5E6IA

Crystal structure of tcr pf8 in complex with flu mp(58-66) epitope presented by hla-a2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
199
structure length
196
Chain Sequence
QLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQEPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGPGGSSNTGKLIFGQGTTLQVKPDIQNPDPAVYQLRDSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR alpha chain,Human nkt tcr alpha chain
publication title Crystal structure of TCR PF8 in complex with flu MP(58-66) epitope presented by HLA-A2
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 196
sequence length 199
chains with identical sequence F, G, P
ec nomenclature
pdb deposition date 2015-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e6iA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e6iA02
3SDAB 1AY1L 5JHDA 4AM0B 4WFHE 4NDMB 1QSFD 3IVKB 4YUEH 2DLHA 1XCQB 1A1MA 3W39A 2FZ3B 4XVTH 2IALA 5I8KH 5BV7H 3WXWH 2HT4C 3TT3L 5C08B 2NX5B 4FOMA 4NNPH 4NBZB 4XPFH 3ZE2F 5JXED 3DECA 4HJ0C 4WUUE 2EDQA 4NSKA 4I48B 4U4BA 4CMHC 8CGTA 4NN5C 3V7AG 3HRZB 1JZ5A 3I2CL 1HSBB 1QNZL 2H1PH 5KSBE 3D3VD 3KYNB 1J12A 1U0QA 5IMKA 5GZND 4JO2L 4MX7B 3QULB 3QCVH 3TBYA 5KSBA 1AO7D 5D6DC 5FYKU 3PXHA 4M7KH 3IKCB 4LSTH 1RJCA 3BKYH 2GSGA 2VXUL 1Y0LB 1L9MA 5DJDA 5EBGA 3S7GA 3SGEH 1IE5A 2VLLA 1I9IH 1IVLA 4GH7B 4LKXA 2DDQL 4OF7A 2UVFA 3RY4A 5C2BL 1PQZB 3S4SB 1CK0H 1N59B 1D9KB 1LK3H 1MFDH 4MD5A 3LDBB 4YFLF 1JIBA 3ARFD 2Z31B 2JJSC 3DO7B 1PSKH 5LWYL 2JB5L 2HH0L 5DVLA 1H15A 3ZKXC 1K4CB 1TETH 3JV4B 4U1HA 1I3VA 3G6JE 2C1OB 2R2CA 5F1KC 4E41A 1KTKE 3FN3A 2HJFB 3IJSB 4PJCB 1OVZA 2ICWB 1HCFX 4HWZB 4Y1AB 1ZSDB 5JW4R 3QDMB 1IGFL 4HG4J 5HYQA 2XFXB 1T7XA 1UWGH 3H9SB 2DQHH 3UO1H 1WFOA 3RVUD 3GRWA 2NY0D 4PP2B 1ZK9A 4K9EC 3LN9A 3UROR 1AGBB 5L7XH 1FYTE 1G9MH 3Q0HA 1WTGT 3ULSA 5E00A 1Z9MA 4HGWB 4OT1H 5CGTA 1KBGH 1PY4A 3NAAH 1EMTH 1JRHH 5DK0B 4YDIH 5ID1B 2J6EA 2W65A 3B2VL 4JFDB 1HYSC 4PJGE 1FCCA 3LRGA 4M6NH 4Y5VC 1F8TL 1KCSL 2HJLB 3DV6B 3C5ZD 2XXCB 3QCTH 2A1WH 4OQ1A 4TUJB 1S7TB 3A6CL 3E2HB 2ADIB 3MACL 3MV8B 2RJMA 3VH8A 2R29H 1R3IL 3EYUH 4MB3A 1E27B 3HR5B 3BPCB 5FIEA 1FG2A 3SPVB 3GI9H 2IFFL 4PJ5A 4YHLH 4WHYG 4NKMB 4WDIA 3OKMA 2CK0H 4HK0A 5T1MB 3MREB 5KVGL 5IV2B 2V9QA 3BMVA 2Q8BH 3EYOA 4PJIE 1QRKA 1HE7A 3O4LE 4G9DB 4GO6B 4ZXBC 1FJ1B 4NYLA 4QT5A 4LRIA 3RBSA 3RIFK 4UOW0 1DANT 3VGAC 3SDDD 3VRLF 5CEXB 4PJIA 1HEZA 3U9PL 5C9JA 3QI9B 1JV5A 3O2VL 1UG9A 1R3JA 2WWKT 3O6KL 1T0PB 5BJTB 1UT9A 5JNYA 1MCCA 1TJHL 1BVZA 2HRPL 2R1YA 4OM0H 5E8OB 5JDSB 4DW2L 1RUPH 4X5WA 1MJUL 4FZ8H 3PWLB 3AS3A 1EEUA 2IADB 4QRPA 5HYSG 4QTIH 4U1JB 3DXAB 4NPYB 3UPRA 1N8ZB 4WRLA 2HT2D 2WBKA 1KB9K 3BGMA 1G7HB 4NOBA 1MVUA 3GJEA 3CFJB 5AAWA 5D96B 5A2LH 4Y5YA 4Y4HD 1OLZA 2IQ9L 5HDBE 3NTCH 4ERSH 2BVPA 3RDTD 1SM3H 4MD4A 3NACH 4JPIA 3FMGH 3IGAB 3MGOA 1G0XA 3DYOA 4GG6E 1EUUA 3L5IA 3VWKC 5HHQA 2PXYB 2W9DH 4LCCB 3UBXA 2DLGA 3LS4L 1UA6H 5E6IC 2VABB 3G6AA 1JE6A 4JY4A 4WV1A 2AJVL 3R8BB 3UTQB 2VDLH 4AJ0A 3MBED 1KT2B 5CUSL 5HHOA 1LP9F 1JYNA 5FCSH 2QSCH 5DLMH 3LRSA 4FQ1L 2ED7A 4HC1H 1ZLSL 1X5YA 5GRUH 1UH4A 3MRIA 2R0KL 4FHBD 5ERWA 1AGEA 1DLHB 4LARL 3MCG1 2ATKB 3QQ3A 1ZVSA 4PJ9D 5MP6L 4XI5D 1U8QB 4PY8J 5EU6A 2WBJD 4XP1L 3T0EE 3SKOA 3SO3B 1HOCA 4L9DA 4U2YA 3WLBB 3EFFA 4EI5A 3H3BC 3PWPA 1MIEL 3D85D 4P4KC 4Q97A 2JJVA 4UNTA 5DC4B 3BZFA 3OKNA 1RZKC 4ONOA 3GMMA 3OWEA 2E27L 3QWOB 2XTLA 2APWA 2YPLB 3GSOB 1Z5LA 2BHZA 3OF6D 4XMKL 2BDNL 4M1GH 1NCCL 4KRPB 4NT6B 4DWHA 1HNFA 1G1CA 5J0BA 3BOVA 2IH3A 4PGBA 5CAYB 3VGDA 4PR5A 2FLRT 3X17A 5D1ZD 4NKIH 4BQ9A 2FECI 2AXGA 4N8VB 5HHPA 1HHHA 3C2AH 4QOKD 5DMIL 3VXRE 5L2KA 5J11C 3HAEH 3BP5A 5IG7B 4J4PC 1J10A 2DQJL 3ALXA 2X4OA 1A7PH 4MB4A 5LGKA 2DIBA 3D48R 3FL7A 5JIHA 5DF0A 1ZANH 5C0CD 1JTTA 4M62L 2VLRD 1OW0C 3GNMH 2V2XB 1QEWB 2VDML 3HZYB 4LGRB 4NQXA 2OM5A 2NLJB 2ESVD 2UWEF 5GGSB 5DZNA 4OBSA 4JFHE 1N64L 2NXYD 2FD6H 4PV9B 3QEGL 1FORH 3RTQB 3QIWA 1CE1L 3WN5B 4U6XB 1VADB 1UKQA 2J88H 1WIOA 3SQOL 1NEZB 3BKCH 4U0QB 3EOTL 5B38G 3UTSB 3BP7B 3DX6B 1KJ3L 1FNEA 4PJ7B 3LN4A 5BRZB 4WENB 5FUOH 4UDTA 2DM4A 4NFBA 5IFJA 3DVNA 1QP1A 1K8DB 2NPLX 4HIHA 5E4IA 1YJDC 3GO1L 1KYOJ 4R9HA 1FVDA 4OTXH 5E24E 3I6LD 4U6TA 5FYJL 1M6OA 2NW2A 4Q9CA 4F58L 5EUOF 1C5DB 3ARSA 3HE7C 4BH7A 3BPNB 4UBDD 3QIBB 2ENYA 1XF4B 1H0DB 1FCGA 2W0KA 4PJ8B 1CFVH 5D7LB 2WQRA 2DB8A 4EN3B 3SE4A 2AEQL 3VG0H 4ODUB 3QEHB 1CFTA 5IB5B 3K74B 4G42A 1AGCB 2EECA 1I8MB 1PKQA 5KVFH 5JQ6H 4KUCD 3DRTB 1NLBH 3GSXA 4JM2F 5C07E 1HILB 5A3IC 3VXNB 4AEIL 4UINL 3ZYIA 5I1DB 2QSQA 2A9NL 4DUXA 2YUXA 4ZSOB 2FNBA 3O3BB 4NQCB 5DVNA 3GFUA 4M7ZB 5CD3B 1H3UA 2R2BB 4XAKE 3MCKA 1QFWM 2NX5D 4RISH 4PG2C 4IRJC 2FSEA 2OJEB 3O3AA 5K9KB 5KW9H 3MRPA 3CMGA 5DHYB 5DQ9B 5B3NA 4F15C 2YPKA 1R5IB 4N0UB 1LILA 4TVSa 4DKDC 1GOHA 3PL6A 3ZTNL 2P5EB 4A6YL 1GHFL 5EU4A 1BQLL 4LLVB 5JHLH 3O3DB 2R8SL 43CAB 1JNJA 4XP4H 5CSGA 1H3TA 3I02B 2BVUA 5I16A 4GMSH 4LLWA 1RFDL 5HYJA 4MMZC 4L8SC 1KLFA 4QYOB 1IC7H 5F6IB 4X6CE 4H0IA 5D1QC 5LGHL 3TVMC 3OPZL 4EIGB 5CEZD 1LD9A 4GW4A 3LKSB 4X6CA 4BQ6A 2VIRA 1IAMA 4BFBD 5DURD 1UB6B 4OZHE 1I4FB 3KLHD 3INUL 1EHXA 4Y2DA 1CU4H 2XG4A 3PWNB 3FB7B 5D7IE 4DOHB 1OSZB 1IEHA 2Z31D 3TA3A 3O8XA 4TVPH 4TVPE 4DUWA 4F7EB 2XQYG 5HBBA 5I73B 2OP4L 3U4AA 3DOSA 4HUVA 2X42A 5C6PB 4Q6IA 2ENSA 1NGXB 3LIZL 5D7IA 5HI3C 1W0VA 1S9VA 1F6AB 3GSQB 3ARDA 3SDCA 4XTRD 3SCMB 1OB1A 2YS4A 4C55A 3SY0A 5FA4A 4ZUWA 3L5WA 3EAKA 2VDQL 2J8UB 1JPFB 2EEAA 3D39D 5DI8A 3IDGB 4DGYL 2GK0A 1X5JA 4PB9H 3CFDA 1XGYL 2OTUB 2X2YA 3WIIL 4MXWH 3Q48A 4HXAH 2UY7A 4LQFL 4ZUVB 3WKML 4XBEH 2HMIC 4QTHA 3P11H 4F7PA 1I85C 3UYRH 1MCLA 3O6FC 3HPLB 1XGUB 1D5ZB 5IT2L 5IWLC 4OI7A 3LHPL 3NH7H 4RGOH 1UM5L 1EZVX 1IC4H 4CDGC 4HIJB 5L8LB 4E0RB 2VUOA 1FGNH 4JO1H 3QUXD 2O5XL 2VR5A 4KJQC 3GIVB 4N68A 4X99B 2DQCH 5D7KE 2FGZA 2XWJA 5KSBF 4BZ2L 3LKQB 3PGDA 4P48A 4QHLA 1DE4B 3X13B 1UKTA 4QCIA 3EYFA 1XR8A 4UV4L 3DJ9A 2EE9A 2ZPKH 5F1IA 3EIFA 2IGFL 5GGRY 5DT1H 2PW1A 2Y6SC 2BNUA 2YBRB 1DN0A 4P2RE 1BBDH 1G7LB 1ACZA 3I50H 4X4YB 1QLRA 2X4SB 1C16A 5IB2A 2F5AH 5BMFH 1D6VL 5DRWA 2VDNH 2BXYA 2X4UB 3QI9D 4GAGH 4I3SH 4P2RA 5JTWA 2H32H 1KULA 4XPHL 3PXJA 4L5FL 4LCWE 5FGRA 1RVFL 4KHXH 5F89B 4U6YB 5DS8A 5FO7A 2OX5A 3AREB 2VXSL 1PEZA 5IMOA 4UQ3B 5IQ9A 3TFKC 2QJDA 3V5KB 5LQBL 5C0FA 5MERA 1H3PL 4WO4A 1V7NH 4DFHA 1Z3GL 3SKMA 3I6KA 5HYSB 5IFHH 1R5VB 4QHUB 3ULUH 3ULUE 4NO0A 1U3HA 5E9DE 1GGTA 3ZE0E 1J8KA 4HS3B 1WLHA 2CO7B 5T3ZD 2F53A 5D71L 2GFBB 3IFLH 1D5IL 2I60L 4W70A 5I9QB 1EDQA 3P0VH 3DX9A 4Y4FC 4JRYD 1A3QA 2JJUA 4HUMB 4KKAC 4H1LA 4Z0XB 3IAQA 5BZDA 1AKJA 5C8JB 1MCNA 4BK5A 3GEWB 2PXYD 3GSRB 1TITA 4NN6B 1U8NB 2BHYA 4OAWB 5FCUH 1PFCA 3BSZH 2FEDD 2Y07H 4PUBL 3FT4A 3O3EA 4BELD 3OGCA 3BP6B 3MRRA 3FRUA 4OV5B 5JIKA 3WIFB 3RKDD 5HHXH 4MNQA 1DBML 4OFVA 4G9FD 4NZTL 4RGNB 3CAFA 3FQUA 4M3JA 2APTA 4I77L 3RY5A 5TGBA 1A7QH 3CVHL 4L3CA 1AE6L 2NZ9D 3M17A 3HE6A 5AZEH 3ET9F 4KTDL 1M7IB 4ZFFA 2UZIL 3DPBA 4OLZH 3QFJD 4DVBA 4C56B 4ZUUA 2DQEH 1ZA6A 1EZVY 1H8OA 4G5ZH 1MEXH 4NQEA 5BS0B 1G9MC 4XVJH 4MDJB 3V5DA 1YDPA 4KRPD 5CGYC 1C5BL 4PLJD 1C08B 4X7FC 1FPTL 3HMXH 4KK8D 1INQB 4GRWH 4WFFE 2XA8H 1ZHKA 4GW1B 4L8BB 3BRDA 5IROC 3QFDA 5IB3B 4HX1B 5DJ6B 4A6YA 5DD6A 3ROOA 1IL1B 3W9DB 3MXWL 1MUJB 4GG8A 4L3EE 1CFNB 5EN2A 1LE5B 3SO5A 4UUJA 4TTDC 3O2DH 1RULL 3P73B 4K8RH 4I3RH 2H2PD 4XC1L 3P0YL 2G5BA 4JPKL 4ONGH 5TJWK 1A2YB 3CUPA 5TF1H 2YSSA 1FE8H 3BN3B 4LRIC 5I1CL 4IMKA 4FG6D 2F5BH 3FFCE 1DQQA 4WNQA 4XPTL 4X4XA 2XY2A 2NTSP 1Q9KB 4OSUH 4HUXB 4OZ4B 3GDBA 1LDPL 3RTQD 3VXOB 2LVCA 4LLDA 5FOJA 3PIQA 2FX9H 5I0ZA 4Z95L 3Q6FA 4APQD 4NN7C 3EHBC 4NWTL 1BWWA 2UY6A 3EOBB 4WU7A 3QEQB 1DBJL 4ELKB 5B38B 3RGVB 1LEKA 5IMMB 4DN4H 5JORA 4KUZL 3GB7B 3BE1H 4RCAA 5E2JA 4PG9B 1J0HA 3BZEA 1UADC 4JKKA 1JUFA 4ZODA 1D5MB 1UZ8B 1YMME 3VWJA 3KPMA 3X12B 3IXTB 3GK8L 4EKXA 2I25N 5E0QA 3VFUA 1BM3L 3MNWB 2W9EL 3QIBD 1WQVT 4N5EC 4PJ8D 3OQ3B 1F4XL 4CADA 3PP4H 1WAAE 3OKEB 5E8NA 1HI6A 1RZJH 2GI7A 1AXSA 2ZUYA 1DBBH 5HHMB 3QHFH 3MGTA 4WEUD 5ETUA 3VDCA 2P8PA 2P44B 4XNMB 5I8OL 1CICB 1HQ4B 2XRAH 4FTVD 1I3UA 1KB9J 5D72L 3D25A 3IDIB 4QHNA 1F45A 4RNRA 2VZSA 3D5OF 1TQCC 3WFEH 3RL1B 4LSQH 2RFXB 3PJSA 1JWMB 1B0RA 3V79C 5F1NB 3TCXA 4NQDE 3MV7B 4PJXB 4OD1H 4MXVF 2D3VA 3SKNB 3VFMA 2NY5H 1CGUA 3FT2B 3WD5L 5EZJA 2P8LA 4NQCD 5D70L 2NR6C 3ECBA 3TH3T 1OP5H 2AJUH 4NGHL 3OKLB 4W68A 5E5MB 8FABB 4KDTA 3T0EC 4Y19A 1V7ML 3LOWA 2Y5TA 3WMSA 2CDEB 3BPOB 3NCMA 4F9PC 2D0HA 1RZ8B 3T2NL 2VQ1A 1A47A 2Y5EA 3MODH 4U33A 4YK4C 3LB6D 1QHPA 4MNGB 1H9VA 5TE4L 5E8DL 4OM1L 3T65B 3N85H 1GC1L 3W9EB 5HYFA 3HUJE 3TWCL 3QNXB 2CJUH 2OBGA 3D2UA 1PZ5B 4HLZH 3B8YA 1EO8L 1MWAH 4QRTB 5FYLD 2HFTA 1MRFH 3C60D 2OTWB 4KGJA 3LKRB 2QHLA 3QCUH 4HWBL 3SJVA 1S7WA 3FOLB 3FQXB 1R3KB 2HVKA 4KAQL 5FHBL 3TGXA 5FM4A 7CGTA 4NNYA 3MLUH 1V5JA 1ETZA 4PJHA 4UT6L 3MTRA 5DUMH 4E42B 5F9DC 3MPCA 1KN4L 1YN6A 1CFQB 4JAMB 2XWBA 3WFCL 1CBVL 2CUMA 1XFPA 3QIWC 4LDLB 2QQNL 2WNGA 3ARVA 2NTFB 2BK8A 2NXZD 1NGPH 3VA2C 4CDHA 3K8MA 2GJ6B 1XAUA 4WTZA 4Y8DC 1QO3B 1FGVH 3QCVL 2Q6WB 3IFOB 1EPFA 5DHVB 4AEHH 4ZFZB 4RBPK 2LU7A 4F37F 5EBWB 2JB6A 3HFML 2NY1D 2XZCH 2XN9A 4G6MH 3BKYL 1S7RB 4NZUH 5DD5L 1S5HB 1CFSB 1BQUA 2F8OA 1T5XA 1CDHA 2FJGA 3OX8A 3ZE1E 4YX2L 3KNBB 1VSCA 3ELAT 4MDIB 3L5XL 3CVHA 3OR7B 3RPKA 5F97E 1JVKA 2QLVB 1MAML 1AC6A 3ARZA 1R0AH 3CFEB 4Y16A 1PLGL 3SE4C 2IJ0C 4RWHA 2HLFD 3L3OB 1MFEH 3P4NB 2CPCA 4R4FH 4WHCA 3OV6A 3BH9A 1TETL 3WNOA 4AL8H 3PHSA 5DWUL 4MCYA 3U2SA 1EHAA 2RQ8A 4HJGA 4UILH 4WEBL 2X1PA 4MQ7A 5AAMA 1WGOA 5IJKA 2FHCA 3MV9B 1SYVA 3QUML 3IDMA 3H42H 4BYHA 2Z4QA 3WDJA 1X5GA 1ZHLB 3PHQB 4MWFB 4FABH 3WHXB 4NKDA 5ENWA 4QO1A 4K2UH 1OTSC 4ELMB 4X6CF 4N1HB 1P5UA 1B6DA 2ZKHL 5ACZB 2XKNA 3QO0A 2A83A 2XPGA 3LSOB 1WBXA 4QNPE 3MA7B 4KJYB 3AY4C 4ZAKD 1VHPA 1YYLL 5GS0H 5MEOA 3X3GL 3GJFK 4LEXL 2FWOA 2YOCA 2EDFA 2EIEA 1JRHL 1G6RL 3RZCA 1AD9B 2LFGA 2KZWA 4KZEH 2DL9A 4HWEL 4MSWB 5ITFA 5M95B 1OP9A 5D7IF 3P4OB 3PL6C 4RIRA 3TIEA 2EIBA 4BKLB 3D9AL 4WHDA 1VDGA 1FQ9C 1ZEAL 1OY3B 5DUPL 1A4KB 3OXRB 5KSUA 3TZVA 4NQUA 4NP4H 2EDNA 3U4EA 3V7MA 4KI5E 5SV4A 3UTZB 1U8PB 4YO0B 3CDGB 1QLFB 3T4AA 2CMRH 1KEML 1QG3A 4NJAH 4Z0BL 3C9NA 3P0GB 1NMBH 1VEMA 5E2TL 4ZNEE 2X40A 4B41A 4GOSA 2V17H 5D93C 3IJYB 5F96L 1N4XL 4D9QE 5IESH 4HKXA 1FZKA 3JVGC 1J8HB 5I2IB 3T3PE 3ARTA 2X7LB 4NZRH 4S1SH 1LO0L 1GZPB 3QBTB 5DFVC 4YPGA 3KPQA 3VXUE 1K2DB 4JKLA 1BBJA 4P5MB 3TA3C 3AM8A 3DVGA 3O8XC 4PRIA 1XF5A 5I66B 3FTGB 4O4YL 1D6EA 1G7MA 2MMXA 3UZEA 4Y5XA 3VXSA 1FHGA 3OKDB 3ARDC 3L7EA 4R90L 3MLWH 3SDCC 3DHJA 3O9WB 2XNAB 2P45B 2YD7A 2SEBA 4X8XA 3MR9A 1K6QL 3T2OA 43C9A 3CPLA 4OQTH 3EYQC 5F3HB 4BQ8A 4DEPC 1KJVA 4TSCL 1WFNA 3MRNA 1ZHNB 4CMMA 1QR1B 3WDIA 2YXMA 5IKCB 4GBXD 4HZLB 4LPYA 4JRXE 2O61B 3HG1D 1WBYA 5F88A 5A2IH 3WO3B 3KLAB 3D1MC 5GGRB 1NUDA 1H8SA 1MCRA 5INCB 1T5WA 3MBXL 4K71C 4LPVA 5DUBA 3G08B 4JRXA 3SGEI 1AIFA 4ZUTB 5IVNA 1VGKB 4ERSL 2VITB 4FQ2L 4MYWB 1F58H 5C0RH 3EO1B 3TT1H 3VI3E 1K8IB 4OLEA 4JZNA 2QTEA 1YNKH 2M8XA 2DBLL 4X0KA 3SGJA 2F58L 4WIQA 3VRJA 3EKCA 1IZKA 1FNAA 1J86A 5I30H 3EDFA 5IFAH 2QHRH 3MNVB 3QDME 4OCYL 4G8EB 4TOYL 5I1IL 2OR9L 5GGUB 3UTPE 3AB0B 5EOTA 2DLFL 2W92A 5EO9B 3ZL4L 4K7FA 1MIML 3QDGB 4H8WH 4JFQB 4PRNB 2IANE 1TXKA 5C09D 4IEFB 5K9JH 2DWDA 5MEQA 1AD0B 5KVEH 2LABA 1EAPB 4JFDE 1EJOL 2IANA 4G80A 2WIIB 3W0WE 1JWSA 4AG4H 5CZVL 2BRRL 3C5JB 3G04B 3LN5B 3RHWF 4H20H 1JRHI 2GK2A 4HJJH 1ZXQA 1K4DA 2ARJA 3MV8E 3DSFL 1EEZB 1KPUA 2VLJD 1G7IA 5DTFA 5EH1A 2C3WA 2I9TB 4YGVA 1FFOA 1HHIA 2CKBL 3TBSA 4HPOH 3S37X 3L1OH 4JHZA 1MHPL 1CDYA 1A3RH 3FKUS 4LAQH 3GSUA 5DYOB 1L7TH 3GIZH 2X44D 3IDXL 2MTPA 1OPGL 1P7KA 3T0WA 1ADQL 3TESA 2WW8A 2YD2A 5DGQA 1LHZA 4MVBC 1NGYB 3ZDYF 1KFAL 3RNQB 3ULUC 1AH1A 2EXWD 3DX8B 2DRUA 2DTSA 4HK3N 1YEIH 1UVQA 1F3JB 3VFTA 2VLME 1MHEA 1I7RB 5MEPB 1RURH 2XTJE 4QRUB 1KJMA 1YPZA 2ATPA 1YYMH 1CICD 1T66D 1KEGL 1N3NB 2GKIA 3QQ9C 5ITBL 3B9VA 2X9WA 1U95B 1RK1A 2XWTA 5GS2H 5L9DL 3C5SA 1Y18B 3RAJL 4ODWA 3WUWA 3JWDH 5DRNA 4PRHB 5DK2B 3RUGA 2ICWJ 3U82B 4J8RB 1DFBH 3ULVD 4ALAH 5C0AD 5FO8B 1JL8A 1KXQE 4U0RB 3DETD 2L4OA 5IIEA 4RQQB 4PRDB 3D69B 3QUMA 1BGXL 4MA8L 3HE6C 4Z7UA 2C26A 4U1KB 3LMJH 4XHQA 4UIKH 3FQTB 4D9RE 3TPKA 1OAKL 3FO1A 2JF1A 2J1KA 3OSKA 1I8IB 4N0FB 2FL5B 4Z78A 1QSEA 4CVXA 1RIHH 2HJKA 3BH8B 3MJ9H 2VE6B 4EUPA 3NABL 3NCJH 3DMMD 1R5WA 3G5ZB 4OFDA 4LVOB 3J8F7 1OCWH 1XF1A 2CD0A 4OZFA 3DUSB 1INEL 4I0PD 5I6XB 2PYED 3EO0B 1A1NB 2DKSA 3C6LB 2DI8A 4MJ5A 5CD5C 1J1PH 5CINL 1IAIH 2YR3A 1EVUA 1T1XA 2ITCA 3VA6A 4I4WA 4FQQA 1F6LL 5E99H 1P9MA 2K7PA 1GXEA 1DP0A 4JQIL 1PEWA 3FZUC 3PWVB 4XRCA 4WWKA 4L4TD 1MCDA 3AC0A 2H9GB 4LSPH 2X4QB 4JKMA 2XY1A 3VDAA 4K8RC 4CMHB 2ICES 3PNWA 2YPLE 1U92B 4L4VB 4NN5B 4C4KT 4QWWC 4U6HB 1IC1A 5FK9A 3R0NA 1QFHA 3QDJB 2BP3A 4DVRL 4RAUB 4RRPG 5DD3L 1QLEL 3MROA 5GRZA 2VSDA 2H8PB 1NDMA 5FV1L 2GJ6D 4UT9H 4KMTH 1TIUA 3QAZB 4ODBD 4Z9KB 5LBSL 3CFIC 2AEWA 2AJXH 1EGJH 5CS7A 1E4JA 2O26U 3L3HA 4HQQL 1H3WM 5CJQL 4P23C 5FFLA 5JW5A 3X11B 4FFWD 5GSVB 1EGJA 3P9LB 4PRPD 2ZSWA 3OHXB 4UV7L 3E6FA 4TNWF 5T1LB 1PBYA 2VISA 4LPXA 4GT7A 1ES0B 3PGFH 1LWRA 4FFYH 1UM4H 4M48H 3ZKXB 4HUWB 4XCYA 4NC1E 5TF0A 1YEEH 4QXTB 3MRDB 1JF6A 3NN8B 1FNSL 4NM4L 3UTOA 1NL0L 5T3XH 5T3XE 3LKOA 3UTSE 1VFMA 5DA0B 2FBJH 1RZJC 3DV4B 4X6DA 3NOIA 3DO3A 4DQOL 1KNOA 3E6HA 5TDNA 3ZDXF 1YEHH 1NC4D 1XGQA 3QUZA 1SEBA 4OIIH 3HI1A 1Z9LA 5FAAA 3KPPB 3VGGA 4JY6B 4N90E 5D2LB 4LCYA 2EDTA 3ARXA 4FNLH 3IU4H 3LPFA 3EFDL 4FRWA 5GGQL 5I1EL 2EDHA 2NY3B 3KYAA 1DDHA 3BAEL 5BQ7B 2J7LA 4PJHF 1GIGL 2NY5C 2VXTL 1JYVA 4F7MB 3IU3B 4KDTC 5DJ8B 1HWGB 2AEPL 4Y5VB 1OTUC 1XF3B 1SY6L 2EIDA 4M6AA 4DGVH 1AGFB 1GH7A 4RBPH 4PTTB 3N1GC 2ZUWA 2DYPB 5IJVA 2A74A 5E94B 4UMGA 4Z7QE 4Y4KD 1JPSL 1RUAL 1X5FA 3WS6A 1NAML 4QF1A 3L3GA 1SJEB 3PWUA 2XQYK 4EJ1C 1UJ3C 1XGTA 1UH2A 1FBIH 2WINA 3PDOB 4JDTL 4F9LA 1J0YA 1HKFA 4O9HL 1FNGB 4Z7NE 4IDJL 3OAUH 2CKBA 2R69L 4KKCD 3GM8A 5AYQA 4KY1H 3ARGA 1JWUA 3VGAB 3JWNC 1S7QB 4DKEH 3BHBB 3FN0L 3U7WH 3OG4B 3RWDB 5KOVC 2LVEA 2YA1A 3IDNA 4PFEA 5C0EB 1ADQA 4I3SL 3V0WL 3VFSA 3V7AE 3O45A 4AH2B 4BFIB 1L7IL 2P5EE 1L4IA 1FVCA 1T7WA 3VXQA 2AK1L 1A4JB 1PKOA 1MQ8A 3A67H 2EYSB 3W2DL 3I6GA 5GRWA 3N0PB 1KIQB 3ZZ1A 4D0DA 5FUZL 3NZ8B 4M7JH 5EB9A 3O9WD 5FDYA 5DJCB 3IETA 1MNUH 1FZJA 2A73A 3GMRB 4XC3H 1MH5A 2Q76A 1EFXB 1T1WB 3GJFH 4MJID 3L9RA 4H5SB 1OAQH 1N5YL 4XCFL 2QSVA 1J0JA 5CCKH 3AVEA 1CLCA 4YFDB 5F72S 1HZHH 4HT1L 1C5CH 1PX3A 4QHMA 2P4AB 2VDRH 1E28A 2OS7A 3FOMA 1ACYL 4DOHE 3V8CA 4NHUA 5HI4C 3NA4A 1UGNA 1KLGB 3GSNL 3QUYA 3PQYD 1RJYB 2AJZB 5I8EA 3BUYA 4MNHA 3V4PH 3UDWA 1OGAA 5T1KA 2VDOL 4WUKH 2MCPL 1CTNA 2CSPA 1MCJA 4JPWL 3OB0K 4K3JH 1B4JH 2Y07L 3BDXA 2F74B 4HKJA 4WI7A 4J3XA 4PGEB 5IJKC 4FFVD 1FZMB 4J3OC 3K8KA 3SQBA 4NO3A 5ILTH 1MCSA 2YZ8A 4EXKA 1WWWX 2WSKA 4HHAA 4P5TA 4KPHL 4KI5F 1A7QL 4ZYKB 4PJBA 4V1DB 1QRNE 4GKNB 4P4KB 5JW3H 1S8DA 3DIFA 3MMEB 2ADJB 3S6CA 1U93A 4JB9L 2PO6C 1RMFL 4MAYD 4FQXD 3HB3D 4QRRB 3RWJA 4XNZC 3RZCC 4JRWA 2ZCLH 5HGAB 4ISVA 4POZD 3BYTA 3RFZC 3BMWA 4JFFE 3VD3A 1UKSA 4D0CB 2NY4C 4TRPL 3X14B 1A7NL 2HN7A 5EA0H 3VH8G 3TJHC 1CD1A 2AJ3A 2KQMA 5CEYA 4FXLA 4NC2B 5CLWA 2ED8A 2BNRB 1JPGB 5LGJB 4JFFA 2EZ0C 3LH2H 2YD1A 4WHYH 2H45A 5J11B 2EYTA 4NRYB 5D7SL 1DVFD 1SJHB 3GI8L 3LEXB 2Z0BA 5GRXG 1OTTD 4ZS6D 4GUPA 4HULB 1IC5H 1IGTA 2BC4A 4KI5C 2DJ4A 2XKSA 4OCMC 3L95A 3WJJA 2GSIA 1YEGH 5FKPB 4MA3A 4NO5B 3JTTA 1UQSA 1DQJA 1A6UH 5ISZE 5C70A 4GRLD 2F54E 1JBJA 4OB5H 1XIWD 5EIVA 2R2HB 3NA9H 4R6UA 3S36L 4LFHD 2ICCA 5ISZA 4MD0B 5BO1H 1X4XA 2F54A 2Q7YA 4LCUA 3GGWB 2X6MA 3VI3F 3HNSH 4N9GB 1INDH 3CSYA 4PV8B 4X7SH 4LSRH 3WS3A 2HFEA 3DI3B 1WZLA 2BJMH 3TC9A 2IBBA 1VFAB 5HJ3B 1J1OH 4M4PA 1RUKH 2NY6B 1IAOB 4G8GB 3X3FH 5DJXB 3H9ZA 4PGZA 4PJDB 3HE7B 4HGMA 2IAMD 2X4RB 5GGVH 1YEDA 2BNQE 3WLWC 2E9BA 4G43B 3E8UL 1MELA 4UAOB 4H25A 2O5ZH 1LEIA 2D9QB 4WFED 5BW7A 3QXDB 5F8RC 4UB0H 4PJAA 2AV1B 2UWEB 4OZIE 3HNVH 1NCWH 5A16A 1NFKA 4WW1A 3U4BL 1D9KC 3AU1A 3G9VA 2A0LC 4I2XB 3B9KA 5HYEA 3ZT5A 2QL1A 1G9EA 4P2QE 1OQOA 1WSST 3SGJC 1K9TA 1HKLL 1SY6A 4RGNE 5A40E 4YXHL 3UC0L 5IB4B 2G60H 3LEVH 3ES6B 3WV0A 1P4IL 5IW1A 32C2B 4LRNL 4LLYB 4IRSA 3KXFE 2OSLB 4PGDB 1NAMA 2HT4D 4WI8A 4OGYL 3K1KC 3HI5L 3H9HB 5F7DB 1MQKH 4Z7VA 5EUOB 4IRJB 1I1AA 5SWSB 3O4OC 3SE8L 3EGSA 4C56E 4QXGH 4MHHG 3B9AA 1BAFL 4WY7H 2APXA 1O5DT 3V52L 4XPBH 3HI6L 2AK4E 4JQXC 1FAIH 1I9EA 4F15B 4JFYA 4H8WC 1YPZF 5FOBA 1NBVL 5GGTH 3QDJD 4YBQC 3RVTD 5SWZA 3C8KA 3SDXA 5DC9B 5FKAB 1DQLH 2AK4A 5C0BD 1RK0B 5F6HJ 1FFNA 5B22A 2BSTB 2OQJB 3BD4A 3QUKA 3FCTB 4L8SB 4GXUM 3RUGF 4XHJD 1Q38A 1KB5L 4YDKL 4JM2B 4DCQB 4GAJL 3GHEL 4IOIB 2Z8RA 4P49A 4MXQD 5D1QB 3BP4B 3E2HC 3TVMB 3TJEL 1KG0A 5ICYA 5F3BA 4NZDA 2DICA 2XA3A 4L8CA 1QSFE 2A6KB 1B88A 4Z7UF 1ONQB 1VPOH 4FQJH 2AERT 4YFEA 2HTLC 1RQ5A 2JIXB 1NKRA 4OCWL 1QBLL 4F8QA 1FVEA 1OL0A 1QSFA 4PJEA 3UPCA 5I19H 1NGQH 1PG7H 3V4VH 1W72H 1NGZB 4JG1H 1S3KH 2ZJSL 4HXBH 1W0WA 3PDDA 2YD9A 4YWGL 3NZHH 2NW3B 3MRFB 4OLXL 5DVMA 4BSWA 4IDLA 5JXEA 3LS5L 3GSNA 3D3VE 3NIDE 4YIQA 2VLKB 3LKNB 2GTWB 3FQNB 2XTJC 3FQWB 2WUCH 1CGWA 3WE6B 2PW2A 3LEYL 4K55A 4NO2A 1Y6KR 1AO7E 3D3VA 1HXYB 2V7HA 4PJFB 5GIRB 1OF2A 3WFBH 1T3FB 5C0NC 3JWDC 1IZJA 1AO7A 4J1UB 4KHTH 1I8LA 1VA9A 3CFCH 3CVIH 5GS1A 2C3GA 4XNUH 3CFKA 3VRIA 2FHBA 2IPUG 1BEYL 4FQLL 3O6FB 1JGUL 2PN5A 2BFVH 4U1NA 5D96C 3WNKA 1HYSD 4ZD3H 1MHCB 4UIMB 5HHME 1I3GH 4JZJA 3OKOA 3LV3B 4MJ6B 3U46A 4JKPL 4XBPA 5AWNL 4WU5A 4Z76A 4LAJH 5IMLA 4MQXC 2DJUA 2UYLB 2G9HB 2YK1L 1S7VA 1A1OB 3ARFA 4KK5D 1OAXL 3RQ3A 4AMKL 2JJWA 2KDGA 1X5KA 2EDOA 5JHDB 1NAKH 4NWUL 2D9CA 5EU5A 1CGSL 2CDGB 3IJHA 2X1WL 3W39B 1JZ2A 4XGZA 4FZEL 2IALB 2I24N 4ZXBD 3EO9L 4ONHA 3KPSD 2FH6A 3OAYH 1NBZA 4J3TA 2R23A 5B3JF 2CR3A 1P69B 3DUUA 2VJXA 4P9HL 3SO3C 4DKFH 1U8JA 4NSKB 2VZTA 4FQCL 4M8VA 3UTTE 1AQKH 1IQWH 3MXVH 3RZWA 4WUUB 2OR8A 3BJLA 5JW4Q 4OCRH 2OJZH 4G6JH 4KKLC 4EQ2A 3KPNA 4HK3J 4TN9A 5IMKB 4X6DF 4JJHA 4M6ML 2QQQA 1Q0YH 3TBYB 5KSBB 1IM9B 3VD7A 1YC8A 4OFIA 4YHOH 3C5ZA 3HC0B 2PTTA 5KVDL 3UJTH 5ESAA 3QA3A 3KJ4C 5DJDB 2VLLB 1T22A 3NIGE 1T83A 3GKWL 5L88H 1YZZA 1I1YA 2WMPA 4Y4FB 1MJ7H 1U3YA 5ALCH 5FM5M 2YA0A 4MD5B 5JZ7C 4LF3A 5CMAA 3L7FA 3VWKD 1QACA 4UNVA 2CDFA 4JO4H 5E6ID 1H15B 4U1HB 5DA4A 3T1FA 4Y0GA 3SDDA 4E41B 4PS4L 2MCG1 5HDOA 3TF7C 3WN5C 3TO2B 4N0YH 4FXKA 3STLA 5DHVH 2HKHL 2Z8VC 4DAGL 2LU4A 4LIQH 3QUZC 5INDA 1E0OB 1P4BL 2CLZA 1NH6A 5IBLD 3W11C 2Z35A 1LO4H 1MJ8H 1CF8H 5H35B 1OAYH 3WL9A 5JIIA 2EO9A 1V05A 5E00B 1S5IL 1JGDA 1N6VA 1T03L 1IRAY 1X3DA 5FYKD 2W65B 1FYTB 3U0PA 4PLKC 4JR9L 1UACL 4Y4HA 2P46B 1AXTL 1RUQL 2A77L 2R9HC 1ITBB 4X9FA 5LCVL 3T1WA 4EN3C 1DR9A 2AJSL 2NYYD 1E6JL 3R1GL 5GRJL 4PJGB 3RDTA 4M43H 3VH8B 3MV9E 3JTSB 1V3LA 3ZDZE 3SDYH 2BOBB 3K4AA 4WI3A 2DTML 4BZ1L 3MLRL 1FG2B 4XP6L 4PJ5B 1AJ7H 4YAQA 2KUTA 3OKMB 3U79A 3MBEA 4ETYA 1M05B 4HK0B 4EI6A 5CP7A 4X80L 4J4PD 1U58B 1KB5A 3EYOB 5EORL 5GQBA 4KVNL 5T5FL 4NUJA 4NYLB 2BVOA 4LMQI 4ZDHA 4QT5B 3ARGC 3OB0H 1CLZL 1CXKA 4PJ9A 5F21B 1KIRB 1GSMA 1CD9B 4PJIB 3O4LB 5C9JB 3MC0A 2PYFA 4I8DA 2WBJA 1JV5B 3QO1B 1Z6JT 4XBGA 2CRYA 2N1KA 4LHUD 5JNYB 1MLCA 3D85A 3WFHA 4NN7B 1AC0A 4X5WB 2EDXA 3HLAB 3ZYZA 3QHTC 4LOUC 2ZCKL 4G6AD 4J3VA 2ICEA 3FB5B 1BIIA 4M1DL 4M7LL 3NGBC 3OF6A 4QRPB 4GSDL 5T33H 1S7SA 3VXTA 1I3RA 2R0WH 1U2HA 5ALBH 4HS8L 3V0AC 5C0IB 5JQHC 3BGMB 3QP3A 4JM4L 4RX4D 3LZFH 2H26B 2YUZA 4G8GD 1MVUB 4QOKE 3KR3L 1I7ZA 1CQYA 4PJBF 4EBQH 5FA3B 5HVWA 5D1ZA 4K23L 4LU5L 2YUWA 1A22B 1NSNH 2DJSA 4OCNC 4QOKA 4IIQC 4H1LG 2BVPB 5K9OA 4BZYA 3SKJL 4MD4B 3G5XB 5C0CE 5TFSH 3MRJA 3MGOB 5HGDB 2VLRE 4O58L 3ZKNC 3EDJA 5HHQB 3CDFA 3VW3L 3UBXB 3UDWC 5FO9A 3S34L 3G6AB 2YWYA 4JY4B 4MS8D 4EZMA 5BOPA 5C0CA 1RHFA 2W1NA 2VLRA 1JZ6A 5E08H 1L0QA 2XZQH 3LRSB 2ESVA 2D03H 3CLFL 4KQ3L 3F8UB 4AEEA 3L3JB 4O2EA 3MRIB 3VFWA 5ERWB 2QKIA 1AGEB 5KAQF 3SCMC 3QQ3B 1ZVSB 4HEPG 3GSWA 2VDPL 4XVUC 1AXIB 5SWQA 4PBXA 1EERB 1HOCB 5KN5B 2Y06H 1CR9H 5JOPD 5T3ZL 3EFFB 2P49B 3RWFA 3VFNA 2DMKA 5E1AA 5SWSD 3RVXD 5D5ME 2Q20A 2IPTH 3T0EB 2AGJH 2V5SA 4KZDL 3BZFB 3V95A 1Q72L 1HCVA 4HH9A 3GMMB 5E2VL 5HY9A 1Z5LB 2AKRA 3V0VA 4KGLA 4IMLA 4BSJA 2IH3B 4KMQA 3Q3GA 4PGBB 1X5AA 2Q3AA 4I1NB 3LAFA 4PR5B 1BZ9A 3QNYB 4JLRA 2ARWA 1A3LH 2DQTH 4TUKL 2MNUA 5DDHA 2AXGB 5D1QD 5HHPB 5TE7L 4OZGE 5GS3A 5IQ7H 5CP3H 5F9JA 2RCSH 3MV01 5I0DA 2ICWI 3NIFE 1WC7A 3BP5B 1LO3L 4JHAL 1BECA 2QV2A 1Q94B 4OZGA 3L3IB 2X4OB 4JQVC 1MCOL 5IEHA 2WIMA 2JIXD 1DQDH 3RRQA 4IHOA 2PR4H 3HAEB 2E6QA 1T21A 3G5VA 3QPQD 3MOBL 1XCQA 1MRDL 1PY9A 2B0SL 4NQXB 2FZ3A 4PJAF 3UYPA 5JXAH 3GMPA 1YEFL 1I1CA 3QIWB 2NX5A 1Q1JH 5IHZA 2YEZB 4F57H 5BVPL 1JHKH 1SJVA 2AABL 3L5HA 2VR9A 4O02L 1FNEB 1DEEA 3LN4B 5FGBC 5IFJB 3DVNB 4GJTB 3MLYL 3QSKB 3AREC 4J6RH 3HTLX 1GGCH 3BGAA 4D0BA 1JHTA 4X4ME 3QULA 3CZJA 5CEZH 4LBEA 5CEZE 1M6OB 2NW2B 4ZO6A 3T3ME 4Z7VF 3O2WH 4BH7B 2EKSA 3RI5F 5KTEH 2J4WH 3O0RL 5I18L 4X4MA 1RIVL 4KV5E 7FABH 2XKUA 2EDEA 3MX0A 1BHGA 2H3NB 5JMRA 3T0DA 5I9QC 1WT5A 4LSUL 1SVZA 3SDXF 1EHLL 2JELH 1PQZA 3S4SA 4KJQD 4P46C 1IGCL 2QEJA 1NBYB 2Z31A 4HAGA 4F8TA 3GSXB 3DO7A 4PRHE 5E7FA 4HBCL 3NCYP 3RX5A 5DK3A 1AHWA 2MFNA 3ZKSD 3F7RA 4POYA 1JNNH 1OGTA 1D5XA 3REVB 4LP5A 3D39E 1BD2D 3MRQA 2Y6SD 3AS1A 1RD6A 3Q5TA 4G7YL 3K1DA 4IRSC 5CJOL 1E4XL 4PJCA 1Y6NR 4OLVL 5K59E 2HFGH 3D39A 3ARBA 3MCKB 5HGBB 1A6TA 2ADFH 4PJEF 1KCVH 3QIUC 1JGVL 4ZTOL 1W8OA 1I1AC 4AYFA 2FSEB 2H2SD 3U48A 3MRPB 1LO2H 3UJIH 5DJ0A 5I1KL 5CZKA 5IVXA 1JMZA 2ZCHH 5EWIH 3IXAB 4NBYB 3PL6B 3ZKMC 1YNTB 4WUUD 5EU4B 3TBWA 3TFKD 4ZQKA 4Z77A 4D3CL 2FATH 4F2MB 4LLWB 1IM9D 4AK1A 2PTUA 2HJLA 4K3HA 5DRZA 5AYUL 1OM3H 4MA7L 1F4WL 2ZUSA 1C12A 2KPNA 3QUXA 4W4NA 3V6OA 1JNLL 1IAII 3VGFA 2APFA 4K94H 2AXJA 3IRPX 4YHKL 1QFUH 5ANMA 2Q86A 4C83B 4X6CB 1BVKB 4DGIH 2A6DA 4G8IA 5D93B 3KYKH 2CIIA 3SPVA 5HPMB 4Y4FD 3F58H 4G6KL 3NPSC 4XP5H 3CU7A 4J3SA 1F4AA 3EZ8A 3MREA 4TSBL 5IV2A 3TA3B 1RZ7H 4X7EC 3O8XB 1ZWIA 4G9DA 2A6JA 4OZHB 1I7TA 4PBWD 4Y2OA 5KS9E 3GMLB 1E4WH 2YD3A 5D7IB 1GZQA 4N1CA 3SOBL 1W0VB 1OARL 3ARDB 3SDCB 5AZ2H 3QI9A 3WXVL 4ODXA 3C2SA 2FLBT 1OB1B 1YY8A 5KS9A 3SY0B 4FMKA 5EOCL 5FA4B 4ZUWB 1ROWA 2DQDL 3CLEH 5DI8B 5JDSA 3W81A 3RWIB 5FYLL 2D7OA 5KVMC 4PLNC 2GK0B 3DSNA 5GSRA 1I9RH 1DBKH 3CFDB 4XX1G 3VGHA 5GZNC 1YUHA 2OK0L 2IADA 3RVWD 3C8HA 1T89A 4WI9A 3BT2L 5H8DA 4K71B 3TNMA 1I8LC 1FFPB 4U1JA 2C3VB 3T0VA 4EDWH 4QTHB 4F7PB 4IM8A 4TPRL 3ZKQD 3ZE2E 1G7HA 2D4FA 3B5TA 3AMKA 3CFJA 4RMWA 1FYTD 2GIYA 4HUNB 4JZJC 3C8DA 3WIHL 5C3TA 4JRYA 3RWGA 3A6BL 1TVHA 5F7EH 2XWJB 4ZS7L 4JANA 1T1YA 3U7AA 1EBAA 2PXYA 1NQBA 3PGDB 4QCIB 1NCDH 3UTQA 1OQXA 5DQDL 3EYFB 4TTDD 1FH5H 1XR8B 1ZLWK 1FL3B 5F1IB 2X41A 4K9EH 4R8WH 2PW1B 3MLVL 3VXME 3U7YH 4G9FA 1DN0B 2HWZL 4U1GB 1A6WL 1QFWL 1E4XI 1BFSA 5H2BA 3BEVB 4DN3L 1QLRB 3I75A 2ATKA 2R56H 4RWYL 1N6QH 1C1EL 12E8L 1B3JA 3NCEB 4UTBL 3O4LD 1I9JH 3U0TA 4JFEE 4P2RB 3QFJE 1WICA 3RVUC 1AFVL 3WLBA 4K07A 3EHBD 3QFJA 4HAFA 1DTUA 5IMOB 5KSAD 1F4YH 5IQ9B 5C0FB 2BERA 1PVHA 1NCAH 4W6WB 1N2RB 3I9GH 3K2MC 4LCWB 1CLOH 2AQ2A 2P24A 3WSQH 4KTEH 3SKMB 2DQUL 2ZUTA 2NMSA 5KJRH 5EPMA 5GJTL 2ZUXA 3RVVC 5IK3A 1J1XL 4HMCA 5TQ0L 4PTUB 4N8VA 4K7PH 4Q0XH 5JR1H 5E9DB 3DX9B 5LAXA 3SBWA 5BZDB 1AKJB 2WUBL 4XCNB 2FB4H 5FM8A 3HN3A 4YQXL 1F11A 3R06A 3N9GH 4CN1A 4GMTL 2HRLA 3BN9C 3FT4B 4M5ZL 4NHCL 3OGCB 3HZYA 2X4TB 4U7SA 3DGGA 3FRUB 4OLYL 3SDDC 2NLJA 5F9OL 5GGSA 2FEEL 3ARPA 3EDDA 4WTXA 4KROC 4DK6A 1QYGH 5TE6H 1FSKC 4X8JA 4XXCA 2YPVL 1XF2A 3FQUB 5E2WH 5ESQA 3RTQA 3JV6A 4U6XA 1WZMA 1B6UA 1NEZA 2EH7L 3ILPB 3U0WH 4APQA 1JN6A 3DVIA 1R3LA 3QZWB 4QXUH 1HDMA 2NR6D 4HPYH 4L3CB 5IVOA 3HE6B 1U91A 1KCRH 4PJ7A 3VJ6A 4S2SA 1TMCB 1GGUA 2FX8L 2WWMC 1MOEA 1HH9A 4IRZL 3T0ED 4DVBB 3WFDH 4ZUUB 2Z8WC 3MRGA 3VRLE 4WEMB 2HT2C 1T7VA 1ZA6B 1EXUA 2CUIA 3WJLA 1EH9A 4NQEB 1C5DA 4P3CH 1U9KA 4Y4HC 1YDPB 3QIBA 1BJ1H 4PJ8A 4FTVE 1JFQH 3QQ4A 3RDTC 2VC2L 1ZHKB 3RWCA 4P2OC 4IJ3C 3V4UL 3BD3A 1MFNA 4A6YB 5DD6B 4GG8B 5EN2B 4FTVA 5HHVH 2VDKH 1A14H 4UUJB 3MBEC 5ID0A 4GAYB 4QLRA 4V1DE 5JPNA 4GS7C 1HILA 3C08H 3IFPB 4RMSA 3VXRD 1UXSA 5DRXA 1SEQH 1QBML 3CUPB 2YSSB 1FP5A 1KCUH 1DBAH 1U8HB 1QFWI 4LQ1A 4PJ9C 4XI5C 4R26L 4NQCA 4X4XB 5DD1L 1GGBL 2R2BA 4LLDB 4OJFL 3ZTJG 3FFCB 1NANI 3Q6FB 3OJDA 2OJEA 15C8L 1LP9E 4TUOA 5DHYA 4CJ0A 4JFHD 4WU7B 3EDEA 1LEKB 5GJSH 2BNRE 4Q2ZA 5JOFA 4N0UA 5JORB 2ZOKB 1LP9A 1NKOA 3BZEB 5C6TL 2R0LH 3HC3L 4NNXA 5ESVB 4P23B 3VWJB 1S9WB 3B2UC 4LPTA 5C92A 4QYOA 4XZUB 5EO1A 5D1ZC 3VFUB 3OB8A 3RA7L 5CILL 3VMPA 3KWWA 3C60A 1DL7H 3D0VB 5DJ2B 2EEDA 4CADB 3TV3L 5J13B 3EJZC 4YXKL 5E8NB 2OMNA 3WUZA 2XI9A 4NCDA 1HI6B 1AXSB 1N26A 3MGTB 4HWUA 5ETUB 2P8PB 1OAZH 1LEGA 3SEPA 5F70A 2O93L 3QISA 4J7RA 2Y1VA 1I4FA 3D25B 4HCRH 1BJ1J 2FO4A 3FT3B 1G7QA 4RNRB 3WUWG 1JZ3A 5BZWB 1IGIL 1KUMA 3S88L 4XCCH 3PJSB 1B0RB 4X98A 1YJDH 5F6HI 3WIHA 4FFZL 4KQ4H 3T09A 4KUCF 1JGEB 2R4SL 1QSVA 5C07D 4OCXH 4OD3L 2P8LB 3ECBB 2J8UA 1JPFA 1N7MH 4NZJA 3IDGA 3T08A 1KENL 2VQTA 1CLYL 4CNIA 4TQEL 4XMPH 3PV7A 3JZ7A 4FN0A 2Y5TB 4EUPG 3MLXL 1G9NL 4XAKD 1MCPL 4CRPA 1HSAB 2VQ1B 4OZFG 4JG0L 3HZKA 4YR6A 4EDXB 1ZVYA 1ND0B 1SMOA 1XGUA 2H41A 3U6RB 1WTLA 4LSVL 3A6OA 3MOAL 4XAWH 1Q9OB 1WZ1H 4E0RA 4G7VH 2VUYA 2OZ4L 2C3XA 3ULVL 4Q9BA 3GIVA 4X99A 5EBMA 1DEDA 3G6DH 3SJVB 1S7WB 4WGWB 2HVKB 2KZ1B 4EOWL 1CG9B 1DE4A 1GGIH 5D7JD 4NNYB 4ONFH 3KPLA 4XP9H 1ETZB 1ZT7A 4I0KA 1TCRA 4PYGA 4PJHB 2P5WD 1BP3B 3Q1SH 1YN6B 5FXCH 4UU9B 2XWBB 4HIXH 1DLFH 2XG5A 1BZ7B 4ZAKA 1J5OL 2X4SA 2A6IA 2IPUK 2X4UA 3P30L 1CD0A 3RNKA 5JW4M 5FEBA 3RJQB 1IFHL 1MFCL 3EYQD 4H88L 3F7VB 2F19H 2CK2A 4HFUH 4LL9A 4QGTA 5EC1B 5F89A 4LNRA 3OXSA 1MFBL 3V5KA 2JB6B 3MCLL 4XMLL 4H0GA 5F8QC 4PJCF 5EDXA 4YBLC 1P4LA 1T5XB 2FJGB 3OX8B 1EEYA 4EIZC 1T20B 1TFHA 2OL3L 1MSPA 3CVHB 1R5VA 4QHUA 2B20A 2ED9A 4ZO7A 5K59F 4S1DC 3QEUA 5IVXF 1X5IA 1UFUA 2BSRA 3O6MH 4X7CC 4K3EH 2YMXL 2CKNA 1UWEL 2A38A 3CU1A 3KLHC 4S1RL 4JFPA 4MCYB 4YNYA 3U2SB 5C71A 4Z0XA 5HSFA 3BKMH 1KC5L 3BZ4B 5TQ2L 1MI5D 4MQ7B 3UJJH 2VXQH 3LD8B 3IDMB 2BVEA 2I9LA 4NJ9H 5TDOB 4X4ZA 4OAWA 5DJYB 3P9WB 3O6LL 2IBZX 2GJZB 2L7UA 4WW2A 5TPWH 1SYSB 5FECB 1YECL 1NCBH 1RV6X 2XKNB 3QO0B 3HG1E 3VFGL 3HPJA 3QJFB 4K3DH 1WV7T 1P6FA 3ARBC 2HVJA 2PO6B 3D0LA 3PV6A 4GBXA 5MEOB 4B53A 2FWOB 3HG1A 2I5YL 1WIUA 4X5XB 2YRZA 3IF1A 3TM6A 5LJYH 2RHEA 4XNZB 1EJ6A 3RZCB 5EZIH 2EYRA 5ITFB 5AD0A 1M7IA 4KVCL 2VZ3A 4RIRB 1T2JA 5ICXA 1NJ9B 1ZT4A 2YZ1A 2W0FB 5KS9F 3KPRD 2QQLH 3KPTA 4UT7L 2PTVA 4LCWD 1CYGA 2B7DT 1TZGL 1N0XL 3TZVB 1MCKA 1MFAL 4NM8L 4FQIL 4U1MA 2JCCA 4YHIB 3SDYL 2I07A 2B1HL 4TSAL 3S3SA 1HINL 3V6FB 1UC6A 3C9NB 3QUXC 4UNUA 4UDUA 3V6OC 4PD4K 5DFWH 2HTKC 4L8BA 2VSCA 35C8H 5IB3A 2V2TA 4HX1A 5DJ6A 3JWOL 3VD9A 4QY8A 3MO1A 3MLPA 1MUJA 3ULUD 1FZKB 1JYXA 3P77A 5E9DD 1CFNA 5I15H 2XICA 4XVSH 4K94C 2Z93A 3OJ2C 4ZTPH 4YPGB 3KPQB 1BBJB 2AI0H 2FGWH 5J3HC 3DVGB 1J0ZA 1B2WL 2NQCA 4PRIB 1YQVH 2ZOLA 1ZLWH 5C09A 1D6EB 1EUTA 1CL7H 1G7MB 5ADOL 3VXUB 4Y5XB 3L7EB 5IBTH 2FYYA 4D9LH 1JPTL 4OZ4A 2OI9B 4JFOB 3CPLB 2VLJE 3BO8A 3VXOA 1KN2H 5ADPH 1KJVB 2APVA 1ZGLA 2Y36H 1EAJA 5J6HA 2JLLA 1KTDA 3EOBA 5IGXL 3QAZC 3BPLC 3VDBA 3KYOA 4OLUH 1VGEH 2VLJA 4PRBB 2VXVL 4ZMAT 5F88B 3O41A 5IMMA 4P59H 3T2QA 2ZSVB 5D2NA 3QXAA 2GUOA 3QG7H 4JRXB 4ZOAA 5KSVA 1AIFB 1NSNL 4XWGH 4DZBB 4M8QA 3BQUD 4U1IA 5DEFB 1UZ8A 1QBAA 3GUTA 1QZ1A 4GQ9L 2B5IB 4O5LH 5IW3A 1PG7X 4X0KB 4E41E 4LSDA 1PGRB 5I17B 4ENED 4YHMH 5CD5D 4P9ML 2IBZY 3VRJB 3MRBA 1BOGB 1XR9A 3QPXL 1S7UA 4DZ8B 1LE9A 1CICA 1HQ4A 2DQIH 3FO0L 2FEDC 4WFFD 2Q8AH 2EIZA 3GRWH 5BCAA 3KYMA 4N0CD 5EOTB 4YEEA 5C0AE 2VTFA 1BFVL 5DD0L 3RL1A 3RKDC 1T4KB 2RFXA 1JWMA 4L3ED 4LVHC 5F1NA 2CGRH 1RUML 4RZCA 3O4OB 1BPVA 2VH5L 5I1HH 1A5FL 2DWDB 1R6VA 2D7TH 2AJYL 5MEQB 3QNZB 3MYZA 5C0AA 4K8RD 4OCSH 2DM3A 2B4CL 2J6EH 1Q9WB 2NZ9C 2IANB 2GAZA 2NY3C 1JWSB 1NLDL 1BX2A 1E6OH 2EDKA 3OKLA 1P84K 3CSGA 3FFCD 3BGFB 1K4DB 1A0QL 4OBRA 2ARJB 4ZPVA 3HMWL 3MA9L 3LQAL 5GHWH 4FP8L 4JY5L 3V6ZA 1KPUB 3MRMA 3W0WB 3HKFA 5D1XC 3GBML 3RL2A 1G7IB 5DTFB 3DMMA 4YGVB 1FFOB 1HHIB 3TBSB 1M71A 4JN1L 2B2XL 3NFSL 4JO3H 4PJ5E 4LSSL 1F97A 2FECL 5KAQG 1DSFH 1JI2A 4I0PA 3RHWK 2PYEA 3DRQA 3T65A 3K3QA 3GSUB 2W38A 4P23D 4PJ7F 3W9EA 5J1TC 2CR6A 1TJIL 1IAIM 1F90H 2V2WA 4M6OL 5MI0C 4RAHA 1CTOA 3MOQA 4YHZL 2QR0B 4L4TE 3S35H 5D8JH 1YMMD 2OTWA 5MEND 3U30C 1UZ6F 4TULL 4KU1A 3VFTB 3SBWC 1MHEB 5I1AA 2H2PC 3GMOA 1IGMH 4L4TA 2WAHA 2OL3A 5JXAL 3OG6B 4ODTL 5EOQL 2VZOA 3QRGH 1RU9L 1VFBA 2XWTB 1RK1B 3C5SB 3RU8H 4XPGH 2PUQT 4MZ3A 3OZ9L 4E42A 2I27N 2XTJB 3WUWB 4AQOA 3BKJH 1MREH 2WLYA 3OMZA 1CFQA 4QRPE 5C2UB 4ODVL 2ORBL 4XXCC 4N8CL 4GKZB 4APQC 2H6PA 5IIEB 3KJ6H 1FC1A 3QUMB 5LXGH 4NQDD 3OGOE 3PG2A 2KKQA 1OAUH 1YEKH 1F2XK 4G6FD 1MCEA 1R3HA 2ZUVA 4PRPE 3AAZA 5EBWA 1CGVA 1SBSH 2Y25A 4Z78B 1WEJL 4M02A 2W0LA 1OTUD 2HJKB 1S7RA 3ZMRA 4CVXB 4RFEA 3VD4A 2MKWA 3KNBA 4PRPA 1T2QL 3DYPA 4MDIA 5HHOE 2VKXA 4CVWA 1YNLH 3CNKA 3O11A 1CXFA 4RFOL 4S1QL 1JCKA 2WZPD 2MHAA 4IOFD 1CDCA 4MJ5B 25C8L 1FN4A 3F7YA 1FL5A 1T1XB 2ITCB 4GKOA 4XNXH 3VFVA 3BRGC 3UZVB 1EBPA 1GPOH 3GMQB 5I75B 3HC4L 4FQQB 5IHUH 1IEBB 5FDWA 1FYHB 5EU6E 1JNNL 3WFZA 2ID5A 2O5YL 3FO9A 2IG2H 3TO4D 4XRCB 1AY1H 5DGRA 4WWKB 1EV2E 3KAAA 3PWPE 1ULVA 1NC4A 2WP3O 4M9OA 5EU3A 1P7QB 3U9UA 3H8NA 3MJGX 4NFCA 3TT3H 1A8JH 2E9JA 3UJIL 3MA7A 4KJYA 4DTGL 1UXWB 1R24A 3QJHA 4OGAC 4RAVA 3THML 1UCBL 4R7DA 4J3WA 4MA1C 5E2UL 1NDMB 5HGHA 3I2CH 4PP1C 1QNZH 1AD9A 3WDHA 4MSWA 3OKKB 2K3TA 1RAMA 5L2KE 2C1PB 1B0WA 2EXYC 1CXLA 3L3HB 4JO2H 4MXVE 4R7NA 4Y4KA 3KJ4B 4YJZL 1F5WA 2E9IA 3F7QA 1DUYA 1BWMA 2J8UF 5JW5B 1VACA 1VKXA 3UTZA 2ZSWB 2VXUH 3CDGA 1QLFA 1B0GA 5HI4D 2BX5A 3C60C 2XYCA 2DDQH 3UXFA 1YEJL 1X4YA 5C2BH 4NCC2 4XCYB 3IJYA 2A9ML 3U36A 4W4OA 2EH8L 5I2IA 4WFGD 3SE9L 1BVLB 1GZPA 4TNWK 5LWYH 2JB5H 4ZFOL 2HH0H 2LTQC 1KJ2L 1KNOB 3E6HB 5TDNB 1XGQB 5HPOA 1QBBA 3F62A 3QUZB 1MAJA 3GBNL 3HI1B 4ODHL 1NBQA 4GXVL 4LGPB 1C7SA 4LCYB 2NXZC 4Z7OF 3O9WA 5I71B 1IGFH 4U6VL 1ZHNA 2NY6C 1DDHB 2PO6D 4MJIA 2FR4A 4HBQA 5I1GL 5IUSA 1S9XB 1A7RL 1IBGL 2NY1C 2YKLL 4J12A 5M94B 5GGRA 1KIPA 1K85A 5IJVB 4UAOC 3F7PC 2A74B 4JJ5A 5GS0D 1PKQE 2NY2D 2NY4D 1MHHA 1F3RB 4LVNC 3B2VH 3TJHD 4F7CA 1M7DB 1RZGA 2VITA 5CHNB 3PQYA 3BWAB 1F8TH 1KCSH 1KTRL 4I9WE 4KKBC 1I8KA 1IMHC 2E6JA 5BVJA 4O2FB 1RIUL 1XGTB 2HLFC 3A6CH 2UV3A 3MACH 1WWAX 2OR7A 2WINB 1R3IH 3SDAD 4KFZC 3MFFA 2CKBB 3DI2B 4EXPX 2IFFH 3E1F1 3ARGB 4HF5L 4OGXL 1JWUB 2LU3A 5KVGH 2BHUA 3MYJA 1AQDA 1SQ2N 2DIAA 5C08D 3IDNB 5CJXA 4RMVA 4D9QD 3VFSB 4JFQA 3O45B 3TN0C 1NFIA 4PRAA 3BDBA 5BXFA 1FVCB 3VXQB 5DZLA 4V2BA 3U9PH 3ETBF 3VXUD 4D0DB 3R0MA 3O2VH 2D31A 1AI1L 3O6KH 4MAYA 3GZKA 5HYJE 1KELL 3IETB 1TJHH 2HRPH 3NGBB 1J0IA 2ADGA 2WIIA 1FZJB 4FQXA 4DW2H 5F9WC 5GRVL 3LKPB 3C5JA 1MH5B 3K2UL 2Q76B 3LCYA 4WW2F 1MJUH 5JUEH 2ZNXA 1JPST 1XMWA 3L9RB 2ZZUT 5L6YL 2FX7H 2OMBA 1XGRA 3WO4C 5IR1A 4JM2C 5KBNC 3QHZL 3B6SA 4QHMB 2E7CA 3GJFB 1JGLL 3EYSL 1I7UA 4IIQB 2IFGA 1DVFA 5DYOA 3ROLA 2CO6B 3QUYB 1ZTXL 1D9KD 2IQ9H 3I84A 4MNHB 1ZA3B 1OGAB 5T1KB 2A0LD 1SJXA 4LLQB 1I1FA 5FGCE 4Z18A 1FG9C 4GRLA 4HKJB 4OKVB 1FNFA 3MRKA 1XCTB 5HDQL 1I7RA 3H7BA 3LS4H 4U1LB 1XIWA 3N1FC 2AJVH 2JCCF 5CUSH 1FO0L 4NO3B 2Z9TA 5E2WL 3ZHDA 2IWGA 1NC2B 4WW2C 3HS0B 4R4BA 4HHAB 1Y18A 4P5TB 1ZLSH 4Y1AD 2R0KH 3QDMD 4PJBB 5DK2A 4LARH 1Z9SA 5DR5L 3MLSL 3H9SD 5MP6H 1S8DB 3UTPD 3BYYA 1U93B 4XP1H 5J89A 5FO8A 2V7NA 4AT6A 4GBXC 4RQQA 4M5YL 1NMAL 1QRNB 4CN4A 1UYWL 4U1KA 1MIEH 2IAMA 3RWJB 2D2OA 4ODSL 1ZMYA 4ISVB 4P3CL 4JFDD 2E27H 4JFXB 2DQGL 4LPUA 2HN7B 1HNGA 1HIML 4XMKH 3W0WD 1CD1B 3WKNA 2AJ3B 2BDNH 2VE6A 3FJTA 5CEYB 4KK9C 1NCCH 1FIGL 5AG9A 3UPAA 1U6AL 4JFFB 3MV8D 3BDYL 3V2AR 2EYTB 2RIKA 2ZG2A 3STZB 3EO0A 1A1NA 2AXHA 4GUPB 1IGTB 2HTLD 5DMIH 2Q87A 4XNYL 3L95B 1KLUA 4BM7A 1KF9B 2GSIB 4MA3B 1LK2B 1PG7W 1GJIA 1DQJB 1WWCA 1I75A 3M45A 2DQJH 4A2MA 1RZKL 3PWVA 2W60A 2W07A 5E7BA 5FYKL 3T8XB 1ZGLP 3HNTL 1HK6A 2H9GA 2J5LC 4M62H 5ISZB 2VDMH 2F54B 4LASL 4YFLI 2Q7YB 4LCUB 5GISL 1V3KA 1EX0A 5ECJE 2VLMD 6FABL 3CSYB 1TZIA 1N64H 4PD4J 3WS3B 2HFEB 3QEGH 5HD8C 1U92A 5FB8A 3VFPA 4F33A 3QDJA 3MZTA 3JV5A 1JJUA 5AG8A 3EOTH 5GS2D 4RDQF 1IT9L 4HIIA 1Q0XL 5C0ND 1KJ3H 4NUGL 3RY6A 4YXLL 5C0BA 2H8PA 4ZO8A 1ITCA 1J18A 4HV8B 4M3KB 1PDKA 1CD8A 1MCIA 4OLWL 5DQJA 3W5NA 2F53E 5B8CA 1KJ2A 2Z92A 3DXAD 4FXGA 4YDVA 3GO1H 1CXIA 1YEDB 3QB7C 5EU7E 5D2NC 3ULVF 1BIHA 1IKFL 2KBGA 2CUHA 4H1LH 5FYJH 5FYJE 3MUJA 5F1SA 1DL7L 4F58H 1ZT1A 3NCBB 1NGWB 2BNQB 1HQRB 2CH8A 5IHBA 1KV3A 4M93B 4ZO9A 3X11A 5IEKB 1G0DA 4D9RD 4WW1B 3P9LA 3AU1B 5I1LA 4P46B 3MZGB 1OAZL 5DJZB 1MRCL 1U3JA 1QA9A 2AEQH 2JJSA 4MNQE 4OZIB 2F8VA 1G9NC 4KRLB 2X1QA 5HDLA 1RHHA 1L6XA 4P2QB 5FHAL 3BJ91 3ZT7A 2BRQA 1L0YA 4XPAL 5IW1B 5JOEA 4IRSB 4LDOB 1NAMB 4OUUA 4AEIH 1A6VL 4XB8A 4Z7VB 2A9NH 3QIUB 3IRZA 1I1AB 1P7QD 3ZDYE 4ZFGL 1OOAA 5L2JB 3KXFB 4R2GB 5D2LA 1A6ZA 4NQEE 1JZ8A 5LG1A 4JFYB 2VRAA 2R4RL 5AUMA 4JZOA 2QADB 4KKLD 3SDXB 5DO2D 3AMLA 2AK4B 1NDGA 2YPLD 3GKZA 4F7MA 3IU3A 1FFNB 4KJWC 3I85A 3QUKB 1NUGA 3ZTNH 4A6YH 2R2EA 1GHFH 4ZPTA 1BQLH 1G7PA 1UEYA 2R8SH 3OTTA 3DLQR 2MPAL 4I0PC 1RFDH 4L8CB 2X9XA 3V5HA 3OJVC 5LGHH 1SJEA 4LVEA 2X5PA 3H3PL 1YMHA 3OPZH 1P84J 4O2CB 3NPSB 1QSZA 3ME0A 4Q9RL 1QSFB 2COQA 5JZ7D 1H5BA 2BCKB 2HT3C 4JN2A 3Q6GL 4XP9L 2G2RA 4Q7DA 4CW1A 4ZXBA 2AV7B 2IC2A 1ZE3C 1WFUA 2BSSA 1W0WB 3QH3A 3ARRA 3INUH 3KPSA 1Z9OA 5SX5K 4RMRA 4JDVA 2F9BT 4HIXL 1DLFL 4MAUL 1W72B 4O51B 2OP4H 4YIQB 5JPMA 2J8HA 4PY7B 3MUZ1 3S98A 5TDPA 3LIZH 4HKBA 4JHWL 1II4E 5T3XD 1OWWA 3UTSD 3D3VB 2DD8L 5BRZD 3W11D 2V7HB 2XZAL 1OF2B 3NZ8A 2VDQH 1ZLVK 1H3GA 1CZ8L 4OV6F 2VR4A 1AO7B 1D5BB 1FO0A 5GS1B 4DGYH 1U8MA 1GAFL 4N90D 1T1WA 4H5SA 1XGYH 3CXDL 3NCCB 4UTAL 2VN7A 3WIIH 5CBEA 4JFZL 4Y5YC 2J2ZA 4PLOB 4LQFH 4K7PX 3WKMH 4JZJB 3OKOB 1EFQA 1CDGA 2R9HD 4KTYA 3U46B 5D7LD 3S4SG 4FFWC 4EN3D 4WU5B 4Z76B 5IMLB 5IT2H 2V9TA 2Y7QA 1S7VB 4PB0L 1KLGA 1FRGL 3VWKA 1CWVA 1UM5H 3S3JA 1FDLL 4WV1C 3M8OL 5C7XL 5E6IA 2O5XH 4QRSA 5EU5B 4BZ2H 3IJHB 1TZHB 4BSVA 1FV1A 3MLZL 2G75A 1P53A 4UV4H 4MLSA 4KRMB 1NBZB 4LCIL 2IGFH 1N0LA 4Y19E 3DUUB 4RMQA 1U8JB 3MRHA 4G3YL 4MCZB 4Z8FL 4EI5C 5I1JL 1L0XA 2NY0B 5C0GB 3JWOC 2GW5A 3CK0L 1D6VH 4JPVL 5F93C 4LOUD 3UTTB 3AS2A 1Q9LB 1TJGL 4XPHH 4YE4L 4L5FH 1AP2A 2P5ED 3CMOL 3P40A 4Q9QL 1RVFH 2YN5A 3T4YB 4TNVK 4M1CD 2FCBA 3ZDXE 3TBVA 2VXSH 2HKFL 3S37L 3C5ZB 4CVZA 5LQBH 2PTTB 4QRQA 1H3PH 4XNQB 4D0CA 3X14A 2QQKL 5ESAB 4Z7WA 3VE0A 3QA3B 1Z3GH 2EDBA 3SJVE 2KL6A 5KANG 1QKZL 1T22B 3OL2A 5LGJA 3TBTB 4DJMA 5MHSE 4WJ5B 1I1YB 4YUEL 4FQHA 4NRYA 4PJHE 3S8WA 5B4MD 1SJHA 1XGPA 5D71H 3ZKND 4J4PA 4LF3B 4XVTL 4L8DB 3L7FB 5CMAB 5I8KL 1D5IH 5BV7L 2I60H 3WXWL 1PAMA 2N7BA 4JGJA 4NNPL 2DOCA 4XPFL 5E8PA 1OW0A 5H94A 4X7TB 4X83A 3SDDB 3TH2T 3OJMB 2DBJA 1RZIA 3RPIA 2I26N 4KROB 1FSKB 5HI5D 4LHUA 1U3ZA 3MRCA 4PUBH 5EUKB 2H1PL 3STLB 4Z5RA 3SCMD 4MD0A 4XCEA 1XEDA 1NC2D 3S9DB 2NNAA 2R1XB 4OFKA 2FJHA 2XN9E 2ZNWA 4N9GA 4NZTH 2Z35B 4XX1E 2GCYB 4I77H 1HHJA 3HZVB 3CVHH 4M7KL 3WL9B 1VFAA 4LSTL 5HJ3A 2M26A 1AE6H 1JGDB 4LDEB 4RX4A 4G8GA 4KTDH 5DJXA 1QRND 3EDKA 3U0PB 1I9IL 2P1YA 4PJDA 2UZIH 2QSTA 4Y4HB 2P7TA 3CSPA 1CK0L 3FHAA 4G43A 4L3AA 1LK3L 2FHFA 1TDQA 1MFDL 4WWID 1QQDA 2B4CC 2X4PA 3RDTB 2FIKB 4P2OB 1PSKL 4IJ3B 3P3YA 4YHML 4JVUA 3RIAF 1C5BH 5FM5O 4I2XA 4YAQB 1FPTH 3MBEB 4P3DB 4PGCA 1P1ZA 4R4NC 5FYJU 5EC2B 5CP7B 4YZFF 1IGJA 4GS7B 5B39A 2DWEA 3MXWH 3H3KA 4NUJB 3H0TA 4AIZA 4ZDHB 5CIPA 5HHNA 1RULH 1UWGL 4PJ9B 2DQHL 4XC1H 3UO1L 3P0YH 5I76A 1G1YA 4JPKH 2WBJB 3IAPA 5L7XL 3K4DA 4XBGB 3ZYJA 1G9ML 1A02N 1CT8A 4JDZA 5I1CH 3CFBA 1NUFA 1MLCB 3D85B 4QHKJ 5SWSA 4OT1L 1KBGL 2FDBP 4XPTH 4NKQB 1UCTA 3NAAL 1EMTL 4YDIL 4ZUSA 1LDPH 3DBXA 4MAYC 4M6NL 3ORJA 2ICEB 1BIIB 4FQXC 4Z95H 3QXWA 3ARED 1C7TA 4AIOA 1I3RB 4NWTH 3QCTL 2A1WL 4X6EA 1DBJH 4POZC 5CZXC 3NMEA 1RK0A 2R29L 1I7ZB 5DFTA 4KJPC 1F3DH 3EW3B 4KUZH 3EYUL 1V8HA 4L8SA 5D1ZB 4N8VG 1M4KA 2ZG1A 3EJYC 1CDUA 4UQ2A 3GI9L 5D1QA 4YHLL 2CK0L 4QOKB 5J9PB 5K9QG 4OD2A 3TYFA 5JIPA 3GK8H 5K9OB 2HFFB 2Q8BL 4ESKA 3MRJB 1BM3H 1OTTC 4PBVC 2BNQD 4PRIE 2W9EH 1T7ZA 2E8YA 4OIBA 4Y2DC 2JIXA 5FO9B 1F4XH 4P46D 3K81A 3MLTA 3VXSE 5C0CB 2VLRB 4OFYD 4GRLC 4XH2A 5I8OH 4PPTA 4Q6IC 4O2EB 1XIWC 1A6PA 4OM0L 1V3JA 5D72H 1NEZG 3VFWB 3BKJL 2QKIB 4P2QD 3K0WA 1RUPL 3KS0H 3GSWB 4RGND 1JHLH 1JF1A 4FZ8L 5SWQB 1QOKA 5C3LD 4M7LT 3T77B 4P57A 4QTIL 3RWFB 3WE6A 3JSSA 3QIUD 2HG5B 1HXYA 3WD5H 3SE3A 3KXFD 4PJFA 5D70H 5GIRA 4HH9B 5IM7A 3BEWB 1HHKB 5IB1B 4NGHH 4H0HB 1SBSL 4J1UA 1JK8B 5D5MB 4C56D 3ZKMD 4F3FB 2IAMC 3V8OA 2AKRB 1I85A 1V7MH 3NTCL 3V0VB 5BS0D 4HFWB 1SM3L 2YD6A 3NACL 3Q3GB 4GRMB 3FMGL 3T2NH 1BZ9B 3FFDB 3TYGH 4HH8A 3FO2A 2W9DL 5JMOC 1L9NA 1UA6L 4HD9A 5DDHB 5E1HB 5F1OB 5TE4H 4R96A 2VDLL 4OM1H 5F9JB 2UYLA 2QSCL 2G9HA 5DLML 3EUUA 3CIQA 5DHXB 3TWCH 1WC7B 4ZFOA 2X09A 4IBLT 1BD2E 4HC1L 1EO8H 1U2CA 1OP3K 4OZGB 5GRUL 1U8IB 2BVQA 1F3DJ 2ZWLT 5IEHB 5HTSA 4IHOB 1OT2A 4I18A 1T21B 3F12B 3G5VB 1FFQA 2CDGA 4HWBH 5D4QA 1BD2A 5IVZA 2YRPA 5KG9A 4KAQH 1UWXK 5FHBH 4U1GC 4ORZC 1RZFH 3GMPB 2GY5A 5IHZB 4HWBA 3PGCA 1A9EA 4UT6H 3ZTJH 1KTLA 2DQFB 1KN4H 3N1MC 1ORSA 3WFCH 1DEEB 1CBVH 4WHTA 2QQNH 4M1GL 3RVTC 4WUUA 3QEQD 2ITDA 4Y89A 2V6HA 3HHRB 3RGVD 4WO4C 3RY6C 3KS0J 5CBAA 4YBLB 1JHTB 4D0BB 1A9BB 3PHOB 4NKIL 4LBEB 1IM9A 5B8CC 4WVRA 4XHJC 2EKSB 3C2AL 2EDRA 1G7JA 1U3HC 3HC0A 3HFMH 4MXQC 2JKXA 5D2LF 1OSPH 4PY8I 4P5KA 5DD5H 5J7CC 4YX2H 1BLNB 1A7PL 1YPZE 5EU7C 3LPGA 3L5XH 5DURB 4Y4FA 1ZANL 3MSPA 1MAMH 3RI5K 3GNML 1MY7A 5HHMD 1A6AA 1PLGH 4HZAA 2X89D 4JVWA 3RUGE 2V9RA 2FD6L 1FORL 5CSZB 3TP4A 1AHWB 2J88L 4M9PA 5DWUH 1OGTB 1D5XB 3DROA 3BKCL 2RGSA 4WEBH 2R1WA 3MRQB 3QUMH 1XH3B 4GKSA 1RJLA 1T2XA 3MNZB 4OUOA 3MV7D 3PABB 4Z7UE 3CSBA 1AGDB 5FUOL 5SX5H 4AENB 1KGCE 3TO2A 1TNNA 3G6JA 3D39B 3ARBB 1A6TB 2BMKA 2ZKHH 4OTXL 4U05A 1QSEE 5DJ0B 4EUPH 1DUZA 4HKZA 3UAJC 5IVXB 2P43B 5H35A 2DF3A 1YYLH 3PP3K 4OZFH 1QHOA 3X3GH 4LEXH 1CFVL 1S9YB 4NQVA 3TBWB 1ZLVH 1CS6A 2MJWA 3UTTD 4ZQKB 4JE4B 3UBXI 4Z77B 1JNHB 1G6RH 3VCLA 1FYTA 2MKLC 3VG0L 4HWEH 2OCFD 5T1DH 4WI5A 4FMFA 5IHLB 3D9AH 5DRZB 3WBDA 3HRPA 1GL4B 1HYRC 1C12B 1G6RA 5KVFL 5JQ6L 3RVVD 3QUXB 1ZEAH 4PJGA 5DUPH 1NLBL 5ANMB 1RI8A 2GHWB 2FH8A 2Q86B 3H9YA 3JTSA 2A6DB 4G8IB 4KK5C 5IROA 1OD9A 2BOBA 2CIIB 3QQNA 1KEMH 2CLVA 4Z0BH 3MRLB 2P8MB 5J6GA 2AAVA 5E2TH 1M05A 5DMGC 3C6SA 1H5BC 1U58A 5F96H 1ZWIB 1N4XH 3VD5A 2A6JB 1I7TB 4MHHI 4RISL 4IMKC 4X9BA 3BN9D 3V9FA 2YC1A 1LO0H 1GZQB 3GSVB 4Y7MA 5KW9L 1KIRA 1IAKA 3WHE1 3O4LA 1GCFA 1P7HL 1U8KB 4ODXB 1G0YR 3QO1A 4KROD 1YY8B 4O4YH 5KS9B 3MFGB 4MQSB 4M00A 3IFNH 3AXLA 4IS6A 2AXFA 3BISA 4R90H 5JHLL 3BPLB 1TQBC 4XP4L 5GSRB 5KSAA 3HLAA 5JUEL 1K6QH 4GMSL 5A43C 2L0DA 2RAMA 1YUHB 2FX7L 2WWMD 1IC7L 3FB5A 4TSCH 3G5YB 5D9SA 3TNMB 2IPKA 2RR3A 4U1SB 3ZSTA 1MCBA 5C0IA 3VWJC 5B3JE 3EBAA 2H26A 2XACC 5EFIA 5JLZA 4BFGA 5FA3A 3QXUA 3MBXH 1IKNA 3A0OA 3S35X 5J1SC 3CXHK 3FQRA 3NVQA 5IBUG 1J05B 2XQBH 1WCBA 1CU4L 5I8CB 5J13C 4JRYB 4FQ2H 2C5DC 2EE2A 3RWGB 4ORGA 1TVHB 4TVPL 4X6DE 3G5XA 4JANB 4P2OD 5HGDA 5EG6C 1T1YB 1F00I 2X1XR 2DBLH 5FF6A 3RGHA 5J06A 2F58H 4MJ2A 1HWHB 4HW6A 4Z7WF 3MV9D 4GG6A 3DTXA 3BIAX 4Q74A 4G9FB 4LVHB 4OCYH 3CZFA 3NPZB 3L3JA 4ZOBA 4TOYH 5I1IH 2OR9H 3DX7B 5H2BB 3I75B 4LPCA 5F9AC 5CJBA 3VXMB 2DLFH 4PB9L 4M4RA 5EZLB 5EO0A 3ZL4H 3U0TB 1MIMH 1WJ3A 5IBLC 4HC1A 1T80A 4MXWL 4HXAL 2ZUQC 1H3VA 5KN5A 1ORQA 2VZVA 1XZ0B 4XBEL 2N4IA 3P11L 4LHJB 3UYRL 5J4MA 4JFEB 3QFJB 3T0EA 1EJOH 1F13A 5E70A 5D1XB 4F9PA 5CZVH 2BRRH 2DMCA 4RGOL 3NH7L 3D18A 4GFTB 3ILQC 2P24B 3AS0A 3IS0X 5HGGS 1IC4L 2GT9A 1T04A 3UMTA 4M61B 1FGNL 3DSFH 4JO1L 5EPMB 1IEAA 3DNKA 2DQCL 4QEGA 2NYYC 5IK3B 3PWJA 3B2UD 1G6VK 2CKBH 3QNYA 5MI0B 1TPXC 4LK4A 1MHPH 3IDUA 4R97C 2ZPKL 4YPJA 3U30B 1BFOB 2CIKA 1TVDA 3EJZD 3IDXH 5DT1L 1OPGH 5LAXB 3QG6A 4PJDF 1ADQH 1J8HD 1BBDL 4TYUA 1Q94A 3L3IA 3TCLA 1HH6B 3B3IB 3E0GA 1KFAH 3I50L 3VXRA 4YHNA 2QBWA 3L3DA 2K9UA 1F11B 3R06B 3HAEA 2F5AL 5BMFL 2YD4A 2VDNL 4GAGL 3DGGB 1UENA 2CLRA 2VQUA 1HXMB 5C0JA 1KEGH 4X8JB 2N56A 4H26B 1XF2B 2FBOJ 2NZIA 5ESQB 3JV6B 2EEBA 4KHXL 4R3SA 4POUB 5ITBH 2YEZA 5L9DH 3RAJH 1OP5K 4APQB 1JN6B 1R3LB 4KKNA 1HDMB 1A7OH 1V7NL 1U91B 3OR6A 1GGYA 3IS1X 3VJ6B 1MJJA 1BQHA 4G6AC 4S2SB 3EYVB 1HH9B 1CGTA 3UCRA 5IFHL 3ULUL 1CIUA 3MRGB 3LQZA 1BGXH 2DI7A 4MA8H 1LNUA 4E5XA 2HLAB 5HVHC 1EXUB 1OGAE 3IFLL 3RWEB 4P4RA 2DS4A 1OAKH 3P0VL 1CE6A 1UB5A 3NABH 4XXDA 4Y16C 3M1BB 3QQ4B 4P99A 1X7QA 4KK6C 2H3NA 3RWCB 3LPWA 3BUTA 5FCUL 1INEH 4WI2A 1MCWW 3BSZL 3HZMB 3CX5K 1PZUB 4FTVB 4RDQG 1AR1D 2UZYB 4MS8C 5ID0B 3VMNA 1NBYA 5CINH 3LD8C 5HHXL 5AEAA 4X6FA 4PJBE 5JPNB 3WHE0 2VL5A 2UUDK 1UXSB 5JO5A 5DRXB 3REVA 4JQIH 2XIDA 4FA8A 5C07A 3QDGD 3REWA 2Q7NA 4BH8A 5AZEL 3VGBA 1ED3A 3B9DA 3AY4A 1MLBA 5HGBA 5JW4N 4OLZL 1TVBA 3OJDB 2DQEL 4MA1B 4YGAB 3RVXC 4YEFA 3PE9A 4TUOB 4G5ZL 1MEXL 4JCMA 1UJTA 4Q2ZB 4DVRH 5JOFB 4XVJL 3JUZA 3IXAA 3VI4E 5DD3H 1QLEH 1LP9B 3ZHLA 1YNTA 5EIIA 1EEQA 2E7HA 3HMXL 4NNXB 3TLRA 3CX2A 5LBSH 2XA8L 4F2MA 3TZVC 2DAVA 4UZGA 1YY9C 4JVPA 4D8PB 3QWRD 5EO1B 1YA5A 4HQQH 3KWWB 1MCWM 4PJFF 5CJQH 3C60B 3O2DL 4S1DD 4NRZB 5DMKA 4CUCA 1CVRA 4I3RL 4K8RL 4C83A 1BVKA 2P5WE 3L6FA 4ONGL 4UV7H 1LEGB 3JVGA 5TF1L 5HPMA 1FE8L 5D7JA 2GTZA 1KPVA 3T0BA 2F5BL 4HS6A 2P5WA 3AM8C 3QPQC 2FO4B 4G8FB 1G7QB 1OP3H 3NFPB 4OSUL 2VO5A 1PYWA 2LTQB 1FNSH 4DUVA 4OZHA 4NM4H 4X98B 4NQTA 1NL0H 3MJ7A 2FX9L 4Y5XC 3GMLA 4LKCA 1UWXH 4W81A 2NXZB 4PRHD 4U7KA 1KACB 4WCYH 4C54A 3FB8A