4DN3H

Crystal structure of anti-mcp-1 antibody cnto888
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
217
structure length
211
Chain Sequence
b'ELVQSGAEVKKPGSSVKVSCKASGGTFSSYGISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CNTO888 LIGHT CHAIN
publication title Structural basis for high selectivity of anti-CCL2 neutralizing antibody CNTO 888.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 211
sequence length 217
ec nomenclature
pdb deposition date 2012-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dn3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dn3H01
1A1MB 4MJ4A 4HFWA 5D1QC 1P9MC 3AREC 5TDNB 1P4LA 1PG7L 2YPKB 4I48A 3D3VE 3KJ6L 4AH2A 1F00I 4JRYB 2MQ3A 3PXHA 4O5LL 4TSAH 3RDTD 4OCMC 4JO4H 3NGBB 3CSYB 3GI9L 3BQUA 4IDJL 1XF1A 5FM5M 4LLQB 3AAZA 4PIRF 2R2CA 5ELIA 2QQLH 5HGBB 1D6VL 1GZPA 1I3GL 3MROB 3QEQE 3TA3D 2WBWB 3U48A 2GHWB 5EU7C 4R4BB 3JTTB 1HKLH 1S7WA 3DECA 5E8NA 3QIUB 1WC7B 4UT7H 1MLBB 2IPUG 1T7YA 3MV7E 1Z5LA 2HVJB 3QFJB 1HXYB 1A02N 4NZTH 2JIXB 1KLUB 4O2EA 3T0ED 4H20H 4ONHA 3CDGB 4LOUC 2R4RH 1CU4H 2ADIA 1T20B 4CMHC 4R4ND 3SQOH 2G9HB 4MNHB 5J9PA 3MYJA 1RI8A 4YE4L 1INDL 4J7RA 1U8JB 1BIIB 1CQKA 2F54D 2VISB 3HC0A 4YNYA 2BSSA 4HUVB 3DX6B 5DK2B 3ZHLA 1DUYB 4RQQA 5AD0A 2D7TL 2AJSL 5F96L 5ICXB 2FECI 5IW3A 1D5MA 4MAYA 3JTSB 3PWLA 1OCWH 2W92A 3IFOA 4UV4L 4L8DB 4NBYB 3ZE1E 1WWCA 4Y4HC 3QWOA 2B2XH 2Z8RA 5JDSA 4NKIH 3VXRE 5KG9B 3RVVC 4BZ2L 4QCIB 4K71C 2P49B 4OQTA 5DRNA 5BV7L 2J3SA 4UAOC 1BOGA 1KCLA 2H2PD 3TNNB 1S7UA 2NW3B 4OIIL 2GIYA 2Z35B 1FZOB 12E8H 4WIQA 3BEWA 2DB8A 2AJYH 2D3VA 1BJ8A 2XFXA 4XMKH 4CN6A 2VXVH 5T5FH 4JRWA 4D3CH 3ALXA 1T3FB 4OLYL 4MHHI 3EJJX 4FQQA 4ZXBD 3B9KD 1FBIL 2WQRA 5F1NB 3VFNB 3FZUD 4JFPA 5GRYA 4UB0H 4X6CB 4WW2F 2F5BL 4YHZL 5E2WL 2ESVE 4J1UA 5E08L 7FABL 3RGVA 1WAAA 2PYFB 5ETUA 3MXVH 1A4KA 4CVWA 1T1YA 1YMMB 4HJGA 4KKBD 4P57A 4KTEL 2FL5A 1LP9F 1YDPA 3E8UL 4Z8FL 3H7LA 3GSNB 3GBLA 4CL7A 4F58L 1TCMA 2R39A 4OCRL 2QQQA 3GSNH 4Z7OF 5JXAH 3QUMH 3SDXA 1EA9C 2AXFA 2H8PB 5BO1H 5DEGB 5E5MB 4R97B 1ZLVK 3VI3E 4N0CD 3QT2A 3PV7A 1RURL 3I6KB 4KTYA 4D9QE 1UKTA 1I85A 1NAMA 4PGJA 2NXYD 2BNRB 3BOVA 1GGYA 5C08A 2QTEA 5GS0L 4FTVE 1J8HA 1HHJB 5IBLC 3RKDD 3K4DA 3FT3A 5FCSH 4LSQL 2FGWH 5KJRH 5DTFA 4JM2F 3UTSB 4LSUH 3BO8B 3OB8A 1Q9OB 1JNLL 1KJ3H 2AK1H 3GBNH 1I8IA 5DFVC 3ULVE 2VB5A 5ENWB 1LDSA 2B0SL 3QIUC 4YIQB 1MY5A 2Y9RT 5INCB 3V0VB 5F7NC 1B0WA 1C5CH 1HYSD 3CSPA 4HZLB 3OZ9H 4HS3B 3RGHA 3TEUA 1AXTH 3D2UB 2YSSB 4L9DA 1GSMA 1NFDB 3VWJD 5CEZE 3JWNC 5JLZB 2I9LB 3HR5B 1WZKA 3DLQR 5HHOE 3HE7D 2Z31A 5KSBB 4ZFOB 3UDWC 5HHPB 5C6PB 2PXYD 4RMSA 1VGKA 4LCCA 4P23A 3WIIL 4Y5VC 2EYTB 2D7NA 3VRJA 1Q94A 4JANA 3TN0B 3VGDA 4JFOB 1FFOB 5C0AE 3FOLA 3ARXA 3VH8A 4OSUH 3B3IB 4WNQA 5J13B 5DVOA 2F5AL 3MACL 5C0GA 1A6UH 3K1DA 1GGUA 2VDML 1NGXB 1S5IH 4Z0BL 3ARFA 2AQ1A 4F33A 4JZOA 3PJSA 3WLWD 2EEDA 2FCBA 1I9IH 4K8RL 4PJ5E 3ZHDA 5INDB 2I60H 1QFUL 25C8L 5B38G 5E8OA 2IFFH 3RY6A 2GCYA 2W0PA 1L9NA 5EZJA 1LK3L 1VKXA 3H2WA 3LEYL 1TFHA 5EZOL 3VXUA 4BZ1H 3BH8A 4YDLB 3CPLB 4KV5F 3NPSB 2M1KA 1JI1A 5DI8A 5K9QI 1Q8MA 3UC0L 4W81A 3QQ3B 5ERWA 4F7MB 2XWBB 1W8NA 2YR3A 5SWZE 2OTPA 3MA7B 2E9IA 5JPMB 1IMHC 5HHMD 1CICD 4X83A 3WNOA 1TZHA 1Y18A 3PDOB 4IM8A 1QHOA 1V3MA 1WT5A 4JFFD 3MRBA 1UCTA 3S3PA 5ICZB 4LPYA 5F7MC 3FMGH 3AFLA 4X98B 5KVFL 2HKHL 2HG5A 3QDMB 4LLMB 4GAJL 4NIKB 4NUJB 5FYLH 2OXGA 5DHYB 4J3WA 3ARWA 2DBJA 1T21B 4GLRI 1MFCH 1OGAA 1IGFH 3UBXB 5I1EH 3H9HA 4J6RL 3E0GA 4UI2A 4XP9L 3KPRE 1MEXH 1FVCA 4YO0B 4MXWH 4JY4B 3C5ZB 3SGEI 3PG2A 2E7LA 1RZJH 1DBKL 4G6AC 3Q6GH 1NCAL 4S1RL 1X5AA 3D39B 5H35B 3QG7L 4FABL 3FO1A 4YHML 1XZ0A 3QG6B 3MV8E 2FH6A 1AHWC 1OTTC 2NMSA 3G5YB 2WW8A 4N8VB 1QR4A 3UTPD 3X3GH 4LHUG 1A2YB 1KNOA 5DUML 3WFEH 3S5LG 1YYMH 4P2CG 4ZTOH 2VLJE 1AXSA 3IAPA 4ORZC 5MHSD 1MUJA 1V8HA 5IOPB 4FN0A 1R3LB 3MRKB 1U92A 4N0FA 3U7YL 5JZ7D 1LO0L 4NM8L 3FB8B 4D9LL 3U36B 4X7SL 4JAMB 1JRHL 1UACL 5AUMA 1IC7L 3L6FB 3IDJA 3M17B 3V0WH 4HUMB 5IFJB 4G43A 3MBEB 1T1XB 1HHIA 5L7XL 1IAIL 1CBVH 4NN6B 1MHEB 1A3RH 5GGRY 5F9WB 1N64H 3FQUA 1I4FB 1JUFB 3TP4A 3TN0C 4P3DA 3GMRB 4NUGL 4GKNA 3TF7C 1UB5B 5E9DB 3VRLF 4HWUA 4Y5YA 4P49A 3LDBB 2SEBB 2DQGL 3ZKXC 2VC2H 4PGBB 1OAKH 5I0DA 3DWTA 4PJ7E 5BVPL 3K2MC 1S7XB 4IJ3B 4JVWA 4KZEH 5DK0A 2Q20A 3OXSB 2ERJC 1ETZA 4HS6B 3MSPA 2DBLH 1YNKH 4TULL 5E99H 5DF0A 4NQVB 3ARYA 1DLHB 5HYSA 4RNRB 2PTUA 1XGYL 3GFUA 4YDLC 4ZAKB 5IESL 1U58B 1U8KB 4NC1E 1PG7H 2DWDA 3QIWC 3H9ZA 1WJ3A 3B5TA 2HT2D 4XCNB 3KJ6H 4PG9A 4NQSA 4O5LH 1BZ9A 2RB8A 4LVNC 5ISZB 4ZUWB 3PWUB 3GI9H 4IDJH 3BJLA 4LVOC 5JXED 4IOFC 4OLXL 1AQDB 1OAXL 3H7BB 4U1MB 3ZDZE 2H45A 4U1LA 4XNXL 1D6VH 3QEUB 3BPOC 4BQCA 1I3GH 3V7MA 3PQYB 2D0FA 1CYGA 1MPAL 1R3HA 3HI1A 4ZSOB 3QUYD 4ZUTA 5E1HB 4YHPB 1R5IB 2P8MB 4WEMB 4AEHH 2A83A 1DQLL 3GJFK 2GK2A 2GEEA 1HYRC 1RZJC 1IGJB 2J8UB 1Z0MA 3OKDB 1JJUA 4WU7A 3AS1A 2VIRB 2VZTA 4QGYA 3VXME 1KULA 1N6QL 4YE4H 1INDH 4JG0L 5IVXE 4YHIB 3VRIA 5EIIA 1ZHNA 3FB5B 2OR7A 4RMTA 2I5YL 5J57B 1FG9C 5L2KD 3KXFD 2D7TH 1O5DT 2AJSH 4XPBL 3I2CH 3ZE1F 1YY8A 5F96H 4Z0XB 2CR6A 4RFOL 3O45B 4WUUB 5JMRA 4NYLB 2E8ZA 2PYEA 3FB6B 5EORL 1NJ9A 2OL3L 4UV4H 2NY2B 2XT1B 5HGDA 3G5VB 4BZ2H 3K74B 5BV7H 3FT2A 4AQ1B 3ZHKA 4PLNC 4G8EA 3DIFA 3P9WB 4OIIH 1FVEB 4PJHB 3ZO0A 3RVUD 4M6ML 3QQ9C 4QY8B 4NQTA 3ETBF 4PBXA 4U05A 4OV5B 4A6YL 4HBQA 5HY9A 4NN6C 2R1YB 5BRZA 5F9WC 5EBMA 4MA1C 4PJAA 4KKAD 5ACZB 4MJID 3OWEA 2X4NA 4HX1A 4JRXE 1Y0LA 3LDBC 3EOAB 4X7TB 2F5BH 3VFUA 4YHZH 4PRHD 1GH7A 4QRRE 5E08H 4TN9A 4HV8A 7FABH 3K7UA 3BH9B 1T22A 5FB8B 3UTQB 4F8QA 5I74C 3GHEL 1AO7A 4KPHH 4XHQA 4KTEH 4ODWA 3E8UH 3MMEB 4Z8FH 1SYVB 5HHVL 3H0TB 3QWQB 1X5LA 4BH8B 1J5OL 4F58H 2WMPA 4OCRH 3VI3F 2VQ1B 1A21A 4Q9RL 4PY7A 5HYQB 1AC0A 1OT1A 2W65B 3V6FB 4AIXA 2CQVA 3MNZA 1LEGA 1WEJL 3NA4A 1XAUA 2HT4D 1RURH 4Z76A 3D25A 1YMHA 1IC1A 5I1DB 43CAA 1Z9OA 1H3VA 3ARBB 4XBGA 4C54A 1U8PA 3DETC 1BF8A 3DRTB 5GS0H 4NQUA 4YPGA 4HIEA 2LVCA 4FQPA 5DA0B 3W9EB 4Z5RA 1AI1L 4LSQH 3T8XB 1HSBA 1WBYA 1P1ZA 3MRLB 3QEHB 4TUJB 1JNLH 5HYJE 5DC9B 1AIFA 2B0SH 4R9HA 3I6GA 1KXVC 4BSWB 2JJTC 4DK6A 5IB2B 3HRZB 1BD2D 4F7CA 4HLJA 2PCPA 3LEVL 4WW2B 1K4CA 5IHBA 3T09A 2FR4A 1BMGA 3T2PA 3GSUB 1MI5E 2FIRT 3TFKD 4POUB 5DVKA 1D6EB 2P5EE 3BD4A 1KIPB 3IDYB 1BJ1J 4KUZL 3WIIH 1CI5A 3RJDA 1X5IA 1OSZB 2X4PB 5E2UL 1A8JH 1P7KB 3OKKB 1SVCP 2R23B 1QR1B 2GUOB 2HLFC 3K0WA 3IFNL 2WIIB 3IDMB 4YHNA 3C9NB 3VE0A 1KOAA 3KYKL 2F5AH 2P1YA 3L9RB 2VKWA 3AB0C 3MACH 2N1KA 3BHBA 3WJLC 5BV7C 3BZFB 5MENA 1VGEL 4Z0BH 1IAKA 4WHTA 1B90A 1X4YA 4YGAB 4K8RH 3ARDA 2JK5A 3PHOB 4RA3A 3TBYB 2QADD 2ICWJ 1QFUH 3NN8A 4U49A 25C8H 1KB5L 5F7LB 4EXKA 5LGJB 3DARA 4BSVA 5J1AB 4RIRA 4XAKE 3LEYH 3AY4A 3DMMA 1RIUL 3CFCL 3D48R 4MA3B 5KS9B 3PABA 4JFEE 5LBSL 1FAKT 3V6OA 3O6ML 1EEZA 3UC0H 4P2YA 1VEOA 3O3DA 4X0KB 3NCCB 1A9EA 1G0YR 5CEZL 4NQEE 2BFVL 4DQOL 2CRYA 3KPNA 3ARGB 2VXSL 2HKHH 1G7QB 4GAJH 4R4FL 2AK4B 1JZ2A 2IH1B 2YUVA 4Y2OA 2L4OA 2IC2A 3N50A 4WU5A 4ZODA 3KLAB 4X80L 5F88B 4C59B 1CDGA 1JHTB 3OKNA 4J6RH 3TO4A 5BW7C 3S37L 4XP9H 1WZMA 5IQ7L 3EGSB 1J05B 2X6MA 5A2KH 4TNWK 2J6EA 2ZWLT 4X5WB 3LKOA 5GS0C 4MCZA 1AKJA 1DBKH 4YH6A 2X9YA 3JSSA 1NCAH 4FFWD 4PJDA 4I0PB 3MOBL 3QG7H 5F9JA 4YHMH 1G7MA 5CBAB 2GFBA 5E94B 2BVOA 2HH0L 3ZMRA 3LH2L 3NCYP 2FYYB 5BXFB 3O4LB 1CK0L 4KDTC 5DUMH 4LGRB 1UVQA 2R2BA 5A16A 1CFQB 3PL6A 2IANB 4X6DB 3BQUD 3O8XB 4IRJB 5T5NF 1IGCL 1U3HB 5I1IL 4WW2C 4XPFL 4JZNA 3MPCA 3DYOA 2KUTA 3U7YH 1LO0H 4NM8H 3S96B 2BVPA 4D9LH 4X7SH 3ZKQD 1JRHH 1UACH 2BNQB 1IC7H 1P9MA 3AREA 1ZMYA 5F7KC 2B4CH 3A0OA 4ODXB 1S7TA 1X5HA 4GAYB 2AP2A 5L7XH 5FA3A 1IAIH 3IDYC 3KWWB 3VFTB 4HWNA 2ARJA 3DVIA 3GKWL 4F15B 3IXAA 1E28B 1OAZL 4NUGH 2P8PA 3M8OL 1GGBL 4PJ7F 4EN3C 4XCEA 3LQAL 5HI3D 2DQGH 4YDJA 5IKCB 2HT3C 4RCAA 5C09E 1QG3A 4O9HL 5CIPA 3OMZA 3TM6A 5BVPH 4K8RC 3V7AG 3E6HA 1ND0A 5B39B 1YUHA 5I1HL 2OM5A 2YA2A 2VABB 4E0RB 5D2LB 2OQJB 4OCNC 1IEAB 4TNWF 3ZKND 4MAYD 3LN9A 4TULH 1C16A 4JM2C 2GSGA 1NPUA 5ILTL 1MJ7L 5DMGD 1MHCB 4MNQE 3G9VA 1LHZA 3HMWL 1XGYH 4FXGB 5CHNA 5IESH 5AZ2H 4K3DL 3FFCD 3BVNA 1L7TL 1RK0B 2PO6B 4DEPB 2P8LA 3S9DB 3Q5TA 1W72L 5H94A 3MJ9H 1J0HA 4OLXH 1FN4B 2HA1A 1OAXH 4ODSH 2H26B 4NWTL 4RZCA 3I85A 5C9JB 4HBCL 4HK0A 4Y4HA 4HH9A 3V9FA 1CCZA 3GSXA 3RGVD 5CSBA 4DFHA 2E6QA 4CRPA 5DFTA 3BXNA 3HCVA 3V6BR 3PWPE 3HAEH 3MCG1 4FQ2L 1OTUD 4MCYB 1FPTL 1SEBA 5EU6B 4KVNL 3EDDA 3O3UN 2R2HA 5ALBL 4CDHA 5TDOB 4UOW0 2Z4QB 3LN4B 1MOEA 4NO0A 4UT6L 4I0PC 4IDLA 1YPZB 1EBAA 4JO3L 4JG0H 1RY7B 5ID1A 1KPUA 5CD3A 1ZT7A 3WIHL 5J56B 4B7IA 3MNWA 1TMCB 2I5YH 3LPWA 3MGOA 3UTTB 1VADB 3DI2B 4RMWA 4XPBH 1CDYA 2KDGA 4ODUA 3O8XC 4IRJC 5EORH 4IS6B 2OL3H 5I9QB 2BY0A 1Y6MR 5FV2A 1PG7X 5FYJD 3UJIL 5DJ2B 4B5EA 3HHRB 2FZ3A 4PREB 5DYOA 4PJBE 4FHBD 4O2FA 3EJZD 4Z95L 3VH8G 1T7VA 2B4CC 1JWUA 4PJIE 3L7EB 3VJ6B 5I19L 4A6YB 5DUBB 2YPKA 2K7QA 1T04B 1KTDB 3EYVA 3LRHA 5TH2A 1FORL 4YFEA 3FHAA 4JRYA 4A6YH 3LKPB 1AGFB 4EEEA 5HHQA 4U3HA 4RGNB 5BJTA 4F15C 3CSYA 1QHPA 5T3ZE 4Y19B 4LLQA 3QP3A 2HVKB 3BP5B 1P7QB 5HGBA 3CUPB 3V2AR 1Z6JT 2V5SA 1YNLL 2YWZA 3MROA 2CLVA 2QEJA 2NY4D 4P23D 4R4BA 1IGYA 3GHEH 4JFYB 3W81A 1QZ1A 3QIUA 4BKLB 1KJ2L 1WC7A 3DROA 1MLBA 1VEPA 5DRXB 5HHVH 1RZIB 3QFJA 4GRMB 1HXYA 1WWAX 2RIKA 1J5OH 2DWEA 2V5MA 3QUKB 2JIXA 4P4RB 2UZXB 4MHHG 1QBBA 1BX2A 1YNTB 43C9A 4X5LA 4Q9RH 2CRIA 1GVIA 3ELAT 1NCNA 1T20A 2DM7A 1CGUA 3ARFD 3UDWA 4MNHA 4ZNEE 5MEPA 4D0DB 1ERNA 1U8JA 2PO6C 1AQKL 2DQCH 4Y5VA 5FOBB 4WFGD 1QPPA 1BIIA 5K9OA 2YA0A 4W4NA 4HUVA 4EI6B 4M02A 2BP3A 2I25N 3PNWA 3H9YA 3NFPA 5FUCC 4HIJB 3VXUD 1II4E 2D4DA 2HRLA 1AI1H 1U9KA 4L8DA 4WI8A 3FOMA 4W68A 5KG9A 2F74A 3SKNA 1BVKB 1SMOA 2XI9A 3WE6B 2Z35A 1FZOA 4NO5B 2VLLA 2MCG1 3T04D 2LABA 5ITBL 3LEVH 1MCHA 4L3CB 4HGKC 3WS6C 4BQBA 5I8CA 4F7TB 4CAGA 4NBXB 1T3FA 3UTOA 4MQXC 2P7TB 4KK8D 4OI8A 3VFNA 5F1NA 4DCQB 1J9CT 5E6ZA 4H5SB 1OGAD 4X6CA 5FA4A 1ZKAA 4HUXA 3PF2A 4I77L 2MHAA 5FYJU 4P3WA 3GJFB 4KUZH 4RBPK 2WQ8A 2PYFA 5EU5B 4PGEA 3Q1SL 4L9LB 3UBXI 1AD9A 5GGUA 1YMMA 5E2UH 3GJFH 3PWNB 2AJVL 3IFNH 2CDGB 2NR6D 4GW4A 3RL1A 3GSNA 4A2MA 2YRPA 4Z7VB 5IJKC 3TV3L 3KYKH 3AXLA 5I9QC 1FL5B 4EDXB 1U8HB 5DDHB 3IU4L 1UWGL 1QSFA 1JTTA 3TH3T 1VGEH 4RAUA 2H8PA 4E41A 2YXMA 3QNZB 4KJQC 4W6WB 5DEGA 5E5MA 3LEXB 4BA8A 1P6FA 1WFTA 1OD7A 3WNNA 1LO2L 3I6KA 1IGIL 1KB5H 3CFDA 3KPPB 4OM1L 2YS4A 3ES6B 3SCMC 3JWOL 3MCKB 3QAZB 1MIML 1RIUH 4G9FD 3CFCH 4CVZA 5DJ8B 1HHJA 2HTKC 3LB6C 4QRPE 4MMZC 5LBSH 1HXMA 3O6MH 3RQ3A 3UTSA 5HYSG 5K9KB 4LPUA 1AHWA 3V5DA 1UB6B 1Q9OA 4GQPH 3ILQC 3CCHA 2HTLD 4EZMA 1PD6A 3Q6FB 5ENWA 5CEZH 4IRSB 5BS0B 5E4IA 2BFVH 4DQOH 5IB1B 4RX4D 4LDEB 4YIQA 2VXSH 3OJVC 5INCA 3V0VA 1C5DB 3O3EB 4R4FH 1OT2A 3QJFB 2FSEB 3S34L 1G1YA 4HZLA 4HS3A 4F57H 3HB3C 2YSSA 5C2BH 4X80H 2I9LA 3HR5A 3HNTL 5GXBB 1DVFB 1B0RA 5KSBA 3B43A 4ZFOA 4KK9D 1DQJB 4LVEA 1U8MB 3S37H 1I7TB 5K9QG 4LIQE 2IH3A 3F12B 2C3WA 3WUZA 5IQ7H 3ABZA 2EYTA 3TN0A 2F53A 4JFOA 2P44B 1H15B 2X4QB 5L6YL 1UWXH 1WWBX 3MOBH 5ID0B 3B3IA 1ES0B 1L7IL 2HH0H 5ICYA 3TYGL 3O3BB 2CLRA 4JLRB 3LH2H 1NGXA 4OZIE 1CK0H 3A6BL 3RTQB 1F3JB 3FQRB 2P5WE 1FFPA 2Q1EA 1FSKC 1T80A 2VQTA 5INDA 1MCWM 1ACYL 1CG9B 1IGCH 3MJ6A 5I0ZA 1DDHA 1DE4B 1TVBB 4URTB 5I1IH 1RJYB 5SWSE 3CFKB 2E7BA 1A6WH 1VFAB 3L1OL 3W39B 3CPLA 2VAJA 2EDNA 1BFOA 2CXGA 4MQ7B 3R1GL 1RU9L 3QQ3A 3IS0X 5CLWA 4F7MA 2XWBA 3VMOA 2A77L 2A9ML 3MA7A 3GKWH 5JPMA 1CGSL 3PDOA 1OAZH 4OZHA 1GC1L 1HILB 2YRLA 3M8OH 3QZWB 4YFLI 5ICZA 1GGBH 4X98A 3CFIC 4LKCB 4AJ0A 3QDMA 4LLMA 3FAWA 5AEAA 4NUJA 3H42L 5DHYA 2FJHB 1T21A 1J88A 4AL8L 3VFOB 5IIEB 4MDJB 4L4TB 2UVFA 4LCWB 5C8JB 1PVHA 1RUKL 1SJHB 3DHJA 4J3SA 4WJ5B 4ACPA 5ESVB 5I1LB 2AI0L 4JY4A 2PYED 3C5ZA 4PGDB 4JFXB 5ILTH 1MJ7H 3HMWH 3BP4B 3KLHD 1NBYB 4K3DH 1OP5K 1W72B 3QG6A 1L7TH 4OFIA 3MRGB 4M48L 3Q3GB 4LGSB 3G5YA 2Q86B 1W72H 4N8VA 5D1XC 3FQWB 3VGFA 3VG9B 4JR9L 1DEEA 1C5BL 1A2YA 4P2RB 1HH9B 4IRSC 3HUJB 4NWTH 2EDXA 4UV7L 1OQXA 3W0WB 1FNAA 3P4LA 5IOPA 3RPIA 3SGKC 1R3LA 3DX8A 3MRKA 2OS7A 2NY1D 2XY1A 3U36A 1TZGL 4AIOA 3L6FA 4IIQB 3M17A 1DVFC 3FONB 1AO7D 1T1XA 1DR9A 4FQ2H 4ZMAT 3D85B 1D5ZB 1MHEA 3BEVB 1JK8A 5F3HB 1Z2KA 1JUFA 4KVNH 4GMTL 3GMRA 1YEIL 1N6UA 4NC0B 3IVKA 1UB5A 4Y4KD 5E9DA 2DQDL 5ALBH 3TCLB 3VDBA 4UT6H 4JO3H 1E4JA 4PGBA 3TVMC 5CJBA 5ANME 3QA3B 3WIHH 1KN2L 5IP4A 5GGVL 1WBXB 4KHXL 1MVUB 1TENA 2E6JA 2MOVA 2APVA 1R5WA 4U3XA 5FKAA 1SEQL 3RDTB 4PJIF 3LKQB 1P4BL 3UJIH 4E42B 4NQVA 5DJ6B 1FCGA 1DLHA 4RNRA 4KH2A 5IV2A 2H9GB 3MLXL 4GS7B 4MA7L 4ZAKA 5I19H 3NBNA 1U58A 2JJUA 2NY6D 2AW2A 4LQFL 2YWYA 3MLTA 3SJVB 2VZSA 1FORH 2C4FU 4Z7WE 4KRPB 2C5DC 5ISZA 2VR5A 1FYTE 3MV9D 4HULB 4G3YL 2D9CA 4DVBB 4U1MA 2YPLE 4GKZA 4PJ8B 3G6AA 2I9TB 5T33H 1YNLH 4LSTH 3T0VA 1JNHA 1KJ2H 2JJTA 4YHPA 5GGSB 3MTRA 3A6OA 1PYWB 2XTJE 1PLGL 5IF0A 3RVTC 1JPSL 1IC5H 4QOKE 2J8UA 3NFSL 3OKDA 1NBZB 1MJJB 2VIRA 5A40E 5CJ8A 5MEND 2FLBT 5AWNL 4JDVB 3ARDD 5F8RC 1AQKH 2YD3A 3EO9L 5DJAA 4Y4FC 4HLZH 5EUKB 3VG9C 1FJ1B 1INQA 5K9JL 1NC4B 3D69B 3DOSA 2EEBA 4Z0XA 3O6KL 3O45A 4WUUA 1F90L 3DMMD 4NYLA 3WNMA 2CRMA 3WJLA 3B9KB 2YN3A 1INEL 3ROOB 3LKRA 4QRSB 4P3CL 3QB7C 1G7JB 2D9QB 2A6JB 1FVEA 2X89A 4UNUA 2OK0L 5JR1L 1ZA3B 5ITBH 5TPWL 1HDMA 3TBTB 3SY0B 1IJ9A 5T1DL 3GB7A 3EDEA 2XRAL 5ACZA 3VXOB 2EDWA 3K46A 1AH1A 2LU4A 5D7LE 3EOAA 4I77H 2XYCA 4X7TA 1B3JA 2VZUA 3BGFC 3G6JE 5HDBE 3TO4D 1M1SA 5BVJB 3Q1SH 3KS0H 3UTQA 2AJUL 4HK3N 4GG6B 1J0YA 4PRPE 5DJYA 4Q97A 2AJVH 4I8DA 1AKJD 1SYVA 3TV3H 3DV4B 4MXQC 2VQ1A 5HYQA 3CIQA 1UWGH 5IQ9B 1BGXL 1PBYA 4Y1AA 4PY8I 3V6FA 1F2QA 2Z93A 1EO8L 1QD0A 3QDJB 1LO2H 5A2LH 1IGIH 1MIEL 1ZLUK 4FQIL 3PL6D 4OM1H 1A5FL 5I1DA 3WKNA 1K5NB 2BSED 3ARBA 3HG1B 3L3GA 3KPSE 3DRTA 1X6LA 2HFTA 2UWEE 3JWOH 3ZYIA 1MIMH 3ZKMC 4ZFZA 1FNEA 2YKLL 1JE6A 2AERT 1JRHI 3ARED 4PJ8C 3T8XA 1G0DA 4X6EB 4XBPB 1L0YA 1GGTA 5KN5A 1CDJA 4HG4J 4TUJA 3QEHA 5DVMA 5LG1A 4UT9L 1N8ZB 3UX9B 2ITCB 4DZBA 4HEPG 1IAII 4IOIA 1G7HB 4KDTA 5IMLB 4DW2L 1IAIM 4BSWA 4EUPG 3PHSA 3GIZL 4MZ3A 4I5BB 4OIBA 4WW2A 3S34H 1V3KA 1TJHL 4KRNA 5HI4D 3VWKB 3HNTH 3GSUA 4AYFA 4C4KT 4BSJA 4CU6A 1D6EA 3A67L 5MI0B 4TTGA 1CGTA 1KIPA 2EYRB 1CGWA 2CD0A 2YXFA 2IBBA 1OSZA 2WUCL 2X4PA 1P7KA 3OKKA 2XKNB 4F3FA 2GUOA 5DGRA 1QRND 3QPXL 4LPXA 2ENYA 3D18B 4EN3A 4LOUD 2WIIA 3IDMA 5L6YH 1XH3A 3L5XL 1RJLA 4OZIF 3T2NL 3ZTJH 1L7IH 3L9RA 3S35X 3TYGH 3HLAA 1RJZB 3SPVA 1BP3B 2W07A 1CLYL 2FEDC 4G7YL 1D5XB 3A6BH 3PHOA 4LBEB 2X4UA 4YZFF 4WFED 2BVQB 1ACYH 5LGJA 5FK9A 4ETQB 4K7PY 2PF6A 2AABL 5J1AA 4JM2A 4LASL 1NLDL 3OKLB 1GIGH 4WI4A 4Y4HD 4UU9B 2WV3A 3RVVD 3L1OH 4MA3A 5KS9A 5GISL 3REWA 4LSPH 5C07D 1RU9H 4C83B 5ADPL 4X9HA 1JFQL 5D7IE 3MZTA 3MJ7B 4X0KA 2A77H 2A9MH 3TC9A 5D6DC 2J5LC 3MRHA 1CGSH 1QFWI 1GC1H 3WNLA 1HE7A 2HJFB 1CXIA 5EZIL 2YZ8A 3ARGA 5I1CL 1G7QA 4LKXB 2FATL 4LIQL 3IETB 2YC1B 3H42H 1V7NH 4NO0D 3S37X 3MLPA 2O93L 4AL8H 3KLAA 4RBPH 3T0EE 4C55A 1JHTA 3CH8A 1EFQA 1U42A 2BVYA 4M7KL 3WFZA 5GGTH 2JKXA 1RUKH 4P4KB 4UBDC 2AXHA 5I18L 1J05A 2AI0H 3JWOC 1F2XK 4X5WA 2F54E 3IJYA 3B6SB 5IFHL 2F8XC 2LE9A 4N0UE 3BIKB 1EDQA 3ARZA 5D5ME 4PJXE 3UYRL 5I15L 4I0PA 1K2DB 5C0CB 5CBAA 1DFBL 5E94A 4UIKL 2JJWA 4M48H 1U8QB 2GI7A 1YJDL 3LPFA 4U6XA 4JRYD 4JR9H 2FYYA 1F11A 1C5BH 1OSPL 5BXFA 3O4LA 1B2WL 3ZTNL 2XKSA 3RX7A 1CFQA 3ZT6A 2XTLA 3V8OA 3O8XA 4RMVA 4IRJA 3CMOL 1FFRA 4UV7H 5IBLD 5FIEA 3QI9C 5HSFA 1AGDA 5JO5A 4BJLA 3RWJB 2VWEC 3PDGA 3VWKC 2BNQA 3K4ZA 5DFVD 5MI0C 5C09B 4ODXA 4UDUB 3UAJC 1PY9A 4OZGB 4QT5A 3QIUD 5TDPB 4GAYA 3FO0L 5GGQL 4XZUB 3VFTA 3ZYZA 5E00A 1H8NA 3L3KA 3QFJD 1FZJB 3CLFL 4DKFH 4GMTH 2JIXD 1YEIH 2NTFB 2DQDH 3CVIL 2M2DA 4HW6A 4HUWB 3GGWA 1JGEB 1RZKL 1GRWA 4PLJD 4PJFB 4BFIA 2I07B 4JHAL 1S7RB 3I50L 5H37H 5GGVH 4KHXH 3DVFA 2X70B 4E0RA 5D2LA 2OQJA 4FFYL 4L4VB 1IEAA 4NQDB 3U46A 3PGDB 1EGJL 1JMZA 5I71C 5C0FB 3T1FB 1GYAA 3VD9A 1P4BH 1DZBA 3KNBB 3C60B 2WUBL 3VFWB 4Y8AA 4K07A 3MRCA 4Z7WF 2W9EL 3DBXB 4MA7H 3ECBA 3X17A 4KROB 2NPLX 2OMNA 1RK0A 2PO6A 3IDNB 2ED9A 1GC1C 5IW6B 2IPTL 5DJCB 4EOWL 5ESQA 1AGCB 4G3YH 1FN4A 3BYYA 3F7RA 2YBRB 2CLZB 5E95B 5GSVA 4NO2A 4X6BB 1C12B 3SDAB 3ROLB 5F71A 5E6IC 3EFFB 3GMMB 3HAEA 3VDCA 5JHDA 1MAJA 1YMMD 1M6OA 2W0KA 4MB4A 1TXKA 3OB0K 1NC2B 3VGGA 4P4KC 2NX5B 3WS6A 5BZDB 1KUMA 1PLGH 2OYPA 1JPSH 4RFEB 5EU6A 2UZYB 3U6RB 3EJYC 4YBHA 3NFSH 1T1ZB 1JNNH 1PY4A 5TDOA 2EIEA 5MEQA 1QSFD 1LDPH 4E41D 4POZC 4OD2A 5KAQG 5AWNH 1YPZA 2JCCB 3EO9H 4GRLC 2I27N 4MB3A 1G7IB 4OGZA 5K9JH 5GJTL 2BNRD 3UTTA 1VADA 3MXWL 4LPWA 2VZ3A 2Y6SC 2OL3A 3RUGB 1PQZA 3O6KH 5E5RB 5DQ9A 1F90H 3BWAB 4GOSA 4IS6A 1M7DB 2K1MA 4JEGB 1OP5H 3SE3C 5EB9A 4DN4L 4PREA 3UTSD 1INEH 4MJIB 1OTTD 4OLZL 1DL7L 4P3CH 1IBGL 3U4AA 3VJ6A 2JF1A 4A6YA 3QUZC 4HGWB 2WBJB 5DS8B 5DUBA 2D4FA 1T04A 2OK0H 2XQYG 3MLRH 4OKDA 5TPWH 2Q7YB 4ZOEA 3SCMA 3FN3A 5T1DH 3BZEB 1T83C 2KBGA 3LHPL 5HHME 5HDBF 3G6JF 2XRAH 4W70A 4Y19A 3LY6A 4NO3B 3BD3A 3PE9A 4JFFE 2HVKA 3BP5A 1FG2B 3CUPA 3IFPA 5F72S 2PUQT 1A6PA 4JY5L 3NFNB 4JFYA 4NSKA 2Y36L 1MCNA 5CLTA 4ZPTA 1FGNL 4BKLA 32C2A 4JFZL 3TN0D 1EUUA 4JQVC 5DRXA 1R24B 4Y16B 4I2XB 3UYPA 4QF1A 3QUKA 3C60C 4XNUL 1BGXH 4HWZB 4XNYL 4PRIB 5BOZG 1AGBB 2DIAA 4K55A 4X4XB 3T0XA 3I6LE 1EO8H 3NACL 4D0DA 3CU7A 3PP4L 4KROC 5DC0A 4JPWL 5CBEA 3VXRA 1MIEH 5FOBA 4FQIH 2UWEF 4LNRB 4MNGB 5EIQA 3UBXG 4MLIA 1A5FH 2CK0L 4CGTA 1NBQA 3WFCL 3D1MC 3UTPE 1EAPB 4QHMB 1E6JH 2YKLH 4Q6IB 5E8PB 1EVTC 4QTHB 1G7LB 1LNUB 2DQHL 2FJGB 1Q9KB 2V2XA 5MHSE 4UIMA 4UT9H 3CVHL 4R0LC 1BVKA 1G9ML 4NKOB 1OP3K 4DW2H 3TBWB 2ESVA 4NO5A 4IOFD 4N8VG 5FYLD 3GIZH 5T3XE 4L3CA 3QDMD 4ODHL 1TJHH 2P7TA 5TE7L 4DCQA 4QNPE 5HGGS 3OJ2C 1Y6KR 4PRNA 3ME0A 4M9OA 4X9IA 5C0EB 3GJFA 5EU5A 4HPOL 2WUCH 2Y25A 4OD3H 2MQ0A 3PWNA 3W2DL 5DMKB 2QADB 3C5ZD 5JORB 3HZKB 3GKZA 3C8KB 4Z7VA 1QSZA 1H0DA 3AROA 3L5XH 4LEOA 4OBSA 1Q1JL 3T2NH 5EUOE 4EDXA 2NNAB 1TPXB 5CS7A 1U8HA 5FM8A 4FTVA 3UPAA 2IALB 3QNZA 1KB5A 2VTFA 1CLYH 5IROC 3G5ZB 5AZEL 1HNGA 1QVOB 3BGMB 2A0LC 3KPPA 3QQ4B 3KPLB 2AABH 4LASH 3LKSB 1NLDH 2BRRH 3LKNB 1XGUB 5DJ8A 5I1AB 5GISH 5IEKB 1BQHB 1MRFL 1YECL 2C4FT 5ADPH 2GQHA 2H1PL 2YUXA 5K9KA 1JFQH 3QQ9D 5D1XA 1UB6A 3RWEB 5HHOA 4AY0A 1HHHB 3Q6FA 1FNLA 4L5FL 1MCCA 4IRSA 2BOCB 2YEZA 5EZIH 2DQJL 5E7FA 5IB1A 4Y16C 5FO8A 5I1CH 5E9DD 1C5DA 5I1KL 3O3EA 2FATH 4LIQH 1RPQA 4IHOB 1AY1L 2Z91B 4CBPA 3SGKA 3FRPA 4XNZB 2EC8A 3F7YB 4GG8B 3MRRB 4TNVF 1DVFA 4HFWB 4NKDB 4WO4B 2J4WL 1X5KA 1U8MA 4M7KH 1I7TA 3RWFA 1U8IA 3F12A 4AQOA 4AH2B 3ULUL 5D5MF 4HIIA 4PJXF 5I18H 3MFGB 1XR9A 3QXUA 1RZGB 1TQBC 2V17L 5IFHH 5I76B 5CEXB 1H15A 3UYRH 5L2KE 1EVUA 5I15H 3KXFE 3RNKA 2ADGB 3CJJA 4XBEL 3TVMA 1ES0A 4ZAKD 4WEUD 4MLSA 4UIKH 3JUZA 1EJOL 1GZPB 5D70L 3VD7A 3O3BA 1YJDH 1UKQA 1SMAA 1OSPH 4JREC 1B2WH 4F7EA 1BFTA 4LARL 5LVEA 3RTQA 3FQRA 5ISZD 3DETD 4KU1A 3H6JA 1CTOA 5IK3B 5SWZA 3CMOH 4XX1G 1HQ4B 5HPMB 1DE4A 1JNJA 3QYCA 1RJYA 3CFKA 2NZ9C 1EEQA 1OF2A 3EDKA 1VFAA 5EULV 3RBGA 2DICA 4X9FA 4MQ7A 2IAMC 4ZS6D 2OX5A 4N90D 5F9OL 2R1WB 3FO0H 5GGQH 1NANI 2GJ6E 4PRHE 2BSSB 3CLFH 3BE1L 4RQQB 4HK3J 3KPRA 4FQHA 5AD0B 3QZWA 4F9LC 3CVIH 4LKCA 4MAYB 3PWLB 1RZKH 2EH8L 3IDGB 1KIUA 2FJHA 4JHAH 3V4UL 3QWOB 3OJDB 5IIEA 3UPCA 4MDJA 2W1NA 2ZJSH 3CX5J 4L4TA 1MHPL 1S7UB 3K4AA 1BJ1H 3U7AA 2H32H 1EO5A 2HLFD 5C8JA 2EEAA 4FFYH 1SJHA 5J0BA 4OZFB 3MUGB 1FFNB 4WJ5A 1EGJH 5ESVA 4WUUD 4D9RD 3TPUB 4FP8L 4Z7UE 4OZFH 4ELME 2NY2D 4FQQB 4P2QB 3OAZK 4GW5A 2W9EH 4LDOB 5EDXA 3BP4A 1K8IB 1NBYA 5CZXD 1W72A 4J1UB 2X89D 4Y4FA 3Q3GA 3QFDB 2ICWB 2Q86A 4M4PA 2IPTH 4EOWH 4HJGB 1PAMA 4P2RA 1NCWL 1HH9A 1NEZG 4P57B 2WIMA 5DR5L 3HUJA 4XPAL 4YHOL 1WWWX 3TIDB 3HZMA 3W0WA 4OIAA 4N5UA 1HWGB 4XNZC 2AXFB 4FQXC 2EDFA 1LWRA 4K94L 3O2DL 5ACLA 3LQZB 4D2NA 2W9LA 3LV3B 4XAWL 3V79C 4OUOA 4PJ7A 1NAMB 3D85A 3BEVA 4M7LT 3BIAX 5DA4A 5C08B 1DTUA 3X3FH 1J8HB 4YEEA 3TCLA 4Y1AD 4RDQG 5I6XC 3V52L 4S11A 1YJDC 3FT4B 3S3SA 3WIHA 1GGCL 3GO1L 1QACA 3NCMA 1YEHL 4J4PC 4WHCA 3QA3A 3V5KB 2R1XA 3GIVA 1KLGB 2P42B 4ONFL 3ARBD 5GJTH 5GS0D 3MXWH 4JM4L 4OCXL 4OF0A 5HDQL 1HKFA 5GS1C 3AGVA 1KTRL 4V1DE 1MCJA 4R8WL 4K9EL 3VA6A 5DJ6A 4DN4H 2H2SC 4DK3A 3C6SB 1DL7H 2H9GA 2X1WL 3JV4A 4RRPA 1IBGH 2Z31B 1TTUA 3SJVA 3MRMA 3MRPB 5A2IH 2NY4B 1SVZA 5LKNA 5CZKA 5J3HC 5MEOB 1UCBL 3LHPH 2CJUL 3RHWK 1RZKC 4PJ8A 4PJ9C 2FHCA 2I9TA 3F5WA 5C0GB 1CD9B 4XTRC 4JY5H 1KJ2A 3VXMA 3ARFB 4F33B 4JZOB 2Y36H 1FGNH 1A47A 4JFZH 4ZG1A 5GGSA 2N7BA 3TO2B 3RWIA 4EIGB 4DGVL 4EN3D 1PYWA 2G5BA 5T1KB 1ZVHA 4ALAL 4EQ3A 2HT3D 3H9SB 5EZJB 1VKXB 4KKCC 4HKBB 1F3RB 1TZIB 1NBZA 4M7LL 4XNYH 1L0QA 3CDCA 4X8JB 3FTGB 2EXYD 4AT6A 4OV6F 3TESA 3PP4H 1ZVSB 4JDVA 5DI8B 3VXTB 4JPWH 4B41A 2DI7A 4FG6C 1JV5B 2CK0H 5DRWB 5EUKA 4PB9L 1FJ1A 5BMFL 2VKXA 3D5OF 1UJTA 1NC4A 1Y18B 1ZSDA 2W38A 3MRBB 1SYSA 2YD5A 1EEUA 1F6FB 2FB4L 3VXSE 3CVHB 5DZLA 4G8FA 2EC9U 5C0BE 1OGAB 3CVHH 3QHFL 4QRSA 3IJSB 1G9MH 2XG4A 3C2AL 4NZJA 1F4XL 1BWMA 1UM4L 2JJVA 1ORSA 5D72L 3RIFF 1ZA3A 4HT1H 3ARGD 4QNPF 1FVCB 3TBTA 4ODHH 4QTIL 2IBGA 1KEGL 3JZ7A 4Q2ZB 5TE7H 1OTSD 4J3VA 3LCYA 1WQVT 5GSRB 3U2SB 4PB0L 3QRGL 5HHXL 1XZ0B 5DD3L 5BVJA 2GTZA 2V5YA 2FBOJ 5D6DA 3OB0H 4HPOH 4GG6A 4ODVL 3SDYL 1CD0A 3VGHA 2DLFL 3W2DH 5F7FA 5IHUH 5EUOF 1LEKA 4DOHE 4NJ9L 3N06B 5C0ND 3W5MA 3DV4A 1MUJB 1NGYB 1OAUL 1Q1JH 4I0PD 3ARRA 1U92B 4N0FB 1R6VA 5AUMB 1OOAA 2AEPL 2DI8A 4RMRA 3PHQB 4G43B 4FFVC 2BX5A 2KQNA 3O4LD 3QDJA 1JGDA 5AZEH 4EI5B 3FFCE 4OLVL 1M05B 1AE6L 3O8XD 4LK4A 5B39G 4IRJD 5IBUB 1AR1D 3E2HC 3ILPB 3FQUB 1YEGL 5I66A 3HG1A 1DN0A 4P3DB 2VXQL 4GKNB 5MP6L 1KCSL 1JMXA 1MNUL 2BNQD 1MRFH 1YECH 5C0IA 5T3XL 3V7AE 4UINL 1S9XB 4QLRA 1F02I 2ITCA 1VEMA 1G7HA 4HG4K 4L5FH 5LWYL 1T5XB 1WAAE 5F1OB 5JDJA 3IB4A 1H8OA 4P48A 2DQJH 4S0SD 1CVRA 3PWVB 5I1KH 4I5BA 4Y5XC 3QI9A 1AY1H 4MB5A 3L5HA 4CVXB 3INUL 1LEIB 2JE8A 3VWKA 4PJGB 1CWVA 3B83A 3BP7B 5BQ7A 3WFBL 2J4WH 2UVEA 2Y5TA 3SDXE 2EYRA 5EOTA 3E3QE 5E2TL 2CDFB 5B8CB 1EHNA 3EYOA 3EYUL 3WN5B 3WBDA 5L8JB 1QA9A 5L9DL 3HE6C 1LE9A 2V17H 3B2UC 4YJZL 1LVEA 3D18A 3CD4A 5EU4B 4L8CB 2HYMA 1ITBB 5HBBA 1EJOH 5D70H 2NLJA 2PO6D 1G9MC 4KY1L 3CLEL 5EWIL 4S10A 4EBQL 1RJZA 4KHTL 4LARH 5EO1B 1D5XA 1CFTB 1TVDA 3GRWL 2BVQA 2A83B 2OJZL 5B4MC 1A4JB 2BVEA 1HHKA 4BQ8A 4NQEA 3OKLA 3SBWC 4UU9A 4YDIL 3IF1B 3B8YA 3S8WA 3V6ZB 1CFNB 1N59B 3MYZA 5J12B 2ZG1A 4C83A 1RZ8B 1OP3H 5F9OH 3ZSSA 3CNKA 3IS1X 5D9SA 3HNVL 2YD2A 2X42A 3MJ7A 4N1CA 4KKLD 3BE1H 5FAAA 3RPKA 5EU6D 4L3EB 3QHTC 1HZHL 1YY8B 3OG4B 3QR2A 2AAVA 2HFFB 5DZOA 2EH8H 3IETA 2YC1A 3BSZL 5IB4B 3V4UH 1TDQA 4KK5D 4GO6B 4KQ3L 1ED3B 4PTUB 2O26U 1UA6L 2C7UA 1HQRA 5GRWA 3HR6A 4G8EB 3DIFB 1MHPH 2ZUXA 3UTTD 1DEDA 4Z7UF 4ELMF 4P4KA 2IADA 4EI5C 4LHQB 1FDLH 4TSAL 3N1QC 3VCLB 5BRZB 3SDDC 4WFGE 4U7SA 1A7NL 4FP8H 4HPYH 5EBMB 5F70A 3B6SA 4PJAB 3GSOA 4B50A 2X4NB 4KJQD 5C2UB 1MJ8L 3VXUE 2NQCA 5C0CA 4WTWA 3P4NB 3VFUB 4GRLA 4HV8B 4XH2A 1A7OL 2X4OB 4DN3H 1S5HB 4Y2DC 4F8TA 2GSIB 4J12A 4RFNC 1AO7B 3LS5L 1NCWH 2VERN 1HSAA 5DR5H 4ODWB 1J8KA 4YHOH 4WI9A 4Y19D 2HTKD 3LB6D 4UTBL 4YHYB 1I1AB 1P7QD 3SE3A 4PY7B 3RWJA 3SHSA 5F7UA 5E6YA 3ILQD 2DQEH 5JOFA 4JFQB 3QUZA 3J7HA 4K94H 3O2DH 4NQCE 5C09A 5IGXH 4UDUA 4AM0A 4OZGA 4XAWH 3BPLC 4Z76B 3T0DA 3FFDB 3RX8A 1IARB 1YMHB 1IQDA 5FCUL 1FZJA 3WN5C 4XBGB 4DWHA 1T83A 4XNMA 3U30C 3GNMH 3HB3D 2NTFA 4YPGB 4O2CA 4PUBH 3SO3B 1ZTXL 2OI9C 5IB5A 4HUWA 1JGEA 4M8VA 4PJFA 3V52H 4BELD 1K3ZA 1GGCH 1HSBB 1S7RA 1P1ZB 3DGGB 4MNQA 3RWHB 1T89C 1YEHH 5I73B 4QYOA 4XHJD 4M1CC 5FF6A 1AIFB 1QBAA 4ONFH 4JM4H 4OCXH 4JQVA 4OKVA 2VDRH 2Q3ZA 1JF5A 1J0KA 4LLYB 3VFPA 5D7JC 4L4VA 4NQDA 4XMKL 3PGDA 4F7CB 3CFBA 2PCPB 3VXPB 3KNBA 4K9EH 3C60A 4RMQA 1P5UA 3DUSB 3P77B 2E27L 1GHFL 5M95B 5J12C 1E0OB 4G9FE 4TRPL 3X12A 3IDNA 2ESVD 4R96B 3X13B 1QO3B 4GRWE 5DJCA 4GUPB 4EDWL 1UCBH 2CJUH 1AGCA 4YHNB 2YBRA 1YN7A 4YWGH 2EDHA 2CLZA 3D0LA 4X6BA 2XN9E 3BHBB 3QUML 3SDAA 3ROLA 4R0LA 3PUCA 3GMMA 5MENB 2JK5B 1BZ7B 1NC2A 4DGVH 3EOYG 5GRJL 3ARTA 1F45A 2NX5A 5BZDA 4BSVB 2YK1L 4ALAH 1FVDB 3DUUA 4XVUC 4M7LH 2H2PC 4FTVD 3UZQA 3PABB 3F65A 1MCLA 4XPGL 2J1KA 1KT2B 3Q2CA 5I1GL 1WSST 2JCCA 4HFUL 1EMTL 3O4OB 2BOBB 1WIUA 4LRIC 3O3DB 5TFSL 4HHAA 4AEFA 4PB9H 5BMFH 1W2KT 1ONQA 2X7LB 1A9EB 4G9DB 4UOJA 2KZWA 2ZCKL 3KPNB 4KRMB 4GJTB 3RA7H 2FB4H 1PZ5B 3BWAA 2E7HA 3OAZH 1EFXB 1C5CL 1M7DA 2C9AA 3F7VA 1GOFA 1IM9B 1I1AC 3N1FC 4I3RL 4K94C 4Z18A 5C92A 3QHFH 5D1XD 3ZDXE 3C2AH 4OAWB 5HHOD 1J10A 3OKNB 3TO4B 4HAGA 4HGWA 1F4XH 1G9NL 2WBJA 5DS8A 1HOCB 4IRSD 1UM4H 2QHLA 1VERA 1NUNB 2Q7YA 4QTIH 3WJJC 3WXVL 2EDQA 1KEGH 3WV0A 1AKJB 4NO3A 3SO3C 4R7DA 2NW2B 3TJEL 4YHLL 3QRGH 1DVFD 2COQA 5HHXH 1G7MB 4LEXL 5DD3H 2GFBB 2NY7L 2BVOB 4ODVH 1P2CB 2EE9A 5I73C 3SDYH 4HJJL 2DLFH 1NCBL 1I9IL 3QXAA 2R2BB 5A16B 4Y16A 4HJ0C 4NJ9H 4K9EC 2JTDA 4QXGL 2IFFL 2WWMC 1OAUH 1B88A 3WSQL 4NBZB 3TVMD 1N0XL 1F42A 1MCIA 2W60B 4S2SA 1GCFA 4N9OB 2PYEE 4HWZA 1I8MB 1MLCB 2BVPB 4PRIA 3NH7L 5D1QB 3F7QA 1WICA 3AREB 2AEPH 1EXUB 3B9AA 1AC6A 1S7TB 3RTQD 3T1WA 4NM4L 4MSWB 2R0WL 5F6HI 4OLVH 3DXAB 4LNRA 2CR3A 2EICA 4NN7B 1AE6H 2ARJB 5SWZD 1JYWA 3TJHC 3FQTA 4PLOB 1YEGH 1WZ1L 2CIKB 3DRQB 4F2MB 5MP6H 4QHMA 1KGCE 1KCSH 3GUTB 1QSEB 2R4SL 1MNUH 4XP6H 2WAHA 2PXYC 4U1KA 4HKZB 5KSAB 1LNUA 4YDJB 2FLRT 2MFNA 2FJGA 1Q9KA 1TCRB 1WAAF 4LAQL 5T3XH 3OKEB 1OLLA 4K7PX 2DRUA 3OAYK 5CCKL 3NCJL 5A43C 3F8UB 4HKJA 3E6HB 1ND0B 5LWYH 4NKOA 5EBGA 1VENA 3KPRD 3OKMA 1G7PB 4XXDA 1ZOXA 4JKMA 3LAFA 5FHAL 2PTTB 2VN4A 1C16B 3INUH 3BT2L 3SDXF 3WLWC 4CMHB 5ITFB 5CKAA 5CHNB 5FUOL 3WFBH 2IAMA 3BUTA 3BVNB 5EUOB 5FGCB 3VMPA 2G60L 3MOAL 4L4TD 4NZRL 5E2TH 2P8LB 3O4OC 3U7WL 4OI7A 4LCWD 4QWWC 3EYUH 5H94B 4UQ3A 5L9DH 3PIQB 3RVTD 2X2YA 4LLUA 5DMKA 5EO0A 1U3ZA 5IWLA 3N9GL 4XP1L 4F9LA 1YYML 4LCUB 1LMKA 5I17A 3G08A 2CH8A 5JORA 2FEEL 3C8KA 4RZCB 4HK0B 4WHYG 5A2JH 2NNAA 1CICC 1MQKL 4KY1H 3CLEH 5EWIH 4Y4FD 1JPFA 2VAAB 3KYNB 2IALA 4EBQH 5J7CC 4KHTH 1NL0L 4UAOB 1KCRH 1I1RA 1IEBB 4J23A 3BXNB 3AM8C 2RFXB 4P2RD 1VFUA 3G5ZA 1QVOA 4M5YL 1EPFA 3BGMA 3GRWH 2OJZH 2VE6A 3QQ4A 1SEBB 3UXFA 3LKSA 3W0WD 2HKFL 4YDIH 1G6RH 2R2HB 3MV9E 1XGUA 1X4XA 3KG5A 1BQHA 1A7PL 3KYMA 4MD4B 1KN4L 2QQKL 5D7KD 1RZFL 4RRPG 4J3XA 1KPUB 3RWEA 3VD4A 5CD3B 1ZT7B 3D85D 1SM3L 4KK6C 1J1PL 1IC4L 3MGOB 2BOCA 1DQML 5T1LA 4L3AA 4KZEL 2UUDK 3MRDB 3L5WA 4LPCA 5CGYC 5GQBA 1SJEB 2XA8H 3LMJL 1X4ZA 4IHOA 3BSZH 3X11A 4GG8A 2FZ3B 3F7YA 2IGFH 4KQ3H 2N7AA 2ARJQ 4O2FB 4N5ED 1UA6H 1JWUB 2AGJL 4NKDA 4YGVB 4NFDA 4ZFFB 4WO4A 2VZOA 5IM7B 3OGOE 3WYRA 3N0PB 3DI3B 3EYVB 5TH2B 4LGPB 1ZV5A 5HHQB 1KB9J 4NN7C 1SJXA 1GZQB 2NY0C 1RZGA 1A7NH 4MXQD 5BJTB 3MGAA 5I76A 5CEXA 1FZKB 4CJ1A 4PP1C 2X4RB 1DUZB 4NOFA 2ADGA 1MJ8H 4JPVL 4OD1L 5KSAC 4IRZL 3NAAL 4U1GB 4G8GB 3SJVD 1A7OH 2CLVB 4J4PA 4NCC2 3V6OE 4U1IB 1IGYB 3LS5H 4KRPD 1CDIA 5DJZA 2AV7A 2VDQL 3DROB 1I1YB 5GS1A 3ZKMD 1BOYA 5IK3A 4X6FA 4AEHL 1Q9LB 1HQ4A 4I18B 4MQTB 3BMWA 5HPMA 4UTBH 2EC9T 2DWEB 3IDXL 3RY5A 4PJ8D 1ZHBA 43C9B 1BX2B 4HUNB 4W4OC 4N68A 2NXZB 1DQQA 3SOBL 4PJCB 4ZO8A 3VXMD 4EIZC 2D31B 5MEPB 2HRPL 3Q5YA 3VD5A 2R1WA 4Y5VB 2HWZL 5K9OB 5FCUH 3OQ3B 3K1KC 3N85L 3PNWB 4PJEE 3NFPB 3I2CL 1ZTXH 4KZDL 2DOCA 1F4HA 4WTXA 1ZT1A 2ED8A 3IDGA 2HT2C 3C08L 4M4RA 2FX9L 3FOMB 4PJDE 2GW5A 3OJDA 5L2JB 2F74B 2H32A 4L4JA 3LD8C 1QKZH 1XCTB 2FECL 3SKNB 4JPKL 2FGZA 2XZCL 2ZUYA 4XWGL 1EGJA 4HDIB 1NC4D 1J1OH 5KOMC 3CX5K 4AEIL 2VLLB 4N0RA 4OZFA 3MUGA 1FFNA 3MLZL 4JKLA 3EOBA 4LRNL 5I8CB 2EE6A 3JV5A 2DJSA 3TPUA 4P9HL 4P2QA 2E27H 1GHFH 1K8IA 4GRWF 5FA4B 2FEDD 4TRPH 4HUXB 3QO1B 2MHAB 1T2QL 4PGEB 3BISA 3QFDA 4R3SB 2ICWA 5IW1A 1AD9B 1MF2L 5FM4A 4BM7A 2KH2B 5GGUB 1FRGL 3P9LA 1RMFL 4EDWH 2AXGA 7CGTA 1A14L 1OWWA 3UYOD 3WEXB 1HK6A 4KPHL 4WI3A 2L7JA 3RBSA 2L7UA 4GW4B 2HAZA 3TIDA 3RL1B 5C6WH 5F9AC 2VLKB 3AXLB 3QUMB 5GS2D 4PBWD 1JHKL 4GXUM 5B3NA 1QSFB 4RAUB 4E41B 1RIHL 1HEZA 3LQZA 5CJOL 3LV3A 4UZGA 4DTGL 4QRTA 1R3KA 5GRJH 3CFDB 5ANMA 4WWID 1I8LC 4H0HB 4MVBC 3HA0A 5IBTL 2YK1H 1PJ9A 4OFYA 5D2NB 1A6AA 5I2IB 5HVHB 4OT1L 4CVZB 1QRNE 3MNVA 4XPGH 1HXMB 3FT4A 5I1GH 4HFUH 1H3TA 3VFGL 5BCAA 1EMTH 1AHWB 3QDJD 1UZ6E 4U1GC 4WI5A 1U8LA 3V5DB 3V5KA 1GXEA 4UBDD 3CCHB 5TFSH 2GITA 4KKAC 1KLGA 3HN3A 2H3NB 2ZCKH 3HG1D 1WFUA 4JN1L 1X5GA 1P4IL 4WFHD 8CGTA 4LP5A 3TH4T 1UQSB 4C56B 4I18C 4WFEE 3D0VB 4POYA 4HD9A 5JPNA 4I3RH 2DLEA 3L3IB 1QLFB 3C6SA 2Y06L 2BXYA 2NXZC 1U41A 3DNKA 1B0RB 2LU7A 4M7JH 1G9NH 4UNVA 2GK0A 5IVOA 5ALCH 3MRPA 4WEBL 2IH3B 2R69L 5C07E 3EYSL 5BOPA 3ORJA 3T2QA 2YD9A 3WXVH 5MEOA 2P43B 2F53B 1ITCA 1P84J 5F1SA 3VWKD 1UM6L 4Z7QE 3IDIB 3TJEH 4YHLH 5M94B 3ZKXB 5FGSA 3ARVA 4MX7B 4M00A 4LEXH 3UAJD 1WIOA 2NY7H 5ICYB 2FWOB 2CLRB 2ZG2A 3NZ8A 3CXDL 4HJJH 1NCBH 2BERA 3JV6B 1FFPB 5B3JE 3TO2A 1JYXA 2ERJB 2V9TA 2Z8WC 3UROR 4Y5XA 4QXGH 5T1KA 1I7ZB 4YEFA 1DDHB 4Q6YA 3WSQH 5DJXB 3H9SA 1JN6B 1N0XH 4XAKD 4HKBA 1NMCC 1TZIA 4JQIL 1EIBA 2OZ4L 3NH7H 5C0RL 4X8JA 5TQ2L 3FTGA 3QIWB 1BFOB 1ZVSA 3VXTA 4NM4H 3MREA 2R0WH 5EU3A 3VGEA 5HI5D 1JV5A 4LVNB 5DRWA 1KIRA 1WZ1H 2R0LH 5C0JB 4JRYE 4OZHB 2E7CA 1F4YL 4LVOB 2GYSA 1LO5B 2BCKB 4NQED 5K33A 2R4SH 5C3TA 4NZUL 1Y6NR 4JO2L 3RWGA 3BPOB 3KYOB 3CVHA 4LAQH 2NY5H 4KI5E 5CCKH 3NCJH 3WUWB 4WI2A 3H8NA 1NLBL 4N1HB 3IJSA 2FD6L 3VI4F 2EO9A 5DVLA 3TZVC 1FCCA 2AJZA 1NMBL 1RFDL 2I26N 2V2TA 2Y07L 4TTDC 3K8LA 4LLAA 3TBVA 2EDTA 5FHAH 2BSTB 2ZNWA 3SBWA 2V9RA 5D2NC 3BT2H 3GHBL 3QFJE 4Q2ZA 5HVHC 4XC1L 1X7QB 1KYOJ 5GSRA 5FUOH 3U2SA 4FS0A 2OTUA 3K2UL 3L3DB 2G60H 2G75B 3MOAH 4NZRH 3IU3A 4NJAH 3U7WH 1S9VA 1OL0A 4P4KD 1X5ZA 3DO7B 1WVZA 1DEEB 3BYTA 3EJYD 3N9GH 4XP1H 5JIHA 4NRZB 1NGYA 4POZD 1FC2D 3LRGA 2Q6WB 3KPSA 5CSZB 3RPIB 5C0CD 2MWCA 3DX8B 2UWEA 1MQKH 4GRLD 2X10A 4TVPL 1G9NC 1NL0H 3MOQA 1QSVA 3PHQA 2B4CL 2G2RA 4LVHC 4NDMA 4M5YH 2Y6SD 5CMAB 4EI5A 1WCQA 1M05A 3MLVL 1I3UA 1JK8B 3SDDA 3ILPA 4OCWL 1T0NB 4MA1B 2HKFH 2PTVA 3F6LA 4J2XA 3IVKB 1A7QL 5JIIA 1ZA6A 5I8OL 3GMLB 4LLVA 1A7PH 1DP0A 1KN4H 3QUZD 2EH7L 2QQKH 5C09D 1RZFH 4Y2DA 4KDVA 1S9XA 2XNAB 2ZUVA 4X6CE 5I74B 4MZ2A 1RUAH 1SM3H 3PXJA 1J1PH 1IC4H 1T5XA 1T2JA 4NKQB 4FFWC 2J88L 4NKMA 1DQMH 5LCVL 4PY8J 1YMME 1R5WB 3ZDZF 3PWVA 5FKAB 4HC1L 3LMJH 2BNUA 3KDMA 4X5XA 1UH2A 4CVXA 2GY5A 1IAOB 1LEIA 3VG0H 2GAZB 5IV2B 5FYKE 4R6UA 4PJGA 4MNQD 2AGJH 4X7CC 3BP7A 5AZ2L 3BQUC 3MLTB 4ISVA 3TBSB 1OD9A 2MJWA 5B8CA 2CDFA 4L4VD 3WN5A 4NQDD 3MJ9L 3PV6B 1S9WA 4H8WL 2QBWA 3C60D 2LAGB 2BNRE 5EU4A 4L8CA 4ODSL 1K6QL 1UYWL 2NY5C 4GKZB 2ZUQC 4JPVH 4OD1H 3G6AB 4IRZH 3NAAH 4ONOA 1SHMA 4KROD 1T89A 2AJ3A 1MQ8A 4YXKL 3UTSE 5EO1A 4U31A 1JNHB 1CFTA 2VDQH 5D7JA 4XCYB 5HI3C 4XI5D 4S1SH 5HYIA 1A4JA 5CFHA 4DUWA 3BKYL 5IF0B 3IDXH 5IMKA 2A6IB 4WWKB 4Y7MA 3IF1A 4FQCH 2AXJA 3V6ZA 1CFNA 2PW2A 3SOBH 1ZVYA 3OAYH 3SDAD 1N59A 4CU7A 3O2VL 4CW1A 1NFDE 1RZ8A 2IQ9L 3LS4L 4PJEF 2HRPH 3VDAA 5DJAB 2HWZH 5KSBE 5LQBL 2CUMA 1NC2D 3EUUA 4S1DD 1WITA 3N85H 2NX5D 1T1WA 1QBML 1INQB 3L3HA 1VESA 5DFWH 5GPRA 4Q7DA 4A2LA 1FE8L 4JN2A 1R5VA 4L3EA 5CWSB 4PJDF 4KZDH 1FP5A 4JFDB 4LSRL 4LMQI 4BFBD 2HFFA 3C08H 5TGBB 2FX9H 4P2OB 3AB0B 3QNYA 4JZJB 1KF9B 5IB4A 5BV7B 3THML 1ED3A 4PTUA 3MGTB 2ICCA 3LKRB 5A3ID 4JPKH 1E4XL 1CD1B 2XZCH 4XWGH 2DD8L 4JCLA 2VZVA 2PETA 4XMLL 4AEIH 1MELA 1UXWA 5ADOL 4JE4B 3MLZH 1EZVY 1CIDA 4LRNH 3VCLA 1HDMB 2EDKA 3HI5L 4NNXB 3KHOA 4U2YA 3GB7B 4P9HH 4ZO6A 1KBGL 5IT2L 1WBZB 3P4NA 5DGQA 2HFEA 2WBJD 1G0XA 3S7GA 4LRIA 1T2QH 2X4OA 2A0LD 1S5HA 4TSBL 1C08A 1MF2H 1FRGH 2GSIA 5DJYB 1RMFH 1A14H 3MV11 4HXBL 2K9UA 1J0IA 2DLTA 5HTSA 4WDIB 4L8BA 1T0MA 5FYLE 1I1AA 5EOCJ 3O6LL 3QDME 1CGXA 3GMQB 3O2DA 1JHKH 3OR7B 1UWXK 2GJJA 3MFFB 4Y1AB 1RIHH 4OCSL 5CZVL 4ENEC 4JFQA 2Z93B 5CJOH 3CXHK 5GRXG 3FFDA 4DTGH 3R8QA 2DQCL 4Y16D 2UUDH 2BY1A 5IBTH 1VDGA 3AUVA 3EJZC 3L3GB 5DEFA 2B5IC 4LPVA 4OT1H 4GKOA 4ZFZB 2KQMA 1UZ6F 3PGFH 1FNEB 1JPTL 2R56H 2Q76B 4PRID 5C70A 3ULVF 3VFGH 5KN5B 4G6KL 2G5RA 2Q8BL 4P46C 3D39E 3DGGA 1KPVB 3RWHA 5DJDB 4DZBB 4IOIB 4O51A 4I13B 3O9WC 4LLYA 4JN1H 1F13A 1P4IH 4JPIB 1BQUA 5T1MB 2R15A 3SDCB 3SKJL 3VXPA 4ZOCA 4BQ6A 4O00A 4WWKC 2WSKA 2Y06H 3CX2A 4GRWH 3DUSA 3P77A 1DBML 4FXKB 4F9PC 1T6VN 4TYUA 2P46B 1T66C 1PKQE 4OBRA 2DIJA 2XN9B 3V4PL 1LP9B 4WEBH 2R69H 4Z78B 1KC5H 3EYSH 4R96A 3C2SA 3X13A 5E24E 4NPYB 1QO3A 4GUPA 1I1FB 4Z7QF 1I9JL 4CNIA 5KZCD 3KPTA 4F3FB 1F97A 1DBAL 2DYPA 4EN3B 2PXYA 1UM6H 1H8SA 2XOTA 1XH3B 1Z0NA 3FN0L 3FRUA 1RJLB 2IAMD 5E9DE 4P2OC 4JZJC 4MDIB 5B3JF 4XNQA 3HLAB 1NUDA 1BQHG 2VLME 1CLCA 3CXDH 3A6CL 3SPVB 3BDXA 4M5ZL 5E7BA 3OTTA 4YQXH 2X4UB 3CDFA 3S35L 5F7DB 1BZ7A 5FM5O 4ONGL 3U0PA 5FK9B 1EHXA 1J0JA 4P9HC 5EC2B 1FVDA 4CKVX 4JM2B 2ILLA 3ULVL 4JQIH 1X5YA 4P5MA 2OZ4H 3AMLA 5C0RH 5TQ2H 2Y23A 2V5TA 3BWUC 1BF2A 3REWB 1KT2A 1GGIL 2B20A 2D7OA 2BOBA 4U6YB 3W11C 4PPTA 3MRHB 2X7LA 5GZOD 2EDJA 4G9DA 1F4YH 4KI5F 3MA9H 4NZUH 5CEYB 5ISZE 5C0DB 1PZ5A 1CZ8L 1EFXA 5SV4A 3VFRB 4JO2H 3ZE2E 2M8XA 1IM9A 3ZSTA 4F57L 1CICA 4NZDA 2BK8A 5C2BL 3GI8L 3MLYL 2GJZA 4LF3B 3P4OA 1NLBH 2D7PA 4JFFA 5F7EL 5HYEA 2FD6H 1AXIB 4OAWA 3AM8A 3PQYE 1NMBH 2NR6C 1HOCA 2IMNA 1S7VA 1RFDH 4F7PB 2Y07H 5T1LD 4ZSOE 4GLRH 4N90E 2N4IA 1NMAL 3GHBH 3IJYB 4XC1H 5DVNA 2NW2A 4ZQKB 2D7MA 2J8UE 1OVZA 3K2UH 1N2RA 4WO4D 1LILA 1I8KB 3GSRB 3SGEH 4Y88A 4U6XB 5LAXA 1P2CA 2ATKB 4X9GA 1F11B 4KRLB 2A9NL 3T77B 2MPAL 4XX1E 5GIRB 4HWBL 1IGTA 4LPTA 3SDCC 4B0MM 4KWUA 5L88L 1AGDB 1WFNA 4WUUE 5JO5B 2W60A 4D9RE 1EERB 4NNYA 1A6WL 4KXZH 4TVPH 4U1NA 1MLCA 1I8MA 4J4PD 5D1QA 1EX0A 3F6IA 1EXUA 4G6FB 1YY9C 1JBJA 4M1DH 1UADC 4QT5B 4MSWA 3DXAA 3MLVH 1A9BB 2VLRB 5E00B 4MD5B 4PJHE 3L3KB 4OCWH 1HCFX 5E0QA 3HPLA 2CIKA 1UFUA 2RJMA 3DRQA 4F2MA 2H2SD 1A7QH 3G6DH 4OZFG 3GUTA 1QSEA 4KGLA 1MFNA 5I8OH 4X6CF 5FOJA 2A6DA 4HKZA 3GGWB 1H5BB 5KSAA 4I0KA 1NUFA 4NRYB 2EH7H 4BFIB 1TCRA 2VDNL 2EDDA 3OKEA 1B6UA 1ADQL 2EZ0C 2IBZY 4WI6A 5J3HD 2J88H 5LCVH 1BEYL 5CD5C 5JOEA 2RBLA 1G7PA 4G6MH 4LHUA 1XFPA 4HC1H 3U46B 4UQ2B 4BH7B 4NHUB 2PTTA 2CXKA 1DN2A 1NFIB 4W4OA 3VXQA 2ARWA 4XTRD 5L8LB 5ITFA 3MRCB 2XQYK 3ECBB 5EUOA 1IRAY 2D7QA 1SJVA 3I02A 3PIQA 4H8WH 1DSFL 1CE1L 1J12A 5IVNA 3DV6A 5ESQB 3C5JA 4KKCD 1A7BA 4LCUA 5HGHA 4P2QD 1K6QH 1UYWH 1IEHA 4JVPA 1ZGLP 3I3BA 2VR4A 5GSVB 1F4WL 1YN6B 4NO2B 1OGTB 4ZFGL 4ZUSA 3KYNA 2VAAA 2CIIA 4YXKH 3HAEB 1IEBA 1WGOA 4LLWA 3GRWA 5JHDB 1M6OB 2JLLA 2RFXA 4PYHA 1BWWA 4ELKB 1MRDL 3UJTH 1V05A 2BHZA 3EW3B 3BKYH 3C6LB 4CADA 5KAQF 3RZWA 2ZSWB 1NFDF 5IVXF 1MAKA 5KVGH 5MEQB 5IUSA 4IMKC 3O2VH 2XQBL 4OD2B 1CXHA 4MD4A 2IQ9H 2FHBA 3LS4H 1EEYA 4JHWH 3VXNB 5KANI 5EZLB 5LQBH 4XPTL 4XMPL 4YBQC 1QBMH 4ZUVA 4M43L 3V5HB 5FYKL 4OFYD 5C08D 1FE8H 2OL3B 3D3VB 1PQZB 5CUSL 4LSRH 3BN3B 5DQ9B 3MRDA 2ADFL 1J8HD 1SJEA 4LCYA 4NN5C 1QUNA 2HJLB 2QV2A 3KVQA 3RAJL 5GRVL 2R8SL 3QEGL 5SV3A 3THMH 2E5EA 5IVZB 3KXFA 2H41A 4YGVA 4WVRA 1E4XH 1R3JA 4ZFFA 4XC3L 5IM7A 2DD8H 4XMLH 1I8LA 5JW4Q 3QEQB 5ADOH 1WV7T 3HI5H 4WENB 1GZQA 3SCMB 3DYPA 1E4KC 1MJUL 4BK4A 1LO3L 5KSUB 1KBGH 3TGXA 1KB9K 5IT2H 3MV7B 1FZKA 2ZUTA 2XZZA 2X4RA 1DUZA 1UXSA 3HMXL 1XR8A 2Z31D 1H5BC 4FFVD 2EIZB 5T33L 3IFPB 4G8GA 1JF6A 5KS9E 3F62A 4TSBH 4LSTL 4OM0L 1IL1B 3HC3L 4U1IA 3CC5B 4NSKB 4DJMA 2X1PA 4ZPTB 1R0AL 4Y4KC 4EKXA 4KJWC 32C2B 3GJEB 1I1YA 2AJXL 4HXBH 4LSDA 2IPKA 2GJ6A 1Q9LA 4I18A 4PRHA 3DSNA 2C1PB 4CMMB 4QF1B 4MXVE 1U0QA 1IC5L 1HH6A 3O6LH 1PX4A 4P5TC 1KCVL 4Q58C 4W6XB 2AK4E 2APXA 1ZGLB 4OCSH 4PJCA 1TNMA 5CZVH 2D31A 4BK5A 2J6EH 2UV3A 2CO7B 3VXRB 4D0CB 5CBEB 3VFVB 1FL3B 4FXLA 4L8SB 4H8WC 3NCEB 4TPRL 1J86A 1D9KB 5T1KD 4RISL 3RZCC 2QKIA 3H9SD 4OFPA 1KIQB 1X9QA 1JPTH 4OCYL 3K80A 4WV1C 2O5YL 5F9DC 4J3OC 2LU3A 3J8F7 3DGCR 4Z7UA 4ELMA 2V2XB 4G6KH 2Q8BH 4X7EC 3CFEB 4UIMB 5DQJA 5L2JA 1XCTA 2OR8A 4U0RB 1H3PL 4ODTL 1UENA 1FSKB 4IMLB 4HDIA 4RGMC 2ESVB 1RUPL 3O4LE 3SKJH 4QO1A 3C6LC 3HFML 1C8PA 4KMLB 4X6DE 2IANE 4E9LA 2VYRE 2QSCL 4M61B 1DBMH 1E4WL 1N5AB 4G42B 4PRNB 3QO1A 3QH3A 3V4PH 1B0GA 2BNQE 4R3SA 5B4MD 3QPQC 3LRSB 2EE2A 1U2HA 5KBNC 1I9JH 1M7XA 1YEDA 2EDBA 1DBAH 4XP4L 3WEXA 2ZUUA 2P47B 4H0GA 3K8MA 1D5BA 5IBUG 3OBAA 1H0DB 2YA1A 3FN0H 3HS0B 2VLKA 3QUMA 4LEOB 5DUPL 5I1JL 4FTVB 1JTOA 3A6CH 3TZVA 1KB5B 4M5ZH 3NZHL 1I9EA 4QRQB 3T65A 3S35H 4G7VL 3QHZL 3UTZA 4ONGH 1T7ZA 4OF6A 4PV9B 2MNUA 4CU8A 2FEEI 1XIWC 5D2NA 5D2LE 4D94A 5I2IA 3ULVH 1K8DB 4V1DA 4WFFD 1J87A 5D6CB 4EUPH 1ZLWH 1CXLA 5F3BA 3GSVA 5E8EB 4OUUB 3VGBA 1GGIH 4G80B 4GAGL 1XF2B 4PP2B 1UZ8B 5D1XB 4EI5D 5HHOB 4FMKA 2H3NA 3ZE2F 3T3ME 4NFCA 1IFHL 2YEZB 1A6TB 3L3JB 5FO8B 1UQSA 4C56A 4WY7L 1CZ8H 3D0VA 3U0TA 4JCMA 4MGXA 1KG0B 2DKUA 3L3IA 5C0AB 1QLFA 3GI8H 3MLYH 4OFDA 4Y2DD 5F7EH 5GGRB 3EIFA 5I75C 3RWFB 1U8IB 4RMUA 4YFLF 4MYWB 4HIIB 4L8SC 5EO9B 1FYHB 1XR9B 1D9KC 1NMAH 2J8UF 4PJ5B 2VL5A 3SN6N 4GBXB 2YD8A 3EFDL 5EU6E 3IDIA 3FHQA 3RNKB 1Z9MA 5D71L 3QIBB 4MX7A 1RD6A 3TVMB 2BXZA 1P84K 3ULUD 3PL6C 2X44D 2FWOA 1L9MA 1BZQK 1NAKL 4HS8L 1YPZE 2A9NH 4AIZA 4F7EB 2QR0A 2MPAH 1JHLL 1BLNB 1WISA 3JV6A 4U0RC 4HIXL 2FX7L 4HWBH 5SWZB 2UY6A 3UTTE 1I7ZA 3OAUL 5CP3H 5DJXA 1JN6A 1X5XA 5L88H 1GIGL 1OF2B 2RGSA 2VXUL 3JBG7 2CUHA 2J7LA 4M1CD 3R06B 1VACA 4PJHF 3QIWA 3VXSA 4LSPL 4XPHL 1HWHB 3HZVB 1A1OA 2V7HB 2XZAH 5D7JD 5C0BA 2E6PA 1ZHLB 4NP4L 3QQNA 5HI4C 3UO1L 5C0JA 5LGKA 3P73B 3KPRB 4FQHB 1LO5A 2BCKA 2ZOKB 5FGBC 5IG7A 2NY3B 2ZZUT 4RGNE 1X5JA 2APFA 4M9PA 3L95B 1XF5B 1XGTA 3DVNB 1KENL 1V7NL 3KYOA 3TLRA 3GK8L 4Y19E 4M7ZB 3V0AC 2VDNH 3EYQC 1ADQH 1AP2B 5E56A 1JTPA 3WUWA 1ZHKB 3EAKA 3SQBA 3C09B 3STZA 3MV8B 1BEYH 5DWUL 5GGTL 4QKXB 4L3ED 2APBA 4XXCC 4LHJB 4NOBA 4N9GB 3ULVC 2BSTA 3S4SB 5JA8B 4OJFL 2YD1A 1CIUA 1IGML 1X7QA 2OLDA 2VLJB 4XCCL 4GW5B 2VJXA 4LLDB 1KJMB 4O02L 3L3DA 2G75A 4RGOH 1KYOK 3MUY1 5C6TL 4Y4FB 2A38A 3DO7A 5EPMA 2V7NB 2ZPKL 3SE4C 1A6VL 5BRZD 1DSFH 5CP7A 1CE1H 1MFEL 2BZDA 1MCBA 4XVUD 1P69B 3FFCA 4NRZA 5F21B 1XF3B 3CZFA 3HZMB 2Q6WA 2Z8SA 1F4WH 5CSZA 3IKCA 3NTCL 5FXCH 4ZFGH 1A0QL 1UM5H 2WINA 3EO1B 2UY7A 2DQFA 3U0WL 1JPST 1QLRA 2EO1A 3WLBA 1MRDH 4PJ7B 5CMAA 1EAJA 2JJSC 4PR5B 4RDQF 4R26L 2VOTA 1T0NA 4V2CB 4DKFL 5JQ6L 1I1AD 3ARSA 1A7RL 4GBXC 5AYUL 1RVFL 1N3NB 3P0GB 3GMLA 2XQBH 3QIBC 3SKOA 3BGFB 2PNDA 2Y1VA 5FO7B 3GZKA 2XNAA 3NABL 4XPTH 2R9HC 4XMPH 1TIUA 2R1XB 3BRDA 3QDGE 4M43H 3ZYOA 3GIVB 3OKYA 5FYKH 4JKPL 1RULH 4DZ8B 4X7FC 3BN9C 5CUSH 4PJBF 2A2QT 2ORBL 2ADFH 3UPRB 2OSLB 1FIGL 3RAJH 2R8SH 3QEGH 1IAOA 4Z7VE 2GAZA 2ZSVA 3JV4B 5L0QB 3S98A 5J11B 3NGBC 2BSRA 3OGCA 4XC3H 4R2GB 4AK1A 3M07A 1VB9A 3TBSA 3MRMB 4KI5C 4HJ0D 5DD0L 2EIBA 1C7SA 1CT8A 2WWMD 3DX9B 3PV6A 3QCUH 5TE4L 1MJUH 2A73B 1LO3H 1OQOA 1S78C 1U91B 5KS9F 2NY3C 2Q8AL 3HMXH 5ACMA 5F7YC 1CGVA 3S88L 1NGPL 3UEZA 3V95A 1XGPB 4P46A 3F5WB 4M7ZC 4GXUN 4AENA 1KJ2B 1ORQB 4OM0H 3VXMB 2DMCA 3HC3H 3TJHD 1NBVL 5E2JA 1R0AH 3O9WA 4MXVF 3C09C 4P0DA 3BPCB 1FO0L 2AJXH 5IVXB 4FZ8H 1KCUL 3CMGA 4HCRL 1C7TA 3RWIB 4XCYA 5CGMA 4PLJC 2DYPD 2G5BB 5BS0E 5GRZA 1CLOL 2A6IA 2F58H 2XACC 2YMXL 4WWKA 4TSCL 3T08A 2PR4L 2XPGA 1KCVH 4D8PB 4F9PA 3QNXB 1JNNL 1RQ5A 1LDPL 2XICA 1HI6A 4AT6B 2Q87A 1U93B 5JIPA 1ZS8B 1PEWA 4TPRH 3QSKB 1KTLB 4RISH 2IF7A 2ATPA 1ZSDB 5MERB 5CWSA 4O4YL 1SYSB 4OGAC 1IE5A 4JFDA 3WDIA 4OCYH 4TUOA 5E1AA 3U4EA 1DLFL 2O5YH 1RIVL 4ZNCD 4K3GA 5TGBA 2HMID 4P2OA 4JZJA 1I7UA 4G8FB 2NYYC 1ZE3C 3MGTA 4KJYA 4QWWD 5JW3H 4JRXB 1FV1B 1MY7A 1CD1A 5CAYB 1GJIA 1H3PH 4ODTH 5T3ZL 1CDBA 4X6DF 1PDKA 1RUPH 4QRRB 5JW5B 4JKWA 4GW1B 4HZAA 4DUVA 1ORSB 3MLRL 4NNXA 3HFMH 1EFXD 4KUCD 2QSCH 1OHQA 3QUXB 1IM9D 1E4WH 4OLUL 4XWOC 2R0ZL 1IKNC 1CFVH 2CSPA 3BESR 1WBZA 2RAMA 1MAML 2GTZB 3E6FB 4V2BA 2J5LB 3OKOB 3KPOA 2VDOL 3FL7A 2X40A 4NQCA 2CPCA 3CSGA 4NC1C 4WRLA 4XP4H 1TJGL 1LEKB 4R97C 4WDIA 4RA0C 4M1GL 1NDGB 5DUPH 3LIZH 1IT9L 1VFBB 5I1JH 3GMQA 3OR7A 4H26B 3IXTB 3MFFA 3NIFE 5L0QC 4KK6D 5J11C 3SE9H 5BW7A 3NZHH 3WCYA 1U8OB 3I6LD 4R2GC 4G7VH 3QHZH 1JGDB 5D2LF 4AEEA 1NCDL 5HYJB 4L4TE 5D96B 5CGYD 3P0YL 2DJ4A 2EKSB 4LCWE 5I66B 1DN0B 4U7KA 1H3XA 3DYMA 1E6JL 2Y4SA 1MCFA 2Q76A 3MLUH 4KXZI 2YUZA 5D1QD 4L29B 3D6GA 1BBJB 4GAGH 5C0IB 2V2WA 4HF5L 3T3MF 1LK2B 2XKUA 1KPVA 1J1XH 5DJDA 1MI5B 5DT1L 3DXAD 5D7SL 4DAGL 2P5EB 2NY0D 4G9FA 1PKQB 1IFHH 1IILE 4JPIA 4U6HB 5T1MA 3SDCA 4P2RE 3Q5OA 1QSED 1P5VA 4PP1D 1URLA 4WTZA 4WY7H 5T3XD 3QI9B 4YHKL 5KSAD 3HUJE 4MJ2A 1K85A 2DL2A 1W0VB 1SBSL 5DJ0B 4MD0B 4FXKA 3W0WE 2Y7QB 4RX4A 5BQ7B 5CJXC 5JW4M 4PGCB 1IQWL 2Y5TB 2XN9A 1LP9A 5EOTB 4Z78A 3WIFA 3EYOB 1J7VR 5J13C 4NPYA 5D7KE 4LHUD 1I1FA 1QA9B 4OD3L 4LNVA 4APQB 1LE9B 5GS3A 3P30L 4TOYL 1V3LA 3EFDH 2LQRA 4UDTB 1Z9SA 3T0BA 5EOQL 1YPZF 4QHLA 5D71H 3PP3H 3WKML 1CE6B 4MDIA 4M62L 2IEPA 2NLJB 1NAKH 2OTWB 5EIVA 4HS8H 4KJPC 4JFEB 5D1ZB 1XF4B 3DSFL 1JHLH 3OL2A 4HIXH 1DCLA 2FX7H 5F7DA 3WXWL 2GT9B 1L0XA 4JHBA 3P40A 5I71B 3NPSC 3OAUH 1HHKB 1REIA 1UH4A 2APWA 3OR6B 4DGIL 1JZ3A 5EC2A 2OZ4A 4C57C 4NQEB 3FO2B 4U1JB 2BRRL 2VXUH 3DPBA 5DD6B 3QUXC 2AV1A 1RSFA 4GAFB 4XPHH 4U6YA 1UG9A 3NMEA 4H1LB 5D9SB 5A1AA 4HGMA 3SJVE 4NP4H 4PTTA 3UO1H 4H1LH 1F4AA 4XVJL 1FL6A 4NC2B 5KOVC 5CEYA 4IBLT 5C0DA 3OX8A 2AS5M 4FRWA 3VFRA 1KENH 3LSOA 9CGTA 4D0BB 3GK8H 4X4MA 3VMNA 1QFWL 5E6IB 3WO4B 4LF3A 2C7UB 3JV0A 1HQRB 3C5ZC 4MS8C 4JFHD 5DWUH 2V6HA 4F7PA 2IADB 1NEUA 4QHUA 5D96C 2CKNA 4OJFH 1IGMH 3BUYA 3WO3B 3GSOB 1CTNA 1FLTX 4XCCH 3RFZC 4PD4J 4IMKA 3MBXL 5FKPB 1Q9WA 4ZQKA 1ODAA 4LAJH 5EOCL 1JF1A 1N0LA 1U8NB 4O02H 3T4AB 1E4XI 4GRLB 5C6TH 1I8KA 3GSRA 4XH2B 3OJMB 2R2EB 1GOGA 4P5KA 4MVBD 4J3TA 2ATKA 2ZPKH 2NTSP