1ZV5A

Crystal structure of the variable domain of the camelid heavy-chain antibody d2-l29 in complex with hen egg white lysozyme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
VQLVESGGGSVQAGESLRLSCAASGVTYKNYCIGWFRQAPGKDREGVVFINSDGGITYYADSVKGRFTISQDNAKNTVYLQMNSLKPEDTASYYCAAGYRNYGQCATRYWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Lysozyme C
publication title Molecular basis for the preferential cleft recognition by dromedary heavy-chain antibodies.
pubmed doi rcsb
source organism Camelus dromedarius
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zv5A00
3ZKMD 3GSOA 3L3GA 4Z95H 3DO7B 4NWUH 3GFUA 1U8JA 3E8UL 3AGVA 4PS4H 3ROOA 2A74B 1PY9A 3DV6B 4DGYH 5GPRA 2BVOA 5TGBA 1T5XA 1I7ZA 4EVNB 5T1LD 1AXSB 1WISA 3RL2A 4DN4H 5BO1L 3QNZB 5D96B 2JJSC 1KLUA 3MOAH 4I5BB 1K5NB 4WUUB 4HUXA 2EH7H 5DWUL 3VXUA 3DX6B 5DMKA 1N4XH 3TA3D 5D9SB 4HS6B 1EFXD 4OCWL 5JPMA 3V7AG 4OZGB 3SDCA 2LVEA 5CZKA 4UMGA 3ZKXC 4KZEL 1P4BH 5CGYD 3ULVH 2PYED 1XF1A 3EBAA 1EUUA 3FN0L 4K7PH 4MNHA 2WQRA 2UUDK 3L7FA 4GKZB 2CK0L 3HI5L 2VDML 1CIUA 3SO3B 3H7LA 4JRXE 4OGAC 3O2DA 4H5SA 5GS2H 3MODL 1QLRB 1F90L 1NCUA 5INDB 5EUOF 4ETQB 4M8VA 4Q9QL 1CE1H 1DQDH 3TA3A 2OMNA 3RY6A 5DD1L 1EFXA 2W65A 4U0RB 4OM0H 1BVKA 3CVHL 3IU4L 2A6DB 2E7MA 2FNBA 4OI7A 2PYEA 1A1MA 5K33A 1SVCP 3CFJB 2OXHA 3NA9L 5T3ZH 1ROWA 3BX7C 4RGNB 1II4E 4O58H 4YWGL 4PGCB 2CIIA 4FZEL 4LSVL 3C5SA 5ISZD 2DLEA 5IBUB 2VQUA 1JZ6A 4NNXA 2PW1A 5GJTL 1NAKH 4D0CB 1YYML 4PJGB 2W60B 4KFZC 1CQKA 3WHE1 2IGFL 2QADC 3X3GH 1JK8A 1L0YA 1N59A 1DQJB 2OK0H 3ARPA 4WCYH 2YEZA 4NC1E 4UZGA 4ZAKB 3TIDA 2MKLC 4GUPB 1J9CT 4ZD3H 2XQBH 4QOKD 1KYOJ 3B8SA 4MMXC 2ZUSA 3RDTD 3V6OC 3N1FC 3HE7D 4YPJA 1MREH 4NN7B 1HI6B 3HI1B 1QPPA 1GGBH 1XGPA 1FPTH 4OZHA 5IUSA 3SKMA 1HSBA 5BZDB 1A6WL 4HWZA 2G5BB 4W81A 1EEZA 4U1IB 1U8NB 4TTDD 4PJCF 1TENA 1MNUH 2UUDH 2ZSWB 3DYPA 3PL6D 2X9WA 3C6LD 4OCMC 3BWUC 1EEQA 4OCNC 1YDPB 3UPAA 3PHQA 3H3BC 3RWIA 3MLPA 2VE6B 3VI4F 1F5WA 2IANE 4YEEA 4QOKA 3DSFH 4N0FA 1QLFA 4U49A 2QHRL 3OWEA 3HE7A 3MV8E 4MX7A 5KVMC 4NBZB 4NKIH 5FYJE 4PJ8C 1JFQH 4AJ0A 2VQ1A 4LEOB 3OKMB 1D6EA 4AY0A 5D1XC 5CBAA 5A3ID 4RZCB 5JOFB 3O9WA 1NEZA 2HFGL 5HYSB 2ARJQ 4XPBH 3TBYB 2Y72A 2X1QA 2PCPB 5C09E 1RUPL 1KOAA 3C6LA 3P73B 3D3VA 3WNNA 3CVHB 4Z7UA 1CLYH 1QQDB 3ZKND 4ZUWB 1I9RL 5JIPA 4N1CA 3VFPA 1FHGA 2GAZB 1BD2B 3WN5A 3QHFH 4EUPG 1IGIH 3ULUL 1JNHB 3HMXA 4Y5YB 3KPSE 3E6FB 3RA7L 3VDAA 4CRPA 1KXTB 5DJYA 5DZLA 3W2DH 3NCCB 1I9IL 3FT4B 1MFBL 2R1YB 1FG9C 2IMMA 5IESL 5M95B 3GIZL 2EDTA 3FN9A 3G04A 4X80H 5DJDB 3KPOB 4TUJB 2ZCKH 2A1WH 2AV1A 5DFVC 2IFGA 1BBDL 1NDMA 4QXTA 4YC2C 5I30L 1R3KB 1MCKA 2E9WA 4ZNEE 4AT6A 4JE4B 4R3SA 3LKQA 1S7SA 2KUTA 1DDHB 4HXAH 4UQ3A 1NGZA 4GKNB 4QHNB 3BGFC 3SEPA 4KGJA 3S4SB 2KH2B 4O2EB 3IAPA 3CFCL 4PJDF 3WBDA 5JLZB 1CDUA 2VERN 4NN6B 5F9OH 4PRBB 3ES6A 5IVXE 3X11B 2LTQB 3F7VB 3KYKH 4H26B 5F9JA 2CXGA 2MCPH 1BFVH 4KROD 4JVUA 4IIQB 3STZA 5EU4B 1Z9MA 3GMRA 4I0PC 1A9BA 2DQEL 1XZ0A 1HOCB 4GMTL 4HJJH 4K3GA 5IROA 3QFJE 5MERB 3IFNL 2W1NA 1MFCL 4JZOA 3X17A 3MLZL 1C5CH 4AIZB 1IGFL 2Z31D 2DLFL 4BQBA 4PJEF 2AXFA 3O8XB 4K8RH 4OQ1A 5AD0B 5D72L 3GSVB 4N1EA 4K9EH 4KU1A 3ZL4H 3QEQD 5KVGH 2VL4A 4XX1G 1JWMA 1UJ3C 5C07D 3VFUB 5A1AA 2IQAA 2FLRT 4LARH 1LEGA 2WV3A 2YN3A 1MRDH 2PXYB 2Q3ZA 1WFOA 4RISH 3BAEH 1QLEH 4GXVH 4JFXB 4EQ2A 4JFQB 1DFBL 4LOUD 3F6LA 4KKLC 4O2FB 1DQMH 3WFZA 1NGYA 1KCUL 1YZZA 2DN7A 2Y36H 2R0WH 1OTSC 2NLJA 3LMJH 2DKSA 5E8EB 4JANA 3KNBB 4YDJB 3RGVA 3QEQA 5KSBB 4MLSA 5FKAA 5C07A 5GZOD 4NSKA 4AEFA 1RZIB 2VDPL 3CJJA 3NGBB 1CFQA 1N5YH 2UZYB 3BPLC 2IJ0C 4KI5C 3KLAA 5AWNL 2EDRA 1F11A 1QP1A 3RVWC 3TVMC 6FABH 2GSGA 2WBJC 4KK9D 3WIFB 2CLRB 5F7MC 1ZGLM 1T03H 4C54A 5JHDB 4F7CA 4DFHA 2R0KH 3FHAA 1MCEA 3B8YA 3IJYA 1OTTC 2AJ3B 1VFOA 2EZ0C 2FHCA 1TQBB 3AREC 3QZWB 2EXWC 2BNUB 1PY4A 5TF0A 4JRXD 5MP6H 1ERNA 5HD8C 3DVNA 1F3JB 2BVQA 3QYCA 1IZKA 1U92B 1UYWH 2APTA 4H20H 5EO0B 4JPKL 2HJLB 5B3JE 5I8EA 3IDYC 4F58H 1ZSDB 2I5YL 3BZFB 4OSUL 2FO4B 4TYUA 3D39D 1TDQA 2DMCA 2LVCA 4PJXE 3NZHH 3W0WE 5JORB 4X4YA 4PBXA 1FO0L 3U1SL 4OGXH 3ILQD 3FCTB 4GRWE 3R06A 3RTQD 2DQDL 2Q7YA 4X5XB 5TE4H 5TFSL 1H15A 1UM6L 1YMMB 5I17B 3C8DA 3FQNB 3GSUA 2AJZA 5GHWL 1SBBA 3ZO0A 4P2QD 3EYFB 4P99A 3O6KH 1OAXH 2Y5TB 4I3RL 4FG6C 3IB4A 3QEUB 4ZUUA 1Z5LB 2EDYA 1IAKB 3VG0L 4PJ9C 1YPZA 3VE0A 1JN6A 4WFGD 1J5OL 5T3ZD 1J0YA 3BGMB 4G9FE 3D39A 5LQBH 4X4MA 3O3DB 2CSPA 5D7LD 3VXMD 2H2PC 2VIRA 2B2XH 4LU5H 1OT1A 3VH8B 2ERJC 4JHWH 4NT6A 1LK3L 3RTQA 3WNOA 4F37K 2F8VA 3NCJL 4LMQI 1KJ2A 4NQEA 3MLYH 5EUKA 1G7MA 4OFDA 3K80A 4P2QA 3ZHKA 4TVPE 1T0NB 3CUPA 1DVFB 1RJLB 3CH1B 3GIVA 3I84A 1LO0H 4O5LH 5IBLC 2BNRD 1NUDA 3LEXA 43C9A 4EUPH 1U2HA 1AC0A 5HHME 2WWMC 2V5YA 2H45A 3HG1E 3UZEA 1X4ZA 5TF1L 1DEEB 1ZLUK 5E1AA 2DYPD 4B7IA 5D7LA 3VXMA 5DA0B 4Z0XB 1OARL 4ACPA 1DP0A 1BJ1J 3RWFA 3F8UB 3WFHB 3P2TA 5A2FA 5EC1B 3B4NA 1F6AA 2JKXA 4MA3A 5JDJA 3HRZB 2X5PA 5E9DE 1DBJH 4IS6A 2Y7QB 1CD1A 4E41E 1HDMB 5IHZA 2XZAL 1S5IH 5DTFA 3TNNA 5I1JL 4IDJL 1KTLB 4MNQB 5J13B 1O7SA 2B4CL 4G3YL 3IS0X 4ELMA 3U7YL 3L3IA 3QIWB 2CGRH 5FYLE 3X14B 5KJRH 3KWWB 2W0LA 2H9GB 1HK6A 1MIEH 1FO0B 5E4EC 2B0SL 1OD9A 5FV1L 1UVQB 5JW4N 2GITA 2NY0B 1XCTB 2DYPA 3MRRA 3HMWH 4WTZA 5DK0A 3T0ED 3CLFL 1NC4B 4PGBB 3F7YB 4ZFZA 4O51A 1TFHA 3JUYA 4WWID 4WJ5A 4YK4C 4CJ0A 2VDKH 1EHXA 4UTAL 2QKIB 4JCLA 4U7MA 1I1AB 5E2TL 4LSDA 2CJUL 3U0TB 4K7PY 2X4RA 1QSVA 3SDAD 3FOMB 7FABL 3O0RL 4M61A 4GKSB 2ADJB 2OQJA 5IHUL 3OXRB 2Z8SA 1BZ9A 3W11D 2AK4E 5D7JC 2MPAH 1N3NB 2IF7A 4ZFFB 1J88A 3RUGE 1H3WM 5ESAB 3D69A 2FX8H 4M62H 1IL1A 3KPRB 4G6AC 2V9RA 3K8LA 3T0EA 2FGWH 2D2OA 1U9KA 5D7SH 1XGQB 1BOGA 5FKPB 1ZLUH 2D7TH 4URTB 3UYOD 4PR5A 2YD4A 4YBHA 4LSRH 2DM3A 4FQ2H 3CMOH 1Z9SA 2MKWA 3Q2CA 3SDAA 3S3JA 4LHUA 1C12A 3GSXB 5EORL 4Y1AE 5D70L 3MNZB 5TH2B 3WUWA 1A02N 5GS1B 3T2QA 3QCVL 2R4RL 4JFFD 2A9NL 4CMHB 4XP6H 1OLLA 2CKBL 3N9GL 3FO1A 1KEGL 3FONA 1KC5H 2EE3A 3DO3A 4FFWD 4JDTH 4YDKL 3RIAK 1CGSH 3H0TA 1DSFH 1RUAL 5CIPH 1F00I 1FQ9C 3QFJD 2MHAA 1QVOA 1Q9LA 4L5FH 4UNTA 3VXTB 4PJEE 4F3FA 1TJGH 4GSDH 2WANA 5IFJB 1GVIA 2IEPA 4JKWA 4JN1L 4LSTL 1NGWA 1PVHA 2HT3C 1MWAH 3ULUF 1AP2A 5HGDB 1UM4H 5HYJE 5EU6B 3KJ6L 2WUCH 2YPKA 2QR0A 2GHWB 4W4NA 4MWFA 3O2WH 1BIHA 3D2UB 4GBXC 4JFFA 1NC2D 2HLAA 5A16B 4NDMB 5J6GA 4QRUB 4K71C 3T2NL 2Y06L 2ZUQC 4JKLA 5I1IH 25C8L 3HC3L 2VOTA 2DJUA 5KG9A 1PKQA 3S5LA 5C0EB 2N1KA 3IDGA 4MA8H 4AH2A 4P4KD 3LZFH 1OCWH 3VFSB 4P4RA 4WWKC 5FCUL 1OY3B 6CGTA 2HKHL 3ARWA 3NCMA 4Y4KD 2AEQL 3OKEB 5AG8A 4Q0XH 4ODSL 2EDEA 1L9NA 3D87B 4JM2D 1GGTA 4X7EC 5EU3A 4LAQH 1FV1B 3QQ4A 5FM8A 4L4VD 1NC2A 4B41A 3MBEB 3O3BA 1EEUA 3QISA 5IV2A 1S8DB 3C8KA 3ARRA 3E3QC 2DOCA 5BS0B 1KGCD 2WINB 5E7BA 1MIML 1NFIB 2OP4L 4GG8A 1RZFH 2GKIA 4OLYH 5EA0H 4GW1B 2ZWLT 5DK2A 5ERWA 4M7JL 1CZ8H 2FEDC 4NFCA 4LRIC 5EZLB 3TIEB 3OAZK 1FBIH 1JPST 4DCQB 4HFWB 3TP4A 1U8KA 1JPFB 4GAGH 3P4MB 4NKMA 1EHLH 2CKBB 2IH1B 3QG7H 4JM2A 5IP4A 1OWRM 4L4VA 1JGLL 2R0ZH 3RZCB 3BQUB 1OP9A 5F93C 5FGCB 5AYUL 3T0DA 5CJOL 4JGUA 4OLVH 4KKNA 4D9LL 4G43B 2FR4B 2XKNB 5C7XH 2X9YA 4BZ1H 4XB7A 1E4XI 1FNGB 4GW5A 2HP4A 3TT1H 4PJIA 4TUKL 3U4EB 4JG0L 3FFCE 2APFA 1C1EL 1NJ9A 2X7LA 3CSBA 3MRCA 5C08D 2IPTL 3LAFA 1QOKA 1JHLL 3RNKA 5HI5D 3H7BB 2OX5A 5C0FA 3UJIL 1UB5B 3SKOA 1KB9K 1T20B 5IJKA 2DKUA 5IMLB 2FGZA 4P3CL 4Y7MA 1H5BA 1XGUB 1GHFH 2OR8A 3CX5K 3IXAB 4PRIB 5JR1H 2XG5A 2F9BT 1FDLH 3WXWH 4M43L 5C0AB 2XXMB 3BN9C 4X6DB 4JLRA 5IGXL 3WHE0 3QJFA 1S7WB 2NW2A 4QY8A 3S35X 3NABL 5DHXB 1MCJA 3L5WA 5C08A 1P2CB 4TSCL 3VMPA 4F7TB 5FK9B 4HLZG 1WJ3A 4P2OD 2D0HA 3OG6B 3K81A 1G7IA 4XGZB 3V79C 2C3GA 3OAZH 3QCTL 4JO2L 1HHJB 1W8NA 5BXFB 3RL1A 5DHYA 4H8WC 4OKVA 4MLIA 4OAWA 2P8LA 2XI9A 4DN3H 3OAUH 2HN7B 4HUUA 1K6QH 3C5ZC 3ZDXE 4AEIL 2D9QB 3CVIL 1BQUA 4XZUB 4X98A 3Q6FB 3LSOB 1ZHNA 4N90E 4P2OA 1IAII 2VZVA 3QIUB 4B5EA 4QEGA 3D9AL 5CEYB 2ZCHL 4YBLC 3MUY1 3X3FH 1M6OB 1ZLSH 1R3IL 5F3BB 3DBXA 3WUZA 3VCLA 2E7BA 2Q6WB 5FO7B 1G9NH 3DRQB 2Q7NA 1HINL 1Q0YH 4MA1B 2ITCB 1I8MB 3SQOH 1Y6NR 1GZPA 3V8OA 4FFVD 3NTCL 4HS8L 4JQIH 5JXAL 5KW9L 3U79A 4ODHL 1IJ9A 1CBVH 1K9TA 5E2UL 4YXKL 5E24E 1KG0A 3IDXH 5IB3A 3S34H 4DQOH 3WFEH 5DRWA 3GSOB 3L3GB 2V5MA 3HE6D 1A7OL 1U8JB 5GGRA 3ZYOA 5J56B 4GXUN 1U8OB 1DBMH 2VR4A 4KUCD 1R3LA 3EYQD 3V7MA 2BVOB 4HEME 5HGHA 5TGBB 1VFMA 4HJ0D 1I7ZB 1WC7B 2XTJC 3RL2B 1DL7H 3UTPD 3BD3A 4K2UL 4XC1L 3RKDC 5DI8A 3VXUB 3MPCA 2P5EB 1EDQA 5D2NC 1Q72L 1PG7L 2F8XC 1BJ8A 3QDJD 4YFLF 3UP1A 2CO7B 4PP2A 4ZO7A 5JPMB 4U3CA 1M71A 2CRIA 1J10A 3CZFA 3BMWA 3LCYA 3SDCB 5HDOA 5L2KB 3HN3A 1VKXA 5I1HH 3HE6A 5GRZA 4YHYB 4K3EH 4MNHB 3L7FB 4HGWA 3BPCA 2ICWI 1JF6A 1BWWA 3SKJL 1WFNA 5D5MB 5T5FL 3BKJL 4GAFB 2AEWA 3MRDA 1TPXC 3VXQA 1LP9B 3LIZL 3KYMA 4ZPVA 1YJDH 3F7RA 1IQWL 5C1MB 3GKWH 4I18C 5IMOA 3Q6GL 4NQVA 5DD6B 3TA3B 3OXSA 2EEDA 3QDJA 1EFXB 2W65B 5T3XH 3P0YH 3QUMH 1Y6KR 2BSTA 1BVKB 1S5HB 5GZNC 3ARDD 4BJLA 4YAQA 4QRSA 1OL0A 2HKFL 4CN1A 2VDOL 4UB0L 2Q86A 4GRLA 2PYEB 5CBEB 1A1MB 2RCSL 2W07A 1DLFH 2VLME 5JA9A 1NFDE 4Z7WB 5GGQL 4CMMA 1CFTA 2CIIB 2C7UA 2D4DA 5T33H 1RZKL 1MVUB 5TDNA 1QSFB 1CQYA 2PW1B 4WGVB 4HUWA 2APVA 1YNTB 3HMXL 3SPVB 3UTTE 4MSWB 5E5UB 1A14L 3TBVB 1QSEE 4J3UA 4PLNC 1SEBA 4NRYB 1AHWC 1KCVH 1FFNA 4U3XA 4QHMA 5GGRY 2NR6C 3MRMA 1CTNA 1N59B 4PLJC 2YEZB 3IDMB 3TESA 3CZJA 3TIDB 2OSLA 3ARDA 3WYRA 4X7TA 2XRAL 1CFVL 1T66C 4YXLH 5K93A 3O6LH 4D9RE 3OJDA 4XCYB 1XGPB 5GJSL 1U2CA 4OZHB 4CKVX 1KTKE 1AQKH 4HPOL 3TH3T 3GMLA 1HSBB 3F62A 1YQVL 4HWZB 5GS0C 4GW4A 1PLGL 3CFEA 3SDDC 3VFVA 5K9KB 1EEZB 1SY6H 1A7RH 2I60L 1CDYA 2RQ8A 4JFDE 5CMAB 1AQDB 3CX2A 1ZLWK 1INDL 4LL9A 1F3DH 3ROLA 3E0GA 4J7RA 2NZ9C 2NY6D 5JDSA 3LKPA 2A6IA 2EDKA 3GB7A 3PHQB 5IF0A 4FA8A 2PW2B 3RWIB 4HWBH 4OV5A 4QOKB 1P5VA 4N0FB 1QLFB 1LNUB 5AZ2H 1IC5H 3QUZC 5TE6L 4MX7B 4OJFL 1Z6JT 4C58B 4ZXBC 5JW4R 2VQ1B 1D6EB 3CSGA 2OS7A 3WFBH 3O9WB 1O7VA 1NEZB 2PO6D 3ZE0F 2IBBA 1K8DA 2VLJE 1MUJA 1WVZA 4RMTA 5FYKL 4MB3A 4F15C 4FZ8L 1N8ZA 3PF2A 4RFEB 2UV3A 3C6LB 2V17H 1WCBB 3MLVH 5E94A 3D3VB 1OPGH 3EJZC 4Z7UB 1MCPH 5E2VL 2NXYB 3HRPA 1MCQA 3RX8A 4HLZH 4P46C 3BWAA 1TJIH 3G6DL 1XF5A 2NNAA 3FFCD 4Y19E 4NJ9H 4Y5XA 4Z7OF 4YX2L 2AKRA 3A6OA 5EO9A 4PV9B 3P3YA 4R0LA 2V7NA 3QDMA 3BGFB 3N50A 2PO6A 1IBGH 4OLUL 5DR5H 3EOAA 1MQKH 1GL4B 1K4CA 5DEFA 3Q5OA 5EZOL 5SWZD 1FH5L 4U7KA 5L88L 4HKBA 2ZUXA 4LF3A 3G04B 3Q48A 5DFTA 1AGCB 2F5BL 3KHQA 3RVVC 1QFWI 3ARYA 4B50A 1CDGA 1A7BA 2AV1B 4I0PB 3BMVA 1JPSL 1U8MA 2JB6A 5DO2C 3RVXD 4XCCL 1NDMB 3DURA 1AE6H 1FIGH 1AD0B 3INUH 4AT6B 4IMKC 4R3SB 3DETC 1S7SB 1NBQA 1FAIL 2WLYA 3BISA 3CGTA 4PJBA 4DEPC 1P84J 1NGZB 4CVXA 1IEBA 5SX4I 5C6PB 2X89D 4X7SL 5HHOA 2GJ6E 4ODUA 1FIEA 1ZVYA 2YUWA 4FQJH 2EYRA 3FO0H 2DMKA 3AFLA 5SWZA 4XNZB 4NOBA 4O02H 1AO7E 2DB8A 3V5DA 1UZ8B 1X6LA 4YFEA 3GMRB 1YEEL 2EIEA 2VLLB 4AIOA 1A9BB 2A83B 1XZ0B 1FG2A 3D85D 4JZOB 5BW7C 4Z95L 2NY4C 2AV7A 4ONHA 3OKYA 4NWUL 1A6TA 4WHYG 2QSVA 4PS4L 4YXHH 3GMMA 4U6YA 4DGYL 3KYAA 4L4TE 5ANMA 3OAYK 2AXFB 4EI6B 4HIJA 4RNRA 1T7YA 3DGGA 4PJHE 4M7ZC 4DN4L 4RGMC 1T22B 3PG2A 3MOAL 1JWMB 5FECA 2EH7L 2WAHA 3PWUA 2IQAB 1U8PB 2CRZA 1N4XL 2GT9A 5CJ8A 4ZPTA 3BESR 4JFED 2VTFA 1FRGH 2X4UA 1Q94A 1IEAA 4BSWA 2AS5M 1ZV5A 4NN5C 2KZWA 3D85A 1P4BL 3ULVL 5D2LB 5IT2H 1EMTH 1A64A 1NGYB 2F53E 5EOCH 5FA3A 4MAYD 4K7PL 3U6RB 4LHQB 4EN3C 3OKDA 1D5BA 1RAMA 2OJEB 2CUHA 3VXRB 3UTQB 2NLJB 5GSVB 1TZIA 1PX3A 1KCSH 4JANB 1DN2A 4OCLC 3RGVB 4CUCA 5FKAB 1FORH 5C07B 3SDXB 3W9EA 4OIBA 1CE1L 1DQDL 4NSKB 4NZJA 4QRRE 3TO2A 1QG3A 1AJ7H 3IKCB 4TNVK 1CFQB 4UV7H 1JGEA 5D5MF 5B4MC 4ODVH 4OM0L 1BX2A 1WBXB 3KLAB 1OQOA 1LP9F 4MVBD 1F11B 4G42B 1EJOH 2BFVH 2GSGB 3DJ9A 3RRQA 5T3ZL 1H9VA 4O58L 5I8KH 5CHNA 3FB7A 2IPKA 1NAKL 4LFHD 2BVQB 5F89B 5D8JH 2OI9C 1E6OH 3X3GL 4Z7WF 5I8EB 1WITA 3I02A 5FO8A 4NHCH 4WCYL 5JQ6H 1TLKA 4H1LA 2XQBL 4PRHD 4XPHH 2FSEA 4ZD3L 2E9JA 3UO1H 2FO1A 4P5KA 3ALPA 5IEKA 1MREL 5I74B 5A2IH 4X4YB 1GGBL 3STBA 1FPTL 4C59B 4MJ5A 3R06B 1G9NC 1FN4A 2Q7YB 3G5VA 1H15B 2DWDA 1FNAA 3GSUB 2AJZB 3RWHA 1MNUL 5GS3A 2ORBH 3PDDA 5T3XD 5F72S 3T04D 4ZUUB 2EDJA 4DAGH 1I8IA 3BOVA 3ARBC 3UJTH 1YPZB 1ND0B 3VE0B 1JN6B 4NQXA 2EE2A 4PRHA 4S1QH 3DSFL 1CXIA 3R0NA 5IB2A 3HPJA 1R5WA 1X5KA 4Y2DC 1VEOA 2H6PA 4NKIL 1JFQL 2VIRB 4D9QE 4TPRH 4WU7B 3QJHA 3QCUH 2ARJA 4NT6B 3RY6C 4I77H 3RTQB 4AMKH 1Q9WB 5DMGD 4JGJA 4NQEB 3B5HA 2VZTA 1G7MB 4XPBL 1JE6A 4KKCC 5CGYC 1OAKH 3NIFF 2C4FU 4JFDD 3PQYB 3CUPB 3QUMA 5EZJA 1E4XH 2J8HA 5F97E 4R7DA 4K3JH 3FFDA 3GIVB 1QA9A 2VZ1A 1ZGLP 1CLYL 3AU1A 2ED9A 1N0XH 2JCCA 4DK3A 3I50H 43C9B 1J8HD 2NY2B 5ECJE 2YMXH 5FYJH 4MQXD 4KTEH 4G8FB 4P2RB 5E1AB 2VN7A 1Q9KB 5D7LB 3PDOA 4NJAH 3RWFB 2RB8A 4GS7B 1IGIL 5CWSA 3QHZH 1F6AB 5CEZH 4MA3B 3WFCH 3W2DL 1TQCB 3UMTA 5GIRB 4Y4HA 5L7XH 2P1YA 4IJ3C 4IS6B 1CD1B 2H8PA 3AS2A 1HEZB 1LILA 3SE4C 4OB5H 5IHZB 5DTFB 3TNNB 4OTXH 4ELMB 2QQQA 4X80L 3L3IB 1LK2A 1JMZA 3SE9H 2ZCKL 1J8HA 3L6FB 4E42B 3AUVA 4Q6IC 2J8UE 2VL5A 2IFFH 2L0DA 4GKOA 1UWGH 2EXYC 4M1DH 3MRRB 1HHKA 5DK0B 1SY6A 4P49A 3BP5A 4PPTA 4ZFZB 4WJ5B 3HPLA 4HXAL 3MV9E 4JFPA 3HNTH 4UNUA 3JWOH 3BP6A 1LO4H 1VADA 3HAEG 3RDTC 3WJJA 5HGAA 4HXBL 1NBYA 2GUOA 5IG7B 4M61B 4RA0C 2OQJB 4DGIH 1KENH 3KXFB 5F9OL 3KYKL 4KH2A 5F70A 1KFAH 2MCPL 5TQ0H 1BFVL 5HDBF 2I25N 3HB3D 1T83C 4BFGA 3PL6C 4HJJL 3D69B 4XNQA 1IL1B 1VA9A 4S10A 3SCMA 3LEVH 3T0EB 1IAIH 1RZJH 3BUTA 1BOGB 4JFHE 1CGUA 3P30H 1C5CL 4YZFF 1TZGH 4JQXA 2DM7A 4QXUH 3PHSA 4XP9H 1S7QA 2YR3A 4KV5E 3L7EA 2YPLD 3U82B 5HHVH 4K8RL 4X7DC 5JUEH 1HQRA 5HVWA 4K9EL 3ZL4L 3SDAB 4LHUB 1C12B 1NFKA 3WN5C 5KVGL 3WUWB 2B7DT 2DQHL 2QLVB 5A3IC 2UYLA 5FHBH 4LARL 3IFOA 5MI0C 1IGTB 1MRDL 1YEHH 2GFBB 3FO1B 4RISL 3W5NA 1KJ3H 2MQCA 1QLEL 3BAEL 4XH2A 4GXVL 1J1OL 1KTDA 3H0TB 4XBGA 2XA3A 1JYWA 3P4NA 3WDIA 3C5JA 1QVOB 1DQML 1Q9LB 2MHAB 4S1DD 3K8MA 1A6ZA 4TVSa 2R2HA 2Y36L 2R0WL 4BQ8A 5KS9A 4BYHA 2YPLA 4HBCH 3LMJL 4MD0A 1NGWB 1IE5A 4KI5F 1I1CA 1AP2B 1SEQH 1A1NA 4D0DA 4QTIH 2UY7A 1NBVH 4MWFB 3QAZC 2XA8H 4OLXH 1A7NH 3MOBH 5D2LF 3RJDA 3EDDA 4PRNA 4I9WD 4I13B 4S1SH 1N5YL 3SY0B 3T8XA 4IM8A 1F13A 4R7NA 4DOHE 1PKQB 6FABL 1AXIB 3IDGB 3DROB 3SDXF 3VGEA 1T03L 4QRPE 1NDGA 2R0KL 3UC0H 5D7IB 4P4RB 2E7LA 3UTSE 2VB5A 4HZLA 2BHYA 5DJ8B 3MOQA 5EH1A 5IROC 1I9JH 1UXSA 2NXZD 3UXFA 3KDMB 2BY1A 2UZIH 3MXWH 3BZDA 5AG9A 1WT5A 2CUMA 5MP6L 5B21A 2Z8RA 3J7HA 1UYWL 4JZJA 4H20L 5DJZA 4EBQH 5KN5B 1NC2B 3QIBC 2H1PH 1WAAA 3O3BB 5EC2A 1XR9B 4HG4K 5IV2B 1MCIA 4F58L 3C8KB 5CJ5A 3H9SE 4ZOBA 1HZHH 3NZHL 3WO4B 5B8CA 2QL1A 4XVUD 4YBQC 4OGXL 5CSZA 4KROC 2D7NA 4HLJA 4UUJA 2EEAA 5DK2B 4PLOB 5CD3A 3NIDF 5SWSD 5TE4L 3WS6A 1GCFA 2YD5A 3IGAA 4CU8A 1ZANH 3DX7A 5C86A 4NHUA 2UWEF 1U8KB 4MJIE 1I75A 3O6KL 1OAXL 4JM2B 4U2ZA 1RUMH 3C2AH 3S36X 4Z7NF 2Z31C 2AGJH 1YN6A 3L5IA 4M1GH 4ZDHA 2K9UA 4QTHB 5SX5K 2BOCA 5JQHC 5LQBL 4GW5B 2DF3A 3VWJD 1XGTA 4NO3A 1NCCH 4Q97A 5DVNA 2B2XL 4LU5L 3TN0D 4DFIA 3LHPH 4QXGH 4JHWL 1HILB 3NZ8A 1AGDA 4WI6A 4XVJH 1NJ9B 3MLWH 2H26A 4J3SA 3MRCB 3ULVF 4LLYA 5JMRA 3AB0B 3MLYL 3RNKB 3CFKB 2QQNH 3MRGB 5C0FB 2EDBA 3SKOB 1FL3A 4O5LL 1BF2A 1LO0L 1H5BB 2X4NA 3T2OA 3FRPG 4JGMA 1Y18A 2HRPH 1VPOL 4OZIF 1RD6A 3IAQA 1EO5A 3QQ9C 5GZOC 4JLRB 3VGAB 3TN0A 3OSKA 1J1XH 3HUJE 3QJFB 2YK1H 4TVPH 4QY8B 4CVUA 1IFHH 3L5WB 5C08B 1WWCA 4KRMB 1OGTA 1DBJL 2VC2H 5KVFH 1AIFB 3ZE2F 1G7IB 3B9KB 1S5IL 2HG5A 1XR8A 1BZ7A 2EH8H 2VUYA 1NMBH 3RL1B 2CGRL 2OMBA 3NPSC 5KJRL 1VSCA 1MIEL 4Y8AA 4OAWB 2IAMD 2BNQD 5DMIH 3BVNB 3B3IA 1A4KA 1M4KA 3ELAT 3WNKA 4HUUB 3C09B 3HMWL 3HAEH 3LDBB 3P9MA 1DUZB 5SX5H 4Q7DA 3KJ4B 4L8SA 5E0QA 5C92A 1YYLH 1J0HA 2VDKL 3DUUA 1GAFH 2FEEI 1ZHNB 4N0UE 3H2WA 1MI5B 5HGGS 3BSZH 3K2UH 2P24A 4ZMAT 4YHPA 3FOLA 2MCG1 1JZ8A 3VDCA 3DBXB 1QFWH 4C56D 1CT8A 2MPAL 4XRCB 5HYIA 5CFHA 5LG1A 5CEZD 2FX8L 4M62L 4BH8A 1GZPB 4PJ7A 4JO3H 3TO4D 2FGWL 1DBAH 3V4PH 4NKQB 5D7SL 5I15H 1F2XK 2D7TL 3KYOA 3TNMA 3HR5A 5DD5H 1KG0B 4MD5A 5SX4H 1A47A 4LSRL 1K8IB 5BOZG 5E99H 3MV9D 4FQ2L 5I71B 4LVHC 4NC1C 1RJYA 3CMOL 4Q6YA 4XBEH 3MNWA 3ARTA 3EYOA 1UT9A 1R3LB 4UOJA 5HDBE 1CD0A 3PWNB 1UM5H 35C8H 5IVZB 5HGHB 5L8JB 4XP6L 4C56A 1FNEB 3CXHJ 1KC5L 5BRZD 3P9LA 1ITCA 4JDTL 4PJAE 1CGSL 3NMEA 1J0IA 1MSPA 1WSST 1L6XA 1DSFL 4YZFE 5DI8B 4LLVA 3KLDA 5I1AA 3KLHD 4L5FL 2HFTA 5IM7B 1TJGL 4MXWH 4GSDL 1MCFA 3CZFB 1KCKA 2ZSVA 1VKXB 1MWAL 4LSUH 3HE6B 3O6MH 1T2QH 1UM4L 4U1JB 5L8LB 5EBMA 2WUCL 2ADIA 4HGWB 2A9MH 3BPCB 3DXAE 3O2WL 4U6XA 4GAJH 2X1OA 4M9PA 3DMMD 2YOCA 3MRDB 2G5RA 4LVOB 3IF1A 5JXED 4YFLI 3KYMB 2X4TA 5BRZA 3LB6C 5GRYA 3QB7C 4WNQA 5I1IL 2MQ0A 1T21B 3IRPX 5IMOB 4IRJA 5F88A 4NQDB 4MA8L 4NFDA 4JY4A 1JI1A 3LZFL 3QDJB 5EBLA 4DKDC 1OCWL 4X5LA 3DOSA 2EKSB 2QSTA 2BSTB 1H8NA 3QP3A 4YAQB 1ZE3C 3MC0A 5KVEL 4LLUA 5FGBC 2Q86B 4GRLB 4P9HH 4Q0XL 3QRGH 2N7BA 4HWUA 2I07B 2VLRE 4ZNEA 2RFXA 3R4DA 4LAQL 4NUGH 1CFTB 3DMMA 4M6MH 4K94H 5D7IF 5TDNB 5JXEA 3C9NA 5EBGA 4HUWB 4GO6B 2B39A 3IDUA 1SEBB 5H37G 1Z0NA 4JDVA 3TZVA 1FFNB 4QHMB 4ZO6A 4FFYH 5J6HB 5IVXA 1RZFL 4OLYL 5EA0L 3W11C 5K59E 3ZKSD 1CZ8L 1T5WA 2OSLB 3ARDB 5K9OA 3QUZB 4X7TB 1X44A 4WUUE 3IT8D 1FBIL 1NPUA 3OJDB 1PG7W 4GAGL 5CS7A 1EHLL 3QG7L 4GW4B 4QLRA 3CFEB 2R0ZL 4OZGE 5CIPB 2KQNA 5E56A 3VDBA 4F15B 4PV8A 2BY0A 3LV3A 4OLVL 4IEFB 5DRZA 5C7XL 2A6JA 2VH5H 1G9MH 4BZ1L 2OL3H 1KPRA 3ROLB 3TT1L 3CDYA 1LGVA 5JDSB 1N5AA 4N1HB 3LKPB 1W0YT 1MWAB 3GB7B 5IF0B 4A6YA 4OV5B 1B0WA 5C0IA 3ZLQC 5L9DH 4FFWC 4RIRA 4L9LC 4Q9RH 1JGDA 4YHKH 1BVLB 3S7GA 3MV7D 1RHFA 3MJ7A 4L3EB 2FYYA 1PW3A 4UI2A 5KSVA 1LMKA 1WIUA 1K8DB 5JR1L 1GHFL 1KSRA 1MUJB 2BC4A 1NCTA 3TPKA 1B3JA 4LDEB 3CK0H 3MZTA 3J8F7 3T65A 1N8ZB 1FDLL 1N64H 4ENEC 3WXWL 5I1KH 4Y16A 1NANI 2ICWA 5E94B 4WHCA 3ZDZF 1H8SA 2C9AA 4OFYD 4EDXA 5LGHL 3FN3A 5BV7H 3BWAB 3GHEH 1XF5B 2NNAB 4XWOC 4WW2C 4XXCC 4MHHI 3WIIH 4CU6A 1CDCA 4Y5XB 4FP8H 3MV7A 2XOTA 5EO9B 1GGCH 3GSRA 4X6FA 4R0LB 2V7NB 3QDMB 4OKDA 4U1KB 4P4KC 2YZ8A 4Z7VF 1CWVA 1E4JA 4EXKA 2CQVA 1C08A 5DVOA 1J05A 2XICA 3MUGA 1K4CB 4Y4KC 5EUOA 3QXVA 2C4FT 3VWKD 4HKBB 2AJUH 1VHPA 4DN3L 1Q1JH 3OAUL 4LF3B 4OFYA 1HKLH 1R5IA 1K6QL 3FB5B 1T1YA 5F7DA 2YXMA 1U8MB 4DUXA 3JWDC 4YIQA 3DURB 3NA4A 1VEPA 1EHNA 2HT4D 4JKKA 1MJUH 5DRXB 3QWOA 4OV6F 4PJBB 3X3FL 4KC3B 4CVXB 1IEBB 2K1MA 1ZLSL 1I85C 5HHOB 1RJZB 4P59H 4ODUB 3GSWA 4M7ZB 1C5DA 1G9NL 2EYRB 1LE5A 4PTUB 1Q0YL 3BUYA 1GH7A 4LPVA 3SQOL 4HWEH 4CDGC 1RZ8A 4JQIL 5D6DA 1I3RA 5JZ7D 1CBVL 3KLSA 1BIIA 2VITA 4YQXH 3IDXL 3MREA 32C2A 3S34L 4DQOL 3WFEL 4UDTB 2VXQH 4ONHB 2AV7B 2EO1A 1A6TB 1U93A 3GMMB 1DBML 2LE9A 4HPYH 4U6YB 2AJYH 4PJCA 2M26A 4PBVC 5ACMA 4HIJB 5DUBA 2FATH 4GT7A 4WENB 5TDPB 1ED3A 3LQAH 1DL7L 3DGGB 5HI5C 1BD2E 1NSNH 1YC8A 4ZTPH 1N2RA 3PWUB 4TULH 4ZUVA 1U3HA 2GT9B 4UT9H 4ZPTB 2GSIA 1SJEB 3WIHA 4WI4A 1Q94B 4KDWA 2CH8A 2WIIA 4BSWB 3HG1A 2AEPH 3UDWC 1Y6MR 2X4PA 3MFFA 5I1HL 3BP4B 15C8H 1T7ZA 5FA3B 4K3EL 3PXHA 1D5BB 1H3XA 3QDAA 1FVCA 1TZIB 4ORGA 5ABDE 1E6JH 1FZOA 2WK2A 3HAEA 4XMPH 1IGJB 4YEFA 2R1XA 4P2OC 5CJBA 5DZNA 1YJDL 3W9EB 3GKWL 5JPNA 2EO9A 1D9KC 3TO2B 4UU9A 1JGEB 5T3XL 5J57B 3P0YL 3QUML 1BX2B 4TQEH 4JO4H 1N26A 3MJGX 2V5SA 1MCLA 1C7SA 1GGIH 1L0XA 5C0ND 1DLFL 3MRKA 2NY3C 3ZTJG 5H37H 1DN0B 4HX1A 3EZJB 3D0VB 2HJKA 5T33L 3FB7B 1OF2A 2IPKB 4RBPK 3VFGL 2DTMH 4AEEA 1K3IA 2EE9A 1B4RA 2YPVH 4HV8B 2E6PA 1KCVL 1ZT1A 1GOFA 4NP4H 3WXVH 4UAOC 5ADPH 2X40A 3I02B 3W39A 3E3QE 2AK4A 3EIFA 2FSEB 5DDHA 4P5KB 3BYYA 1SVZA 4YXLL 5IEKB 1UG9A 1LD9A 3O6LL 1YMHA 2VDRH 1AQKL 4MJ5B 3K1KC 3MO1A 3G5VB 1CU4H 5I1CH 3MCKB 1SY6L 1A7RL 1X7QA 2YA2A 3RWHB 1MJ7H 4PJDA 4PREA 5CINH 2ENYA 3OZ9H 4POYA 2HFFA 1PFCA 3OGOE 1HYSD 4QNPF 5BJTA 4Y4FC 2YRLA 1I8IB 2HT2C 3O6FA 4HJ0C 2IMNA 4RMRA 4HWBL 4YJZL 1PSKH 2F54D 5CEXA 5IB2B 5AZ2L 1IC5L 1R5WB 5GXBB 4WEMB 4Z6AT 2Y23A 3LD8C 2JJWA 2ARJB 1X4XA 4F9PC 1DR9A 3WFBL 4PJEA 4I1NB 1NL0H 4XCFH 4LVEA 5D7KE 3BHBA 3FZUC 1CXFA 1XAUA 1E4KA 5DMYA 2XXCB 5JHDE 3QUMB 5EZJB 2V17L 3MLVL 2CKNA 1OPGL 3FFDB 1QA9B 1MCPL 3DV6A 4RBPH 3AU1B 2JCCB 3EYUH 3O41B 5DSCA 1TJIL 3CAFA 4EVNA 2EDQA 2F54A 1FZMA 3GI8H 4NJ9L 4L1DA 5DRNB 1BJ1H 3HC4H 3PDOB 1K5NA 2UZXB 2HLFD 4FFZH 3WCYA 4CVZB 3DX6A 5CWSB 1RHHA 4MNGB 5D9SA 4KK6D 4YGVA 1IBGL 3REWA 5DR5L 1FLTX 3VRIA 1MQKL 4Y4HB 3ZDZE 2FL5A 1LVEA 4ZOAA 2H8PB 1CXEA 1MHEA 3NFSH 5I76A 4DVBB 3S88H 3DVIA 1E27A 3WJLA 3IDIA 5DK3A 1YMME 1LK2B 4R2GB 1XIWC 4RGND 5DS8A 4DZBA 1M7DA 2VL5B 1P69B 1A4JA 3RX5A 3UEZA 1AE6L 1WZLA 1JGVH 1QLRA 1FIGL 3QI9D 4NQUA 3INUL 4Z7VE 4G6FB 3MLRL 4OCYH 3BP5B 1JPGA 5I1DA 4APQC 4Y89A 4LLDA 4JFPB 4MHHG 4XHQA 4FXGA 3DSNA 1AI1H 2OL3A 4ZAKD 3BZ4B 3BP6B 1GOHA 2CD0A 1VADB 1J7VR 4FQJL 3FO0L 1NBYB 1G84A 1I7TA 4O02L 4PBWD 1JWUA 1BLNA 4PGCA 3FRPA 4FS0A 3D25A 2XFXA 4XNQB 1B0GA 5E8OB 3QI9A 4D0CA 3SCMB 3VW3H 3MJ9H 4POZC 2W60A 1JV5B 1UFUA 3M8OH 2VQTA 4EXPX 2WBWB 2NY6C 4DVRH 1D5MA 4YXHL 3CPLA 1S7QB 3RNQA 4DKFH 3VRLE 3L7EB 4OCXH 2BRRH 4IOSD 5T5NG 4O4YH 4R26H 1HQRB 3MRQA 4IHOA 2D0FA 1BQLH 3HI1A 4LQFH 5DZOA 2UYLB 2MQ3A 2FIKA 2PO6C 2NY5C 2XTJE 5H94A 3IFOB 1ZLVK 5BQ7A 4U1IA 1N6VA 3OF6D 1FRGL 1SBSH 4QHUB 4XH2B 3DX8B 1KTDB 4XBGB 3TFKC 5A40E 4MNQE 4XTRD 3P4NB 5IT2L 3C5JB 5EOCL 2V6HA 2WUBH 2AP2A 2WIMA 2Q8AH 5KS9B 1U8QA 4S0SD 3TYFA 4MD0B 1EV2E 1KCSL 4N0YH 2BVEA 1A1NB 4HMEA 4I4WA 5BV7C 4D0DB 4PJFF 3MRNB 1FORL 1WWAX 4PRNB 1BBJB 1AJ7L 4HW6A 4UV7L 3OF6A 5C0CE 3T8XB 3HHRB 4I8DA 3TBYA 3ZTJH 4R7NB 1EJOL 2BFVL 5E00B 3SBWA 1LEIA 4YHMH 3CVHA 3GNMH 1V3KA 1NDGB 4G6KH 5I8KL 4L8CA 3RVXC 2VN4A 2BP3A 1TCRA 4HZLB 1J87A 3QUKB 2V2XB 1UXSB 5CJXC 1AXTH 2BXYA 1IGMH 3DARA 3CXDH 4PY7A 3KPMA 4X83A 5D8JL 3OKKA 4JZJB 5DJZB 4X9FA 1E6OL 3I3EA 4BSJA 4NHCL 2X44D 5JQ6L 4R8WH 4XPHL 3SQBA 3UO1L 1ZLVH 4N8CH 5MEND 5DT1H 3RBGA 2GW5A 4X6EB 4TUJA 5CSZB 4UUJB 5CD3B 5EB9A 1CGTA 4G8IA 3IGAB 2ILLA 3DX7B 4NHUB 3PP3H 1S9XB 1A1OA 2ORBL 3NIGF 4QGYA 5EIIA 2YD2A 4Y5VA 2GTWA 4TTGA 4OF0A 4DAGL 5KSAD 1NUGA 1MHHA 4QHNA 3BPOC 4ZDHB 1A6VH 3UJTL 2DL9A 3S4SA 2ZCLH 5F71A 4F9LA 2VWEE 3O3EB 1HYRC 4LGRB 5K9JH 1XGTB 5MENA 4NO3B 1A9EA 3OV6A 4TPRL 3QCUL 4H26A 2IALA 3NZ8B 3TBWA 4I77L 4AMKL 5IQ9A 2PXYD 4IIQA 4LLYB 3FQUA 2VNCA 4FTVD 5EU4A 4JN2A 3ULUD 5D1QD 2CRMA 1OAKL 3U46B 2J88H 5A2JH 1NGPH 5I75B 1KPVA 4MAYC 1FL3B 1E4XL 2ATPB 4K3JL 4AIZA 2ICCA 3S8WA 5KSAA 1N0XL 1GPOL 2X4NB 4P3DA 3I50L 1FCGA 5FYJL 2YMXL 5AD0A 1Y18B 4ZS7H 2FJHA 4KTEL 1Q9OB 3CU7A 3VFUA 2X41A 3TN0B 1RFDH 4NJAL 1F4YH 1G1YA 3QHZL 3S97C 3JUZA 3TPUA 4YDLB 5CEZL 2HTKD 1MFDH 1KJVB 2YA1A 1V7MH 3WFCL 5L0QC 4ONGH 4FTVA 2NY1B 2EECA 5D93B 2XT1B 2J5LC 4V1DE 1L7TH 1OGTB 5D1QA 5L7XL 5DVKA 1NANH 4OB5L 2FZ3A 2F19H 4J3VA 1BZ7B 2R15A 1EHAA 3SE9L 4JKPH 2IFFL 3SGJA 3B3IB 1UWGL 4N5ED 2BY2A 3GMNA 3P9MB 2XKUA 4L8SB 5FGCE 3T1FB 3ESVF 3DUUB 3GM0A 4RCAA 1P7HL 1R3HA 3HNTL 5FOJA 3JWOL 1LO4L 1UH4A 5F7NC 1VGKA 3LVEA 2LQRA 2P24B 5DGQA 3WE6A 4YHPB 2MMXA 1KENL 4DGIL 1L4IA 1KFAL 1CT8B 5J7CC 5TQ0L 1QRKA 3GJFK 3QZWA 2HWZH 3C60D 5DHVH 3SKUD 2X1WL 1BQHG 4W6WB 1A3QA 4A2MA 1HCVA 4FQXD 2FJGA 4BH8B 2IG2H 5I66B 4PJ7B 3MRIA 4N8VG 3LEVL 3UCRA 1IAIL 5I18H 1F3JA 2JELH 1RZJL 4PRIE 4GOSA 4YGAB 3P30L 1G6RH 1TZGL 4P23C 3KYOB 4QXUL 3ALXA 3TNMB 4XP9L 3HR5B 3AM8C 2VAAA 5HHVL 5C0AE 3SJVD 4ODWA 5JUEL 1FYTE 1RJYB 2O61A 3BYTA 4NZUH 5GGSA 3BZFA 4X6DE 2FO4A 3MNWB 4JRYE 4ZOEA 4C83A 3EHBD 3A6BH 5TDOB 4BUHA 5FHBL 1YEIH 4C56B 4WUKH 1MFNA 3QUXA 1YEHL 3SDYH 3C60A 1D5ZA 3P9LB 1KJ3L 4BM7A 3B9DA 1EPFA 3EYFA 3U0WL 4FQXA 4B53A 1DLHB 4LCWD 5I1AB 4WI2A 4EEEA 4RFNC 1T04B 4F7EA 1BQSA 1IAKA 1NAMH 5GSRB 1KIRA 3V0WH 4HBCL 1LO2H 2ZSVB 3SJVA 4F2MB 1JHTB 4Y19A 2Q1EA 4UINH 3RPKA 1SEQL 3LRHA 4YUEH 5IK3A 2ADIB 4OT1H 4QTIL 2WWKO 1JNJA 2M8XA 1MCOH 1NBVL 4OLXL 2XA8L 4U6XB 1A7NL 3MOBL 4S1SL 3IF1B 3TBTA 5ENWB 3S37X 4M8QB 3WJJC 4WNQB 4BELD 3A67H 3VD9A 5MHSE 4HIHB 2O93L 1T0NA 1IKFH 4LCWA 4HMCA 1UCTA 3GJFH 4IRJB 1UKSA 1G6VK 3CH1A 5EBLB 2XN9E 3UC0L 3PWPE 3ABZA 4L9DA 3T3MF 4LLUB 1DEEA 2QQLH 1U58A 4QXWA 1I9JL 3ECBB 3T0AA 3L95A 4JREB 2UZIL 3MXWL 2NY0D 2B5IC 3DECA 2EC9U 1F4WH 2RFXB 1NC4D 5SWQA 5C2UB 4OLZH 4R97B 1W8OA 4EBQL 3DMMB 2A0LD 4M7KH 5M7QA 2DLGA 5C8JB 2H1PL 4U33A 3MJ9A 3C9NB 1HQ4B 3G08A 4ZG1A 5JNYB 1EZVY 4TSBH 1HZHL 4JDVB 5GGSY 3TZVB 3ZSSA 4MJ6A 4OQTH 5IVXB 3QDGD 4MA7H 1C5BH 2ZP0T 2NZIA 2R23A 5A2KH 2DI7A 1T5WB 5K9OB 4Z78A 5F7KC 1ZANL 2EIZA 3VXUE 5FGRA 5EULV 3L3HA 3KPRD 2YA0A 4P5TC 3AS0A 1NC4A 1SYSA 3SHSA 1RUML 3C2AL 2A2QT 2AGJL 1VEMA 4LNVA 1CF8H 5DJ0A 1B88A 4M1GL 4NC0B 4PV8B 3LV3B 4BKLA 5DRZB 4C57C 2A6JB 4HAGA 5M94B 3FOMA 2K7QA 1QBMH 1NCCL 1E28A 4KK5D 3LHPL 5CILH 3QDGA 2ZG3A 4ZQKA 4QXGL 1C8PA 4M6AA 4XVJL 4U1GB 3MLWL 5C0IB 1N3NA 4RIRB 1LWRA 1JGDB 2QQNL 3KPRA 2P7TA 3MJ7B 1NEUA 5B39G 4S1DC 5C70A 2HVJA 3WEXB 4OUUA 5KSVB 2BY3A 5GGUB 2Z93A 3BT2H 1A3RH 4UV4H 4NCC2 2PYEE 3T65B 3EAKA 2EE6A 2HRPL 4Y16B 2BSRA 1Y0LB 3IETB 2ICWB 5EU6D 1CG9A 4EDXB 5TH2A 2VABA 1I3VA 3PIQB 3AY4C 1J1XL 3D2UD 1YECH 2YK1L 4TVPL 1OWWA 1IFHL 1JZ5A 1OM3H 1KTRL 2PUQT 3TGXA 3MV7B 3GSRB 2VC2L 4X6FB 5B8CC 5KVFL 4IRSA 4XCNB 4KKBD 3GSNH 4LSPH 5DJXA 1C08B 2EDHA 2OR9H 3JTSA 2EH8L 1NMBL 2F58H 1J05B 1BREA 4PGZA 3NPZB 4PY8J 1KEMH 3V6BR 4OZHE 2NXZC 5F1OB 5DMIL 1G7QA 4P5MA 4F8QA 5EU6A 2AW2A 2GEEA 5LVEA 1HHIA 3S9DB 5ISZE 1B6DA 3MUHL 1T1YB 5F7DB 2FCBA 5J12C 1YYLL 4M5YH 5A16A 3MBED 2FJFA 4YIQB 2XWBA 3OBAA 5D1ZD 1GAFL 1X5AA 3ARGC 5BS0D 5FF6A 4M7LH 4PJXB 4XVUC 1VFUA 3BSZL 3K2UL 3QUYD 3QWOB 5F6IB 4QOKE 5FGSA 1QFWL 3GSWB 3V0VA 3RZWA 1I7RA 1KJMB 5C6TH 3BUYB 1OW0C 3IJHB 3FO2A 4WI8A 4NQCD 4Q9BA 3OB0K 4JO3L 3V4PL 1DBAL 1RZ8B 3WNPA 1I3RB 5I15L 5IB4A 1R6VA 3MBEA 4LNRA 2DIBA 3BQUD 5DD5L 5FUCC 4U6TA 3MREB 5E99L 1GXEA 5D1ZA 32C2B 1QSZA 2VXVH 3GBMH 5I8OH 3VWJC 1BFOA 1RY7B 4XBEL 4ODTH 4CGTA 1K2DB 4E5XB 4X4ZA 2FBJH 3QUYA 1FFPA 1R24A 4G7YH 1MAMH 4U3HA 4HQQH 2FRGP 1UM5L 35C8L 4PJCB 4GW1A 3HZMA 5DUBB 4P57B 1ED3B 3QWQB 1MEXH 3TIEA 3ARSA 5CJQH 5HI4D 4L3CA 4XVTH 4DCQA 3VXNA 1JWSA 4NQCA 5HHXH 2IH1A 4ZUVB 1N2RB 1HE7A 1U3HB 3UAJC 2GSIB 1RQ5A 2KQMA 2ZOLA 1Z9LA 1D7FA 1AR2A 3BQUA 4MXWL 2WIIB 5HHMB 3L3JA 5HVHB 3HG1B 1EGJH 1YY9C 3U0PA 4G43A 2FR4A 4CBPA 2X4PB 3BH9A 3MFFB 4I2XE 2CMRH 5C0AD 4LSUL 3O6ML 1T2QL 3BEWA 3MTRA 2G60H 2A9ML 5ESQA 1OP5H 4JCMA 1FVCB 4GAJL 4KJQD 2H2SD 3RVTD 3BN3B 4ORGB 1A8JH 1FZOB 3HAEB 5DJAA 3ZDYE 2R1XB 3VXPA 3H7BA 3LPFA 1BFTA 1CYGA 5KAQG 1UB5A 5JPNB 1T20A 4R4FH 2EEBA 4UU9B 4Y8DC 2EDOA 2P8MA 2IAMC 3QA3A 2VDQH 4ZUTA 3RU8H 1KT2B 3WO3B 5I6XC 1MY7A 3JV5A 2I27N 4M1CD 4P9HL 3QRGL 2DDQH 3MRKB 3MV11 5CD5D 3A6CH 3BGAA 1DQTA 3DX9A 5DHVA 1FSKC 2A6KA 3ARFC 4UBDD 4NUGL 4HX1B 4O00A 4NUJA 1S7WA 1EJ6A 2HJKB 4M6ML 4K94L 2HA1A 4RAHA 4Z77A 2VZOA 1OF2B 2YKLH 3EFDH 5JOEA 4XI5D 5FK9A 2AJSH 3EYSH 1G6RA 4ELKB 1LDSA 3QIUD 1J1PL 4Y4FB 1M7IB 3PGFH 4BFIA 3R1GH 1ZT1B 5I0DA 1NCNA 4FFYL 3GSQA 3LKRA 2Y6SD 1INEH 1EO7A 1HHJA 3W39B 2DKMA 2H3NB 2ZUVA 3MJ8A 3MGTA 1MPAH 3RI5F 2YWYA 2GIYA 2AK4B 2CLVA 3BEVA 4YO0A 1RZGB 5DDHB 3O4OC 4E9LA 1CICC 1YMHB 3TO4C 4UNVA 4LCUA 4BK5A 5IVOA 3CFBA 1X7QB 2AJVH 1WBYB 1UXWA 1D5XA 3DTXA 3Q6FA 1ZTXH 4KJYA 4PREB 1HN1A 4NBYB 2HFFB 2OTPA 1G9ML 1NAMA 4PGDA 2OL3L 3P0GB 5BJTB 2Z35A 4LSQH 1O0VA 3O6FB 3T77B 3U2SA 3QEQE 5F6HJ 4OGAD 5L9DL 2JIXA 1GGYA 5C07E 2JJSA 4HIXH 4PYHA 4Q9RL 4YHKL 2ITCA 3PV7A 2P5ED 5JIHA 1Z9OA 1AD9B 3REVB 4PJEB 2P47B 4K55A 1V05A 4HBQA 3I75A 1CDIA 4WW2F 5DQJB 3GJFA 1M7XA 3CK0L 5I1KL 1N64L 5IW3A 1G0YR 5L2KD 4WHTA 2PTTA 5HYJB 4ZFOA 1MLCA 4HCRH 1U8OA 3R8BB 2VZ3A 5BV7L 5DSCB 4U0QB 1UENA 2WM0A 1WC7A 3BE1H 2F54B 1FZMB 3WIIL 3QBTB 5D6CA 1F4XH 2DJ4A 4FP8L 4I48B 1DE4A 1I7UA 1JNNH 5FYKU 1GGCL 2E27H 3G6AA 4APQB 3QXAA 2P5EA 1RHHB 4YNYA 4YGVB 2YZ1A 4QO1A 2XZZA 3ORJA 3OPZH 3REWB 3VRIB 4UT6H 4WV1C 2FL5B 2DJSA 1TNNA 5L2KA 4ISVA 2YWZA 3OKNA 1MHEB 2AJUL 5I76B 1Q1JL 4L8BA 1E27B 5J9PA 3IDIB 1HKLL 2DBJA 4CN6A 5DS8B 3BPNB 5A2LH 5D5MA 4DZBB 1M7DB 1A4JB 4EZMA 1LP9A 5ETUB 2VISA 3RWJB 1QSFD 2DLTA 1V3LA 2D7PA 5LJYH 2BK8A 4YR6A 3H9SA 5DD6A 1JPGB 3T0XA 5I1DB 1QEWA 1YPZE 1MJUL 4LLDB 1KELH 1A6UH 4EJ1C 4PGEA 4FXGB 1R5VB 2OL3B 4P59L 1S5HA 3D39E 5EDXA 5B3JF 4X4ME 2VR5A 3V6OA 5E08H 4PJ8D 5E6IB 1I7TB 3MCG1 5CBEA 5B3NA 3EOBA 2FECI 1BAFH 3DI3B 3I2CH 4FQQB 4MJIA 1QR1A 5D1XD 4HWEL 2X4SB 1FL6A 1UGNA 3HZKA 4PJXF 4Z7WA 1JJUA 4FQHA 3MYZA 1JWUB 1BLNB 2RBLA 4WFED 2YC1A 4P2QE 4GRWF 3D25B 1MVUA 4KZEH 1QSFA 4YQXL 2XFXB 3SPVA 1YNTA 1B0GB 4MSWA 3QI9B 1B2WH 3TBVA 2VXQL 3DWTA 2QSCH 3UPRA 4NRYA 1G7JA 1EZVX 3HR6A 4MAUH 1D5MB 3KPNA 4H0HB 4HPYL 4WFGE 3CPLB 4LAJH 1W0WA 3RNQB 5T3ZE 2AJYL 3JTTB 3IDMA 2HJFA 4KUZH 4BH7A 3MRQB 1A21A 2FATL 4IHOB 3LQAL 5D7LE 3VXME 5BV7B 3IJSB 4PJ8A 4EI5C 1NSNL 2G75A 4BZ2H 4XCYA 3VH8G 5D1XA 4ZTPL 4TULL 2FIKB 4I3SH 5H94B 3K0WA 3O9WD 4UT9L 4F7PA 5K9KA 3KPPB 3QQNA 5BQ7B 3LH2H 1P7QD 2Z92A 1VCAA 4XC3H 1A7PH 1EA9C 1OD7A 5CMAA 1AQDA 2AEPL 1B90A 4ELME 1IZJA 5J11C 2BNRE 15C8L 3D3VD 3WV0A 2VXUH 2NXYD 3K1DA 5CLTA 1NMAH 2MOVA 5ID0A 5DFVD 1U8QB 3FAWA 5H35A 1KBGH 3TYFB 2PW2A 4DGVH 3AXLA 3CFIC 4KKAC 1E6JL 2DQJH 1LNUA 4XMPL 1J0ZA 1S7TB 4UIMA 3NFNA 4I4WB 5HTSA 5I73B 1UA6H 4LIQH 2BHUA 4XHJD 2X05A 4KQ4H 4RWHA 4UIKH 1FZKA 3I3BA 4JFZH 4CW1A 1P7QA 3H42H 5DUMH 3OR7A 4TQEL 4JO4L 4RFEA 3VWKC 1WCBA 2XWJA 1GGIL 1LEIB 5DEZA 1QBLH 1PGRB 4L8CB 5J8OA 4JO1H 1TCRB 4I0PD 5F7UA 1BFSA 1SMOA 3T0EE 1KLGB 1R0AH 1DBKH 2DTML 4PY7B 4HC1H 2YPVL 4PV9A 3KPMB 3OKKB 3U7AA 1MCCA 4NP4L 3WXVL 4XMLH 3BPOB 5ADPL 2XNAB 1S78D 2D31A 1ZGLA 1S9WB 4QWWC 4LPUA 1VB9A 2VDRL 1AGCA 1CU4L 4G8IB 5I1CL 4I0PA 1DJSA 4Z7QF 1MJ7L 3PHOA 1AC6A 1A1OB 3O45B 1CLOH 1AD0A 5CINL 4KKLD 1H3PH 3OZ9L 3RUGF 5EIIB 2EC9T 4Y5VB 2GTWB 2AEIT 3GMOB 3G6JF 4DZ8A 5FYKD 4NKOB 1HWGB 3VFRA 5KZCD 1MHHB 5GRVL 3OTTA 4ONFH 2P5WD 1GJIA 1PSKL 1NGXB 1U36A 3ZYZA 5FDWA 2IWGA 5MENB 1UJ3A 2GY7B 4ALAH 4W4OC 3QNXA 4JFFE 1A9EB 4NRZA 1FE8H 3TBWB 2IALB 2NW3B 1UZ8A 5IQ9B 5L0QB 1NL0L 4XCFL 3FQUB 2J5LB 4KI5D 3PUCA 4JN2B 2VLLA 5CP3H 2A83A 4NYLA 1PKQE 5IESH 3DPBA 3RVWD 1VGEH 4RSVA 1KPVB 2EDDA 4WI5A 1OTTD 1KCLA 2EIDA 2EZ0D 1GIGH 5KSAB 3VXRD 3EYUL 4P3DB 3ARED 2NX5D 4EI6A 2P5WA 2EXWD 4R4ND 4WO4B 3MRFB 3S96A 2FJHB 3GI8L 3MV01 1T22A 3RGVD 2C1OA 3HC4L 5HD8D 3B83A 4FFZL 5I9QB 3PP4H 5HI3D 1U8PA 3QPXH 3TPUB 2LAGB 2W92A 1MQ8A 4FTVB 1DUYA 2BMKA 5IJVA 4GQ9H 1HCFX 4PP1C 4UOW1 5D1QB 1KB9J 3TVMA 4J6RL 3U9PH 4TN9A 2P42B 2WBJA 2YUVA 3G5XA 1NUNB 1OSPH 3CX5J 5D2LA 2FZ3B 2CUIA 3NFSL 5C0NC 3D48R 3S88L 3U6RA 5IWLA 1VERA 2OJEA 3VXRA 1AH1A 3AREA 3UTQA 2NX5A 1KN2H 5GSVA 2HMIC 3G5YA 1JIBA 3JZ7A 1WV7T 1JGVL 2B1HH 1QSEB 5FCSH 4L4VE 3SDXA 3GMNB 1NCDH 4OCYL 2VYRE 4M6OH 4U2YA 1QTYT 2JJTC 3IKCA 3U48A 1R3HB 2X2YA 1KGCE 1AI1L 1WBXA 4PJIE 4OGZA 2GI7A 1VGKB 4G42A 3QPQC 2VXSH 4H8WH 4WFFD 2H2PD 1WCQA 3JV4B 3Q0HA 3JV6A 2LV4A 3WE6B 1RPQA 3L1OH 1RVFH 1BEYH 1KB5H 1MHCB 4LVNB 2EIBA 1MH5B 4JPIB 3UJJH 4M48H 2FEEL 2FJGB 1HYSC 3MRIB 3VW3L 3MJ9L 5DC9B 5F89A 5IBLD 4DVRL 4KJWC 1SYVA 3QH3A 3ULVD 2IADA 4DKFL 2VAAB 4OCXL 3P77A 4LRNH 2BRRL 4HCRA 2UWEA 4O4YL 4ODWB 4R26L 2O61B 3MBXH 5GGSB 2K7PA 3TLRA 3CMGA 5D96C 1IVLA 1BQLL 3U30B 4LQFL 2QJDA 3VGHA 4C83B 4K7FA 5C08E 4FQLH 4JFOA 2APWA 4OD3H 3IAGC 5GS2D 1E0OB 3QUXB 4NQED 2IH3B 2VLJB 3C60B 3SE8H 1D5ZB 1SBSL 4EIZC 1S7VA 3NCYS 4FQXB 4PRPD 3FQWA 5BZWA 3PQYD 4XBPA 1P53A 4WRLA 1ZT7B 2WUBL 4F7EB 3UTOA 4OM1H 2Q8AL 4X6CF 1ND0A 1KIRB 5IEHA 2NY2D 2AERT 3SO3C 1FGVH 3SJVB 4Y19B 1RIUH 2WBKA 1FLRH 3RHWF 4N0YL 4P2RD 4LBEA 2ZZUT 5IK3B 5E5RB 2HLFC 5C71A 4WU7A 2Q87A 1CVRA 2HH0H 3KVQA 1Q9WA 4U0RC 3TBTB 1ZHBA 1KIQB 1ORSA 4OZIA 4YDVA 1OTUC 4PRPA 4PJ5D 2Q8BL 2GQHA 4LCWB 4HDIB 3PQYA 4FQPA 4HK3N 1U41A 4YHML 3GNML 4HH9A 4RGNC 1YQ2A 3N1PC 5D7JD 3TC9A 2B20A 1QR4A 4G6KL 5ICYA 5L8KB 1JHKH 5DGRA 1U58B 1PKOA 1DQQB 3OHXA 3GBNH 3Q3GA 5I1GH 4G8FA 1AXTL 3L95B 4P2RA 4DK6A 5JOPD 4LLWB 1P7KA 1IGML 1Q9KA 3EYVB 5H2BA 3WHXA 5HBBA 3CXDL 1RJCA 5SWQB 1F3DJ 3KPQA 5ACZB 5DLMH 5CLWA 2DI8A 3ZDXF 3Q1SH 4Y88A 4ZS6C 4ZAKC 4OUOA 5F9WB 1QRND 3G08B 5GIRA 4R8WL 2R69H 4PJ5A 1FNSH 4NN7C 1DQLH 4N8CL 1HEZA 2W9EH 5DT1L 2ZUYA 3KXFD 1AO7B 4MJ6B 3I6LD 4N9OB 1XF3A 5D7JA 2R23B 1UEMA 3L6FA 5F8QC 2Y07H 4DKAA 1P4IL 4JFYB 4E42A 4Z78B 1EAJA 1I4FB 2ADFH 4KPHH 4X7CC 2EIZB 3L3HB 2ED7A 1WZMA 2R9HD 4OF6A 1SYSB 4M7LT 3IFLL 4CN4A 4NQTA 5DJ0B 1JP5A 1YNLH 1A6VL 1QRNA 2HT3D 2ZCLL 4BKLB 3MLXH 4X6BB 5IG7A 3L3KA 4LHUD 5K9JL 3DVGB 4HAFA 3L5HA 1E28B 3KXFA 4GBXD 3QDGB 2VLKD 1ZKAA 4ZQKB 4KQ3H 3WKNA 3SKNA 3UTPE 4Z7QE 3GRWH 4XAWH 3DYOA 5GS0H 5C0RH 12E8H 4NFBA 3QXDA 4WIQA 4NQSA 3G6JE 3SE3C 4XTRC 2P7TB 2P43B 2J88L 1NGPL 3QDJE 2Q76A 2HVJB 2F53B 4OUUB 2X10A 5IR1A 1UWEH 3CFDA 5E8NA 2Z93B 4WWKD 3EFFA 3RFZC 2K3TA 1JTTA 4WI7A 5E4IA 3EJYD 5HGBA 3T2PA 2BSRB 3MACH 2W59A 3L3DB 3OL2A 3SGDI 1CG9B 2VABB 1FC1A 1RFDL 4GBXA 2A73B 1F4YL 2VLKA 4Y5YC 3CCHB 2AAVA 4HWNA 1IGTA 1MFDL 2CJUH 1V7ML 2GFBA 4HC1A 4DTGH 3G9AB 4ONGL 2V2TB 3ULSA 1L7TL 4LCCB 3VFOA 5TE7H 4IRSB 1W72H 4X4XA 3OX8A 5IMKA 2F19L 5DJXB 2DRUA 2NPLX 3JTSB 4WWKA 5BVJA 2YSSB 1IKNC 4JKPL 3VGDA 1G7QB 4P5MB 1G7HB 3CH8A 1HHIB 2J3SA 5DYOB 2FX9H 5EO1B 4BSVA 1NFDF 2G2RA 1PD6A 1CDBA 3O2VH 3SY0A 2FJFB 2NYYD 2XWBB 3BXNA 3BRFA 3RVUD 1JMXA 2A77H 3O3UN 3B2UD 5FF6B 3MRLB 3D0LB 4NN6C 4G8GD 3LKSB 4K8RD 3DROA 2I26N 1T1XA 2LTQC 3I6KA 1V3MA 5D7IA 5KSUA 4LRIA 4IIQC 3V0VB 1GGUA 4L8DA 2YS4A 5K9QI 5ITBH 5DJ8A 3OKOA 5HDQH 2HWZL 1I7RB 3M17B 4TNWF 1G1CA 3FO2B 3KDMA 4G7VH 1ITBB 2IG2L 1SJXA 4KHXH 2JELL 2O5ZH 5I18L 5EOCJ 5CP3A 5FA4A 5KN5A 2DQGH 5IB4B 1G6RL 5C0BD 4LNRB 1U0QA 4AEHL 5F44A 3O8XC 1XR9A 2YBRA 4J4PC 1VESA 5D1ZB 1UJTA 1U95A 1BFOB 2UY6A 1T0MB 2V9QA 4XMKH 4G8GA 3EOTH 3QUYB 3MFGB 1FFPB 1R24B 3A6BL 3HZMB 2PXYC 1YEIL 1T3FA 2FHFA 4YHNA 3ULUC 3SDYL 3C2SA 4KI1A 4L3CB 1WWBX 4CU7A 4Z76A 1MCDA 2KL6A 4MB5A 3VXNB 4EOWH 1JWSB 1JZ2A 4NQCB 2XQYG 3FT3B 3V6FA 1PG7X 5GRWA 3IXTA 1TIUA 1NEZG 4GQPH 3LS5H 2ZOLB 5C0BA 2O5XH 1NAML 3ILPA 4O2CA 2AEQH 4QTHA 3V0WL 3L3JB 1LO2L 4CL7A 3T3PE 1UQSA 4X7FC 3U0PB 5I6XB 3S98A 3BH9B 4KTDH 4ZO8A 4UINL 3SGKA 4YUEL 3BEWB 3WFDH 3C5ZD 5GGVH 1IRAY 4OT1L 3V52H 1MCOL 5ESQB 5FHAL 5IW6A 1HILA 2HTKC 3NGBC 5GRJH 3FKUS 5DJAB 3EO0B 1ACZA 3CFKA 3VXPB 1YA5A 5DMJB 3EGSA 3A67L 3MRGA 4PJBE 4HULB 3MRBA 3B9KD 1IKFL 5HHOE 3M45A 4X6CE 4XP1H 4QT5A 4YHIA 2ZOKA 1T1WA 5SWZE 2P8MB 3EDFA 1TQBC 4ZFOL 4JG1H 3QA3B 4ZUTB 2QQLL 4R90H 2BSED 1KB5A 4KMLB 1X6NA 1ZK9A 3C5ZA 5FDYA 4Z7VA 1F4WL 3DX9B 5DHVB 1LQSR 1MJJA 4M03A 4M5ZH 2A6KB 3E2HB 4OLZL 4N5UA 4M7KL 4NUJB 1ZT4A 4Z77B 2EKJA 4J23A 2V7HA 2DBLH 3VG9B 4M4RA 3H3PH 1QHPA 4M6NH 3W82A 1G6RB 1MI5D 1AIFA 3DV4A 4TSBL 3B9KA 4BFIB 5ANME 3RWCA 3GSQB 3I85A 3LKRB 3PNWA 4OQTL 4XPAH 4MA7L 1C5BL 4KRPB 3MGTB 3MJ8B 3BEVB 2CLVB 4YO0B 1S7XA 1FVEA 3EOYG 2YHGA 3BVNA 3I3DA 3W9DA 3RKDD 3N85H 4KJPD 4OCRH 1H3GA 1DUZA 4LCUB 4O9HH 2V2WA 4M93B 1EEYA 3ZHLA 3CFBB 1CF8L 1UXWB 2W0KA 3ARVA 1D5XB 3DTXB 4KJYB 4U1LA 1MI5A 3ZE1F 3QDHA 1NAMB 4PGDB 4FXLA 2Z35B 1QBML 3EHBC 3TCLA 5CILL 43CAA 4WFHE 3U2SB 2JK5A 4KDTA 5E6YA 3JVGC 4XB8A 3IS1X 4XRCA 3F12A 2JIXB 4LP5A 1EAPB 4WY7H 2WWKT 1PJ9A 3BKYH 4PJHF 5D2NA 1DVFC 4U6HA 1EIBA 4JFEE 3MLUH 5INCA 5C3LD 2G9HA 2XY2A 3I75B 2I9LA 3BT2L 1A3RL 4UV4L 3GJFB 1K8IA 3B6SA 3ZKXB 5I8CA 3MZGB 1TTFA 4WHTB 2PTTB 4ZFOB 3O2DH 4ZOCA 1MLCB 4EUPA 4XAKD 5HPMB 1WBZA 4RRPG 3PWNA 5IVZA 1YECL 1FNEA 5CUSH 2VSCA 1F6LL 3LOWA 3QO0A 5D6CB 5C0CA 1OM3L 1KV3A 3HNVH 3VD3A 5F1NA 4I18A 2XQYK 1DE4B 1I7UB 3P11H 3G6AB 1F4HA 1OB1B 3KYNA 3QXAB 4OIAA 5J13C 2NR6D 3GSNL 4YNYB 4A2LA 4NQDD 4PLJD 4LSPL 5IM7A 4D3CH 3QIWC 2OR9L 3AMLA 3FQTA 2DIAA 3RWDA 2F58L 2NY7H 1XF4A 1ORQB 2AXHA 1KEML 5E5MB 4ISVB 2NY0C 3OKNB 4GRLD 5ID1A 4U1JA 4L8BB 5J9PB 4U1SA 5B38G 3ZT6A 4L4JA 2A0LC 5AAWA 3QSKB 1NKOA 4AIXA 4POUB 1PZ5A 2HFEA 4M5YL 4X99A 3BW9B 1I1AC 2VISB 4AQ1B 3QNYA 3ZYJA 4WW1A 3S3SA 4ETYA 4YR6B 3H9SB 4LCYA 3OGCA 1AHWA 3OR6B 1T21A 4M7LL 4GLRI 2QADB 4X9IA 1X5ZA 2NZ9D 1OSZA 3IYLW 1QEWB 4NQDA 1N6UA 4PRHE 4PGEB 2EKSA 3BKMH 3QUZD 4K23H 1X5YA 1T89C 5C6TL 3EOBB 3X13A 3GRWA 4MJIB 4XNXH 1QR1B 2I07A 1MFEH 1FL6B 3HZKB 5ELIA 4FQHB 3EO1A 1NCBH 5JHLH 2YC1B 4Y0GA 4HSQA 1F3RB 5EWIH 1FJ1A 5T3XE 3GKZA 2NCMA 4HJGA 3WD5H 3PWJA 4BQ9A 2VXVL 5J11B 2QV2A 3GBML 5I8OL 4KHTH 5FM5O 3EJZD 3QO1B 3UPRB 3LS4H 2QSQA 1G7JB 4ODTL 4P46D 3KPNB 4RX4D 2FBJL 2EYTA 5FO9A 5GS1C 1W0WB 5J6HA 1FP5A 4CMHC 4G7YL 1MAML 1OLZA 4HQQL 3M1BA 4PIRF 2HJFB 4BH7B 3QUZA 2RJMA 1VFAB 1MEXL 4LPTA 4PJ8B 5CJQL 4XVTL 2G75B 2F5AH 5JW4M 5J1TC 5D1XB 5HHXL 2ZUUA 4L3ED 3D18B 3NCEB 4F7PB 5K9QG 1V7NH 2Z92B 2ICWJ 5CIPA 3VFNA 1W72A 4MDIA 3GSNB 2B4CC 1LEKA 3N1GC 1EGJL 1MCHA 2YD9A 2CMRL 1BOYA 3MA7A 1T80A 1ZVSA 2VWEC 4K7PX 4P46A 1J8HE 3RVVD 1WGOA 2G60L 2R2CA 4RX4A 5ID0B 4NWTH 3S35H 1MWAA 5H35B 3HUJB 4X9BA 2WQ8A 3B2VH 3AXLB 4J12A 3CDFA 4LKCA 4UIMB 4G6JH 4KDVA 3NFNB 1BVLA 1T4KA 4V1DA 4KKBC 4AK1A 5ILTH 3QDMD 4L3EA 3K74B 1FZKB 4R4FL 4UT7H 5KOVC 2PTVA 5HYQA 2HAZA 5F7EH 4CW1B 1P7QB 3OR7B 3GBLA 1UCBH 3ZYIA 4QHKI 1BQHB 2VDQL 2DQIH 2XWJB 1PLGH 2DDQL 3NCBB 1OAUH 3A6CL 4RDQF 3MBEC 4YC2B 2YKLL 1B0RB 2DLHA 3EFDL 4MMZC 2J8UF 2AJSL 3EYSL 4WTZG 4IMKA 1CK0H 3F5WB 3PGFL 2DM4A 4U1KA 3R1GL 4W6XB 3GUTA 2BX5A 1INEL 5HHOD 1MPAL 2IQ9H 5T5NF 1WEJH 4LASL 2D31B 1ZGLB 5IIEA 2GJZA 3MNVA 3O4LD 4GRMA 3VXSD 3HFMH 5AEAA 5TQ2H 4BUGA 4M02A 3FB5A 4MS8D 3RZCC 3BQUC 4KWUA 2XWTA 2AJVL 3ZMRA 4NRXB 1MCBA 3PHOB 1TVHB 2AQ3A 1ZTXL 5BW7A 4U05A 1FYTA 2CK2A 4OGYH 2C26A 5E1HB 3O3AA 5EOTB 4DZ8B 4HG4J 2YPLE 5DRXA 4LSQL 3VFRB 3T09A 4XPFH 3CSPA 1OGAD 3BI9X 1RJZA 4NZRH 2ENSA 1HXYB 3K46A 5HI4C 1X5LA 4KV5F 1TVBA 5FDWB 4HIXL 4PTUA 1UJ3B 3O4LA 3QNXB 1CE6B 3MRJA 4NRZB 3VXSA 1VACA 2R8SH 3HC0A 4PG2A 3V9FA 2OM5A 4AL8H 5IOPA 5B4MD 1IC4H 5FXCH 3GO1H 4NYLB 3LRGA 1HHHA 1MFAH 5DURB 4UDTA 3CC5A 5I19H 3BIKA 4EN3A 4HCRL 3DXAB 5KZCB 4KJQC 2H2SC 3RVTC 5C2BH 1WWWX 3N1QC 1OGAA 1FNFA 5E70A 2P5WB 4FXKA 4HKXA 5TDPA 3BE1L 3S96B 4WFHD 5GRUH 1F4XL 2C1OB 3NACH 4KK8C 3MA9H 4XP4H 1EERB 3LRSB 1JNNL 4I9WE 2E27L 3RGHA 1WAAE 1H0DB 4PG9A 1SJEA 3BPLB 3P4OB 2XN9A 3OPZL 1DUYB 2BMKB 5IJVB 2YD7A 1FVDA 4PB9H 5J3HD 4UT6L 4FQCH 3TVMB 4PJFA 2WBJB 4M1CC 1QHOA 4UTBH 3G5XB 3S5LG 3BP4A 3D1MC 3FMGH 4FQ1H 4LPXA 5CD5C 3SGDH 4XWGH 4UBDC 3QEGH 4KXZI 2LAAA 4WTWA 1TETH 1JYNA 3AREB 2NX5B 2D7MA 3G5YB 3VGBA 2JB5H 2VMFA 4XI5C 2CDFA 1IGJA 1ZEAH 2C3XA 3ZZ1A 3QIUC 3IVKA 5LWYH 1XEDA 3U4BH 4S11A 1INQA 4OFVA 4HKZB 4WEUD 3ARBD 2Y6SC 1KELL 3IDYB 2VXTH 1A6UL 3TJHC 1PYWA 1KF9B 2ESVD 4Y2DD 5E08L 5GGVY 4LK4A 4MA1C 5B39B 3I2CL 1BAFL 3CD4A 3JV6B 1J86A 3FQRA 5SWSE 4XVSH 5DC0A 1DN0A 1BF8A 2J12B 3D0VA 4YPGB 2H32H 4LLMA 2W0FA 4KKCD 3T4AA 1QUNA 4X8JA 1JZ3A 3GGWA 1B2WL 3RWGA 2QSCL 4HV8A 1PQZB 4MAUL 1SYVB 3ARBA 4PJ9B 3QH3B 4PFEA 4QYOA 1U3ZA 5FUCE 5T1LA 3OJ2C 2IADB 2OK0L 1P9MA 2Y1VA 3P77B 2UWEB 4XNUH 4KUZL 5EPMA 4Y2DA 1KJ2H 2ESVA 3KG5A 3K3QA 2ERJB 4BZ2L 3WLWD 4WVRA 3QFDA 2WW8A 4K7FB 2Z4QB 4JFOB 4I3SL 3PJSA 2ZUWA 3B5TA 4N8PA 3MCKA 3LH2L 3W81A 1MLBA 4XC3L 2C1PB 2C5DC 3SDCC 1S7VB 2F74B 1MCRA 1A7PL 3ZKMC 3FQWB 5BZWB 2ZUTA 4YHYC 1L0QA 4XBPB 2VXUL 4MQTB 3E6HB 1NMAL 1S9KC 5IEHB 1KBGL 1CLZH 4DGVL 2DAVA 3KR3H 3S6CA 2EXYD 2DQJL 4LBEB 5E6ZA 4BFEA 2CO6B 3OB8A 2YUXA 2ARWA 3TA3C 4KMTH 2Z8VC 5EU7E 1UA6L 2X4QA 4LIQL 4KQ4L 4UIKL 1SMAA 3TT3H 1U42A 4G5ZH 4JFZL 1ZHBB 3HUJF 3H42L 5C9JA 5DUML 1ORSB 4OZIB 4D8PA 1SM3H 1NBZA 4YDVB 4Y4HD 4PRPB 3SE4A 4P0DA 4GXUM 4HH9B 1MHPH 2YN5A 4R2GD 3RI5K 5ISZA 1QBLL 3O41A 4Q6IA 3VMNA 5ICYB 2BNQE 3QULA 4NM8H 5E4EB 4JO1L 3UZVB 4BK4A 1AFVH 3OHXB 4CADA 4PJ7E 3Q3GB 5DRNA 1R0AL 3EUUA 1DBKL 1P7KB 5DD0H 5H2BB 3WHXB 4G6FD 3TBSA 4HC1L 4CVZA 3KPQB 3QHFL 4YK4B 4MNGA 2XACC 2COQA 4XMLL 1J12A 4MJ2A 3LPWA 4JB9H 5BMFH 3RDTA 1IT9H 4PJ5B 4YHOH 4ZODA 4BQ6A 5GGTH 1KXQE 4DVBA 4C56E 1CXKA 1XF3B 5D7JB 1PEWA 1T83A 2A1WL 1Z3GH 2DQFA 5CEZE 3PL6A 1B4JH 1WFTA 1U8LA 1CLOL 3SCMD 1H3PL 1F6FB 3DHJA 3FT2A 1BM3H 2M2DA 4ONFL 1QRNB 2R2BA 3BZ4A 3VFMB 4OCSH 3F65A 4BA8A 3HE7C 4AM0B 1EO8H 1XCQB 1BWMA 2CDGA 1N7MH 3L3KB 4ALAL 4HWBA 5I1LA 4S1RH 1FE8L 3TJEH 3O9WC 3SKNB 4GG6F 5TPWH 2X70B 5E8PA 1NCAH 4TTDC 5BRZE 4WHYH 3MLTA 2N56A 2EDWA 3QXDB 4NQSB 4HFUH 3C6LC 1AGFB 5E8OA 3DYMA 1VGEL 4I2XA 2Q76B 1JV5A 4PJAF 2NXYC 5IR1B 3CFDB 5E8NB 4JVWA 3EFFB 2ZNXA 1GIGL 3HKFA 4HEPG 4LCIH 1FL5B 5HGBB 1RMFH 1T7WA 3BRDA 3K4ZA 5I2IA 1RZKC 5ICXA 1IAOB 4GJTB 4XHJC 4GBXB 2VLKB 3QIBD 3PP4L 1IM9B 3QPXL 1I9EA 1XGYH 1WICA 4RGOH 4K71B 4FMFA 2ZUQB 4N68A 4HXBH 4QHUA 4GQ9L 3ULSB 3DX8A 3MR9A 5FYJU 3VFOB 3U9PL 3T4YA 2JF1A 2C3HA 4X4XB 3OX8B 4YBQD 1OSPL 5IMKB 4OBRA 3ZKNC 1Q0XH 8CGTA 4LPCA 4WWKB 5BVJB 1X9QA 4K3DH 1KN2L 5FAAA 2L7UA 5KBNC 4PGJA 1YNKH 2B1HL 1HH6B 3GJEB 3MRNA 5CKAA 2OTWB 1NCDL 4M6OL 4BSVB 3QIBA 1BBJA 4U1NB 2G2RB 1OOAA 1S78C 4CNIA 3BXNB 1D5IH 4I0CC 4JDZA 5LGJA 4XNZC 5C0DA 2DQHH 2IBZY 4H8WL 2VXSL 5E00A 3OG4B 1T1XB 4U31A 3L1OL 1RVFL 3I6KB 1BEYL 3ZE1E 5KSUB 1JPTH 1KB5L 4KY1H 1NMCC 1QD0A 4L8DB 4ZFGH 1J1OH 4NNPH 3OKOB 5K59F 2IC2A 2B1AH 3QUKA 1KLFA 3UJJL 2V2XA 5FFLA 4M48L 3JWDH 4P48A 1CDJA 1NKRA 2X9XA 3IDNB 3WMSA 4GLRH 4RRPA 1ZWIA 2Z31A 4XPTH 5FA4B 1OHQA 1JTOA 4QRTA 4OLWH 2EDFA 2YBRB 4XNMA 3NH7H 4LRNL 4OZGF 4ZO9A 1IC7H 3AROA 3MBXL 1U95B 2F15A 3QQ9D 3KS0H 1BMGA 3NBNA 4G8GB 2M1KA 2BJMH 1HHGA 3I6GA 4X6EA 4FQLL 4OD3L 1T3FB 4ERSH 4YHNB 3MV7E 3SE8L 4Z76B 4OI9A 1S9XA 4KAQH 3QRFM 3H3KA 5T1MB 3V6FB 3IXTB 5B38A 4LKXA 4BZYA 1RU9H 5IWLC 2DQCH 5C0BB 4GAYA 4OM1L 3ILPB 4O2CB 4LGPB 4R4NC 5EUOE 4IRZH 4PTTB 1UQSB 1FGVL 4NC2B 3RGVC 1RIUL 3BJLA 4GRWH 1FLRL 3O3EA 2ZKHH