4V1DB

Ternary complex among two human derived single chain antibody fragments and cn2 toxin from scorpion centruroides noxius.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
b'SEIVLTQSPATLSVSPGERATLSCRASQSVRSYLAWYQQKPGQAPRLLFSDASNRATGIPARFTGSGSGTDFTLTISSLEPEDFAIYYCQQYRYSPRTFGQGTKVEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINGLE CHAIN ANTIBODY FRAGMENT LR, HEAVY CHAIN
molecule tags Toxin/immune system
source organism Homo sapiens
publication title Optimal Neutralization of Centruroides Noxius Venom is Understood Through a Structural Complex between Two Antibody Fragments and the Cn2 Toxin.
pubmed doi rcsb
total genus 24
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4v1dB00
3BEWA 5DMGD 1BFOB 1VFAB 1F8TL 5D1ZC 4KJQD 2W0FB 4WI8A 4OZIB 1OGTB 3PDOB 4F33A 4XT1C 3BO8B 4JFFE 4U1GC 3BP7A 4GG8A 4ZTOL 4MD0A 2A73A 1AGCA 4R7NA 4DGYL 3VRIA 4EUPG 1INQB 4J3TA 1KELH 4JPWH 5FYKL 3FRPG 1QSFB 3BSZH 2IG2L 4ZPTA 1B6UA 3O0RL 4PJ9B 3HTLX 5IIEA 3B5TA 5ACZA 3QBTB 4YE4L 4M9PA 2BFVL 5J9PB 1GSMA 4FXLA 3UYRL 4OM1H 1XH3B 1CK0H 4JKPH 2R23A 4ALAH 3PIQB 4H1LB 4KTEL 3G5ZA 3FQWA 1ZS8B 4EKXA 3V7MA 4NQTA 1JV5B 3OTTA 3G5XA 1MRFL 3FTGB 4JFHD 4H25A 5KVMC 5FM8A 5LGJB 5EBWA 3O6KH 2P5EE 2HKHL 1QSEE 4DVRL 1Q9OA 2QADD 5DUBB 2ESVA 4HS6A 1WUNT 1CGSL 2CXGA 3QJHB 4HK0B 5ID1A 4RGNC 1AC0A 1WF5A 1A64A 5BOZG 4NRYB 3AXLB 1J05B 3C60A 4PJ7B 3V9FA 3WIHA 3ULUF 2R4RH 4ODUB 6FABL 4OZIA 4LBEB 5D2LB 2VC2H 1P9MC 5JW3L 3G5YA 5JNYB 4U3CA 1Q38A 4PLKD 2FO4A 2EDFA 2VJXA 3MV7E 1MHHB 1I7TB 2IH1B 2A77H 4OKVA 2BY1A 1HEZB 1A7RL 1KCRL 5LJYH 3N50A 1WCBB 3GSNA 4PJ9A 3V4VH 3VFMB 3WNLA 4WFFE 1T2QH 3IDMB 1N4XH 4LGRB 1D9KC 3NCBB 3S34L 1TTGA 2Q6WA 4LCWD 5TF1H 3VA2C 5ICZB 2WUCL 3B8YA 2CO6B 2DLTA 4LEOA 4NCC1 3KPMB 4EDWH 5EN2B 2ADGA 2ICEA 4F9PC 3RZCB 2IPTH 2VDPH 1ZA6B 2UVEA 4RQQB 1ZLUK 5JLZB 3KGRA 4XWGL 3U0TA 4DKEH 4OCWH 4F8QA 4QRRE 1NLBH 4FMKA 3MCLH 3DIFB 3T77B 3TYGL 1CLOL 3TT1L 2J6EH 2X70A 2SEBA 4RA0C 3G5XB 5FCUH 4HDIB 1JI1A 2XZAH 3HR6A 5C9JB 4TTDD 4J3SA 1FL6A 1DCLA 3R06A 3WFZA 2D9CA 5FYLE 3QO0A 3GKWL 4R4FL 5LCVH 3BYYA 4I2XE 5C0FB 3UCRA 5DT1H 1X4XA 3C2AL 1JBJA 2OCFD 3MRPB 4GO6B 2BCKB 4HS8H 1P4IL 1Z0NA 5CKAA 1NCAH 2ADFH 3WNMA 4DEPB 1CBVL 1DDHA 3UJJL 4WEUD 4XNZC 1FBIH 1A4JB 4PJFA 1LP9F 3Q2CA 3LY6A 3FB5A 3OWEA 2W65B 1FSKB 1XR9A 3IS0X 1XMWA 5C09E 2G9HA 3PDOA 4P46D 3MRDA 3W11C 1QLRA 1S3KL 1X6LA 3ILQD 3W5MA 1KPRB 2QSVA 1A6AB 1Q9LB 4F15B 4CVXA 2NY7H 2Y4SA 2R69H 4RMUA 5CP7B 4OV5A 1P1ZB 3V95A 1EAJA 1RUQH 1ZA6A 4GQ9L 3LH2L 7CGTA 5D7LA 4LKCA 3GMMB 4JKKA 3F6LA 3MOAH 1B2WH 5J11B 2FR4A 4UIKL 1OP3H 3WFCL 1PGRB 1S9WB 1INEH 2A1WL 1JYVA 5FM5M 3LDBC 1YN6A 1UWGH 2YHGA 5DRZB 3EO9L 1BZ7B 4OGZA 2F19H 5E2TL 1T7WA 4MHHI 2DWEB 2XZQH 4YXHL 4M1DL 5L0QC 1CICC 1E4XH 1PY4A 3MRLB 1U0QA 2BCKA 1CZ8L 4WFGD 5ACMA 3DVNA 4BFGA 4BKLA 4ZUTB 5GJTH 1CFVH 5JZ7C 4Z7WA 1A9EA 5I1LB 4UILL 3WXWH 1CDJA 5ID1B 4J4PD 5FYKH 5C6PB 1WZLA 4GRWE 1IAMA 3ZE1E 5IB2A 4LP4A 1N64L 5KSUB 4ZSOE 5D2NB 1Y6MR 4HWZB 1KNOB 4OCXH 4QRTA 5T1MA 3EYSL 2NXZB 3TN0B 4OCRL 5SWQA 2RB8A 1NMBH 4WWKD 5DQDH 3GM0A 5E8EB 2YMXH 5FOBA 3U2SA 3DRTB 5FGBC 3U4EA 1LO0H 3RVWD 4M6MH 2FB4L 1LEIB 2YKLH 3O8XB 2VXVL 1NCWL 4HK3J 4UDTA 4AH2A 4DKAA 2P7TA 3WS3B 4P2OD 1X7QB 2RQ8A 3IFPB 3L3DB 4P5TA 5F89B 2H9GB 5I1IH 1J18A 2VERN 1A3RH 5I1KL 2P5EB 4I48A 1GZPA 2OZ4H 4JN2A 1XIWC 4U1JB 4DVBB 5C7XH 5FYKE 4WO4D 3RGVA 2BJML 2I9LB 5B4MC 3Q6GL 4KJPD 1TVHB 2JB5L 5BMFL 4F58L 4X4XA 2E27H 2GTWA 5ICXB 4BKLB 1MFDH 4PJ8C 4ELKA 1H15A 3ISWA 1CD9B 3P4NA 4WFFD 1N2RA 3KYMB 1NSNH 2Q8AH 2F74B 4O9HL 4DN3L 5CSZB 4FP8L 5DEGB 3LPWA 2ADJB 4P49A 2XY2A 5BXFB 4FQ1L 3RGVD 4PGEA 2B4CC 3IF1A 2C4FU 3RY5A 2GT9A 4ZUSB 4NDMA 3RU8H 1HXMB 4CW1A 1PX4A 3A67H 1LGVA 1BFVH 4DZ8B 5KBNC 4ZFGH 2A9ML 3DBXA 4JQIH 5AZEL 3TH3T 3C5ZD 4HXAH 1R3IH 1RK1B 3LQAH 3WHE1 2D0FA 3UTSE 4PV9B 4X9FA 1Z9MA 2J8HA 1I9RL 3IDGB 3NAAL 3HB3C 4WU5A 3KYOB 1KENH 4PJIB 2EXWC 2OJZH 4KTDL 1J87A 4N0FA 4JFDE 4IDJL 4L8DA 4HIHA 4WIQA 4HJGA 2R1YB 4TRPL 4AJ0A 1A6AA 2MPAH 4NO5A 5TDOA 3GSXB 5CEZH 4QWWD 3IFPA 4PJIF 1IKNA 2C1OB 3LEXA 2YWYA 3VWJC 1S9VA 3WNKA 3C2AH 4OF0A 4N8VB 2VR9A 4I2XA 4EI5D 3MNVB 2P44B 1DVFC 2OL3B 4JO4H 3BQUB 4GUPA 3IFNL 3EOBB 4NP4H 4WI5A 4ZPVB 2HJFB 1TIUA 4K9EL 1JYWA 1H15B 4NJ9L 4P46C 4ZG1A 2A6DA 4LCWA 2DWEA 1EFXA 2CGRL 4YUEH 1S7TB 2F74A 4M5ZH 1RHHA 5EZIL 2HLAB 4MA1B 2F8XC 4G7YL 4M1GL 3WN5B 1DL7L 1SM3L 1ZHNB 3HKFA 4G5ZH 4RX4A 3MV9E 3ZDZF 4Q9BA 4UQ3B 1GXEA 4F9LC 3MOQA 2HTLC 4ZXBA 4M61A 4ZYKB 2ZNXA 2JTDA 3ALXA 3T0BA 2BNQB 2IFGA 2DQIL 4Z7UA 1FFPA 5FGCB 4I13B 4ZTOH 2P8MA 1M7DB 4U1SB 1F6FB 4TPRL 4DN4L 3QIWC 4OGXH 5I30H 4KV5E 2HT4C 4L3EA 3MLUH 4R4BB 2XXCB 4GKSB 3QEQE 1FO0A 1RU9L 5AG8A 1HINH 3JWOC 5L2KD 2NY4D 1ZHBB 4O4YL 4MQXD 5IKCA 3SDYL 1MY5A 3BT2H 2XRAL 3BPOC 1DQLH 4WV1B 1H3PH 2P7TB 3TBYB 1FVEA 2OBGA 4UDUB 3WUWG 3WS3A 5J89A 5GRJH 3ARPA 1IZKA 3ZDXE 1UZ8B 3O3DB 5D6CB 4PG9B 3QPQC 1DLFH 3W81A 3MXWH 1JF1B 5IP4A 1FYTA 1HILA 5GGVH 4HUXA 1CICD 2Y06L 2PYEE 3VGAC 3PGFH 3QIBA 2NPLX 3JSSA 2W92A 4JFHE 4M1CC 2VWEC 2MCPL 2QL1A 1TNMA 3VDAA 3KS0H 4XMLL 5HGAB 3VXSA 3DX7B 3FT4A 4AK1A 3MYJA 4ZPTB 3V5DA 3X3FL 1QO3B 5JHDD 1CQYA 2R39A 4OFVA 5K9OA 4FFVD 1FNAA 1DQTA 3L5JA 3OSKA 3DURB 4ZXBB 2JJSA 2P47B 4K3EH 4YWGL 2DM2A 4NRZA 3D25A 4KHXH 1GCFA 4TUJA 1U3JA 1A7QH 3VXSE 1H8OA 5J06A 4HJ0C 3HPJB 1HSAB 4K23L 3MRHA 3CSYB 1AY1H 1FH5H 1HXYA 1D3CA 5L7XH 2YRPA 4WU5B 5B8CB 4U1LB 3OKNA 5E6IC 2R2EA 4QHNA 2H3NB 3REVA 4ENED 4D9LH 4OZGE 2RCSL 2YRLA 5EUKA 3SE3C 3AS0A 3QUZC 4AMKL 3NPSB 4XAKD 5JHDE 4JRYA 4F9PA 3QJHA 1T5WB 5FV1L 2Y07L 5DJ6A 1H8NA 1DUYB 4K07A 5DS8B 1F11B 1WIPA 1FIGH 3ZZ1A 5EIVA 1MCCA 1UADC 3E3QC 2FL5B 3FQNB 2Z31A 1WAAE 1QYGL 1F6LL 1IC5H 5F7EL 3WUWA 5IMKA 3MNVA 3IXAB 4F3FB 5KVGL 1IAOB 4X8JA 2UZIH 5IB1B 5B21A 4HK3N 3UC0L 2PXYD 1S7WB 4OF3A 1I7TA 2IH1A 4HUMB 1JI2A 3JWOH 1P4IH 1LP9A 2P42B 3QEGH 4ZFOB 3BQUD 2LU4A 2ADFL 1T1WB 3MLWL 3QAZB 4LOUC 2DQEH 5FYJE 2AK1L 4HD9A 1YMMB 4L9LA 3ZKMD 4NNYB 2I60H 4N8VG 5A2IH 1YEGL 1M71A 1BQHA 4KHTH 4XPAH 3QIUD 4LQ1A 43CAA 1H5BB 1B0GA 4QXUH 4XZUB 1PQZB 3TF7C 5L8JB 3DTXB 3HE7B 3QQ9D 4JJ5B 1GRWA 1I1FA 2RFXB 4KDWA 5IB4A 4D3CH 3MR9B 1EO5A 1T6WA 5HHMD 4QXGH 2E8YA 4K7PL 5FUOH 1X5YA 4QHNB 4HSQA 2R69L 1T0PB 2GAZB 1P4LB 5MP6H 4HV8B 5JA8B 5DK3A 5FKPA 3RWDB 4JAMB 4TUKL 4OLEA 1BD2B 4X99A 4NNPH 3B2UC 3INUH 1ZHBA 3MGOA 1GGCH 1JN6A 4NZTL 5FGBA 1F11A 3VGAB 1M4KA 5MENE 1PSKL 2W60B 3UTTB 3MRCB 1PY9A 3CPLB 4NZRL 4F33B 1IGJB 1ZTXH 3DV4A 1T5XA 1QSFE 3BKJH 1A9BA 4G8GE 5KW9H 1W0YT 1MI5A 3V6OC 4GW4A 5AWNH 1H0DB 1IGCH 2ZSWB 2BNQE 4HBQA 4FNLH 3K8MA 1CLZH 4I0PA 3MBEA 4NKDA 4XNYH 3ZHKA 3V5HA 4NNYA 3DLQR 3NA4A 2A2QT 1IQWH 2ATKA 2BOCA 2YZ1A 5KAQG 4DW2H 4FFYL 4OCNC 2BVYA 3FFCD 2A77L 5ESVB 3MRMB 2H2PC 3LZFL 2YUVA 5FB8A 2OP4H 2BNRA 1NCCL 3S37H 3WL9A 4MJIE 4ELME 4R4NC 3R1GL 2H45A 2P8LA 4MAUH 2X7LB 3TH2T 5HGGS 1E4KC 4EDWL 1L6ZA 3UO1H 1LO0L 4LU5H 1SJXA 3GHEH 3SDCB 1BD2E 1EHLL 5FKPB 4Y4KA 4PYHA 4FS0A 2YKLL 3BAEL 3WDJA 1QRND 2W0KA 3V52L 3LKNA 3WN5C 4DQOH 3IDYB 2X6MA 5EA0H 5F44A 1JPFB 3P11H 4XX1G 2XPGB 3D87B 3GSQA 5FGRA 1NFIA 4A6YB 5HGHA 1ZGLA 5MEQA 5HYFA 1UCTA 3TCXA 3QUML 5DJZB 5C0BA 4AL8L 2D03H 4IBLT 3WO4B 3D69A 2YPLB 3KPOA 5CZXD 4D9QE 3BEWB 4HT1H 3MTRA 5J13B 1I9EA 3HRPA 3ULVL 1HHGA 2WINA 1AGDA 5I1EH 1YEDB 4Z0BL 4K3EL 4LLAA 1ETZB 5F9OH 4GOSA 3BP7B 5FYKD 1XF4B 4X9HA 1MH5A 4QHLB 3B5GA 5C0AE 3CU1A 3GM8A 4OLVH 1R5WA 3MJGX 2ATKB 5D7IE 5AYQA 2QV2A 2AXGB 5DA4A 3PV6B 4HLZH 2NNAA 1A4KA 5EOCJ 4M7LL 4Q0XH 1T0MA 5EU6A 2FWOA 2Q3ZA 2VL5A 1MLCB 3DV6A 4PRIA 5D1XD 3K2UH 3HI6H 1C8PA 3MV7B 3PHQA 1UQSA 2XTJD 3NIDF 3K8LA 1RJZA 1EFXD 1UB5A 3EYVA 1U8OB 3VDCA 3QG7H 2ILLA 2ZCLH 2XOTA 3MR9A 4NWTH 3MO1B 4KTDH 4DFHA 3MRGB 2VAAA 3VI3E 1XFPA 4DKDC 2MOVA 1MCSA 4OF8A 1QACA 4JFYB 5F3HB 4F37K 2I07A 2Y6SC 4PGBB 3U4AA 1D6VL 1PEZA 1UJ3B 4X5WB 3TM6A 1CS6A 2D9QB 4G80B 3KR3H 3TIEB 3ZKNC 1J05A 2AEIT 3U6RA 4N1EA 4M1DH 2EH7L 2CIKB 2HVKB 3DWTA 2G9HB 5D93C 1I1CA 3L5XH 2A6KB 1XF4A 4P23D 2Y7QA 3O6LL 1UB6B 1ZWIA 3CD4A 3QUMA 4Y0GA 4R9HA 5T5NG 2X10A 3CLEL 4M7ZC 2R2BA 1JMZA 5L8KB 3U9PL 4DAGL 4PYGA 4UUJA 1QZ1A 1VKXB 1U95A 3HI5L 2EKSA 2GI7A 2ZUSA 3MJ8B 4HXBH 2CIIB 3N85H 3TVMC 2OK0H 4PJEB 1FAIL 1NMBL 1N26A 2BOCB 3P0VL 3ZYIA 3GMMA 4WUUE 4NFBA 4K8RL 3CFEB 3FRUB 3MV7A 3VFRA 3GSWB 1S9VB 3W9EB 2F54A 4NQCA 2UY6A 2K7QA 5JHDB 4YDVB 1BZ7A 4LPVA 3ZSTA 4N9GA 2V5SA 3QDGA 3EUUA 3HFMH 2LAAA 4PJDF 1IT9H 2YUZA 2N7BA 4IIQC 3SOBH 5TQ2L 5DJ2A 4K3DL 2AERT 1SBSH 4W70A 2HKFH 4UV4H 3FT2B 4O4YH 1A9EB 1CXLA 2D7OA 3VXNA 5IK3B 2HLAA 2E5EA 4YHIB 3UAJD 4A6YA 1T22A 4K8RD 3O4LD 5IVXF 5SX4I 3C08H 1IL1B 1F58L 5BMFH 1OSPL 3W0WE 1NAKL 1MFCL 4WI6A 5C0BB 1ZHLB 4KQ4L 2IGFH 1E4XI 1XF1A 3ARDD 5T3XL 5KZCB 1ZT4B 3N06B 4PUBH 1H9VA 1UWEL 3QUZA 1P2CB 1HH9A 2VZOA 2OM5A 3EO0B 5JOFB 5H94B 1QFWI 1CDCA 4U1GB 1LEIA 5IBTL 1U95B 2QQKH 3ALPA 2B1HL 3TWCL 4E5XA 4UAOB 3TZVA 1J0HA 1EO7A 2NY3C 3HR5A 3LMJL 4PJFE 4QY8A 3Q3GA 1A4KB 3VI4F 4I48B 5KN5B 3UYRH 4HS3B 4YDVA 5FO9A 2FD6H 4G6AC 3NIDE 5E8PB 1EZVY 3MLYH 5HY9A 1TVHA 4ZAKD 3CXHK 1DQML 3GNMH 5KVFL 2AVGA 4WFHE 3EYVB 5KAQF 4Y4FD 1ZVSB 3KWWB 4OZFG 3MV7D 3HMXH 2OL3H 4PJBB 2ZCHH 4F7MA 3LCYA 1QSFD 5I1CH 1MFBL 4PGBA 2V2WA 5ABDE 3KPRB 4J8RB 4RAUA 2FIKA 4YHOL 5IG7A 3I50L 4PJBF 2DQGL 3CVIH 4WW1A 3BKMH 1A14H 3FB8A 4LDOB 1QQDB 2VQTA 3JV0A 4ETQA 3VXRB 1MCWW 2DI8A 4OBRA 5DJXB 4WJ5A 5SWSE 1U2CA 3NFSH 4LMQI 4GS7B 5J4MA 5ANME 4G7YH 1RFDL 4MAYA 1AD9A 2A0LD 2H1PH 5DJ8A 5T1MB 4AQ1B 5I74C 4HC1H 3G6JA 4JN1L 4R3SA 4KU1A 1EO8H 5BO1H 3KPRE 5EO1B 4L8DB 3TJEH 1W8OA 4NKMB 1AC6A 1HXYB 4LVNC 3ROOB 2JJTC 5H8DA 4PRHB 2VABB 4XNXH 4BQBA 5DJDB 4XPAL 2ICWI 4L3AA 1MVUB 2Q3AA 4CMMA 4LEXL 4KH2A 4HUKB 3SCMA 5I2IB 3V0WH 4JLRA 4WO4C 3H7BA 3QNYA 4MX7A 4LPCA 1GZPB 2DLGA 2VZTA 4ZO7A 5CJOL 5ICYA 3LQZA 3QXWA 4X7TB 1T0NB 2H32A 3PG2A 1CE6A 5GZNC 3U36B 5FHAL 1X6NA 2OXGA 3IAGC 5CJXC 5EUOA 5HHOA 3QHFH 1C5CH 4MDJA 1KV3A 4QRQB 4XRCA 5CGYD 3SDDB 3TJHC 1MJJA 15C8H 3BI9X 4IRZH 2BRQA 1LNUB 4Q6YA 5ISZA 2F53D 5C1MB 3NCJH 4K7FB 4MB5A 1ACYL 3BIBX 4JKLA 5CSZA 4EI6A 2F53E 2LABA 2X4SA 4LSPH 3QFDA 2EYRA 2VLJB 1G9MC 4ZSOB 3PP3K 1W0VB 2ICWJ 2QQNL 4C54A 5H37G 4Z76B 3QUXA 5TFSL 1BBDL 1H5BA 3HS0A 5KG9A 4XVTH 4XGZA 1NCBH 1UEYA 3TIDA 3H7LA 4XB7A 3NIGE 3DVIA 3NH7L 5D96C 1LK3L 4KUCD 4QHUA 3ZTNH 2J2ZA 4DOHB 3EZJB 4Y16B 4GXVH 4WUUA 3RIAK 1U8PB 1MWAH 2LFGA 1PG7H 1GGIL 5HDOA 4N0FB 4I3RH 5DJ0A 5L2KE 5A2FA 1FVEB 2EYTB 8FABB 3C60D 1F3DH 2ICCA 4NN6B 4X99B 3GGWA 3H7BB 5DUMH 2B0SH 1T89A 5E8NB 2X42A 1RUKL 2Z8RA 3BP6B 3HLAA 1UCBL 3U4BH 4LQFL 4NM4L 3VWKD 2FX8L 1MCFA 3VXMA 1E4KA 2UYLA 3QWOB 5EUOB 1S5HA 2DI9A 5JHLH 4FXGB 3B9AA 1KJ3L 1TJHH 2BY0A 3IJSB 1J86A 5IVZB 5JXEA 1I9JH 3VXQB 3G08A 4EXKA 3KLAB 2KQNA 1OW0A 1LDPH 3BN9C 5A2JH 1CDIA 1A6ZB 3O11B 4GBXD 3DYPA 4Q6IA 1L7IL 5DTFB 3V7AG 4KI5E 2AV7A 3UTZA 4C83B 2HN7A 43C9B 1MFEH 4QRSA 5EO9A 2ED7A 4K3JH 4P0DA 3U0PA 1UKQA 5TF0A 5JIKA 2HFEB 4MJ2A 3O4LE 4OZFB 1ZHKB 1INDL 3CSYA 3QWRA 4NQUA 4ZS6C 2VDRH 3VXRD 1JZ7A 4YQXH 4WUUB 5BCAA 4A6YH 1N8ZB 5SWZB 4J2XA 1QFWL 5LWYH 4PRDB 3WBDA 4L3EB 5I1AB 5F8RC 3QPQD 4R4BA 1XIWA 4YNYB 4MNGE 3U30B 3B43A 4Q0XL 2NR6D 1EERB 3O4LA 4GAYB 3OAZH 4U1IA 3HMXL 1KULA 5C07B 1H3VA 1CU4L 2AP2A 5IJKC 3ARED 3MCG1 3HE6A 2HWZL 1YNTA 1YNLL 4PRHE 5I8KL 1XEDA 1NUGA 4FZEL 2PW2B 4I18B 2YRZA 2E7MA 4FQ2H 4EUPA 3MLTA 4OGAD 1ONQB 1MJ7L 3QEQA 2WBJD 2P5WD 1VPOL 3HC0B 1OSZA 2PXYB 4PJ5B 4RRPA 4CRPA 3U36A 1WFTA 4U3HA 1YQ2A 4H88L 4Z7WE 4FQCH 3PV7A 5EBMB 2BSRA 5DK0B 1SY6A 4XPGH 3EO1A 3KPSB 1D9KD 1RFDH 3MRFA 4Q6IC 5HPMA 3FFDB 3BN3B 4PBWD 3BPCA 3S35X 1BQHB 3V6FA 1DEEB 2VE6B 5EOQH 2NY6D 2XZCH 3QDMD 4LSUL 4P5MA 1KIQA 1IKNC 3RL2A 1TVBB 3MGTB 4P2OB 2RJMA 3OXRB 5MEPB 2VDQH 4YPGB 1T20B 3QA3B 3HAEG 5FYLL 4NRZB 4D9RE 3GI8H 2EZ0C 3TFKC 1QVOA 3O3AA 2OI9B 3FB6A 1NC2D 5BV7B 3GIVA 2VLJD 2LU7A 1I7ZB 1DE4A 3F58L 4RMVA 1AR1C 2IG2H 3VXPB 3OZ9L 4C4KT 4P2RE 1P84J 3FT3A 4EI5C 4NKIL 1FZMA 4MJ6B 3TT3L 3T0WA 2JELH 4Y5YC 1FRGH 5TH2B 4WTWA 4U1LA 1Z0MA 4GAGH 2OK0L 3AS3A 4Y5VA 4OD3L 2CLRB 3HI1A 2E7CA 4TVSa 1T7XA 5DJ0B 2BVQB 1RVFL 3KXFB 5F7WC 5C0NC 3ULVD 1MF2H 5GHWL 4PJGE 3CH1B 4PRPD 3RIFK 4JY4B 2DM4A 4MA8H 2UY7A 4XMPL 3HE6D 1A9BB 4EUPB 5DD1H 2G75B 3A6CL 2NY2C 2YK1H 4U2ZA 2ERJC 3RHWK 5TE4L 3BWAB 4GAJH 2EH8H 3RWEB 2E3VA 3LKQB 4BYHA 3KPSE 4GRMB 1T1XA 1X5ZA 5K9JL 3BPNC 4UV4L 5CUSH 3SKMA 4PLJD 3CX2A 3EO1B 4L8CA 1ZWIB 3MRKB 3PWPB 4PJGA 4NUJB 2MMXA 1I1AC 2O26U 2ARJB 3IXTA 3T0EB 5ID0B 5HI5D 4L4TA 3G5VA 3MRMA 4YHLL 1BF8A 3HPLB 5DSCB 1EA9C 2VC2L 4NGHH 4X7DC 5MEPA 3MFFB 5D2LE 2AEPL 2C3GA 2NX5A 3ARGC 4LLUB 5FAAA 3KVQA 5EO0A 1CFSB 2CRMA 3ARFA 3SE9L 1ZVYA 4KDVA 4TNWK 5SV4A 4Z5RB 4G9DA 5HDBE 2H2SD 5DUML 5KSAD 1FZMB 4Z7UF 5B4MD 4P9ML 2C5DC 4M7LH 5I30L 4JM2A 3O6FB 2BXZA 4QYOA 3ZT6A 2XPGA 3GSQB 4Z7VB 1U8IB 1WWWX 1P4LA 9CGTA 5JDJA 2M2DA 4Y4HB 3RNQA 3F12A 3KXFA 4WGVB 1RIVL 5EZOL 3D2UD 1Q9OB 1VGKA 3SGKA 1T4KA 1X4YA 4HWBA 1C16B 2M26A 3ZKXB 1JN6B 2VIRA 1NCTA 2C3XA 2AABL 5FCUL 3RUGA 4KROD 3WHE0 1GGBL 3T2PA 2YPKA 3QZWA 4G6KL 4IRSC 4MGXA 4P9HH 3T4AA 5C0CE 5GGVL 5DR5L 1NKOA 1XGYL 2H2SC 1L9MA 1MH5B 3D3VA 4QHLA 4KGLA 4UI2A 5AUMB 1DBBL 1RIUL 4WWKC 2AJUL 5CILL 1AO7D 4HKXA 1JZ4A 3B9VA 3PL6D 1MNUH 2R0ZH 5EPMA 4O2EA 4WW2C 2EH7H 2CQVA 5E1AB 4MHHG 4X83A 5FK9A 4NC0B 4Z7OE 3D0LB 1H3UA 2ZUTA 3TZVB 2VL5B 5KS9F 1CFSA 3STZB 5LGHH 1EJOL 3MJ9A 4MA3B 3UYPA 4XCNA 5GGRB 4JPVL 2JB6A 4XXDB 1Q1JH 3Q1SL 5F9JA 4XPBH 4JRXB 5JIHA 2WW8A 1B3JA 1MEXL 1OPGH 3HB3D 5IGXL 4XMKL 1CU4H 5GRUH 4IOIB 1S9XA 5DFWH 2NX5D 4KUCF 5GGSB 1BVKB 3P73B 2HRPL 3IAQA 4H0HB 3QH3A 5CINL 2G2RA 2PO6C 3CLFL 4X80L 1U8MA 4ZFZA 4BUHA 5EU5A 2V2XB 3FOLA 4HUWA 1C16A 1VPOH 1LO2L 4MCYB 1GGTA 4HHAA 3KDMA 4TOYL 3LKRB 1F5WA 3IU3B 4PJHA 1X9QA 1IGFH 1WITA 5HDBF 1INEL 2A1WH 1KB9J 5KANI 1KACB 1UYWH 3EO9H 5E2TH 1GL4B 2VDMH 1S9YA 3IYLW 3ZHLA 1AR1D 1LHZA 3EW3B 5KSBB 4BZ1L 5E4EB 1WT5C 4X4ME 3W39A 2GY5A 3JWOL 2WANA 1A1MB 3GI8L 5BS0A 4G6MH 2NZ9D 2AV1A 3EGSA 3T4YB 3AM8A 4CU6A 3QB7C 4ODUA 2OZ4A 1A21A 1SY6L 1V3JA 2P5ED 4QHMA 3I6LD 1MRCL 4P2OC 2VABA 1RZ7H 1N64H 1WBZA 5EWIH 1P1ZA 1UKSA 3CSBA 3T0DA 4WNQA 2WLYA 3L1OH 1DQJB 5KANG 3F7YA 1I9IH 5F7KC 4B7IA 5DVLA 1QKZH 3S98A 4PJAA 3QDGB 1VEPA 1MLBA 5IHZB 1JZ8A 2A83A 2PW1B 4U6XA 1J12A 3SKJL 4YX2H 3ARXA 2DM3A 4JGJA 3KPMA 1QBAA 1FCGA 1PLGL 1Q9KA 3NZ8A 3Q48A 3HMXA 2VAAB 2BVOA 3S96B 4XI5D 3CGTA 1GIGL 1EUUA 2XFXB 4GAJL 5KSAB 2H41A 2BSTB 3BKCH 5EU6E 4HIJA 1G7HB 3PHOB 3MSPA 5I18H 2X89A 1TLKA 4NN7B 5HI5C 4G43B 4XCYB 3S6CA 2HP4A 2X70B 3MYZA 1ZHLA 4L3ED 1OCWL 5D8JL 3HNTL 3K1KC 1FZKB 1RJYB 4HEME 5EU4B 1LE5B 3BIAX 5DI8B 2UZXB 5AEAA 5KZCD 1FIEA 3UZEA 3WO3B 2VLMD 3MLVH 1F3JB 4X5LA 4P4KA 1KCVL 3AS1A 4NWUL 3P4OB 4OLWL 5A43C 4KI5C 4LLWB 4M43L 1KJMA 4MJ5B 1JIBA 5EC1B 2DKUA 3JTSB 1FC1A 3LN4B 3IS1X 2FRGP 4MXWH 3UPRA 1MELA 2PYED 3U79A 2WNGA 3RKDD 1A6WL 3VGEA 2CKBL 4EBQH 3BXNA 4U05A 4IRSD 1PVHA 1JZ2A 4IRJA 5GGRA 1CGTA 2WUBL 2R8SH 1INDH 3FCTB 3PDGA 5ETUA 2IPKA 3MJ7A 1YJDL 4HAGA 4JN2B 5F7DB 2X05A 5TGBA 1UEMA 4R6UA 1G7PB 3OR7B 3QUYB 1JNLH 2IJ0C 1NAMH 4F7MB 2DN7A 1Q72H 5CIPH 3CH8A 5D7LD 5SV3A 3DETD 5C09B 3V52H 1IGIL 3P73A 3KLDA 4L4TD 1WV7T 3GO1L 4Y89A 5D1QC 4ELKB 5B39A 5HHOD 3BMVA 2NY6C 4LKCB 1VA9A 4OTXH 2HJLA 4JHAL 3CCHA 4AIZA 5CEZD 5HVWA 5JXED 5MERB 4OF5A 3CDYA 5DJXA 5E95B 4JQVC 5JO5A 3LRSA 1LE5A 2GT9B 6CGTA 4NYLA 4EOWH 1UXSA 1NDMA 4PP1C 4QRRA 5EBGA 4ZS7L 5DJ8B 3DX6B 4LIQE 2EDDA 4NNXA 4MLSA 3UBXG 1ZT4A 3WLWD 1KFAH 2W07A 3N9GL 1KJMB 1NGQH 2HFEA 4L29B 4Z18A 4OUOA 4LVOC 3NTCL 4MYWB 2VQUA 3IDGA 4HX1B 5JPMB 3L3HB 3RNKA 4OZIF 5IVOA 2X4TB 1FNEB 4L4VB 5EH1A 1EZVX 5C8JA 4HJGB 3TCLA 4U1KA 3EHBD 3OKMB 4OAWA 1LK3H 3WHXA 1F4WH 1J5OL 1G7MA 5FO8A 4MX7B 4HWEL 1NGYB 1MCOH 4JHZA 3C6SA 1CIUA 2X4NB 1U8LA 3VDBA 1OL0A 2PCPA 1YDPB 4F7EB 5IQ7L 1INQA 4PBXA 3VFVA 5ITBH 1A7PH 3I02A 2XWBB 3U48A 4DJMA 1QSFA 1JZ6A 1V8HA 1M05A 3BIKA 4QNPE 5HD8C 2F19L 3JV6A 3T0EC 5DK2A 2IAND 1OB1B 1ONQA 1MJJB 4UTBL 2APFA 4EI5A 1YY8A 3TA3C 1MJUL 3O3EB 4H8WH 4POZD 4PJ5A 4JFOA 2IAMA 2M8XA 4LSSH 4HKZB 4UINH 4NT6A 5GRVL 4R4FH 2X4SB 4QTIH 3O3UN 2GTZA 2VSCA 4XNQA 4MA8L 2R0WL 1CGWA 4L1DA 3ZYJA 1EXUA 4ODSH 5AAWA 3IU4H 1ZXQA 3K4AA 2GSIB 3QFJB 2YD1A 1EH9A 3QEUA 4ETQB 3CVHA 4ORZC 3D2UB 4PP2A 4U1MB 1JHLH 4BQ8A 2P43B 3JV5A 4P3CL 1W8NA 4QHUB 1I3GL 3ES6A 1YEEL 3VD4A 3L5XL 4N8PA 4HGKC 1U3YA 4Y4HC 1BQSA 4U7KA 3FJTA 2ESVB 4HS6B 3D9AH 4YBLB 2DQDL 1N0XL 4KROB 4TUOA 4AEHL 3S3PA 2MWCA 3O6MH 4Y8AA 2B7DT 4LBEA 4NBXB 5A3ID 2XT1B 4R2GB 3QYCA 4OFPA 5GJSH 3NMEA 1DBMH 1AO7B 4HULB 4LLDA 2XN9A 1HZHH 4X6EB 4HMCA 3BRGC 4JVUA 1PYWA 1Z3GL 1MHCA 5DRWB 1A3RL 3TN0D 5ALCL 4EDXA 1HNGA 3BIKB 4KJYA 2VLLA 3VJ6A 4MQ7B 1WBXA 3CJJA 1BJMA 2X4QB 4G9FE 5T5NF 3QIBD 5F7UA 1MFNA 3MOAL 3LQZB 4DEPC 2E9WA 5IW6B 3VH8B 1N0LA 4G6AD 4GRWH 1FYTD 3EJYC 4KK6D 3O41A 3EDKA 1KCSH 3E8UH 1RULH 4PD4J 2NY0B 3DYMA 3GSUA 2AW2A 4JFXB 4K3HA 3D6GA 3PJSB 5FUZL 1W72A 3SQBA 2R1WA 3DMMD 4AZ8A 4YK4C 4L4TB 4LSRH 4CAGA 3EYQD 4HDIA 4JDVB 3BQUA 4GUPB 2VLJA 3SJVE 3MRBA 5EFIB 2CO7B 1XGYH 5EO0B 3RVXD 3PWJB 4Z7WF 4HUUA 3EJJX 1FO0H 2EIDA 4TUJB 1NFDF 3BP4A 4LSVH 2COQA 2CDFB 1KCRH 4DCQA 5FA4A 4LSUH 2P4AB 5L2JA 4MZ2A 1YJDH 3AMLA 5E2UH 1RZKH 3L3HA 4P5KA 2LE9A 5D5ME 3RNKB 1TMCB 1U93B 1E6OL 2W65A 2X4TA 4AEEA 4BA8A 1KTDA 5DDHB 1XR9B 2XA8H 2EE9A 3S4SA 5IQ9B 3IRPX 2OYPA 4Z77A 4WUUD 3L5HA 2BX5A 1JVKA 2FECL 3WFBH 5MENB 5DJYA 3F58H 4XPBL 1G7MB 4LLQA 3P4LA 4IJ3B 1WBXB 1AHWB 3GSOA 1RURL 1OAZH 4LFHG 4XP5L 3JUZA 4M48L 1FO0B 3RJDA 1PJ9A 3LSOA 1CI5A 1JFQL 4W81A 1RZIB 3NFNB 4N0YH 5D7SL 4PJ5D 4LNRB 1V3LA 2OL3L 1B0WA 4LKXA 3LKPA 3MNWA 5DT1L 1HH6B 3RWHA 1HDMA 5EZIH 3IGAA 4XP6H 4YR6A 2ADIB 3GZKA 2R1XA 4GT7A 1KIPB 1KIQB 1SM3H 3X3GL 2FR4B 4UV7L 5F93C 4X6CF 3UTPD 4Z7NF 5E08L 1C5BL 4LHUB 4DN3H 1YN6B 1C1EL 5E8OA 3I6KB 1QVOB 2I5YH 1KPUB 3DX8B 2AJSH 4BZ1H 2FO1A 5IW3A 2WQ8A 3IFOB 4JJ5A 5E9DB 3DVNB 1NC2A 3QFJD 3NPZB 2VO5A 5C07E 1W0WA 4WDIA 1S9XB 2XV6B 2EDJA 3TBWA 1F8TH 4MNQD 5IQ9A 3OAYK 3QQNA 3S4SB 1MCNA 4Z77B 1G7JB 3X14B 1BAFL 1H3XA 4S1QH 5HHQB 1A7BA 4K7PY 4GQ9H 4ZS6D 2VZVA 2WZPD 2NY3D 4HFWA 3P0GB 4U1IB 1DQLL 4G9FD 1H3PL 4CL7A 4MCYA 4QRRD 1QKZL 2O61B 5GRJL 4HHAB 4MAUL 1DFBL 1XCTB 1E4JA 3K74B 2E9BA 5GS0H 4JFED 1T03L 1BWWA 3RVUC 5IV2A 2QHRL 3HE6B 4HH8A 3NIGF 3L5WB 4GRMA 4C56A 3SKMB 2O5YL 5C6TH 4BM7A 1TCRA 3LKPB 1KEML 3UDWA 1IZJA 4C59B 3TNNB 1YPZF 3R8BB 2R4SL 3BE1L 1H3TA 4UT7L 3CXDL 1DJSA 1SYVA 3SGDH 3MGAA 3X3FH 1M7IB 3D9AL 1FGNH 3WXWL 5HYQA 2DQDH 1XCQA 3T3MF 1DEEA 4WTZA 4DWHA 2X41A 2PNDA 2NY0D 5B38G 4Y1AA 1NUDA 4WO4B 3WIFA 4U6YB 4G9DB 4ONOA 5E9DA 5F9OL 4RAVB 2QR0B 4YXLL 4ZFOA 3MBXH 1T1WA 2VZUA 2D7TH 5I8CA 2PW1A 3MACL 1KTRL 4JFFA 3FN0L 4QTHB 5FA4B 3G6JF 4UOW1 2J1KA 1TQCC 1HWGB 4X6BA 3Q1SH 1D5XA 1KF9B 2VXVH 5TH2A 3TVMD 2AQ1A 3BEVB 5DHVH 5IGXH 3ZKSD 3X12B 2R8SL 4AQOA 1ZS8A 5CLWA 5IV2B 2OZ4L 3H3PH 4FXKB 4TSBH 4Z78A 3BP5B 3T0XA 4NHCL 1BOYA 4OFYA 3CLFH 3JWDC 1T66C 1LQSR 4X98B 5C0JA 4P2RA 5F7YC 1HHGB 1VFOA 2B1AH 1X5HA 1I85C 3S88L 3BH8A 3K46A 3SGEI 5FK9B 2ZOLB 4UT6H 5T1LB 3D0LA 4U31A 2H2PD 5F6IB 3WNNA 3JTSA 4LDLB 4JO1H 2LVCA 5L88L 3G5YB 4YFLF 4Y7MA 5AAMA 2AI0L 1T5XB 1YEGH 5EZJA 3JTTA 4E9LA 5J12C 4QXUL 5IM7A 2Z92B 3GRWA 4JRXA 2WWMD 1MFEL 4LCWB 2W0FA 4URTB 4PRIB 1N5AA 4M62H 1N59A 3IDMA 4K55A 5F71A 5KS9A 2VDKL 3FZUD 2EXYD 5IB3A 3UTTE 5J13C 3U9PH 4U1HA 1JYXA 3MLSL 5FKAA 3FMGH 4WDIB 5LWYL 3HN3A 3QCVL 1BFTA 5F7FA 1I4FB 4PJFF 1XZ0A 4P5TD 3IKCA 3M07A 4Y4HA 1F4WL 2HT2C 4UBDD 5CEYA 5B39B 1BREA 2W0LA 5J9PA 1GGCL 4QOKA 1UGNA 1P7KB 5I73C 4NQEE 1T21B 1A0QL 3KYKH 3QXDB 3GMRA 1ZTXL 3MV9B 4QLRA 2Y07H 4G9FB 3CDGA 5BOPA 5C0FA 3S5LA 1SBSL 3DSNA 4WTZG 5IMMA 3PDDA 3BH8B 4B41A 4M00A 2C9AA 3MUHL 4QNPF 3WJJA 3MODH 5FDYA 2DLFH 5AUMA 4MS8C 3SHSA 1ZOXA 5D1QB 1F2XK 3SQOL 5D71L 1CE1L 3QNXB 3CFIC 4DGIL 2KPNA 5KOMC 1J1PH 4M5YL 1Z5LB 3MRQB 4KXZH 3CSPA 3MJ8A 5C0RL 4OT1H 4CNIB 4OLXL 1KCVH 1IAIL 5C0IA 4ZAKB 4FRWA 4NZJA 4M43H 3ULSB 1DVFB 4GRWB 3FRUA 1BAFH 4S1QL 4S1RL 3MRDB 4POYA 2FO4B 1T1YA 5BZDB 2BFVH 3OKOB 2E9IA 3OJDB 3UMTA 2ICWA 4MA7H 3VXME 1B88A 3FO1A 4AG4L 3NZ8B 3JVGC 3B9KC 1QFHA 2Z35A 1WCBA 3O6ML 1R3KB 1LEGA 1BOGB 2B5IC 3VXSD 3IDXL 3JV6B 4KY1L 4M7ZB 5IR1B 2BDNL 1T0MB 3OKLB 3QH3B 3P9LA 1MLCA 4Y2OA 4QF1B 3RVVC 1KEMH 4HKZA 3BEVA 4X6DA 4XBGB 1MF2L 5JLZA 3OL2A 1JNLL 4NC1C 1U8OA 2V2TA 1KCKA 3ECBB 4G42B 1JGLL 1FV1B 4JZJA 1KJVA 3I2CH 4I8DA 5I71C 2GHWB 1KJ2L 3D2UA 4IDLA 2EH8L 5JW3H 2OMBA 3REVB 1QEWB 35C8H 3MA9H 4MD5B 4OQTL 3NCYP 4YHYB 4XPFH 2NW2A 4IM8A 3SE3A 2ED8A 3MUGA 4WV1C 3V4VL 4ZS7H 4DGVL 1FYHB 1QBMH 5KSUA 3B2UD 1DN2A 4O2FB 2HMIC 4OD2B 2Y36L 1IEBA 1MFDL 3DX9A 3V79C 4JM2C 2DQCH 1MI5D 1FVCA 1KPVB 1T80A 1RUMH 4HS3A 3ZL4H 3CDCA 2DJ4A 1N6QH 1OAQL 1K85A 3QQ4A 4O02L 2VLLB 1ZSDA 3VJ6B 5T33H 4MQ7A 2ZCLL 2GUOA 5JDSB 1KB5L 1QLRB 4P9MH 5LGKA 2YUXA 3H2WA 1KPRA 1LO5B 3FFCA 2PYEA 4GKZB 3TP4A 2HMID 4IIQA 1BQLH 2GJ6A 3LD8B 3D85D 2DLEA 3G6AB 1YEIH 1IKFL 1OF2B 5DGQA 2ICES 4GAFB 3SE4C 2GFBB 4RZCA 1YYLH 4MCZA 3NCFB 4UAOC 4HMDA 5GS1B 4MNQB 4ODXA 1GPOL 3T1FB 1JPTH 4QCIB 1KYOJ 4H5SA 2GAZA 1TQCB 1PZUB 1U8HA 2AI0H 4RMRA 2IF7A 2ITDB 1F4XH 2BC4A 3P4NB 3PXJA 2ZCKL 5JPMA 1HQRA 1U58B 1WFNA 4HPYL 1U42A 2X89D 1J1OH 1IM3A 1MWAB 3HRZA 4WY7L 1J0JA 4RFOH 4NSKA 4Z7WB 1HXMA 5IW1B 2CLZB 4OQTA 4Y4HD 1JHLL 4KI1A 3QUKA 1NANH 4KRPC 1I3GH 2I60L 4XPHH 3C9NB 5D1QD 4QOKD 1YA5A 2VDNL 2X4NA 3FMGL 5C0DB 3OQ3B 4Z0XA 4CJ0A 2KZWA 3GBNH 4OKVB 4OIIL 1CF8L 4OLUH 2XA3A 3R4DA 2R56H 3BZFB 1XT5A 4KKBD 1DBJH 1H0DA 4LSTL 4GH7B 3HZKB 4ZFFA 4DUXA 2BXYA 4JFDD 3BZ4A 2X09A 1VESA 4LSQH 2ED9A 3V6OA 3RIAF 4G6FD 4RWYH 2DQFB 2JIXB 3EYFB 3HG1E 4GXVL 1DVFD 4ONFH 1MWAL 2R1YA 4X7TA 3VG9B 1CFNB 2GK2A 1GGIH 5C08E 3MRJA 1S7SA 4L8BB 3WDHA 1J8HA 1JZ3A 3GUTB 1J0KA 2HKFL 1WT5A 4NHUA 3BMWA 1YC7A 3RZCA 4PY7A 3MLZH 4OM0L 2ZG2A 2HA1A 1EEYA 3MRIA 3MPCA 3BDXA 2OTUA 3GMLB 3K4DA 1E4WH 3IGAB 1ZLSL 1BIIB 4NZTH 3QXUA 4K94L 4NQDB 2A6JB 1ZEAL 1J7VR 5I0DA 1JWSA 1KTLA 5DD5H 2FGWH 3F8UB 4LCCC 5DD3L 5CGMA 1TITA 4P9HC 5GGRY 1LEKA 4G42A 5GZOD 5KSBE 2I9LA 4L4VE 2W9DH 3ZKXC 1R5IB 1F2QA 1C7TA 3QXTA 2BNRD 3L7EB 4NNXB 5F1IB 5ITFA 3QQ3B 5FF6A 5LGJA 2V2WB 1FL3B 3UTPE 2A9NH 1B9ZA 5FDWA 1CTNA 4DGYH 4OFDA 4PD4K 2X2YA 5FA3B 2HT2D 1QQDA 4UBDC 2MFNA 3VXRA 1FAKT 2DBJA 3OGCA 1SEBA 5DYOA 1FG9C 4L4VA 3RIFF 2ENSA 3OF6D 4X6CB 1PBYA 1H3GA 4KY1H 4CW1B 2P8MB 4O2FA 4ZUWB 3BDYH 5E8NA 4RDQF 3DGGB 2VR5A 1NGYA 3C6SB 4L5FH 2J5LC 4YXLH 1J11A 4LRIC 4K8RH 4IRJD 4NO3A 5K9KB 4YDKH 1CFNA 4BFIB 4PV9A 2CK0H 3HUJA 2MNUA 2DYPB 2J5LB 3D3VE 3VXUB 1S8DB 1XR8A 2FSEA 3T3PF 1B90A 2Q6WB 1NAMA 1MCHA 2ZCHL 4R0LB 3HUJF 5T1KB 1PEWA 1YY8B 1MRFH 1DBAL 4DK6A 3ULUD 1GOGA 3HG1D 1MCLA 4HFUL 1Y6KR 1X5XA 1CXHA 35C8L 2I24N 3KLAA 3MA9L 5D72L 5LVEA 1AGEB 5C0AD 1IILE 2ZJSH 3CU7A 5EFIA 5ICYB 3QDJD 5JMRA 5DLML 2JKXA 4D9LL 2HN7B 2UUDK 3QDJA 4S2SB 4JFYA 5F3HA 4IRJC 1P4BH 1B4JL 1KXVC 3SPVA 5DFVD 3U0PB 3QDGD 3SGEH 2FX7L 3ARBB 1FZOA 5CEXB 5KTEH 3ES6B 4GW1A 3S88H 5E8DL 5BS0E 2CUHA 4H20H 2NY1B 1BEYL 2AJXL 4X0KB 3WKML 1RUAH 1WQVT 4XP1H 5FA3A 3KXFD 5HHMB 3TIEA 1P7QA 2EDKA 3RWJB 4M6OH 5MI0B 2FYYA 5HDLA 3Q0HA 5DD0L 3FQXB 1KNOA 2D4DA 4QRTB 4Q9QL 2J8UF 1OARH 4PJEE 4YK4B 5MEND 4M61B 3BHBB 2Y7QB 2VISA 3WIHL 2FEEI 2XKUA 2K9UA 3LQAC 2NZIA 3U4EB 3L5IA 5FOBB 3BZFA 3RWIB 3EHBC 4XC3L 2WV3A 4KZDL 1GC1L 2FSEB 3L3JB 3KJ6H 3OF6A 1ES0B 2XTLA 4P59H 1FL5B 4M8QA 4QT5A 4ZTPH 3FQUA 4JRYD 1HH6A 2IANE 2HFGL 4HH9B 5KVFH 8FABA 1X7QA 1VCAA 2HT4D 2P1YA 4YDJB 4NHUB 1HHIB 1DUYA 2F54B 5DS8A 3JVGA 2EDWA 3B9KA 5E1HB 4JFXA 3MCKB 2WMPA 3LS4L 3V6ZA 3T04D 5C6TL 1IM9D 1KPUA 2ARWA 1CL7I 4PG9A 1ZKAA 1OHQA 3AREA 4BQ6A 1NBYB 4E0RB 4F80A 1S9KC 3E6FB 3BESR 4L8SC 4NNPL 2X4RA 3CNKA 4NOFA 4PREA 4UT7H 3CVHL 3E1F1 2ORBH 1QOKA 3O4OB 1UVQA 2AXFA 3LPFA 1FDLL 3KYMA 4FFWC 4NCC2 4U6VL 5DO2C 1XIWD 5ITFB 3E2HB 3BX7C 4LF3A 1TTFA 5I16A 1FGVH 3TBVB 5TE7H 1YNKL 3K81A 4OCYH 1RJLA 3V7AE 5I1LA 3R8QA 4LIQH 3KYAA 3O9WD 4JFZH 5M95B 1LP9E 4WUKH 1TZIB 3TO4B 2VISB 3V6OE 1YY9D 4KVCH 1I1FB 3SDCC 5J7CC 1BJ1J 3HHRB 3FN0H 3KYOA 5EULV 5CS7A 3UEZA 5EZLA 5DMKB 2MCG1 1AH1A 4Y16D 3MOBH 4FFVC 4YO0B 2DJUA 2H6PB 4XWGH 1WZKA 4DKEL 3VD7A 1UWGL 2J4WH 1JF6A 5A2KH 5MHSD 1HHIA 1HKLH 4R0LA 4D0CB 5L2KA 2FCBA 4MNGB 2E7BA 3IXTB 5KJRL 4ERSH 2DL2A 4JY6A 5I71B 5JZ7D 3C5ZC 5CD5D 5E94B 3MRQA 4TQEL 4U6YA 3SO5A 4DQOL 3MFFA 3U82B 3CMGA 3NGBB 4PRBA 1A1NA 1GOFA 3LKSB 4S2SA 1IFHH 2PTVA 3M17A 3U30C 1LMKA 4GW1B 3FO1B 1N0XH 4XXCA 3I3BA 2PR4H 3KLSA 5EORL 3ULVC 5EOTA 2R4RL 4YHPA 2YMXL 5C0ND 2C4XA 3R0MA 5ACZB 4KQ3L 5F9DC 3PP4L 2BNQA 4Z0BH 4BFEA 5F7NC 1S7RA 3OKLA 3RWJA 5ACLA 4PIRF 3U7WL 4MVBC 5GJSL 5IMOB 1R3LA 2IQAB 5AD0A 5CWSA 1M71B 5LBSH 1F4HA 2XN9D 1S7XB 4BQCA 1UENA 1KCUL 4G3YH 2ZOKA 3M1BA 4FQLH 5F9WC 3GMPA 3MLSH 3GI9L 4OZHB 5GRUL 2I9TB 5J8OA 2V2TB 1RZ8A 4PRNB 1DQMH 3GNML 4PY8J 1QRNB 4JDZB 1F3DJ 4C56B 4LFHD 3FTGA 1FL5A 4M8QB 3T65A 3Q6GH 2E9JA 1QEWA 2VSDA 2FLBT 3BPLB 4MNGA 1YQVL 3C60C 3QXAB 1BD2A 5DQ9A 4ZD3H 3BOVA 2JIXD 3U0WH 1NLBL 2EDLA 1HIMH 5T3ZL 4O9HH 3UPAA 5I66A 5B3JE 2ZPKH 4M6NL 3V6ZB 5DHYB 4YBHA 2WINB 3X11B 3P4MB 1CE6B 4Y5XA 1I8LA 2QSTA 3WLBA 3VWKA 1B0RB 3RWGA 4NN6C 4OZ4A 4GRLD 2MQCA 1FLTX 1QFUL 1TQBC 1ADQL 5ISZB 1EMTH 4LSVL 3EJZD 4MA1C 5I8CB 4N90D 4EI6B 4KUZL 1UM6L 4TN9A 5E2VL 1KG0A 5HGDA 1AI1H 4J6RH 1I9RH 3IKCB 2FEDD 4BZ2L 1SMAA 3CC5B 1OP9A 2O5ZL 2XTJB 1JGEA 2OJZL 3QHZH 3K2MC 2YPVL 2YXMA 4DK3A 5F97E 4HUWB 4FTVE 5D7IA 3X12A 3HPJA 1EEQA 1TJGH 4YAQA 4R26H 2PKDA 2AQ2A 3WNOA 4G9FA 3WL9B 5FYJU 1J0YA 2AAVA 1UH2A 2X7LA 2YSSB 2YA2A 1NGWB 2EO9A 3PF2A 1MIMH 1XGPB 2NY7L 3B6SB 4Z7VA 2VXSH 3F12B 12E8L 4MMZC 4FZEH 1ACZA 2R29L 1JZ5A 4XPTL 3KS0J 4IS6B 3GGWB 2UZYB 3SDDC 1KUMA 4PJ8D 3G6DL 1IMHC 1G6RL 3S5LG 3ZTJH 3OAUL 4KJWC 1SJHB 4ZAKA 1AHWC 5GGSY 4POZC 1FGVL 5CBAB 4LCYA 1TETL 1C1EH 1D5MA 5I73B 3PE9A 4IOSD 2PYFB 1BBDH 3OBAA 1RIHL 5E99L 4XPFL 1CT8A 3W0WD 2NXYD 1EGJH 4J3OC 5BRZD 4ZFFB 1Y18B 3MNZA 1AIFA 5F88B 1OM3L 5HGDB 5T5FL 3T2OA 1E27B 5IB3B 1BHGA 1OD9A 4UT9H 2VMFA 3A67L 4I5BB 5HGAA 3VXSB 1Q9LA 2DQCL 3QDHA 4RGMC 4M7KL 4N8CL 4X4ZA 3MJ6A 3PV6A 4XAWH 2IADA 1PQZA 1P7HL 2DWDB 4I3GA 3PHOA 4H1LA 1I3UA 1N3NA 5CEYB 4UTAH 4YC2B 5DQDL 1EHXA 1WCQA 2A6JA 4WI9A 4D8PB 1BJ1H 3PHQB 5FOJA 4B50A 1FZKA 3SJVB 3C2SA 3OR6B 4ERSL 1D5BA 4XCEB 5DJ2B 4PRPA 3D18B 3VCLA 1PX3A 1YMHA 1KC5H 3GSRB 5C70A 4ZFZB 3VFWA 1DBBH 1I1AD 1RIUH 1U41A 2DJSA 2FATH 1NCDL 3OV6A 4HT1L 4YHIA 2OTWB 4PLJC 3TYGH 4PLNC 5BVJB 3ZO0A 1T22B 5L8LB 4PJ7A 5I1IL 1GPOH 1JHKL 3ZYZA 2EDBA 5A16A 5HGBA 3DX9B 1CFQB 1AJ7L 3EYUH 3HE6C 4OLZH 2ZCKH 5JW5A 4HPYH 2Y5EA 2BNUA 4YHLH 5IFJB 4HWZA 1RJCA 4NGHL 3BJLA 4GBXC 3MNZB 5F88A 4OZ4B 4XNUL 4MQSB 4YQXL 2H26A 2V9TA 1A6UH 4FP8H 1LE9A 4MSWB 4QHMB 2Z35B 4I77L 2YR3A 1R3KA 1S8DA 1XR8B 3RY6C 3O2VL 5C09A 1YUHB 1MREL 3RTQC 3P0YL 3MROB 5J57B 1T83C 3M8OL 4OI8A 4KGJA 3T09A 2A9MH 4ZO6A 5AZEH 1S78C 2VXTH 3T2NH 1R3IL 2CDGB 4JCLA 1ZANL 1YQVH 5IESL 4N5ED 2YWZA 4F57L 2QKIA 1NDMB 3FT3B 1Q9KB 2LTQC 3IB4A 1F6AA 4Y4FB 1JV5A 4OM0H 2CKBA 4FQHB 2AABH 2EIZB 1NGWA 1JPFA 2WK2A 2HFGH 3SPVB 4X4XB 1IM3B 1MWAA 5CLTA 3B6SA 1CQKA 4LSSL 1S5IH 5CD5C 1YEKL 2DQHH 4JQVA 3VU2A 2JK5A 1N2RB 2GW5A 3QUKB 1FE8H 2ZSVA 4KKCD 4YZFF 3IF1B 2Q86B 3TCLB 1U91B 1UM6H 4FFZH 3LB6C 5TDNB 5DC0A 4YHNB 4NP4L 5ELIA 3VFNA 1UZ6E 1IGJA 2F5BH 3CVHH 4NJ9H 1KIRB 4QGYA 1JUFB 1A5FL 1JGDB 1P2CA 2PCPB 4EN3C 4JO3H 3IJHA 3RVTD 4PRHA 1M05B 1IGMH 4LAQL 1UH4A 2HTKC 5D93B 5GGUA 1UZ6F 4OV5B 4MS8D 1MEXH 1OPGL 4EXPX 4FTVA 1EBPA 3W0WB 3CFCH 5H37H 3TBSB 1FYTE 2JLLA 5CP3A 3O3EA 3HR5B 1IT9L 3SOBL 1UACL 1P53A 1SMOA 2IAMB 3L3OA 5TQ2H 1MPAH 4KK8D 2MTPA 1U3HA 3OJ2C 5FECB 2IPKB 1KTLB 4RGMB 3ARFC 5L7XL 2VTFA 2X4OA 3ESUF 1KXTB 4LK4A 1CIDA 1X5GA 4NPYB 5INDB 1HE7A 2QBWA 3A6CH 4TOYH 3BYTA 3QG6B 4YDLB 3CUPB 3QZWG 4GBXB 1Z2KA 1OGAE 4YIQB 2CLVB 1DR9A 3NABH 4NZRH 3VD9A 1OT1A 4NQDD 1T6VN 4LNVA 3SDDD 2NY0C 1YMHB 1UCBH 4D9QD 1HQRB 1U58A 2VL4A 3DXAB 3THML 5E24E 3MRPA 2V9QA 4LPXA 1IGCL 4WI4A 4LF3B 5I16B 3LRSB 1SEBB 1MRDL 5DYOB 3FO0L 1ZGLB 2FIKB 2Q86A 4M7JL 4Y19E 2ZP0T 4F58H 4YHNA 4HUNB 3QUXB 1NDGB 4WHTB 1A4JA 3Q5YA 5AZ2L 1I8IB 3TN0A 4NO2A 5C3TA 2AJXH 3DO7B 4WI7A 4XP1L 1FFPB 1NGPH 1KYOK 3SDXB 3LZFH 2J88L 1RQ5A 2L7JA 5IFJA 4WI3A 3GMNA 2DLIA 1CDYA 4OZGB 3TEUA 1AD9B 1VADB 2B39A 3BZ4B 3SY0B 5JR1L 5BJTB 5KVDH 4Q2ZB 5D1ZA 5EBLB 4XXCC 3U46B 3P77A 4ZFGL 3ETBF 1JYNA 2P24B 3TZVD 4YBLC 1WAAA 4XCNB 5CCKH 4HXAL 4QOKE 5JORB 4R2GC 4G8FB 1EEYB 3RDTC 4K7PH 4Z8FH 4NQEA 4WV1A 5FUOL 2YD7A 2VZ1A 3S3SA 4OD1L 5C0AB 4JLRB 2R1WB 4OV6F 3QNYB 3LIZL 1OP5K 5E9DD 3CUPA 2MPAL 3RUGE 3DOSA 4HCRA 4ZUUA 1QBLL 1RJZB 2BVPA 4JEGB 1FZOB 4LRNL 4HPOL 1LEKB 2HT3D 1OCWH 3BW9B 4U0RC 2CUMA 3W9DA 1AJ7H 1OWWA 4HGWB 3C6LC 3NFSL 4HLJA 1M1SA 1OAYL 1G9EA 5HHOB 3BP4B 5BXFA 2CDFA 4B0MM 2GTZB 1CGYA 4OLWH 5GZND 1X44A 3LEYL 3PXHA 3B9EA 3T0VA 4NO2B 1QSED 2Y6SD 1AGFA 1M6OB 1FDLH 4HWEH 2NXZD 2CIKA 5LKNA 3O2VH 4GFTB 1WC7B 1O0VA 2VUYA 4FQQA 3BKYL 2YD9A 3M1BB 3PGCB 4XP4L 5JQ6H 5CJ5A 5DVNA 1Y0LB 4JPWL 5GSRA 3GSOB 1HYSD 4RIRB 1EUTA 2W9EL 5E8EA 2WUBH 3ARGA 5SWZD 1OTTD 3BRFA 4I4WB 1Q0YH 4JO2L 4ZQKB 2CD0A 3SO3B 5DMIL 4D94A 1DP0A 2BRRH 2CMRL 5CJXA 1RZIA 2VDQL 2IMNA 2VITA 3O8XA 4LHUG 5E6YA 2WIMA 5DJAB 2Z91B 1PYWB 2I25N 1F90H 4LMQE 3IT8D 4PG2A 1WZ1H 1TZGH 1D9KA 4I0KA 3PWVB 3GHEL 4OFIA 5CZKA 4JRYB 3ZE0F 2DICA 7FABH 3EOBA 4LGPB 4DTGH 1U8QB 2DKSA 4OZHF 1A6PA 2FL5A 3FQNA 5HHPB 3VFGH 4N9GB 3RZWA 3V8OA 4DKFH 2VXSL 5FXCH 4IOFD 1RVFH 4AEIH 5LXGH 5F21B 2DD8H 3PUCA 1WGOA 2GTWB 4JR9L 4JE4B 3MRFB 1KLFA 3EYQC 1MUJA 4P2CG 4TVPE 2EECA 3G6DH 1G84A 2YBRB 4S1DC 1HOCA 5D96B 1T7VA 1FP5A 4B7LA 5TE4H 1PKQE 1TVBA 3MGTA 5CEZE 1M6OA 3ZHDA 5HVFB 3RRQA 1XF3A 4ZAKC 4LOUD 3RDTB 1HI6B 3BKJL 2X1XR 43C9A 2OSLB 5GSRB 2O61A 3OKEA 3PWLA 3TPUA 4L3EE 3DBXB 2V9RA 4PJAE 1BLNA 2B4CH 1OT2A 1I7UA 3S34H 3UJIL 2H6PA 4WHDA 4UT9L 3B3IB 1TZHB 3LKOA 4MAYD 5DRNA 3RWCB 4GXUN 3HI1B 4NUGL 2FECI 2DDQH 5CD3B 5I1AA 3BRDA 1RUPL 2WLZA 3O2WL 3ARBC 3PGDA 4M8VA 3CK0H 4HG4J 2FEEL 3TO4C 3SDXE 3WYRA 4UTBH 5B38B 3RP1A 2XKNA 2YD3A 5D6CA 4K3DH 4LLQB 4ODHL 1E28B 4IRSB 3SGDI 1GZQB 4TSBL 2YD5A 1NEZB 3UO1L 3BWAA 4XVSL 3HNTH 1N7MH 3QIBB 3N1GC 4HKJB 4MJ4A 3D48R 1G0DA 1D5MB 3BAEH 5DHVA 2IMMA 2M1KA 1VGEH 1X5KA 2A6DB 3VE0B 4HS8L 25C8L 2AXFB 3KAAA 4V2BA 4G6FB 4JGUA 2BOBA 3X13B 4Q9CA 1T89C 4P4RA 4N0UA 2VXUH 4B5EA 3QFDB 3KPSA 5HPMB 3VGFA 1JF5A 3SDAC 1QSVA 2VZSA 2UZIL 1HCVA 1YEHH 2CRIA 3UC0H 4X6CE 1GC1C 3ARFB 3I6KA 4KRMB 4CN4A 5I9QC 3VD3A 2IFFL 4QKXB 3ULVH 3CLEH 3GMOB 2DWDA 4FQIL 5FO7A 1I7UB 4FZ8H 4L5FL 4S1SH 1MSPA 1OAZL 5TQ0H 3L3GB 1JRHI 2O5ZH 4R3SB 5IBUG 2AK4E 4ZOBA 3QCVH 3LIZH 4TULH 3D18A 3C8HA 3PGDB 2NY4B 4JRYE 3LH2H 4OAWB 2X5PA 4R26L 4QXTB 4H1LG 4NBYB 5DZOA 1GH7A 4XP6L 2IBZX 2QTEA 2W38A 5BVJA 1HSBA 1K4DA 1OQOA 1V05A 4HFUH 4E41D 4F7EA 3I9GH 1A6TA 3VFOB 4H1LH 5IJVB 5E5RB 5MP6L 3QG7L 1HHHA 2CPCA 3NVQA 4K7PX 2N56A 1S5HB 4HKBB 3HZVB 3QIWD 1U8QA 1B4JH 1P4BL 1OQXA 3A6OA 1U3HC 2VN4A 1HN1A 3D5OF 5E2WL 5IEHA 1D6VH 1KB9K 2X40A 1MUJB 2JJVA 3L95B 4G7VH 3BVNA 3K4ZA 5LAXA 3MA7A 3QULA 3RVVD 1MFAH 4OLXH 4YHPB 4NKIH 2GIYA 3O81A 1QFOA 5IBLC 4RA3A 1S7RB 1GHFH 1ZHKA 5CMAA 4KC3B 1YEJL 5D1XC 3FAWA 3MFGB 3GMPB 1V3MA 5ECJE 5GISH 5ITBL 4RGOL 2QHRH 4M7KH 4N8CH 4PJXB 4EQ2A 5C0BD 4U6TA 2NW3A 2OMNA 1UM5H 3FONA 4FQHA 5B8CA 1NCWH 3NCMA 4M48H 1AO7A 5JXAH 1FAIH 1RPQA 1U92B 4UOJA 3HAEH 5T1DL 3P30L 4JDTH 5HD8D 2NY3B 2HLFC 3WEXB 1C5CL 1UWXH 2JK5B 3V4PH 4YX2L 1EHLH 1HHHB 3DV4B 1KC5L 3QFJE 3D39A 4F15C 2R9HC 4CVZA 3U6RB 1KLGA 1A22B 4Y88A 1Q94A 4KDTA 4JANB 5C0EB 3IXAA 4F3FA 5BV7C 1YEEH 1SEQH 3O41B 4LVHB 1A1MA 1PKQA 1AGBA 5HXMA 4V1DB 3MBXL 1BQHG 1F13A 2X1QA 1CXEA 1QLFA 3MA7B 3QULB 3QISA 4LVHC 4KKLC 4QRPE 1NLDL 2WP3T 3DSFH 4GMTL 2BOBB 1ZLUH 3X13A 5IIEB 1QBML 2JCCF 3EFFB 4PFEA 3TLRA 1QTYT 1YMMA 4YBQC 3HAEB 1A47A 4R4ND 2X9YA 2ZZUT 3TN0C 1OTTC 1RUPH 2JCCB 3WO4C 2A83B 4JRWA 5EZOH 4BJLA 3HE7A 3QT2A 1TXKA 3OKKA 3ELAT 4XNXL 1W72H 5HVHC 3F6IA 4F7TB 1OAXH 3U4BL 3LD8C 3DUUB 3F5WB 4F2MB 3BUTA 2V17L 1U92A 1XIWB 4Y19B 3TVMB 1P5VA 1FNSL 4QOKB 4UQ2A 5C0BE 5HGBB 2DF3A 1KJ3H 3BD3A 4TVPL 5CILH 3E6HB 3QWRD 5FHBH 1YYLL 3IAPA 3X17A 1I9JL 4QXTA 4LHQB 4P4KD 1SJHA 2W60A 3QHFL 3CDGB 4XBEH 1FSKC 3O8XC 3RVTC 4WHTA 1CR9H 15C8L 2KBGA 2MKWA 5IBUB 2CSPA 4ESKA 2R15A 3RPIA 4FQJH 3ALWA 5H2BB 1IVLA 3B8SA 1K8DA 3QDME 4M5ZL 4JG0L 1LE9B 5H94A 4MSWA 3QNXA 4XVUC 3QJFA 3W39B 3G5VB 4NRXB 5D7JC 4MZ3A 5BJTA 5D2NC 4XMKH 3EFFA 3MBEB 4NKDB 1JNHA 2FWOB 3U83A 2PYEB 4GKZA 4OZGF 4JY5L 1BP3B 4Z95L 5C0IB 1I8MB 3DV6B 4PGJA 1QFWH 3NH7H 4WCYL 4QY8B 8CGTA 2PO6D 3U7WH 2CDGA 5JQHC 4L1HA 5IROA 1DQJA 3OKKB 3U0TB 3VRIB 4JM2D 4FQLL 2P8PB 1PG7L 1EO8L 5E8PA 5GZOC 3QIWA 3O6FA 2FEDC 3DUUA 1I8LC 2NY2D 3ZDXF 3MLXL 1OP5H 3EZ8A 5D1XB 3F7RA 2VXQH 4BSWA 1FL6B 4WRLA 1DBKL 5D7SH 1S78D 3T8XA 1UA6L 4QF1A 5IFHH 3SE4A 3G04B 4IJ3C 1UM4L 3UBXI 4GRLC 5GXBB 4HJJL 1JK8A 1MOEA 3WLWC 4OF7A 4K94H 4FHBD 5E2WH 4CN6A 3PWPE 1FV1A 2BNQD 5D5MA 2Z93A 1KJVB 4IMLB 3RPIB 4KK9D 1TCRB 5I76B 3V4UH 1CFTA 4ODWB 3VRJA 5IF0B 1E6JL 1AGDB 3PP3H 3DHMA 1MRDH 2GITB 2QSQA 2MSPA 3G6JB 4MAYC 3W0WA 1MCIA 4UIMA 1JWUA 2X1PA 3P3YA 5DO2D 5D7KE 4FFWD 5CJQL 4KUZH 5E2VH 5GISL 4QRUA 5F6HJ 1IEAA 1K2DB 4U1KB 2DLHA 3OKMA 4M6AA 5HYJD 5IROC 4OD2A 5JNYA 1NGPL 3CFEA 3VFRB 3H42H 5L9DH 2XQYG 2VDRL 5CP3H 5F9JB 4KZEL 3W82A 3GJFA 1HYRC 3PABB 4OCXL 2OTUB 5EIQA 1GIGH 1WEJH 3BXNB 1U3HD 2FNBA 2QQKL 3BKCL 1OTSC 2B1HH 4QRPB 4XAKE 4GKNA 4UNUA 3AMKA 4LCWE 5ENWA 4Z5RA 5FV2A 3V4PL 1WJ3A 5TGBB 3RWFB 1IAIM 4FTVD 3KG5A 2O5YH 4JREC 1D5XB 4ZNEE 5E6IA 5M94B 2J7LA 3O2WH 4PJ9C 4OQTH 5HI4C 4OD1H 5IK3A 3WXVL 4YC2C 3RNQB 3DXAD 3DNKA 2DKMA 5FDWB 3DIFA 5E6ZA 4MMXC 1AD0B 6FABH 1V7NH 1H5BC 1JE6A 4XP9H 2VIRB 5ADPH 2Y36H 3BH9B 4NYLB 5I76A 5GIRA 4H88H 1TETH 5IF0A 3RL1A 2AKRA 5I1CL 3UZQA 5GS2D 1NMCC 2CKBH 3DGGA 4YHOH 1S7UB 3HRZB 2APWA 5EOQL 3EGSB 3NCCB 1FFOB 4X4YA 1BLNB 1L0QA 5I1JL 3Q5TA 4BFIA 4XVUD 3C8KA 3MACH 3KLHC 1RSFA 1NBVL 4PJFB 3VXUA 4E41A 5DMYA 4AG4H 4EVNA 1GAFL 5KN5A 1JNHB 2CXKA 4G8IB 4UDTB 1NC4A 1IKFH 1MQKH 5D7LE 3SGJA 1PAMA 1N5AB 3V8CA 3MBED 4I0PC 3GO1H 1EEZA 3OX8A 4KJYB 4G6JL 4P4KC 4NQED 2EO1A 3MMEB 4YHKH 5TE6H 2JELL 3DXAE 2J6EL 2Y5TB 5GRWA 3N1QC 2XN9E 4HUVB 3VH8A 4PJHF 5FIEA 2WM0A 2P45B 3WUZA 4GBXA 2GKIA 2EDOA 4OUUA 1JGLH 1F4XL 5LCVL 1BVKA 1TZGL 3DMMB 3MRIB 1A2YB 5IWLC 2VLRD 2ZKHL 4L8SB 4XCYA 2KDGA 1YMMD 1BIHA 3TO4D 1GJIA 4F8TA 5TDPA 1I8KB 2FH6A 5JUEH 4M02A 2JF1A 1EHAA 4D0BA 1JWSB 1S9WA 2HH0H 2MQ3A 2EDNA 4LLMA 1ORQB 4XPHL 5K33A 1EPFA 3IFNH 1IARB 1P7QD 4OLZL 5SWSD 3OHXA 5DF0A 3UX9B 1HHKB 4NKMA 2CUIA 3JZ7A 3C8KB 4PBVC 4XNUH 4ZODA 3D39D 4Z7VE 5E7BA 1YNKH 4LPWA 1OWRM 5MHSE 2Z8SA 1NANI 1Z5LA 4RWHA 1N6QL 4N1CA 4Q2ZA 5D1ZB 3OGCB 1MVUA 4O02H 1IEAB 1K2DA 4LASL 1R24A 1MREH 1HHJB 1DVFA 4KXZI 4V1DD 3PWPD 5CSGA 3P0YH 1MJUH 3HC4H 3MMEA 1OAKL 4ODVL 3B9KB 4P46A 2Q8BH 4M03A 3UTSA 5MI0C 3GJEA 1WK0A 4GKNB 2QQLH 3NFNA 4X7CC 5ENWB 5DVKA 5DC9B 2X4QA 4MB3A 5DC4B 1ROWA 4CMHC 4H8WC 4GAGL 5T1KA 1UC6A 4WTXA 2GQHA 4ODHH 4RISL 1OSZB 2PXYA 3EFDL 2NX5E 2BVOB 2Q76A 3ZDYF 1DFBH 4JDTL 1NBZB 3UJTL 3W5NA 4LHUA 3EDEA 1ZT1A 4NKOA 3LPGA 3BPCB 4DVBA 1W0VA 4G43A 4KFZC 1HI6A 4Z76A 3TFKD 4UQ3A 3UBXB 3DX6A 4JGMA 4K71B 1A7NL 1R6VA 4WI2A 2IPUG 4RFNC 3MJ9H 5K9JH 2ZUUA 1KT2B 3VFUB 1J10A 3DUSB 5DRXB 4QXWA 5F7HA 3B3IA 1FZJB 3T2QA 3WS6C 5I75B 4MXVE 4R8WL 3O0RH 1CTOA 3X14A 1V3KA 2YD8A 4UMGA 4PJ8A 4K9EC 5EC2A 3RVWC 3FQXA 4FQIH 1F02I 4GG6B 3QCTH 2FBJL 2XWTA 3WHXB 1NJ9A 5F1SA 1KPVA 2E7LC 4NFDA 2LQRA 4EJ1C 2B2XH 5HYJE 1BM3H 3I6LE 4XVJL 1RK1A 3SCMB 5I2IA 1FNGA 2VQ1B 5D7KD 1DN0A 2NLJA 5D7JA 3CH1A 3ARGD 1EEZB 3OX8B 4HWNA 4IRJB 5HBBA 2DTMH 1FFNB 3UTSD 5ERWA 3OKDA 3ZYOA 4FG6D 2BZDA 3VXQA 1KJ2H 3RAJH 5HHPA 2RCSH 4AY0A 2F8OA 1BGXH 4P4RB 2F53B 1FPTH 3K8KA 4LKXB 4NKQB 1LK2A 3HG1B 3OMZA 2DBLL 5I8KH 1FQ9C 1AFVL 5BVPL 1LNUA 1QR1B 1JPSH 2NYYD 1HOCB 1KSRA 5HYIA 1RK0B 4A2LA 4M6OL 2A9NL 2AV7B 1FIGL 4MJIA 4ELMA 1NBYA 4GMSL 2ZPKL 4M6NH 2NMSA 3F7VB 1NFDB 4NQDE 1CR9L 4PJXE 4LLMB 2ZNWA 4H0GA 5BQ7B 4RAVA 5CWSB 4R96A 2QR0A 1G1CA 3LOWA 3WS6A 1D5IH 2VYRE 4XGZB 2AJUH 4WEBL 3D0VA 1T3FA 3KPPB 3VFTA 1SQ2N 4QTHA 5JIPA 4PR5A 4RNRB 1YJDC 1N4XL 4J3WA 5DWUH 1I1RA 3TYFB 4PJ8B 2CJUH 2HVJB 5DXWA 5J1AA 1VFMA 3OB0K 4JY5H 4QYOB 4YDKL 5L0QB 3SGKC 1IAKA 2YPVH 2ARJQ 1NL0L 3ROLA 3U7YH 1IQDA 5IVXE 3ARSA 4GW5A 5JW4M 1ZLWH 3QXAA 1CGUA 5IVNA 2YOCA 3PQYE 4JHWH 3PQYD 2J8OA 4PB0L 4F9LA 4MNQE 2NY5L 1UM5L 2VUOA 4IRSA 1MHPH 1DQDH 1Q9WA 3HZVA 3BGMB 3DRQB 3QEHB 1AXSB 4M1CD 3EDFA 2A0LC 4GKSA 5BS0D 4JB9H 2XZAL 4LLYA 4OD3H 2OQJA 2KUTA 2HYMA 4BH7B 4CGTA 1P9MA 1UA6H 2EE3A 3TO2B 3OPZL 4PJDB 3PQYA 3GSUB 5CHNA 1VERA 2OTPA 3GMLA 1LP9B 4WY7H 1BIIA 4JY6B 4P5MB 2AXJA 3RA7H 1HQ4B 5E8DH 1CDHA 2BY3A 4N0UB 4JDVA 1IGFL 3P9WB 4I3SL 1EGJA 4XNQB 4PJ9D 5HYQB 1LILA 4JFZL 4ZNCD 1YPZA 5CUSL 5DQJB 3KPSD 1UWEH 1QG3A 2DQIH 1RIHH 3SJVD 3UTZB 3STLA 1CF8H 3V0VA 3VFPB 5GRXG 2GCYB 2DQUH 3NACH 4DCQB 4MXWL 4PR5B 5L2JB 1MCOL 1OAKH 2J12B 4WW2F 5T5FH 3VMOA 3TWCH 3LB6D 5FM5O 3QAZC 3VRLE 3L3GA 4N0UE 1N8ZA 1SY6H 4YHZH 3TJHD 1IQWL 1NGZA 1RZ7L 4PJCA 5E03A 5L9DL 1OTUD 3D25B 3O4LB 3HZYB 4GAYA 2EDEA 3DVGB 2EKJA 1OAXL 4X6EA 3TGXA 2OS7A 1ORSA 3HZMA 1MY7A 4UINL 1B2WL 2B20A 2ATPB 3HUJB 3WFCH 2GSGB 2DYPA 4Z78B 1FGNL 5F1KC 1AQKL 3ZE0E 4BH7A 4D9RD 4DTGL 1FNSH 4I18A 5E00B 3MLTB 1O7VA 4V1DA 4HIIB 1KCLA 3VRJB 1A7NH 2YD4A 3LN5A 4JR9H 2UWEF 2D7QA 5GGTH 2DQGH 4MNHA 3J8F7 3HAEA 3L95A 3S3JA 5BRZE 5I66B 4KPHH 4KMTL 4QRUB 5C08A 3N0PB 5GGVY 4EZMA 3PP4H 4LCUB 2FZ3A 1J8HE 1A02N 5D5MF 4P2OA 3RWGB 1S7WA 1LO4H 2R0ZL 2GJ6D 3OXRA 4LIQL 1NC2B 3F7YB 3UDWC 5F1OB 1HZHL 4F7TA 2P8LB 2HG5B 4XH2B 4KVNH 4RGNB 1CL7H 1BOGA 1I7ZA 2VLRA 3PHSA 3VXOB 3CFJA 5DJCA 3H3PL 3Q6FB 5CKGA 2J8UB 1EJOH 3FQRA 4BSVA 1Z9SA 1G6RB 2CDEA 3UTQB 3ME0A 5D6DC 2CH8A 1XH3A 2EC8A 5B3NA 5F7LB 2OTWA 4Y5VB 1Z9OA 3T0AA 3SCMC 5D72H 2QSCH 5MENA 32C2A 1HIML 5D1ZD 5K59E 2J3SA 3RDTD 3MZTA 3VXRE 1AD0A 5C7XL 4IEFB 1QFPA 4NCDA 3B4NA 3BFOA 4W6XB 5JW5B 5F7EH 1NAML 3HC3H 4X6DE 3CMOH 3MXVH 4HKXB 3TNNA 5H35B 2AGJL 5HHVL 1CGVA 1F3JA 2OQJB 1VGEL 4P4KB 1CVRA 1S5IL 4HQQL 4PJHE 4PRAB 4YDJA 1BEYH 2PUQT 3VXMD 1TVDA 4P99A 1RUAL 4NUJA 5IHUH 2DQEL 3RWHB 5JUEL 1I8MA 5I8EA 4YR6B 3LHPL 2AK1H 5A3IC 2R1XB 3ULUC 2HH0L 5IOPA 2WBJB 2VB5A 4WU7A 1FVCB 2APTA 1MHHA 5TFSH 3WE6A 2X4RB 1NCBL 2HJKA 4J23A 1JGVL 1MI5B 1KFAL 2YC1B 5I17A 1OGTA 2NXYC 2EEDA 1X5LA 3EKCA 4ZDHB 3VFMA 2WAHA 1RD6A 1NMCB 1TJGL 4GG8B 1UQSB 4FZ8L 2WIIA 1G9MH 3Q6FA 1VFBA 3OJDA 3NAAH 5TQ0L 1G7IA 1GC1H 1KENL 1Z9LA 3DROB 1W0WB 4J3VA 3DECA 4PJCF 3G04A 4KZEH 2NY5C 1MIEL 5I6XC 4ZOAA 3QRFM 5HYEA 3P0VH 3H3BC 3QUXD 2V5MA 2GFBA 3AROA 4RZCB 4PJHB 4QEGA 4PRIE 2H32H 3FAXA 3QO1A 3MRRA 3IFLH 4XCCL 2Z4QB 3OAUH 3HZYA 2IPUK 3DYOA 3CCHB 3LV3A 3BD5A 4X6DB 3ARFD 2QADB 3BJ91 3RA7L 1I7RB 3RUGB 4YO0A 2ITDA 5TDNA 3E8UL 1N6UA 4KAQH 4JFFD 1UT9A 5IMLA 1J1XH 4X4MA 2E7LA 4PRAA 3EFDH 5KSVB 2EDHA 2HTKD 4U2YA 4K2UH 3RBGA 5A16B 1V7NL 2YS4A 1F58H 1R3JB 4NFCA 5B8CC 4NRYA 4XC1H 3NPSC 3T3ME 4JFDB 2AQ3A 2HJKB 3VXUD 4NWUH 1UH3A 1AI1L 4J6RL 4YFDB 3PNWB 1CDUA 4P2QA 1YEFL 5IHZA 2VOTA 4UTAL 4TSCL 3QHZL 2WIIB 5JOEA 5I8OH 1U8LB 3HMWH 4OM1L 4P46B 3P9MA 2DQFA 3EYFA 3O9WC 3G9VA 4NPYA 1U6AL 1R5WB 4AEHH 3KPNB 4LU5L 3GSNH 3QIWB 5EU6D 5BZWA 4DZBB 3VXOA 1OB1A 3CFJB 1CDGA 5DJCB 4AT6A 3GIZL 2MHAB 3GK8L 4GG6E 1X4ZA 3O3BA 3EYOA 4RMTA 3EOYG 1HKLL 4NQCD 1T04A 2G5BB 3ARBD 12E8H 1JHKH 2FD6L 4RQQA 2R4SH 1IBGL 3O6FD 4LVOB 1ZT1B 4NKOB 1FHGA 5GGTL 5GS1A 4ODXB 3MRGA 2CKBB 3OGOE 4JCMA 1ZLVK 5EU7E 2XQYK 4NQVA 3C6LB 4K8RC 4LLWA 4HJ0D 4X98A 5C0JB 2IQ9H 2VDOH 3QUZB 1FFOA 3UZVB 1HH9B 4ISVB 3R06B 3ZE2E 1Q0XH 2F15A 4IMKC 1SVCP 1IFHL 2DL9A 3AREC 3KPQA 4MVBD 1KEGH 3H0TA 4DUVA 3GB7A 1NC4B 3ZE2F 5I8EB 1RZFH 3P77B 1HWHB 4H26A 2WUCH 1NFDE 2FX7H 5KTEL 3VGHA 1TENA 4NZUL 5LBSL 2A73B 3WE6B 5IM7B 1JGDA 2DMBA 3KPTA 5FO9B 4GG6F 1A7QL 1DN0B 2NLJB 4PJAB 1ZMYA 3OZ9H 4NQXA 4QHKI 4K23H 5GGUB 3DUHA 4NWTL 1QNZH 1VKXA 3QQ9C 4YHMH 4W68A 4AH2B 4U1HB 3EJYD 3U9UA 1JGEB 3C8DA 1S7SB 4L8BA 4ORGB 1KLUB 3KJ4C 3GSWA 2XFXA 5KSAA 3QPXH 5DFVC 1KN2L 1FE8L 3BPLC 3GKZA 1LO3H 2X4OB 1ORQA 4PB0H 1UG9A 5JW4Q 2X1WL 3BQUC 3IDJB 1IGTB 1NCAL 1RK0A 2YPLE 5DZLA 5EIIA 5CJBA 4RFOL 2F5AL 2YSSA 3QDJB 3UYOD 4X6FA 3REWB 1CD1A 4WHCA 1RJYA 5EU4A 2BHZA 3BH9A 1QPXA 4R96B 4FQJL 4MAYB 3PGCA 4KK5D 3KPQB 4OLUL 2R56L 1S7UA 1RZKC 4ODSL 1DBJL 2X9XA 4U6HA 2HTLD 5I19H 1MAMH 4OZHE 4L9LC 4DAGH 3ROOA 1SYSB 1S3KH 3EIFA 4YE4H 1YC8A 3WD5L 4Z6AT 5EG6C 3UPRB 2AEPH 4RBPK 4JG1L 4I77H 4PGZA 3U1SL 1MAJA 4PB9L 2YA1A 2B8OT 4GW5B 3ULSA 3MV11 1PW3A 4BK4A 4A2MA 4NJAL 3NFPA 3OXSB 5IEKB 5F7DA 4QT5B 2ICWB 3HFML 5EBLA 3T2NL 4N0CC 4PJ5E 5C2BH 1KJ2A 3U2SB 4HUVA 2ADGB 2GJ6B 1G7QB 2DDQL 2IBGA 3G6AA 1PZ5A 3KHQA 5CIPB 1IM9B 5HVHB 2FH8A 2BY2A 5AG9A 2H8PA 3VW3H 1BZ9B 3CFBA 1ZT7B 3VWJD 4MCZB 3TZVC 2DQJL 2IANB 3T77A 5C2UB 3UBXA 2Q20A 2EDRA 4I2XB 4OCLC 3FO0H 5HPOA 2R9HD 4G6KH 4P9HL 5DD6A 3E6FA 1AQDB 4P3WA 4JREB 1WFUA 2L0DA 1XGUB 2IGFL 3MREA 5F70A 3STBA 1KT2A 3BW9A 3OB0H 3RGVB 3W9DB 2D31A 3HS0B 5JHLL 4OT1L 3V0VB 3VFPA 2OSLA 1RHHB 1E6JH 1EGJL 4JJHA 3KPRA 4J8RA 4RAUB 1DDHB 2VH5L 3LDBB 3CXDH 5JR1H 5IW1A 5F7MC 5KVDL 1VSCA 2XWTB 5CJQH 2ADJA 3ARQA 5J3HD 1NGZB 4PGDB 4OJFH 4XAWL 4LAQH 1FVDB 3VMPA 4G8GB 5HHQA 4GLRH 4KMQA 1FNHA 4FQQB 3HZKA 1NGXB 3WFDL 3DVGA 4NC2B 5EZLB 4D2NA 1MCKA