5E6IA

Crystal structure of tcr pf8 in complex with flu mp(58-66) epitope presented by hla-a2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
199
structure length
196
Chain Sequence
b'QLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQEPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGPGGSSNTGKLIFGQGTTLQVKPDIQNPDPAVYQLRDSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR alpha chain,Human nkt tcr alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Crystal structure of TCR PF8 in complex with flu MP(58-66) epitope presented by HLA-A2
rcsb
total genus 23
structure length 196
sequence length 199
chains with identical sequence F, G, P
ec nomenclature
pdb deposition date 2015-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e6iA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e6iA02
1UB5A 3B8YA 3KYMB 3CX2A 5KSBA 2FB4H 5BJTB 4IOFD 4URTB 4BZ2L 3FQXB 5JUEL 4XCFH 3WXVH 4YHOL 2DBLH 3TEUA 4UIMA 3NPSB 5EU7C 3GBNH 4TUKL 3LEVH 3UTSE 2Q8BL 2AJZA 1SJHB 5F44A 5FOBB 4K8RH 3MBEC 4JPVL 4H8WL 4L5FL 3ROLB 1DQJB 2JELH 1TENA 2PYED 5JHDB 1A7RH 1GZPB 3FOMA 1LEGA 1RUPH 4OJFL 5I18L 5E99L 4YXLH 1OGTB 1CFBA 5JHLL 3NCCB 4UINL 5E6YA 4PB0L 4Z5RB 2WBJA 2WP3T 5DI8B 4LRIA 2CK0L 2D31A 5EOQL 3QXTA 1HSBB 1T22B 4OSUL 3U46A 3LCYA 2H41A 2XWTB 4KQ4L 2AXGA 2O5ZL 3UYPA 1FYTB 4O2CA 4OCSL 2HJFA 5EN2A 2GTWB 2BNQB 2OTWA 1INEH 2YPLD 1EHNA 5FHBL 5DMIL 2ADGA 2VC2H 5I1HL 2LAAA 4K8RC 1RAMA 1FZMA 2WW8A 1WITA 3PWPB 1AXSB 4YHYB 5DRNB 4HK3J 1NCUA 3ILQD 3QBTB 1EHLH 2D7QA 4M7ZB 1ZTXL 1CD1B 3BKYL 4N0CC 2P8PB 3QDGB 4AK1A 4OLXH 5I6XB 3N50A 4XPTL 3ZT7A 2EXWD 1ZLUH 1RZ7L 3C60D 4KY1L 4EIGB 4LCCC 5KS9F 4S2SA 4L8SC 1RIVH 1DLFL 1MHPH 5EIIB 5D7JD 4ZSOA 4CNIB 1NGPL 1E6JH 3T04D 4HQQH 3QIUA 1ZHNA 4GSDH 1ZA3A 1JGDA 4TSCH 3SDXF 1J5OH 2X9YA 1NC2A 1EVTC 1MJUL 4KZEL 3OR6A 5DRWA 1HE7A 1JYNA 3OAZK 3OB0K 3CSGA 1K4DA 2EXYC 1EFXB 3OKDB 4OFYD 4XXDA 3FB5B 3QI9B 5HGBA 2VDPH 4D3CL 2W60B 4NGHH 4Q97A 2X42A 3R0NA 3IDXL 4P59H 5FUOL 2C5DC 4HC1L 1EZVX 1H3GA 1NGQH 1XH3B 4LLVA 5B39A 4F58L 3UTTB 3BHBB 3C5JB 4PG2A 1I9RL 4BSWB 1MFAL 3MJ9A 3ZHLA 3RNKA 3S97C 4RAUA 5D1QC 4JJ5B 4NZTL 2VQUA 5B38B 2X4UA 3FRUA 3HUJA 5EOCJ 1MWAH 4TTDD 4KRPC 4D94A 2NXZB 3EBAA 4NUGH 3D85B 4ONHB 1K2DA 3MGTA 4KJYA 4MXQD 1UFUA 5J6HA 1FIEA 3OG4B 4GRMB 3ULSB 1VFAB 2AQ1A 3ES6B 4JQXA 4ZQKB 4NWUH 1VEOA 3PDDA 4PGDA 4WUUA 4NRYB 3B4NA 4ZOAA 4CMHC 2J5LB 1RMFH 2NY2C 1MRFL 4PRPE 3FZUD 2DB8A 4ELME 3P11L 1R24A 3LS4H 3PG2A 2YC1A 5B8CA 1ZAGA 4LSUH 1QEWA 5IEKA 1D9KB 4PRBB 2UWEF 1VKXA 4P5KA 4XZUB 1FNEB 4P2CG 3MJ6A 2Y36H 1S7TA 5EC2A 5FCUL 5DURD 4N0FB 5BZWB 3SOBL 1BAFL 4ODWA 1AGEB 1HDMB 3MLWH 4WWID 5CJOH 5IVNA 1F97A 2EEBA 2B1AH 1FNHA 2ATKA 3KJ6L 3LV3B 3D1MC 4K9EH 4P46B 2D7OA 1WBYA 3BP6A 4NBZB 3EYQD 4JFZL 1UACL 4ELKA 4HHAA 3D3VB 3Q3GB 4JZNB 1C12A 1HOCB 3T0EE 3BMVA 2ESVB 1BBDH 2P7TA 5JR1H 1S9XB 1JWSA 4KVNL 3AS3A 4HCRH 3VU2A 5KVEH 4PYGA 3MRMA 4JANB 3RVUD 5GHWH 5IHLB 4A2MA 3SKMB 4EN3A 5F3HA 1KN4H 5L2KB 1HIMH 1UWXH 5GGVY 1YYMH 3SO5A 4RBPH 2EEDA 4YFLF 1B6DA 5TDOB 2HT3D 3HC4L 3PWVB 4MHHI 5HY9A 1IC7H 4PJFF 3U82B 4C83B 3F5WA 4IRJB 5FO8B 4P57A 5KTEL 2I24N 3GHBL 2PYFB 2LU3A 1CQYA 4Z7VA 3TVMA 3L3DB 4F7PB 1FO0H 2NNAA 1S7UB 2RFXB 1U8LA 3IDNB 1I3UA 4G6ML 3MOBH 4O2FA 4JKPL 3GBML 3UJJL 4LCYA 1NGYA 3W9DB 3VFTB 3IDIB 3OZ9L 2XKNB 5F1IB 1T21A 5T5FL 1DQDL 3RI5K 2PKDA 2WQRA 2FZ3B 4BZ1L 1E4WH 2XN9E 4FZ8H 2DWEA 3MUY1 1IMHC 1MJ8H 4PG9A 1N4XH 1T20A 2FX7H 3NAAL 4RGNB 5DD1H 3QUXD 2VDOH 4P9MH 3RDTB 1S9KC 2BSRA 1F00I 2DM7A 4UIKH 3IDGB 3LKRA 3O11A 3DX9B 5C07E 2B4CL 2IH3B 2PUQT 5IF0A 1BAFH 1MCNA 1NC4B 1CGUA 3MYZA 1KLUA 5TF1L 4LCCA 3H42L 3AREB 3LB6D 1ZVHA 3LS5L 1I7UA 1SBBA 2P45B 4DFIA 3GSVB 1DEDA 2A6IA 2EC9T 1SJVA 5DS8B 1E6JL 2P42B 3TN0B 4YC2B 4LU5L 5ACZA 1EGJA 2CIKB 3LKPA 4DKAA 4CN4A 1NGZA 3KHQA 1KNOA 2MMXA 1BJ1J 1Q9KA 1XGQA 1OP3K 2MKWA 2DLEA 2VXVL 4HAGA 5E8DH 5C1MB 4TVSa 4Q6IC 5D96B 1E6OL 4HKXB 3OSKA 3LH2L 5TDPB 4ZNEE 2DQDL 5FM8A 2VMFA 2K9UA 1PG7L 1MAJA 5I6XC 1R24B 3VFNB 1RURL 4RDQF 3BGFC 4I1NB 5D8JH 3GSXA 3G9VA 2EDBA 4FABL 1N6QH 3MROA 2VQTA 4LLVB 3MA9H 4HIEB 2F58H 2VDLH 4YHIB 4H26A 4LF3B 3MV11 3PWUA 5K93A 1FC1A 1CZ8L 3EO9H 5ESAA 3S96A 5D2LE 1Q0XL 3ZKNC 2NX5D 3FN0H 4GKSA 4JREC 3MRBB 1UKTA 3VXOA 1EJOL 3BKYH 3Q0HA 1QHOA 4NFCA 4U1GB 3TV3L 4P4KD 1U6AH 4HKJA 2VDQH 3BKMH 3QCVL 3FQWA 4N0CD 3MRIA 1DVFD 5JOFB 4QWWC 4WI8A 1ZSDB 2FIKB 4ZOBA 3V0WL 1E4KA 3K3QA 3PF2A 1OB1A 5ACLA 3VFVA 4FA8A 1EFQA 4NN6C 2EDHA 4HXAH 2VC2L 4LAQL 2GSGA 2R2HA 3VXMA 3FN0L 4ZAKD 5FCSH 2LTQC 3SDYH 4WW1A 4QTIH 5IB3B 3EW3B 2NY3B 3MTRA 4CRPA 3S36L 3GNML 3ARDB 1NC4D 4HT1H 5KJRH 3VRIB 4DW2L 5HYJE 3ULVC 5FYJL 4FABH 2X5PA 2DQIL 4LSSH 4FFZL 3SQOH 3S36H 4ALAH 1IM9A 3K80A 3PQYD 3MJGX 2DTMH 3QDHA 3P4OB 2A6KA 4S1SL 4A6YL 1JRHL 1NANI 1R3HB 3SJVB 2BOBA 1YMMB 3SDYL 1WWAX 2YZ8A 3VFTA 1H5BA 2H2PD 4NUJB 5D7LB 4RAHA 4M3JA 4P2YA 4UV4L 2J5LC 1C8PA 2NY2B 1Q9LA 1BQHA 5KSBF 5SV3A 4LGPB 2DJ4A 3GSQB 1BZ7B 2VDQL 3T0EC 1S7UA 1T2QL 5D9SB 4PRNB 5F89A 4NN5C 1YNKH 2QEJA 3HE7D 4XZUA 2LABA 5HGHA 3WE6A 3SDCC 2HA1A 2IADA 4PTTA 2CJUL 4KK6D 2FZ3A 5IV2A 2YA1A 1L6ZA 3ARGD 5E2WH 5LQBH 4X6CB 5DJ6A 1C5CH 4PRHD 1O7VA 2D9CA 1S7SB 2EIZB 3G5ZB 4MSWA 3D39A 4FQQB 1PKQB 5CZVH 4ZSOB 3EOAB 2CXGA 1DL7L 4O58L 1NQBA 1K9TA 3OGCA 1S7RB 4NQUA 2EDKA 3V5KA 4D8PB 4JFYB 1BHGA 1HKFA 2J8HA 3MLXL 4POZD 3WIHL 4KQ3L 4GW4A 2NTFA 3B9KA 1HILA 1J10A 1RIUH 4PRHA 5D7SL 5KSAD 4OF7A 1C12B 5E2TH 1NCWL 4NKIH 3VWJC 1NGZB 3HUJB 1QA9B 3WKNA 3CXDL 4KTDH 4UB0H 4NT6B 2A74B 4WV1A 4BH8A 3C2AL 4XVTH 2Q8BH 3W0WA 3NIGF 3MGTB 5EIQA 1CS6A 1KB5L 4Y19A 1LP9A 1QFPA 4XNXH 3WS3A 5F7LB 5I17B 4Z77A 4D9RD 2UWEB 3O3DB 2F54A 3PABA 1ZLSL 3LEYL 4L1HA 5DD3L 3RTQB 4EI5A 5CSZB 4EZMA 4DVRH 3DARA 5ETUB 3VXUD 4ODTL 3BPCA 1A5FH 3CFEB 4KAQL 4ONGL 3PWPD 2C4FU 1JYWA 5HI4D 3MRDB 3A67L 2Y07H 1QSEE 1UZ6F 1F90H 1YEJH 1X44A 2BSRB 5AZEL 4LSVH 1VGKA 3SBWC 3QCTH 2QQLL 2W65B 4KKAC 2I60H 4X99B 4G7YH 5T1KD 3D18B 4F15C 4QOKE 4QWWD 4FQHB 2H6PA 2P8LB 3INUH 1INQB 2C3GA 4PTUB 5GRXG 3CCHB 2GSIA 4WIQA 4J3SA 5DXWA 3VXSD 1K85A 4NRYA 4UILL 4U7SA 4MWFB 1LGVA 2YUZA 1WCBB 4LLMB 4NQCE 2X4QB 4XC3H 2O61B 3O0RH 1R5WA 3IRZA 2V2TB 1EK3A 2I5YL 5EC1B 2XQBH 4W4OA 1PLGH 1HZHH 2FHBA 1XGYL 4BA8A 3EO0A 5JW4Q 1A2YA 2DQHL 1XF2A 1YEEH 2CLZB 5D7KD 2DYPD 3FKUS 3K1KC 1AIFA 1MHHB 4YDIH 3VFWB 4CADB 2HFFA 3AREA 3E8UH 1MJ7L 2PO6C 5I71C 3MLZH 5L8KB 2B39A 5C0NC 2A6DA 2N56A 1N8ZA 4YE4H 3ZE2F 3MUZ1 1X3DA 1OAXL 4LSPL 1XFPA 3WFEH 2EH8H 2BC4B 3TBTA 4NRXB 2ZUSA 3ZZ1A 1RPQA 5KVDH 1MCBA 4LGRB 3SCMA 3U7WL 3UEZA 1EZVY 2BY2A 4ODXB 4OIIL 3O4OC 4TTGA 3MFGB 1A6PA 2FRGP 5IQ9A 4K55A 3I75B 1IKNA 4NOFA 4PJXA 3GMOA 4NQXB 4GS7B 1OAYL 4UI2A 4W70A 2AJXL 6FABL 2R0LH 4N9GB 4PFEA 4F37K 3EO0B 5GGUB 3UTZA 2GY5A 5IVXF 4QRPD 1S9VB 4Z9KB 1HSBA 1BQLH 5F9OL 1KIUA 4HD9A 2IQ9H 3BIKB 5HHMB 3GJFK 5EOTB 4F2MB 3HC4H 5FKPA 5A3ID 1P9MC 1K4CB 3GSRB 4PJCB 2PTTA 1K5NA 1MRDL 5HVFB 5C0IA 5C0BE 1S7SA 1ONQB 4APQC 1R5IA 1IM9B 5ANME 3BZFB 1HQRA 4LPVA 3KDMB 3LKNA 4WI6A 4Q9QL 4NT6A 1INDL 1QTYT 3KYMA 3VMOA 5DRNA 4L8BA 1IAIH 4X5XB 1M4KA 1R3KB 4WHYG 4BK4A 1JZ4A 2R69H 4PRHB 3AU1A 4JPKH 32C2A 2JIXA 4Y5YA 3QWOA 3IU3B 4IDJH 4F9PA 5D5MB 5DGQA 2OJZL 4JY6A 2NY3C 4AEIL 2HFGH 4DKEL 3ARDC 4WJ5B 2G60L 3MQIA 4GQ9H 4NHUA 2NY7H 4OCYH 2ZSWB 5GISH 3S5LA 5E5MB 1DUYB 1C5BL 1DLFH 4U1KB 2DBJA 4P2OD 2JIXD 3HE6D 4ODWB 4XCCH 4GW1A 3I3BA 5F7EL 5D7LD 5I19H 2XPGB 3QCTL 4W68A 4WO4C 1J05A 3S37L 2XNAA 4IOSD 4JVPA 5IEHB 4K7PL 2GTZB 2OLDA 5C8JA 4GG8A 3GO1H 2VSDA 4UDUA 3SJVD 5LCVL 2AXGB 3IXTB 2ADJB 4P2OC 3GSQA 1BVKA 1SYSB 25C8H 5IMLA 3REWB 3H6JA 4M1GL 5K9QG 5GRUH 3V79C 5TPWH 1MCHA 1DE4B 3V9FA 5DQJB 1XMWA 4PLKC 5FDWB 3I2CL 4Z7UE 4NZUH 4AIOA 3VH8A 4GXVL 4LQFL 1IAKB 1DDHA 1FE8L 3BMWA 3OX8B 3ROOB 2M2DA 1FYHB 3KPSD 1ED3B 5D2NC 3RPKA 2X44D 4OKDA 1VGEH 4R8WL 1PKQA 4NZTH 3WFHA 1WAAF 2DI8A 3O4LB 4BQBA 3EFFA 2YD7A 1T22A 4MNGE 1EEZB 4MA1C 2EDYA 3RWHB 4OCLC 5EFIB 4LCCB 2WNGA 4MDJA 4CVUA 2P44B 1AE6H 4XP4L 1UZ8B 4YZFE 5GRVL 4GBXA 3ECBA 1DCLA 2DQUL 1I75A 3MLRL 3DMMA 3MRIB 2NY7L 3HZVA 1JE6A 5C0AB 4ZFFA 3U0PB 1X9QA 3QUZB 3TYGH 4PJHB 4XP1H 4P5TB 5DMIH 4OLYL 4TTDC 4EI5B 3L3HA 3FHQA 4TSBL 3V6FA 4I18C 5CD5C 1QOKA 4Y5VC 4FQLH 4WFED 5IB3A 4XRCB 3AB0C 3W9EA 3BEWB 1LWRA 2GYSA 1OW0A 1BZ7A 4LARH 3P0YL 4RCAA 3ABZA 1QSFD 5ENWB 1IM3B 1H3XA 2J88H 1NGXB 3N1FC 2IBZY 1RZKH 4M9OA 1JNHA 4H0GA 4M9PA 5GZND 3V0VB 3HZKB 2CDEA 3FFDB 1UA6L 2FD6H 1R3IL 4JN2A 5K59E 3HG1E 3IGAB 2EXYD 5D1QB 3OKNA 4PJEF 1TQCB 4YWGH 1BWMA 4PR5B 1U8IA 2FWOB 3EOAA 1AP2B 4FOMA 2VZ3A 3FFCB 3KPMA 1Y0LB 1ROWA 1KNOB 1XF5A 1TMCB 4B7IA 3MRQA 1IAII 2OTUA 3S4SA 1T7YA 1VFAA 3G5VB 4DTGL 5HYSG 1WSST 4LLYA 3KYKL 5K9KA 3FONA 3U9UB 1G9NL 3VXRD 3AFLA 3EO1A 2OK0L 3QEQB 5E7FA 1I7RA 5HDBF 4DAGH 3QA3A 3DVNA 3SKOB 1ZVSB 2O5YL 1YNTB 3Q5TA 4M4PA 3RNKB 1FV1B 2W9EL 1BVZA 4H26B 5BS0D 5GS1B 1FLTX 3FAWA 2NY0D 3NVQA 3QNXA 3V52L 2CUIA 5C09A 4AT6B 4BQ8A 3GSWB 3C8HA 1IEBA 4L8SA 4LLWA 1ZHKA 4PJBF 3DGCR 5IBLD 4XHJD 5B8CC 4NM4L 5E56A 5E1AA 2VAAA 3VRJA 2IPKA 3MLSH 1JL8A 1T83A 4ZDHA 5LXGL 1FH5L 1WFNA 4L4VE 5ISZA 5IOPB 1CG9B 4XXDB 3FTGA 1HINH 1XF5B 3IKCA 5F7FA 5DJCB 3T0WA 4F37F 2W92A 3T0EA 5AG9A 5DDHA 2GJ6E 1U91B 1A9BA 4PIRF 3CLFH 5EO1B 5CZXC 1OARH 4S1QH 5CINH 5MENE 1GCFA 4W4OC 4IIQC 3JTTA 2NY2D 3QUXB 4CBPA 3HTLX 5E8PB 4NC1C 3KR3H 3B9KD 3QEQD 1UA6H 4M6OL 4HPYL 5AUMA 1BZ9A 5D1XC 1NUNB 1ED3A 2F5BL 4QXUH 2V2WB 5I1CH 1U8JA 5SX5H 3OX8A 3V4VH 1MHEA 3SJVE 3QZWA 2VITB 3MNWA 4Y4KA 4HH9A 2NYYC 3TC9A 1KPUB 1FDLH 3OKOB 4LASH 3H7BA 3OR7B 3RVWD 3WLBB 5CJ5A 1FZJB 5FYJU 4Y8DC 1GZQA 4UOW0 5EA0H 4M93B 3DX7A 4FFVD 4IRJA 1WC7B 4OQTA 1FJ1B 4Y4KD 4LPXA 1YA5A 1MEXH 4Y2DC 4QEGA 5I2IA 2EE6A 3VFUA 1FP5A 3SKNB 1A6TA 1KCVH 4G8FA 3QRFM 3VXPB 3JV0A 5CBEA 1MY5A 3ZTNL 3RX8A 5GS0D 5TPWL 4DOHE 1D5XB 3OZ9H 4XP9L 5FDYA 5H2BB 5DMGC 1INDH 3CDCA 5I15L 1LE5A 3WD5H 1FO0B 4WY7L 3VXSA 4Z8FH 4ODHH 1KIPB 1TXKA 5CZKA 4KKBD 2H2PC 2NR6D 1F2QA 5B3JF 3B9KC 3MODL 3GJFH 4KK5D 4NDMA 5DT1L 3HCVA 2VE6B 4I2XB 1HCFX 5EZLB 1XGTB 4LLQB 5FUCE 4K7FB 5J0BA 2R1WA 2RQ8A 2C3HA 3KYOB 3AXLA 1IFHL 5LQBL 1DE4A 3P9LA 1LD9B 5L2JA 1T03L 4F8QA 4KKCC 4ZAKA 1FQ9C 4PTUA 3IXAA 1FSKB 2QKIB 3F58H 1OARL 3NIFF 4OM0H 5CJ8A 4XVJL 5EBLA 5DURB 1KF9B 1RUQL 3VFUB 2H32A 4U31A 3QHFL 3WS6C 4BQ6A 4KKLC 5D6DC 3VGGA 4RFNC 5C0RH 4PJDA 1FFQA 2DKUA 3TBVB 3TF7C 3RFZC 4YK4C 2G9HA 3ZE1F 3CVHH 5GS3A 2HRPH 4HS8H 4XNQB 5K9OA 3GEWB 4JKPH 3UJJH 1ZVSA 3QQ4A 3MOAH 5IW1A 4MA1B 2OP4L 4NO3A 3TPUA 4QHNB 2X05A 3GKWH 5CJXA 3OJVC 1FVCB 4B7LA 1S7VA 5HYJD 2C1OA 1S9WA 3KXFA 4UOW1 1A22B 2ZNXA 1V3KA 3U4BH 3D2UA 3H9SA 1U8MA 5GJTH 3EJZC 3IDNA 1F13A 4PJBE 3X11A 4RSVA 2QR0A 2VH5H 3C8KA 3QP3A 4JQIH 3L3HB 3CFKB 1F5WA 1AP2A 1XGYH 3QUZA 1Q94A 4JREB 1QBAA 5KSAC 3CSYA 2YXMA 5IJVB 1WFUA 3QWOB 3UC0H 4RMQA 1YEDB 4XC1L 5GS0C 5LGJB 4GKZB 4ZFZB 2W0PA 4ONFH 5A2FA 2YR3A 1MF2H 3O9WD 1CLZL 1RZJH 2P1YA 1UYWL 1NBQA 4YHKH 1S3KH 3KPRE 3S5LB 3CFBA 3HKFA 3QQ3B 1D5ZB 3QG6B 2VSCA 1HEZB 5CCKL 1I85A 3BP5B 2IH1B 3P30L 3UJIH 2VB5A 3DURB 1C1EL 1NMBL 3BPNB 3RNQA 4XCCL 3TIEA 4FFVC 5KVDL 5FA4B 2FO4B 1BOGB 1FZJA 5E2JA 5JQ6H 1OSZA 4HKZB 5DD6B 1OSPH 3CH8A 5F9AC 5E24E 5ADPL 4D0DA 1EO7A 4OZHF 2YZ1A 3GI9L 3BZFA 4HUKB 1OAYH 4Y19D 3ULUL 5DK2B 3CFCL 5T5NF 2HT4D 4L4TE 2ESVD 1FJ1A 3VFPB 5FXCH 3GMOB 5D7JA 4K71C 3QISA 1IZJA 2QQKH 1TZIB 1IGML 1XGPB 1CE6A 1I8LA 3W11D 5ICZB 3CIQA 4M00A 5CZXD 5I66B 3CVHA 3M45A 3Q2CA 3N85L 2CMRL 1RU9H 3U4AA 4NN5B 4YE4L 5C9KA 7CGTA 2XN9D 4Y1AD 2WAHA 5FYLE 4M6AA 4WTWA 4MD5B 3I02B 3SDCB 3QNYB 4D0BA 3GMNA 1MRCL 4H0IA 4PGBB 2PYEE 4NC2B 3KYNA 2EYRB 1I8IA 1BP3B 5KW9L 3CMOH 5C0IB 2F19H 1P7KA 3HCVB 4XHJC 3KPQA 4B53A 4UQ2A 2X4UB 3FRUB 4BFGA 4JM4L 2XQBL 1EBPA 4IMLB 4PRHE 1WCBA 4LLMA 5JOFA 5C08D 2F19L 5I76B 3IDMB 2XWTA 5MEPB 5FEBA 4KJYB 1U91A 2NTFB 4DVRL 5CJQH 5BV7C 3OKEA 3P4MA 4FQCH 4RDQG 3P30H 3UJIL 3PHOA 1EHLL 1T2QH 5IW6B 3MCKB 1U8QA 1CQKA 3L5WB 5HGAB 4LCIL 5IB4B 4C56B 1QKZL 3FOLA 5IB2B 5MI0C 2VDPL 3KPLA 1MCOL 2YS4A 1FZMB 4OCRH 1JRHI 4AQOA 1ZLUK 2AQ3A 2J7LA 2XWBA 4XNZB 1J8HE 4NO0A 3IF1B 5DJ8A 5FFLA 5JXAL 1S9WB 3BPCB 4I3SH 4U33A 1J1XL 1F58H 4YHZH 3ARDD 1Z9LA 3RGVA 1MJUH 4KZEH 3IRPX 1WIOA 1PD6A 1YPZB 4NO3B 3SKOA 3JV4B 5E6ZA 1F4YL 4XT1C 2BVTA 2X4RB 1EVUA 5FA3B 2VLRA 4HS3A 3AS0A 3KS0H 3BUYB 1J0YA 3P3YA 5F72S 2H9GA 3Q6GH 1YY9C 3MACL 4NNYA 1SMOA 1F6AA 4OFIA 4WI2A 3G5VA 4KJQD 4MJ5A 1AFVL 1KIRA 2P48B 2V6HA 4Z7WA 5IROC 3QI9D 2GITB 3RWFA 5DQJA 2VABB 4APQD 4L5FH 2J4WH 4G43A 4X9HA 2DICA 2DAVA 4LASL 1NGWA 4OD2A 2XTJC 2MQ0A 4Y1AE 7FABL 4NGHL 2A6JA 5C0CB 1LE5B 4B50A 1FN4B 5DJDA 3D39B 4RGNE 3HZYA 3QFDB 2DL2A 4X9GA 3NIDE 1IC4L 2A83B 1H3UA 3PNWA 1T0NA 1P4BH 3TO2A 3ZLQC 4JO3L 2HFFB 3HAEA 2D7MA 1FYTA 3DHJA 1IEBB 4O2CB 1BZ9B 2P5EE 5I74B 2O5ZH 1BEYH 4KHTH 4QHLA 5D5MF 1A1OB 5GIRA 1CFTA 3HE6B 4RGOL 2BSED 3QXWA 5DD3H 4P23A 1FSKC 5HSFA 4UUJA 5KS9A 1T89A 1CK0L 1YY8A 3TBSB 1UB6A 4F7EA 4KHXH 1BVLB 1RZFL 5DRZA 2NNAB 3WEXB 4P2QB 1GHFH 1XCQB 3TYFB 1MCRA 3HR6A 1IGFH 3DXAA 3LS4L 5E00B 1X5JA 4PD4J 3HG1D 5F71A 3IFLL 5BVJA 4I3GA 3MLSL 1QSEA 4U3CA 2BVPB 1SBSL 5DJXA 5AYUL 3TN0D 2BHUA 3IU4H 3QNYA 2V17H 1ES0A 2ARJA 2VUOA 3BT2L 4MQXD 2BMKA 4YDKL 4QKXB 4I77L 3DX8B 1MELA 3MRCA 1E0OB 4QRTA 4DGIH 4Q6IB 1IGCL 5DUPH 5D96C 5AWNL 3TO2B 4H88L 1NDGA 2ZUTA 2HH0H 5C6TL 3WHXA 2EYRA 5AZEH 1OAZH 4P0DA 1UCBH 4OKVA 3HLAB 4F7MA 3LSOB 3TH4T 4M6MH 5DJYA 5I30L 5F3BA 5HPOA 1HHIA 1YJDC 2ID5A 5KSAB 2OTPA 1IKFH 5BOZG 2ATPA 2EXWC 3GGWA 4F58H 4M61A 3PP4H 8FABA 2DQEH 4HX1A 2V9QA 1HYSC 3RP1A 4OLVH 4ZG1A 3WNLA 2FJFB 5EO9A 1PSKL 2HWZL 4KH2A 1UXWA 4JFDE 5HDBE 3GMMA 5F89B 5H94A 4ZSOE 2XKUA 4U1GC 1DN2A 5ITBL 1U3HC 1FGVH 1D5XA 1E4JA 4L3EB 4O4YL 3SDDB 4Z76A 5HI3D 3BPNC 4GAGL 4HMCA 2HWZH 2YBRA 3BVNA 3HRZB 1J0HA 3HFMH 5TDNA 2IBGA 1A0QH 3HI5L 3KG5A 3JTSA 2JJVA 3GHBH 3T2OA 2ZUUA 1Z3GH 1WV7T 4CMMA 3K2MC 1DLHA 5B3JE 5CD3B 3BIAX 4MNQA 4Y4FC 4XNQA 4QTHA 4X80L 3LRHA 3N06B 1T66D 5IBUB 1ZLVK 3W11C 5FO8A 1QLEH 1I7TB 4M4RA 1F4XH 4ZQKA 4OZGE 5IBUG 3VXOB 2GEEA 4HW6A 5A3IC 2FDBP 2BRQA 4LSTL 2X10A 1IC5L 2Y7QA 1E4XL 1S5HA 4OF0A 1JPSH 3V6ZA 4X4XB 1YYLL 3T3MF 4TNVK 5F7MC 2DQUH 4UBDD 2FJGA 1OD7A 2PN5A 3BT2H 1X5IA 4C56D 2OK0H 4HIEA 3VGBA 5E8PA 4RGMB 2YPLE 1BIHA 5JLZB 1LK3L 3GJFA 5IP4A 4N1CA 4WEUD 4M6ML 1CDGA 1RUML 3WFDL 1RK1A 4EIZC 4NRZA 4R97C 3QULA 4ZO7A 1U92A 2DI7A 1EIBA 3KJ6H 4QRQA 2R0ZH 3AM8C 1UQSA 3MRBA 4FQXC 5CJOL 2JCCE 2F58L 5IMOB 1J05B 3CDGB 4RNRB 2JF1A 1HWGB 3DYOA 2CK0H 2H26B 4XNMB 3TCLA 3H3PH 2WWMD 5ADOL 2GFBA 2NY1B 1N5YL 3TO4B 1IVLA 3EJJX 3GSVA 5T3ZH 5JA9A 1WBYB 35C8L 4W4NA 1L0XA 4NQED 2OMBA 3MRHB 3VD4A 1Q72H 2J88L 2BY3A 4DFHA 4YDVB 1P2CB 2HMIC 1BIIB 5J13B 2IPTH 2R2EA 5CEXB 4OCMC 3CMGA 4HKBB 2XWBB 5HGDA 2CDGB 1TFHA 4GRWH 5GGQL 3CFBB 1PW3A 2LQRA 3MO1A 3VWJB 3ULVD 2UY6A 3OHXA 1M7IB 3QDME 4EUPB 5T3XH 2W9DH 5DC4B 1F4XL 5L2KA 4G3YH 1Q0XH 4ZUUA 4PUBL 1EXUB 1JWMB 1OAKH 3M1BA 2XA3A 1ZGLP 3VXME 3W81A 4JHZA 5FV1L 1M7DA 5F88A 1IGIL 2WLZA 4ZAKC 4KPHL 1UM4H 1DUYA 3ILQC 4HLJA 4PBWD 3DV4A 1VADA 2ZOKB 1MFAH 4IS6A 1G7PA 4FRWA 1AY1L 4AL8L 2HVJA 1CCZA 3FQTA 2WINB 2GW5A 3QWQB 4MA7H 5CJBA 5GGSY 2HFTA 5FYJD 4NZRL 2NY5L 3SDDD 5EO1A 5L0QB 1F4HA 2EKJA 4PJAA 1A1MB 2XZCH 5DRZB 3S34L 4HFWB 1JF6A 2UUDH 1VERA 3BP4B 4D9LL 4ZD3L 5ELIA 2XZQH 5DWUL 2ZPKH 3SDDA 1ZLVH 4Z76B 3O3BA 3ARRA 4UQ3A 4Z7NF 3VFSA 1G7JA 1NLBL 3F8UB 1T6VN 4HV8B 3VWJD 4Z0XB 4UBDC 1KPUA 2IFGA 3NCJH 4XP1L 2GCYB 2R1YA 2AS5M 4MZ3A 2R4RH 15C8H 1WWCA 4XCYB 3QXAA 3DUUB 3DYPA 4P46D 1OLLA 2VXSH 3LD8B 2GQHA 5TE6H 2HKFL 1KCLA 1T1WA 1G9MC 4LVOC 1NMCC 1E4WL 4FZ8L 4JM2A 3CK0L 4XXCC 5E1AB 5FYJE 2H8PB 5KSBB 3MRLA 3VI3E 2JB5L 1HH9A 2DKSA 5JIHA 1MHCA 2ITCB 2KL6A 2GAZB 3VDBA 3RWDB 1R5WB 3IB4A 1PY9A 4PRNA 2D7NA 1IL1B 4X4XA 3NZHH 2H2SC 1TTFA 4R9HA 4WW2F 3CDFA 1DBAH 2F53A 4NDMB 4OGXL 3WHXB 3VFMA 1R5VA 4R4FL 4Y16A 1CN4A 2AKRA 3CFDB 4LKXA 3QUXC 1IGTA 3HS0A 5JLZA 4NNPH 4L9DA 5GJTL 2DWEB 3C5ZB 5D1XB 3NCYP 1B0WA 2UWEE 2DQHH 4YNYB 4U1MB 3ALWA 2BNRB 1L9MA 2UY7A 1KN4L 5EZOL 5JDSB 1QACA 2PCPB 4OAWA 4CMMB 2H26A 5MP6L 2GTZA 1A4JB 4PJ7A 3QUML 4S1DC 5FV2A 3OR7A 5C0CD 3G6AA 5JNYB 5T3ZE 2F54E 2X1WL 4HS8L 4JY5L 4XNUL 5K9KB 5DEFA 1UGNA 5I17A 4APQB 1I8KA 3AMKA 2NY1D 1P2CA 3NCEB 3D5OF 2B0SL 2PETA 3I3EA 2A6JB 3GI9H 5C0CA 3PGFH 1FO0L 3SGKA 2IALB 2M26A 5FO9B 3PIQA 3RVUC 1N6VA 5F7DA 1NAMB 5TQ0H 2PXYB 1QRNB 3BPLB 4QRRE 3U30B 4GKOA 4O02H 4OFDA 4I0PA 4G80B 2IJ0C 2UZYB 4KUCD 3ZKND 3OTTA 1C16A 4NJ9H 4E41A 4NFBA 2GSIB 1J1PH 1WFOA 4M7KL 3PJSB 3GIVB 1R5IB 3DI3B 1Q1JH 4JJHA 1JCKA 3I6GA 2BCKB 3GKWL 3MGOA 5IK3B 3T65A 3MFFA 4BFBD 4C54A 2XA8H 3O41B 5GQBA 1Z9MA 3LRSB 5I1HH 4HSQA 4MX7B 5DHVA 4M1DL 1BBDL 4MB5A 2VLLA 3C60B 4RGMC 5AG8A 2LVCA 2BVPA 4MVBD 2QSCL 3RA7L 4JQIL 2CK2A 5EU6B 3GMRB 4QF1B 1WVZA 1DBAL 4ZUTB 3JUZA 1EFXA 2I5YH 4OCWH 3RY4A 4IMKC 4D9QE 1P84K 1N6UA 3JWDL 3KPOB 4NO5A 1R0AH 3QIWC 3IJSB 3TP4A 1TVBA 2N4IA 4RFNB 3IFOA 3DXAD 3PP3K 1K8DB 4ZUVA 2CLRA 1HCVA 5IHBA 2X9WA 2XZAL 1T4KA 2X1QA 3VG9B 4QLRA 1EFXD 4KVCH 3SCMB 4L8CB 5F3BB 2I60L 1NMBH 5D2NB 2NY0B 1ZXQA 2HKFH 3SE3A 1JTOA 5FYLH 5D5MA 4EN3C 1QYGH 3OAYH 1UB6B 4F7EB 3NFSL 5KVMC 1GJIA 2QQNH 4TVPD 5BRZE 4OM0L 1QLFA 3SEPA 2DD8L 4E42B 4JG1H 4JFDA 1G6RL 3JWOC 2AJ3B 1NEZB 4JRWA 1MHCB 5C0DB 3ZT5A 4NUJA 5D7LA 4YUEH 3D3VD 2YK1H 1YQVL 3MRKB 4Z5RA 4QRSB 4PJXB 3V95A 4XPAH 2DQCH 1I8IB 4XAWH 1N3NA 3EYUL 3DO7A 1NAKL 4LBEB 1A6WL 3CXDH 4U1NB 1MWAA 1H15B 3UYRH 2VZOA 3UZVB 3S9DB 4HK0A 5C08A 3QCUH 2IANE 3O6LH 4LLAA 2E8ZA 3AB0B 4YPGB 4YQXL 2PTVA 2P8LA 3ZSSA 1CFTB 1J7VR 4X6CA 5DJ6B 4Z18A 3LRGA 4ZS7L 2VWEE 3HG1B 2X4TA 5D7IA 4KUZH 3PGCA 3OKMB 3KPSA 2BNQE 4HKZA 5DD6A 1OGAB 3LMJH 3MOQA 3HZVB 3EIFA 4PUBH 4XPGH 4DJMA 4NO0D 1I8KB 3EDEA 3SE3C 3OB0H 3I6LD 2VYRE 4X7DC 2J6EH 5EC1A 1JBJA 4PGDB 4XWGH 1R3KA 1ITBB 3BAEH 1JUFA 3MCLH 5DFTA 1TZGL 4HHAB 1U8OA 2VLRD 3A6BL 2ENSA 1Q0YL 4WO4A 4LMQI 3B43A 3HNVH 4JFFA 3K8LA 1FG2B 1KB9J 1G7IB 2YWYA 5DZOA 1EERB 1FH5H 2MPAL 3QUYA 4K3DL 5IWLA 5IGXL 3G5YB 3ZL4H 5F1NB 4WI7A 4LPWA 2NY3D 2RBLA 4TUJB 1CGXA 3HNSL 1SM3L 2BVOB 2ZKHH 5E94A 1S7TB 5EC2B 1QFWI 3ZL4L 4YXLL 1MH5A 4KFZC 5KVGH 5IJVA 3DRTA 1XIWA 4F7CB 3EOBA 3HNVL 2C26A 4GOSA 1V3JA 4IOIB 3F6IA 4TUKH 5HDQH 3BRGC 3X11B 5ITFA 2R0KH 2XT1B 5INDA 4HUVA 2Q7YB 3RU8L 1NFDE 4MQTB 1OTTD 3WFCL 5MEQA 4JO2H 3FOLB 4CJ1A 3SGDI 3BGMB 1V3MA 3BRDA 4NQEA 5DRXB 4LKXB 4OCSH 1KN2H 3QG7L 4E9LA 1ORQA 3CNKA 1FVDA 4N0FA 5DR5L 3S37H 2FHFA 4EDXA 3KPNB 1XR9A 4IIQB 5FO7B 3WUWA 4MQSB 5HPMB 3DVIA 1MJ8L 3VJ6A 5D7LE 4YFLI 5TDOA 1MHHA 1B3JA 1HQRB 5E94B 3ARTA 4HWZA 3OKYA 1AD9B 1C5BH 3AU1B 3QCUL 5HDLA 4N0UA 5EUOB 2R4SH 3ARSA 1D7FA 1HNFA 5BS0A 2WBKA 1BF2A 1MREH 3ULUE 3V8CA 2RFXA 3C8DA 3IFPB 5C09D 4NOBA 3CVHB 5I1LA 4UOJA 4M93C 3HNTL 1HINL 1S7WA 1W0WB 2IALA 3RZCD 4HUWA 1DSFH 4Z7WE 1IAIL 1P4LA 4OZIE 1R6VA 2BOCB 1X7QA 25C8L 2EO9A 5L88H 2APVA 1MWAB 3ULVH 2XTJB 4IRSD 1NH6A 3MBEB 2AEPH 5FYLL 5EU6D 1A3LH 2MPAH 1KG0B 3DJ9A 1T4KB 1BVKB 2EO1A 3JWNC 5D2LB 4GW5B 5IT2H 2RCSL 4GRWF 1ZT1A 1A7QL 5C0GA 3B9KB 2P5WE 3C8KB 4MJ2A 3C60C 4J3VA 5H35A 4R8WH 3QIBA 5EU3B 3TBSA 4D0CB 3G6JF 1ZS8A 2BFVH 5EU6A 2HMID 3BO8A 3GM0A 4W81A 4MB4A 1AI1L 4NQDA 2NR6C 4FXLA 4ZO6A 2A74A 3IFNL 4WV1B 1A6WH 1D6VL 1KTLB 3QIWB 1JNJA 1ZKAA 3QB7C 2AJ3A 4X6FA 4JFFB 1P7QD 5GGTA 4RWYL 2YD3A 4BZYA 2L0DA 2YD9A 4GKNA 2P4AB 1AQDA 3L5XL 4HKXA 4JRYB 5FCUH 4IJ3B 4IRJD 1BFOA 4JPWH 1SMAA 3FCTB 3MMEA 1V05A 1R3IH 3VE0A 2N7BA 4NM4H 4P99A 4Y2DD 3W39A 3QRGL 4NBXB 4NKOB 3T0XA 1BQUA 4YK4B 3G6JA 4FQIH 3B5TA 5D6CA 1W2KT 4K23L 1RUAH 3MLZL 1JHKL 4EN3B 5FO9A 2FH8A 2FYYB 5IFJA 3O2DA 2JK5A 3P77B 1RMFL 5DUBB 3ARFB 1UCTA 1T1WB 2H45A 4L8SB 5CEZD 3P9LB 2X4TB 4G8GD 5IM7A 1QFWL 3IAQA 4QO1A 3HA0A 1L9NA 4YR6B 2Y06H 3FQWB 1BBJB 4JN1L 1U8HB 1RZ8A 4PJGF 5E9DB 5ESQB 5KANI 1FAIH 4F3FA 2P8MA 2VDMH 4N9OB 2FX9L 1N2RA 4Z7NE 2OJZH 1HQ4A 4ENED 2HFEB 3BD4A 3BXNB 4MCZA 4U1SB 2B1HH 3SGDH 3CFIC 4JFQB 3LN4A 5EOCL 3U46B 1TLKA 4YWGL 5CMAA 4CDGC 4IOFC 4G6JH 4PJ8A 1L7IL 5JOEA 4K9EL 2YPVH 5BZWA 4QT5A 5TJWK 3QIUD 3Q6GL 5DVNA 5JPNB 4PJIB 1FNGA 3QZWB 1B2WL 5BCAA 4WNQB 3ULVL 3T0BA 5T1MB 4Y4FB 2GI7A 1HHHA 4D8PA 1JGUH 4S0SD 1HSAA 3NCYS 2Y36L 1ZLSH 2FX8L 3VGEA 1JPGA 2QSCH 3RA7H 1YECH 5HBBA 3C6SA 2D03H 2CXKA 2GAZA 4YBLC 1F11B 1LO2H 1FVEA 1S5HB 4PJBB 1FFPB 3GM8A 3GHEH 2KUTA 4RGND 4K23H 4FQPA 2C1PA 5ALBL 3G04B 3MV7E 4NWUL 4K71B 1W72A 2CPCA 5HHNB 1AKJA 1BECA 1MRDH 1IAOA 2VE6A 4PGJA 4PP1C 4DEPB 5J6GA 2VAAB 3VRJB 4ERSL 3FT4B 1ZV5A 3RGVB 3BOVA 5F9JB 4K3JH 4OLZH 4PP2B 1D9KC 4ORZC 4FQXB 3DX6A 3VGAC 3TBYB 5EUOF 5MP6H 2E7LA 3FB6B 3ZDYE 3GMPB 2OJEA 3UYOD 3F12B 2OS7A 2X40A 4JZJA 5I1KL 2V9RA 1BQHB 4W6XB 2BFVL 3BP7A 3IXAB 5BZDA 3TO4C 4LCYB 2ADGB 4WUUD 5D93C 2UVEA 4ZTPH 5L2JB 1C5DA 3GMLA 3LKQA 4JFEB 1GYAA 2OXHA 3KNBA 4HUNB 5GRUL 4RRPA 4Q9RH 2L7JA 5ALCH 3RQ3A 4NRZB 4G5ZH 2OTUB 3S4SB 5BV7B 5J13C 5TE7H 1WTLA 5C0BB 1IGMH 4I2XE 3VRIA 4KROD 3DGGA 5D6CB 1AC0A 1GPOH 5T3XE 1UXSA 5TH2A 2APBA 2Q3AA 3HUJE 3MRNA 5I1DA 2PXYA 1JRHH 1WICA 3EFDH 3UO1L 3HAEB 3JWOH 5DMJB 1AHWA 1TJGH 4XNZC 1PEZA 4ZUUB 1YEEL 2GT9A 4O5LH 1MCDA 4GG8B 5KAQG 1H8OA 5IB1B 2C7UA 1EUUA 1IGIH 2XTJD 3FFCD 3G5XA 3KPPB 4IRSB 2NPLX 4NQXA 4Q7DA 5J3HD 2PXYD 2QR0B 4CKVX 4NJAL 3REWA 5C2UB 5FGCB 3SKJL 3MJ9H 1D5IH 3EAKA 4JRXA 5DFWH 2ICCA 5IM7B 2YUVA 3INUL 4N1EA 1L7TH 1ACYH 5IB2A 1Q9OA 2LV4A 3CJJA 5EZIL 5BS0E 1RZJL 1QSFB 4PJEB 4ZOCA 4A2LA 5I75B 2LU4A 1IAMA 2OBGA 4I48B 1P69B 5I0DA 4NYLB 2VJXA 2SEBB 3BKJL 5GRYA 1AIFB 1N0XH 5JW5A 3QG7H 1I1RA 2NX5B 2WUBH 1S5IL 1HYSD 4Q74A 1A02N 1LQSR 5DI8A 3FMGL 4N5EC 2IPUK 3RAJH 5KN5A 3RIAF 1J8HB 2OL3B 3GB7A 4WO4D 3QT2A 5D4QA 1J18A 1KCRL 3RVTD 5J57B 2WV3A 2JCCF 3H9HB 1S9XA 4FG6D 4JHAH 5I74C 4ZPTA 5K33A 5MEOA 4QTIL 2DQFA 3DBXB 5E95B 3HE6C 2X09A 4LVOB 4D9LH 3J8F7 4S1RL 1I1AC 1LK3H 1LDPL 1F11A 4YC2C 2D7TL 1MLBA 4PREB 3TBVA 1YNKL 4IJ3C 3MLPA 5HI5D 1QQDA 4JPVH 4L9LA 1MCCA 4N8VG 4PLJD 1HQ4B 1VPOL 2E27L 4NKOA 4DGYH 4ORGA 4G9DB 1FFRA 1VGKB 3N1QC 4ELMF 3UJTL 3IAGC 4JRYD 2CRYA 2WZPD 3KXFB 4JEGB 4OUUA 5C8JB 3O2WL 1QSVA 1IBGH 1W8NA 3V0VA 5LGHL 4GAFB 1YEHH 2EDFA 4KDTC 1MIEH 4LCUB 1AKJB 4ZS6C 4TOYL 1MJ7H 1LO3H 3IDUA 1JGEB 3RVTC 4KQ4H 1LEKB 4PJ7B 5ANMA 5EH1A 5ID1A 2F15A 1YMHB 5FM4A 4P9HC 5GGQH 5DD0L 4J6RH 3P9MA 3JBG7 1M71A 1FRGL 3U0WH 2X1XR 5J1AB 4IOIA 5F9DC 2GJZB 4JGMA 4KK8C 2AAVA 4IMKA 3QHTC 3WNOA 1U8QB 4CU6A 2EYSB 2RHEA 2JIXB 5D7IF 1TZHA 4RMWA 3L1OL 5JHDA 4S1RH 3UTTA 3WKMH 3VFMB 5FDWA 3LQZB 3SE4C 1A7OL 4KQ3H 3SE8H 1PBYA 1DANU 1GHFL 3P73B 2A9NL 2V2TA 1MLCB 1N5AB 2ZSWA 3O6LL 3NGBB 1T04B 4M5ZH 2XY1A 1F8TH 1U3HB 5KTEH 4OLWH 3D6GA 2LTQB 4X6CE 4DKDC 1LO0L 3ESUF 4PRAA 1QSED 3WFHB 1QLRB 2PXYC 1LEIA 4WUUE 2XPGA 5CKGA 4RMTA 3UBXB 4PJFE 4TSBH 2QADB 3QFJE 4L8BB 2G5BB 3GSNB 4F33B 2X1PA 5JO5A 4U49A 2P5EB 3PGFL 1AC6A 3SGKC 3H2WA 1F8TL 4MXQC 1ZT4A 3QO0A 4CGTA 5HDQL 4MXWH 4OF3A 4LCIH 3VXNA 3QIWA 4JQXC 5A16A 2DS4A 3WHE1 2J4WL 3NTCL 3D39E 4WU7B 3R1GL 1JYXA 3EJZD 3HC0A 3TJEL 4R96B 4ZS7H 1XF1A 4KTYA 1GSMA 3SE9H 3EOTL 5EWIH 3QDJD 3FHAA 3GSUB 3R8BB 2DDQH 4L8DA 5D1QA 4C55A 1NLDH 1NEZG 1ORSB 1WAAE 1F3JB 2VLJE 4HX1B 2MTPA 3I3DA 1F4YH 2H32H 2FLRT 2Z92A 4LARL 1FL6A 1HKLH 3QJFB 4JGJA 3VG9C 1KENH 5DMKA 3PHSA 2YPLB 4JHWH 5D93B 5CBAB 3U36A 2B8OT 5T3ZD 1BGXH 1MCWW 1MCIA 5CWSB 5CEZH 3IU3A 1PDKA 9CGTA 5BW7C 2BJMH 4LDLB 1QRKA 3PWLB 2LU7A 2ED9A 5CKAA 3NFSH 4XXCA 4K94C 4JANA 2PW1B 4J1UA 5FYKL 2HFEA 1KB5B 3F7YA 2ESVE 1TVBB 1SEBA 4PJHA 1ES0B 2ARJB 5HGHB 1ZGLA 2UVFA 2GJ6B 3RJDA 4OZHE 1HOCA 5DJXB 5C0AD 5DK3A 3QXUA 2UUDK 3IJYB 4M48L 5EIVA 1MUJB 3QR2A 3FO2B 2CRIA 2MQ3A 5KBNC 1NJ9B 1IGFL 3PQYB 5C0JB 3O2DH 3DIFB 1WFTA 4IRSC 1GGCH 1HNGA 1LO0H 3WJLC 3BW9B 3BUTA 3MLWL 3PUCA 2O5XH 2MFNA 1I9JL 4FXKB 2C7UB 4ERSH 4JN2B 5C0AA 4PJAE 5ESVB 4POZC 2IBZX 1HIML 1JV5B 4ZAKB 1AGEA 1UXWB 4U1LA 12E8H 4JFDB 3L5IA 1M05B 4PV9B 2VZ1A 3KPSB 2X2YA 3MXVL 3W0WB 4QRQB 3OJDA 4XRCA 2V2XA 4S10A 4JAMB 3K1DA 2ERJB 1A9BB 4ZO8A 2AK1L 3SDCD 5ILTH 2QLVB 2DQEL 3RTQD 4JFEA 1HHKB 4ENEC 3O9WC 1S7XB 2Y5TA 1TITA 2Q20A 4HJ0C 3DX9A 1MOEA 5I30H 2AGJL 5T33L 2CDEB 1C08B 3RIAK 3P4NB 2VO5A 2J1KA 4M1CD 4MD0B 3X12A 2FSEA 1MCKA 3OKMA 4NBYB 1GL4B 4KWUA 1IC4H 5KW9H 4HCRL 1X6NA 2R9HD 3VXSE 4HJJH 3T09A 4DGIL 3RZCA 4RQQB 3DO3A 4QXTB 5HGGS 5CIPH 3WL9B 5IG7A 3BYTA 5MHSD 4TQEL 3U79A 1L4IA 1LILA 2NZ9D 3E6FB 1UYWH 3KPPA 4IRSA 4YHPA 1NMAH 1N2RB 3RWIB 2WBJB 1N64H 1NMCB 4L9LB 3NABH 3DO7B 4E5XB 1KELL 1FFPA 3FO0L 3X14A 1UEMA 3RRQA 2WQ8A 3PWPE 3K74B 5IBLC 2DYPA 3RBSA 4BQ9A 3Q5OA 5F7HA 1JNNH 5HVGB 3VFOA 4GS7C 4LLWB 3ARED 2XACC 1OQXA 2Q7NA 3QZWG 2DIBA 3H3PL 3VFWA 3TZVA 4YDIL 5CP3H 4HS6B 2X4NB 2Z35A 1X4ZA 4KU1A 4ZFOB 1CDJA 4MLSA 4NZJA 3MNWB 5F7UA 4O00A 1RZKC 4KMTH 1MAMH 1BREA 4K07A 5CLTA 3DSFL 1KELH 4Z8FL 2ATPB 2H9GB 2O61A 5IQ7H 4DK3A 4JFPA 5C71A 1RUMH 4XAKD 5DMKB 3T3PE 4FQ1H 2FX7L 4OLXL 4FQ2L 3FL7A 4FNLL 2GY7B 5IF0B 5L6YL 1Z9OA 3RX5A 3JTTB 1KC5H 4LHUA 2V7HB 1CVSC 5EDXA 4WUKH 4KKBC 4FQCL 3N85H 4RISL 3QWRD 4D3CH 3MOBL 1T3FB 4WGWB 2ZUYA 5CP7A 5EU4A 4U1HB 4Z0BH 4Z7UB 1FFNA 2C3VA 3NH7H 2VZSA 2BVQA 2IGFH 3HC0B 3IDGA 3LKRB 3T8XA 3NACL 3SQBA 3RHWK 4XP5L 2Z8SA 3QH3A 5B4MD 1I9EA 5GRVK 4K3EH 4XH2A 4XCEB 1UEYA 3DX6B 2BOBB 4YHZL 1FNFA 4X6DF 5EFIA 1H3WM 2PCPA 2D7PA 1LO5A 2GT9B 3MLVH 1ONQA 5T3XD 1F2XK 1FORH 1URLA 1U8KA 4LSUL 2NY6B 4LRNH 4GAGH 4OTXL 2YPLA 3MPCA 2C9AA 2V7NA 2X4PA 3LAFA 4P49A 3S4SG 1C1EH 5CGTA 4ETQB 32C2B 1UKQA 4IEFB 2JB5H 3GK8H 3FQNA 3BP5A 1UACH 4PJ8D 1U58A 1FRGH 1LEGB 4K3HA 1KJVB 1TTGA 2DJUA 4YNYA 3VRLE 2R15A 5L9DH 3SHSA 3RI5F 1OB1B 2B2XL 4YGAB 1P53A 5ENWA 3UC0L 1OTTC 5ADPH 4U6HA 1OCWH 2APFA 4OUUB 4RAVB 2ENYA 4TNVF 1R3LA 3G6JE 2EDOA 1B4JL 4QHUB 4Z0XA 4QXGL 2N1KA 2HH0L 2OXGA 3MC0A 1IE5A 5EPMA 3GDBA 1YNLH 1D5MB 2YOCA 5IB1A 3ZT6A 2VZTA 5HYQA 3BDBA 5ANMB 1ITCA 1N8ZB 1DVFB 3KLAB 5DO2D 4GG6E 4FQIL 1JHTB 1RZGA 3WHE0 1ADQH 1XGPA 2NW2A 4YIQA 3KAAA 2HT3C 4ZD3H 4Q0XL 1U3YA 4ZPTB 5MEOB 3HC3H 3ARFC 4G6FB 3MREA 4OV5A 2AJUL 4P5TD 5K9OB 1INEL 4E41D 1RK0A 1I1YA 5B38G 3U83A 1JHLH 3B5GA 1NJ9A 3MRDA 3HR5A 2X4NA 1AY1H 4AL8H 5ICXB 4CU8A 1AR2A 2SEBA 2R39A 4I18B 4MQ7A 3PABB 5DUMH 4PRBA 4Y5VB 2D9QB 2YD2A 2VLME 3FB7A 4QRUA 1OP5K 2BNRA 4P2RB 3HI1B 3UTTD 1Z5LB 4R4BB 1AXTL 5D2NA 1DUZB 1NL0H 4HWBH 1FBIL 2P24A 1BFVL 4TYUA 4FTVB 3PL6B 3O2VH 2EH7H 1HHHB 4DN4L 3V0WH 3A6BH 4MXWL 3B2VH 4WNQA 3V5HA 3V6ZB 1TCRA 5J6HB 4DK6A 1E4XH 2ZZUT 3DPBA 5DEFB 2RIKA 2VWEC 5C0GB 2FX9H 1WF5A 1DQQA 3BJLA 4GRWE 4X5XA 1NSNL 4JPIB 4R0LC 1WBXA 1K6QL 1CXEA 2CDFB 2A73B 1DN0A 3O3BB 3L3GA 3O9WB 5C2BH 4S1DD 4XNXL 4OFPA 4YBLB 5D7KE 3F6LA 3RUGF 3BIBX 5BO1L 4OGZA 1BQHG 5CD5D 4NHUB 3B2UD 3TVMC 1IZKA 1A21A 2BCKA 2AV7A 3MGOB 3BEVA 2E9JA 3TBTB 2UYLB 3RJQB 5FB8A 5J06A 5JXAH 3RGVC 1MQ8A 4HLZG 4JZOA 1U36A 3G6JB 4WHCA 2Q8AL 3RIFF 1A8JH 4H8WH 4JFPB 2VXQH 2JJUA 5DFVC 5IFAL 2JK5B 4L9LC 4RFOH 5D7IE 1T7XA 2CO6B 2YC1B 5B8CB 3L3IA 4DZ8A 1B0RB 2EDTA 4H5SB 4XBPB 1IC5H 2KKQA 3RKDD 1LNUA 4PYHA 1GC1C 5BXFA 4L4VA 1YY9D 4NKDB 1BEYL 4KHTL 5EOTA 3SDXE 4Z7UF 1CIDA 2E6QA 4HG4K 4D9RE 4PJ7E 3KLHD 3QEUB 1QO3A 3IT8D 2XZZA 4I3RL 1DQLL 3KLSA 3U2SA 1Y6KR 4YBHA 3GSWA 2CR3A 3TNMB 2WIIA 1VPOH 2E27H 2A9MH 4Y0GA 3WO4B 4EOWH 3QEHA 4WY7H 1EEZA 5EUKB 4UMGA 4XTRC 1AO7B 1CBVH 1W72L 1SBSH 1MIMH 1WZMA 5AYUH 3VGHA 1E6OH 5T1DH 5LJYH 5IW3A 1HHGA 5IKCA 1EAPA 2IQAA 5C0CE 1EDQA 5D7JC 4MCYA 1FHGA 1NUFA 4JZNA 4OCXH 3JWDH 4DUWA 4HWUA 3OB8A 3TO4D 3PWNB 3EYSL 4U1HA 3O4LD 1GZPA 4Z95H 5IB5A 2ZCLL 3BAEL 4P48A 3BGMA 4CVXA 1T5XA 1N7MH 4Y2DB 2R29L 2ZCKL 4NHCH 1EAJA 1FVEB 5DQ9A 4L8DB 5LAXB 1PX4A 1D9KD 5HYEA 2OQJB 1UADC 4OCNC 4TSAL 1MHEB 4OFVA 5FKAA 1GOHA 5FGBA 4XP6L 4UIKL 1A6UL 3SGJA 4ZFGH 2ADJA 3MLYH 2A2QT 4CNIA 4PRIB 1NPUA 3IKCB 1A7PH 4MS8D 3C87A 2R56L 3BD3A 4WWKC 4GW1B 4OZIB 1SYVB 1TETH 1PG7X 4DWHA 5J89A 2GSGB 2J3SA 3EUUA 4Z7OE 3R4DA 5C70A 4M61B 3SGEH 4UTBL 8FABB 4QCIA 2G75A 2GJ6D 2QBWA 4FQ1L 2L4OA 4XC1H 2AEWA 3ZDYF 4X9IA 4OCWL 2HT4C 2PR4L 3MBXL 3ARVA 4CJ0A 1CLOH 3KPNA 4J6RL 4EEEA 2ZCHL 4NO0B 5DJ8B 1CT8A 5IB5B 1NCTA 1CK0H 3LKSB 2VN7A 2DQDH 2WWKT 5H2BA 1NKRA 1CDIA 1OAUL 3M07A 2HTKD 4PS4H 1XAUA 4J3XA 5FGRA 1HK6A 1UJ3C 1SM3H 4V1DB 1OPGL 3ROOA 1YPZE 1BD2D 2FEDD 4X4YA 5KS9B 4L8CA 1KPVB 5DA0B 3ZDZF 2FCBA 4LF3A 1A3RH 5EZOH 2AI0H 3LZFH 4HIXL 1JGDB 5IJKA 3E8UL 4KK6C 1ZEAL 3ARUA 3L3JB 4GG6F 5FK9B 4U1IA 4JR9L 3VXUB 5F1NA 5DJYB 3FRPG 4LHJB 2BRRH 4R4BA 1UH4A 4ZNCD 4OZGB 4G8EB 1BM3L 4I0PB 5IVZB 1VFBA 4AG4L 2W91A 1IJ9A 4H1LA 4Y7MA 2B1HL 4J7RA 3ULSA 1ZS8B 1P4LB 5TQ2H 3PV6A 4P3CL 2C4FT 3OKLB 3BZDA 1I85C 4AMKH 1UH2A 3IETB 1LDPH 2H1PL 3QDJA 3MJ9L 2IAND 4QRRB 1KLGA 4P3DA 4XVJH 1Q9LB 4QRTB 5TFSL 2Z8VC 1S9YA 1N26A 4L4TB 5KAQF 3VXMD 5F7NC 4ZTOL 3GZKA 2JKXA 2EIZA 5GGRA 2AXHA 3TJHD 1KG0A 3RWFB 3ETBF 4HDIB 2IAMC 5DSCA 2YPKA 4U1KA 4QRPB 5FYKU 4GG6A 5KS9E 3S7GA 2VRAA 1MFCH 3CH1B 4LHUD 4G7YL 1WZLA 3RVXD 1JWUB 3BZEB 4V1DA 3BN9D 2EYTA 5J9PA 3ZSTA 3HLAA 2F8OA 5HYJA 3WFEL 1OF2B 1MCEA 3KYAA 4PBVC 5LBSL 1QFHA 4PD4K 4FQQA 2CMRH 4BJLA 1W0VA 3P2TA 4IIQA 2EKSA 3QRGH 3GSNL 3UYRL 1DANT 2WANA 2OR9H 2Z9TA 4M7LL 4OZGA 3GSNA 4KKLD 4N68A 3EZ8A 4V1DD 2DMKA 4NFDA 1I1CA 3FQUA 4PJDE 1CFQA 3VFVB 1Q38A 2W0KA 1J88A 1ZWIA 5AYQA 5SWSA 5JW3L 4BKLA 3WCYA 2G5RA 4HIHA 3MV01 5GHWL 4OLYH 2R0LL 4P4KC 5J8OA 1DN0B 3O9WA 4P4RB 5HHPA 1ZHLB 4BSVB 4KKCD 3GUTA 1TDQA 1BPVA 1CDCA 5C3TA 3LPFA 5A43C 5CGYD 1JZ2A 4G8GA 1AJ7H 3WS3B 1VDGA 2OM5A 4NSKA 1RZ7H 3F7PC 5E8OB 2YPVL 4QRSA 3MUHL 4UNUA 2BVOA 1PG7W 4GUPB 3D39D 3O3EB 5FECB 3P4OA 1KGCE 3UAJD 2ZWLT 4ODUA 1N59A 1I7TA 3K4ZA 5GGVH 5CIPA 3ILPA 1CXFA 1XT5A 4LL9A 1X5LA 5DMGD 2ZUQC 4DEPC 3C2SA 3VA6A 1CGSH 4OQTH 1OPGH 5D1ZD 5ICYA 5LGJA 3IJHA 1K2DB 4UAOC 2X1OA 4H8WC 4WHYH 4WTZA 3FFDA 1ZT1B 2CIIB 5JTWA 5CHNA 1DSFL 1H5BC 1GXEA 3SGEI 5MEND 3OPZL 4WGVB 5EORH 4G43B 1PYWA 1YEIH 2YBRB 3BSZH 3BVNB 3HRZA 4WDIB 5F21B 5TDNB 1BIIA 1DJSA 2PR4H 5HHPB 4CUCA 4YDVA 2NY4D 5EU4B 1C7TA 4R6UA 1DQMH 4P9HH 4JFOA 3U48A 4OQTL 5E8EB 1A3LL 1KCSL 3HE7C 1AD0B 4PJDB 4Y1AB 2MHAA 3K7UA 5D7SH 1WBXB 4U3HA 5FAAA 4M7KH 1QR1A 3S98A 1KBGH 4S1SH 4K3JL 3UZQA 4MYWB 3FQRA 2GK0A 4XVSL 3I6KB 2G5BA 4F33A 2FLBT 2MOVA 1MFBH 4X7TB 3NIGE 5D1XD 3MV7D 4A6YA 5D7JB 3HNTH 4FTVA 1G7PB 4JFXB 1HHGB 5IKCB 1JPTH 3ULUF 4G42A 3DWTA 1KXQE 4S11A 2CIKA 15C8L 1A6VL 2Z31A 5GISL 1T66C 3BKCH 2AJYL 3LOWA 4ZYKB 1MREL 2HG5A 4Y19B 5KZCB 1EH9A 2HFGL 4DKEH 4OZIA 5TGBB 1CLYL 4JQVC 4Y4HA 1YEGL 3BWUC 2CKBA 5F1SA 3CFKA 3VFOB 2PW2B 3U1SH 2YRZA 3WJLA 5KG9B 1CXIA 1J0KA 5FUOH 1TNMA 4Q2ZB 3RL1A 5IMKB 2IPTL 3L3KB 3M8OH 1EA9C 1JGLL 3RUGB 5FM5M 2EC8A 5EOQH 5ACMA 1U3HD 3STLA 1RUAL 2ERJC 2YMXH 2MHAB 1B88A 5GJSL 3O8XD 1CD9B 3QG6A 1D5ZA 1UG9A 2ILLA 1JWUA 3BZEA 2AEQL 1GIGL 3G6AB 1EMTH 1F42A 4U6XA 2WSKA 3U4EB 4K3DH 1A7RL 3OBAA 1DBML 3KLAA 1I4FA 3LKOB 3QWRA 3O6KL 1Q0YH 2E7CA 3X12B 3D0LA 5C0RL 1A0QL 1RJZB 4R90L 1G0YR 1RVFH 4WTXA 3FT3B 3QI9A 1TCRB 3LIZL 4R3SB 2MCPH 5BOPA 1FAIL 2G9HB 3TBWA 3D3VE 1KJ2B 1NFDA 4TUOB 1CD1A 1NCCH 4JKMA 3GMMB 2W9DL 1RK0B 2VXVH 1BJ1H 5E8DL 5JXEC 4PJGB 4P3CH 3U0TA 4R4ND 4TOYH 5F93C 3PE9A 3JV5A 2FATL 4NO2B 4OT1H 5AUMB 1S78C 3H7LA 3B6SB 5IT2L 2FO1A 2F53E 5D71H 3WNNA 3AC0A 3OF6A 5F7KC 5FGCE 2W07A 2ARWA 3C6LD 3X13B 4NSKB 1ERNA 5HHXL 4XWOD 4KRMB 1K3IA 3GIVA 3UXFA 4ZOEA 1HHJB 4PGBA 4JRXD 4DGYL 1WZKA 2YN5A 2HVKB 3VDAA 1D5BA 1OAQH 1SJXA 3F7QA 1QRNA 5C07D 4DQOL 1U8MB 5ADOH 3MRLB 4P2RD 3D9AH 2E7BA 5K9JL 2R2BB 4N90E 3O6FD 4K94H 3TT1L 2A6IB 3FZUC 2IEPA 1BBJA 3BW9A 4LVEA 2HJLA 1IILE 2MNUA 1Q9OB 4HIJB 4QOKA 1MCSA 2R0ZL 1V8HA 3OAZH 5KVFH 2XWJB 5DWUH 4RFOL 3FRPA 3L7EB 4U05A 5TE4L 1XR8A 5T5FH 1KJ2A 1NFDB 5D9SA 3L5HA 3RAJL 1SYVA 3IYLW 4P23C 3QIBB 5EU3A 1WLHA 2QQQA 5SWSE 1S9VA 3WE6B 1DEEB 1WISA 3FB5A 3C5ZD 4IRZH 3UTPD 1T0MB 2EYTB 5J9PB 5CP7B 3I9GH 5I1IH 3L9RA 5F6IC 1NUDA 3KGRA 2H32B 2FBJH 3BH9B 3CUPA 4U4BA 1P84J 3TV3H 4UT9H 2CD0A 4RAUB 2DJSA 2LE9A 5ACZB 4Z7VF 3ZDXE 1Z0MA 3E1F1 1NL0L 5TF1H 3BHBA 3MRNB 4G6AC 5I1DB 1YYML 4FQLL 1X5GA 3TNMA 5BV7L 3NGBC 2WUCH 1JFQH 4K7FA 4XX1E 5I1AA 2Q76A 1NSNH 3KYKH 3MYJA 3TFKD 5CS7A 1Z3GL 3RU8H 1KSRA 4P4KB 3IVKA 1ZT7B 1A1NB 1TJIL 4OB5H 1RVFL 5HVWA 2VLJD 2YEZA 2R2CA 4BQCA 4NWTL 4FMFA 5ICXA 4G8EA 4YXKH 1T7VA 4OLEA 2YKLH 2W0FA 3GI8H 1BFVH 3D69A 4YGVA 4XNYH 1HH9B 2H3NB 3MUGB 2BSTA 5F6HI 1YN6A 4C4KT 1RUKH 3IJSA 1JGEA 4L1DA 1EEYA 5GRJH 3JWDC 4MSWB 3MNVA 1MI5A 1IQDA 5EIIA 5FO7A 3WUWB 3EYQC 5DJZB 4MNQD 1NGXA 1IKNC 5EZJA 3H0TA 4HBCL 1GGBL 4Z7VB 5IIEB 4MNGA 5CZVL 4R97B 1A7NL 4HMDA 5CMAB 5DVOA 2OJEB 1WEJH 5EBWB 2P5WA 4MX7A 2NX5A 5DHVB 3S35H 5DJ0B 1UCBL 1H5BB 3WNKA 1QFUH 1OL0A 3P0GB 2AXJA 2BNUA 3MCLL 4D2NA 3N0PB 1G9NH 2V7HA 4OGAC 3DMMD 4HWBA 2W0LA 2EDDA 2F8VA 1DVFA 1U8HA 3DNKA 2XA8L 1EO8H 2NY1C 3OL2A 4L3ED 4AEFA 3DUSB 4C56A 5CUSL 4PY7A 1UVQB 1JWSB 3BKML 2XIDA 3LMJL 4E0RB 1F02I 1OM3H 3PHOB 4XVUD 4HULB 2BVUA 1G7HB 2DLFL 1LO4L 3ARBD 4YHLH 3O11B 4IDLA 5TDPA 4LVHC 1RK1B 2KQMA 4MLIA 3WV0A 1N3NB 3RY5A 3DETC 4TUJA 4F9LA 2ZKHL 5BRZB 4C83A 3H9SE 4HZAA 1OAXH 3NN8A 3T2PA 1BWWA 4AIXA 4CDHA 2D31B 5JIKA 4ALAL 5GSRA 3D87B 1E27B 5DJ2A 2VDRL 3B8SA 4PG2C 2P49B 2NW2B 4YIQB 3ZE2E 3FB7B 3W9DA 2X4OA 1UM6L 3JSSA 3MA7A 5CILL 3JV4A 2K7QA 3MBED 2BHYA 4NNXB 1EBAA 2BNQA 5H35B 3B83A 4ISVA 1RIHL 3BH8B 4M62H 3D0LB 5E2VL 4OD2B 5D1QD 1XIWB 4F7CA 4ZXBD 3V5HB 1CE6B 3HC3L 1H8NA 3IJHB 2BXYA 3TWCH 2DIJA 3BH9A 4YHNA 3EZJB 3IDIA 3HB3C 5CJXC 3HE7A 2BNQD 3KHOA 1MCLA 4KV5E 5HYIA 4ZTPL 4R0LB 2GHWB 4YEFA 4YHMH 1EHAA 4J4PA 1KJVA 5C0EB 4OF5A 4UT7H 4GUPA 1AGDA 4AIZB 2EZ0C 2QHRH 4HCRA 3VFRB 1GGCL 4HG4J 2VLKD 1OF2A 1FZOA 4ZO9A 1E27A 4LVNC 3SDAD 2DN7A 3O2DL 1QLRA 1J8HA 2AGJH 4XPTH 5T33H 2EC9U 4PRAB 1FNSH 1XZ0B 4TULL 4J4PD 2R2EB 1IC7L 4H1LG 2JJWA 4CAGA 3G9AB 1HH6B 5HHOE 4IDJL 1QRNE 1DP0A 3C5SB 1H3TA 4E41E 1FLRL 1NGQL 2B5IC 1YQVH 1M05A 4PV9A 2YSSB 3LD8C 1EV2E 3GMLB 1OTUC 1CL7I 1CLZH 3MV9D 1F3RB 3LKPB 4CVWA 2DD8H 2HLAA 4G6MH 5HJ3A 5MERB 1EXUA 4ZUSA 2GUOA 4UIMB 5A2KH 3EYOA 5KSVA 3ARGA 3SY0B 2AJSL 5EU5B 3V6FB 5IUSA 2VH5L 2WBJC 4RRPG 5D2LA 5I19L 5FOJA 4N8CL 3QNXB 5ERWA 3NFNB 3NCJL 5MENA 3V6OA 3GIZL 1G7QA 1J5OL 4K8RD 3AM8A 3VH8G 1NLBH 1AGBA 1XR9B 1J0IA 1XF4A 5ID1B 3QHZL 2Z92B 1OSPL 1YC8A 3MBXH 4CW1B 1HHIB 2FGZA 5KSAA 3VI4E 1P4BL 4KC3B 2AJXH 4JVUA 4LPCA 3FFCE 3SE9L 2D3VA 3MOAL 3T4AA 4PJ5E 3W2DL 3S88H 5I18H 4Y16C 1CVRA 1CT8B 3I85A 3U6RA 2ZP0T 3BQUD 3QIBC 1UKSA 4KK5C 3L7FA 1KTKE 4JFZH 4HC1H 1AJ7L 1NDMA 1L6XA 1V7NH 4JO1H 2KDGA 3CXHJ 2ADFL 2DRUA 2AQ2A 4UV4H 3T4YA 5J56B 3PWPA 1RQ5A 4U6YB 2Z31D 4WEBL 5ISZE 4JVWA 5SWZE 2KBGA 5E2VH 2CR6A 2WWMC 3A67H 1SEBB 1K8DA 2RR3A 3CXHK 1ZGLB 5IBTL 2FL5A 1U8OB 3HPJB 5FKPB 1KEMH 3X3GH 1N7ML 4F9LC 1JV5A 3CVIH 1J1XH 3ARGC 5DD5L 5I8KL 4EDWL 4UDUB 1S8DB 4LAJH 1NDGB 1CLOL 5C08E 1T2JA 5C09B 3D18A 3I9GL 4IRZL 4HZLA 3ZMRA 4MNHA 1GVIA 3O8XA 4HJGA 4NQCB 4RMSA 3TIDB 1ZT4B 3QO0B 5F8QC 1QBBA 4Z78A 4WWKB 1P6AB 1V3LA 4JZOB 1LO4H 1NBZB 3PP3H 4YHLL 1QKZH 1KFAL 3WNPA 3QDGE 3G08B 1TCMA 4X6BA 3V4UH 1WWBX 4XNUH 1ND0A 3DECA 5DD0H 4H25A 5ETUA 3CGTA 4JFOB 3S37X 4C59B 3JUYA 2BVQB 3MRRA 3NIFE 5GSVB 4JM4H 2ICEB 5KOMC 3IDYB 1YN7B 3VXRE 1MIEL 1JZ5A 3RX7A 4DKFH 4CL7A 2AW2A 3T0DA 3CX5K 3KYOA 3SCMD 4JFFE 3GKZA 3LEXA 4HPOH 1P4IH 4TPRL 3F7VB 4NIKB 2A6DB 4GW4B 3GGWB 3RY6A 1KIQA 2A0LC 1HH6A 2BDNL 3C2AH 4XVTL 4JDTH 4JFYA 1GGIL 5FYKD 1XZ0A 5IVZA 1IC1A 1UJ3A 3SN6N 1LEIB 2X4PB 3ES6A 2EEAA 4WI3A 3MXVH 3V7AG 4GLRI 2NY0C 2PF6A 4KJPD 1DVFC 3P0VL 3ZTNH 2PYEA 3R06B 3FQXA 2BVYA 3N9GL 5T3ZL 4PPTA 1IEHA 3RL1B 3OKLA 1BF8A 4GT7A 4MJ6B 1CFVH 1TZIA 5EU7E 5H8DA 1MLCA 4XH2B 2KPNA 1AR1C 2J8OA 2DYPB 3VDCA 3BPOB 5I1JL 5AD0A 3MO1B 4GAJL 4WFEE 4WW2B 2FB4L 3GJEB 1G9ML 3C5JA 4HFUH 4JZJB 5DZNA 5ESVA 4KK9C 2PTTB 2NMSA 4FXKA 3FJTA 3HRPA 5HYJB 3WFDH 3V0AC 3OAUL 1PJ9A 3RWHA 1K6QH 1H3PH 2EIBA 3UBXA 1J11A 4K9EC 4KI1A 2J6EL 2VZUA 3LV3A 4FQXA 4HBCH 1XIWC 3KPQB 2G75B 2CRMA 1UENA 1EPFA 4MXVF 4X5LA 5C9JB 4PJGE 4BM7A 1VHPA 3KPLB 1QBML 1U9KA 4XVUC 2HYMA 5IROA 3V4UL 3U1SL 3X17A 5GZNC 2EE9A 1QNZH 3QQ3A 4TVPL 3ULUC 3MNZA 4WFFE 3IKKA 2X4SA 4NKIL 2K3TA 1XF2B 3VD9A 1CD8A 1FGNH 1NCBH 4HUMB 5CGMA 3TIEB 4KMLB 1MSPA 4X5WA 3V4PL 3BKCL 3EO9L 5JMRA 5I66A 4U6YA 1S7XA 2IPUG 2Y5TB 4OGAD 4X6DE 4PRIE 4X6DB 1IARB 5DTFB 5FGSA 3MV7A 4G8IB 5DUML 1BFSA 2R1YB 5C6TH 2ORBH 4NCC1 2J8UA 4DW2H 1CFSA 4PJ9D 3VMNA 1OOAA 1JN6B 3HI5H 2KZ1B 5EA0L 4XGZB 5K59F 3IJYA 1IT9L 3FN3A 3WYRA 2HTLC 2IPKB 5BV7H 3T77B 2HLFD 2ITDB 5EULV 2D4DA 3UTQB 2YSSA 5E8NA 4OJFH 3GMPA 1JJUA 5JIIA 2G2RB 4XMPL 1U8PA 4JO4L 2XV6B 4YHPB 1RJLA 2ZUQB 3GRWH 3H9SB 1T80A 4JY4B 4WWKA 1LP9E 2JJTC 4L3EE 2VISA 2C4XA 5ICZA 4MNHB 3O2VL 3BXNA 1PQZA 2VDNH 4W6WB 3TIDA 4WJ5A 1I3RB 1F3DH 1PX3A 4GH7B 5IVXB 1FBIH 2QSVA 4FFWC 1Q72L 4NN7C 3LS5H 1FL3A 2UWEA 3O3DA 2ICWA 1ND0B 3QUYC 3TYGL 4KXZI 1FC2D 3CFDA 2P8MB 3MCG1 2FJHA 1OW0C 2XZAH 4NPYB 3G6DH 2VZVA 5HHOA 1QSFA 4JKWA 2WWKO 5I1EH 2AVGA 4ZXBB 3U9PH 3QUYD 4GLRH 1WJ3A 3EGSA 2VDOL 3HE7B 5BMFH 1YN7A 3MJ8B 4O9HL 3KDMA 3LKNB 3TBYA 1GOFA 4QHUA 1KJMA 4PLOB 1FL5A 4KDWA 4BZ1H 2UV3A 5B3NA 1SEQL 5FA4A 2F74A 3QXDA 1GPOL 3MYJB 4HXAL 3P11H 1DQML 2EE2A 2OL3A 2EDWA 3GB7B 3W5MA 1KIQB 5C0FB 3K8KA 5LG1A 3TA3D 4F9PC 3GUTB 2QQKL 2VOTA 3OF6D 5C0BD 4NWTH 4PB9H 2VXTH 1SY6A 3AROA 4OT1L 2F8XC 1L7TL 1JP5A 3UCRA 4M02A 3O45A 3ARBB 4ETYA 1CDBA 5IESH 1YNLL 1NEZA 3GFUA 4Y2OA 3WUWG 4R0LA 4AT6A 3ZKMC 4O02L 1VCAA 1D6EA 2HJKB 5L8LB 1QRND 4JLRA 3DV6A 2JE8A 4LFHD 4PLNC 2B4CH 3O6FA 5EO0A 3ZYZA 4ZXBA 1RZJC 2VKXA 4M5YH 1LO5B 1N0XL 4YHIA 1JPTL 3ARGB 3MROB 1WAAA 3NA4A 1S7VB 5FIEA 4JM2F 1MFBL 3FTGB 4XCNB 3PDOA 5E03A 2ADFH 1JNHB 3S6CA 3UJTH 3L3JA 2R1WB 3NIDF 1ZA6B 2B4CC 4OD3L 3ARFA 5JDJA 2X4OB 3B5HA 4DGVH 1MCFA 2EYSA 1GH7A 5J11B 4OI7A 4X6CF 3D25A 4HKJB 4AJ0A 1SHMA 4O4YH 3KPMB 2OZ4A 3FB6A 4NC1E 1M6OA 1MF2L 3L3GB 3GBMH 4NKMB 1KJ2L 2CLVA 2VLKA 2HT2D 1R0AL 3BYYA 3L9RB 2X89D 1DQQB 3QEUA 1NANH 3NFPB 4WI4A 5F7WC 1S7WB 4KI5E 1DDHB 1VACA 2EE3A 4MAYA 2DQGH 4WFGD 2ADIA 4LP4A 1I7RB 4HUUB 2XRAH 4OZHA 3IDYC 2VDKL 2CGRH 1KPRA 2BRRL 4P2RE 4WV1C 3TT1H 5KSBE 1HXMA 1CU4H 4KUCF 5GGTH 3NN8B 2X89A 4HGKC 1M7DB 5F88B 5DTFA 5GJSH 4Y5YC 3QSKB 5FUCC 2FHCA 4R2GB 3V5DB 4OZIF 3O4LA 1HI6B 5A16B 5DK2A 1B4JH 1DBJL 5AAMA 2NX5E 3D25B 5GPRA 1A9EA 4MB3A 1OM3L 4KTEH 4NQDD 4R7NA 4Y88A 5C0ND 2W1NA 5C9JA 3MLTA 2P47B 1OCWL 3O6ML 3BP4A 4PGCA 1KCSH 2P5EA 3QPXL 3BDYH 3SKJH 1ZOXA 3IFNH 1FIGL 3QEQA 3U7YL 4KV5F 5DF0A 2MCPL 2Q1EA 1EEYB 1QSFE 3JVGC 4Q9BA 4FQJH 4MAYB 5KANG 3QUXA 1YZZA 3LQAC 1WCQA 3I2CH 3DURA 3VXUE 3NZ8A 2P5WD 4KGJA 1RJYA 3SOBH 3TCLB 1FL5B 5ECJE 5GGSA 2VXUL 3ULVE 4M7LH 3FMGH 1DUZA 4G9FE 3U4BL 4Z7QF 4HWEL 2HTLD 4HIXH 4X83A 1UQSB 4I48A 1I4FB 3LKOA 4HH9B 4IBLT 4MNQE 1GOGA 3ISWA 4LNVA 2ICES 4WCYH 2JB6A 3REVA 5EU6E 1KT2B 3PHQA 5GGRY 4HAFA 3PL6A 4HWEH 3HZKA 3WJJA 1MJJB 1LO2L 5FF6A 5I1AB 2Q3ZA 3DTXB 1NMAL 3L3OA 4KKAD 2E8YA 2V7NB 3Q1SL 3VGDA 3OGOE 4PRPB 4LNRA 2OYPA 3UBXI 3BP6B 4LSRH 4P4KA 3LN5B 4KRLB 2V5MA 2ZUWA 1KCVL 5INCA 3I50L 4XPFL 4YXHH 3RUGE 1P6FA 4R26L 4DVBB 3DV6B 4AEHL 3PL6D 2P7TB 2AXFB 1FNSL 4TULH 4EVNB 3LN9A 4QHNA 3KPOA 2N7AA 3F58L 5I1KH 3IFPA 3BDYL 3MV8A 4NQSB 2EICA 3QUMB 4KPHH 1MIML 5TQ2L 1X5HA 2CSPA 3WFBL 1JFQL 5I8OL 2DTSA 4MJIA 4MNQB 2XQYG 3MBEA 4NM8L 2WK2A 4U1MA 1NC4A 3A0OA 4M7LT 4I5BA 5AZ2L 5DA4A 5IQ7L 3MZTA 2O26U 2ZUXA 1CICA 2B7DT 3WLWC 1SY6H 3O3AA 5I1CL 4P5MA 3D2UD 1JYVA 4HPYH 3VG0L 4OFKA 4KAQH 1F45A 4YPGA 2JLLA 3PXHA 1LD9A 2EDXA 2Z4QA 3TESA 3VGAB 2FJGB 5IW6A 4L4VB 4NKDA 4Y5XB 5CEYA 4UQ3B 2KH2B 2VLJB 3WS6A 4EI6B 4OIAA 1CICD 4R4FH 4Y4KC 1T21B 3QULB 3WJJC 5MEQB 3CH1A 4BH8B 1OD9A 4OGYL 3GJFB 3OXRA 2V2WA 1ZE3C 3WXWH 4LLUA 2E3VA 2WBJD 2V5RA 4OM1H 4OUOA 4QYOA 3VG0H 4NCDA 1CFNB 1G7LA 3MJ8A 1S7QB 5HPMA 5L2KD 1CBVL 3EGSB 5E7BA 1G6RB 1IM9D 3PQYA 5E08H 3KYNB 4KKNA 4N0RA 3V5KB 2COQA 4YJZL 4GKSB 1VFBB 4PJFB 3WBDA 5FYLD 5HD8D 2ICWJ 3ILPB 2GTWA 4HGWB 5I16B 2NXYC 1NFIB 1A6AB 3E6FA 5DUBA 1F90L 2F5BH 3NCBB 2FYYA 2WLYA 4K2UL 4Z7VE 2D4FA 4ODXA 3ZDXF 4NZDA 1QFOA 3CU7A 2ZCKH 4RQQA 2CKBH 3RL2B 2VERN 3OHXB 5GGUA 3WIFA 3OKKA 1BGXL 4G8GB 2DKMA 3SDAC 4JPIA 4HFWA 1UWGH 1Y18A 2AP2A 3AY4C 3RPIA 5CLWA 2R0KL 1X7QB 3B9DA 4KJWC 2BY0A 3P9WB 5I8CB 5IW1B 2K1MA 5DQDL 3MNVB 2A83A 3PNWB 3WUZA 4HDIA 1CFNA 1G7LB 1KJ3H 3NCMA 2XN9A 3ROLA 1AD0A 1F3JA 4Y1AA 1REIA 2ARJQ 4M5ZL 2HRLA 1CDYA 1WBZB 5DEGB 2JJSA 5GRJL 4U2YA 2A6KB 5MHSE 5I75C 1TQBC 3SKUD 1H0DA 5D1ZB 5C7XH 4WHTB 1T89C 4XP9H 1W0VB 2WP3O 3VXQB 1KYOK 1DQLH 4LVNB 3KPRD 3EDFA 4WENB 1OTSC 3VW3L 2ESVA 4PJHE 4XP6H 2ED7A 2VR5A 5T1KA 3CPLA 4P4RA 1XGTA 3EYVB 1LHZA 3VCLA 4HWZB 1AQDB 1DFBL 3FO9B 4JG1L 3DUHA 3RWGB 1XH3A 4ZPVA 3VFSB 1CIUA 3CSPA 1JZ8A 1YQ2A 4MJIB 3DSNA 2AABL 2IWGA 4TRPL 3VXTB 2HP4A 3DETD 1BLNB 2IFFL 3BFOA 4KI5D 1I1AB 5SWZB 4Y16D 3VW3H 1FVDB 2VXQL 2C1OB 4WWKD 5HHNA 1W0WA 4NQSA 4R2GC 1T2XA 4QNPE 1FVCA 1AXTH 4F7PA 2DLIA 2AV1A 3S96B 4PJXE 1A3QA 1A7OH 1I3GH 4U1IB 2A9ML 5L88L 3L6FB 4Y4HB 1YMMA 3RZCB 5GS2D 1C7SA 4GMSH 4MA8L 2HRPL 4G7VH 1XCTB 2J8UF 1QA9A 2X6MA 1NGWB 2W65A 3KPSE 1NBYA 4OI8A 2VQ1B 2XTJE 4GRWB 4IMLA 4JHAL 5F9WB 2W60A 4D9QD 5E6IC 1KXVC 3O6KH 3HHRB 3N9GH 4MAYC 5M94B 1TZGH 3DLQR 1R5VB 4Y16B 5FGBC 4BH7B 2E9BA 4UV7H 3WO3B 4PGEA 4XWGL 3B9AA 3UTZB 1HHKA 1G6RA 4J3OC 1OTUD 5CSZA 2VIRA 3AAZB 4KRPD 1CGSL 2FNBA 1QPXA 2WUCL 4QYOB 3FQRB 3GO1L 5JORB 4JO3H 4XTRD 5IGXH 4J3WA 3IS0X 1T83C 4F7TB 5C0BA 4J4PC 1QR1B 2NZIA 1H3PL 4I0PD 3MJ7B 2FBJL 5JW4N 4LSVL 2DMCA 4OKVB 4WEMB 4ZFFB 1G1YA 4HEME 4X80H 1FZKA 2DTML 3RL2A 1F3DJ 2R29H 3CCHA 3I6KA 1A7BA 4NHCL 4PRDB 5DHYB 3RZWA 3QXAB 1V5JA<