4V1DB

Ternary complex among two human derived single chain antibody fragments and cn2 toxin from scorpion centruroides noxius.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
b'SEIVLTQSPATLSVSPGERATLSCRASQSVRSYLAWYQQKPGQAPRLLFSDASNRATGIPARFTGSGSGTDFTLTISSLEPEDFAIYYCQQYRYSPRTFGQGTKVEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINGLE CHAIN ANTIBODY FRAGMENT LR, HEAVY CHAIN
publication title Optimal Neutralization of Centruroides Noxius Venom is Understood Through a Structural Complex between Two Antibody Fragments and the Cn2 Toxin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Toxin/immune system
total genus 24
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4v1dB00
1A1MA 1S5HB 1QKZH 1HNGA 4M7JH 1JZ6A 4ELKA 3VXUE 1RUKL 1E4XI 4JANB 4O5LL 5CHNB 5DJCA 2X4OA 2KKQA 4YFLI 4LOUC 2HVKB 1C08A 1L6ZA 1MCHA 2Y06L 5EDXA 4PS4L 1K6QH 3AMLA 3SGJC 3EDEA 1AGCA 5H35B 5DD5L 1G0DA 1KC5H 1OPGH 3W9EB 3W2DH 1T2JA 3T3PE 3T77B 1RULL 1MI5B 4GS7B 5FA3B 2DQCH 4ZFZA 3BH8A 5E1AA 1LE5A 4PJ8A 4I48B 3R8QA 3KJ4B 5GRUL 4XP5L 3SE9L 1IQWL 2IF7A 3LKSA 3KS0H 4OM1H 5E8EB 4G7VH 1G84A 1N6VA 4KRPB 3P40A 5DEGB 2R8SL 3NOIA 1FPTH 3BEWB 2ED8A 1H8NA 5KVGL 1I85C 1LMKA 4MXWL 4IRZH 4OQTL 1JZ3A 4NZTH 4GUPB 5C3TA 2H2SC 3HUJF 2QSCH 4X0KA 1A6VL 5CMAA 3RA7L 3QWRD 2BNRA 2Z35A 2W9DL 4YDKH 3L6FB 2JF1A 1UB6A 4HT1H 3MV11 4S1DD 4UOW0 4EI5A 2VDOH 3MRMB 1MWAH 3OL2A 2MOVA 5JTWA 3S88H 5JW3L 4DAGL 3HC4H 2VL5A 4JJ5A 4FABH 5BS0B 1JPFB 3FB6B 5KSUA 4XP1L 4R96A 4V1DE 5AAMA 4E41A 3MC0A 3MRGB 3WXWL 1RK0B 1A2YA 4BELD 1JUFB 5F9JA 4G7YL 1SJXA 3GIVB 4HV8A 1WFTA 1T2QH 3O9WA 3Q1SH 1ZA6B 3QZWA 2ZCKH 3AC0A 5TE6L 3R1GL 5AUMB 1AJ7H 3HMXH 3IRPX 3I6KB 1W0VB 5ACLA 5L7XH 2Y5TB 3UTSB 2VQUA 1PSKH 3QNZB 3VXQA 4XAKD 3ZKNC 1AE6L 3BP7B 4RFNB 4AMKH 2XA8L 5F7EL 5EBLB 2DQUL 4X9HA 3FOLA 4WNQB 1V7NH 1DQDH 5LAXB 1TZGL 1VACB 4JG1H 5F9WC 5J12B 1NCWL 1JWUA 3HE6B 2YWZA 4TNVF 3WIIL 2EYSA 1R5IB 5F70A 4KPHL 2AJZB 5D1ZB 3PP4L 3MJ8B 3K7UA 5HJ3A 1OARL 5KSBB 3CMGA 3MCLL 1MCKA 1XIWD 3JV6A 1DBAL 3RGVB 3QO0A 5ALCL 3SCMB 3PGFH 1MLCA 4DN4H 4FTVE 4GOSA 2YPVL 3VXTB 4ZAKC 3VD3A 3PP3H 2H45A 1KB5L 5A3ID 5I75B 4L3CB 3PHQB 4JFHE 2AK4A 2X41A 1QSEE 2I9TA 2OI9C 1A3LL 4CW1B 4KZEH 1YEJL 2J8UB 4NN6C 3PWNA 4WW2C 3TYFB 4OD2A 3LRGA 3O0RH 3SDYH 3WXVH 2YMXL 1RHHB 2XT1B 3G6AA 5ERWA 4AG4H 3KPLB 3TCXA 1P4IL 2HJKB 4DEPC 5IBTL 2KH2B 3VWKA 1KLFA 2BXYA 4ORGB 2UY7A 5DJ6B 2X7LA 1GC1H 3C09C 4CDGC 3T0ED 3MRIA 4Y1AE 4O2FB 2IQAA 3FZUD 3F58L 1I9RH 2VAJA 3RDTA 2NY2D 4ZUWB 5CBEA 2MNUA 3C9NB 4ISVB 4LLQB 7CGTA 1FZOB 5DRWB 4M03A 1X6NA 3S36L 2LAAA 5CUSH 2JJSC 2E7BA 3FQWB 4KV5F 1NLDL 4ONFH 2EC8A 4NHCL 4YH6A 1ONQA 2GK0A 4NJAH 1JV5B 4YR6B 4YO0A 3LN5B 3QUXA 2X1QA 4KKAC 2XWJB 3C8HA 1J88A 1MCJA 1NBYA 4NKDA 1HQ4A 2ZUQB 2ICCA 4DFIA 7FABL 2NMSA 1HEZA 1J0KA 2EDKA 4XP4L 5KS9B 5E1HB 5GGQH 1JZ4A 1G7MA 2AV7A 2D7TL 2NY1D 2EH8H 1BJ1J 1LO4L 1EHNA 1JGDA 3L95B 2J4WH 2VDLH 1MEXH 3TCLA 1HWHB 4C83A 1S3KH 5I74B 5HDQL 3HRZA 4X5WB 2BNRE 3FQTA 1QD0A 3D85A 5IG7A 2PF6A 3TEUA 3QYCA 4U3HA 4PRPD 1WFOA 4WFFD 2JB6A 1HDMB 2A6JB 2XIDA 4HUUB 1TPXB 4RQQA 4PG2A 4GRLD 1AO7D 1CFTB 5IMMB 1I1AD 4MX7B 5IM7A 2ENSA 2G75B 3LS5H 4NM8L 5D71L 1EO8H 2D31A 4BM7A 5L0QB 3QCUL 3UJIL 4E41E 5EOTA 2OJEA 3RIFK 3GBNH 5IBUG 2NCMA 4FFWD 5IJKA 3EFDL 4PJIB 3UYPA 4BQBA 3MLSL 5DHYB 4NJ9H 4HJGA 5HGAA 2YD5A 1EHLH 5DVLA 3PL6C 5SX4H 3TO4D 3MJ9H 1HZHL 5ESQA 5KSBF 1SYVB 3QQ4A 4EDXA 3LSOA 4RGMC 1QFHA 3DVIA 2DD8H 4M7KH 3DARA 4GQ9L 5EUOF 3MRLA 5J4MA 3VW3L 4QYOA 4N1EA 2P8LA 3S5LB 3TBSB 1QSEB 1YPZF 2DKMA 3DIFB 1U8QA 4I3RL 2AW2A 5EBWA 3HPLB 4F37K 4PJHE 4L8SC 3TN0B 3MRQA 3PWLB 3QUMB 5GGSY 5KVEH 3ARDC 1EFQA 3OKEB 2R9HD 1OAXL 3M17A 5CEZE 3B83A 3MRHA 4NQCD 5IIEB 1EGJA 2IH3A 3UJJL 3I84A 3O81A 5L2KA 3OHXA 3F7YB 4FG6D 5A2FA 2FGWH 3LV3A 3T3PF 3STLA 3D69A 1A1MB 4YX2H 3VWJA 3PXHA 4S10A 4ELKB 1NLBL 1CVSC 1BQSA 5DJCB 2BMKB 2X4OB 1XGRA 4FQ1H 1C08B 2CUIA 1RJYA 5HY9B 1N6UA 1NC4A 2EKSB 5AAWA 4HIXL 1AGCB 4PTUA 4EOWH 2C4FT 3MLXL 2IGFH 2RJMA 1LD9A 3DETD 4JO4L 2EDNA 3BH8B 5E1AB 4ZFZB 1LE5B 3NCYS 4PJ8B 5C0FB 5HPOA 4HBCH 3SKMA 4EXPX 4ZXBC 3TBVB 5GS2H 3RWCA 1OB1B 1Y0LB 4HWZA 1N7ML 2PUQT 1IFHL 2YXMA 3Q6GH 4D9QD 2GSIA 3LKSB 1B2WL 4HCRA 4N0CC 2XTJC 2IAND 2R2CA 3HLAA 3QPQD 1F97A 4MQSB 3CXDL 1OTTD 2YK1L 3GSUA 1NEZA 3RWDA 4KUCD 3RX5A 4KJQD 1PKQA 4XNUL 4OGXL 4X0KB 1CDJA 3SGDH 3QIUA 1JBJA 1KEMH 2Z35B 3BZFB 2XY1A 5INDA 4NZUH 1UB6B 5D7IA 5HHXL 5MHSE 1EEQA 5D93B 2EXWC 2R2HA 4Y88A 1V5JA 2R4SL 3UZVB 3WHE1 5C0BA 1LK3L 4JJ5B 2VL5B 3G6DL 4PRHA 2FEEL 2FL5A 3ARGC 2FH6A 4LF3B 5KSUB 5E9DA 3A6OA 3SDCA 4R96B 5JXAL 1U36A 2I5YL 3FRUA 4E41B 1MCRA 1B4JL 1A2YB 5F9JB 2ED9A 1GPOL 3O9WB 3QZWB 1V3JA 2N56A 3HZYA 5J13C 1OY3B 4XMKL 1J8HB 3I02A 5HHVH 4ZUUA 3VXQB 2DIAA 4F7CB 3CDYA 2AEPH 3BSZH 3CU1A 5AD0A 4MS8D 5CJ8A 3MLYH 2DF3A 2B0SL 1OLLA 1JWUB 3SO3C 2ICES 3O6FD 1GOGA 4NN7C 2EYSB 1A22B 1U0QA 1UJ3A 3D25A 1D9KC 1U9KA 3BI9X 1UT9A 4JM2B 1MHEB 1WVZA 5HJ3B 3OWEA 4OLZL 4HWUA 1LEGA 4J3TA 1KIUA 4TSBH 1I1YA 1WSST 4BH8A 4E0RA 3W11D 4OZFH 4KJPD 1JWSA 4YNYA 3U0WL 5KAQG 4OZIA 4EBQL 3TWCH 4OKDA 4JN1L 4UQ3A 1ZLWK 4KK8D 1BFVH 1P53A 2AK4B 3TYGH 1M71A 1MELA 4TSCH 5GS0D 3AMKA 4F9LA 4MHHG 5TPWH 4JPKH 4AEIL 5EPMA 1OAYL 1L7IL 4MYWB 3WS3A 5CEZH 5J11C 3PWNB 4OD2B 3BGMB 5B8CA 1FFNA 4FQJL 4S1QH 4TOYL 3IKCA 2MFNA 3G6AB 5ERWB 1KJ2L 1P84J 3VWKB 2BNQA 2X7LB 4H5SA 5E2UH 4UNVA 3O2DA 3K1KC 4MAYB 3NGBC 3MRIB 4BZ1H 4QHNA 5L2KE 3BQUA 3AM8A 2IQAB 1CGTA 2B2XL 1MAJA 4EN3A 4P5TD 3VGFA 5IBLD 1DSFL 5F7MC 4PJ9A 2HTLC 3FHQA 3FQUA 3RDTB 2R39A 5CBEB 5MEOA 5F44A 2Y36L 3LPGA 4L4TA 1PGRB 1A7OL 5JXED 3U7YH 4J6RH 1MJ7L 3VGDA 3EIFA 1CLCA 1HHHB 5T1LB 3OKNB 5T3ZE 2GK0B 5HD8C 4LGPB 4OIIH 2P49B 1IE5A 1C5BH 4YO0B 3QUXB 1BFSA 2DQGH 4OT1H 4K94L 3QXDB 4HK0B 4KDVA 2HTKD 4P9HL 1NBYB 3DX9A 4NKDB 4LSPL 1HEZB 3B8SA 1XT5A 1AI1L 2LU7A 5FV1L 4FXGA 2DDQL 3DX8A 4UOJA 4XT1C 2BVEA 4JFEA 1G7MB 1IC5H 2AV7B 4JGMA 3S5LG 4MNHB 43CAB 1JGDB 4XMPH 4NDMB 1FN4A 2V17H 3QIWD 3RPIB 2I07A 4C83B 2X4RA 3HRZB 3PV6A 3D85B 5IG7B 5D7IE 2ZJSL 4M7LT 1VGKA 3EGSA 2NY0C 2JB6B 4RQQB 4RRPA 2A73A 2AV1A 1WV7T 4UINL 2B1HH 2XZAH 5IM7B 4NRYA 5DVNA 1JFQL 2Z92A 4PRHE 4RISH 4ENED 1F4YL 2Z91A 4XNZC 3VGGA 1RMFL 4H88L 5E9DE 3QUZD 1CZ8H 1U3HC 1GZQA 5D1QA 1HQRA 4PJ5A 4M6NH 5GGRB 5TFSL 1WZ1L 3B2UD 5EOTB 1A1NA 2Y07H 1WT5A 4IRSD 3V0VA 1KTKE 1A0QL 3DECA 4LPWA 3ES6A 4UT9L 2Y7QA 4B53A 4JGJA 4QRTA 3DMMD 4HJGB 1DBKL 1YQ2A 4X9GA 5HGAB 5FO8A 1AH1A 5EOCH 3WNNA 1SHMA 4JEGB 4JQXC 1CL7L 3QJFA 1WFNA 1NUNB 4I0CC 4DKFL 1PD6A 4PJHF 4ELMA 2Y6SD 5ESQB 3KPOA 2R2BA 4EQ2A 1BEYL 4H0GA 4NKOA 3IFLL 3RI5K 3QQ4B 4EDXB 2I27N 2QHRL 3LSOB 2AP2A 3MRLB 2L4OA 2VXQL 4LKXA 2P8LB 2J12B 2QEJA 1X5KA 4HG4J 5HI5D 1GJIA 4U0RC 1RQ5A 4NP4H 3U7WL 1QYGL 1KYOJ 5EBWB 5F1NA 3PWVA 4AK1A 1Q72H 3BYTA 1YEEL 3MRQB 1H3XA 4I5BA 1XGUA 1QKZL 4M7JL 4J3VA 4F3FA 3GIZH 4WY7H 3M17B 3H0TB 1UXWA 4QXTA 3F65A 3MRHB 1MCLA 3JBG7 5L2KB 1K6QL 3WJJC 3OHXB 3SJVD 3P77A 1KLGA 3V0WH 3LV3B 1OPGL 1KC5L 3W2DL 3STLB 3D69B 3L5IA 1Q0XH 1QRNA 4WO4A 3VWJB 4QO1A 3IETA 3GSNA 4IS6B 4X4ZA 3IF1A 3EHBD 1XGRB 4N8VB 3W0WE 2DQCL 2DI9A 3CDCA 3ARFD 1RJYB 5EU6A 3C6SB 4NHUA 1OP3H 3LQZA 1AHWC 3EJYD 3WNKA 4HUNB 1IEBA 2Q86A 2APFA 1LD9B 3OB8A 3TBTA 4GO6B 1MCWW 2ESVA 3BKMH 4OM1L 1I8MA 2BNQE 3DHJA 4G7VL 1UCBH 2W9EH 4LLUA 2EDRA 3N1MC 4RA0C 5FHAH 4K07A 5ADOH 4WCYH 3SKMB 5JHDE 5CLWA 3SQBA 5MENA 1FPTL 3RWCB 1SVCP 4HWZB 1EZVX 4IRZL 3WUWA 4FFYH 4NZTL 2R23A 2GSIB 1REIA 2QSCL 1UWXH 4OZFG 5FGBC 2CMRH 1KTRL 4L4TE 4PREA 5T3ZH 3HLAB 4YDKL 4HT1L 5CZKA 5JUEH 2FDBP 3GSUB 1NEZB 2P8MA 2VDOL 3RWDB 2EDBA 1MWAL 2NQCA 2Z4QA 4F7EA 3S88L 1PKQB 2IAMD 3HC4L 2M8XA 4FABL 3O6LH 3WFBH 5INDB 3IDYC 3SE3A 2V5TA 3EOBA 4HCRH 5DO2D 4Y19D 4HFWA 4P46D 2AI0H 3T09A 4NN5C 1ZVHA 3WD5H 5C0BB 2KZ1B 3MRJA 1T2QL 2YUWA 3G5ZB 3Q1SL 3OR7A 2ZCKL 1IKNC 4MJ6B 4FQQA 4HLZH 3SDAA 1AJ7L 3HMXL 4S1DC 5L7XL 3EKCA 4JFEE 1Q0YH 5E9DB 3SDCB 1VADA 3UROR 1CG9A 3AY4A 3FRUB 1PSKL 3FL7A 2W65A 3BIBX 5E0QA 4L3ED 3U79A 2JKXA 4AMKL 1W8NA 5IVOA 1W0WA 1BLNA 1EX0A 1T6VN 2IG2H 4EJ1C 1V7NL 1DQDL 4JG1L 4PLKD 5J0BA 4LLVA 3NZHH 2CDFA 3I02B 1D3CA 3OG6B 4ZUUB 1NBQA 3FB5A 4K7PX 2IPKA 4JFFA 1E4XH 3BN9D 3P9MB 4L1DA 4M1CC 4YDLB 5IT2H 1HNFA 3ULUD 3ZKXB 2R56H 4QOKE 3REVB 1L0XA 3PGFL 3LKQB 4DN4L 1OM3H 4S1SH 3UO1H 4ODVH 1UJ3B 3D25B 1YEHH 2VXTH 5BZWA 1IM3A 4RBPK 4LU5H 2NX5A 1LEGB 4LAJH 2ZUWA 4BH8B 1T1XA 2IALA 1VEPA 4JAMA 1EEUA 5HDBE 4NUGH 1CR9H 2W0PA 3NCEB 4YNYB 4ELME 4KZEL 5J1TC 5GSVA 1UFUA 2OZ4H 4MMZC 4OZIB 1SJVA 4PRIB 1XIWC 2D2OA 3P0GB 2F54D 3BGFB 4UQ3B 4I1NB 1X7QB 3O0RL 3SDYL 3WXVL 4AG4L 4QY8A 4ZPVB 3WFEH 2V5RA 1UZ8A 4I9WE 3WNOA 4QRQA 1GC1L 3QISA 3C6LD 3TJHD 4HEPG 2VDPH 5EPMB 1RVFH 2DLIA 3LD8C 2EDXA 1PEZA 5A3IC 5B8CB 1FFNB 1YC7A 3IKCB 1I9RL 1KGCD 1CDYA 2HVJA 4WFEE 1RJZA 2R1XA 1CQYA 1MAMH 3UYRH 3DSFH 2XY2A 5CP3A 1PDKA 1XGPA 3BQUB 3VXME 1KJ3H 1NGYA 4EN3B 3S6CA 5CUSL 2ZG2A 5E24E 5JOPE 1QRNE 3L5WA 4PJ9B 4DJMA 4ONFL 1EDQA 2DIBA 3HCVA 1TZHB 1M7IA 3FQUB 2VKWA 2APVA 1NH6A 4PB9H 4NJAL 3T0EC 2PYEA 4XHJD 5MEOB 3IU3A 3JV5A 5C70A 2EIEA 5HHOA 4L4TB 3FZUC 2JCCA 4FP8H 1MHPH 4XCEA 1FLRH 4XGZA 5E5MA 3UAJD 3DNKA 1CFQA 1P84K 1RAMA 4OGZA 3MR9A 4P0DA 3O8XA 2WINA 3BP6A 5GGQL 2FHFA 5MENE 4RMTA 5IHZA 4TPRH 4JKWA 3DX9B 2J4WL 2VDLL 4JKKA 4G80A 5EO1A 4PJDA 1MEXL 1RZGB 4KJWD 4XNMA 2P5WE 4FXGB 3DX8B 1EHAA 5D7IF 2IPTH 4L8CA 4HFUH 4CMHC 3VXUD 5EU3B 2YOCA 3CFEA 2RHEA 3OXSA 4JZJC 3GK8H 3IS0X 3DRQA 3BD5A 1FN4B 3MV9E 5CAYB 2I07B 3WN5C 4U6TA 4PJGA 5C0CA 1FV1A 2NY1C 4MCZA 1EO8L 4L4VE 3BH9A 4LVEA 1VGKB 2YD6A 3EGSB 2FYYA 3GBNL 3MNZA 2AV1B 4Z0BL 4WUKH 5I18H 4NRYB 4IRJA 2CXGA 2Z92B 4Z18A 3X13A 2D7PA 4AIZA 3QI9D 5EOQH 3O3DB 1EHLL 4GRLC 1GZQB 3TA3A 5D1QB 1JGVH 4PJ5B 2FR4A 1I1AC 1A1NB 3NH7H 3MJ9L 4PGZA 1HHKB 1OW0C 3VGBA 3ES6B 1FJ1A 2D7NA 1KJMA 2Y7QB 4M7KL 2DD8L 4QRTB 4QRSA 5FO8B 4P5MA 2B5IC 4FFWC 3QJFB 1LQSR 1MH5A 4ELMB 1KCRL 3UMTA 4NKOB 5KVEL 5E8DH 1ZLSH 1YA5A 2H8PA 1CICD 3DV4A 2HLAA 3LKOA 4ZOCA 3TO4C 1JYWA 4LKXB 3NCFB 1MRCH 3T4AB 2UWEA 4XRCA 5GZND 3OR6A 5F1NB 5EIIB 3PWVB 3BPLB 4F8QA 2FGWL 4LCUA 4I5BB 2NX5E 4YX2L 1XGUB 3TZVD 4V1DD 1NEZG 4F3FB 4HLZG 4QXTB 1UXWB 1EJOH 1I7ZA 2EDDA 4FQ1L 4ZODA 2ZP0T 4R0LA 1KTLA 3CFIC 3KLHD 2R9HC 3EYOA 3UZQA 3P77B 1KLGB 4I18B 4EOWL 4WO4B 1QRNB 5IQ9A 4YDIH 3QB7C 4CVUA 2IGFL 3GSNB 3T0XA 2WBWB 1BBDH 1FC2D 3IF1B 4HG4K 4J3UA 2K1MA 4M1DH 2OR9H 3OSKA 1MCOH 4FG6C 5EU6B 3OAYK 4NHUB 1WZKA 2R1YA 5C07A 5C0ND 1KYOK 3LQZB 4HBCL 1P6AB 1MFAH 5GXBB 1IEBB 2NW3A 1QR4A 3WO3B 3Q6GL 4XX1G 4HULB 2ESVB 1Q9WA 4RCAA 2OSLA 2W60A 2A9MH 4LLUB 5KZCB 3GSNH 3NIFE 3QT2A 4N0RA 2ZCHL 5MENB 5C71A 1YEGH 3DETC 5D7LA 1GVIA 2EDFA 2R0ZH 2FEDC 3ARVA 3WUWB 4FTVD 2R23B 4CADA 3C5ZD 2PYEE 4I13B 4PREB 4HXBH 1KEML 2VDNH 4BUGA 2NY4B 1INDH 4NZUL 4UV4H 1JJUA 1CFVH 4P2OA 4JFHD 1H3UA 2P8MB 3D39A 1A7RH 3SPVB 2Z4QB 3QIBA 3RVTD 4F7EB 3ZO0A 2IFGA 3O11A 2YD2A 3VG9B 1FZMA 5EU7E 3QPQC 1DJSA 1OT1A 2W92A 3JUYA 1OTTC 1T7YA 2EDTA 2D7QA 3IDNB 4KJQC 4XPAL 3EOBB 4OD3H 1AY1H 2DLFH 1Q9OA 1XGQB 1UADC 2AJSH 2DQFA 4PJDE 4X6CB 4MD5A 4Y1AD 1B88A 5IB5A 1MPAH 1FO0B 4FQQB 3SDAB 4Y5YA 5E08L 2VZ1A 4KHTL 1UM6H 1VADB 1CG9B 3VRIA 4P2RE 5GS2D 1CIDA 1J86A 2W65B 5HHVL 3WDIA 4LHQB 1K3ZA 3RVUD 3ULVE 2JJVA 2AEPL 5A40E 3BSZL 4F80A 1W0WB 1BLNB 5C0CE 1WZMA 1FGNH 5DEZA 3MLYL 2I25N 4QHKJ 3IAGC 2F53E 4LLVB 2YN5A 2CDFB 4OUUA 5GS1A 5JMRA 1FGVH 4JJHA 1M4KA 2A6IA 2DQDH 3FB5B 5F8RC 4W4OC 4JFFB 5JPMA 4H25A 5HDBF 1U8MA 4TSBL 4N0FA 3DURA 3ZYIA 4ELMF 4D8PA 4M43H 3MFGB 2YD1A 2KBGA 4RWYH 4A2LA 3BO8A 2BXZA 3TWCL 3PQYA 5BZWB 1IM3B 3STZA 1RUQH 4MJIA 3S98A 5LGHH 1GHFL 1ORSA 4FXKB 1IEAA 4OB5L 3FOMA 1T1XB 2IALB 3O6FC 4JAMB 5HHNA 3D2UA 3TYGL 3AREA 3QHTC 3U9UA 4TVSa 4TSCL 1UYWH 4HAGA 1FE8H 3QDMA 5TPWL 5GSVB 4JPKL 4CAGA 1BREA 5CEZL 3RNQA 2Z93A 2VLKB 4QTHA 4S1QL 4MQXD 3W11C 1KPUA 1VFAA 4NQVA 3HAEA 1JYVA 4LEOA 3V5KA 4RSVA 3WSQH 4KROD 1UZ8B 1A6PA 1E0OB 3L5JA 1SBSH 5E2UL 4JRYA 4BZ1L 2O5YH 4L9LA 2E7MA 1TNMA 4KK8C 5T1DH 2OR7A 4R6UA 1SJEA 3FFCA 4OCYH 1JZ8A 5E2TH 1QQDA 5TQ2H 4Z95L 3U4EA 5GS0C 2HVJB 3KVQA 4PGDB 2VLJB 2R1XB 1KFAH 3A6CH 4PJXA 3KR3H 2QTEA 4JB9H 4MGXA 3U7YL 2F8VA 1NGYB 4J6RL 1PG7H 2P7TB 4F8TA 5D9SA 2VR4A 3L5WB 2GY7B 4RRPG 3HCVB 1M7IB 4OIIL 2PYEB 3LCYA 1INQB 3O4OB 1JCKA 1C5BL 4QGYA 1GL4B 5HHOB 4U0QB 5C07E 4P5TC 2DQGL 4OT1L 2JCCB 1IGYA 3KHOA 4KQ4H 4XCEB 2OYPA 3EYQD 5CP3H 4RX4D 4XGZB 2PO6D 1KENH 5E5MB 3U30B 1F42A 3EYFB 3B9KA 1CFQB 4U6XA 3T65B 4JFDA 3MR9B 3S36X 5JXEC 1S5IH 3O8XB 4LVNB 1OTSD 3BP6B 3TBYA 4M7LH 4NQEA 5BMFH 3RHWF 1IC5L 2YA1A 1DZBA 4KMTH 5CEZD 4W68A 5M7QA 4XMPL 2V17L 1OP9A 2IPUK 4PJDB 5GISH 2AAVA 3FB8A 4XNMB 5BCAA 1I1RA 1S7TA 2V7NA 1QP1A 4GBXD 4MA7H 4W6WB 3P30H 4L8CB 3DTXA 2WIMA 2X1WL 5DLMH 3H3PH 2OJZH 3CFEB 1CLYH 3OXSB 1O7VA 2XZZA 4NIKB 3DRQB 4AEHH 1G9MH 2B1HL 5CGYD 2XZAL 4YBQC 4PJGB 5C0CB 4RISL 2FHBA 1FV1B 4I0KA 4MCZB 1XGTA 4Y5VC 1P7QA 3GGWA 3W9DA 3QIWC 3AB0B 2D3VA 5C6TH 2FYYB 4M6NL 3D3VA 2ZSVA 1B9ZA 2Y07L 3MNZB 4ONOA 2MHAB 2OQJA 3FO1A 5KVFH 3F5WA 3X13B 4AIZB 3ULVH 4Q9RH 5EOCL 2XG4A 4KRMB 3TA3B 1CICB 2FR4B 1S7QB 1FFRA 4XBPB 4JVPA 4PP2A 1DEEA 1NC2A 3QUZC 3CSGA 2DLTA 2Z8VC 3B2UC 1ZXQA 4I2XB 4ZUSA 4IRSC 4ZS7H 4G8IA 2R0WH 5FF6A 1MCCA 5BVPH 3F7QA 4NP4L 3H9YA 3TM6A 3AFLA 4XPFH 1UACL 4N5ED 4F15C 1Q72L 4H20H 3DMMC 5JIKA 3MBED 5GRJH 5MHSD 1P5UA 4PGCA 4K94C 2E9BA 2O5ZH 2H8PB 3LKOB 2HLAB 3GIZL 3MACH 1A02N 3H9HA 4P9HC 1L0QA 3VCLA 2UWEB 4O02H 4XRCB 2A38A 5I1CH 3QEQA 5FDWA 3OR6B 4LAQL 1B0GA 2WSKA 3V7MA 3V0WL 4MJIE 4OLYH 3QUYD 3RIFF 2WBJD 1Q0XL 3WEXA 2W0FA 2HT2C 2YPKB 1JK8A 5HI5C 3S3JA 5LQBH 1U92A 2NTSP 1QLRA 4MNGE 2P24B 4R0LB 1KTLB 2VAAA 2F74A 1JYXA 3DX6A 4JZOA 3EYOB 2NY3B 2QQNH 2M1KA 3KXFD 5FGCB 4G8GA 5ISZE 1U8KA 2VJXA 5IQ9B 1NCTA 2L7UA 1KOAA 1MVUA 5DRXA 4U1IA 3G5XA 3VJ6B 1RIHH 1RFDH 4U1NA 1UZ6E 5IVNA 3BKML 4MNQA 4L8DB 3NIFF 4IM8A 2G5BA 1UCBL 2W9EL 4CL7A 2R1YB 4JRYE 4QRPA 5FHAL 4E42B 5ADOL 2C7UB 2UY6A 4WCYL 3RU8H 2DM3A 3I85A 4ZO7A 1A6ZA 1Y18A 4LRNH 3FFCE 4GJTB 2NW3B 3EHBC 2C3XA 4FFYL 4F37F 4CVZB 4R2GC 4OLVH 2V5SA 4PJXE 3EJYC 4H0IA 5E7FA 2OSLB 2NY7L 2W60B 4LDOB 5T3ZL 5JUEL 1DBJH 4KHXH 5D7LB 2XXMB 3BMWA 4LPYA 4JFZH 2P5EE 4XXDB 1E6JL 4YXKH 4CADB 4NZRH 1EV2E 1XF5A 4ONHA 3O6LL 3WFBL 4PLOB 2WLZA 4UDUB 5DK3A 5J57B 3RTQD 3MV8E 4M6AA 1OAQH 1ZSDA 4HCRL 1QBMH 2XZQH 3JTTA 4PJDF 3D39B 2AI0L 2EE6A 4XC3H 1J0ZA 3VFUB 3VFPA 1CFBA 3WYRA 1FZMB 2VISA 3WO4C 2H9GA 2X5PA 2FBJH 4NQEE 1Q0YL 3VI3E 1G7LA 2VLRA 4POYA 4HSQA 3ULVF 2IAMC 4OTXH 5C0JA 4KXZI 2DQFB 4PJGF 4MD5B 5IB5B 2YS4A 1IGCH 3BZDA 4Y5YB 5IK3A 1A3QA 5DO2C 2H1PH 5FYKU 2IG2L 3INUH 4P46C 3DI3B 3V4PH 3LB6D 4ZS6D 3VRIB 3I2CH 4QT5A 5K9QI 3NZHL 1R3IH 1TZIA 4UU9A 3IB4A 1YYMH 3NZ8A 1NC4D 4NQTA 3E2HB 5E56A 1E4XL 1TNNA 4LSUH 3C60A 2Z8SA 5ADPH 1MFEL 4Y4HD 3BKCH 1QLFA 5T3ZD 3KLAA 1UB5A 2R56L 1MCSA 3ARQA 3D3VE 3H42H 3MTRA 4BFBD 4D9RD 5CJOH 2WK2A 2ZNWA 4ODVL 4S1SL 5EZOH 1OM3L 3UO1L 1II4E 2VXTL 1LNUA 2A6IB 5E95B 4LU5L 1S9VA 5IROC 2CKBA 5JPMB 4PLKC 4H25B 3RBGA 1U8MB 2ZUSA 4N0FB 3DURB 1IBGH 4NUGL 4D8PB 4ONGH 1CR9L 2EO9A 3AGVA 5GRVL 3BO8B 3I75A 4DOHE 2OZ4L 4OZ4A 3PQYB 3STZB 2X09A 5EG6C 1OHQA 3ULUC 3OJMB 2JLLA 1ORSB 3PJSA 1IEAB 3FOMB 5D5ME 2UWEF 3D2UB 1B90A 3AREB 2D0FA 4M5ZH 1TLKA 3SO5A 3U9UB 1ZHNA 4JKLA 4MLSA 5AWNH 2DRUA 3QDMB 1WJ3A 3QIUD 2VDPL 1RVFL 4HZAA 3RNQB 1HI6B 2Z93B 2PTVA 4XNYH 4QTHB 3CFDA 1KPUB 5GRWA 3T2QA 1VFAB 4NQVB 3HAEB 2NW2A 4LEOB 3V5KB 5D1XD 1EBPA 1MOEA 2CDEA 5JA9A 3DPBA 4NPYA 4R97C 1MAML 4LP5A 3UYRL 1HH6A 3NCCB 3DSFL 5KVDH 4PRHD 3QEQE 4JRYB 4L9LB 4R8WH 3HZVA 1KJ3L 1WC7A 2A0LD 1DTUA 3MFFA 1OAKH 4HWNA 2DMKA 4PB9L 4DVRH 3U4EB 3C6LC 3TJHC 1D6EA 1BJ1H 3HAEH 1A9EA 5FUZH 3ME0A 4FP8L 5T5NG 2XXCB 2D9CA 1MHPL 1EXUA 2R0LH 4J3WA 2E27H 3O2DL 4QXWA 1FLRL 4Y2DD 5DMGD 4PJFA 5I8KH 4YLQT 5ITBH 3MJGX 1AKJB 4XVSH 2K9UA 2VDMH 1BOGA 4LHUA 1IGYB 3RZCA 2ADJA 5I66A 3DVGA 4FRWA 4XHJC 5ENWA 1EUTA 1VKXA 2NXZD 3B9KB 5EZLA 5EZIH 1ZLUK 2O26U 3QCTH 4JFDB 3RWFA 4U49A 4NUJB 2IPTL 3LDBC 4P2YA 4HFUL 4J23A 4X99A 3LZFH 3TBYB 1TVBA 3UAJC 3U48A 3NABH 3GK8L 3QXTA 4R9HA 2WBKA 3C8DA 3FB8B 2EE9A 1S7TB 2V7NB 1AIFA 3DTXB 4K71B 5C08A 2ID5A 5IMKA 1AR2A 3SCMC 4KWUA 4KJWC 3W0WD 2R69H 3FHAA 4WUKL 4Q0XH 5I18L 1GC1C 4MA8H 3SDDD 4AL8H 4U6HB 2BSTA 1S7WB 2ARWA 1XGTB 5EOQL 1MHHA 2HFTA 2JIXD 1P7QB 3GGWB 3W9DB 4ODBD 2VLRE 2B4CH 5HYEA 2YA2A 3D3VB 2ZSVB 2BNQD 3NH7L 5CEXB 2HFEB 5MERA 2OQJB 3K4DA 3DXAA 3FO1B 1B6DA 1YNKH 5JHDD 3F5WB 1OGAA 1L4IA 3MLUH 4EI6A 2GUOA 4KUZL 1TTGA 4M3JA 2OM5A 3RL1A 2YA0A 4PP2B 3QI9C 4DK6A 1BWWA 1DEEB 5E8DL 1NC2B 3L3GA 3MREA 3OZ9H 1ZLSL 5E99H 5I76A 2VSCA 4YHZH 1Z2KA 1QSFB 4ZUSB 3QQ3A 1MRCL 4Y8DC 3DO7A 5FF6B 1RZJH 4FQHA 5TH2A 5D7JA 4G6MH 4PGCB 1HYRC 1Q8MA 4RDQG 2XQYK 2BHYA 1T66C 1EJOL 3D18A 5I0ZA 3ECBA 5GGUA 2EYRA 3VCLB 2HRPH 3GKWH 1J0HA 5DFTA 3QEQB 5FDWB 3S3PA 2HLFD 4JFED 1MCIA 3WEXB 4YDIL 1JK8B 1UZ6F 3KPSD 3W81A 1LWRA 1U92B 1BBDL 3QR2A 1T83C 5GZNC 4M1DL 2OR9L 2CKNA 1MCOL 2LU4A 4C55A 2VAAB 1G7HA 2F74B 3DX6B 4JZOB 3TZVC 1MFAL 1ADQA 2M2DA 2V9RA 4G8GB 4I77H 1U8KB 1MVUB 5DRXB 4JQVA 4PJXF 3WL9A 2C3HA 1G9EA 1TITA 4MNQB 5CSGA 1U8HA 2G5BB 4U7KA 2A9ML 3GSNL 4QRPB 4KKCC 4Q9BA 5ACZB 1TPXC 1A6ZB 1YEGL 2EIBA 5AYQA 2PN5A 4QOKD 2R0ZL 3BISA 5DI8B 2DWEA 1X4YA 2WP3O 3AUVA 2CR3A 4HGWA 3AVEA 5C0NC 2VR5A 3I50H 4ODSH 5K33A 1INEH 4HXBL 2VDNL 1JHKH 5D96C 1INDL 5FYLD 5CJXA 4UV4L 4BZ2L 1CFVL 4RBPH 1ZVYA 2CGRH 1CD0A 2DLEA 1X5ZA 1A7RL 5IVXA 4PJFE 2GAZA 1N2RA 3QAZC 2QV2A 2FJGB 4XCCH 1O5DT 2YZ1A 4BFEA 1XF5B 4ONHB 5C7XH 2JJTA 2VC2H 3VI3F 4Y2OA 5B38G 1ZSDB 4IIQA 3ELAT 3JTTB 4OD3L 3MGAA 3C5ZC 4PJ7E 4I9WD 3TIDA 2WW8A 4UT7H 1AY1L 2DLFL 2V5MA 2AJSL 5I6XC 3VFPB 3V8CA 2CRMA 3BPOC 1MPAL 3KWWB 4HIHA 4RNRB 3QG6A 1AD0A 5DVKA 2H9GB 3DYPA 3HE7D 3BJLA 3V6FA 2VLRB 1UM6L 4GT7A 4XB7A 3RVTC 3DOSA 4Y4HB 5C0JB 4P4RA 4LCWE 3GJFH 5T3XD 2YN3A 4KKLD 4LLDA 2FO4A 4OF8A 3VXMD 2ITDA 3VDCA 5HYQA 2HFGH 1CF8H 5IK3B 1FGNL 5JOPD 4HUMB 2Q7YA 4P23A 2ZNXA 5D2LE 4BZYA 4QT5B 2Z0BA 3PWPE 1LHZA 4TULH 3VGAC 1TZIB 4UU9B 1FGVL 1KPRB 4YHMH 5DHVA 3VXOA 4H1LH 2KZWA 3NZ8B 2DQDL 3CVHA 5EIQA 3MRPB 3WMSA 5D8JH 3C60B 1RZFL 3MRFB 1OP5H 3KLAB 1UB5B 2W0KA 3RVUC 5ETUA 4HC1A 3JV0A 4RWYL 2Q76A 1T1WB 5E7BA 4NSKA 4Q6IA 3DXAE 3EYUH 1UEMA 1RUQL 2WANA 1F6LL 1OGAE 1S9VB 5LGHL 2HKFH 2CKBB 5F97E 2VDRH 5D5MF 3IJHA 4M6OH 2EEDA 4Y0GA 3IDIA 5CKAA 3QWOA 2AERT 4PJ8C 2UZIH 1UYWL 1XFPA 2P5WD 1FE8L 3HNTH 1MCFA 3GSXA 4OZ4B 3MLZH 3ZDYE 5CD5C 3MUJA 1X5GA 3PJSB 3AU1A 3MLVH 3NN8A 4OFIA 3MV9D 1X5IA 2E7LA 1PX3A 2CKBH 1SBSL 5ITFA 3G08A 2O5YL 4GH7B 5SV4A 1W72A 1SMAA 4L4VD 3T1WA 4OCYL 4W81A 4CJ0A 5E2TL 5TQ2L 1ND0B 2NW2B 3P3YA 3KHQA 2CDEB 4KK6D 2A83A 4M7ZC 3B4NA 4P59H 3A6CL 4NCC2 4NPYB 2E6QA 1KJVA 1HH6B 3KR3L 4QHMA 2FHCA 4IBLT 4MQXC 3HZVB 4JB9L 4EI5C 1WC7B 1TQCB 1ZS8A 3ZZ1A 3MFFB 4F57H 3O3AA 1CXEA 4KROC 1FNFA 5HDLA 5CJQH 3MXVH 1D6EB 1IVLA 2A2QT 4PY8I 1WBZA 5E94A 2R1WA 5GZOC 4YFDB 4K7FA 3ILPB 3Q6FA 4KQ4L 1OWWA 2H6PA 1U3YA 1DUYA 2EC9U 2GI7A 3QRGH 4PJFB 2Y72A 5CSZA 4KRNA 5IUSA 3CLEH 4D9LH 4UNTA 1F3JA 1S5IL 4NQXA 4XHQA 1BOGB 4LHUB 4M7LL 3RZCB 5BMFL 5T1KB 3A0OA 4Y4FD 4PBXA 4KMTL 2ADJB 3VH8G 5I66B 3DVGB 2NZIA 1WAAA 1VKXB 3ALWA 2GY5A 1T0NA 5GISL 4HS6A 5EZLB 5ESVA 5BV7H 4O9HH 1SQ2N 3RWFB 4MA7L 3S4SG 3P30L 4P4KA 2NX5D 4OI7A 4X99B 1RJLA 3EYQC 1TVBB 2PO6C 2OJZL 1FL5A 1CLYL 3QDJA 3ARBA 2JE8A 5KTEH 4AEHL 1CN4A 1G9ML 1OTSC 2OP4H 3H7LA 1MCEA 2FECI 3U2SA 2HT4D 1AIFB 4MD4A 4LNVA 5C08B 4TRPH 4KK5D 4HQQH 5IMKB 3LEXA 5JW4R 1X6LA 2C3WA 5C6TL 2FRGP 1MRFH 3IAQA 4GBXC 1KNOB 2D7OA 2HMIC 3KPTA 4WHTB 1A47A 1FNSH 2XTLA 4CKVX 3ULVL 4F7TA 4Q9RL 1MHHB 9CGTA 2VSDA 3KPNA 3RVWC 4FFVC 3D6GA 5CGYC 4QWWD 3WJLA 5MERB 3DXAB 3EDJA 5ACMA 5F7FA 4UB0L 3LQAH 4EI6B 2GUOB 4WWKD 4DTGH 4ZS7L 2BCKA 4XNXH 4MA1B 5DJDA 2R0WL 3VXNA 3RL1B 5BVPL 4XPFL 2F9BT 3O2VH 2XACC 3QUKA 3T0DA 4H20L 5GRJL 2X4UA 3P0VL 3L3GB 2WWMD 3MREB 4NO2A 2O5ZL 1CU4H 5D7KE 3BESR 3CPLA 3MACL 1HXYA 2NYYD 5E2JA 4HKBA 4XI5C 3KPSB 3QQ3B 2FWOA 1F8TL 3Q5YA 4O02L 4A6YA 4PYHA 1T21A 4QRRA 5I1CL 5DMYA 4FQHB 2ZUVA 2PTUA 5TH2B 4OLYL 4LLYA 2A1WH 3ULSA 1DFBH 2JB5H 1I7UA 1NBVH 1PW3A 3GB7A 5LQBL 4HJ0C 2NLJA 4MAUH 3SGJA 3QUXC 3ECBB 5FM5O 2EYRB 4N5EC 5B4MC 1XGYH 4GAGH 1IEHA 1TMCB 2VIRA 4AT6A 3MBEC 4OCMC 3GI8H 3HRPA 2QQNL 3O3EA 4GW4B 1FH5H 1MY7A 3U9PH 1NFKA 4P2RD 3FN9A 1RIHL 1RFDL 1YMME 5K59E 2FD6H 4YUEH 2OXGA 3QUYC 8FABA 1G7HB 2WBJC 5DD0H 2X40A 3RU8L 2K7QA 2VWEC 4H1LG 1DQMH 4LRNL 4HPOH 5CJBA 2F53D 4HZLA 2GIYA 5BRZD 1P5VA 1OQOA 2CH8A 4NNYA 3WL9B 4OLVL 3U36A 2YUVA 5D2NE 1I85A 4IRJD 1U8HB 1CD8A 3DO3A 4PP1D 1OTUC 4XVJH 1LVEA 4ESKA 1JGLL 1DBJL 4KHXL 4AYFA 4PJFF 3PDOB 2XKNA 1R24A 5F9OH 4JFZL 1MRDH 5F1KC 2DWEB 1TDQA 4YXKL 4HGWB 4N0UB 3KPPA 4Y4KD 3VMNA 1OAQL 2EIZA 4PJ7F 2DJUA 3HI6H 5DSCA 1QBML 5F3BB 2XZQL 1EJ6A 1DVFB 2BNUA 4GRWB 5IVXB 4XC3L 2GAZB 1N2RB 3UBXA 1NQBA 3NTCH 1QPXA 2ZSWA 5C09B 5IWLA 2FBJL 5SX5K 4HKZB 5HHMB 4IIQB 3RWJA 4FS0A 3D48R 4OTXL 3VXSA 5I30H 3TIDB 3WCYA 5FKAA 4EEEA 2GJ6D 4HX1A 3OGCB 3WFZA 4KKBD 4HIHB 3QNXA 3QG6B 1IGCL 5D2LF 1AD0B 2H1PL 4CDHA 4GRMA 1DQQA 2OTWA 1DP0A 3INUL 3BN3B 3V4PL 2H2PD 3QDJE 3I2CL 5KVGH 4P4RB 2EECA 4MXWH 1R3IL 4Z7VB 1NGPH 1CVRA 1YYML 4Z5RA 4RAUA 1M05A 2DMBA 4LLDB 2FO4B 5HVHB 2ITDB 2ZCLH 4LSUL 5HYQB 3VMOA 5ADPL 4P2QA 2EXYC 3MNVA 2BVYA 1RZKH 4P23B 2Q7YB 3BKCL 5SWQA 3BOVA 3CSPA 3H42L 4WHCA 4KMLB 1DUZA 1QR1A 5CJOL 5EZOL 1NGZA 1HIMH 5D7SH 1Q38A 5DHVB 5C07D 3VXOB 3CVHB 3UTZA 3VWJC 2BK8A 1NKOA 4ORZC 5I0DA 3ZKND 3LB6C 1N4XH 4ZS6C 4ZAKA 1IBGL 4GXVH 4ONGL 3SKUD 1ZK9A 5ETUB 5EORH 1JI2A 2Q76B 4Q6IB 1N26A 1LO5A 4YAQA 3IJHB 5BQ7A 5DHVH 1F4HA 3CVHH 3IDIB 3IAPA 4HMCA 3S35X 4AEFA 4M5ZL 1KCKA 3QWOB 4PY7B 4WW2A 5DJXA 5AWNL 3L3DA 1WUNT 4TVPL 2J1KA 3GSXB 2CD0A 4XNYL 4HC1H 5F7EH 4P2OD 3GI9H 3IT8D 1O0VA 2EH7H 4NWTH 1HXMA 3AU1B 2ADFH 5IB3A 3MRDA 3NN8B 3QIBD 1TZGH 1D5BA 1IRAY 4QRRE 4U6YA 5ITFB 4IOSD 1ZT7A 4R8WL 1W72B 4M62H 1V3LA 5KJRH 5B39G 4Z6AT 1OAKL 1K5NA 1ZLVK 1I8LA 2XN9B 4DVRL 1BD2D 3QIUC 1P69B 4GG8A 1NGQH 3FT3A 3RX8A 1R3KA 2JJSA 1KJVB 4QHMB 4M8QB 5FUZL 4U05A 4GQPH 5KSAA 2R0LL 1ZS8B 5D1XC 4P3CH 3SKJH 2E27L 5C6PB 3O3AB 1F6AA 3CX2A 4RZCA 1W72H 4QXGH 1KT2B 5I8KL 2PCPA 1LO3H 5H94B 2J2ZA 2XPGA 5ITBL 2LAGB 2B20A 1CYGA 4XVSL 1WBZB 5E94B 2A0LC 2R1WB 2VDML 4NCDA 4K7FB 3LEYH 1CCZA 5SX4I 5E4EB 4KXZH 1JHLH 1NFDE 2H6PB 1DUYB 3ARSA 2YMXH 1T22A 5FM4A 5CSZB 5EZIL 4MJ5B 5ICXA 1YECH 1QHOA 3QCTL 1CFSA 3EJZD 1F3JB 1QO3A 4NQXB 5EH1A 3V6OA 3BWAA 3LZFL 1K2DA 4KKAD 5DMGC 3NABL 1PG7W 1F3DJ 3ARYA 1U91A 1T0NB 4HS6B 5ESVB 1F11A 1QA9A 1ZA3A 5FCUH 4MJID 5A43C 3EFFA 4P4KB 3MA7A 1RJLB 1TTFA 4K3DH 4UMGA 3RRQA 5TE4H 1FL5B 3CH1A 4N5UA 3ARBB 1D5MB 3W5MA 2R69L 1NLDH 3I6GB 1BQHG 4HIIA 3MMEA 4IEFB 4Q0XL 2BY2A 1J18A 4V2BA 3U2SB 4MA8L 2X10A 4MD4B 4AL8L 5ISZD 1JMZA 3D1MC 4RGNB 3VG0L 4FMFA 3LEXB 4XBGA 2B4CL 2FJHA 3UC0H 4CMMA 3VXSE 4ETYA 1DE4A 4FQXD 5CD3B 4M93B 1YNKL 3QFJB 3BKYH 2VABB 4X6DE 3PL6A 3FFCD 3MLUL 3QRFM 4K9EH 2V5YA 2VRAA 4F7TB 5IQ7L 4JM4H 2RR3A 3KPNB 1CFNA 1PBYA 1G9NH 1ZHLA 4MWFA 4F9LC 4OCWH 5IB2B 4QGTA 1YEKH 3CSBA 3IVKB 3SDDC 5B8CC 1HSAA 3UPAA 3OZ9L 5JDSA 5E99L 4YHZL 4Y5XA 1JHTA 2P5ED 1EK3A 2BCKB 5DJDB 1DL7H 3ARDA 4JO2H 3VXNB 4R4BA 4X4XA 4DK3A 3BQUC 1RZJL 4M9OA 3GM8A 3MGOA 1MJJA 3QUKB 3MV8D 4PJEE 2X4UB 4G6ML 4NO2B 4OSUH 1NCNA 5CP7A 1WZLA 1ZHBA 3CPLB 3FONA 2HWZH 4HKBB 3U7AA 12E8H 2FWOB 3QJHB 4DGVH 1GGCH 2HRPL 4A6YB 3GKWL 4QRRB 3VXRD 3GSQA 3MYJA 3EFDH 2LABA 2NXYD 3E3QE 4U1GC 3ULSB 3TNNB 5HYJA 2DL9A 3RFZC 1ORQA 5DJ2A 2E8ZA 3ARPA 4GAYB 5K59F 3GB7B 3MLSH 4JFYB 2ZUXA 4LRIA 2NLJB 1IQDA 2YRLA 3K2MC 2VIRB 4AT6B 2YD9A 5DS8A 3FJTA 3KPRA 2A74A 2X1OA 3O3EB 3TT1H 4I77L 2FZ3A 4DW2H 3O6KH 4NZJA 3FKUS 3RVXC 5SWZE 4OCLC 4YDVA 4ZXBA 4M3KB 3SQOL 1A4JA 5J8OA 5K9OA 1Z0MA 2HLFC 2RCSL 1MCQA 4CVXA 5HTSA 3M45A 2K7PA 4C59B 1CXLA 2XOTA 3MRCA 4HZLB 2YD4A 2VO5A 4YGAB 5CHNA 4NNYB 3GMLA 3I50L 4ODSL 1INEL 1U2CA 3ZT6A 4LKCA 4CU6A 3K74B 3NPSC 2B7DT 3MV7E 3W9EA 2CGRL 2XKNB 1R24B 2D4FA 4RMWA 4XCCL 3V9FA 3KPPB 5FA3A 5C7XL 2AJVH 1LO0H 2HJFB 2KQNA 4I48A 4PD4J 1S78C 5D1QC 4D3CH 2XTJD 4JREC 5DSCB 2IPUG 2Q20A 3VFSA 2BNUB 4OCSH 4UT7L 3VU2A 1H9VA 4XZUA 3ARGA 3QO1A 4OV6F 3UBXB 5FECA 1MFNA 1VENA 3LKNA 3REWA 3V6OE 2ZSWB 5I1JH 5FM8A 5DEGA 1U42A 4H8WH 1T89C 1MFBH 3RWJB 4C56A 2IBZY 5FKAB 3TVMD 3D87B 5I8CA 3SKNA 5CZVH 3QNXB 2HFGL 1AP2A 1CF8L 1NCBH 3TBWA 4GRMB 1DQQB 2OTWB 4WEMB 3RGHA 4LP4A 1S7UA 4TULL 3FB7B 4APQD 4YHML 3BPCA 4RAUB 3HE7C 2CPCA 5F9WB 1MQKH 5D8JL 5BS0A 1JPFA 4P2QB 1A5FH 3MNVB 3H9SA 1V3MA 3QEGH 3RY5A 1D9KA 4G9FD 5SWQB 4KKLC 1DUZB 1NGZB 1JUFA 3EYUL 3UTZB 1ZA6A 3HR6A 3CZFA 2HKFL 3BT2H 2VDRL 4WWID 1LO2H 4M6OL 3VFGH 3I6KA 1VA9A 4J12A 2WIIA 2AXHA 3M07A 4ZAKB 5IW1A 5K9QG 4Z7UA 2UZIL 1NCUA 1B4JH 3MLZL 4WTXA 1LO5B 3LKPA 1ZLUH 1KCVH 4NQDB 5BQ7B 3MLVL 5ID0B 4WNQA 1EMTH 4NN6B 1VACA 2ENYA 3ISWA 4WW2B 2CKBL 2QSVA 3BVNA 3L3DB 2VLLA 2P43B 3H7BA 1ED3A 3OX8A 5IESH 4FQLH 1KPVA 3C09B 5HHPA 1GOHA 1HXMB 6CGTA 4G6FD 5IB3B 1ZVSA 3MRDB 3DWTA 4P59L 5FUCE 4U6YB 1UH2A 1M1SA 2GSGA 2ZOLA 3QBTB 1ZT7B 5HYSA 3NCYP 5HYJE 1OF2A 4F57L 3CFBA 4UUJA 1K5NB 2IEPA 4JO1H 5CJQL 3B8YA 3MXVL 1U93A 4XPTH 1JE6A 1NUFA 4GG8B 3FT3B 1R3KB 3U0WH 1CE6A 1E27A 1VFBA 2Q3ZA 4LHJB 1N59B 3FO9A 5KSAB 1A7QL 3KPRE 1BIHA 1NFDF 3QDGE 4KK6C 2BOCA 1RHHA 3QRGL 3X3GH 3RWGA 4RZCB 2ARJQ 2PCPB 2XPGB 3CLEL 3SDAC 4D9LL 2YEZA 1I3VA 2HTLD 4KC3B 3DX7A 5ILTH 3GUTA 1FAIH 1AC6A 5H37H 4AH2B 3AY4C 5TDNA 3DHMA 5IOPB 1IAOA 1SJHA 4TOYH 5H2BA 1QACA 3L5HA 4IMKA 1JTTA 4O9HL 1CFSB 1T80A 3MGTA 5DRWA 3BWAB 4U7SA 5EU4B 3TJEH 2B2XH 1YEDB 1K2DB 2KUTA 5KTEL 5DTFA 1ZANH 1U91B 2GQHA 3CLFH 5DQJA 2OP4L 3MV01 2ADGA 4K55A 4TSAH 4XH2A 1F11B 3MSPA 4OJFH 3EFFB 4Y4FC 1OCWH 4TRPL 4HQQL 4KDTA 4LCCA 3VMPA 3CH1B 2BVTA 2Y25A 1MRFL 2OL3H 4HIIB 4X6DF 3MMEB 1JZ7A 3O4LA 3WFDH 1U3HA 2FIRT 3VDBA 1NAKH 3SGEI 4X7SH 2FIKA 1FNSL 5KS9A 3NFSH 4YJZL 4XBGB 3OKOA 2FJHB 2JK5A 4C56E 3R06A 1DE4B 2APWA 1FBIH 4LLMB 2ATKA 1C5DA 4ZMAT 2NZ9D 3K80A 1S7RA 5FKPB 4JFOA 1IC1A 1ZT4A 2UUDK 1Z0NA 3PL6B 3BPNC 1IKFH 3LQAL 5E6ID 1CFNB 1AQKH 4DTGL 1T0PB 4XNXL 4MWFB 1HDMA 4X9IA 5LBSH 4RGMB 1QTYT 3O2VL 4AIOA 1I1FB 4WFHE 5JDSB 5BS0E 2IH1A 4NO0A 1CU4L 1U8NA 1UQSA 4WUUD 4Y5XB 1JNNH 3TT3L 4D0BA 5GRZA 3ARDB 1CD9B 4R4BB 4X4XB 2AEQH 5C0AA 3MGOB 1MJJB 2A1WL 3PWUB 2JB5L 3MCKB 4WWKC 5IB4A 5CP7B 5DHYA 1ZHBB 1BZ7A 4OFKA 3FONB 4MAUL 3WJJA 1X5JA 3UTTA 4Z7UE 4R7NA 5JW5A 1XGYL 3ZKQD 1XH3A 4K8RH 1WZ1H 3GSQB 1IM9D 2WWMC 3GI8L 4NQUA 3RKDC 5HYJB 1AXTH 1FH5L 1MCNA 1ORQB 2HA1A 2NYYC 4UT9H 5DJ2B 5DJ8A 3U9PL 4LCWD 5EU7C 15C8H 1B4RA 1ES0B 1PX4A 3O8XC 2FD6L 4LVNC 4OF0A 5FO9A 4YUEL 4MDIA 1YY9D 3DIFA 2VH5L 1WTGT 1G9MC 2BDNH 3LN4A 1VDGA 1BVKA 2A74B 3QUMA 2FZ3B 3FAXA 2QHRH 3PWPD 4ZOEA 3EYVA 2YWYA 4ZXBB 4YDVB 5K9OB 1UA6H 2DQEL 5B21A 5C9JB 4HJJH 4XVJL 4CVXB 1B0WA 1YEEH 5FGBA 2XTJB 3MRCB 5F9OL 3ULVC 1EAPA 1MRDL 4X5XA 3K4ZA 4UDTA 2BMKA 3GMLB 4LQFH 2IC2A 1OGAD 4LKCB 5HY9A 1T04B 1OD7A 3SDXA 2J8UE 2EKSA 5HGHA 4UIKH 2DICA 5I73C 1D5ZA 5IJVA 3HI6L 4Y16D 2Y5EA 4QTIH 3U82B 5FYKE 3UTQB 1CQKA 3TH3T 4IRJC 2DS4A 1F5WA 3NTCL 4PP1C 3CX5J 1R3LA 3UTOA 3BKJH 2PXYD 5C0FA 3VA6A 1VEOA 3TBVA 4HKJA 2L0DA 3QWRA 4J4PD 1FIEA 1OB1A 1Y0LA 3VFSB 5I30L 1IKNA 4XZUB 3ARGB 3QO1B 3VFVA 4Y4KC 3IGAB 1QZ1A 5FECB 3CXHJ 3NPZB 3LKNB 3REWB 4MA3A 4MZ3A 4C56B 4CN4A 4F7MA 2X70A 2AXFA 1NGPL 2UYLA 4FFZH 4PJBA 1FNAA 5I8CB 3N1PC 3SKNB 5J13B 2ZCLL 3QFDA 4K3EH 1AP2B 2A77H 3BZFA 3TBWB 4PD4K 3RNKA 2XYCA 1RZKL 1DN0B 2YXFA 5GS3A 3KLSA 1S7UB 3S97C 2MCPH 5FEBA 2F8OA 4KKBC 1HIML 5D7SL 3BDXA 3BPCB 1AFVH 3O4LE 2OBGA 3SO3B 2AGJH 3E1F1 2H2PC 4NN7B 1N4XL 2EDEA 3H9SB 5KS9E 4LF3A 1D9KB 1UKSA 1C7TA 4GXVL 5EORL 5DVOA 3PABB 1HHIA 1YJDH 1CXFA 1UKTA 3UP1A 3HZMA 3CZFB 4KAQH 2WIIB 4PBWD 5IW1B 3CVHL 3GMOA 1XR9A 5JHLH 4M48H 1XIWA 4M1CD 4Z7UB 4LPCA 1J8HA 4JPVL 2V7HA 3D0VA 3IXAA 4F7CA 1FYTB 2XQYG 4O2EA 3LKPB 4HC1L 3GI9L 2E5EA 4HUXA 2EH7L 4NWTL 3CAFA 2ADFL 2ORBH 5J11B 1KCUH 1TJIH 2ICWJ 1NGXA 1BHGA 1CXIA 3BVNB 5DURB 3HMWH 2VLLB 3H7BB 2VTFA 4M62L 1ED3B 3T0BA 3OX8B 4JM2A 2G5RA 1VSCA 1MHEA 5KJRL 1KPVB 3L3HA 4PJIE 2A9NH 3NACH 1EPFA 1FLTX 2AEWA 3PHOA 4OZHA 5HHPB 1PFCA 3FRPA 1ZVSB 3UTTE 1NGQL 1F6FB 4GKSA 2GSGB 2ZOLB 4P2OC 5HYSB 3T0EA 1OF2B 4P3CL 3SKJL 2QL1A 3CFBB 3QIBC 2VITA 4UUJB 1NGWA 2PW2B 1W72L 3CFKB 4QXGL 4RMRA 1LO3L 1U93B 3HG1B 4GXUM 3DYMA 3RZWA 5F6HI 1CE6B 1FG2A 1WGOA 1E27B 1VFBB 4BH7A 3FO9B 2R2EA 1UCTA 5L6YH 3LEYL 3X17A 3BGMA 3RWEB 1JHLL 2BOCB 3ZDZE 4K7PH 4HDIA 1BBJA 4XBEH 3RWGB 4OD1H 3CGTA 1YECL 5DUBA 2YEZB 2GTWA 1DLFH 1PG7X 3GSOB 3DX7B 3GUTB 4MAYA 4XVTH 4KTEH 5TDNB 1EO5A 4JGUA 3RWHB 1I9JH 1IAOB 1WTLA 1SJHB 3UCRA 5H2BB 2VZ3A 3DGGA 1JPGA 1KB5A 3VDAA 5FCUL 5KANI 3MGTB 2EZ0D 4JZJA 5FYKH 3B5TA 4O51B 3SDXE 4KRLB 4K3DL 1LEKA 2CUHA 3TIEA 3NAAH 2VL4A 4OGYH 5TE4L 5GS1C 5T5FH 4F2MB 2R15A 1HHHA 2BVUA 5DTFB 5T1LA 3OKNA 3EJZC 5DQJB 5CILH 2ADGB 1OAUH 1BZ9A 4XH2B 5EU5A 3Q3GB 2NY0B 4N8CH 2G9HA 1OQXA 3QXDA 2BRRH 4HK0A 4LCCB 1YMMD 3UC0L 1DEDA 2YD7A 3HC3H 4XNZB 3FO2B 3O4LB 2YC1A 1U3HB 1AO7A 3BKYL 1I1AA 2FIKB 5SV3A 3TF7C 3QQ9C 4K9EL 5DUMH 1ACZA 5E6ZA 1OW0A 4MQTB 4JM4L 4DGYH 1G9NL 3OKOB 4MNHA 4OCWL 2JK5B 4WUUB 2AVGA 3R06B 4NQSB 5EBGA 43CAA 2LVCA 1YEKL 4NDMA 5IB1A 1LEIA 3RPIA 2BRQA 2ATKB 1C5DB 1S9WA 3BXNA 1S7RB 4JFOB 3L3OA 1CIUA 1ZT4B 1WWWX 1FZJA 4FQXC 2VZUA 1DL7L 2X89A 4JO2L 1NANI 2YBRA 3TO4A 5SWSD 4ALAH 4XAKE 4UAOC 4OSUL 2AQ3A 2IH1B 4NO0B 3WNLA 4OKVA 1U8NB 1UQSB 4Z7UF 3E6FA 2HWZL 1KIPA 4YHLH 12E8L 5F1IA 4D0BB 4DGVL 1GGCL 5GGRA 5DR5H 5C0AB 1F45A 5J1SC 4P57A 4Z0BH 4LFHG 5DMKA 2H26A 5IB4B 1QSZA 1TENA 5TDPA 1BZ7B 4GSDH 1T2XA 2VE6A 5DXWA 4OBSA 3UTTB 4HWEH 4R7NB 5JW5B 1XH3B 4NQCA 1J8HE 1H3VA 2OMNA 1P7KA 5H8DA 1LK2B 1MHCA 2X4PA 4GKNA 3TT1L 1KXQE 5DJ8B 2V9TA 4DW2L 3O6KL 2YRZA 5JMOC 4YEEA 4BSWB 1AHWB 4GLRI 5FO9B 3ZYJA 3DVFA 4MDIB 5E8NA 4AQOA 2NXYC 3LN4B 1KCRH 1BVKB 3TC9A 1AD9A 5EIVA 5HGDA 3BZ4B 3H0TA 5KOMC 3EYVB 2B4CC 1UKQA 3EO1A 3HZKA 2J8UF 4K71C 3BFOA 1CXKA 3EDKA 4JFXB 3T0EE 2LVEA 3WLBA 5E8OA 2AJUH 1EAPB 4X5XB 1CGSH 4UDTB 2AK4E 4IS6A 3V2AR 3QUMH 4N8VA 2AJVL 3K1DA 1LO0L 3IYLW 3C6SA 4RAHA 1SY6A 3SDXB 4U7MA 2IANA 4D3CL 5HGHB 1D5ZB 4I0PD 5IJVB 4YK4C 4OCSL 3IFPA 1KXVC 4LMQE 4CU8A 4YIQA 3G6JA 3OF6D 2N4IA 3IDYB 1TJHH 1S8DA 4JRXD 3KPMA 2FEDD 1R3LB 1RZJC 4HKXA 4PPTA 4WRLA 4LLWA 5I1JL 4NN5B 4H8WL 4HKJB 2CK2A 1MFBL 2DOCA 1K3IA 3PV7A 3QEUA 5LCVH 5LGJB 4K3JH 3VFVB 5CZVL 2H32A 1JWMA 3QQNA 1NCBL 4MA3B 5JOEA 1G7IA 3FFDA 2ZCHH 1R5WA 1B3JA 4F7MB 2DB8A 2X70B 1A1OB 2AXFB 4PJBB 2UYLB 4ZO8A 1ZLVH 5C6WH 1U58A 3IU4H 1UGNA 3CX5K 3OKMA 2XA3A 3MO1A 5KS9F 1MQKL 3QFDB 4F33A 5IHLB 1A5FL 5FV2A 3BW9A 3HTLX 3RNKB 1F58H 2WWKT 3QEGL 3BIAX 4AM0A 3WHXA 3NIGE 3TVMC 4CN6A 4NYLA 4WFFE 2ZKHH 5J3HD 3G5ZA 1AO7E 3CXHK 3BT2L 4MJ6A 1LO2L 1YEIH 1GZPA 3VFGL 1KN4L 3MLPA 2VZVA 4XPAH 4APQC 1Z9SA 5IMOA 5KVMC 2WWKO 3TV3H 4ZOBA 1HHIB 4OGAD 3V4UH 3K8LA 3HZMB 2HG5A 5D6DC 1KCVL 2PW1B 1BQUA 4HF5H 5E08H 1CDGA 3GMOB 1XR9B 5HPMA 4KHTH 1EMTL 1XIWB 3ARWA 3TP4A 1UWEH 4FQCH 4F7PB 3H3BC 2V7HB 3D0VB 3IXAB 4PJIF 1A8JH 3EO0A 3KYMA 4O2EB 3GHEH 2RAMA 5IESL 4FQLL 4EUPA 3P9MA 4HUXB 1MQ8A 5CINH 4JHBA 3LD8B 4WEBH 3REVA 4DCQA 1NGXB 3ETBF 3LKQA 1MCPH 2OX5A 3IS1X 2HFFA 4GG6B 1WQVT 3L3HB 4HWBA 5GJTH 5B3JE 1PYWB 4JVUA 3D5OF 5EFIA 4JO1L 4Y7MA 3PHOB 4OZHB 5HGGS 4YHIA 4XPTL 2F19H 1HN1A 4UI2A 4BKLB 1EZVY 1KELH 4NQCE 2FATH 4GKSB 5T1MA 3LRHA 1XF3A 1SEQL 4CVWA 4PRIA 3MUGA 4R4NC 2EDJA 3T0EB 3ZDZF 3CIQA 3MOBH 1X7QA 3MA9H 4NFCA 1GHFH 1X4ZA 2VITB 3X3GL 4OB5H 1NGWB 4ZPVA 2UZYB 1AXIB 1FG2B 2BFVH 2NY2B 3IJSA 4TUKH 3Q5TA 2R0KH 5ILTL 4EXKA 1JZ5A 4BH7B 1FAIL 1NMBH 2R2EB 3EUUA 4YHYC 2ERJC 1EO7A 3N85H 5JXEA 2EICA 4HDIB 1BBJB 5I2IA 5DUBB 1S7VB 1ZHKA 2GTWB 3SDXF 2PKDA 3ZSTA 3P9WB 5AZ2H 5ID1A 4MSWA 3TJEL 3KYKL 1HINH 5HXMA 1C8PA 2BZDA 1ZANL 5DD3H 4X4MA 3CLFL 3ARUA 4WDIB 1TZHA 4Z95H 4CMHB 3DGGB 2GT9A 5KW9H 4TSAL 2Z31D 1JPGB 1TCRB 1KB5B 4D9QE 4GAJH 4OJFL 4S2SA 2ZUTA 4JZJB 4WV1C 1OCWL 4LSQH 2IANE 4RFOH 3LVEA 1LEKB 3TIEB 3WN5B 5LKNA 2VN4A 3KYAA 2NY1B 1JNHA 1T0MB 2OL3L 4Y5VA 1EVTC 3WFDL 1BZ9B 5EU5B 2YUXA 1NAKL 1FHGA 3AS3A 3P0YH 4X98A 4X7SL 2G9HB 1KJ2A 1OAZH 3NFSL 2DYPD 5DFWH 1EFXD 1E4KA 4NFBA 5SWZD 4K7PY 3EDFA 3TH2T 4PRPB 1FBIL 1JYNA 1RZGA 2YC1B 4GRLB 1AO7B 2P48B 2GTZA 4YC2B 5BW7C 1I1AB 3B6SA 1IKFL 4YBQD 1JIBA 3M8OH 4GXUN 1AQKL 2NY6D 5EU3A 5DF0A 2QADD 3S8WA 5DGQA 3QUZA 1JF1A 5LBSL 5EA0H 5IB1B 1LEIB 1IILE 1FFOA 1PKQE 4WI9A 1S9WB 3BXNB 4IRSA 2B5IB 3L3OB 1PZ5B 3MV7D 2BP3A 3IFNH 1JNNL 1FZJB 2KPNA 4NC2B 3OQ3B 3DMMA 3ZT5A 2AEQL 2NZ9C 2QHLA 2YBRB 5C0BE 1T5WA 5I8EB 3TO4B 1LDSA 1GIGL 4OQ1A 5GSRA 5E6IC 1UG9A 4PRDB 5F8QC 4CUCA 2I60L 1YEFH 3HR5A 1PY9A 5AYUH 3IXTA 4OKVB 3E6FB 3O3DA 2ZG3A 1I4FA 1UXSA 3JWOC 1KIPB 4JY6A 5F1IB 4K8RL 1T6WA 3F12A 1HHKA 1R3JA 1ZMYA 5BV7C 4P57B 1J9CT 5DMKB 1V8HA 2H26B 1AXTL 3P2TA 5TDPB 15C8L 3ZKSD 2VE6B 1FNGA 1T20A 4ZFOL 1A6AB 2QQQA 4NQCB 5HI3D 1XF4A 1P7KB 2BDNL 4JM2F 4XP6H 6FABH 5LG1A 1MHCB 1P9MC 2X4PB 4GKNB 1E28A 3CK0H 3ZYOA 3SJVA 2WMPA 1QBAA 2C4XA 2YPLD 3O45A 2HT2D 5E8NB 2OCFD 4RMUA 1UA6L 4H0HB 3T4AA 1JZ2A 2CSPA 5JA8B 4HJJL 1UACH 5EIIA 3ARFA 2DJ4A 3SEPA 1AD9B 5I9QC 4XP9H 4KKNA 4U1JA 1P4LB 2FECL 5HGDB 1XEDA 1YY9C 2EDQA 4IOIA 3DUHA 1IC7H 3EO1B 3HZKB 4LQFL 4XNQA 5IMLB 1U8PA 2DM4A 4LAQH 4PRIE 4UIKL 4OZIE 4RIRA 3WLBB 2VKXA 4I18A 5E8OB 3QG7H 4LSSH 4QTIL 5DQ9A 1UH4A 2E9IA 3SGEH 1EEZA 3LN9A 4KJYA 3BKJL 2VZTA 1K85A 1SVZA 4K8RD 4R2GD 5GPRA 3VFWA 2IANB 3OXRB 3VGHA 4BFGA 1EGJH 3IFPB 1JNLH 4YIQB 3G6JB 1S8DB 1FAKT 3KPMB 3QZWG 4XCNA 2IAMA 4HKXB 2A6DA 4LK4A 4LLWB 3C08H 4L4JA 3QSKB 5EZJA 4Y16C 4OLUH 1FIGH 1ROWA 3QEUB 2DQTH 2QSTA 4FFZL 1IAKA 4Y19A 2PXYC 3E6HA 4P46A 5DDHA 4K3EL 2H32B 2DKSA 1JWMB 2A77L 4J4PC 2NY7H 3NIGF 5IW6A 4KVCH 3PG2A 1G7IB 3FFDB 4ZSOA 3V8OA 1R5WB 2BERA 2EE2A 4WI3A 3MOAH 2MKWA 2MCPL 1W0YT 3SPVA 4ERSH 4J8RA 4F58H 5D7JC 3MXWH 1E6JH 1AFVL 1U58B 2FCBA 3J7HA 3OKMB 3MO1B 4L3EA 2AGJL 4FA8A 3JVGC 4F33B 3QDGD 3BW9B 5F7YC 4UOW1 5ALBH 3JWDH 3ZDXF 3WHXB 4AM0B 3IDNA 1NMCC 3FRPG 3LRSA 1SYSA 5IFHH 2AJ3A 3I6LE 4NYLB 2X4SB 4U3CA 1YJDL 1XGQA 4KZDH 4X6CA 3WBDA 1FO0A 1GZPB 3O2WH 4KAQL 1BX2B 5GIRA 5JHLL 4M48L 3S3SA 5IMOB 2MQ3A 4BQCA 2ZPKH 1MF2H 4K23H 3LIZH 3O6FB 1YNLH 2HG5B 3BP4A 1MWAA 4EIGB 5CGMA 4ZD3H 5HPMB 2ORBL 1KCUL 1MI5D 1TJIL 3N1FC 1QVOA 3BRDA 5FA4A 2DI8A 3HMWL 2DAVA 5B3JF 3EO0B 1GGIH 3IDMA 3KYMB 5TGBB 4EUPB 2A9NL 3NACL 1NDGA 1VGEH 1MFEH 2F54A 3V52H 1DQTA 1F2XK 1TVHA 5DGRA 4OLWH 4XCYA 5FIEA 2V9QA 4PJ5E 4DCQB 2IJ0C 3P4OB 5CJXC 4KRPD 3S37H 3WHE0 2HFFB 1KACB 5EFIB 4FXKA 3X3FH 1FG9C 4HUWA 4HHAB 4YHIB 2J7LA 3RKPA 1X5XA 4OUOA 2GITA 1F3DH 5T1MB 3HNVH 1XF3B 3K3QA 5L6YL 3MUGB 1KBGL 3I3DA 2VLKA 1A6TA 1NFIA 4K7PL 5IR1A 4P5TB 4XBEL 3U1SH 5GS0H 4OD1L 4F9PC 2H3NB 3UPRA 2CLVB 5CZXD 4HWBH 1DLFL 3IJSB 4WFHD 4WEUD 5D6CB 5BS0D 4AZ8A 1MUJA 3VFOA 4XVTL 4DQOH 3CJJA 4KTEL 3H9ZA 2JJWA 1FNEA 1I9JL 1BVLA 2W0LA 4L29A 3BE1H 1ZOXA 5D4QA 2OLDA 1NCAH 3CC5A 2VLJA 4NCC1 4NT6A 4PGDA 5I2IB 4I4WA 1ZHKB 4S1RH 5A2LH 5FYKL 5ID1B 4MSWB 1QFPA 2P7TA 3NAAL 4OGYL 1FSKB 5ANMA 5FM5M 5T5FL 3UTSD 4DUWA 4YHPA 4KUCF 1UWXK 1KCSH 1TIUA 5CILL 2GT9B 5EUOA 3QNYB 1OAUL 4Z76A 1INQA 1NMAH 4N8CL 3U0TB 4LVHB 4S2SB 5EU6E 5JR1H 4LL9A 2BRRL 3O2DH 3VXUA 3HC3L 3DV6A 1JNHB 3HE6D 4MXVE 1J0IA 3EYFA 4PRNA 4Y5VB 5FB8A 2EZ0C 1IL1A 3L1OH 2ESVE 3QIWB 5D1ZD 3T65A 4X98B 4KGJA 5DUML 4OM0L 4NGHH 1RZ7H 1KJ2B 2P8PA 4DGYL 5IV2A 3RGVD 3SCMD 4Y19E 4PUBH 2XFXA 3KDMA 1CDBA 1RK1A 2GTZB 4HK3J 4JHAH 2X1PA 3LQMA 3B6SB 5JIHA 3OJVC 4KTYA 1YN7A 3QI9A 3RIAK 3QUZB 1JF1B 4H26A 4N90E 1FFOB 1KG0B 1WFUA 4ALAL 4IRSB 4JQIH 3LHPH 4M6MH 4F15B 1YDPB 4OBRA 5D2NC 2CRZA 4YHLL 3DMMB 3QDHA 5DR5L 2HH0H 3GSVA 1L0YA 3FTGB 3TH4T 2MHAA 4PFEA 1AR1D 1T5WB 4X6CE 5DMIH 3CH8A 5F89A 5GSRB 1IC4H 3HR5B 4HS8L 3IXTB 4BJLA 4GSDL 1I4FB 1UXSB 4HWEL 1CICA 4JY6B 3ZTJH 3TLRA 3ULUE 4N8VG 3ZTNL 2GK2A 1S7QA 3F12B 3MCG1 4XBPA 2R29H 1R3JB 8CGTA 4Q74A 5TJWK 5C2UB 3HUJB 2Q8AH 3DI2B 2BVOA 1WITA 5DA4A 4V1DA 1FNGB 3KYNB 4I2XA 1T20B 2VZOA 4KUZH 5GRVK 1LDPH 1T66D 5GGSB 4OI8A 1XF4B 5C0IA 4YHKH 4LIQE 4JFQA 1E28B 2J5LC 1S9XA 4XVUD 4JFFE 2B8OT 4QXUL 2RGSA 3SJVB 2F54E 4Q9QH 2CR6A 3O45B 4ODTH 1HHGA 2OTPA 4OZIF 4NKMA 1MFDH 2JELH 3ARFB 3EOAB 5KN5A 2AJUL 5KBNC 4S0TD 4K9EC 4B7LA 1S9YB 4U1JB 2YPKA 1CGSL 4IOIB 1G9NC 1MJUH 1KGCE 3QUML 1E4JA 3T3ME 2MJWA 2P24A 4XNQB 4KI1A 1U8PB 2MPAH 3BAEH 4G6KH 4R4FH 1X5YA 1H0DA 2VLKE 3A67H 4JHWH 4RIRB 4KKCD 4I8DA 4M93C 4KTDH 5J9PA 1MSPA 4YBLC 5DQ9B 3OB0K 3VJ6A 1I7TA 1TJHL 1EEZB 3RY6A 4FTVA 3QXVA 4KJYB 4L8DA 4YWGH 3C5ZA 4HGKC 2MQ0A 1JPTH 5FOBA 3VFWB 4E42A 5DYOA 5GGRY 2C7UA 1G1YA 4WI6A 4B5EA 2ED7A 2AJYH 5CCKH 5BO1H 5JW4Q 5LCVL 3WO4B 4K3JL 1A3RH 4CVZA 2VLJE 3GNMH 3FN0H 4XCNB 1F4AA 1Z9MA 2IAMB 3JUZA 4FHBD 2A6DB 4I0PC 4ZPTA 3WKMH 5EZJB 1NANH 2FBOJ 1SM3H 5ANME 1P2CA 2ICWA 3GMRB 4OFYD 5F7WC 1IAKB 4XXCA 4Y19B 4CRPA 4XXDA 1PZUB 3UTPE 3IU4L 3E6HB 1CE1H 4P46B 5DDHB 1P7HL 2D0GA 5HHOE 5I71B 2IFFH 4UDUA 5IW6B 1F58L 2JCCE 3GMPA 5EO9B 4BZ2H 4ZSOB 4MB4A 2MWCA 1QSED 3SGKA 3ZL4H 4J8RB 3VFUA 2ZKHL 5CWSB 5I1HH 1JNJA 1HKLH 3OPZH 5IBUB 4L3EB 3TN0D 1YEIL 4C57C 1YN6B 4X7DC 1CK0L 3LRSB 1SYSB 2AJ3B 1ZGLA 3TV3L 2QBWA 4X7TA 1DLHA 4OCRH 3V4UL 4GAFB 4HEME 3CD4A 4ETQA 4GLRH 1GGUA 4HF5L 1R5VA 4WI7A 4XCFH 5GIRB 3TPKA 1UWEL 4FQCL 5J3HC 5JQ6H 4XB8A 3BZEB 4PGBB 3GHEL 4PJGE 5DRNA 3BP4B 1MWAB 1CWVA 2DBLH 5CINL 1A7PH 4QLRA 4O00A 4WEBL 4OGAC 1R3HB 1FO0H 3WLWC 1QVOB 1MCPL 4B7IA 5FA4B 1CT8A 2EKJA 4PJ8D 3IDMB 3ULUH 5GJTL 4R97B 1NDGB 1RZFH 2F54B 4H8WC 5CD5D 1J8KA 4KGLA 3WIFA 1TVHB 1WCQA 1T4KA 4XCYB 3BDYH 5DC9B 2F19L 1KELL 2LTQC 1SBBA 2BX5A 2FATL 5CEYA 1X9QA 5JNYA 3C6LB 4M4RA 3MOBL 3MA9L 3W82A 1EIBA 4LIQH 4HUWB 4I2XE 1TVDA 5IWLC 2BFVL 4TUKL 4G42A 2GITB 2R0KL 1NCCH 5HI4D 1DDHA 1NMBL 5INCB 1FNLA 2EEBA 2BNRD 1HI6A 4P3DA 3N85L 1A6TB 2GHWB 3PHSA 1NFIB 4LVOB 1K9TA 4EI5D 5IEHA 5IR1B 4POUB 4U1KA 1C1EH 4P9MH 2DTMH 4HGMA 3UPRB 1JI1A 1NUDA 4KQ3H 2Q3AA 2UWEE 5AZ2L 1CBVH 4J3OC 3ET9F 1MUJB 4OZFA 4X5LA 3VFOB 3VFTA 5LXGH 4TNWK 1FNEB 1BVLB 5GZOD 2AS5M 3K81A 1HINL 5DD3L 5A1AA 4L29B 3EYSH 1ITBB 3LDBB 4E41D 1NDMB 3HPJB 5KW9L 3WIHA 4RX4A 3CC5B 2PO6A 4NT6B 4I4WB 1U41A 3O9WD 4GAJL 5FYJU 3ZTJG 3MUZ1 5HYFA 4PJHA 3K46A 4LSQL 4RFOL 1D5XB 3MRKA 4OFDA 3NFPA 2SEBA 4FN0A 4MLIA 5FGCE 4TUOA 4MXVF 5ANMB 3OGOE 4YHPB 1J8HD 1L7TH 4YDJA 1D5IH 5EUOB 3CU7A 4LNRA 4FZEH 4Z76B 3P0YL 1AKJA 3FO0H 3UEZA 1YPZB 3VRJB 1OAZL 2AQ2A 4GBXA 5F1SA 4YXHH 4AJ0A 3ROLA 3VXUB 1SEBA 2Z31C 3DV6B 4M9PA 3HHRB 4DKAA 5F9DC 5CKGA 3E3QC 4PRNB 5FB8B 1IL1B 2P45B 5KANG 4U1HA 2EEAA 2GFBA 4O2CA 4JM2D 1RJCA 4NUJA 5KOVC 3M8OL 2P8PB 1LE9B 5IV2B 4IMLA 2QSQA 4U6VH 5D7LE 5DJZB 1GGYA 5EA0L 4J7RA 4RAVB 4X8JB 2XFXB 3RHWK 3KDMB 4A2MA 1RK1B 4YE4H 3UJTL 2BVPA 2Q6WA 3LPWA 2CQVA 2HMID 2C3VA 3IFNL 3NA9H 1FNHA 1U6AH 1YN7B 3QI9B 5A16A 3B2VH 2AK4D 5I1GH 3D39E 4X6CF 1KXTB 4H26B 4N9OB 2MQCA 5FUOH 3BX7C 3RVWD 4FFVD 2FJFA 3UDWC 5I8OH 1I8LC 2EYTA 2NY6C 1YEFL 3V7AE 5AYUL 2QADC 4U6HA 1S7WA 1FL3A 3ULUF 4UTBH 2Q7NA 3VWKD 3GSVB 5KSAC 5CEXA 2HFEA 3X12A 5HHQA 1J0YA 5F6IC 5DJAA 4MAYD 1JRHH 4IHOA 5F89B 2Q8BH 3MBEA 5F7KC 4UBDD 1M6OA 3JWNC 2DQIH 5DA0B 1VHPA 4J1UA 3RDTD 3ZHLA 1TETH 3F7RA 4XI5D 1EBAA 2DIJA 4XP6L 6FABL 3CK0L 5JW4M 4V2CB 2BVOB 4UB0H 3QUYA 5T1LD 1QSFA 2WBJA 5MI0C 3TZVB 4V1DB 2FX7H 5I1KH 4RMSA 4RMVA 3V6OC 4OV5A 2V2WB 4HJ0D 2EDOA 4WFGE 2PNDA 3V4VL 3QUXD 4FQPA 5C0IB 4JY4B 5B4MD 1QFUH 4X6EA 4JFQB 1S9XB 3BJ91 3P0VH 4XP9L 3T0AA 2E9JA 3KXFA 4TVPE 3T3MF 3WUWG 2DMCA 5HI3C 1HHGB 2J8OA 1IC7L 4XWGH 5DJ0B 4NKMB 1F8TH 4QEGA 3DRTA 4R90H 3QXAA 3PQYE 4JG0H 5KN5B 5FHBH 3QG7L 4LSSL 2ZWLT 3DLQR 1IGJA 5D96B 1WIOA 3BP5A 2EDLA 3QDME 1G7JB 4XAWH 3RWIB 3QAZB 3D85D 1H15B 1H0DB 1OTUD 1EGJL 5J9PB 2X89D 1MY5A 1VFUA 3F6LA 5DVMA 1IAII 1JNLL 1I7TB 2P1YA 4FTVB 3C5ZB 4LGRB 2XZCH 3N0PB 3C08L 4JKMA 5FOBB 4OI9A 5DYOB 5I6XB 1VCAA 4OLUL 5TQ0H 4Z7NE 5A2IH 3L3IA 5ACZA 2F5AH 3BPOB 3RTQA 1FIGL 1N6QH 2DQTL 5DI8A 5GGVH 1SY6L 4U1SA 4O4YH 3H8NA 4K8RC 2FLRT 2JCCF 1J12A 1H5BC 4Y5XC 4ZPTB 4KVCL 1JGLH 3MOAL 1LGVA 1P2CB 1IZKA 5IFAH 2ICWB 4ERSL 4F58L 3MXWL 1P1ZA 2X9WA 2FJGA 3JV4A 4DN3H 3ALXA 3T8XA 1E4WH 4Y1AB 3VGAB 3GMPB 5ALBL 3BRGC 3JWDL 5FUCC 4W4NA 3U83A 2NR6D 3U6RA 5IFHL 4HAFA 1BPVA 1ZLWH 3MODH 4LARH 1TQBB 4KZDL 2KQMA 4TQEH 3CMOH 4JFDE 3KWWA 3N9GH 4RNRA 1PJ9A 4ZUVA 2CRYA 3GO1H 4LRIC 3O2WL 1R0AH 3WFCH 3L3JA 2EXYD 4Y4HA 2D9QB 1ZGLB 4BA8A 5KSVA 2ZPKL 1MF2L 2EDWA 4K23L 1DLHB 4X7TB 2OR8A 3LIZL 5L2KD 1YNLL 3ESUF 5I1LA 2W91A 4ETQB 2FX8H 3WUZA 3VD9A 1IGMH 1QRKA 4ZD3L 3VWJD 1R5VB 3WS6A 5ICYA 5E70A 1XCTA 1RV6X 1WBYA 2KDGA 5KAQF 1CGVA 1UJTA 1KPRA 3PWJA 5DD6A 5DWUH 1GGIL 3Q2CA 4HD9A 2Z8RA 4NZDA 2LU3A 3MRPA 5DRNB 4ODUA 5E8PA 1VGEL 3S34H 1EUUA 3V52L 3MRFA 4OLWL 2DQHL 5AG8A 1T1WA 1CT8B 1MIMH 4LCIH 2DQJH 4M4PA 1J10A 3S37L 2X9XA 1U8LA 4GMSH 4M7ZB 5CMAB 2BNRB 1XCQA 3X3FL 4GS7C 3WIFB 4EI5B 5K9JH 5E5UB 1T4KB 5D1XA 1CGUA 4KROB 5CEYB 3KJ4C 1ZV5A 2VMFA 1H3TA 3HNVL 4LPUA 5JNYB 1BECA 3P4MA 4JVWA 1QSFE 3O6MH 3U1SL 5GS0L 1CS6A 1BAFH 2VWEE 3RBSA 4HWBL 1FP5A 3BHBA 2D0HA 4KRPC 1N0LA 4G42B 4TVPH 4HV8B 1DDHB 3V5DA 4DQOL 2JTDA 5DZNA 3UPCA 3GHBH 4P3DB 5IEHB 3KXFE 4FQ2H 1ND0A 1N0XH 5CIPA 3BE1L 4U1KB 1NCAL 4Y2DA 4KU1A 5C0BD 4S1RL 4NC0B 1YJDC 5LVEA 4OZFB 3S96A 3VFTB 4JPWH 4O58H 5E9DD 1URLA 5L8KB 3SDCD 4RFEA 1KIRA 2OZ4A 1KCSL