1ZV5A

Crystal structure of the variable domain of the camelid heavy-chain antibody d2-l29 in complex with hen egg white lysozyme
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
b'VQLVESGGGSVQAGESLRLSCAASGVTYKNYCIGWFRQAPGKDREGVVFINSDGGITYYADSVKGRFTISQDNAKNTVYLQMNSLKPEDTASYYCAAGYRNYGQCATRYWGQGTQVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title Molecular basis for the preferential cleft recognition by dromedary heavy-chain antibodies.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Hydrolase/immune system
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zv5A00
1RUMH 2FZ3B 2VQ1B 4JDZB 3VU2A 5DJ2A 1OVZA 4NO0A 4P2RE 1QLFB 2HA1A 5J89A 4M48H 3EOAB 4Y4FB 4PRPA 5JPMB 1SY6L 2FGZA 3QCTH 4PB0H 5HI5D 4A6YA 3FFDA 4Z7WA 1UFUA 4PD4J 4YE4H 3ZO0A 4ZFZB 3O8XA 4U7KA 1OARL 1ZHNB 4RAVB 4EVNA 1KIQB 1EO8H 1DBKH 3VFGH 4XCNA 1DLHA 4RAUB 5E08L 3C8HA 4NCC1 3QUXB 1EUTA 4ODTL 5A2IH 2OTPA 4QNPE 1CFNA 3T4AB 5EIIB 5DA4A 4XPBH 4KKBD 2VE6B 2NQCA 3NZHL 4MAYD 4Z8FL 4GBXC 1XIWD 2ZNXA 3BZEB 4OZHA 4PJBB 1N5AB 3V7AG 5C09A 3LQAH 3GMRA 3MXWH 5IHLB 1MCHA 3O4OC 1X5LA 3OXRA 1T7VA 2DBLL 4N0RA 4XBEL 5E1HB 3ROOA 3BEVA 4OLVH 3X14B 4NKOB 5IMMB 4TRPL 4JFYA 1NLDH 2L7JA 1DQJA 1C5CH 2CKBB 3FRUA 4LSRH 3EKCA 3ZL4H 4BSVA 3T1WA 1B0RA 2VWEE 2WIIB 3MV11 4OCNC 4P2CG 5E7FA 4CN1A 1A14L 4BFIB 4FFZL 1YMMD 2QHRL 5FA3A 1R5WA 4JVUA 5D96C 3DMMC 5CEZL 2YK1L 1YEKL 4OGAD 2R4RH 5C7XL 3U9UA 1EEYA 5IBTL 1KFAH 4KTDH 1IGCL 2K7PA 4NRXB 4RAHA 1F02I 4GW5B 4Y4FD 5D1XB 3PWLB 5I73C 3GSUA 3EJYD 5E94B 2IFFH 3QIBA 5SWSE 1D9KA 1R5VA 5C2BH 3HE6A 4OI7A 4GW1B 3PABB 2NTFA 1NCBH 5CZVH 4IMLB 3RKDC 3X3FH 2PTTA 4N0YH 4OZGF 4KVNH 5EZJB 4UDUA 4LEOA 4AT6B 5K9QI 4KHXL 3ULVH 1H5BA 1CIUA 3QUXD 3S98A 5C3TA 4KKAC 1T1YA 3DWTA 4XMKL 3BQUC 1WLHA 3O4LA 5FO9B 4LHUB 1YY9C 5GZOC 2FIRT 3OJMB 1G7PA 2Q6WB 1KJMA 4NC2B 4URTB 1L4IA 1EUUA 3L95A 1G7JB 4L5FH 4JFQB 5EOQH 1AR1C 5M94B 2AEPH 3TJHC 4EIGB 5F72S 1QQDA 3O2DA 1YN6A 4FXGA 4S11A 4M6AA 5IKCB 5E2VH 3BUTA 3EOTH 3FL7A 4GRWH 5EOCL 4HPOL 3MJ6A 4PLNC 5DWUH 3TA3B 1A6WL 4PJGA 3RWCB 4S1QH 3H3PL 5T3ZD 4FOMA 5IFJA 4F57H 1FG2B 2GIYA 5EUOE 5BRZA 3SDCA 4F37F 1DLFL 3B43A 3QRFM 4IRSB 1AD0B 1VFAB 3GMQB 1TQCB 5DHYB 5ICXB 3UPRB 3DYOA 5JW4N 5D1XD 2JJTC 5CJXC 2I07B 7FABH 3LCYA 2ZUYA 3BKCH 5D7JC 2DMCA 4XPGH 3BSZH 1R3KA 1G9NC 1RZIA 4ZDHA 1FVCA 1MHCA 3HLAB 4NN7B 1KV3A 5HI4D 5MEQB 3O2VH 2YPLE 1RPQA 2GK0B 1JGVH 2W60A 1TJHL 1ORSB 4KJQD 3OKOB 4ZD3L 3V5KB 1UEMA 2HLAB 3RDTC 3OKNB 2VDNL 4BUGA 4XC3H 5ITFA 4TUKL 1E28A 5D1ZB 4LHUD 2C9AA 1JI2A 1HHHA 1H3PL 1BEYL 1D6VL 1MHPL 4L9LA 4YEEA 4KI5D 1AJ7L 4BFGA 1LO5A 1INQA 2QKIA 4ZSOA 2XZAL 2EXYD 4X0KA 2WWKT 1M1SA 1BBJB 4M7JH 5JOPD 1LVEA 1S7QA 3IKCA 4JGMA 3HE7C 4R96A 4F3FB 2HTLD 5CD5D 2J7LA 2XFXB 3THMH 1N8ZA 3O2DL 4BSWA 5KBNC 1OAUH 3LZFH 4Y7MA 1VDGA 2MKLC 3L3IA 2Z31C 3TA3D 5DYOA 2A73B 4PJ7A 1GGBH 4Y4KA 3VXSE 3IDIB 3CLFL 2Y6SC 2X7LB 3M07A 2VIRA 4KKNA 4RGNB 4XNQA 4IRSD 5F1IB 1TFHA 3FN0L 1KIPA 2QQLH 3EYQD 4QF1B 1KT2B 5L6YL 2H2PD 2CIIB 3UTTA 1AE6L 2IANB 4KKCD 4P2QE 3G9AB 3CH1B 4I18A 3RWGA 1C5DB 2LTQC 1BJ1H 1MREL 2WNGA 4LVNC 1IFHH 5LAXB 5TE6L 1EHLL 2ZSVA 1NMAH 1MCOH 1Y0LB 3BRDA 1NLBL 4CAGA 2YMXH 5K59E 1DQTA 2GJ6A 3I9GL 1FO0L 4J7RA 2W9DL 1CGTA 5D1ZD 3PWJB 1LK3H 3UJJL 4WV1C 5CMAB 2NMSA 3PQYA 2IALB 2LU3A 4M43H 2H26A 2GSIB 3C2AL 2XY1A 4K3GA 1CGUA 3HI5H 1LE5B 1AQDA 4XBEH 5KOVC 4PJEF 2BVUA 5IW1A 4OUUB 4LLYB 1NFIA 1PKQE 4TSAH 3P4LA 4UT7L 5C0FB 3VXUA 3HMXH 1JF5A 1WSST 2DWDB 4M00A 3SDAB 1W0WA 1C7SA 5H8DA 3X3GH 3REVB 2VTFA 2LVCA 3ZT5A 1IZKA 4AEIH 2E7LC 1UCBL 1MLBB 4PV9A 3AFLA 1JNHB 4NO5A 3AY4A 3D39E 5DMGC 4MMXC 2YK1H 1QBBA 1YEKH 5DGRA 5JDSA 2NZ9D 3BKYL 3CSPA 4RGND 5ECJE 5D5MB 1X5YA 3RWEB 1I7RB 2YRPA 2PKDA 1CDGA 2B39A 5CSZB 1UWEL 2IAND 5ETUB 4D94A 3AB0C 1YC8A 2ICES 3JTSA 5FHAL 3UCRA 1R0AL 2NY3B 1ZLUK 3TPUA 2QR0A 1EEZA 1IVLA 1AGFA 1NFDA 3HC4L 1WCQA 1KTRL 4DFIA 3IFNL 3S4SG 4ZO7A 3SPVA 1IEAA 1WWWX 3RGVB 1H15A 4M1GH 3GMPA 3RVTC 3S96A 1CD1A 4Q97A 2PXYB 2W0FB 4XMKH 2VNCA 3BIKA 3TP4A 3VH8B 2EDYA 2Y5TB 5IW6B 4LVOC 4Y0GA 4D0BA 4QNPF 1U3ZA 5A16A 4PYHA 1YEHL 4NNYB 4OCMC 3L7EB 5KN5B 3OF6D 5ICYB 5SWQB 4OZIA 3LQMA 1OAQH 3DVIA 1E4XI 4XMPL 1IM3B 3IU3A 1ZLWK 3Q0HA 5F89B 5CIPH 4HKJB 4L29A 2DAVA 1LEIB 2G9HA 1CWVA 3SDAD 4D0CB 1A6ZB 1IC5L 1PX4A 4YHYB 1HWHB 2EYTB 3WIIH 2NNAA 1IKFH 3H3PH 3GGWA 4XX1E 3GI9L 5JMRA 3GHEL 4WI9A 12E8H 5LGHH 4M6ML 1UYWL 2OZ4A 2ZUXA 4LSSH 4PJHE 1RHFA 1MI5A 3X11B 4F15B 3WS6C 4POUB 5KVDH 1QVOB 3C6SA 1MCEA 1GHFL 1MY5A 2C3VA 3EFFA 3MV9A 4MZ3A 2P8MB 5TDNB 4QOKB 4QRPE 2CLRB 3B9EA 4JPVH 1IM9A 4ERSL 4ZFGH 2NY3D 1DDHA 3LAFA 1ONQA 3ILPA 2UZXB 5AZEH 1YUHB 1PJ9A 4H5SB 4JO4L 5FOJA 4F7CA 3KWWA 2AEQL 3RGVD 4ZD3H 5MEOA 3DV4A 4PJXE 4WWKC 4LP4A 2J6EL 2OTWA 1I9IH 4OD2B 3OAYH 4IDJL 2PXYD 2X4PB 5ELIA 4JB9H 4ZUSA 3AS3A 5KANG 4UB0L 1A21A 1M7IA 3UZEA 5GRUH 5KSVB 4JFZL 2P8LB 4UDTB 4DZBA 3DIFB 4EQ2A 5GS0C 1TJGH 1W72B 1CGSH 5KW9L 1VHPA 3EO1A 1MUJA 2EDTA 1OGAE 4FG6D 1NUNB 4TQEL 3RBSA 3W81A 3S35L 2ATKA 4EDXB 1B9ZA 5F97E 2WWKO 15C8L 3D48R 3MNZB 4JM2F 2B20A 2Q76A 2PO6C 3MJ8A 5I9QC 4P4RB 4KRNA 3QQ4A 4X6FA 1J0HA 5A43C 1G6RL 4NHUB 4XBGB 5ALBL 4ODWA 2VL4A 3P4MB 1EXUB 3WNPA 2RAMA 5EOTB 1OD9A 1RZJC 1FZOA 5LBSH 5EUOF 2NX5B 4QOKD 1NGWA 3ZHKA 3O6KL 5TDOB 4Z7OE 3HZVA 3OAZK 4D2NA 5IR1B 4O2EA 2ZWLT 3OZ9L 3TH2T 1ND0A 3F5WB 4GQ9H 4LEXL 5IB5B 2X1XR 5LG1A 3NIGE 3MA9L 2WUCH 3UTPD 1MELA 2EH8L 3TBTB 1XCQA 1DTUA 2W0PA 5DO2C 1I8LA 5GS1B 4L4TA 1R3LA 4G7YH 4JG0L 3JTTA 2EIZB 1B4JH 3TNNA 5F9JB 2P42B 1QSZA 1WITA 1ZWIB 5MERB 3RHWF 2F54B 4UILL 4KUCF 4ZTOL 2AJXL 1PY9A 5IIEA 3PWUB 3VXRB 4CADA 4O2CB 2IBZX 1WQVT 1L6ZA 1VENA 3B83A 1XF1A 3FO1B 3RL1A 1QACA 4K94L 3MOAH 3V5DA 5E4EB 2YXMA 3LEXB 4NN5C 3VXOA 4RWYL 3MUGB 5FGCE 1QFWI 3STLB 5GQBA 1BREA 2VITA 3WE6B 4JZJC 4U1MA 3MODH 5E8NB 3UYRL 4P59L 3T09A 3TCLB 1YEFH 5EO9B 4WCYL 4CDHA 4Q6IB 5FFLA 2R0WH 5T3XH 3VI3E 1RZKC 2NX5D 3PWNB 1NANH 1BD2E 1WBZA 4JO2H 4KUZH 1JFQH 1RIHL 1R0AH 1Q1JL 2E8ZA 4IOFD 2VDPL 3PGCA 1X44A 3LV3A 2IH1A 3DHMA 1T21A 4HZLA 5F7DA 3IFNH 1IARB 1HWGB 3I6GA 3UP1A 2MHAB 3TH3T 4K3DL 1PG7X 1FFPB 4HJGB 4I8DA 1Z3GL 3S5LG 3UJTH 3MTRA 4M8QB 1PLGL 5K59F 3VWKC 4BM7A 2V9RA 2X9WA 2W0KA 3GMNA 4R7DA 3OGCA 1F00I 4XMPH 3G6JA 1OSZA 3D85B 4GMSH 5EPMA 1ZGLB 1N59B 3QEGH 5DK0A 2F54D 3VFMA 1ZEAL 3UAJD 1D6EB 3DARA 1OW0A 3VXRD 4DGVH 3WKNA 4FQPA 1H0DB 3QIWC 4W4NA 1IKNA 3V6FB 3FQXB 5I6XC 5JQ6H 5SX5K 1L0YA 3H9YA 2C3GA 4C83B 4Y1AA 4OF8A 1RV6X 2XKNA 2HTKC 4WTZA 2R2HA 3BKML 4I77L 3IJHB 2Y06L 3MGOA 3IDMA 5TE4H 1XGUA 4Z7VA 1MAKA 1RURL 4WU7A 4FQLL 1GVIA 3U1SL 3WJJA 1KACB 5D2NE 1ULVA 2AK4B 1J88A 2BVPA 3ZE2E 5FUOH 3G08B 1UB6A 2X4OA 2B1HH 3CFIC 3OJVC 5DD5H 5F7EH 4M5ZH 2KPNA 2AXJA 3U7YH 3EDKA 1MIMH 4YQXH 3T0EC 2BK8A 2XACC 2NLJA 1WFOA 1F90H 3LB6C 3DROA 5FA4B 5I1JH 5F1SA 3VFVA 1IQDA 3LS5H 1YEGL 4JDTL 4JRXA 2Y4SA 1NAML 5ERWA 3HS0B 2X4TB 1YZZA 1JNLH 3FB7B 3IS0X 4M1DL 4K71C 1N7ML 2BMKB 4U6VH 5IMLB 4JFZH 4QRUB 4HIIA 1T5XA 4FNLL 3U0TA 1N3NB 2R2BB 3TNMB 3D85D 1BAFL 5K93A 1NEZA 4NZRH 2VOTA 3QNZA 2YD2A 3UZVB 4YBQD 5I8KL 1ZANL 2X10A 1CIDA 2RJMA 3K1KC 5HGDA 3H3KA 1J0JA 4JY5H 4PFEA 2N7BA 3EZJB 4U6YA 3WS3A 1Q72H 2VXTL 1I9EA 3MV7E 4U1LB 3UO1H 4Y19E 4HT1L 1X5XA 43CAA 5FYKU 1UH3A 1S8DB 2IPUK 3QXDB 5JIPA 3QXAA 5HGGS 5BZWB 3BI9X 4PJHF 3WUZA 4FTVE 4OAWB 3HAEH 4ENEC 1Y6MR 3KGRA 2AK4D 3BPLB 1LO4L 1YQVL 5EFIB 4QT5A 3FCTB 3B5HA 3AXLA 3PIQB 2VZSA 4AQ1B 5HI3D 2PCPB 2EE3A 2FX8L 2IMMA 4HK0B 1S7UA 2BERA 3DBXA 5KSBB 3OR6B 4JQVA 3L6FB 4KPHH 1QLEH 3NFPB 3V6OE 3KLHC 3QHTC 2C26A 1JWSA 5KG9A 2JB6B 1EDQA 4AM0B 5H2BB 1YA5A 1FAIL 5AAMA 2EH8H 2Q8AH 3IJSB 4PJXF 5KSUA 5FECA 3OHXA 5IHZB 4O2FB 1CE1L 4JG0H 4MQXC 1A9EA 5I8CB 2B5IB 4PY8J 4LCWB 5F96L 1EA9C 1NC4A 3KPPB 3MLWL 3VFUA 2D4DA 5B38A 1WCBB 4CBPA 3P40A 4I3RL 3U6RA 1BGXH 3KNBA 4NQDE 1ZS8B 1J8HE 1KUMA 4UILH 3MNVB 2X4QA 1SYSA 1O7VA 1FNLA 2WSKA 1D9KC 2ZCKH 3KHOA 3MBEB 4PLJC 5GGTA 2WUBH 5IVZA 3GJEA 1JHTB 1CDIA 2WANA 1CDCA 3IF1B 3B2UD 3GJFA 1KJ3H 3W0WA 3E8UL 3DX9B 4TOYH 1LD9B 4XBPA 2YA0A 3EAKA 4MCZA 4FFWD 1OP5H 3WKML 1FGNH 1OSPL 1DUZB 5EZIL 5E8PB 1UJ3A 2J1KA 1TPXB 1SQ2N 3HFMH 3W5NA 1QFWH 4AMKL 1AXTH 2EE2A 3DXAE 4Y5XB 4FZEH 4Z7OF 3TBWA 1UGNA 1HILA 2DTML 2CK0H 3NN8A 4RRPA 3IFLL 3MACH 2BCKB 1JUFB 2APXA 2VSCA 3OXSB 4O5LL 4KJWD 5A2LH 3LDBB 4HEPG 5DA0B 4XCEB 3FTGA 2H32H 2DQGL 3TLRA 5KAQG 4XVJL 1J1OH 4NIKB 3TWCL 3VFRA 3SDCC 5KS9A 3CU7A 4LCWD 4Z77B 5CEYB 1R6VA 3BEWB 5JIKA 3GIZH 1YJDH 5ADPH 4CJ0A 1JYNA 2AXGB 5B8CB 1C16B 3FQNA 3MBED 1J86A 2DYPB 5A2JH 2HRPL 3KPNB 3QEHB 4YR6A 3VMPA 4HIXH 2BSSA 1NGZB 2A77L 2W9EH 2NY4C 2B4CH 4Z7WE 3IRPX 3OG4B 5JXAL 3GKZA 4I77H 3DNKA 4RMWA 4Z7QF 1OTUD 1AIFA 1MHEB 2ATPA 4G6AD 1AO7E 3PP3K 4XVTH 4RIRB 1XF3B 5CP7A 3RU8H 2R2EB 1QO3A 4PS4L 5CJ5A 1LK2B 3VXTA 4HK3N 4E42B 3QAZC 4FFYH 5C1MB 1UM6H 3WHXB 5JW5A 4MD4B 4DEPC 1I3UA 3FB8A 1QSFA 4A2LA 4F7MA 1A47A 4U1IA 1YEGH 2IPKB 2R1XB 2XZQH 2MMXA 1MCNA 3OB8A 3D25B 3SKJH 1F6AA 4G8EA 1ZAGA 3BMWA 3CFDB 1D5IH 1CE6B 5TPWH 5FYJE 3MRFB 4OV5A 4J3SA 4YC2C 5IMOA 5HHPA 2IAMB 4J23A 2XWTA 3E3QC 3U2SB 4Y2DA 2MCPL 4OV6F 4M93C 2IFGA 4MMZC 2IBBA 3QDJA 2VH5H 1OLZA 3FQWB 4QGYA 1KEGL 3VD9A 5IJVB 2VDQH 4X7EC 3TZVC 1INEL 1P4BH 5E6IA 4N5UA 5E70A 4MXWH 1QRNA 2ESVE 3EJJX 1L7TL 1LEKB 2HFFA 5FO7B 2X44D 1U92B 2W9LA 4J4PA 5IUSA 3E0GA 3ZDYE 1I7UA 3HZKA 3MREA 2DYPD 4PJDB 4X83A 1AKJA 2JIXA 2R8SL 3F12B 1NL0L 4K3JH 4XZUB 3BXNA 2YPKB 4NRYB 5D6CA 3VE0A 1TVDA 2NW3B 4PJ5B 5HGHB 3VW3L 4MXQC 4N90D 4P3CL 2D0HA 4GSDH 3LKQA 4KY1L 4KJYA 1ZMYA 4YO0B 3U79A 3FMGH 3H7BB 5KANI 2L7UA 1K4CA 2AJZA 5KJRH 3DSFH 3EYUH 4KAQL 1YQVH 3MRIA 3U36A 4ALAL 4MA1C 3BVNA 2VISB 1X9QA 4R4NC 5DQ9A 4BA8A 5I1KH 4TNVF 3GMOA 4JO3L 1ZA6A 3ZE2F 2V7HB 3RUGB 3JVGC 4Y5VB 3QIUA 4U1SA 3MXVH 3BRGC 1PKOA 1RUQH 5GZND 3QZWB 5FKPA 1KB5H 5JHDA 1QNZH 2JK5B 1LHZA 1WZLA 5TF0A 2ZUQC 1PQZA 1A7QL 5F7KC 3GJFK 4TNWK 2H6PB 4HK3J 5GS2D 4C55A 2IAMD 5HYIA 1JPSH 4UIMA 32C2B 5LCVL 1CE1H 1CL7L 3GO1H 3MRMA 2DDQH 1UQSA 5HPMB 4U4BA 4NWUL 4WHYG 2DD8L 1WIOA 2LAAA 1FHGA 3TYGL 1DVFB 4APQB 3VXPA 4ONFL 1QR1A 5BRZE 2AJSL 3CAFA 4LVEA 3IGAB 2EH7H 1F3DJ 2A6JA 4PG9A 1KB9J 4KMTL 5E9DB 3SJVA 5JW4R 3FO0H 4H1LB 4X6CE 1CLZL 4M9PA 1G7LA 2UY7A 3QWOB 4ODXA 4PJ5D 2J8OA 4PRHA 4JG1H 4S10A 1OTTC 3QXUA 7CGTA 1Q9OB 3MOBL 5FV2A 1RUKH 5D7LE 3OKMA 3C60A 2Y5EA 4XP6L 2R0ZL 1UM4H 5HBBA 5JXEA 3GBLA 1EZVX 4OCWL 4GG6B 4ZODA 3L5HA 4U1HA 1CLCA 5CJOL 5FDWA 2EDKA 2H2SC 2VLKE 4GRMB 3AS2A 1G7MA 5GRJL 4NQEB 4UV4L 4NGHH 1NGPL 1G7QA 2WINB 3V52H 1KTKE 4ZNEA 1JWMA 4I0PC 1KJ2H 1MSPA 5LWYL 5ID1A 4DVBB 3UPAA 3TWCH 4IRZL 4LSTH 4GQPH 3IDGB 3RWHA 2H45A 3PXJA 4MAYA 4GBXB 3QWQB 3DLQR 3KPQA 4PJ7E 1DVFD 4APQD 2WAHA 2CDGB 2H3NB 3TN0C 3T2PA 5E2TL 2FYYA 3CVHA 5I1GL 4HCRA 1MAMH 3W9EB 3O4OB 1A9BB 4NM8H 5KTEL 2HRPH 1S7XA 3FN9A 4KK5C 3H6JA 1FL3B 4PJCA 1QBLL 2A77H 4HKBA 2I9TB 3IDYC 1SJHB 2DQIH 1MFAH 2ORBL 1DL7H 3LPGA 5T5NF 5I15L 1HKLL 3NMEA 4XHJC 1KNOB 2FEEL 5J8OA 1X7QB 1KELH 4LRIA 2G60H 3DURB 4QYOA 2DM2A 2OR9H 2J8UB 1XR8A 1SVCP 5I2IB 4TNVK 1CYGA 3I6LE 2B1AL 4XH2B 1YMMA 3GB7A 4S1SL 5DF0A 3S36H 4KRPC 4LKCA 3MRHB 3DMMB 1HXMA 1AHWC 3O9WB 4BQ8A 3TVMB 2VQ1A 4JDZA 2DQDL 1QTYT 1QLFA 5JPMA 2A9NH 4UI2A 5C07E 4NUJB 3SGJA 1PW3A 4NQED 3I2CL 1Q0YL 2E6JA 4ZFZA 4DCQB 4RDQF 4RAVA 1ZHNA 3VXUE 1DCLA 1KIQA 4U6XB 1N5YH 4JDVB 1DQLL 4Q2ZB 1NH6A 4RAUA 5FYKD 4XVSL 3QUXA 4LF3A 4UZGA 1CZ8L 4QLRA 3T4AA 5EIIA 1OB1B 1CR9L 2VE6A 5JMOC 4GBXD 1X5JA 1N5AA 1WAAA 5M7QA 1L7TH 1S7SB 4HWBL 3QCVH 3I02B 5TE7L 5C0EB 1BM3H 2IPUG 5IHBA 3FQRB 3A6CH 5DJAA 3X14A 5IMMA 4NKOA 1SM3H 2OK0H 1T7XA 2AAVA 4HAFA 2CKBA 3EDEA 3N1FC 1IC4L 1TCMA 4MA3B 2O5ZL 2I24N 3HG1B 4Z7WF 2WIIA 2NXZB 4BZ2H 4ZG1A 4G6ML 4LQFL 1IGJB 4BFIA 1IMHC 2AGJH 4DTGL 1I8LC 3DMMD 4JO1L 1A7OH 4Z78B 3O9WD 5DD3H 3TVMD 1L0XA 3UYOD 4NRXA 3L7FB 3PG2A 3HRPA 4GUPB 4GW5A 5CEXB 1VFBB 5IBUG 5D1XA 2FR4A 3MRLB 5GGQH 5E94A 5D7JB 3GSOA 2AJYL 3KYOB 4QO1A 3I50H 4UQ2B 3QR2A 4GW1A 3PABA 3QDGE 3RKDD 4G7VL 2ZSWB 5EZJA 4AT6A 1MFBL 1Z2KA 4U1GC 3O2WL 3RDTB 4KKAD 3BH9B 3T4YB 2AEWA 1WZKA 1B2WL 1Q8MA 2EDEA 2UWEB 4LHUA 2H41A 3W82A 1YY9D 5GZOD 5HYQB 5JIIA 5MP6L 1LP9E 1MI5E 2Q6WA 3PUCA 1GGYA 1RMFL 1G7JA 3KJ4C 5CINH 1A7PH 3MV9E 4JFQA 3GM8A 4KMTH 1AR1D 3BKJH 2UVFA 5I30L 3HE7B 5IVXE 1ZA3B 4K9EL 1IGFH 1X6LA 5IKCA 5FYJL 1NBZB 4OT1L 3ZDYF 1EEUA 2V5SA 1TENA 3MOBH 1UXWB 3A67H 4BELD 3OBAA 3TA3A 2NXZD 1MLCA 1G9MC 3RWCA 4ONGL 4U3XA 1JZ7A 5FGBA 4XP6H 4FQHB 1FG2A 4DVRH 2KQNA 4W4OA 3GSNL 3R0MA 4IRSA 1AD0A 1VFAA 3GMQA 4YDKH 3L5WB 5DHYA 3VRIB 5ICXA 3UPRA 1BP3B 4WTZG 4Z7UB 5LKNA 2I07A 2BHZA 5ANMB 1CN4A 5D7JD 4JRYB 2LTQB 1F4XH 3W5MA 2BVYA 3UTSE 3HLAA 2DLFH 4GW4B 5LWYH 5L88L 2FSEB 2JB5H 4LVNB 1WTLA 1U3HC 5MEQA 1LO3H 2OR8A 2GK0A 3C5SB 4K7PX 1ORSA 4HULB 3OKOA 2FB4H 3MFGB 2BY2A 4PJIA 5JQHC 4X9HA 3FQTB 2HLAA 3OKNA 3RDTD 4UQ3B 3RNQB 5DK2B 3LKPB 5D1ZA 3WJJC 5ALCH 5EBLA 5JR1H 4OQ1A 3QQNA 1BBJA 2OXHA 2V5TA 1NBVL 1JTOA 2QTEA 4HS6B 2V2XB 4KQ4H 4C56B 3HE7D 2ORBH 4F3FA 1I9RH 1HKLH 2XFXA 4NFBA 2ZPKL 1CDUA 3RNKB 5FUCE 3INUH 3NAAH 5H35B 1OAKL 3S37X 1UA6L 4PRBB 1LQSR 3CDGB 4X6CF 5C0NC 4YHZH 3AU1B 2Z31D 5IM7B 1RJLB 4G80B 2A73A 4KVCH 3L3GB 3IDIA 2FD6H 1ZLSL 1EJ6A 4HF5H 3BP6B 2ENSA 2X7LA 2Y6SD 25C8H 3BN9C 5F1IA 2ZUWA 4QF1A 1KT2A 4L3AA 3WXWH 4LL9A 2CIIA 4GKNB 1A7NL 5K9KB 5DFTA 3CH1A 3VD5A 3AB0B 5C0JB 1V8HA 1C5DA 3I2CH 1Q0YH 4JRYD 4LPWA 1EHNA 3T0AA 1QUNA 1LO0H 4G42B 2DIAA 2GY7B 5LAXA 3WN5C 1XGYL 1Y0LA 4Z0XB 1A3QA 1CR9H 1S7WA 5CZKA 2CR3A 3ZTNH 4FN0A 4XC1L 4B50A 3PWJA 3LH2L 5AUMB 2HKFL 5CMAA 4BUHA 2IALA 1DQQB 2GSIA 4PY8I 3LEVH 2SEBA 4PJ7F 1LE5A 2ADIB 3NZ8B 3N1PC 2WBJB 2FWOB 4LLYA 4OUUA 5C0FA 4C56D 2Y36L 2Z0BA 1Q9WB 4XWGH 2DWDA 1GL4B 4JZNB 4Q0XL 3SDAA 5B38G 4I48B 4N8VB 3REVA 1E6OL 1IC4H 3H2WA 4K3HA 4TTGA 2EKJA 1MLBA 4G6MH 2BXZA 3L9RB 1JNHA 1MRDL 1JNNH 1MWAB 3P9MB 3QCUH 4YK4B 5DMGD 4GXUN 1BFVH 2OTUB 4JCMA 5JHLL 3GRWH 1S5IH 5D5MA 3RWEA 5I76A 4MNGB 1I7RA 1LE9A 3VFOB 4A6YH 4EUPH 3OR7B 5CSZA 5ETUA 4N8CL 4F9PA 1JF1B 1FBIL 3OX8B 4H88H 3EO9L 1QBMH 4UT6L 5IEHB 5EU6E 3RVTD 2FRGP 4BQBA 1BVZA 2PXYA 2W0FA 2V17H 1T3FB 3W39B 1GCFA 1AC6A 3VH8A 4B53A 3BZ4B 4Y1AE 5IW6A 3G6DH 4Y4HB 4AEEA 2OXGA 3VFSA 4HWEH 5HYFA 2QSQA 3T0BA 4BK5A 4RRPG 4G5ZH 2I60H 4NNYA 5SWQA 3L7EA 5KN5A 5ICYA 5DSCB 4X7FC 1IM3A 1JRHI 5I30H 5IQ9B 1KG0B 4LARL 1XF4B 1KTDB 2OR7A 3SGEI 1TZGL 5F7NC 4OGZA 4HKJA 1QD0A 4OCRL 4OD3H 2XZZA 4D0CA 5I9QB 1A6ZA 4KK9C 3JV4B 4XCFH 3QISA 2EYTA 3FHQA 4ORGB 5ESAB 5IESL 3WUWB 5MENB 1GZPB 5FCUL 4JRXE 3X11A 3GSNH 3MCG1 5KVFH 3BE1L 4NCC2 5F21B 4NJAL 3MLVL 1QVOA 2UUDH 4K23H 2P8MA 5TDNA 5BJTB 4QOKA 1PY4A 1XZ0B 1AI1H 4OI9A 2CLRA 1ADQA 1Q0XL 1FVDB 1ZVSB 4KQ3H 1LNUB 1YUHA 5ICZB 2BZDA 4H5SA 4FQIL 3WHE0 2VO5A 3NABL 1WT5C 1J5OL 2UYLB 3RVWC 3HRZB 3I3EA 1J87A 4OD2A 3BUYB 2X4PA 1FSKC 1EMTH 5CJQH 1UACL 3K2UH 2FX9H 4WRLA 2GYSA 4TVPE 4Y4HD 5HHXH 3QUYC 3BZDA 4P46C 1KGCE 5KSVA 2FHCA 2P8LA 4UDTA 3DIFA 3QUMA 2WBWB 4ONHB 5GS0D 4BQ9A 3SOBL 5IGXH 2RFXA 1W72A 3F7YB 4BKLB 4ZXBC 1RAMA 4JN2B 1LP9F 4EDXA 1IT9H 3GK8L 4D9RE 1JE6A 1ES0B 3MNZA 4RFEB 5LJYH 2R69L 4DK3A 1A22B 3QPQC 2CXGA 2QHLA 3QXVA 3TIEB 4P4RA 1A6AB 4QXGH 5IVXF 43C9B 1BFSA 1P84J 4NN5B 2FIKB 4NHUA 1A3RH 4XBGA 2VLLB 5MEND 1RK1B 4X6EB 2YR3A 3P4MA 1JZ4A 1EXUA 4OF0A 1CK0H 5DEGB 1K6QH 5EOTA 3SO3C 4LFHG 3QSKB 3WLBB 5E6IC 1M7XA 4P9HL 1A7NH 1W0VA 2NX5A 4DZ8A 3DGGB 5TDOA 3H8NA 2IGFH 4YHPB 3MJ9L 1HKFA 5IR1A 1Y6KR 4KZDL 1OAYH 3LRGA 2YSSB 1A6UL 2O93L 3R06A 3SN6N 5I1EL 1FYTE 1WBYB 3F5WA 5IB5A 1RVFH 1JMZA 5FGRA 1HI6B 5CFHA 2MOVA 1IBGL 3BAEL 3SE3A 2EO9A 1YY8B 1JYXA 4LSVL 1YECH 1ETZB 3Q1SH 3OB0K 4WFHD 5L0QC 3TBTA 3VWKB 4LIQE 1K3ZA 2C4FT 5DO2D 5GS1A 4BZ1H 3EIFA 2VDLH 3FKUS 2EIZA 4ODVL 5L8KB 4XPAH 5F9JA 1ZWIA 5MERA 2VLRE 2F54A 4JCLA 3BDYL 3P77B 3PWUA 3WXVH 1YEDB 3QIUC 4R8WL 5DVOA 3X13B 3GNML 1T1WB 4NO3B 4LSUH 4FP8H 2CKNA 5EO1B 2APVA 4P2OC 5I6XB 3FO1A 4M5YH 1U95B 3LEXA 1J0IA 2UZYB 1JMXA 3SY0B 1RY7B 2GHWB 3MUGA 3STLA 3WE6A 1UVQB 1GPOH 5E8NA 1MQKL 3TCLA 1QFUH 2WLYA 4Q6IA 5E6ZA 3HHRB 3BISA 3PWNA 4N8CH 1DBAH 3MRGB 2EDFA 2XIDA 4JREC 3QRGH 3UTQB 4YNYB 2A38A 2YBRB 1WFUA 4X7DC 4Z95L 4GAGH 4R3SB 4XP1L 3H9ZA 5DMIL 1QSEB 2MHAA 5I75C 1N64H 2RB8A 4NQSA 1FFPA 4HJGA 1B0GB 4WFFD 3WD5L 4K71B 3QDME 4OSUL 4M8QA 1UWXK 4W6YB 5JPNB 3VWKD 1ED3B 2F9BT 3DYPA 3KPSE 1WICA 5B4MD 4HWZB 3D85A 1ZGLA 1HSAB 3RY6A 1N59A 4PRPB 5HI5C 3MRBB 1YEEL 2IF7A 1D6EA 1RZ7L 1PSKH 3N1QC 3VXQB 4KRMB 2J8HA 1HQRB 4LNRB 1H0DA 1TETL 1Y18B 2NR6C 3KXFA 1FYHB 4NFCA 3FQXA 3TJEL 4C83A 4JN1H 1JRHH 2HTKD 3FN3A 5FCUH 3A6BL 4MNQB 3IJHA 1DP0A 1U8KB 4NJAH 3ARWA 1YEIH 3UTZB 2XRAL 1GYAA 4RMSA 5C09B 3J7HA 4H20H 4H8WL 2AK4A 3CGTA 3QDJE 1FNHA 2VKWA 3DGCR 4G9FE 5D7IB 2CRZA 2K7QA 4M3KB 1IGML 2DKUA 3ROOB 3LIZL 4OLYL 4NNPH 4WHYH 3T0ED 3VI4E 1GIGH 3WMSA 3QHZL 3LB6D 5FA4A 1QSED 2ZG3A 4D0DB 1JGUL 1CFVH 3MUJA 5EWIH 1IC7L 4LRIC 1CU4L 3HS0A 4M7KL 4N8PA 3FB7A 4EOWL 3GI8L 5CEZD 5IMLA 1RUAH 4QRUA 1IAMA 1DQML 4XP5L 5C6TL 2XOTA 1N3NA 5BZDB 2R2BA 1X5IA 4NM4L 4PRPD 5CSBA 4XP9H 1ACZA 4D9QD 4MA8H 1HHIB 2R69H 1D9KB 4HFWB 3JUZA 5DHVA 2EIEA 4I0KA 1T03L 1GOFA 4HX1A 2OZ4H 4ZTPL 3KYKL 5BV7H 3QUXC 4U1LA 1T1XB 4MNQD 5JHDE 1S8DA 4CUCA 1JPGB 5C2UB 1NJ9B 3QXDA 4CNIB 3CSYB 2X1WL 5BZWA 1ZT1B 3IT8D 5C09D 5ACMA 4OAWA 1XFPA 4ENED 3EFDH 5EFIA 1F58L 3IXAB 3FCTA 3PIQA 3WSQH 1TJIH 2DN7A 2PCPA 1T2QH 5DVLA 2FBJH 3GSWA 4HK0A 1A64A 5KSBA 4X5WB 3OR6A 3L6FA 3NFPA 4FQ2L 1XMWA 3KLHD 1MFCL 1V7MH 2JB6A 4AM0A 5H2BA 2KH2B 5GISL 4HMDA 4XPHH 1N2RB 3DI2B 5AG9A 1WUNT 2P24B 1WGOA 3D69B 5FUZL 3IDUA 3IJSA 2EDHA 2PW2B 5FHBL 4HIJB 4J1UB 2E7MA 4O2FA 5IHZA 2XN9A 3MLZL 4MQXD 5I8CA 1MCKA 5F7LB 4LCWA 3P30H 3DTXB 4NHCL 1WCBA 5DC4B 1ZS8A 3MRPB 4IOIB 2C3WA 5D8JL 3BDYH 3MNVA 2XWJB 2CH8A 3GNMH 4DQOL 3IXTB 5C0GB 1D9KD 3MBEA 3BYTA 4PLJD 2ADJB 5DFWH 3O3UN 3FB5B 3NACL 1JHTA 4R90L 1HYRC 3GSVB 4BZYA 4JQIH 4N0UE 2NY4B 3OJDA 3DX9A 2VXSL 1FO0B 1LD9A 1EGJL 2DQCH 3BD5A 4KGLA 4KRLB 5IQ7L 3KR3H 5DRXB 1JF6A 1DUZA 1E28B 1CVRA 3H0TB 4ONOA 5E8PA 4UTAL 1RHHB 5C0AB 1KCUH 2D9QB 2QKIB 3K81A 1UH4A 1V3JA 1JGLL 3LPWA 5JW4Q 5F7FA 4HG4K 4KXZI 4MJIA 4DGIH 4Y5XA 1MOEA 2R4SH 1NGXB 4C57C 5AZ2L 4XP1H 3WV0A 4X4MA 5DMIH 4DEPB 3C08H 2BVOB 2OI9C 4PRIB 2MQCA 3RX5A 1U8LB 3DECA 1JUFA 3D9AL 3OXSA 3CXDL 4PJCE 2YUXA 3SDDC 3WD5H 3PDDA 4LGRB 4XCEA 4X5XB 2F5BL 2NY5C 3QB7C 4HJ0C 2EZ0C 4M93B 4W4OC 3SKNB 3VDBA 1HN1A 1GXEA 4Z77A 3FB6B 5CEYA 1TQCC 1CXHA 4XPFH 5CWSB 3TZVB 4MQSB 3BEWA 3SKOB 4LASH 5GGRB 1YMME 2AQ3A 4I9WD 5B8CA 5MEPB 1C16A 3MLYL 2DYPA 1GGIL 2IC2A 3KPNA 1JK8B 1AC0A 3QEHA 4HUNB 5K33A 1NGZA 1JIBA 2NY4D 5EUKB 3DUSA 1Y6NR 5CCKH 4N5EC 4LIQL 3TT3L 1GGUA 3B2VL 4LLAA 1MHEA 4P2RB 3CDFA 2N1KA 4RIRA 1XF3A 1ACYH 1XEDA 2D03H 3JV6B 2HH0H 5C0AD 5HVFB 1LK2A 3GMLB 4MA1B 1I1YB 2KZ1B 3LIZH 4PJBE 4TUOB 1WAAE 4E42A 3WHXA 1MCRA 4MD4A 1O0VA 3QUKB 4NZJA 4PRID 1W0WB 2HWZH 3RZCC 3CJJA 2IPKA 2R1XA 3AUVA 1FNEB 3DHJA 4P57B 2YD5A 3RA7L 2F8XC 3D25A 4M7KH 3CFDA 4AK1A 3A6OA 1CE6A 3MRFA 2ADFL 4MDJB 5CS7A 4YFLF 1G9MH 3U2SA 4YDIL 4GS7C 4CMHC 3U82B 3FQWA 5C70A 2QEJA 3TZVD 5T3ZE 4OTXH 5EC2B 2Y25A 3WBDA 3K4AA 3P73B 5DJXB 2VDRL 4YAQB 4JHWH 1F3JB 1LEKA 3JUYA 5FO7A 1U92A 4Q9CA 3RBGA 1PVHA 4XNYH 1HSBB 2HFGL 4PJDA 3BFOA 1J18A 4D3CL 1LMKA 3F12A 2WMPA 2R1WB 3MCKB 3KLSA 3U0WL 2YPKA 2EDRA 3QG6A 4PJ5A 4MXQD 3T0VA 4CL7A 4YBLC 4HWUA 1UKTA 3EYSL 4YO0A 4P2RD 3F58H 3H7BA 4WY7L 1UWGH 5KVEL 4MWFB 5L2JB 1P6FA 1ZXQA 3QQ9C 5SWSB 4QCIB 2BVTA 2E9WA 2OP4L 2VISA 3OKDB 3IU3B 5F44A 4FQCL 1QP1A 4XAWH 3BZFB 4IIQC 5ADOL 4KI5E 1HZHH 2V7HA 3RUGA 4Y5VA 1HHJB 3RX8A 1CF8L 2I5YH 3SDAC 5K9JH 3IFPB 2MQ0A 4C59B 3QZWA 5A2FA 1G6RB 3R1GH 1J1XL 2JK5A 3VI4F 4I0PB 4DKFL 2H6PA 5IT2H 3ZDXE 2JTDA 4UT9L 32C2A 2ZUUA 1I3GL 4LP5A 3WNLA 1KTLB 2AJVH 2W07A 1NBQA 5HPMA 3G5XB 1S7RB 4YHOH 1DVFA 1VSCA 4APQA 4N1HB 2P1YA 3TN0B 4MD5B 5HDQH 4YXKL 4O02L 5I0DA 2Z91B 4F9PC 2CO7B 4AL8L 2P49B 3IGAA 1OWWA 1S3KL 3DVGA 2NY3C 1PYWB 3ARXA 1DDHB 3HCVB 4Z5RB 1K8DB 3NACH 5FIEA 1ZLVK 4Q9RL 5E9DA 3TPKA 1K5NB 1QKZL 5DJZB 3IDYB 4H1LA 1A3LL 4UAOB 2VXSH 1QPPA 4N1CA 3QWOA 1WWBX 4TVPH 1L7IL 1EGJH 2PXYC 1OTTD 1Q9OA 5IHUL 1FV1B 3VMOA 5EBGA 3MLXL 3LKRB 4NKDB 4UTAH 4HKZB 5BVJB 4ZQKB 2BNRE 1F4WH 2VXQH 2EDNA 5SWSD 1AHWB 4F7TA 4GG6A 4R7NB 2XICA 3V4VH 5AZ2H 2ED9A 1RFDH 5L9DL 3S34H 2H2SD 2YPLB 4GRMA 4UBDD 4KC3B 1GH7A 1UG9A 4NSKB 4LVHC 3LRHA 1HCFX 4NQEA 1I85C 3SE9L 3CXDH 4ZUUB 2WINA 1ZOXA 5HSFA 4I0PD 2FX7L 3QQ4B 1CQYA 2NY6C 4DVBA 4QTIL 2AJUH 4P4KB 4UU9B 1FRGL 2QQKL 3X12B 3IDGA 1CLOL 5C9KA 3PWVB 3FAXA 3KJ6L 1U91B 2FATL 4PYGA 5DD1H 3LS4H 4GBXA 4P9HC 2FEEI 3MPCA 2CDGA 2H3NA 4JHAH 3TN0D 5I74C 2YD8A 3EZ8A 3JWDL 1T7ZA 3W9EA 4RGNE 2BSED 4L8DB 5GGTH 1MRFL 1A9BA 1SVZA 1C1EH 1FL3A 2XA8H 4R6UA 3NTCL 2IANE 2I9TA 1QHOA 2BFVH 1SJHA 2J88L 3VXSB 4ETYA 1YYMH 4XHJD 1P53A 3QPXH 1PZUB 1KNOA 3BHBB 2Q7YB 1X7QA 4I2XB 2GT9B 1IQWH 3NFSL 3DURA 2VR4A 3JWOL 4YXLL 4JKLA 2J8UA 5I2IA 2BRRL 3GSQB 3HNTL 4XH2A 3HMWL 5FDYA 3EJZC 3MRHA 3DMMA 1CVSC 2CJUH 3O9WA 3TVMA 1NCUA 1UCTA 5GRVL 4ZFFB 3TCXA 1OY3B 4N9GB 4Z7NE 1QFWM 5KZCB 4NKIL 3EYVB 4F58H 2YPLD 2PR4L 3ES6B 4CADB 1RULL 4NUJA 3TBVB 5IVOA 3G9VA 4M7LH 5DQJB 4HG4J 4PRNA 1FAKT 1A5FL 4DCQA 3GBNL 4JDVA 2E27L 1SBSL 3Q48A 4P4KD 2GJZB 3C6LC 4KUCD 4U1GB 4PJCF 1OB1A 1EAJA 2OL3A 3ZMRA 1BZ9B 1NGQL 5H37G 1S7SA 1FL6B 2B2XL 2DQUH 4X80L 2R29L 5FUCC 3I02A 4LSPL 3MRNB 2VLMD 4KHTL 3KJ4B 5C0EA 5A2KH 1T21B 3WIHA 3FQRA 1WK0A 3MMEB 2E9IA 2W92A 1U58B 4TULL 4WFEE 4JPWH 4WTXA 3VXSD 1NAMB 2X9XA 4MAUL 4OLUH 3WNKA 3GUTB 4MA3A 5I66B 5J3HD 3HG1A 4XPTL 1NCCL 2AW2A 1UKQA 5FYLH 1MCPH 1IGJA 5E1AA 1CFSB 2NY1B 5GS1C 1S9KC 4Z78A 3C5JB 2NY7H 1TITA 5I18H 3L7FA 1OCWH 3V8CA 4KDWA 4GUPA 5KZCD 5CEXA 1VFBA 2WP3O 3MRLA 2JJTA 5CJXA 1RZFH 3VGGA 2DQTH 5D7JA 2C5DC 4OCLC 2ICWJ 5C6PB 4AG4L 4PJBF 3KYOA 4G8GB 4UQ2A 4HS8L 1U3HB 2B8OT 1P5UA 2ERJC 3V2AR 2Y72A 3RDTA 3H7LA 3BH9A 3T4YA 5I1HH 1AGEB 3MFFB 3M1BB 4TPRL 1ZHKB 1MCFA 4YHKL 2UWEA 3ULVE 3MRRB 5HYQA 1FE8L 4YXKH 4NQVB 5GRVK 4ACPA 1GC1C 4AL8H 4DKEH 2X4OB 3WFCL 1S3KH 1BECA 2IQ9L 1RU9L 5DDHB 2X41A 4Q9RH 3LD8C 2BVEA 1P1ZB 4QOKE 1A1OB 3SKUD 3HE7A 3PV6B 1ZA3A 1XGPB 3RP1A 1NMBH 1L9NA 4J12A 1NBZA 4YHML 1ORQB 3ABZA 3BDBA 1UXWA 2F53B 5T1DL 3AM8A 5E03A 3OKKB 2V6HA 4WI4A 3ZTJG 4QXWA 4HIIB 4JPKL 4FQHA 1WF5A 4PJFE 2VN4A 1KEMH 2D0FA 1JTTA 4F33B 5DD0L 3RAJH 4PGJA 4GAYB 2CMRH 3P3YA 3SBWA 1QA9B 1BOGB 1NSNL 3L5WA 3KPRB 4UV7H 2DQJL 5I1IH 4LHQB 3VRIA 4G6JH 3KHQA 2V5YA 4LLVB 1XR9B 4Z7UA 3S8WA 1Z9OA 1IILE 5IG7B 5ANMA 2D0GA 4AJ0A 4JRYA 1IGTB 4HD9A 4P5MB 4G8GD 4KI5F 3SDYL 3ZE0E 4GW4A 4QRQB 2FSEA 1BWMA 4HC1A 1U3HD 2M26A 2HJFB 3CFKB 3DYMA 1P4LB 3WN5B 1F3RB 3C5SA 5FF6B 5LGJB 4U7MA 4OLZH 1U0QA 3FQTA 3RNQA 4HJJH 4UQ3A 3FT4B 5DK2A 3P9LB 5C0CE 3LKPA 1KXQE 4NN6C 3PF2A 2CRMA 5DC0A 2NW2B 2EC9U 2APTA 4YHLH 1PGRB 4BSJA 4V2BA 3VA2C 4HS6A 3HI1B 2V2XA 4QHMB 4KK6C 1KN2L 4C56A 4QHKJ 3MJ7B 5GRYA 5EZLB 3QNYB 2XQBH 5F9OH 3HC0B 3RNKA 5KG9B 5H35A 4RQQB 1ZSDB 1KSRA 2E7LA 4E5XB 4YXLH 3CDGA 5C0ND 2F53D 1CLYH 2EC9T 3AU1A 5T33H 5IM7A 1RJLA 2W91A 4G80A 4YEFA 1I7ZB 3L3GA 4V1DE 3CPLB 5C0IB 4NWTL 4LCYB 5TF1L 2YXFA 4X7TB 1QRKA 3BP6A 3HNVL 4W68A 3OPZH 3BN9D 5FK9B 2VDKH 4K8RL 3FHAA 2ZUTA 3KPRD 3T04D 3DV6B 2IWGA 5DQDH 5C0DB 4G9DB 4GKNA 5GHWH 4LSDA 1EVTC 4N68A 1RULH 4FMKA 4K55A 5K9KA 1LDPH 4EDWL 5C0JA 4DKAA 3OGOE 5HDBE 5EU7E 4X8JB 2F54E 3MYZA 5I19H 3HA0A 4G42A 3HNSH 4Q9QH 2E27H 3VXRE 3B9AA 4JVPA 9CGTA 5E2JA 1X5KA 4QXTB 5TQ0L 4Z0XA 5CJBA 4OIIH 5I8OH 5JW3L 2ZCHL 4WUKL 5AUMA 3PP4H 1IEHA 4MNHB 3CVHH 3QDAA 4HCRH 4R9HA 1DQQA 3FAWA 3BGFC 4X7SL 3ET9F 2ADIA 3NZ8A 3DJ9A 2WBJA 3QDHA 2FWOA 3C8KB 4R26H 1Q9WA 4H0HB 1CBVH 5FYJU 1AGDB 4JZNA 1HCVA 4I48A 5D7SH 2ENYA 4N8VA 2IPTL 1E27B 5EU5B 3L9RA 2BJML 3IB4A 2BX5A 4YPGB 2C7UB 4XCCH 4KK8C 4BJLA 1MWAA 3P9MA 2OTUA 4RISL 4J6RL 5F70A 3WS6A 3GHBH 1U6AL 5EORH 5GRXG 3K8KA 2XPGB 4MNGA 4UOW1 1T4KB 3VFOA 3NGBB 3OR7A 4LPUA 3L3JB 3CU1A 4F8TA 2JCCE 4AG4H 4LAQL 1JF1A 4NBXB 2MNUA 2PTUA 3OX8A 4KTEL 5DRZB 4Z7NF 4UINH 1BBDL 1FNAA 1JCKA 2D7PA 2BSSB 2ZUSA 3L3OB 5IEHA 1JGEB 3O3BA 4UNVA 5IWLC 3Q6GH 4YGVB 3W0WD 3S3SA 3QQ3B 1TVBA 4FFVC 1X5GA 5C9JB 3NCEB 4JQXC 4M61B 4CMMB 1P4IL 1T3FA 3W39A 1FSKB 2M1KA 3BZ4A 4PRDB 5BO1L 4FQQB 4Y4HA 1FE8H 3QUYB 1TPXC 4P46B 4JANB 4HPYL 1V3MA 1QO3B 1MNUH 3VFTB 3WFCH 5T5FH 1Q9LB 3F7RA 3AVEA 1RUML 5DSCA 5E99H 4ZXBB 2CLZB 1HINL 3BIBX 1MCDA 4M48L 4X4YB 1DN0B 3QCTL 5IQ9A 1FVEB 4PB0L 5IEKB 1XF4A 1KTDA 5JW4M 3DVNB 4M62H 1FGVH 3ZYJA 4OF5A 2CKBH 3S3JA 2X4RB 1F6AB 1H3TA 4G8EB 4YE4L 2ZJSH 4KK9D 4HBCH 5DJYB 5ACLA 4Q7DA 2C3HA 4ORGA 1EO8L 1DBKL 1EBPA 5ESAA 5T3ZH 3VFGL 3WUWA 5MENA 5D2NB 1JV5B 1HYSC 2LE9A 1BVLB 1GZPA 1P7QB 5E00B 4XPBL 3RY5A 1P2CB 1RJYB 3SO3B 2G75B 5BJTA 2Z92B 4ZYKB 3ROLB 1IEBB 2GEEA 1QRNB 3LQAL 1XZ0A 2Z35B 3MXWL 4HIEB 1T7YA 2R0LH 1A0QH 1ZVSA 4WHDA 1LNUA 5ICZA 1X5HA 4OLVL 3OSKA 1NLDL 2CDFB 2UYLA 5SWZB 3RVWD 1B4RA 3HRZA 1C5CL 3N9GH 4PBXA 2HYMA 3VG0H 3BUYA 5J7CC 4FMFA 3ZL4L 5DTFB 1KXVC 4NPYB 4PG2C 3IFOB 5L0QB 3QUYD 4P46D 2AABL 4ONHA 3WDIA 4Z76B 5DJ6B 2XT1B 1N4XH 2X09A 2R4RL 3F7YA 4BKLA 1XGTB 3H9SE 3ULVF 4ZXBD 4TSCL 1KFAL 4JN2A 4BFBD 4KTDL 1EH9A 5HHVH 2XZCH 1N6VA 3ARRA 2VSDA 1ES0A 4RFEA 5I16B 4ZO9A 2IFFL 5GZNC 4GXVH 5C2BL 3TIEA 5GSVB 4IBLT 1A6AA 4P2OB 43C9A 3O6MH 2RBLA 2Z8WC 5CZVL 1NCBL 2FIKA 3X3FL 2J3SA 4FTVB 4N0YL 3KYMB 2VLLA 4KVNL 1AP2B 5IVNA 1RK1A 4X6EA 1BOYA 2NY5H 2QSCH 3ULVL 4PPTA 3IJYB 3Q6FB 1OM3H 5DEGA 2N7AA 2E5EA 3WLBA 1RK0B 4HW6A 4PJFF 5DEFB 2FLBT 1BLNB 1QRND 3DGGA 1JHKH 3O81A 1DBMH 4YHPA 3GIVB 4L5FL 5DK3A 5EOQL 4Z18A 2AEPL 2YSSA 4IHOB 4LFHD 1WBYA 3REWB 5E2VL 3EOTL 1HI6A 5SWZD 5EN2B 1OQOA 5I75B 3ZE0F 4QGTA 1YY8A 2VUYA 5HHQB 4NQDB 2FO4B 1J8HB 5DWUL 1ETZA 2V9TA 4S1QL 3VWKA 4NOBA 1QEWB 4F57L 3WFHB 3QZWG 2GKIA 2ZG1A 5JTWA 4LCUB 1LGVA 1SY6A 2W65B 3JXAA 3AC0A 4RGOH 1CFTB 4WEBH 4Y5VC 1YEDA 1Z0MA 3X13A 1URLA 4NO3A 7FABL 4GRLA 3BKCL 3RVXC 4XPGL 2YHGA 5EO1A 3BSZL 4P2OD 2VDMH 3B9KC 5DJ8B 1FCGA 1WV7T 2F19H 1U95A 4WEUD 5DUPL 2IBZY 3FT3B 3NCYS 4FTVD 3SY0A 1CXLA 3O2VL 5CP3A 5ITBH 1JGVL 4RISH 3L1OH 5D1QB 1OOAA 1UVQA 5EDXA 3F7QA 3NCJH 4XC3L 1P9MC 4H1LG 3FOMB 2QBWA 3JWDC 4HUMB 5DMKB 2YRZA 4K3EH 3T65B 3MRGA 1VB9A 4LAQH 2GUOA 3F62A 4M7JL 3UTQA 4YNYA 5T3XE 2YBRA 4KDTC 4BYHA 1Q94B 1RUPH 4R3SA 4PGCB 2CRYA 5EBMB 2VXVH 1QSEA 3THML 1WWAX 4NC1C 3T1FB 5C71A 5F1NB 5HDBF 1OAUL 3JWOC 3VXNB 3MA7B 4EXPX 5BO1H 4NQDD 4R97C 1B0GA 1J8HD 5JORB 3CSBA 4GLRH 1GGBL 1ED3A 4PREB 4LKCB 4N90E 4OJFH 4NDMB 5ISZB 5DC9B 4LDLB 2VC2H 1FZMB 3H3BC 1HINH 4DJMA 4HWZA 1U2HA 4LU5H 2ZUVA 3HZMA 4EUPB 1HSAA 4WW2C 3MRBA 2QQLL 1BZ7B 3EYOB 4NJ9H 2DM7A 5J57B 3VXQA 1FPTH 1HQRA 4LNRA 1Y18A 5E2UH 2NR6D 3PDOB 4W70A 4ZMAT 1DANT 3ARPA 1AO7B 1IGYB 2YD1A 1IFHL 4PLKD 1HNGA 5E56A 1NMAL 1MCOL 4LF3B 2YMXL 4MNQA 3K80A 5D1QD 1U8KA 3ARYA 4JKPH 1HK6A 1D5ZB 3UTZA 2HG5B 4Y88A 3BGMB 3ZKQD 3VA6A 3P4OB 1MJ7H 4MA7H 1LK3L 4AZ8A 5D7IA 4M43L 4U3CA 3FT2B 3HI5L 4HDIB 5DJAB 2FLRT 3HR5B 4D9LH 4TSAL 4PP1D 2YKLH 1YPZB 4LCIH 1U2CA 2JCCF 3HMXL 1DSFH 4D0DA 2BRQA 3X3GL 1M4KA 2LU7A 3MBXH 4AEIL 3FJTA 3K46A 5CLTA 4L8SB 4PJ5E 2ESVB 3GSNB 3SHSA 3K1DA 2AABH 3DUHA 3O9WC 5ISZD 4OGYH 3TVMC 5BZDA 3EOBB 3VWJC 4E9LA 4TSCH 4Y2OA 2AERT 4EBQL 2FR4B 2D4FA 1HHIA 1G84A 1PBYA 3GSOB 1GSMA 4HFWA 1DN2A 1JHLH 2CSPA 3IDNB 5A1AA 1AR2A 1AO7D 3RUGE 2VZVA 1CDHA 3V9FA 4PGZA 2EC8A 3ARDC 4M1GL 4XB8A 1T1XA 2FNBA 3MV8A 1JPGA 3GMMB 1NJ9A 4GMTH 3A0OA 5M95B 4CNIA 2N56A 3CSYA 2P7TB 3O3AB 3NCCB 3ZT6A 1ZT1A 4MGXA 3VXME 5IBLC 1R3JB 1ADQH 3IXAA 3S7GA 1WIPA 3LN9A 4GO6B 1OAQL 3HB3D 4LMQI 2W59A 4AH2B 5FYJD 2DRUA 4OBRA 5F88B 4X5WA 2OI9B 1XF5B 2CUMA 1IAKB 1AD9B 2ICWI 3SDDB 1N2RA 2NXZC 1MLCB 2P24A 3WIIL 1IKFL 2BNQE 1G1YA 3D69A 2PW2A 5J06A 3G5VB 12E8L 2ESVD 5LGHL 5DVNA 4HIJA 1D7FA 4J1UA 4LSSL 4OM0H 3DUUB 4NZTH 1W72H 3DTXA 3FRPG 5KVDL 4L4VE 4M6NH 5GJSH 5ACZB 5MHSE 2AQ1A 1O5DT 2GCYB 3MRPA 4IOIA 4X6CB 2XWJA 4JFFE 3AAZB 3EUUA 3IXTA 5C0GA 2F15A 1PG7H 3L5IA 4JPVL 1GJIA 4ZFGL 2ADJA 3FB5A 3ZKSD 3F7VB 3OKLB 3OAUH 4GH7B 5DUPH 5AZEL 5D7LB 3GSVA 1KULA 3IRZA 3LPFA 1DEEB 1AQKH 3CZFB 3D3VA 4NQEE 3SGKA 5JDJA 1FO0A 4PJIB 4U2YA 3GFUA 1I9IL 4UNUA 5DRXA 2BC4B 4JB9L 4YBHA 4OLWH 3H0TA 3PHOB 1RHHA 2VLKB 1CXIA 1G7IB 1IGIH 4YDLC 5GRUL 5C0AA 4GKOA 5EBLB 3LVEA 5C0BE 4L8BB 4X9FA 1TJGL 1M6OB 3V79C 1CGSL 4ETQB 5DR5H 4KH2A 1NGXA 4XNXH 4MVBD 2GITB 4CU6A 2BVOA 4PRIA 2H1PH 4OZFG 3RZCB 4NQXB 5H37H 1U8LA 3WNNA 2XG5A 4P5TC 1WEJH 3RY4A 2IBGA 1OP3H 3SDDD 1S7VB 3AM8C 3RL2B 3V7AE 4X5XA 5HD8D 4XB7A 4YHIB 3MOQA 4GS7B 3PWPB 2EZ0D 4HJ0D 4MB5A 4CMHB 3SKNA 3LEYH 5D4QA 3FB6A 3SBWC 4TSBH 5CWSA 5LQBH 4OIBA 2J8UE 1JTPA 3TZVA 3SKOA 2D7NA 5GGRA 5CKAA 5EA0H 5LBSL 1L9MA 2E9JA 4OB5H 3BMVA 3W2DL 3O0RH 1YNLH 4GAJH 5MEPA 3MUZ1 1CCZA 2GSGA 3WEXB 1F45A 1JK8A 1RD6A 5D7LD 5FB8B 3LRSA 4MB3A 5EUKA 4QHKI 1IE5A 4GQ9L 2FH6A 1V3LA 2HKHH 4N5ED 4YBLB 2W38A 1S7WB 4P2RA 1VPOH 2WUCL 4O51B 4EJ1C 4ZFOL 3QULB 5DRWB 4PJAF 4DN4H 2XA3A 2E3VA 3JV6A 5C07B 1T80A 2VABB 1J8KA 3GMLA 4G7YL 2V2WB 3ARBB 1PZ5B 1UXSA 2SEBB 1KCVL 2Z4QB 3SDXB 1B4JL 1I1YA 2LQRA 3N1MC 4TUOA 3DO7B 4NFDA 4IIQB 3MRDB 4QRSB 3JVGA 4HUKB 3QUKA 3RZCD 4HKXB 3V4PH 1K8IB 5L2KB 1FNEA 4P57A 5E7BA 3SGDI 4F37K 2GTZB 3MOAL 3K4ZA 5AYUH 4MDJA 4O9HH 4E41B 3OAYK 3STZB 3B8YA 4JLRB 2VR5A 3PWPD 2ICCA 3MODL 2OJZH 3TV3H 1QFOA 1R5IB 5FKAB 2EIBA 1YEFL 4X9IA 5KVGH 1F2XK 5I76B 4EBQH 2Q3ZA 5EC2A 1LE9B 3P73A 1WWCA 5DJXA 2R0WL 2RCSH 3CX5K 4HXBH 5T3XL 2AI0L 4JO2L 4KUZL 4YAQA 1F3JA 4OKVB 3ULUC 1OD7A 1CXEA 2ZCLH 2VL5A 5CILH 1JFQL 2YUVA 1HSBA 5E2WH 2J6EA 2R1WA 3MCKA 2HT3C 4J3WA 1MJUH 5CUSH 5F7YC 3ZYZA 2HJKB 1S9YB 3QWRA 1HIML 1MCWM 4LLDB 1FDLH 3UJTL 5IB1B 3VFSB 1CFBA 2Y9RT 3V0VB 4MWFA 4HUXB 5C07D 3TC9A 5L2JA 1VGEL 4N8VG 5SWSA 3QQ9D 4QCIA 2A6IB 2FEDC 3N06B 3OKDA 1M71B 5F6IC 5EZOH 4LSQH 2YZ1A 5ID0B 2UWEE 4GMSL 2WBJC 5FM5O 3V4UH 3E6HB 3ZKXC 3BZFA 3QEGL 2IQAB 2VKXA 3ECBB 1HHJA 4DGVL 1C5BH 4YUEH 4LVHB 4JFEE 3IFPA 5L2KD 1G6RA 3PE9A 4I0PA 5JQ6L 2NY6B 1U93B 4YK4C 4E41D 1BWWA 5GJTH 1KTLA 3G5XA 3U48A 5TE4L 2ARWA 1GZQB 1S7RA 3RIFF 3B5TA 5J1AB 3LQAC 2XQYK 3QI9C 5IVXB 5F8QC 1LO2L 4MCYB 3TN0A 4MD5A 5I74B 4B7LA 3ME0A 2Z91A 2R9HC 2CD0A 4F2MA 5FUOL 5I1CH 3GKWH 1NCAH 2B1HL 5D6DC 3HCVA 1PYWA 3MX0A 4Z5RA 1K8DA 3ZYIA 5DD5L 5F7EL 4M5ZL 1NCWH 3U7YL 1K5NA 4Z7UE 1MIML 5DJZA 4YQXL 1BQUA 3P0YH 4PB9H 1F90L 4L9DA 4GFTB 5I1JL 4LOUC 3D5OF 5D72H 1UENA 3LS5L 1KPUB 4JJHA 3RUGF 1FV1A 2AXHA 2CK2A 3LKRA 1JNLL 4NKDA 4Y4HC 2YZ8A 4HKZA 1QYGL 5BVJA 4ZQKA 4U6VL 1TQBC 3QUMB 1AHWA 2RFXB 1UM5H 5GGSA 3TBYB 3UTSB 4R7NA 4XGZB 1EBAA 3WUWG 5L8LB 3V0WL 1R24B 2YPLA 3QEQB 4NZRL 4U7SA 1EZVY 1NQBA 4L8CB 4NSKA 3CH8A 3RKPA 1DFBH 3WFEH 4ZUUA 4JY5L 1A7RH 4MXVE 2NYYC 2NY6D 4NCDA 4P4KA 3GDBA 4UU9A 1S5HB 3X12A 2BOCB 1Q72L 3C6LB 1YYLH 4HXAH 3UO1L 3IU4H 3CLEH 3PWVA 1U91A 5JIHA 3IKKA 1NKRA 2RIKA 2R15A 1W0VB 4DZ8B 3W2DH 5JLZB 4LLUB 2JLLA 3O6LH 4JJ5B 3P11H 5JA9A 3DPBA 4L8DA 2FH8A 3H42H 4OFVA 5FM5M 3R06B 2P46B 2L4OA 3VXSA 4KPHL 1QLEL 4HH8A 4JRWA 3LMJH 3BHBA 4LLQB 2Q7YA 5B22A 3T3ME 4I2XA 2GT9A 5GRZA 1UC6A 2WK2A 1P5VA 5J1TC 2Q8AL 3GSQA 1V3KA 5HTSA 5BCAA 1AFVH 3EJZD 4OLXH 1KCVH 4ZFFA 4G6FB 1T66C 2D9CA 1I1AC 2GW5A 3ARFC 4QWWC 3UTSD 2FO1A 4N9GA 1BGXL 3OKEB 4OD1H 4IM8A 4X4ZA 3EYVA 2Q7NA 4DW2H 3ES6A 3QEQD 3BJLA 3TBVA 2DLGA 1JWUB 5DQJA 3I85A 1MVUA 5CJ8A 2ZCKL 4O00A 2WUBL 3SQBA 2A83B 4HUWB 3LQZB 3V0AC 3QO1B 1J05B 1KJ3L 2GJZA 4OGXH 2ERJB 3C6LD 1VA9A 4TOYL 5HY9B 5A40E 2DI7A 3L5XH 3CD4A 3B4NA 1FGNL 1BZ9A 1PKQA 3ZKMC 3SGDH 5D2LE 2AI0H 1FL6A 3HFML 1JL8A 4QRRB 3Q3GB 3MRNA 2J8UF 1QFWL 4HFUH 3LD8B 4MNGE 3JBG7 1AXTL 1QOKA 4FZEL 1ZT4B 2PYFB 3MMEA 4IOSD 1U58A 1MCLA 1ZE3C 2GJJA 4OFDA 1OF2B 3MC0A 3LSOB 5DXWA 4DN3H 1NAMA 2CK0L 3WJLA 3RI5F 3MACL 4NQTA 1HIMH 5EOCJ 3GUTA 4NQSB 5I66A 2AK1L 5HHOE 5GGVY 1EERB 2XI9A 3VFWB 1VGEH 1J1OL 1CFSA 5HXMA 3BESR 3QJFB 3JSSA 5DUBB 3C5JA 3MSPA 1T22B 5B4MC 1YDPB 3U46B 1T04B 4G6FD 4AIZB 5EU7C 1EO7A 1P7KB 5INCB 2OMNA 5EU6B 3GIZL 1WBXB 4PJ9A 1YJDL 3OWEA 4WUUE 5ADPL 4GRLC 5TQ2H 1C08B 1GGCH 3KXFB 2VXUH 4G8GA 1U8IB 3CFBB 3QHFH 1F11B 1I9JH 1E4XH 1U3HA 4HIXL 5GS2H 2W9EL 2B4CL 3OMZA 4JGUA 2D7TH 5I71C 1U41A 2P5EB 1AGEA 3M1BA 3MFFA 5IFHH 1ZHKA 1LO2H 4NN6B 1YQ2A 5MENE 3MRRA 4XVTL 4JPIB 4NQVA 2OSLB 3RU8L 3KG5A 3TESA 2HT4D 1FNSH 1QG3A 2FBOJ 4QRRD 4ELME 4OCXH 5DDHA 5BMFH 1P1ZA 4FFYL 1UM6L 3M45A 1A1OA 3PV6A 1X3DA 1XGPA 2VJXA 1EO5A 4IMKC 4PJHA 1I4FB 4RWHA 3ULSB 3T77B 2DLTA 2XZQL 1ORQA 3SKJL 3MYJB 2F53A 1D5IL 3D18B 5TPWL 1QYGH 5CAYB 2ZOKB 3OKKA 5D71H 1ITBB 3RHWK 5F9AC 4BH7B 3N0PB 4QRPA 4M6OH 4F33A 2CIKA 2DQFB 5EU4B 4GAYA 5KSAC 4RA3A 3O45B 2VH5L 3MLRH 1CICC 1QA9A 1BOGA 2ICWB 5L7XH 3KPRA 5EU3B 2VDQL 3V0WH 1P4BL 3FONB 4LLVA 1XR9A 5EU6D 1JNJA 4MXWL 4JFXB 1CDJA 3I6KB 5IG7A 2OBGA 2BSTB 5HGBB 4MJ4A 2UWEF 2O61B 1IGTA 3KXFD 2F58H 4JKWA 4F7PB 4P5MA 5DHVB 4S1RH 3BDXA 3QP3A 2FECL 1G9NL 2D2OA 2X4NA 1BX2B 1OTSD 4QRQA 4U31A 1OHQA 4HX1B 2HJFA 3CFKA 3NCYP 1OAXH 1P4LA 3WN5A 5C92A 1HEZB 3C5ZB 4K3JL 1MRCH 3S88H 1FNFA 5FF6A 5LGJA 5B39B 1CS6A 1XF2B 5F3HB 3K2MC 4GSDL 1K2DB 1OGAA 1GAFL 3FT4A 2P5WB 3P9LA 2P5ED 3FMGL 1FLRH 4K7PY 4AIOA 5DVKA 5BOZG 5KJRL 3DSFL 3EYUL 3NCFB 2NW2A 4IS6B 5HHNB 3UEZA 3VD7A 1B3JA 1BIIB 3BGFB 4DWHA 1B90A 3HI1A 2ZZUT 4QHMA 4KK6D 3GSWB 3X17A 2VLJB 5I1KL 2XG4A 8CGTA 1DBJH 3MJ7A 2EDDA 2Q8BH 2BY0A 5EZLA 5F3BB 3QNYA 4Z6AT 3NCMA 1BJMA 3HUJE 3HC0A 3MXVL 4WI6A 3WIFB 3TO4C 1RUQL 4M8VA 5IOPB 5IROC 4RQQA 1KB5L 1ZSDA 3BP4B 1E4WH 1QNZL 4ORZC 4Z7UF 4E5XA 5HVWA 5I8EB 1I7ZA 1JPSL 2WQRA 3GO1L 2XN9B 3CPLA 5C0IA 4LCYA 4X7TA 4R2GB 2DDQL 3FZUC 2KUTA 1D5MB 2YD4A 5FK9A 5GGVH 4EN3A 4RBPH 4CRPA 3DV6A 1FYTB 3OJ2C 5C0DA 4G9DA 1J9CT 3EBAA 2C1OB 3VD3A 1NCDH 4H25B 1F8TH 2EH7L 4ZNCD 2BOBB 4XI5C 2YA1A 4X8JA 4RMRA 1VACB 2EIDA 1MFEH 3OJDB 1KIRB 3FO0L 1KGCD 2FCBA 3C5ZD 5FYKH 3U30C 2BNUB 3NOIA 3AREC 4QXTA 4KMLB 1CDYA 4IEFB 3SCMC 4KGJA 4JG1L 5J6HB 1T5WB 5JUEH 4MXVF 2P5WD 4PIRF 2ITCB 1WFNA 1RUKL 1KYOK 1MF2H 5EG6C 3ILQD 3CXHK 4MNHA 3WFZA 1UM4L 1NDGB 2J2ZA 1S9XB 1N6QH 4PD4K 3FOLB 1T2XA 4MJIB 3QT2A 3C8KA 1JZ5A 2VLJD 3NH7H 1V5JA 1T20B 4AIXA 3LKOB 3V5HB 1AGDA 5MI0C 1U36A 1A1MB 4NGHL 1L6XA 2AK1H 3V52L 2DS4A 1E27A 3T0EE 5EU5A 1KJ2L 2QV2A 1Z9MA 4AEHL 4YPGA 2C7UA 1T83A 1QSEE 4KK8D 1BD2A 3NIGF 4LSTL 3EHBD 4JEGB 4WDIB 2XN9D 3BPNC 2Y07H 2E7HA 3T3MF 5LXGH 1IAII 4R2GD 5IK3B 1UB5B 3K74B 2X05A 2XPGA 1T4KA 3MCLH 3L3JA 1BVKB 1MAML 3RVUC 3M8OH 4M7ZC 5DRZA 1CD8A 4NM8L 4PRPE 3QDMB 4PTUB 3L3OA 2NPLX 1JGEA 3DUSB 2DQIL 1MFAL 1WT5A 1DL7L 3FO2B 4YGVA 3SGKC 2FGWH 3QQ3A 3KPSB 4FFVD 3W11C 5C9JA 3FO9B 4M61A 4CMMA 1KELL 1YN7B 2G60L 4PRDA 4FQQA 2OR9L 2XKSA 3QUYA 1VADB 4P46A 4JANA 4JFDB 3S36L 3ZZ1A 5F93C 3VFTA 5DJDA 1BQHB 1Q9LA 2X5PA 1A7BA 2AXFA 2DLIA 4OZHE 2CLZA 4U1NB 4ZXBA 4MJID 5C09E 4K7PH 5D2LF 3VI3F 4X4YA 1DN0A 1OGTB 4PUBH 4UIKH 1FVEA 2A9NL 5IEKA 2KL6A 5DT1H 3DVNA 5D7IE 2GAZB 1SJEB 5F9DC 2X4RA 2JELH 2YPVH 4Y16C 2NY0B 2HAZA 5DJYA 1N5YL 3K7UA 3GSXB 5D2NA 1JV5A 2PF6A 1HYSD 1BVLA 2EYSB 2F5AH 1EFXB 4WU5B 2BY1A 1Z9LA 1P7QA 1NAKL 5E00A 2DQEH 1NC2B 1P2CA 1RJYA 1R3IH 2HMID 2G75A 2E6QA 2C4XA 2PN5A 2Z92A 3KPLB 4ZYKA 3ROLA 1IEBA 5BOPA 2Z35A 3I3DA 3QCVL 3V7MA 4HIEA 4CGTA 3ZLQC 1BM3L 1JJUA 3U9PL 3D6GA 1G9NH 3FFCB 3KS0J 1IZJA 3A6CL 4WI3A 1KCLA 2D7QA 1SM3L 3QDMD 1XH3B 2X6MA 2OK0L 4XCYB 2CDFA 3QG6B 2EXWC 2ED8A 5SWZA 5E8OB 2ARJB 1HH6B 4NUGH 1GAFH 3QYCA 4DFHA 4ZAKB 5DTFA 4NPYA 4BZ2L 5E5RB 3IFOA 4G3YH 4JFDD 1FFOB 1X4YA 2AGJL 3BOVA 2VZOA 5JOFB 4Z76A 1BHGA 1E0OB 1RIUH 1A7OL 3MLTB 4HQQH 5DJ6A 3O4LE 5DD3L 1N0LA 1XGTA 5FCSH 2YA2A 1K9TA 5DHXB 3DI3B 5GGQL 5I16A 4ELMF 5IB2A 3CK0H 3GZKA 4LCCC 3RZWA 5GSVA 3NA9H 5BW7C 4P2OA 5CSGA 2X4SA 3B9KB 3I50L 2EYRB 2O5YH 2NY0D 4FTVA 3KYMA 4JHZA 2X89D 1AP2A 2MPAH 1EFXD 5GRWA 3DVFA 3HPLB 3IJYA 3Q6FA 1NC2D 3QEUB 2CQVA 4PJGE 1MHHB 4ZS7H 4JZOB 1RK0A 4P23C 1OAZH 3HC3H 4P5KA 5DEFA 1FORH 5IF0B 1BLNA 1ITCA 2DJ4A 3V6OA 2FL5B 4DAGH 3DVGB 1H3VA 5CINL 3GIVA 1A7PL 2XV6B 3FFCD 2VWEC 1KC5H 1YEJH 5J11C 4IHOA 5IMKB 1F4AA 3BKJL 4QXUH 4HC1H 4I9WE 2WLZA 3NPSC 1ZTXH 1CGXA 1IGFL 1RZGB 3REWA 5TGBB 5EN2A 4FQXC 4POZC 2UY6A 5HHQA 4ZAKD 4NQDA 3A67L 2FO4A 4R97B 1J8HA 5DLMH 1B6UA 4U0QB 1QEWA 2EE9A 3WFHA 3QUZC 4LRNL 4MHHG 4DVRL 3R8BB 5TH2B 4F7TB 2IADB 4LCUA 2W65A 3O41B 1OPGL 4YDKL 1AXSB 4M4PA 4WW2B 1NPUA 4N0UB 5C0AE 1CFTA 4UBDC 5EO0A 4ZSOE 3IDXH 3MQIA 4WTWA 3RVXD 1MEXH 4N0CD 1MH5B 1F4YH 1F4XL 5DJ8A 3B9KD 4U3HA 2DLFL 1DE4B 4AEHH 2JB5L 4YX2H 3FT3A 3HUJF 4PRIE 1LO3L 1EJOH 4M1CC 5DRNB 3CC5B 5D1QA 2FB4L 1M05B 1N0XL 4JM2C 2XTJE 1XIWB 1SBBA 5IV2B 4OFYD 3E3QE 3FOMA 4HWBA 5DMKA 1A4JB 3T65A 4U05A 5DZLA 5ALCL 1SYVB 4MQTB 5JR1L 3RX7A 4F9LC 3RWFB 4P2YA 4KQ4L 3UTTE 1Q94A 1IAIH 5E9DD 3KAAA 4UAOC 2FJGB 2YUWA 1I9RL 3PHSA 2A74A 4PGCA 5EBMA 1TTFA 3LKSB 4P9MH 4ODHL 3T1FA 3Q2CA 5CGTA 5F1NA 3INUL 3NAAL 2KBGA 4I3SH 5AEAA 4U49A 3VXNA 3MA7A 3L3KB 2V9QA 5I1AB 3G5ZB 2H9GA 3SKMB 4YHZL 5JORA 4XTRD 4KVCL 4PREA 4WVRA 2GJ6E 4NDMA 2FD6L 3ZKNC 5ISZA 5J6GB 2DBJA 2R0KH 5A3IC 4HF5L 1N26A 3VWJB 2XYCA 1EHXA 1FZMA 1A6VH 25C8L 1BMGA 4EUPA 1KYOJ 1MCJA 3PGFH 3LHPH 1BZ7A 3EYOA 5EH1A 3WXWL 3CXHJ 1GOGA 3PQYE 1PFCA 4JR9H 1QHPA 3N85H 4HAGA 1XGRB 4K94C 4PRNB 4Y8DC 3PDOA 1DBBH 3VFNB 3UJIL 1AO7A 2CXKA 1IGYA 1LO0L 1NMCC 4P4KC 4FQJH 1MWAH 3ARDB 5DEZA 5BVPH 1NAKH 4MDIB 2PETA 3ISWA 5E8DH 1D5ZA 2OL3B 1T0MB 2DI8A 2HG5A 3ZTNL 2O5XH 3BGMA 4DGYH 1H3GA 4OQTL 1HXYB 2HVKB 3P4OA 3OTTA 4YDJB 1ZV5A 4JKKA 3HI6H 3FT2A 2JE8A 3U9PH 3LEVL 1KCSH 4HMEA 4HDIA 4X6BB 3HR5A 1RZ8B 1YPZA 4XWGL 5DZNA 4J3OC 1NFDE 1DQDH 4ZUVB 1XT5A 1FN4B 2ADGB 5J3HC 3VRJB 4JY6B 4L8SA 5E1AB 2ESVA 3GSNA 1JNNL 3QCUL 1BFVL 5GS0H 3GRWL 1T2JA 1KENH 3EOBA 3VWJD 1S5IL 2HVJB 1YJDC 5IFAH 2Q1EA 4XMLH 4OZIE 4A6YL 3RQ3A 4I5BA 2I27N 4OZHF 1F2QA 2EKSB 3IDNA 4H88L 2B4CC 3D1MC 1QBML 3DO3A 4PY7B 5D7IF 4XNMB 4NZUL 4CN4A 4NQCB 3CNKA 3ARDD 4C4KT 3MUHL 3IETB 3GMMA 2V17L 4HUVB 3VFPB 3LN5B 5J13B 2P7TA 3O3AA 5IJKC 3G6DL 1RZJH 4HWEL 4YDLB 1INDH 1SMAA 4G5ZL 2I60L 3V6ZB 1R3JA 5IBLD 4JAMB 1ZGLP 4GJTB 2WW8A 4MLIA 1KJVB 1JPTH 4AH2A 5HHME 1Z5LB 4YWGL 1EHAA 4QHNB 5F88A 1NDMB 1U3JA 1XF5A 4O58L 1IAKA 2MCG1 2XKUA 3WJLC 1AD9A 4RMVA 4OD3L 4P5TB 3HG1D 3SDDA 4XCFL 2E8YA 2HFEB 4J2XA 3G5VA 2NY1C 4WWID 4LRNH 1FIGH 3DUUA 5GIRB 3LN4B 4OZFB 5KVFL 4G8FB 1OPGH 5ACZA 4K23L 5C0RH 4U1KB 3P2TA 2GCYA 3Q5OA 4PJ9C 5ESVB 4X6CA 1CDBA 1AI1L 3AAZA 4O4YH 1CXKA 3PNWB 5FV1L 1OWRM 4DK6A 2F8OA 5ENWB 4K2UH 4HHAB 3F7VA 3OKLA 4KQ3L 1UJTA 5HPOA 5D7LA 4XP4H 3BRFA 2BNRB 1DEEA 4NQCD 5D70L 3CZFA 4NT6A 5TDPB 1N0XH 3IS1X 4RMQA 2ZKHH 4XX1G 1EMTL 2BC4A 5CJQL 3K2UL 2FX9L 2IG2H 3PHOA 5HHXL 2VLKA 1G7IA 1RZKH 1KCKA 1EV2E 4CW1B 6FABH 4L8BA 1M6OA 4PJGF 5IGXL 4ETQA 3NFNB 3TH4T 2A9MH 2CGRH 2GITA 1IT9L 1JYWA 2VLME 4ODHH 1KPVB 3RZCA 2NY2C 2X4UB 4NQXA 4ELKB 1AY1H 3DX7B 3MLUH 4P5TD 3RTQB 5D7KD 3ARSA 4QXGL 5KAQF 1S7VA 5C86A 1TIUA 3RL2A 4NRZB 1HH9B 3CMOL 1ZHBB 1J0ZA 1A3RL 4YHIA 3PWPA 4K8RD 5T1LB 4I2XE 3VCLA 3DSNA 1CK0L 1SY6H 1K6QL 3U0PB 3B5GA 3WFDL 3MRCB 5JZ7C 4L4TE 2IGFL 1OARH 3UJIH 1OAYL 2FHFA 2BVQB 3WEXA 5E08H 2PYEB 4AQOA 2LAGB 5FB8A 3R4DA 2BNRD 4ODTH 3PJSA 1IAOB 5CP3H 1RVFL 2NZIA 3NZHH 3FQUB 4Z8FH 1T89A 2YD6A 3DRQB 4O51A 2D7OA 3QULA 5DRWA 1SEBB 2YEZB 1YECL 4OQTH 4U2ZA 1JVKA 3Q1SL 5C07A 4L1DA 5DS8B 2VABA 2UUDK 2Z8VC 3UDWA 2WZPD 1J7VR 4BZ1L 2DBLH 2VDLL 2PW1B 2V2WA 3ARBA 2X40A 1PZ5A 5F6IB 2Z4QA 1WTGT 3SDXA 4TRPH 4XPAL 3DO7A 1I7TB 3ZKXB 4U0RC 4IIQA 3MRDA 4RCAA 4MS8D 4Y5YA 4QRSA 2ARJQ 3U4BL 2I9LB 3WXVL 4HKXA 4ZO6A 1K8IA 2VZ3A 5L2KA 4LSUL 4FP8L 1NANI 3RTQD 2GTZA 1UT9A 1A14H 4M5YL 4FFZH 2QHRH 3MRQB 3V8OA 4E41A 1MIEL 5CEZH 3STZA 2O26U 3E6FB 4JLRA 5C7XH 1GPOL 5IBTH 5T1LD 4FS0A 1IGCH 1R5IA 5FKAA 3QA3B 2UV3A 4EN3C 1QFUL 3NA4A 3Q5YA 3QI9B 4GKZB 3ALPA 3F8UB 4OKVA 4HGWA 3ULUD 1DBAL 2AS5M 3QRGL 3G6JE 4L3CB 2A1WL 4RMTA 2PYED 4S0SD 4NC0B 4KHXH 4PGBA 4NZUH 3O3BB 4DUXA 4GAGL 3RPKA 3U4AA 4LAJH 2HT3D 4YXHL 3QFJB 1TVBB 2HJKA 1S9YA 1TZHB 4HS3B 4G8GE 1N64L 2WIMA 3O6FC 1KCRL 4LLDA 5IB1A 4MD0B 4C4KO 2B0SL 3V0VA 4HUXA 1TQBB 4ODSL 4R0LB 4WI7A 5DI8B 1I1FB 3OV6A 4Z7VE 2P43B 3UBXB 2A6IA 2FEDD 1M71A 3WL9B 1C12B 5ID0A 4YWGH 4WFGE 5C08B 2WBJD 3QDGA 2VQUA 3E6HA 5EOCH 2NXYC 2CO6B 2IQAA 4O58H 5EIQA 3ECBA 2JJSA 4HPOH 1PSKL 4F7EB 1I85A 3S3PA 1A6WH 3K0WA 5DJ0B 2KDGA 1U93A 5GGRY 1T83C 1HDMB 4JN1L 1LP9A 1JRHL 4FHBD 4IRJC 5IB3B 1NFDF 3G6AB 1DLFH 1EIBA 4MQ7B 4EI5C 3S9DB 5F6HJ 5E4IA 4XXDB 4X4XB 1OT1A 3B3IB 5J1AA 1GZQA 2F53E 2Y7QB 1IC1A 3BPCA 1YEIL 3QI9D 1CTNA 5IVXA 3B9DA 4MCYA 3NGBC 4WFED 3MJ9A 4RGMC 4H20L 1BF2A 3BW9B 2R9HD 3N1GC 1RJCA 4ZOAA 3VG9C 3KPRE 5J9PB 1AXIB 4OZIF 2YN5A 2HJLB 1D3CA 4NNPL 1TJHH 4GRWB 1GIGL 5D70H 4PJFB 2CDEB 3O3DB 2VDNH 1MCWW 3ARUA 4LOUD 3QFJD 1JZ8A 1CFVL 1KPUA 2P48B 4TUKH 5H94B 5EWIL 1H3PH 1BEYH 1D6VH 1MHPH 1FZKB 3VD4A 1AJ7H 5HGAB 2EDLA 2XZAH 1E4KA 1RUAL 4MHHI 1VKXB 2ICEB 3TBYA 3ARFB 1I1AB 3UTSA 1ZLUH 4JFOB 4XGZA 5C08D 1FJ1B 1R24A 3O2DH 2Q3AA 4XP9L 3QEQA 5JO5B 3KYAA 2D31B 4MA8L 4L8CA 3R8QA 4FA8A 3MRKB 3VGDA 5C0CB 1V7NL 3CMOH 2NYYD 3ULVD 1FFRA 3CLFH 5D2NC 1S5HA 3RVVC 2BOCA 4RZCB 2OZ4L 3C6LA 5BV7L 4WO4C 3UTOA 2J5LB 1QLRB 3FN0H 5L6YH 1AE6H 1U8MB 3WFDH 2X42A 3L3DA 1ZLWH 5JLZA 3O3EB 4LLUA 3EO0B 1W8NA 4XAKD 1QR4A 4FXLA 4JJ5A 3EFDL 2ED7A 3WSQL 1MREH 1JZ3A 1TJIL 1JP5A 1A8JH