQL 2Q87A 3CVIL 3GMNA 1CLZH 5DRNB 2GJ6E 4XH2A 3D18A 3MJ7A 3BEWA 3QDMD 4Y19A 4D9RD 4X9IA 1QBML 1LP9F 4F7CA 5HYEA 4UBDD 5IEHA 4IOSD 2HA1A 5DHYA 3BAEL 1ZWIA 3IVKB 1DN0B 4PG9B 3HFMH 4NC2B 5KOVC 1PKQE 5FYKD 3V8OA 3WLBA 4MWFB 4FQLL 3ARWA 5IQ9A 3C5ZA 3KNBB 1PZ5A 5CGYC 5HPMA 5E08L 2ED9A 3R8QA 3ZKMD 4JRYD 1RUPH 5H8DA 3K8KA 1FYTB 4LSVL 3C5JB 3C60A 4TVSa 3VCLA 1KTRL 1A9BA 2WINA 2VZOA 2RHEA 1IAII 4M61B 1XF1A 4ZAKD 4RGOH 2OMNA 1B4JH 3G04A 4NDMB 2WV3A 3IT8D 4X4XB 4ZS6D 4KAQH 5BS0D 5HVHB 3MV7D 4I9WD 2HFGL 4LVEA 1OSPL 4XMKH 2AK1L 5ISZE 4P5TC 1KLUA 4NWTL 4M8QA 3E3QC 1AI1H 3RGVC 2F5BL 1E27B 2Y72A 4NN7B 1CGXA 2JIXA 1C12A 1R6VA 4QHLB 1NLBH 3UJIH 2HP4A 4ZNEA 1KXQE 4PD4K 4RMWA 4Z8FH 3MBEC 3WKMH 2HTKD 2BVOB 2IFFH 3N1FC 3RIFK 4ZTOL 4DEPC 3EJZC 2AEPL 2HWZH 4U3HA 4K2UH 3IDXL 1OW0A 4N8VB 1GGCH 1N3NB 1B0GA 1KN2H 1ZLSL 4NYLB 4WTWA 2XQBH 4HD9A 5EUKA 3WN5A 4MQSB 1WIOA 3WS3A 1YECL 1KSRA 4N68A 4L8CA 5IHBA 1BF2A 1I9RH 1HWHB 3RI5F 1ES0B 2VXSL 2WWMC 1T0MA 1NMCC 3Q6FA 4G7YL 5HHNB 5E2VL 3GGWB 4ODSL 4OCXH 1EZVX 4KDWA 4G9FB 2ENSA 3UO1L 3W9DA 4RDQG 5C07B 4P46B 1F3JB 1WITA 3MLZH 5TQ2H 2DI8A 4F7TA 1OGAA 2Q7YB 3QI9B 1N8ZB 3HNVH 4YDKH 4XI5C 2GFBA 1I7ZA 3BZ4B 2VZVA 1ETZB 4PJXF 5FGBC 3QUZC 3BP4B 2YPLA 4PRHB 4WUUA 4KHXL 1CGVA 3TIEA 1IBGL 3RAJH 5TFSL 5DJCB 4EI5D 5B8CA 2QQLH 1N64L 3CVHA 4UINL 4ODXA 1QLRA 3QUKA 5MEPA 4OZFA 4U1MB 5CJXA 1R0AH 2MSPA 4YX2H 2X4PA 3PDOB 2EDYA 2BVTA 1HHIB 2QHLA 4O2EB 5DRNA 4QT5A 3GHEL 3G6DL 1J5OH 5IB3B 1A6AA 3O6FD 5JIPA 4JDZB 4EKXA 1FO0H 4M4PA 4MA3B 1VKXB 1CS6A 4U6TA 1HINH 3TO2A 1DQQB 4UV7H 5D71L 2Z8WC 3H42H 3IVKA 1RSFA 3OKOA 4YNYB 3MMEA 4FXKA 3MRCA 4OM1L 4PGDA 2DQGL 4X4ME 2BHUA 5KSBA 5KVGH 4Q6YA 1U8LA 1MIEH 2R23A 1JP5A 3KGRA 3VXUD 3ULVH 3DVGB 3QA3A 4LQ1A 3WUZA 1K2DB 1KB5B 3VWJC 1KCRH 4JLRA 3DROB 3O2DH 1BVLA 4E5XA 4PRBB 3G6AA 5EIIB 1OB1B 5KJRH 1I3VA 1Y6NR 1RUAH 3ZE2F 5E1AB 5C0CD 2VO5A 3S35X 4F57L 4U0RB 3TBWB 2BFVH 2LU7A 2NY2B 4CN1A 1KCSH 5SWZB 2K3TA 4NBZB 1T5XA 1QKZL 1QSZA 1AC6A 2LFGA 2FX7L 4R8WH 3QFDB 4OCSL 3AREB 2R1XA 4YHOL 3ZYOA 1UACL 4H20H 1HSBB 1ZGLP 1A6VL 1FG9C 4KI5F 4WW2B 3U82B 1A4JA 4WEUD 3SGJC 5CSZA 1HKLL 3SDDA 4MNQD 1RZGA 4OZGB 3NPSB 5I1JH 5ACMA 5FGRA 4LAJH 2QQLL 5K9OB 2HMIC 2OTUA 2QR0A 3CAFA 2EO9A 2BVOA 4PLOB 5B39B 4JPKH 4PJGE 4KK9C 1BOGB 3WO4B 3HLAA 3KPOA 4L4VD 3UTQA 1O7SA 5EBWB 5DJZA 3PL6B 3RL1B 3HG1B 1T2JA 4OZIF 4X6EB 3O3EA 5EWIL 3FO9A 1FO0L 5F1IA 1ES0A 1FNGB 1NUNB 1DANT 5HHNA 3FT3B 4NHUA 5KZCB 4G9FA 1S7XA 4IRJC 4QHUB 4U05A 4GKOA 5EPMA 3P77A 1A6TA 4GG6E 5D4QA 1F3JA 2RFXB 2DKSA 5DJDB 4FQ2H 1YEKL 3PWLB 3W0WD 1A9EA 2YSSA 3UXFA 2LABA 3BZ4A 5DQ9B 4J6RL 4ALAH 3Q6GL 3BP4A 4P5KA 3O3AA 1KPRB 3IDNB 5EO0B 3L7EB 4PRPA 2BY0A 1K8DB 4NM4L 2WWKT 3ARGC 3HR6A 5DJCA 5D7LE 1RUAL 5D7IB 3O11B 3S4SB 1ZVSB 5I8KH 1D5ZB 3TVMD 3FB6A 4Z7OF 4L8BA 2D9CA 2EDLA 1D9KA 1HHIA 1EH9A 1RZJL 1TVHB 5GGVH 3D3VD 4I0KA 1R5WA 1KGCD 4JDZA 3ARFB 5KSAB 3SBWA 4U1IA 1VKXA 1D3CA 3HI5H 2EYRB 4NRZA 1P53A 1EO8L 4Q9RH 2YHGA 5FO9A 4Y19E 5E94B 2C1OA 3MXWH 5CJOL 3EO9H 1OP5K 4NCDA 2GAZB 2XIDA 1RMFH 4KFZC 4OI8A 2FCBA 5JW4R 3DOSA 2JELL 1UZ8B 3QUYC 1QO3B 1NANH 1FVCB 3DVGA 3ARDA 2ZUUA 3FO1A 3SCMB 2DM3A 1UWEH 1FZKB 2NTFA 3AB0B 3DROA 3VD3A 1RUKH 2J1KA 3QIBA 4OFVA 3U4EB 5HI3D 1FZJB 5EIIA 4LSQL 2C3WA 5I73C 1NFDA 3RPIB 1I9JH 2HYMA 1ZA6B 3TBWA 4G6FD 5FHAH 5BXFB 5IQ7L 4NQEE 4HWBH 2F53A 5LGHH 5SWZA 2QLVB 2BC4B 1B0WA 4KK8D 4NQCE 5C0IB 5INDB 3O2VL 4TVPH 4D2NA 1JV5A 1HQRA 4XP6L 2Z35B 1FQ9C 4GMTL 3AREA 4XMPL 4GRLC 2IJ0C 3QIUA 4Y4FD 12E8L 1UZ6F 3QUMA 4WW2A 2BNRB 1G1YA 4EIGB 3HE7B 4OZGA 1NBZB 1MAJA 1NC2B 2BNQB 2M2DA 3IDUA 2OTWB 1UWXK 3MYJB 1GIGH 5AAWA 4APQB 5I8KL 5J12C 5DS8A 1KNOB 5IEKA 1BOGA 2R1YB 3P9MB 2VXTL 4G8EB 3RL1A 4ZNEE 4G6JH 4GMSL 2CDEB 3ARSA 3TM6A 4DGYL 5HI4C 2CIIB 4X6EA 4LSUH 4NWUL 5FYJH 3FQTB 4X7FC 2JK5B 2V17H 1AP2B 4IRSD 3S5LA 3B43A 2XQYG 2VL4A 3DX8B 4JKWA 4WFFD 3QNYA 4BFEA 3HI5L 4HWZB 2V2XB 2EIZB 2ARJB 4L4TE 2QQQA 5LGJB 4Q9RL 1CE6A 3IAQA 1HDMB 4S1QH 1T1ZB 4X6CF 1ADQA 4GBXB 3LAFA 1UB5A 4HIEA 3ZE1E 1H0DA 1FN4A 1ITBB 4JE4B 4UV4H 4JY4A 2Q8BH 1NBQA 5E6IB 3PWLA 1S9XB 3ULSB 1WWWX 3D39B 3H9SD 1LEGB 1XAUA 5E9DA 2QADC 2DQUH 1XGPA 3QPQD 1TPXC 5DD0L 4J7RA 2NY3C 3MNVA 4QLRA 4YHPB 1U8NB 4DZ8A 3GIVB 4ZYKA 4UAOC 3OKLB 4OCYH 5IWLC 1DSFH 1FL6B 2I5YH 2OJZH 4CMMA 3OR7B 1KENH 4LSDA 3WIFA 5IB4B 5D7IA 3SOBH 2X41A 3V7MA 3TWCL 1YJDC 1C5BH 4KK5C 1D5ZA 25C8H 3OPZH 4LARH 3BKJH 4FQXD 1HCFX 4WUUE 4FQQA 2EKSB 1ND0B 5LCVH 2DAVA 3NOIA 1N6QL 4TVPL 1JNHA 2VB5A 4MCZA 4TYUA 3RZCB 3QNXB 5IVXF 4Y5YB 2XA3A 5EU5B 4DK6A 5AD0A 3IFPA 4I77H 3ARFA 3QCUL 5AZEL 3MROA 4ZO7A 3UDWC 1PLGL 4GLRI 3B9AA 1FCCA 4WO4A 5J0BA 5IUSA 2NZ9C 3X12A 3WXWL 3U7YH 1I1YB 2R1WB 5T3ZE 4KI5D 1GGBL 1M6OA 4KKAD 4AG4L 5HVHC 1UZ8A 5DK0B 1EA9C 2AV7A 1FVCA 5L2KB 5L8LB 2A6JB 4N0RA 1A7QL 1YJDH 1NDMA 4DN4H 3U4EA 2RQ8A 1JPST 3EJYC 5DQJA 4OIAA 5KSBE 2GITB 3SHSA 4IIQB 4PJIA 4Z77B 2CLVB 2FIKA 3RPIA 1ZA6A 1HI6B 2GHWB 3NCCB 3CFIC 4YWGH 3SKMB 2BC4A 4N8PA 3T3PE 1OCWL 5IBTL 3L5HA 3NGBB 5HHOD 3L5XL 3D87B 5I15L 1EO7A 2YUXA 4KY1H 1G6RB 1SJEA 4GW5A 4CDHA 4CVZB 3IFOB 2CRMA 4PRNB 1J7VR 5FKPB 4EXPX 3RWCB 2QL1A 1TMCB 3HE7A 4ISVB 1DSFL 2I5YL 1NBZA 3GNMH 4RGNE 2AXHA 2V5TA 3SOBL 4HSQA 2OTWA 2OI9C 2D7NA 3B5HA 1KNOA 4JVPA 3AY4A 1CFSA 1QHOA 5BRZD 1N59A 4G8EA 3NZ8A 4HCRL 2W9EL 3TESA 4ODUB 3OTTA 5HYSA 5FKAB 3REWB 2CIIA 4U1KB 4WFHE 1VCAA 5GZND 1PKOA 2JK5A 3EYUH 2XV6B 1AP2A 3WYRA 2MCG1 2QHRH 3QI9C 4I3SL 2XI9A 3ZHLA 4RWHA 1NCAH 5D1QA 3CFJB 4JZJC 4P23C 2R4SL 2OR8A 4I3RL 2VERN 1SEQL 5D7JD 3BYYA 1T1ZA 1MFNA 1KLGA 4GBXA 4JPVL 4PJ8D 2KQMA 5KVEL 3RPKA 2CK0H 1MHPH 1H3PL 4Y7MA 2DDQH 4M6MH 2P46B 4JPIB 2NXYD 4PRIA 3D39A 4XPHL 1EEYB 5F89A 7CGTA 2GSGA 4L1HA 4F33B 3KPLA 4G8GA 2ZSVB 4HIIA 2PCPB 3GIVA 3PGFH 3D2UD 4XHJD 3V4UH 2VDNL 4DN4L 1U8QB 5D7KE 4GH7B 4NQUA 4NIKB 1MFBL 1SVZA 3HC0B 5DD5H 2D31B 1R3HB 3O8XD 3WNLA 3BJ91 1F4YL 3ETBF 3NTCH 1IC4L 3EGSB 1ZHNA 1GOFA 2MHAA 5BQ7B 1FNFA 4GKSB 3S35L 3ISWA 3ZDZE 3AMLA 3L7FA 2NY5H 3B8SA 5CP7B 3UJJL 1JTTA 3L3KA 3V7AG 1MJ7L 2X89A 5A1AA 1J86A 4OZHF 3RZCA 3UPAA 5AWNL 1KUMA 4Y5YA 3TZVC 4P2OD 1YNLH 4P2CG 1TCRB 3MV8D 1TJHH 3TF7C 3CZFA 4Q0XH 3I50L 4AL8H 4N1CA 1FFRA 3ZKSD 1HNGA 4Y4HD 1GAFH 4NJAH 1QSVA 3KPMA 4TQEL 3TPKA 4WFGE 4Y4KB 4U31A 4S1RH 3F7PC 2ADFL 3VI3F 5F71A 4O5LH 5E1HB 2HLFC 4HH8A 1J05B 3KXFD 2R1WA 3I6GA 4C4KO 1RZIA 2HT4C 2B1HH 1E6JH 1CLOH 3ILPA 1EJOL 3QEQD 4RWYL 1IQDA 5IVZA 3FCTA 2VLLB 4XPGH 5DK0A 1K5NB 2H3NB 5L2KA 2A6JA 2MNUA 1E0OB 3S3JA 4LSSL 1MLBA 1GCFA 1R3IL 1JK8B 3P4MB 4JM4H 5CHNB 4FABH 5F3BA 3NA9H 3CPLB 1MCLA 2A1WL 5TDPA 3VWKC 1JF5A 1V5JA 3AS1A 5LXGH 4R7DA 2XN9B 3MXVH 3NPSC 5KOMC 4JFDD 2P24A 3CD4A 2AGJH 4U1JB 1MHPL 1ZT7B 5DD6A 3B83A 4UNTA 1BWMA 2WIMA 1QFWI 1NFDE 1KB5H 3MSPA 4KJYB 4AEEA 1G6RA 3NCMA 2F53E 2ZUWA 3KYMA 4TNVF 1CGYA 5ANMB 4OLXL 4WY7H 4PJ5B 5FKPA 1JYVA 2ICEA 3MLXH 4NO0B 1ZGLB 3N0PB 5SWQA 2DQJL 3HUJB 2JKXA 3R06B 3BP7B 1MVUA 3ESVF 3FB7B 3ILQD 2AV1B 1SYSB 3FRPA 5DK2A 2XQYK 4QOKE 1LO0H 1SMOA 5JMRA 5D7SL 3DRQB 3IGAB 1XF5A 3FT2B 3UJTH 5F7DB 1ZS8B 3UTPD 4U1KA 3IRZA 4GG8A 4PREB 4M5ZH 4LLYA 4Q0XL 3ZYIA 2FYYB 1NANI 4CGTA 2J8UA 2PTVA 2VLRA 3V79C 1S7UB 3CIQA 3IDIA 3S7GA 2MKWA 4XXDA 3TO4A 1FP5A 3UBXG 2IQAB 1A14H 5GRUH 2B1HL 4IOIA 4XVJL 1I7TA 3C8HA 1S78D 1EEYA 1A2YB 5GQBA 4PP1C 4OCNC 5CJQH 5BW7A 4HPOH 1YNTB 4Q6IB 3E2HB 3T77B 1VACA 2YWYA 3L3IA 1R3HA 2EDOA 4FFVC 5ILTH 5E9DE 2BHYA 4WI3A 5T3XE 3MZTA 5KSAC 4P2RB 5F7YC 4GRWE 5BQ7A 4NC0B 3R1GH 4HGWA 4Z0BH 5IBUG 1MPAL 4B0MM 2JCCA 3VFNB 1FPTL 4JM2B 4GXVL 4NN5B 5IF0A 1TJIL 5TH2B 1XIWD 4U6HB 4X6FB 1ZMYA 3SE3C 1KB5L 1VESA 4QTHB 4NQSB 5FYLL 1V8HA 4LFHG 3U4AA 5IIEB 1G7LA 4NO3B 5IFAL 4RFEA 3O3BA 1DQML 3SCMC 3DX9B 3ZO0A 1F6LL 1BFOB 1ZT1B 4P5TA 1Q9WA 1LO4L 1Y0LB 4I3GA 3T65A 1HILB 1A3QA 1UWGH 1NDGA 1J05A 8CGTA 4OQTA 1F3DJ 4PBWD 3QUXD 1G0XA 3FMGH 5ALBH 1BFSA 3Q1SH 4X6DE 1CI5A 1TDQA 2YD4A 4ODVL 1K5NA 2H3NA 4WHTB 3JV5A 2A6KB 3QDMB 4CU6A 4NC1C 5F44A 4M5ZL 3FO0L 2HT2C 4JHWL 4P9ML 5ERWB 1K8IB 5GS0D 3P4MA 3TN0C 3KWWA 3EIFA 1I8MA 2OMBA 5D8JH 3RWIB 4ESKA 4F9PA 3EFFB 4YDLC 2Q86A 4MAUH 2DJUA 5IESH 4GSDL 1ZEAH 5GRUL 3BPNB 4APQC 4PJIE 2YRLA 3ARXA 2NPLX 4JRYB 4KJYA 3U30B 1X5JA 2QQNL 4HUMB 1RUMH 1JWUB 3KDMB 1ZGLA 3ZKXB 4ONGH 5F6IC 1UM4H 4ZAKB 5LJYH 2APTA 4HK0A 1EFQA 1SBBA 2VXQH 2HJFA 1W72L 4QNPF 4OFIA 4O00A 3UTZA 4MXVE 1FE8L 3MV7B 3SPVB 3WLWC 4NGHH 4LIQH 4Z7QF 4XCYA 2VZSA 3W9EB 2CDGA 5J56B 3DRQA 5EBLA 5F7DA 1AJ7H 1T1YB 3VFWA 4PGEA 2XTLA 4YQXH 5EFIB 3Q3GB 2DQEL 1Z0NA 2FYYA 2R9HD 5DGQA 3V5KB 3PIQB 4XPFL 4IHOB 5DEZA 2X4RB 1JF1A 4JRXB 2BMKA 3RGHA 4G6KH 4YC2C 2LQRA 2IQAA 3T3ME 1HNFA 5ADPL 5IB2B 1IVLA 1MAML 5EU4B 3VW3L 4X83A 1KXTB 3D85B 5HHVH 5CEZE 1EV2E 2AP2A 4QF1A 5D5ME 1EUTA 2BDNL 4NZRH 4MMXC 5GS1C 3RI5K 4YXLH 1JNLH 5FO8B 1F6AA 3EDFA 3HZKB 1QRNE 2DBLH 4PRIE 1IKNA 4KUZH 4OGYL 2DF3A 1BJ1H 5ESVA 4G8GE 4JO3H 1QSED 4B53A 4MAUL 3GJEB 3MRJA 1PFCA 4L3ED 3F7VB 3IDJA 3GSXB 3QSKB 1SJHB 4J3OC 1DFBL 5I71C 3WUWG 3VI4F 3RUGB 1P7QA 4QTHA 2CKBL 4RBPH 1INQB 2OXHA 3MLRL 4M7LH 1RUML 1ONQA 1M4KA 3MLWL 4ONGL 3TA3C 4X80L 2EDFA 1S7TB 1T7WA 4EI5B 5ACLA 3BH9A 1FBIH 2AXGA 3B2UD 5JUEH 2CIKB 3VJ6B 1F3RB 4XC3H 4J12A 1JHTA 1A7RL 5C0FA 2N4IA 4OLYH 2Y9RT 2VLJE 3DARA 1QSFE 5ITFB 1G9NH 1HOCA 3RVTC 3JV0A 1MJJB 1OGTA 4C58B 2Z0BA 5EORL 3CDFA 5FO7B 1DBAH 5HGBB 3BGMB 3M45A 4AENB 3M8OL 3BVNB 3RWHB 3T8XA 1A6ZA 1AE6H 1I1AC 3KS0J 2V9RA 4K9EC 2EZ0C 3RWEB 3LPFA 2CXKA 3THMH 5CZXC 1W0VB 2MJWA 4ZXBD 2DKUA 4PGBA 3MCLH 3MACH 3HI6H 4XPBH 3K8MA 3QDGE 4JRYA 1AY1L 2RB8A 4G3YL 3GKWH 3VXUB 3CMOH 2PW2A 1MFEH 1JWUA 5DT1H 2NY1C 2A83A 1BD2E 5GIRB 1PG7H 2ED8A 5F6HJ 1FVEA 3RA7H 1BIIA 2C4XA 5E8EB 5C0CB 4PJHB 3PQYB 2CR3A 1KFAH 4NNXA 3MCG1 4RCAA 2ADIA 4MJ6A 4P5MA 3VFTA 5BS0A 3OR6A 4WTZG 3F5WA 5ICZA 3PNWB 1DTUA 1G6RH 5KS9B 2YD9A 2CPCA 1B2WL 1FGVL 3L3JA 3BIKA 2D2OA 1MY7A 4WGWB 1OOAA 4K9EH 5CKAA 3CSBA 4JKLA 3LKRB 2X4RA 1U8JB 5CBAB 1MCEA 4Y2DD 4U1SA 3WHXB 5JUEL 5I1LA 5JPMB 1NSNL 1ZVHA 4PJCF 4RAVA 3QQNA 5L7XL 4L4VB 1M71B 2FBJH 4LP5A 1DBKH 4WI9A 3DIFA 2VLRE 3Q0HA 1IEAA 2WM0A 1A7PH 2Z9TA 3VA2C 2X9XA 4CU7A 3MV9D 1VFBA 3DBXB 2YD6A 3MLPA 4N5UA 4HIHA 2V5SA 1YEEH 4KQ3L 3WDIA 3UTSD 5CILH 1T83A 4QTIH 4NRXB 2GKIA 2R0LL 4IDJH 3BZFA 4I5BB 1KEMH 5L9DL 3GJEA 3K7UA 3FFCD 1AIFB 4QRUA 4W81A 3W0WB 3LEVH 2GW5A 3OAYH 4HBCH 5D6DC 3CMOL 1A22B 3LQAC 2ADGB 1NH6A 2VDRH 3NCFB 3ECBA 3O4OC 1A6WL 1RI8A 3CFKA 4YXKH 3VFUB 2JCCE 2G5BB 1XGTA 1BX2B 1ZLVH 4QRTA 4EI5A 3RA7L 5JW3L 3FKUS 1HIML 3JTTB 1YN7A 4M5YL 5IW1B 3V6OC 2BSRA 3TVMB 1S9WB 3GMLA 3GI9L 4OFYA 4GRLA 4JHBA 3VD9A 1X5IA 2HVKB 4HKXA 5L88H 3K80A 1WFUA 2B0SH 2QSQA 5BVPH 1HYRC 3E3QE 3BZEB 2HFEA 3O6FA 3RX7A 2VDOH 3FN9A 1KC5L 1AGBA 1SBSL 4AENA 3E8UL 1FNSH 2ZPKL 4XP4L 2X1PA 3G9VA 4OLZL 3MRGA 2M8XA 3K46A 5DC9B 4ZSOA 4Z7UA 3RWEA 5L6YL 5CUSH 5JMOC 3CDGA 2FBJL 2PYEE 1E6OL 4ZNCD 4HCRA 1F4WL 5IMKA 3ARTA 5IG7B 4X6BB 5A2KH 4Y8AA 3GO1L 3VXUA 1IM9D 3RKDC 1MQKH 3LB6D 4M1GL 2AJVL 1EAPB 3F8UB 4FFZL 4PJ7B 5JXED 2Z93B 3BJLA 1EVTC 4XPAL 5C0CA 3O6LH 1NGXA 4L8DB 4QTIL 4QXGH 3GSNB 3VFGH 3FRUB 5HSFA 3GBML 3WFDH 1MLCA 2AJXH 5J7CC 3H8NA 4Z7VA 3EYQD 1OAYH 4XGZB 1AO7D 3IDMA 1JCKA 4HJ0C 5DDHB 1VSCA 2J8OA 5IWLA 3PWVB 4HBCL 3DXAD 4XZUB 3OKNA 1C5CH 3LSOA 1HCVA 3C6LC 4YXKL 2VDRL 2ZG3A 2WIIA 3TNMB 3HPLA 1YYML 1CGSH 4MNQA 1X7QB 2O5ZH 5A16B 1U8JA 3LDBB 5CD5D 2OXGA 1R3LB 3SQBA 2AERT 5JPMA 4OSUH 3JXAA 4PJFB 2MFNA 2UWEF 3HS0A 2CJUH 3AM8A 4JB9H 4HUWB 2GCYB 2OP4H 2OS7A 2DQCL 2H32B 1TVDA 3ZT5A 5L88L 1SMAA 1MHEA 1A21A 3NIFF 1T4KB 2LVCA 3OX8A 1X5AA 5BVPL 1JZ3A 1QG3A 1MCDA 1FL3A 3DBXA 5I75B 3TPUB 5BVJA 3NN8A 1ODAA 4IRSB 1NMBL 4ZPTB 5DR5H 4DZBB 4NUGL 4BSJA 4QY8A 4F37F 5FCSH 4HPYL 2F74A 2N7AA 1NGQL 1NQBA 1GJIA 2MQCA 3EYSL 4JJHA 4C83B 5JHDD 5CSBA 4PG2A 3LQAL 2XWTA 5T1DL 3I3EA 1AIFA 4BH7B 4YZFF 4XCCH 2E7LA 5H94B 3CFBA 5B21A 1U93B 5E56A 4A2MA 1JWSB 1LP9A 3F12B 2W9DH 3H9SB 3I6KA 4FFYH 5I1CL 3SQOL 3SJVD 2XY2A 5I1DA 2ADGA 3VFUA 1UM5L 1RIVL 3LV3B 4M7ZB 1BM3L 3W81A 2JJTC 4OD3L 4Y1AA 2IALB 3TVMA 2V6HA 4L29A 1F45A 3DUUB 4OLWH 1PQZA 1RU9H 2I9TB 3WFDL 2HVKA 5HGHA 1A4KB 1ZLWK 4XT1C 5IHUL 4Y16C 2BVEA 5HGDB 4TUOB 3D3VA 4MDIB 4N1EA 2X4UB 2YD5A 5IKCA 1C5CL 2AKRA 4JG1H 5IBLC 1AR1C 2XWJB 4ZQKB 3RP1A 1VPOH 3ES6B 5HYJE 3FQXB 2IBGA 1DBMH 3D25A 3L3OB 3S8WA 4EJ1C 1AGCB 4HV8A 1ZANH 3QHFL 3H3PL 5IB1B 3ZKXC 4OSUL 1BEYH 1K9TA 4NOFA 3TIDB 4RRPA 2J3SA 4JB9L 2H2SC 1N0XH 4N0UE 3FO2A 2OP4L 3NFPB 5C09E 4ZOEA 4XXCC 1XR8A 2XTJD 3TBVA 3TJEH 4X99A 3FB5B 5J6GA 2X4TB 5K59F 2R29L 5CCKH 4FTVE 2GJ6D 1TETH 1LO5A 2P5WE 4PJ7A 4R96B 1WBYA 2VZ3A 3UYOD 1GL4B 5TDOA 5FYKH 1FH5L 2ZWLT 3O9WD 4LHUD 2IPKB 2ZG2A 3KLAB 4P48A 2ILLA 1WV7T 2F9BT 4LDEB 1AFVH 5SWSE 1BQSA 3FRUA 5DVOA 2HT3D 4XCCL 4OUUB 3ZE0F 3SKOA 3LKQB 3MGOA 3P11L 2XFXB 3FOLB 5E4EB 5I1IL 1CCZA 2X4OA 1LE9B 4TSAL 3BUYB 5T1KD 4Y4FA 2YUVA 2EH8L 4AMKL 5BS0E 3HE6D 3CXHJ 4YE4H 3QXWA 4LBEB 4LCCA 1EO5A 3T4AB 3TNMA 2OM5A 4U0QB 4M93C 3U4BH 3OAYK 2NXZB 1ACYH 1MF2H 1WJ3A 4U1HB 4PR5A 4JHAH 5C7XH 3QO1B 3QXVA 1UH3A 5J89A 1ZA3A 1NGPH 3MJ8B 2H9GA 1DLFH 3TZVA 3SDXB 3MA9L 4PJXA 2WAHA 4YFDB 5FM4A 2PO6D 4N5ED 1U36A 3SKJL 4ZUWA 1KOAA 3GI8L 5EC2A 4UDTB 4YK4B 1QFUL 5ISZD 3BO8A 3BDXA 5D1ZC 3QNZA 5BMFH 1CDHA 2FH6A 4ZPTA 5ALCH 4N9OB 2Z92B 4Q9QH 5F88B 2R2EB 1QFPA 4ODHL 1KTKE 1HHJB 1OARL 2ZCHL 3JWDH 4PJ8B 2OR9L 1GZQB 1IJ9A 2IAMB 3VXQA 1KBGL 2R56L 3LKOB 1N0XL 5J9PB 4HZLA 1FFOA 1OL0A 4KK6C 5H94A 5ID1A 2KKQA 2BSSA 4KGLA 4KRPD 4LLDB 1MCQA 1NCCL 1L7TH 1O5DT 1PY9A 4NP4L 2ZUYA 2BJMH 3VWKA 4WJ5B 3D2UB 5IJVA 2XNAB 1MFDL 4GFTB 3LV3A 3VXSD 2ZCLL 1CK0L 4UT6L 3O8XB 1A8JH 4AEIL 4YHNA 3TH3T 1P7KA 1H8OA 2CQVA 1U3JA 5EU6B 2IALA 5KG9B 4YBHA 4Z9KB 4FQXA 2VR9A 2R8SL 1IGIH 3VH8G 2BVQA 4OCMC 2D0GA 1U95B 3T0AA 3I2CL 1T04A 4C56A 4I4WB 1FG2B 1KIPB 3RU8H 3QCVH 4TUOA 4LKXB 3IKCA 4FHBD 4NNYB 1RHHB 1JBJA 2ITCB 5L2JB 2YA0A 4P2OB 1UVQB 1PEZA 4LRIA 3RFZC 1QHPA 1AXSB 1RD6A 4L9DA 5DMGD 4Y4HB 1X4YA 4G8FB 1T7VA 3RY6C 1A7BA 5HHQB 1LWRA 5C7XL 3QEUA 3X3GL 3NBNA 4M03A 3TIDA 5HGAB 3VFPA 2IMMA 3W82A 1EEQA 2D0FA 3X14B 4UILH 3IJSB 2BXYA 5D2LF 4FZ8H 4S1SL 3KXFB 4XRCA 2DQTL 3MX0A 4HLJA 4KVNH 4PJEB 4R0LB 3RVUD 4KI1A 3QEQB 2PW1A 3OKDA 1K4DB 1LNUA 4Z7UE 1CBVL 1X5YA 3MJ6A 3OMZA 3B6SA 5BMFL 3T0EB 5EOQH 3ZE1F 2JF1A 4RIRA 5F7EL 4ZPVB 2CMRH 5C0BD 1G7PB 3OXSB 2IPKA 2NYYC 2IBZY 5A3IC 1CXFA 5C3TA 1QA9A 4OZIA 3BKML 3QDHA 5AUMA 5KVDH 4KXZH 2GJZA 5FGCE 4EXKA 2FATL 3LY6A 4IMLA 3WFHA 5HHOA 4OD2B 4EI6B 2XFXA 4UU9A 1YEFH 5GS3A 3WFCH 4FG6D 4E41B 5IJKC 1NCNA 4TNVK 1EXUA 43C9A 4OLUH 4L9LB 4Z7VE 2V2WA 1LK2B 2I60L 4MAYB 3MOBH 1A7NH 4EVNB 1CIDA 2HJKB 4UQ3B 2LVEA 1R24A 1KELL 3WJJA 3D48R 4TUKL 2ADJB 1I7UA 1JZ8A 5IT2L 4IS6A 4XVUC 5BRZA 3QP3A 5IV2B 2Q76B 1G84A 1J0HA 1FNLA 1IGMH 4WENB 4JQIH 1T2QH 4MB5A 5ESQA 5FDWA 3QCVL 4UDTA 3QH3A 1WF5A 2Z8SA 1F58L 1OLLA 5F9OH 1IEBB 5D1XB 4X8JB 1KJMA 3DGGA 3STLA 4MNGB 5F88A 1C8PA 5D7JA 4DTGH 4L3CB 4PY8I 1H15B 2A9ML 2Q3AA 3DMMC 4R2GD 2D7OA 4NQVB 2FJFB 3DRTA 1S5IL 2Q8AL 5EBMB 1GZQA 2A6DA 3LKOA 5B38G 5KN5B 4DWHA 3EOTL 4OFKA 1MCRA 2DOCA 5GRXG 1GGIH 4K3JL 4RQQB 5J4MA 2WSKA 2XXMB 2XYCA 1DJSA 2R0KL 3TN0A 3EFDL 3R0MA 4X98A 1KYOJ 3BP6B 3OAZH 2YD3A 1DBBH 1EEZB 4X8XA 3IFLL 5A2JH 1LP9E 4CUCA 4LF3B 3T3PF 2Q6WB 5I8CA 4QYOA 3TH4T 1V7NL 1E4XL 2VE6A 2ZG1A 3HI1A 2QEJA 4RNRB 4F9LA 3HB3D 4XVTH 1TQBC 1FSKC 4FZEH 1IAIM 4LLMB 4MMZC 2VDLH 5GS2H 1IAKA 5C0JB 5C86A 3PWUA 3BDBA 1RIHL 4KRMB 3T4YA 1XIWB 3IETB 4Y1AE 3U83A 3VXTA 1YEFL 1UT9A 4NNYA 3HZMA 3PHQB 4P2OA 4PJAB 1UVQA 3MV8A 4CVUA 1OT1A 4LP4A 2WUCL 5DMYA 5IR1A 3TYGL 3KPQA 5KSVA 3D3VE 5HHQA 2E8YA 3WSQL 2GUOA 1IL1B 5B3NA 3LIZH 1UXWB 3RWDA 4ZO9A 4O02H 3O41B 5D7LD 5CEYB 3KXFA 2BVUA 2VABA 1A7OL 1IC7L 5FECB 4NUJB 3QUXB 4PJEA 2L4OA 3QISA 1JGDA 2H1PH 5MEND 1EGJA 1K4DA 3L6FA 3TBYB 3X17A 3UP1A 1CDCA 1Q94B 4BH8B 3FQUB 4ZFFB 1P6AB 4Q7DA 4W6XB 1F8TH 5C0NC 3OGCB 4M43H 2EDDA 3NCJL 1T89C 5GJTL 4HUNB 2ZUQB 5BJTB 3MUGA 2MWCA 4NQDB 5DEGA 4JFDA 3QQ9D 3LDBC 1AGDB 1JGVH 3GIZH 3ROOB 1M05B 1S9VA 4OD2A 3PV6A 1RY7B 4U6VL 4HIJB 5I1EL 4GAFB 3EOAB 2VDMH 3SDCD 2PNDA 5GGRY 5C0DB 4L9LA 2V7NB 1YMMA 3QBTB 4X6CA 3OKEA 3MUJA 3V7AE 4JO2L 1FAIH 4EVNA 4O2CB 1AD9B 1X5ZA 4M1DL 4DOHB 3C5ZD 3GSNH 1NL0H 2G9HB 4JY5H 2ADJA 3GKZA 4HK3N 1U2HA 4PGJA 1RPQA 1GHFL 3DTXA 5I74C 4DW2L 4Z7WF 2VDLL 3MLSL 1CFQB 2VLME 3V0VB 5CIPA 4NQED 3C60D 3WFBH 2MCPL 5EDXA 1ZLUH 1GZPA 4NQCD 3OKMB 3C2AH 4XNUH 1BREA 3JV6B 3CFEB 2NY0D 4PJXE 3HA0A 3QIWD 4JJ5A 1JPFB 4X8JA 1CL7I 1ZAGA 2FL5B 4MNGA 1PW3A 1T21B 4L3CA 5DO2D 5FYLE 5TE4L 2EXYC 3EOBB 4JO1L 3HAEG 2H32H 1IARB 4O02L 3LKSB 3V4PH 2CUIA 2HN7B 5GSVB 1I8KA 2IPUG 4RQQA 1LE5B 5E5UB 4J3VA 3OKYA 2WMPA 5IHLB 4HK3J 4O2FB 4PJBF 4WI6A 5I17B 1WAAA 4OCWL 4OLVL 1F8TL 1XH3B 3MRNB 3PP3H 4GAGL 1DVFA 4Y5VA 1VENA 1DQLL 3MA7A 4DVRL 4LASH 4CW1B 3IDGA 1NUDA 2IG2L 2XKSA 1JI2A 3DV4A 1UQSB 3U9PH 1QSEB 5T33H 4L4TD 4ORZC 3CH1B 1JGVL 4L3EB 4YHZL 3DUSB 2DWDB 4WTZA 2ATPB 1ZKAA 2VIRB 2HFFB 4HWEL 4FP8L 1U41A 4J1UB 5J13B 3PHQA 1KACB 1MCHA 2B5IB 4LCYB 2B4CH 4U1NB 1AD0B 4C56E 4MDJB 5IVOA 1L6ZA 2AJSH 4K8RD 5TGBB 5H35B 4J8RB 1G7JA 1RFDL 3ZE2E 5D6CB 3GJFA 3VFVB 4N8CH 3QJFB 1FVDA 4Y8DC 2IADA 4RAUA 2HG5B 3QUXA 4KKLD 3CXHK 2EH7H 1IT9H 1UJ3C 4WUUD 5IMLA 1JWMB 2EE9A 3OF6D 1GXEA 1RJZB 2ID5A 3D0VA 4IMKC 1J1PH 2D9QB 3FQUA 4NSKB 1UM6L 2YK1L 1V3JA 1UCTA 1DQDH 5GGUA 2QKIB 4KI5E 2D7TL 2A74B 1YYLH 2PUQT 3GMOB 1RZFL 2EEBA 3M1BA 1OAUL 2HTLC 2NR6C 2NXZC 2FSEB 5F1NA 5EIQA 1Z9SA 4UZGA 2C9AA 3I02B 4LVHB 2N1KA 5JQHC 3CGTA 3BPOC 2EICA 2UZIL 5E2JA 1WT5A 2V7HB 3ARPA 5J06A 1DEEB 4DVBA 1R3KB 3J8F7 1JGUH 5T3ZD 4OZIE 5IW3A 4OIBA 1TJGL 1TZHB 4M7KL 3MLVL 2IQ9H 3MJ9L 5JXAH 4UOJA 1IQWH 1TZIB 2PXYC 4PJDB 4TSBH 2EYSB 1L9MA 5GGRB 4G80A 2DJ4A 3V4VH 4MQXC 2NY4D 4QCIB 2COQA 5HD8C 2J6EL 2EDQA 3DNKA 2NW2B 3RVWD 1TENA 3MPCA 2G9HA 1U58A 1T22A 1EIBA 1H3TA 4YR6B 4BKLA 4NKOA 4HEME 2J4WH 1E4WH 5DUMH 2IAMC 4Z0XB 1X6LA 2GEEA 4KKNA 3ZLQC 1YA5A 1V3LA 5GZOC 3OKMA 2KUTA 5FA4B 2YMXH 3WD5H 3MBXL 1JPFA 3VDAA 4RFOH 4LGRB 4KVCH 2AJSL 4V1DE 5E5MA 1OAKH 1P5UA 1BPVA 5MEQA 4X6DF 1XGUB 3CFDA 4YBLB 1CE1L 4OZHA 4WI2A 4DJMA 5F21B 4N8CL 5D96B 1F97A 2IGFL 2OL3B 3LKSA 4RGND 1QLFA 4Z7OE 1MREL 3MOAH 4MQ7A 4EDXA 5DD3L 4Z5RB 5GSVA 4XCEB 2SEBA 4WDIA 4MD0B 3SDDD 4LLQB 4O2FA 3PWPA 1FZOB 1A1NB 4WUKH 1M7XA 3ELAT 1IGCH 5ADOH 1Q38A 1MUJA 1BFVH 4NC1E 1R5VB 35C8L 4I1NB 4D9LL 1QEWA 4WFHD 3FL7A 1FRGH 2F8XC 1YEIH 5FA3A 4M02A 5EZOL 3S98A 3OB8A 1FNHA 3HMXA 1I1RA 5FCUH 3U0TB 3E6FB 2Y7QB 3OB0K 3FFCB 2JE8A 3U1SH 1JRHH 1R3JA 3FN0H 1CWVA 1RZKH 2VIRA 1VEOA 3V5HA 1C5DB 3BQUD 3MGAA 5DGRA 3TBSB 2VQUA 2FO4B 4MJIE 3ZYJA 2H8PA 5CJ8A 4F80A 1I8LC 3DYOA 4R0LC 1M7IB 4U1NA 4L1DA 1HHKB 2NW3A 3OJDB 5E2UL 1A1MA 4OT1L 3T1FB 5TGBA 3D9AL 1WFNA 2ZJSH 2E9WA 4J8RA 2FX9H 4XNQA 3T0EC 5KTEH 5D6CA 3CFCL 4HAFA 1A6PA 3CX2A 1CFNA 3QJFA 3CDCA 4I0CC 3FZUC 5GGTA 2HG5A 1HHHA 1J1OL 3KYOA 4OKVA 1E4WL 1DQJA 1A3RL 1IAOA 5JZ7D 1KULA 4JFFA 2YWZA 1T1WB 4P2QA 1INEH 3MRLA 4P9HC 1WBXA 2XPGB 5FM8A 1ZLUK 3P3YA 1MHHB 2YR3A 3WEXB 4MAYC 15C8H 1D9KD 1D5IL 3TEUA 1J0ZA 2FSEA 4XNMB 4YEFA 1DL7H 2AEQL 4ZXBA 1RUQH 5D5MF 3T1WA 1REIA 1WZ1L 4R3SA 1LK3H 2CXGA 4QXTB 5E8DH 1UH4A 1R3KA 3QO0A 4BSWA 4HW6A 2JB5H 2XXCB 1WBZA 3GMQB 5H2BB 2YBRA 2LU3A 4FQIL 1BZ9B 3NFSH 4WUKL 1TZHA 2R0ZH 4OF6A 1BFVL 3JVGC 4ZUTB 2EYSA 3GRWA 5GGRA 1OTSC 3MLTB 1FRGL 3RWGA 4WU7B 4Y5XC 5D1XC 2LTQB 1KIQA 1YEIL 3MRQB 5DJ2A 4A6YL 2ZUTA 1N2RA 4KUCD 1YMME 4ZTPL 4X6CE 5FCUL 3RVVC 2XA8L 1FHGA 4G43B 3ARDD 4G42A 3WL9A 1YPZB 1LO3L 1HXYA 4OM0H 5E8PB 2Y06H 1KYOK 1AO7B 3DURB 4P9HH 5C0RH 1DLHB 3VGGA 3QIBD 2C4FT 5I66B 4I0PD 4K07A 4Z0XA 1BBDH 5B4MD 4LCIH 5I19L 3DXAB 3CK0H 4DK3A 3SKNB 2VDQL 4CADA 1ZSDB 3IDYB 5FA4A 4ZD3H 1QBAA 1F42A 1CDYA 2IPUK 3SEPA 4LLVA 1VADA 3VD7A 1OWRM 5F3HB 1WVZA 1N0LA 2F53D 2RCSL 4X5WB 4GXUM 4Y2DA 5CZVH 2MQ3A 1XGUA 3G08A 2AK4A 1UYWL 3HCVB 4HIXL 4Y16A 3ESUF 2YKLH 2O61A 4ELKB 1NLDL 1P69B 4W6WB 5DUBA 2FB4H 4QOKD 3GK8L 4YFEA 2X9YA 3CSYA 5FM5M 5IVXE 3HNTH 3MV9A 2YPVH 1HHGA 4F37K 3N9GH 1FIGL 1XGQA 3CLEL 1XGYH 3KPSA 3UTSA 1YDPB 1AHWA 4F7MA 4XXCA 15C8L 5HHXL 5JHDB 1JPGA 2NY6C 1JTPA 4HLZH 4RISL 1BVKB 1ZHBB 2PTUA 2ZCKL 2YD7A 1H5BB 2YA1A 1YN6B 5E6ZA 1NAMB 2DBJA 1M7IA 4GKNA 5KANG 1D6EB 4K7FB 1XT5A 2R0ZL 4EOWH 5I30H 5I1KH 5J6HA 3T1FA 4F58H 4MVBD 1WZKA 1KJVB 1DQTA 5IROA 2ORBH 1WCBA 1I3UA 1VDGA 32C2B 5IB5B 1N6VA 5T3XD 3AU1A 4QWWC 3F7QA 3AS3A 1C7SA 3QXTA 4P9HL 1EHAA 2Y23A 4AT6A 2B2XL 5K93A 4XP9H 1FNEA 4ONFH 3VXMA 1BBJA 3VRLF 3H9ZA 4YXHL 3LHPL 5F1KC 3OL2A 1XGRB 3QDJD 5FDYA 2XPGA 5TE6L 1LO2L 1F4AA 3CXDL 3GJFH 5CZVL 4IOFC 3WHE1 3G9AB 4P3WA 4Z95H 4UDUB 4XNMA 4U1LA 3OGOE 4AIZB 4OGXH 5HXMA 2YKLL 4EUPB 2Y6SD 4DUWA 2JJVA 3P9WB 2G75A 2APWA 4M9PA 4S0TD 5D1ZA 3ZL4H 2WP3O 2AS5M 1IM9A 2QSCH 4WO4D 1T03H 5GS0H 2DTML 5JOFA 3BWAB 2GJ6B 4X9FA 5JXEA 2C3GA 3N9GL 4BQCA 4RZCA 5I1GL 4WU7A 4LHUB 5FUCC 1CU4H 3G6JF 3MRQA 3PP4H 1HKFA 4W4OA 1F00I 4UIKH 4UB0L 2DM4A 3ZTNL 1UENA 3JUYA 1Q8MA 1CICC 3B2VL 2IWGA 3O6MH 5I76B 5FUZL 1PKQB 2N56A 3MFFA 4A2LA 3NZHL 1I85A 1AO7A 3DURA 3QULB 1BQHB 3SKNA 1KCUH 2C4FU 5DVLA 5BV7B 1X44A 3ARBC 3RQ3A 2AABH 1ZSDA 3HE6B 5JHLH 1FDLH 4PLJC 4U1GB 2J7LA 1AGEA 3MNZB 3JUZA 1MEXL 5F3HA 5EN2A 4WV1A 1LD9B 2HH0L 2W07A 5E5RB 3WFZA 3K2UL 4N0CD 2E9IA 2V2TA 3V6OE 2EIDA 1LEKA 4N0YH 5DJXB 3KS0H 3QG6B 2JJWA 4LGPB 2PO6B 5DURD 1NPUA 2I25N 2D03L 2XN9E 2NX5A 4OZHE 1UGNA 5ISZB 3RY6A 5KBNC 4MXWL 4ONFL 3A6BL 1FLTX 2EC8A 4HUXB 4XTRD 4QXUH 5D70L 5J13C 5JPNB 1IC5L 4M1CD 1JHLH 2VAAB 1IAMA 4LKCB 4X7SH 5JORA 3PWPE 5ANME 2F19L 2B8OT 4AM0A 5DJ6B 3LS5L 4Z95L 2X05A 3OZ9H 4UTAL 4NKDA 1NJ9B 5C08E 1HXMB 1BVKA 3B2UC 4WWKC 3T2OA 5ETUA 1T1XB 5CGMA 3X3FH 1NFIB 2Z31C 5HDBE 3LKPB 1RK0A 3A6OA 5EZIL 3SJVA 1YN6A 2KDGA 3L9RA 1T03L 1F2XK 1VFAA 1MCPL 2BVPB 3BHBA 3BRFA 3B9KC 2WBKA 3U0PB 5HPOA 5I18L 1EHLL 1MWAL 4NHCL 3F6LA 5EUOB 2UUDK 3EYOB 4OLEA 2ICCA 3BKYL 3HMXH 1P4IH 1QRND 4D0CA 3TYFB 4P3CL 4PRID 2AJYL 4HWNA 1OTTD 4F3FA 3PE9A 4KJWD 4YLQT 3WFEH 3HC3L 4G8GD 4M6OL 2WBJD 5BO1H 5GGQH 3ARZA 4KJPD 1MIMH 1QBLL 4N9GB 4BQ6A 4M3KB 2CLRA 5DFTA 1Z5LB 2IPTL 1BWWA 1UCBH 2F8OA 3MNWB 5DFVD 3ULVF 1HQ4B 5IFHL 2X4QA 1U8PA 5EOCH 4NZUL 1NBVH 5I1AB 1A6UH 3GHBH 1G7HA 5E6YA 3G5ZA 4PD4J 3WIIL 4HFUH 5D93C 1OWWA 4QHMB 1FLRL 4JFFE 1Q1JL 4ZFOL 5GGTH 1DDHB 1OTUC 4P2QE 2YXMA 4JKMA 1U91B 1MJ8L 3EHBD 4CVXB 3JWOC 4GQPH 4N0YL 1IAIH 4O4YL 1VFOA 4ONHA 2VDKL 3T0WA 2VLJD 1JRHI 1QSFD 3U9UA 1IGYB 4YDIL 3KYKH 4FNLH 4NPYA 2GJ6A 4PJCA 3DMMA 3HZYB 3AAZB 4MNHB 5CD3A 1T6VN 2F5AL 3O9WA 2OZ4A 1A1OA 2ITDA 3B3IB 1ZTXH 2IBBA 4FFWD 5DD1L 1NCTA 2BXZA 3K8LA 5IHZB 1OD7A 4YBLC 4V2CB 3MR9B 5I2IB 5C2BH 3DETC 4FXGA 5T5FH 3UPCA 4YHML 1NCWL 4HUUA 5T1KA 3VDCA 3HE6A 1V7ML 5HYIA 3GRWH 3QDGD 3LZFH 4L5FL 3MNZA 4JAMA 5C0EA 3RTQC 1U3YA 3ZTJH 4G6MH 5EZLB 1QR1B 3CLFL 3JWOH 5C9KA 1AGFB