5E6IA

Crystal structure of tcr pf8 in complex with flu mp(58-66) epitope presented by hla-a2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
199
structure length
196
Chain Sequence
QLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQEPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGPGGSSNTGKLIFGQGTTLQVKPDIQNPDPAVYQLRDSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords TCR alpha chain,Human nkt tcr alpha chain
publication title Crystal structure of TCR PF8 in complex with flu MP(58-66) epitope presented by HLA-A2
rcsb
source organism Homo sapiens
total genus 23
structure length 196
sequence length 199
chains with identical sequence F, G, P
ec nomenclature
pdb deposition date 2015-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e6iA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e6iA02
1N64L 5DEFA 4YPJA 4HKJA 3MXVL 2AVGA 4WI3A 5JPNB 1A7RL 4OZFH 3MRRB 3O2DL 5FV2A 2ENYA 5F1NA 5I1IH 3RUGB 1A4JB 4V1DA 3MGOB 5DC0A 3HMXA 5F7DB 2EDOA 1IC4L 3UJJL 1Q8MA 2OR7A 3FHQA 2FEDD 1UWXH 4NQCB 3L3IB 3GKWL 4DQOL 1G7JA 1VHPA 2Q3ZA 4HS6A 4J4PD 3NACH 5C2BH 1S9XA 1T1XA 3ALXA 4F9PC 3MROB 3UJTH 4I18A 2XZCL 4HWEH 3G5ZB 3MRDB 4KUCD 3AS1A 1BQLL 1YZZA 5D9SB 5I19H 3U4EB 2BOBB 1G7LA 2FX9H 3I6KB 4I3RL 5I8OH 3CFKB 5KW9L 1GHFH 2X1QA 1NC2D 3QXDA 1FZOB 1WC7A 5B8CB 3WBDA 4LVNB 1VPOH 3CD4A 4YC2C 2FR4A 3GSXB 3G9VA 4X7EC 1BM3L 1JPSH 2JJUA 5L8KB 2P46B 2AGJH 3V6OC 3L6FA 3O2DA 4GG6B 1NC4B 1FN4A 3K46A 4AEFA 1TVBA 3VFSB 1HOCA 1TCRA 3OKYA 3N9GH 4PJIE 2WWKT 4FQHB 3V0AC 4IRSB 2VLME 3QNYB 4U0QB 1BFOA 5KS9B 4I5BB 1GGCL 3E2HC 2NY1C 3RL2B 2GJZB 3BPLB 1IGYA 4R3SA 1FAIL 4Y16B 5DJDB 3BUTA 5C9JA 1XGRA 1FYTD 4JAMA 1HINL 1AI1L 3O3DA 1OLZA 2XWTB 4TNVK 1FGNL 4K8RH 1OB1A 2OL3H 3RVTD 2MQCA 1JGVH 1FCGA 4UTBL 3CVHH 4MS8C 4I0PC 5DQDH 1U8LA 4CVXA 5I1EH 3EOTL 3C5JB 1NL0L 5HHNA 4G42B 3W11C 4PJEE 2JIXD 5H37H 3O9WB 2W9LA 3DNKA 1T89C 3EOBA 4LGRB 5D7JC 4HIIB 5BW7C 1JPST 1OD9A 4OCYH 3KYNB 1ED3B 4XB7A 3RY5A 4IDJL 4JFOB 3GSNH 4KJQC 2DJ4A 4CNIA 1RZKH 2VZUA 4L3EA 1UWGL 1BGXL 1C5CL 3L3DA 3KS0H 4R97C 4MWFB 3T2NH 5HD8D 3S35L 1T0PB 4K23L 2QADC 2HKHH 1XF5A 4NO0B 2ZG1A 2OSLB 2VQ1B 3EHBD 5TQ2H 25C8H 3V9FA 4Z77B 2EO9A 4LHUG 5B39G 2SEBB 3U6RA 1CFSB 2NY4D 2V7HB 3H3PL 2O26U 2AK4E 3ARDC 4JQXC 1DDHB 1M7IB 3F7YB 3GSQA 4ALAL 1TZHB 4Q74A 4AEEA 2HFEB 1BP3B 3QQ9C 1X5ZA 4BH7A 1NGWB 1LO5B 3QHFH 4PRIB 3CC5A 3KWWB 4XP6H 5E6YA 3Q2CA 3QQNA 2WUBH 4RFNC 4S1SL 1HNGA 3S5LB 3X12B 1RAMA 4GJTB 5IMMA 1I3RB 1P7QB 3GHBH 2DLFH 4ZXBC 4OLWH 2YD1A 1FVDA 1F2XK 4FQXC 3BSZH 3TBSB 1L0XA 1T2XA 3IDGA 3LB6C 1NC2A 4LCCC 5IIEB 5FF6A 4N0YH 5JORA 3LS4H 5J13C 2PO6D 1AGCB 5TDNB 2H32B 3T1FA 1HHJA 4ELKA 2HTKD 3TBVB 2R2BA 3EYSH 2VXVH 1N8ZA 5IBLD 2NY6D 3SQOH 2E7LC 1T7XA 1HQ4B 3GSOA 3GJFH 1ZT4B 1IL1B 1A6UH 2EYSA 3T3MF 4PGEB 2PXYC 3C6LC 4MLSA 3ULUC 3TEUA 2MMXA 4GRWE 4IOFD 4JVPA 3UTSD 2HP4A 4R2GB 1NUDA 2AEQL 3GBMH 3HZKA 4XRCB 3GSWA 5JMRA 1NGYA 4H20L 1YPZB 5DI8B 4Q58C 1PZ5A 1YC7A 2FJGA 3I6GB 4H88L 3G5YA 4PD4K 2MJWA 5ANMB 4RSVA 2C3XA 3MRBA 5GGTL 1EAJA 3UYRL 4L9LC 1F45A 2BDNH 1FYTA 3U1SH 4AQ1B 2D0HA 3MA7B 5JOFA 3RHWF 2GQHA 5IVZB 4D9LL 1TPXC 1MPAH 4PS4H 2YD2A 1I9EA 4ZFGL 5CILL 1EV2E 1R3LB 3W82A 1QG3A 3MFFA 4GAGL 2IANB 2AABL 1OVZA 2J8UA 4WU7A 4AENB 4KKLC 1NGPH 1A9BA 1R0AL 2JIXA 3QYCA 5DLML 4UV4L 1JNNH 1RUAH 4IRJD 4WUKL 3SGJC 2EE2A 3VJ6B 4YO0A 1XF4A 2J88H 3T0AA 4ZG1A 3VGAC 2CDEA 4GKSB 1ZS8B 4MAYD 3I50L 3T77B 2I07B 4JFPB 3W5NA 3OX8A 1DLFH 1UEMA 4XVJL 1LO4L 4PREB 2H8PA 3Q6GH 3Q1SL 5J12C 3UXFA 3AS3A 1U8KB 2F8VA 3B4NA 1LD9B 5DVKA 4DWHA 4MQXC 5T3ZH 4MQ7B 1HEZB 3RUGF 1IC7L 3BX7C 2E27H 3TT3L 1WZ1H 3P73A 3BPCA 2AEIT 3BO8A 3SDCC 3DWTA 5C0BD 2NY3C 4NFBA 1JWMB 5GGTA 3RY6C 5C0AD 3H7LA 1H15B 5CJOL 1DVFB 1RURL 5E9DB 2VMFA 2WIIA 1S7SA 2BJML 4KTDL 3WKML 2YPKA 2QV2A 1J1XH 3VWJD 5DJAA 4L4VA 4F9LA 2BXYA 2YSSA 2OMBA 1KN2L 1OT1A 1GH7A 4NNYA 3S34H 1TJHL 1G84A 5D7KD 3DOSA 3L3HB 1QSFB 4OD2A 4RGND 1Z9MA 3QO1A 4LNVA 1BBJB 4WCYH 1L0YA 3REWB 5E4EC 3S7GA 2WINA 4XXDA 2YOCA 3VMPA 1CE1L 3B5HA 3E0GA 1J86A 3QG7H 1A7OH 5AZEL 1QFUH 1GGBH 5KVMC 3R0NA 5I8KL 4WI6A 2JB5L 3HUJB 4WTWA 1BBDH 5F6HJ 5LAXA 3UTQB 4X4ZA 1Q0XH 2PO6A 4QT5B 4A6YB 1OAQH 3O8XD 3NA9H 5IT2H 3MQIA 2XFXA 2KZ1B 3RZCD 4OFDA 4DK3A 2ERJC 4Y4HC 1B88A 5KS9F 4QXGH 1NCCL 2MWCA 2BVTA 1RUMH 5EU5A 1C5BH 4U6XB 1ZGLB 1H8SA 3CLFL 2HMIC 1QBMH 2XYCA 4YHYB 1IJ9A 4GT7A 3LS5L 5INCB 1D9KC 2XNAA 2J6EA 4FTVE 1T6VN 1CGYA 1S5IL 4OI9A 3UTSA 1G7IA 1MAML 3U7YL 3V6ZB 4S1QH 2VLJB 2A6IA 5KSUA 2Y07L 1NLBL 4CKVX 1SVCP 3BIKA 5GS2D 4NRZB 5CEXB 1T03L 2A6JA 4CU8A 1GJIA 5C6TH 2XACC 5CAYB 3QDMD 2X1WL 4LU5H 1Q94A 1VEMA 2WNGA 4TTDD 4XB8A 3V5HA 2EE6A 2X09A 4QCIB 4FMKA 1OAUH 4O02L 5JLZB 2A1WL 2BP3A 3HC0A 1FV1A 4LF3B 4OZIE 2ZG3A 3DV6B 4NO3A 3FN0L 3MJ9H 3UJIH 1HN1A 3ZKMD 3DRTA 2VAAA 2YUZA 2BXZA 4IRJA 4JFHD 3G08A 2HRPH 1D5IL 4MAYA 1NAKH 3D85B 2I60L 1DN0A 2EZ0C 3BN3B 4L3CB 3QT2A 2JJTC 5DMKA 4DKFH 4ODVL 4N0FA 1KJ3H 4BQ9A 2NYYC 4DAGH 2LU4A 1IZKA 4PLKC 4LSTH 1E27B 4Z7NF 3VFNA 4X5LA 1LO0L 2D7TL 4PYGA 5C0BA 2IBBA 3HB3C 4DVRH 1I7ZA 5IB5B 1M6OB 2H2SD 4M7ZC 5EU3A 5C0AA 4PGJA 1R3IH 5C2UB 1XR8B 4WWKD 2PTUA 4PFEA 4BZ1H 3FO9A 4DZ8B 1JGDB 3VWJA 4R90L 4MXQD 4I13B 5BXFA 5EUOE 3P9MA 2IQAB 4PBVC 4M1GH 4BKLA 5C0RL 1UQSA 1X5IA 4L29B 5FDWB 3T0EB 1KXVC 1A0QH 3O4LE 4N8VG 4FQQA 3EYQD 3SE4A 3G5VB 4WJ5A 5TF1H 5CEZE 5IMOB 1EGJL 3VXSB 4PGDB 1RJLB 3L7EB 4BK5A 4M62L 5FUCC 4LK4A 1NKRA 1F3DJ 4GS7B 4LEOB 1EIBA 1UXSB 1A22B 3M8OH 3HS0A 4PRBB 1DBBL 3GEWB 5CP3H 3O8XA 4ZTOL 2Z31B 3V4UL 1BVLB 4RA3A 2J12B 1Z9SA 2Q3AA 5JTWA 1U8OA 3SGKC 1W0VA 3ARGB 1FE8H 3RWEB 4R9HA 1YPZF 4X6FB 1RZ8A 5CJ8A 4DVBA 3GIZH 3FAXA 4DW2L 2FX8L 4X4XA 3LPGA 1OPGH 1SJHB 3LVEA 1IQWL 5DUPL 4Y2DC 4Y1AD 3RKDD 3RQ3A 5F7UA 2PCPA 1F3JA 3GBLA 3WHE0 4BFBD 3RA7L 3MCKB 3H42H 1ZVHA 5FM5O 5IROC 5FHAL 4ZO6A 5D8JL 3QWQB 1XF1A 4G9FB 3GUTA 1G1YA 2P48B 4QGYA 5HGAA 2D7NA 4HIHB 1GGIH 1WTLA 4NSKA 32C2B 3HNVH 1BEYL 1W0YT 1WZMA 4R4FL 3SO3C 5C1MB 2NNAB 1SJEB 2OZ4L 3PJSB 1ZANL 3PQYE 4S10A 1CLYL 5ITFB 1NANI 1OAYL 5IVOA 2JELL 5DUML 4XAWH 4G6ML 2XTJC 1MJ8L 3J8F7 4GMTL 1IFHL 2OJZH 5C0NC 4QWWD 2MPAH 3KJ6H 3QNZA 2VKXA 4GKOA 3QZWB 3U30B 3B8YA 3NFSL 4GSDL 1CXKA 3TVMC 2UV3A 1X5LA 3LPFA 4X8JB 4JFEB 4PRPE 1WF5A 5H94A 4EUPH 1FLTX 4WI8A 5FDYA 5D1XB 4MJIB 2A73A 5HDLA 2VZVA 5ELIA 2CK0H 1CD8A 4M7LL 2ZWLT 5D1QB 5JPMB 3QUZB 3E6FB 4WWKA 3WNOA 1YEHL 5AZ2H 2F54D 4G6JH 5E8EB 5TE7H 4KZDL 4Q6IB 15C8H 4N0CD 5IMLA 3UDWC 3KYMB 4I4WB 4P5KB 2OX5A 5J4MA 4ZSOB 2C3VA 3FQUB 5TGBA 5F7KC 1ZA3B 2OZ4A 3RWJB 3QPQD 2VZSA 1CLOH 4P0DA 3WUZA 4DZBA 3HUJF 5KTEL 1OGAE 1U8MB 3IU3A 3KPLB 1FHGA 2A77H 4FXKB 3GMRA 2LAGB 3MV7B 4PJAA 3MRCA 3VXMD 1DFBH 2P7TB 3DSFL 3SDDC 3SDYL 5D7LB 3DX9B 5HYJD 4PRHD 4BQ8A 1OM3H 1S9VB 2A0LC 5K9JL 4JY4A 1ORQA 4NKOA 4CU6A 3QJFA 1U92A 3QFJD 2C3WA 5FUZH 4PP2A 3E3QE 4UILH 4XPAL 1AXTH 1D5XA 1CD9B 1R5VA 5ADPL 2OQJA 3IFNH 5ACMA 5IB2B 3HE7D 3N1FC 2XWBB 3EYOB 2YC1A 2N4IA 2B1AL 2G2RA 4HPOH 2I26N 4GKNA 5I76B 1KCRH 1SEBB 1MFEL 1I9RL 3WN5C 1RZJL 5I1HH 2B4CH 4IOIB 4Y1AA 5DJZA 2CIIB 4PTTA 3GMNB 2LVEA 4YHPB 3UX9B 4YIQA 1JK8A 1U95B 3WJLA 4FG6C 3CPLA 4WTZA 1CK0L 2FCBA 2PTVA 5IK3A 5K9OA 4MGXA 3TPUA 4N8CH 1NFIA 4XWOC 3G6JA 1JPTH 2AK1L 5GGSB 1RIVH 1CDUA 3C09C 3MA9L 2FO4A 1CBVH 1S7TA 4HKZA 4XNQA 1PBYA 4OM1H 4RGOL 5E2UH 4MA3B 5C7XL 3I9GL 1RUPH 3FTGA 4S11A 2AXGB 2EDTA 4KH2A 5T1LD 5EORL 4LCUA 2YUXA 5I0ZA 4KRNA 4D9QE 2XN9D 5EBGA 3CFEB 3O3EB 3VXPB 4QO1A 3OKLA 4DOHE 1HILB 4Y2OA 1IILE 3BYTA 5ACLA 3INUH 3MNVB 3RTQA 2HVKA 4KJPC 1UZ6E 1DBKH 2APXA 2R2EB 3D3VE 3B9KA 1U93B 3OKOB 4HFWB 3QDAA 1ITBB 1YEIH 2F19H 5ICXA 5FV1L 5BZDA 5JZ7D 3CCHB 3DTXB 1ZGLM 2PR4L 3QQ4A 1TNNA 5DFVC 2AKRB 1KB5L 4P3DB 2AV1B 3CXDH 2LTQC 5JXAH 2F54A 1TZIB 3T0WA 3QFDB 4BSJA 1RK1B 1F58H 5AAWA 2UVEA 3QI9D 3V0WL 3WXWL 2IJ0C 4AT6B 2VXQH 4HIJB 3TZVB 1S78D 3U79A 5ADOL 3L3GA 5IEHB 4CUCA 3A67H 1U8HA 4WHCA 4YHNA 4JO3H 4DN3H 5GJSL 4E41D 1PQZA 1F8TL 3MRNA 2BVQA 3MNZA 3MOAL 5CINL 4L8SB 4P2CG 3QDJB 3IFOA 4HWZB 4QXUL 5KJRH 2P4AB 4QRRD 3ARYA 3VXMA 1LGVA 1LDPH 3PDOA 1P1ZB 5GS0L 4P59H 5HYJA 3MYZA 2C26A 2EDBA 3HLAA 2FSEB 3MV9D 4PG2A 3WFHB 2DQCL 4XNUL 3VFUA 1LP9B 2QHLA 3MYJA 3QFJA 2QQLL 4XPGH 3CSYA 4JHWL 3QAZC 5IHZB 3GMPA 3IJYA 1INEH 1JPFB 3L7FB 2DKSA 4WDIB 4KK8D 3KLHD 5JUEH 4L1DA 4XPBH 4GRLD 1KB5A 3IDIA 1DTUA 2VLRE 5KSAD 3F12A 1A9EA 4X7TA 3HRZA 2NY1B 4JRWA 4NQVB 1IZJA 4F37K 2QHRH 4ZYKB 3QQ3B 3T4AA 3RUGE 1XZ0B 1FC2D 1MRFL 5DJ8A 4P9MH 5KANG 5J11C 3DI3B 3IRZA 3O6ML 4O00A 1IE5A 3ROLA 3X17A 4JDZA 5E2TL 2FLBT 4YNYA 5GGSY 5K9KA 4ZS7L 4Y5XC 4P5MA 3DARA 5DRWB 5I18L 3R1GH 3K8LA 4YUEL 5DMIL 5DXWA 3GO1H 3TBYB 4X80H 1JTOA 2CO6B 3VU2A 2ITDB 1E28B 1YC8A 4ZTPH 3MLXH 4M6ML 4I0KA 3X3GH 5D7JB 5EBLA 1UKTA 3WJLC 3MODH 3DRQB 3ECBB 3KPRE 4I0CC 2FX7L 4U1GB 3ZE1F 5FOBB 4Q0XH 2XKSA 3MLWL 5T3ZE 1RJYB 4AG4L 3EO0B 5T1LA 1A7BA 3MRKA 4YHMH 3V0VB 2XN9A 4A2MA 3DV4A 4NJAL 2C4XA 4ONOA 4P2QB 5L7XH 5FECB 1MIEL 2IPKB 3VGHA 4GG6E 2QADB 1KPUA 4JHAL 2HVJB 1KNOB 3O3AB 3OJMB 5BRZB 1E6JH 5CGYC 1V7NL 4JPVL 5GPRA 4EJ1C 4P9HL 1OGTB 5H2BA 3WNNA 2CDFB 3SCMC 2VDRH 4N0UA 2YUWA 1QO3A 4MAUH 2FHBA 3H6JA 4PJ5E 5D72H 4QOKE 3K2UH 4NKMA 2IGFH 1P69B 5DEFB 4HKJB 1KYOJ 4XC1L 5EO0B 5IB3A 1TQCC 2P44B 3CH1A 1MNUL 4F8TA 3M45A 3QI9A 3QUXC 4PGCA 5LXGL 5F1NB 4LIQL 4UMGA 4JO2L 2FGZA 1LNUB 2GAZB 2Y6SD 1DQQA 5IB1A 4HXAL 4K3HA 4NKIH 4HG4J 4E41A 4OLUH 3GSUA 1KENL 4PJBA 2AJ3A 3DGGA 1G7JB 4HS6B 2R0WH 3OKEB 4UIKL 3QBTB 1YN6B 1T1XB 4P2OD 4QRRA 4WUUE 4PV9A 5J13B 5JDJA 4Z7QE 5T1KD 1AXSA 4NOBA 2V5TA 3HKFA 3MV9A 4I18B 5KVFL 3SE3A 4P3WA 3TFKD 5IHUH 4KHTL 4GW4A 2VDNL 1H8OA 3PV7A 3HZMB 2G60H 1B4JH 1VFBA 4RMWA 3KPMA 3PWPD 4GRLA 3BKML 3QXDB 1WC7B 4XNYH 5KSAA 1Q1JL 3WHXA 4JY5H 2FR4B 1N59B 1XIWC 4CN6A 1OAXL 4OLEA 1JFQH 5HHOB 4XZUA 4B5EA 1MCPH 3L6FB 4Z7NE 1S9KC 1FN4B 5F72S 1S7RB 3QUYC 4XCCL 3VFWA 5KZCD 1HOCB 1TCRB 4L9LB 2VDQH 3PG2A 5J9PA 3JV6A 1E0OB 3NH7H 3VGBA 4OFIA 1Q9WA 1JGUL 3P4OA 5F3HA 5CCKL 1BFOB 4CVWA 4PLJD 1A7PL 1C1EL 4PRIE 1ERNA 3HZYA 3RRQA 4HC1L 3E8UL 3HNTL 2E7HA 1IGYB 4R3SB 2EDJA 2X1OA 4XCNA 5CZKA 4OLVL 5C9JB 4QHLA 1XGRB 4G6KH 2CRZA 1YNKL 4JAMB 1MRDH 5DURD 4K2UH 1IKNA 3O3DB 4KI5E 3TLRA 1GPOH 1HZHH 2YS4A 3DVNB 3E1F1 3VGAB 1Z0MA 2A9MH 5DWUH 4KGLA 4R8WL 4CVXB 4JM4L 1U8LB 3JV4A 1G7HB 2BSTB 2QSVA 1RULH 1JI2A 3PNWB 4OM0L 2ZCHL 4LLWA 5HHNB 5DC9B 5DRXA 4HPYH 3D0LB 4FRWA 2X40A 4LOUD 3QCUH 4LAQL 3EOBB 1YEEH 1CFQA 3ZSTA 1LK3H 2W0KA 4HKXA 2EE3A 4MDIA 3SOBH 3X3FL 2DBLH 4CNIB 4L3EB 2APFA 4OQ1A 4O58L 3CFCH 1YPZE 3ZMRA 4HC1A 1QVOB 1XF5B 1A14L 3WEXB 3MBXH 5ICZA 1SYSA 4CL7A 4FQLH 3MGTA 1MHEA 3VFRA 2VLMD 5ISZB 3U6RB 3SE8H 1CXEA 3P4LA 4JPWH 5I6XB 1A6WH 3GSQB 4M1DH 5E4EB 4QHNA 5EIVA 1ACYH 5EIIB 5CJBA 5F9WC 4EQ2A 1YQ2A 4KRLB 2Q8AL 3WYRA 1LP9F 4BH7B 1XFPA 5I30L 3C5SB 5EN2A 4YXHH 3EOAA 2QEJA 4GUPB 3C60D 3CC5B 4R4BA 4YBHA 4MJ2A 4OUUA 1JRHH 4JZOA 1MHPL 4F57L 5IMMB 1CICC 1WIOA 2ERJB 2XRAH 4Y4HB 1N6VA 5JW5A 5FYJH 3RVWC 3QULA 4HBCL 3BGMA 4OIAA 4ODHL 1RSFA 3VRLF 3IDGB 1OWRM 2E6PA 1NC2B 3PWPA 3VDCA 5FF6B 1PDKA 4KRMB 3N1MC 1UM6H 3DLQR 4NBXB 2ATKB 4JDVA 3T1FB 2Y36H 3HFMH 4YDIH 1HHJB 4ELKB 1IAMA 4KMQA 2R2BB 4KRPD 1N8ZB 4XWGL 4RRPG 5E9DE 3GSOB 1N7MH 2P5EB 3B2VH 3B5GA 1I8MA 1CFTA 3QHZL 5L6YH 2CKBB 5AEAA 2EYSB 3BMWA 4Q9RH 4KQ4L 2Q6WA 3I75B 2DTML 3CZFA 1EJOH 3TNNA 2QSCL 5C3LD 4FMFA 5BS0E 4QRUA 5ABDE 2J8OA 3HZKB 1QOKA 3VRIA 1CT8B 1NGYB 2O5XH 1JBJA 3WNLA 1PZ5B 2FJGB 5DK0A 1IGML 1M71A 3G5YB 4TSBH 3T65A 5L9DL 1SMOA 4LLQA 5IOPB 2AK4D 1FYTB 2ZZUT 3PGFL 5EBWA 1NKOA 5JOFB 4P5TC 3HMXH 5HDBF 1GGTA 4XCFL 1QYGL 4JJ5A 1K4DA 4K71B 1TENA 4ZMAT 1NGZA 2VR9A 1AQDB 3I02A 3MFFB 4CN1A 1G9NC 3G6AA 2J8UB 4WU7B 4XI5C 4P3CH 1S3KH 4Z5RB 2JIXB 4Y5YC 3M1BA 4UINL 2EH8H 3ARBC 4YO0B 3HMWH 4RAHA 3QIBA 1XF4B 4WO4C 2DWDA 2CDEB 4L9DA 5EZIH 1FGVH 4NZDA 3C08H 3TH3T 4F37F 3OX8B 4D8PA 4G80A 3GI8H 4Z6AT 2H8PB 4EI5D 1T4KA 5I1GL 4IMLA 3BGFC 3AMKA 1A21A 4NC1E 4IJ3C 3DYMA 3ULUH 1K5NA 3IETB 1FNAA 4OTXH 3MLUL 3CGTA 2MCPL 4NDMA 1M4KA 4M8QA 3P73B 3BO8B 3MLSL 1HHGA 1U3HA 2HWZL 1MCWW 1M7DA 4PJIA 2MFNA 5I1AA 1IARB 4Y4KC 1F3DH 4K3DH 3EDFA 4WI2A 4UT9H 5DJ0A 4YDKH 2WIIB 4H1LA 5IESH 1KULA 1HSAA 1S7SB 1QQDA 5KAQF 4L4VB 5EO1A 2YSSB 4UV7L 1X5KA 3TO2A 4NNYB 3LIZL 5F7EH 1MSPA 3OKKB 1ZMYA 4ETQA 3ZT5A 5F6IC 3RVXC 3WL9A 2V7NA 5J57B 4OD2B 1HXMA 3ARWA 4TYUA 2O5YL 3QO1B 1EHAA 1RD6A 2APTA 4ERSL 1UB6A 2WINB 4BQCA 1UACH 4XXDB 3V6FA 2EECA 4JG1L 1MIMH 1KJ2H 3L1OH 1YYML 3GNMH 5CMAB 4PJEA 4HCRL 3P30H 3RPIB 5LAXB 3L5HA 3ARUA 3OR7A 1DZBA 1T1WB 2PO6B 5KVDH 4DKEL 5CEYB 1CVRA 1XCQB 4X7FC 2XFXB 4TUKH 2I27N 4XNZC 2RBLA 3HI1B 2NY6B 4HGWA 1C08A 3ARTA 4HIXL 4KZEH 2ZUSA 5EU5B 2R8SH 3WUWA 1A3RL 4NM4L 2XNAB 4DCQB 1FNSL 3TBWA 3IKKA 1FL3A 5B4MD 3UTSB 1I8KA 1QNZL 1G7IB 3BI9X 3BOVA 2HKFL 3T0EE 1F11A 1DQDL 1OP5K 5KSUB 3F6IA 1SM3H 3CK0H 3BIKB 4FFZH 2EDLA 2F5AL 3BEWA 5KVEL 2O5ZH 3DPBA 2AK4A 1UJ3C 3GM8A 2A6JB 1FNGA 2OCFD 3VXSE 1MJUL 2O93L 12E8H 3ZDZF 3EFFA 4YXKL 3WDJA 5GHWL 3ZDXF 1Q94B 4BZ2H 1J88A 2JJSA 1F4WH 1OHQA 2XTJB 3V5HB 1IT9H 2IG2H 3BKJH 3VWKD 5E8NA 4MJ6A 4GQ9H 4P23C 4Q9QL 1RU9L 3HC0B 3TWCL 1UH2A 1FV1B 5HSFA 2ZPKL 4HCRA 4G8GE 2V2WA 1XR9A 3NCMA 1A4KA 4LQFH 4HG4K 1H8NA 3NCYS 1UM5H 3IRPX 3DRTB 2VAAB 1MY7A 4L5FL 3R8QA 4IRJB 1KCVH 3TVMB 4NZTL 3G08B 4NHUA 1FLRL 3IXAA 4MAYB 2Q8BL 3MLTA 1ACZA 4EI5A 5DMKB 4N0FB 1CL7H 3ZYOA 5DHVH 5FUOL 1CG9A 3OAUL 4F15B 3PWUA 3OJ2C 4KXZI 5LGHH 4KK9D 1NEUA 5C09E 3VFNB 3QIBC 4RQQA 3D18A 2E3VA 1MOEA 4JVWA 4G7VL 5C0BB 4RAVA 4QHKI 1JTPA 1I7ZB 5LKNA 5EU3B 5C0AB 5HHQA 2H2PC 5DQJA 2CKBH 4FTVD 4M7JL 4MDJA 3PHSA 2LAAA 3FO9B 5E8DL 3HN3A 2YXFA 3IFPA 1WFNA 1NCDL 5IQ9A 3TYFA 3SDDB 2MKLC 1PSKH 2JTDA 3P9MB 3C8DA 1L6ZA 4BKLB 4KUCF 3UPRA 4D0BA 1U3HC 5D6DC 4KJWD 1FNEA 1SVZA 4WEUD 4FQQB 3D9AH 3HC4H 1Q72H 4POYA 4RGNB 4F80A 5ID1A 5GS1C 2D7OA 4F7MA 3Q3GA 3ZE1E 1JHLH 4WJ5B 1CGXA 4KKBD 4B0MM 2I9TB 4PR5A 3MTRA 3EFDH 1OW0C 3BPNB 3ME0A 2ZUUA 2NY7H 2DI9A 3P0GB 4KAQH 4W70A 2BMKA 3JBG7 3PGCA 4JFEE 4KKCC 4HLZH 4PBWD 5AWNL 5HTSA 2EIZB 2G9HB 3HS0B 1Z2KA 4YHZL 4MJIE 4U1NA 4LSVL 3O8XB 2HJKA 3V5KA 8FABB 2W60B 2V9TA 3LEVH 1B6DA 1U8OB 1VACA 1W0VB 3B8SA 1NBYA 3SDAC 2XZAH 2XG5A 5F8RC 4YQXL 2FBJL 1XMWA 4NUGL 1RZ8B 4DVBB 4NM8H 3EZJB 3TV3H 4X4XB 1INQB 2V5YA 5GQBA 3LEXB 4OCXH 5HGDA 1ZEAH 5C86A 2PCPB 4O9HH 2W65A 5C0GA 4H8WC 1NMBL 1H0DA 1R5IA 2J5LB 3I6LE 2BCKA 3TP4A 3MV7E 3QISA 4ELME 1AC6A 2W92A 1KN4L 5I1KL 2J8UF 3GUTB 2XI9A 3PHOA 4M7KL 5HGAB 4G8EA 4WI7A 3VWKA 1FFNA 1JCKA 1N5YH 2DYPD 4NSKB 4XCEA 2ADIB 1LE9A 5L8LB 3G6DH 3O4LD 2R4RH 1R3KA 5LWYL 3FN9A 4LBEA 3EYUH 4J4PC 4Z7UA 3TO4C 3F8UB 4HFUL 4P99A 2DM2A 3S88L 3MACH 1ND0A 5CEZD 1ZVSA 2YKLH 1YYLH 4L8BA 4QRQA 2PKDA 1TDQA 2OTWA 3VRJA 1B2WL 3QNZB 4ODSL 1I7TA 1RFDH 1HE7A 1IQDA 4NJ9H 1IEAA 1ODAA 2QQKL 3KYKH 3MUZ1 3G5XB 2XQYK 4Z7WE 2FH8A 5F1IA 5H94B 3FQNA 1BWWA 3NABL 4FP8L 5MEPA 2A73B 4JO4H 5EDXA 35C8L 3PF2A 2WUCH 4WWKB 2DQHH 1ZLVH 3O6LH 2WWKO 4FTVA 3BKCL 1WCBB 5IMLB 3T0XA 3WD5L 3C5ZC 2MSPA 4JKLA 4X0KB 2V9QA 1WZLA 4JZJC 4NNXB 5E2JA 1DP0A 1T66D 2C3VB 5TGBB 4NZRH 4XT1C 3N85L 4M43L 4J3UA 3BISA 5DDHA 3K7UA 3VDBA 1OD7A 3PL6C 1BREA 4YXLL 5MEOA 1AR1D 4DZBB 1A5FH 3DIFA 2FRGP 3IU3B 4U1KA 5AD0A 2H45A 1EK3A 4MVBC 4OBSA 3GMRB 3BGAA 4PJAB 3MRCB 4OZIA 4GMSL 3VXTA 4TN9A 4X4YB 1WEJL 1U9KA 4JY4B 1ORQB 4NKOB 3PQYD 3QJFB 3TN0D 1U92B 1CLZL 3U46A 2BY1A 5E08L 4GOSA 1DANU 4PP2B 2ED7A 4K9EC 4X9HA 5IKCA 5MENB 4OLXL 3M17A 1ZLSH 4CRPA 3OAYK 3TT1L 5CEZL 1D5XB 1I1AC 2H6PB 1R5VB 3P9LA 4EDWL 1GYAA 4K3JH 1C5DA 2D7MA 2OQJB 5DT1L 4HUVA 3ARXA 5F9JA 1ZHNA 2G2RB 2ZUYA 3RDTC 1RZFH 1EHLL 1JGLH 5J6HB 3BH8A 4PRPD 1FRGL 1EUTA 4R4NC 4U7MA 4Y1AB 4KTYA 4PTTB 1NEZA 1Z3GH 4LSRH 1MJJA 5HI3D 4YIQB 1JK8B 1XGQA 1NAMH 4M48L 3QDJE 2A6DB 3CPLB 1TJIH 3RWHB 4F2MA 5IK3B 5K9OB 3TPUB 1S7VB 1NFIB 3WSQH 3GJEA 1ZK9A 1DL7L 5EUOA 1QKZH 1IM9A 1FFRA 43C9A 5JIIA 3V6OE 2N7AA 1EFXB 3QO0A 2FO4B 1REIA 3O4LA 3MLZL 4HKZB 4XNQB 5IWLA 4LDOB 1TTGA 2WAHA 4OF7A 4Z9KB 1JMXA 3SCMB 3PUCA 2R1YA 2XY2A 1OGAD 3RBGA 1JZ5A 3ZE0F 2YHGA 1MCDA 1VFOA 3OKLB 1G0DA 3GSVA 3B2UD 3OQ3B 3BIAX 1PLGL 1A7NH 3ILQC 3RTQB 4D0CA 4XBPA 4MD5A 4HHAA 4Z7VB 5BZWB 1TETH 4HK0A 2EXYD 4JGJA 1IMHC 2DQTL 4JEGB 4LFHD 3A6BH 1JMZA 3B9KB 2EYRA 1KIPA 5E24E 1NFDA 2DQEH 1CU4H 4M9OA 5BZDB 3LZFL 2HTKC 3GMMB 3QQ4B 4RAUA 4M5YH 4P4KD 5I1IL 1CE6B 3W9EB 1AQKH 4K3GA 2YA0A 1C7TA 2F54B 1KACB 1RQ5A 5CBAA 4K8RD 3JTSA 2HLFC 5T3XH 4DJMA 5FYJE 2R69H 4BA8A 3BQUC 4M6OH 3IU4H 3NACL 5C2BL 5IMKA 5GZNC 4X99A 4P2QE 1PQZB 2UZIH 2X4RB 3EBAA 3UJTL 3MRNB 2BVQB 3MNZB 4MCYA 2EKJA 4HWEL 3IFOB 1J1OH 4FQ2H 4X9IA 2XA3A 1P6FA 2IH3A 2Y23A 3FQWA 4LP4A 5I19L 1EX0A 4L4JA 3PDOB 5BJTA 5HYJB 2FX9L 3HLAB 3ULVC 5I8OL 1GHFL 1BIHA 4EN3C 3VFUB 3EZ8A 3PQYA 3TN0A 3MYJB 3PIQB 3QFJB 3CSYB 3EO1B 3GMPB 1VPOL 3IJYB 4D9QD 1JZ4A 3L9RA 4OZFA 1JPSL 4XNMA 5T5NF 2AGJL 4CN4A 2CQVA 1KB5B 4UTAH 2VZ1A 3F12B 4X7TB 1DSFH 5DD0L 3N9GL 3HRZB 4HLJA 4XCYB 3SPVA 5JHLH 4U6YA 3T4AB 3BWAA 4GFTB 3D3VD 5DJ8B 4QNPF 2J7LA 3CH8A 3ULSA 3V7MA 4LLUA 4S2SB 2R9HC 2G5RA 1X5GA 2C5DC 3UO1H 4P2YA 4OF3A 5FK9A 3ROLB 4RIRA 3TBTA 4JDZB 4NWTH 4YNYB 2BC4B 2ICWI 2NW2A 5I17A 5K9KB 3SKOA 4P5MB 5GS3A 2KQMA 4MSWA 2ENSA 1PKQE 4K8RL 3JTTA 3D39E 2OL3L 1JGVL 5DQDL 5I1EL 3CVHL 3QSKB 1UB5B 2G75A 1YEGH 5EBLB 3MLYH 5DFWH 1QLRA 4OGAD 1EZVY 3PWVA 1G9MC 4E9LA 5E94A 3LDBC 3ULUE 1BOGA 1OGAA 5BVPH 1Z6JT 4URTB 5T1LB 2H26A 3MRKB 4OCYL 4BSVA 2R0KH 2XN9B 3DV4B 2ITCA 5IB4B 2YPLE 3GSNL 5HHOE 4U6TA 4L4TA 4MX7A 1KPUB 1RZKL 4JG0H 5D2NC 4F58H 1R3JA 4KHXH 4O2FA 5H2BB 1RV6X 3T2NL 5DF0A 3T3PF 3CJJA 3TA3D 4N0UB 2YD6A 3ZHKA 2HKHL 4TULH 1QO3B 2FGWH 3IDNA 4KDWA 5F3BA 5TQ2L 5JQ6H 4B53A 3GFUA 25C8L 2VLRD 3GHEH 1I9JH 4NKMB 3HI6H 3RZCC 2P5WE 5FO8B 1FZMB 1LWRA 3W2DH 4P4KA 3BKYH 2NW3A 3SBWA 5IB3B 1ZXQA 4EXKA 2AJXH 3MBEC 3CH1B 2OL3A 4PUBH 5L88H 3CVHA 4AEHH 4XTRD 2K1MA 4ODWB 3QI9B 4PGCB 5J1TC 2GEEA 1TFHA 2WSKA 1I1RA 1KTLB 3LQZA 3ZKNC 1A1NA 4HX1A 2MQ3A 3QHFL 1DQQB 1QFHA 5IB1B 4PJAF 3ZDZE 4E41B 2D2OA 2HTLC 4XP6L 4PJBB 5FM4A 2AJ3B 2WUBL 3OAZK 5DK2A 3DGGB 3ZDXE 4EBQH 2B1HH 2CIKA 4HUKB 1FDLH 1QPXA 5I73C 3GHBL 3VXRE 3WFDH 3GSNA 4QRRB 2DLFL 3TJHD 4OLWL 1AXSB 4JLRA 3MV9B 3KPRD 3BSZL 3SQBA 4IMKC 3S4SG 1E4XH 2R1WB 4N0YL 5T3ZD 4GW4B 3LS4L 4G6FD 4UNUA 4DGIH 4DGYH 5I71B 3UTPD 5SX4I 4MNQB 1VFBB 3EYSL 2VXVL 3DUSB 4ODBD 3IGAB 1CQYA 4GRLB 4LSDA 1NC4D 4U1MA 4I3SH 1A6UL 5KSAB 3DMMD 3WHXB 3DX6A 2FNBA 6FABH 1QPPA 1OTUD 4Y5VC 5ISZE 4KK5D 3D3VA 5IF0A 4RWHA 4CJ1A 1BAFH 4PJ5D 3VFMA 3PHQA 3L3JA 4QOKD 3SGDI 1KGCE 3GBML 1A1OA 5J9PB 3JV6B 1DE4A 3FOLA 1KJMA 1U8PA 1Q9WB 2P42B 3P4OB 2DL9A 5F3HB 3WLWC 5T1MA 5EFIA 1JNLH 1AHWA 1FCCA 3U1SL 3UTZA 1HSBB 4FFWD 1EA9C 4XCNB 4PS4L 1MPAL 4DFIA 1DEEB 2D31A 4Y7MA 1NDGA 4QHLB 3BD5A 4L1HA 4Y5YB 3ARBB 3GMOA 4YX2H 4CVZB 1BOYA 1NGPL 2VLKE 1H5BC 3O9WD 1JNNL 1RUAL 3JV4B 4Z7VF 2F15A 1VDGA 4PP1C 2J88L 3EYQC 4WUUD 4LLWB 5D2LE 4ZUUA 1TTFA 3L3KA 1DLFL 1ZT1A 4IJ3B 1QFPA 4TNWK 3VG9B 3TIDA 2P5EE 3Q6GL 4KMLB 1CFQB 1AFVH 2MOVA 1OTTD 4OCWH 4HKXB 1KF9B 4MDIB 4WTXA 4KQ3L 5T3ZL 3TA3A 2E27L 4O51A 2IAMD 1WZ1L 4QTIH 5JPNA 1JZ7A 4S1RH 2VLRA 1A47A 4LCWB 1W72H 1EUUA 1QFWI 1WLHA 5I0DA 5ICZB 1BD2A 3AS2A 1J1XL 4OZ4A 3RGVC 4UNVA 3MGTB 4WV1A 4MA7L 3VFRB 3BPOC 1MFCH 3S34L 5DD1H 4AL8H 1E4WH 4QHNB 1FAKT 2ZNXA 3O6FD 2J8UE 2BSRA 2B2XH 2COQA 2GI7A 4WCYL 3RX7A 3G5ZA 3F7QA 4MNHB 5EN2B 1PG7H 1GOFA 4MQSB 1NBZA 3IDUA 3DYPA 1T7ZA 3IFLH 3QG7L 4CDGC 4KI5D 3MRGB 4R4BB 1ZLUK 1A7OL 1JUFA 4JZOB 1QFUL 1GGBL 3KPRA 4NN7C 1BBDL 2QLVB 1FZOA 1Q0XL 5JW5B 3ARED 3QULB 5J56B 1OAQL 3NA9L 4RA0C 5IT2L 3GSXA 3BGMB 3QEGH 1B6UA 4R6UA 4GG6A 2ZOLB 1NC4A 4QXGL 4R96A 4MZ3A 1I7UA 3DMMA 1RUML 2BNUA 4JDVB 1C5BL 5HDOA 2CLVB 1I8LA 1QBML 4GLRH 4MLIA 1NSNH 1J8KA 1JWSA 3EJZD 4PJ5A 1I8MB 4MB3A 5C6PB 4R2GD 2C4FT 4QOKA 5KZCB 4S1QL 4L4VE 4YHKH 5CZXC 3AROA 4ONHA 4YWGH 3KNBA 4WFHE 3CZFB 1FNHA 1WWCA 4QRUB 5EZLB 4H25A 1BX2A 5C6TL 3VRIB 2EH7H 2Q1EA 3ROOA 5JIKA 2GJJA 1JNJA 9CGTA 4GAYA 1M71B 3T65B 1KEMH 4EDXB 4PJXE 4LLQB 4LKCB 2ZOKA 1A3LH 1WWBX 1OAUL 5EBWB 3RAJH 3X14A 3C5JA 3MJ9L 5E6ZA 2QJDA 3UJIL 4K7PY 1T7WA 4JJ5B 1T22A 1K4DB 4C57C 3O9WA 1X7QA 4KROC 4HIIA 4D0DA 2HRPL 4WUUA 3QJHA 1NAKL 1IRAY 1NGZB 5SWZB 3I02B 3G6AB 4NWUH 1UCTA 4C59B 4P49A 3WS6A 3PGDA 3M1BB 1A3QA 2C3GA 1U3JA 3JVGC 3QIBB 4N1CA 4XPHH 2DWDB 4MWFA 2DWEA 1BJMA 3MCG1 4G80B 4XHJC 5DC4B 4D8PB 4Z8FH 4LSTL 1FPTH 2DLGA 4JFQB 5ITBH 2IAMA 2XKUA 1T4KB 4IMLB 1BF8A 3BE1H 3HHRB 2DQDH 1KPRA 1WWAX 1MLCB 2VSCA 4PRAA 4DVRL 3EKCA 2E7CA 4Z77A 3TYGH 4W4OA 4OB5H 3ZTJH 1R3IL 2I5YH 3X11B 3VXUE 4NDMB 1CFSA 5E9DD 4M8QB 5HVWA 4N5EC 1L9NA 2X1PA 4BZ1L 3OB0H 1HHGB 1U3HB 1XAUA 5E0QA 4PJBF 1M7DB 4PJIB 3BN9C 5I1AB 2AI0H 2CLZA 2XTJE 2BVOA 4M1GL 5DJ0B 3MJ9A 4H1LB 3ARSA 3CDCA 1HSAB 5BS0D 1QQDB 1A0QL 3JZ7A 1BF2A 3KWWA 5EO1B 1EBAA 5FGCB 3O6FA 1BWMA 3TO2B 2Q20A 3FCTA 5TF1L 1EXUA 3Q48A 4OCLC 3VFGH 1I3RA 4ETQB 3HI5H 4H26A 5E56A 3SO5A 1G9NH 2V7NB 3WL9B 1HXMB 2DI7A 2IBZY 4O4YH 5GS0C 3FRPA 3MLPA 1UB6B 5T5NG 5IIEA 3M8OL 2EDQA 5IM7B 2XZQH 3V6FB 3RNQA 4FFVC 3ILPA 3AREA 3ZE0E 2VXSL 4PJEB 2AJVH 1OTSC 3JUZA 1UH3A 4OUOA 3OR7B 4W81A 4NCC2 1N2RA 1FE8L 4KRPB 3GIZL 4HGWB 2QSQA 2N56A 4OCNC 1C08B 1OPGL 4EQ3A 3WUWB 1V3KA 5DI8A 5F6HI 3I6GA 3DJ9A 3ZDYF 3TBWB 2ADFH 3S37H 1FL3B 1PGRB 1I8KB 3H42L 3RWDA 3OG4B 5IVXE 1F11B 4G6AD 3MA7A 4FQIH 1T1ZA 3QDGB 3SDXE 4NYLA 4PPTA 3F58H 4JDTH 4XPFH 1GGIL 3JWNC 5GSVB 2AK4B 2YZ8A 3HNVL 1R3LA 1JRHI 3EFFB 2ICCA 4YDLC 5GGRY 2RFXA 5FCSH 5CP3A 1AGEA 2V17H 5E8NB 4MJ6B 3O45A 4KVNL 3D0VB 1ZS8A 2V2WB 1XR9B 4YGVA 3T77A 4XAWL 4EOWH 2PETA 4JFPA 3D85D 5HI5D 5E7BA 1KCUH 2OJZL 1B0WA 2MPAL 3KJ6L 3LKSA 1U8KA 2Z91A 4CU7A 1VGEH 3IXAB 1LD9A 3MLTB 3MLRH 1CDCA 3AGVA 1JP5A 2XPGA 5T3XE 2DICA 1IEHA 3HG1A 3TESA 1JWMA 2CK0L 1CG9B 3WS6C 4IDLA 5EU6B 3PWUB 5HYQA 5JO5A 1H15A 4I2XE 5AZ2L 5E9DA 4RQQB 3D18B 4G6JL 5TE7L 15C8L 2HT2D 2W0LA 4K07A 3ALWA 4RAVB 1PG7X 2JKXA 5DQJB 3BD3A 1F5WA 3L3OA 4MDJB 5C0CD 3HE6A 2WP3T 5BS0A 1HWHB 4M3KB 2HG5A 4JFZH 1ZWIA 5E1AB 2E7BA 3KS0J 3IFPB 3MCLH 5BQ7B 5IQ9B 3TYFB 1CLOL 4RCAA 3UPRB 4D0BB 4BQBA 4JRYB 1EHXA 1PJ9A 2A77L 4NHCH 5ACZA 3VXSD 1FNEB 1G6VK 3KR3H 3AVEA 1IGCH 1DFBL 1JYNA 1T0NA 5ID1B 5D7SH 5KSBE 2E6JA 4FOMA 4TNWF 3Q3GB 1OM3L 1MF2H 4OKVA 1AGBB 5F71A 1I1AB 4GBXC 5DRNA 5I66A 3LKRA 5FUZL 3STBA 5B3JF 4G8GD 4EUPA 4WFEE 2D0GA 1QD0A 4UILL 1AXTL 1I85A 4DEPB 2VL4A 2BMKB 5TPWH 4DUWA 4KY1H 3KVQA 3IFNL 1N26A 4JM2C 3ARGD 4U1NB 2EIEA 2HJKB 2WMPA 4U6XA 1E4JA 1Y0LA 1S8DB 4HPOL 1ZGLA 1KCRL 1DQJB 4HS3A 2EXWC 1VACB 1J0YA 4RBPH 5I1HL 2B4CL 3V6ZA 4PRDA 3N50A 4TOYH 5J3HD 5HYSA 2ICWA 1BIIA 1ZLWH 5C09D 3F7PC 3MJ7A 5HGDB 4NRZA 3AS0A 3PV6A 3IDMA 1KLGA 2W65B 3IXTA 2AXHA 4N8CL 5DYOB 2A74A 4F8QA 5C0GB 1JPTL 1H0DB 1P4LA 1R5IB 1RIVL 2NY0D 4TQEH 2ATPA 2EIBA 2P24A 2ZJSH 3T0BA 4PJAE 1NMCC 1CBVL 5DEGB 2OR9H 4OM1L 2ICES 4OFKA 5E2UL 2XICA 3PHOB 4Z0BH 3PE9A 4G8EB 2JJVA 2VL5A 1RUPL 1RUQH 2CK2A 3VWKB 1FFNB 3WDIA 5DD5H 1FC1A 4XCEB 1LE9B 3NFNB 2EIDA 3VD7A 1DBMH 4LLYA 5MENE 1R3KB 4LBEB 3SKJH 4LQ1A 4HJGA 4ZD3H 4Z7UB 4O2EA 3INUL 3KHOA 1XGPB 1ND0B 1JVKA 3RVVD 1ZVSB 3T2PA 4YBQD 4V2CB 2AS5M 4L8BB 1MI5A 3NCEB 2ARWA 2OTWB 3VRJB 2HT4C 1YEIL 5D1XD 2F19L 3CX2A 4MJID 2Q86A 4QTHA 2GCYA 2E9IA 4PJIF 1IEAB 4I48A 3DETD 4UUJA 4N0RA 3BJ91 2W9DH 5CD5D 3FKUS 3CXDL 1ULVA 2UUDK 3ZYJA 2VERN 3FQNB 5A43C 5JXAL 4JQVC 3RU8H 3T0DA 5MEPB 1F58L 4DZ8A 4H8WH 1U8IA 3LKQB 2BVUA 2NY2D 4FXLA 2BVPA 4LLMA 3D5OF 5E6ID 2VXQL 2IQAA 5J1SC 1DANT 4FZ8H 4FTVB 4NC0B 2CJUH 2PTTB 3A67L 3VH8G 5C0CA 3ARFC 4UOW1 4JO3L 4DN3L 3BVNB 4NKDA 4BSWA 4NN6B 2IFFH 5CHNA 1I8IA 3H3KA 4RISH 1K2DB 3I6LD 2AP2A 4EN3B 1MCHA 3UPAA 1EVUA 5KJRL 3MV7D 5DDHB 1AO7E 1LDPL 4P59L 5MEOB 4PJEF 1U58A 3HE6C 1NGQH 4U1KB 5AD0B 1X5JA 5GXBB 4POZC 4XPGL 4Z7VE 2ZCKH 2VLLA 4FFYH 4OZIB 5F1KC 4HUMB 4G8GA 1INEL 3VXTB 1DEDA 1J10A 1BVLA 4NN5B 5JUEL 2N1KA 4XPBL 1BFVH 3U46B 5TQ0L 1NBVH 3ARGA 4NQDB 1WT5A 2D9CA 3KPSE 5IKCB 3V5DA 4X6FA 1T20A 2R56H 3M17B 2QHRL 2OK0H 4F33A 3P9LB 1C5DB 1HYSC 3FB7A 4P9ML 4HUVB 4HAGA 4ZAKC 3QDHA 3FFDA 4S1DD 1ZHNB 2JB6A 4ZODA 1ES0B 3BH8B 5FCUL 5C09A 1UM4H 5F70A 4XNXH 3KHQA 1NEZB 3R1GL 1F90H 1L7IH 2IMMA 3GO1L 1XGQB 3RJQB 5BMFH 1G7QA 2A2QT 4ZTPL 2VDOH 3LDBB 3MLXL 3OR6A 4F2MB 3Q0HA 3X3GL 2B39A 3GJEB 4LSPH 1SJEA 3MODL 3D87B 5IJKC 3AB0B 3MC0A 4LHUA 1IM9B 3PJSA 3WS3B 4HK3J 43C9B 5B39A 1A02N 2XXMB 4Q0XL 5CIPB 1P4BH 4UT6H 4QF1A 1I9IH 5GGUB 5SX5H 4Q6YA 1HQRA 4ESKA 3QO0B 4YHML 3O4LB 2I24N 1CXFA 5L7XL 3O4OB 1JWUA 3LY6A 1EDQA 4JFDE 5BV7B 1K9TA 2R1YB 4HWBH 4U0RB 3GIVB 5FA4A 3C60C 4MCZA 3QZWA 1VFAA 4K9EH 1E6JL 1Y6NR 2Y4SA 2IPTH 1VKXA 3GSVB 2VDRL 1C7SA 1V8HA 4JB9H 4XPTH 4MAUL 4XBPB 4HHAB 3K2UL 4WW2C 5AG9A 5HPMA 3JWOC 5JXEC 2IGFL 2FH6A 4HK0B 1U2HA 4OZGB 3RKPA 5DO2C 1NUFA 1UWXK 2RR3A 1NFDB 2GK2A 1F42A 3MRFA 4MD4A 3NVQA 3C2AH 4LCYB 4XVUC 4YBLB 2W07A 5D96B 5E6IA 2GFBB 3TC9A 2R1XA 1U8QA 2AJYH 1U8JA 1YDPB 3JTSB 1X4ZA 5CBAB 5ICYB 3D25A 3CNKA 4NKIL 3VD3A 2IFGA 4OLUL 4UIMA 3OB8A 2AJUH 3QDJD 3T2QA 2R0WL 4LL9A 3S6CA 1FJ1B 3L5IA 4X6CB 1VCAA 2OR8A 3MV7A 5IMKB 4X99B 5I1JH 4ELMA 2M26A 3MV8D 3MXWH 4MCYB 2DM3A 1S9VA 1TVHA 1YUHA 4J3WA 5DLMH 4JQIH 5I75C 2IH3B 5IHUL 1WICA 3FQWB 2GJ6E 5CSGA 7CGTA 5BJTB 1EJ6A 3MRLA 1AGFB 1C8PA 5HVHB 2G60L 5I9QC 4U2YA 1B4JL 3STZB 3L95A 1X5XA 4XNYL 1C12B 1CIDA 3BAEH 3EYOA 1ZHLA 4E5XA 4JY5L 2NY1D 3L9RB 2P8LA 3BDYH 4OZFB 1JFQL 4XNMB 1SEBA 1WGOA 4YPGB 1J5OL 4WGVB 1MCPL 3TT3H 2YD5A 4PJ9C 1AIFB 3QB7C 3AFLA 5DZNA 2VDQL 3SPVB 1KELL 2EO1A 3NH7L 4FZEH 4U6YB 1FBIH 3EJJX 3BWAB 4Z7WA 5GZOC 2HJFB 4MNGE 3GK8H 3O81A 3ULSB 2VDKH 4LLUB 4MS8D 3LQAC 4I0PD 3FN3A 1UEYA 2PYEE 5FK9B 1NPUA 4RIRB 3TBTB 5C08B 1QRKA 3W11D 2NW2B 1F2QA 2FIRT 3MGAA 4RMTA 3REVB 5I17B 3SKOB 1MRDL 3CDGA 1H5BB 4K2UL 5D7JD 1H3UA 4JFXA 3RIAK 4MSWB 1GPOL 1HZHL 2VWEE 3EYFB 4Z7UF 3MV9E 1QP1A 4X83A 3JTTB 5FYJD 5DWUL 2VITB 4KJQD 1JZ2A 2AXGA 5JNYB 5CLTA 1RULL 2G75B 2LFGA 3HPJB 3CFEA 4P2QD 1IC5H 3ULVH 4LRIA 3QIUC 1QLRB 4MNQE 5JHDE 3PWVB 4HPYL 3UEZA 4GW5A 5E94B 2QADD 1BOGB 1OGAB 3QCUL 2UWEE 1YEEL 1GCFA 2X70A 1LK3L 1KTKE 4BSVB 4JN1H 3G04A 1HWGB 2ITCB 3SOBL 2R2EA 4L4TB 4OF6A 2DBLL 4MX7B 5F96H 4YAQA 4LIQE 1YMHA 1G1CA 3ARDD 1R3JB 5L0QC 3CCHA 4O2FB 3CFCL 5AG8A 5FA3A 5FYKH 4HGKC 1GIGH 3BPOB 2AW2A 3QQ9D 5F3BB 3MBXL 4J12A 1KG0A 4N8PA 2WLYA 1CDBA 4LVOB 4FQLL 5GJTH 4P4KB 3QWOB 3ZDYE 2NW3B 2D4DA 5DVLA 3SE8L 1UWEH 4JPWL 1A6WL 2GYSA 4M1DL 1ACYL 3CVHB 2FB4H 4ZXBD 3OF6A 3LQZB 1A1NB 4HX1B 4FQXD 4YDVA 1SMAA 4YXHL 1GZQA 3LB6D 1WISA 2ORBH 4OZIF 4APQC 2WBJC 1OP3H 1UFUA 1G9MH 3MV8A 1JRHL 5DK2B 2FSEA 3D39D 1KTRL 3QIWC 6CGTA 4XC3H 2P8MB 3GSNB 3V6OA 2XRAL 5FYJL 5IHZA 1XGYH 2X4TB 3GJFK 3CVIH 5CIPH 2B5IC 1QLEH 3RIFF 3ZT7A 5HDQH 2APVA 2C1PA 2PXYD 3C6LD 1OOAA 4H0GA 3TJEH 3ULUD 3VFOA 5AYUH 4LCWE 5BV7H 1UM6L 5LGJA 4ZS6D 3VD4A 1CF8H 3HFML 4MB5A 4YDIL 3S36H 2YD3A 4DOHB 1AE6H 2YPLD 5HHOD 4QHUA 1D5MA 1N7ML 4U1MB 3B2VL 5FAAA 1S5HA 3FQXA 5L6YL 5F93C 3D69A 3DX6B 3C87A 1GOGA 4Q9RL 4LASH 3KJ4B 2FYYB 3D3VB 3D6GA 3K2MC 5IF0B 1EJOL 3VFMB 3P0YH 3PHQB 4I0PA 3LCYA 3KLAA 1A1OB 2NX5E 1DE4B 5FHBH 2P5WD 2O5XL 3FOLB 2X89D 1KJMB 1U8PB 3TBYA 4TSBL 5EA0H 4KKLD 5T1MB 5EFIB 5HBBA 1JZ8A 1AHWB 5EOQH 1T89A 5D7JA 5BW7A 5CD3A 3UTZB 3HMXL 3D48R 4JZNA 4OD3H 2D31B 1NDGB 43CAA 4OIIH 3GMOB 1BQHG 1D6EA 4P3CL 1S3KL 2IPKA 4MQXD 3HR6A 3LD8B 2HVJA 1BJ1J 1KNOA 2EH8L 4LEXH 3VXRD 2VAJA 3HMWL 4N8VA 3SDCD 5B3JE 5EZIL 1FGVL 1CGTA 1P6AB 3C08L 2NY3D 3L3KB 4OZGF 4ZTOH 1ORSB 1FFQA 3NIFE 4QY8A 2FD6H 1NFDF 3GI8L 3TIDB 3IVKA 1W8OA 1MWAH 3HAEG 3FB8A 2CXGA 3ARDA 4JQXA 1SHMA 5F7WC 5EO9A 3ULUL 3S9DB 2X4PA 3TA3B 4JHBA 4KV5F 4OTXL 4YHLH 4O51B 5L2KA 4Q2ZA 5EO0A 4UZGA 5F7HA 3BP5A 2EC8A 4G8FA 2VLRB 5JOPE 1DLHB 3VI4F 2X4QA 2ARJQ 4OI8A 4K3DL 5ISZD 1LNUA 4UT9L 3IDYB 1IGIH 4L8DB 2NR6C 3OL2A 2GAZA 4YDKL 5IESL 5C0DB 1BD2B 5B21A 4IIQC 1KGCD 4OZ4B 2OI9B 5C6WH 4ZXBA 4WV1B 4LAJH 4RMRA 4IS6A 5FGBA 5F7EL 4FQXA 5HGHA 2DDQH 3OKEA 4Q9BA 1YN6A 4LCCA 5SWZE 5J0BA 1G7MA 2A9NH 2OXGA 4K7FA 2BSRB 1PKQA 1B3JA 4LGSB 2Y7QB 3D39A 1DQMH 1MREH 2E7LA 1UACL 4P2RB 4Y4HD 1NBZB 4M93B 1MIML 4PIRF 3HZMA 1KJ2L 1A1MA 1JUFB 2I9LB 2EDFA 3GNML 4X9BA 4BM7A 3KPRB 3WFEH 2HMID 2PXYA 3C6LA 3P30L 3NIDE 2VLKD 4B7IA 3AUVA 5EU7C 1D9KD 4G6FB 2AJSH 5KVDL 1QFOA 1N59A 4TUKL 2YPLA 3SKMA 5B38A 5DD6A 4ZOEA 5HHOA 3EDEA 4ZUVB 2P5ED 3NCYP 4R96B 1U42A 1S7RA 3TM6A 1I7UB 1HH6A 2ADJB 2APWA 2BNUB 3DMMB 3DUHA 3GSRB 4GH7B 1J9CT 4L9LA 4X6DE 2Z35B 2R8SL 2P47B 3BP7A 4J23A 1TIUA 2R23A 5EH1A 3MFGB 2CUMA 3A6CH 1JWSB 5KSVA 3RL1A 2YPVH 4PJ5B 3OXRB 4QOKB 5FGCE 2P5WA 3RWFA 2X89A 1QEWB 1SM3L 3NN8A 4ONHB 3CK0L 4X6EB 3U2SA 3KNBB 4YDLB 3V4PH 4KDVA 3A0OA 2O5ZL 3KG5A 5KVGH 4H25B 1BX2B 1OSPL 12E8L 3SGJA 5A2FA 4ISVA 3ROOB 3UBXI 3DVNA 2PW1A 2R0LH 4ORZC 4BZ2L 4GAYB 3MOQA 4PB0H 1F4WL 1KJ2A 1U41A 1UENA 1IT9L 2ARJA 2IG2L 3BKJL 2ZOKB 1G7HA 2BSTA 4GQ9L 2EZ0D 3LAFA 2B8OT 3PNWA 3X14B 3LH2H 1J0JA 1MH5A 2EEBA 3MUY1 4GXVH 4LQFL 1FFPA 1UM5L 2NYYD 3D0LA 1T22B 1U8NB 1R3HA 5GRVL 4PLKD 1X7QB 1KCVL 3SJVD 1OLLA 4DKDC 4D0DB 3VXRA 4WUUB 3QJHB 3SDCA 2NPLX 3CX5K 4ODTL 2HFTA 5HGBA 1I3UA 3HB3D 3RY6A 3OHXA 3PGDB 2MHAB 2OTUB 4Q9CA 3N1QC 1PZUB 1DR9A 3FT2A 2VUOA 2JCCA 1CL7L 1PKOA 4HK3N 1SBSH 2DWEB 1GZPA 1QVOA 5LGHL 1RZ7H 4HT1H 2ZUQC 3RBSA 1MY5A 2IAMB 3WEXA 4M8VA 3SKNA 5DEZA 1KPRB 2WZPD 4PRAB 3BW9A 4D3CH 2EYTB 3QDGE 4OSUH 3WO4C 2QR0A 4PJFE 5ISZA 2CKBL 3DI2B 3U36A 2NXYC 5EIIA 4ZNCD 1KEGH 4L4VD 3I2CH 3IS1X 3RIAF 4GAJH 1PSKL 2CLZB 4PJCE 2BVOB 3PWJA 4WFHD 3C5SA 4PRNB 4OJFH 4GUPA 5I8CA 3R0MA 4GBXB 3H7BA 3D9AL 3HC4L 1Q72L 4LLAA 3O6FB 3MOBH 2DOCA 3DXAA 3FCTB 3S36X 3MRMB 1IBGH 1JHLL 1EXUB 5B22A 4G3YH 4Y4HA 3EFDL 2NCMA 4H26B 2R15A 3F7VA 3FQTA 4HJ0C 5FGBC 2NY7L 5M94B 4KAQL 2VJXA 4WRLA 5DHVA 5ETUA 5JA9A 2ZKHH 2VLKA 1E6OH 1RMFH 5I2IA 1D9KA 2HFGH 2WV3A 3RNQB 1UZ6F 3ILPB 3AREB 2BNQE 1RZGA 2ATKA 5IW1B 4Y2DD 5D2LA 5EU6E 5D93B 3LEVL 1WAAE 2FJFA 4UNTA 3U9UA 2QQNH 2WBWB 4LARH 2PNDA 2X9YA 2P5EA 2C3HA 2XZAL 4LMQE 2CKBA 5T5FH 1N2RB 1SY6H 1WTGT 3FT3A 3I75A 1JF1A 3C8KB 4OFVA 3TV3L 5F8QC 4OCXL 1WSST 1LMKA 1ZEAL 4KUZH 3FZUC 1CT8A 3JXAA 4WFFE 3LV3B 3I85A 2VDPH 3VXUD 2ZCLH 4JRYE 5IOPA 4QXTA 1EO5A 3ABZA 3RWDB 5IEKA 1K8IA 4JKWA 4U1HA 2NXZC 3FB6B 1I1FA 1T1ZB 2D03H 4NYLB 2XTJD 4K8RC 4XP5H 3QUKA 1N5YL 1G6RB 2CUIA 2YUVA 5C0ND 5DVMA 3G6DL 2JJTA 2R4RL 1AQDA 5GS0H 4OGYH 3W0WA 2DQIH 3EYUL 3AM8C 2RFXB 4K55A 4OBRA 1YY9C 1AGEB 4Z5RA 2DQCH 3FO1A 1E4KC 1HKLH 3MACL 4U1SA 3TVMD 3SJVA 3O45B 4FS0A 3JWDC 4P57A 2YKLL 1YYLL 5DSCA 4YGVB 1TTUA 1MCEA 5FYLH 1S9YA 4PJ8C 5IBUB 2XZZA 5D1ZC 4ZUTA 3LKSB 1HDMA 2Z91B 1RFDL 3T09A 5FB8A 3KYKL 3UYOD 3IETA 1A64A 2XPGB 3BJLA 4HXBH 1AGDA 3ES6A 1T83C 2VYRE 5DA4A 2W0FA 3HG1B 4JO4L 5DRZB 1P9MC 2DRUA 4OKDA 5JO5B 5HYQB 1DUZA 2WUCL 4W68A 3NPSB 2DQHL 5FM5M 3GKZA 1JE6A 1IAIH 3O6LL 1J0ZA 4LHQB 4UB0H 2J6EL 3BXNA 3SDDD 4Z76A 4Z78A 3FO2A 4BELD 3L3OB 3OKKA 3HE6B 4NZRL 5BS0B 2HG5B 3QEUA 5EB9A 1ZWIB 4RDQG 4XX1E 2K7PA 5GISH 4Z7UE 1A5FL 5SWSE 4NUJA 3SKUD 3VFVA 1N6QH 4PJXA 3K3QA 5C0JA 2BSSA 5ACZB 2ZP0T 3SGKA 3PP3H 4AYFA 1A2YA 1UJTA 1T0NB 1J87A 3WNKA 1MIEH 5CMAA 4BFIA 2Y25A 3KDMA 1QHOA 3B3IB 4GG6F 4OKVB 1V3JA 3RPIA 5DRNB 5I66B 3LKRB 1F02I 1T1WA 4KZEL 1U2CA 5CEYA 1NEZG 4EUPB 2DQGH 4Y2DA 1XCQA 3K4ZA 2PYFA 1ZLSL 4M1CC 4ZO8A 1Z9OA 3VD9A 5JMOC 3HI1A 4MMZC 5HGGS 1H3GA 4ZO7A 4K3JL 2Y5EA 2CLRA 1D3CA 2YD8A 1Y0LB 5IROA 1RZFL 4HUUA 1JGLL 4DCQA 4XWOD 4HS3B 5T3XD 1DBJH 4XC1H 1X5HA 1I3VA 5DHYA 4PRDB 1Z3GL 4LSRL 1SEQL 2DQUH 5DVNA 4JVUA 5HYSB 3KPQB 2ICWB 4BJLA 1KCSH 1NAML 1BIIB 3O41A 1IEBA 3VXUA 2ILLA 3MJ7B 1TJIL 4CDHA 5MHSE 3PV6B 3MJ6A 5D4QA 3IDMB 1KLGB 1YY8A 3IXTB 5SWQA 2A74B 2AEPH 3WSQL 3DX7B 1IAKA 1QKZL 1P4LB 3ZHDA 4OD1H 1X9QA 1LK2A 2ATPB 2P24B 4KJPD 3B6SA 2QKIA 4Z7QF 1D5BA 4J1UA 3NA4A 1RUKH 3BDBA 3CFDA 2VL5B 4K94C 2X1XR 3TVMA 1QTYT 5FYKE 4NQDE 4NQUA 4PGZA 4LLYB 4WW2B 1IKFH 4HJGB 2Z4QA 5J89A 4O2EB 1A7NL 5DFVD 1YECH 2J2ZA 4K7PH 5IFAH 2J4WH 1TETL 3UDWA 4WFED 5HYFA 3A6BL 1MI5B 1MQKH 2KDGA 2Q76A 1JHTA 5B8CC 2Y1VA 2DQEL 1QSEE 4LVNC 1CU4L 3EO9H 4QTHB 2X41A 2Q86B 1IAIM 1NAMA 2GCYB 4I48B 4UUJB 2OP4H 4M5YL 1WUNT 3P3YA 1AQKL 1UH4A 3KXFA 3K0WA 1A7PH 2PN5A 3UCRA 4C56E 1U8IB 5T3XL 1F6AB 4IRSC 3QHTC 2YN3A 4LLMB 2BVPB 4Y0GA 3SDDA 2R69L 4G9DA 2KUTA 3ZKXC 1P5VA 5C0CB 4M6OL 3IU4L 4HH9A 3EW3B 4KI5F 4NKDB 4BSWB 5IVXA 2X44D 4Y16C 2UZIL 5CHNB 1IM3A 3SDXA 1I8IB 3DYOA 5I9QB 2WBKA 2I9TA 1J1OL 4FQ2L 1QSZA 4XVTH 4JY6B 2LU3A 5BOZG 3MRPA 1G6RH 3T04D 1U58B 1II4E 5E2VH 2ESVE 2EIZA 2G9HA 3O2WH 2F9BT 4AIOA 2VLLB 2YA1A 3WN5A 2KBGA 4G8GB 8FABA 5MEND 2KPNA 4OZGE 4FABH 2W60A 4M03A 3FO0H 4LHJB 3R8BB 1NFDE 1X6NA 3LRSB 4G43A 4UTAL 3V79C 3IAGC 4E0RA 1DSFL 5JHLL 3V5DB 1T20B 4FQ1H 3ZL4H 3BFOA 4F33B 4KV5E 4Q7DA 3ZTNH 5F88A 1INQA 3FB7B 3LEXA 3WFBH 2EC9U 5E1HB 3WJJC 3FFDB 3VI4E 2JB6B 3O6KH 3UO1L 5DQ9B 4NWTL 1N5AB 4NGHH 5C09B 4ENEC 4I2XA 4OV6F 4X6CE 4JRXA 4KKAC 2O61B 3BYYA 4M9PA 4KDTC 4N68A 1G7QB 2NY0B 2LABA 3OR6B 1DBAH 1EFXD 5E70A 2ADIA 5I15H 1CS6A 1YEGL 1TMCB 3MLYL 5CGYD 5IG7A 4JFFE 4LHUB 4LFHG 3SCMD 5B39B 5HYEA 1NDMA 5BVPL 1XF3A 4QF1B 1HQRB 2R0KL 1AO7D 3CXHJ 1JWUB 5FXCH 4HQQH 4ODHH 5KSBA 3RTQD 4LRNH 4CMHC 5EPMA 5FA4B 5JQHC 5KN5A 3CMOH 4JG0L 4MCZB 3WLBA 1VFAB 4F58L 4I9WE 4LLDB 4KHXL 3MZGB 1VKXB 3G5XA 1MCKA 2GITB 2DS4A 5K9QG 4TULL 3B9KD 3QUXD 5TDPA 2VKWA 1H3XA 3OJVC 2FGWL 4C4KT 3FQRA 5JQ6L 4NBYB 5HPMB 1WBYB 3GHEL 1I9JL 3HI6L 3CLEH 5H37G 3KPSD 5C08E 1PFCA 4RMVA 3W2DL 3BKYL 2V5SA 1J18A 2AJZA 2QSCH 1WCBA 3MRFB 2X4SB 4MD4B 2AJXL 4MMXC 3QH3A 4PUBL 5L88L 2D0FA 2NY2B 4AEHL 2VNCA 5E6IB 1YEJH 4X0KA 2RJMA 5E99H 2R1XB 4NNXA 1U8QB 1U8JB 2BNRD 2FZ3A 1JV5B 3D25B 3PGFH 4UIMB 2DB8A 3HAEH 4EBQL 2B1HL 1FZKB 4MZ2A 3N1PC 5TE4H 3Q5OA 1FDLL 5D71H 1CQKA 3WFDL 4ELMB 2APBA 2BERA 1S7WA 3BWUC 5LG1A 4X4YA 4L4TE 2R0ZH 1PAMA 3U4BH 4QHKJ 1TVHB 1XIWD 1YMME 1YUHB 2RQ8A 1E4XL 2CMRL 1XEDA 5TH2A 1ZSDA 3V2AR 4DGIL 4EKXA 2DQJH 4DGYL 3QUYD 3MRLB 5MENA 1QRNE 2EDRA 1I75A 2H6PA 5KOMC 4JFDD 3L95B 5EOTB 4I3SL 5EC2B 3JWOH 2DMBA 2X7LA 4RFOH 5EC1A 2ED8A 1ZHLB 1NMAH 4E5XB 6FABL 4Y5XA 2P8LB 3DO3A 1WCQA 3BHBA 5J6HA 5TE6H 1J1PH 4XP9H 2AEWA 1BAFL 4C58B 2GUOA 4N1EA 5DJXB 4Z7WB 2A6DA 3OPZH 1BJ1H 3RWHA 2YRPA 1BQUA 3U48A 4ONGH 3UBXA 1JNLL 1T2QH 2OJEB 1S7VA 2DLIA 1DVFC 2AXJA 2Z0BA 2IQ9L 4M4RA 3VFTB 1Q0YH 3CDGB 1EFXA 2A6KA 2HT3D 4KPHH 3KPNA 2IALA 4WW2F 4JFXB 5E2WH 4YX2L 4K7PX 1FQ9C 4YFLF 3RI5K 4LVHB 3SCMA 4A2LA 4DN4H 2XIDA 1MHCA 1AO7A 4CAGA 1AJ7H 4GW5B 1A6AA 3CFIC 5IQ7H 1AFVL 4OCWL 4Z7VA 2X70B 3G04B 5BZWA 2GJ6D 2M2DA 3AC0A 4V2BA 5ESAA 3QUXA 1BQSA 2F74B 3FRUA 4YAQB 3VA2C 4GG8A 1YMHB 3EGSA 1F4HA 4S1RL 2F53B 1OWWA 1VEPA 4MB4A 3GMMA 1FZJB 1CDGA 1W72L 3KPSA 4PV8A 3F62A 5FA3B 1CE6A 3W9EA 1UGNA 2DLTA 3LQAH 2X4OB 1KG0B 3QPXH 3VGDA 1BJ8A 2Y72A 5DTFB 1EEUA 2X4UA 3QEQA 1MFCL 2RIKA 2C7UA 5DD1L 4AL8L 4AM0A 2BNRA 1CFNA 1E4WL 4AMKH 5A2KH 1CICD 3OZ9H 1CD0A 2PYED 2HH0H 3RVWD 2X4RA 2B2XL 4YDVB 1GZQB 1PG7L 1RU9H 2AV7B 3IFLL 2IBZX 1CGVA 3FL7A 3WXVH 1NGXB 3MV8B 5DR5H 1GGYA 4QRTB 4YC2B 3CAFA 3V7AE 1XIWA 1BZ9A 2VR4A 2VRAA 3PIQA 3ZYZA 5FKAA 3EO1A 5GSRA 3QUYA 3BZFA 3QUMA 2Q7YA 4MNQD 5JHDD 2RAMA 3QEGL 4OLYH 5DJ2B 2C1PB 4JFDA 1JHKH 1K6QH 2BX5A 4UBDC 1W72A 3T2OA 2XQBH 3BD4A 1HHHB 5ILTH 3VFOB 3K1DA 1P2CA 5LGJB 3E2HB 1CYGA 1MRCH 4XCYA 1ZGLP 1Q38A 4UQ2A 4QHUB 1NSNL 5F89A 1D5MB 1BD2E 1S5HB 1ROWA 3FQXB 4S2SA 2LE9A 3D69B 5IFHH 4WU5A 4YHKL 2WANA 3DO7A 4IRZH 2EDXA 4P5TD 4U1JA 4YWGL 4X5WB 3OG6B 2BC4A 2DJSA 4QRPA 2F8OA 4I0PB 3KLAB 2H9GA 2EH7L 4YFEA 3IJHA 1KEML 5K59F 2D4FA 4UT7H 4XI5D 4P2RE 1A3LL 1UB5A 5FYLE 3RAJL 5CD3B 3ARBD 2WP3O 4MA1C 4O2CA 4WO4D 4JZNB 4WHYG 4UQ3B 43CAB 4JANA 1V3MA 1NLDH 3T0EC 3BT2H 1M05A 4KC3B 1YA5A 5CJXC 3UTPE 1I1CA 4PJGE 5IB4A 4HSQA 3GB7A 4R97B 3WCYA 1D6EB 5DVOA 4NWUL 1YNLH 1JN6A 1UT9A 5JW4N 1P53A 1FG2A 4XPHL 4N8VB 1U6AH 2GJ6A 4XMPL 3ARRA 4BFGA 4GS7C 4QY8B 4NZJA 4Z8FL 3W9DA 1FPTL 4Y4KD 1KLFA 3IVKB 2VH5H 4X7SH 3BE1L 3FB8B 4F7PA 3ARDB 4LCWD 2Z31C 5EO9B 1T04A 5FO8A 1FZMA 2X4PB 3TYGL 4OB5L 2I5YL 5L2KB 4Y4FC 4W6WB 4Q2ZB 3S5LG 1KC5H 2VE6A 4JPIB 3BP5B 5D6CB 4H0HB 4G8FB 1MJ7H 2X4QB 4YE4H 3TIEA 1ZV5A 3RVXD 3K4DA 2AI0L 4ODWA 3NAAH 4BUGA 1KTLA 1K3ZA 4RFNB 5IJVA 4MNGA 1ITCA 1FIGH 1M1SA 1HXYB 2W91A 1RIHH 1CICA 4ELMF 5I16A 2NX5D 2PYEA 3ZE2E 1P7KA 4ZXBB 1MCIA 1OCWH 4IS6B 2E9BA 4FQXB 4R0LC 5HGHB 4XXCC 3VFGL 3HI5L 4LCCB 4R26H 1G9NL 1G7MB 4K7FB 1PKQB 5GRJH 4O4YL 2MTPA 3D39B 2HLAA 4KK6C 2R1WA 2XZQL 3H9YA 4UI2A 4BK4A 1A1MB 5ERWA 5C0IA 4J6RH 4MNQA 3PWLA 5JHDA 4CMMA 3DUSA 2PXYB 2AJVL 3C6LB 3IGAA 1XGTA 4LCIH 2UWEA 1B0GA 4AEIH 4CBPA 1CXHA 1W8NA 2V9RA 5LGKA 2YPLB 3SKMB 4PD4J 5FO7A 5B38B 5DD6B 3HC3H 4KFZC 4Z7WF 4YH6A 5F21B 2CGRH 1HH6B 4JKKA 4PJ7B 5GGVY 3BP7B 4HZAA 5HHVH 5HI4C 1T1YA 2R23B 4P5TA 5ALCH 2ADFL 3S37L 2EDWA 5KSVB 5D1XC 3RL1B 1TPXB 5F97E 4IOSD 3K8KA 5D1QC 4ZFZA 2OXHA 5JOPD 4P23D 1A7QH 3QUZC 2P5WB 3RWFB 3QEHB 4D2NA 1HSBA 4FQIL 3NN8B 3F58L 1DEEA 4JDTL 4XPFL 3VXNA 5M7QA 3U2SB 1EO8H 4Q6IC 3MO1A 4EEEA 2X2YA 4Y5YA 1MFNA 5GRVK 5L2JB 4ISVB 3ARBA 4NT6A 4TVSa 1YJDC 4CVZA 4WO4A 2PW1B 4ZO9A 3W5MA 1KJ2B 2ARJB 2HN7A 3KPOA 3NCJH 4UOJA 3RVUC 4PJ8B 1MH5B 5J12B 1MFBH 5SWZD 2MCG1 4EOWL 2YA2A 1FFPB 4NQTA 3EDKA 5DJYA 1KCUL 2WWMC 1R3HB 5IW6A 3VXRB 3QIBD 3UP1A 2FEEI 1VGEL 3SDCB 1Q9KA 2NY3B 3MLRL 2ADGA 5HGBB 1CIUA 3OHXB 4Y4KA 3QCTH 1JGEA 3OXSA 3FT2B 2H2PD 1TQBC 1CLCA 2JCCB 3U0TA 4LCWA 1I7RB 3VE0A 5HHME 2GY5A 4XP1L 2DBJA 1GZPB 4PG9B 3UAJC 1OSZA 5HHXH 3SKNB 5ENWB 1U3HD 3BW9B 5H8DA 5F1SA 3ZSSA 2QR0B 5CJQH 2PW2A 3THMH 2VQUA 3U36B 1XCTB 4JFZL 4HWUA 3E6HA 2R29H 3FMGH 2NX5A 3MCLL 3MLVH 4EUPG 1IGJA 4DTGH 3RI5F 4KGJA 2R2CA 5T1DH 4M3JA 3PWJB 1LO3H 4N5UA 4MNHA 1ADQH 4KKCD 1KBGH 5I8CB 3ETBF 3H7BB 1IGCL 3H9HA 5DD3H 3MRGA 1Y6KR 3OKDA 3DXAB 5D7SL 4B50A 1IVLA 1MF2L 4HUWA 5DMGC 1AXIB 4JFYB 4EIGB 3F7VB 3SDAD 3FQTB 1KB9J 3WE6A 1BZQK 1EH9A 3OMZA 3QXWA 2HRLA 5DHVB 3PABA 5ETUB 5TPWL 2ZUWA 5JA8B 4KY1L 5I2IB 2VLKB 2ZOLA 5I8EA 1D9KB 3HG1E 3HA0A 1RZGB 4J7RA 2CLVA 5D2LB 1ETZA 2J1KA 2FJFB 3U9UB 5BO1H 1BECA 4PY8J 3H9SE 4LKXB 3LZFH 1UJ3A 1CZ8L 4JR9H 5DFTA 4TOYL 3FT3B 1UXWA 1ZT7A 1Q9LB 2W59A 3H0TA 1S7QB 2YMXH 1JF1B 2JK5A 1JNHA 3EJYC 3QXAA 4XGZA 5C92A 5EZLA 2VABA 5D7IE 1F6FB 4P23A 3LRGA 4NC2B 1CR9H 5D5ME 3QDGD 1W0WA 3LN9A 1FFOB 4EDXA 3EOYG 4LKCA 3TO4D 3O3BA 4TQEL 4QXTB 5IEKB 3I3DA 2ZJSL 1K8IB 3CIQA 4U1HB 3TZVC 2OR9L 4NZUH 1I1FB 3MRIA 4Z0BL 4YFDB 1QUNA 1RUQL 3QUKB 2NY5L 5DD5L 3DSNA 4POUB 1DBML 5SWZA 4L8SC 3W0WB 3SKJL 4ZD3L 5EWIH 5IR1B 1ZAGA 4OZHE 2NZ9C 3FO1B 4U1SB 3SJVB 3SY0A 3HR5A 4P57B 2Q7NA 5DSCB 5KOVC 4JO1H 1GAFH 7FABH 1S9YB 4M7ZB 4JFQA 5K33A 1NCNA 4ZUTB 5F9OL 1ZLVK 1HDMB 1MLCA 2BNQD 5DD0H 5FB8B 1FSKC 2BHUA 3C5ZD 4YHIA 5EU6D 1FO0H 2W9DL 3X11A 2XA8H 2CH8A 1AGDB 3ES6B 2DIAA 5IBTH 1ZOXA 5T33H 4FNLH 5C70A 2W0FB 3RU8L 1DUYB 2NZIA 3ZKXB 4X6DA 5D6DA 4H8WL 1RVFH 2ZUTA 1DUZB 3PL6D 2Z92A 2JJWA 4HWNA 4FZ8L 5GS1A 2CJUL 4LDLB 2V2XA 4M00A 4NRYB 4MVBD 1OW0A 4CADB 4WFFD 2IFFL 4L8CA 3BXNB 3U82B 4Z76B 1JI1A 4Z78B 3FO2B 1TZGH 5K9QI 2CXKA 4RISL 4RNRB 4LVEA 4AJ0A 4JRYD 2EDNA 3QEUB 4PJDB 2X10A 4MJ5A 4P46C 5A2IH 4OCRH 4LGPB 4NUJB 3VFVB 3ULUF 1NGQL 1I1AD 4PJXB 3JWDH 5C0JB 2BSSB 5IM7A 2ZCKL 1BPVA 1A2YB 4FFYL 3NMEA 3HZVA 3SDAA 4F3FA 4U1GC 1MI5E 4BFIB 3RDTD 3KDMB 5JW4M 4H5SB 1BFVL 3VA6A 1RHFA 1NBVL 4PJ7F 4UDUA 4R4ND 1X5AA 4Y2DB 2PYFB 2R56L 2J3SA 5EOCJ 4HEME 2VZOA 2OK0L 2F5BH 4ZDHA 4TRPH 1MFAH 2L4OA 1OAKH 2CLRB 3KYAA 3VMNA 4HUUB 5A3IC 3B5TA 1X44A 5IGXH 1VENA 4RWYH 1S7UB 3VW3L 1UM4L 5C0CE 5E8OA 5DHYB 4XNXL 3X13B 5E00A 1F90L 1L7IL 2RCSH 3SO3B 3UROR 3QDGA 1H3VA 3O41B 1IEBB 4PJFA 5BMFL 1RY7B 3QRGH 3VXUB 1KT2A 1YEKH 4J4PA 3TO4A 1H3PH 5GSVA 1KYOK 2VDOL 1RIUH 4MYWB 3QZWG 2DAVA 1YY8B 5SWQB 4LSPL 1IAKB 4PJCA 2A83A 2BHYA 1P4BL 1LK2B 3ILQD 4UT6L 4CMHB 1I9IL 2XKNB 3B6SB 2QKIB 3D0VA 2FATH 2LU7A 4U1LA 1D5BB 3RWGA 4J1UB 2X6MA 3JV0A 3CFDB 1PX3A 5SWSD 4HWBL 5FO9A 4AZ8A 1VFMA 1F97A 3DVGA 3WIHH 2JCCF 1CCZA 3STLA 4K9EL 2IPTL 5ID0A 3QXVA 4I18C 3C6SA 2Z4QB 3FT4A 4LSUH 5TFSH 1L7TH 2BHZA 4JB9L 3WHE1 4XPTL 3L5XH 1QLFA 4LSSL 4X8XA 3RY4A 4WY7H 5CP7B 5BOPA 1GC1C 2BNQA 4ODUA 2ZNWA 1Q9OA 2HLFD 1J05A 3C5ZA 5EU6A 1MVFA 5FFLA 1WAAA 2Q76B 1JHTB 2FBOJ 1MCRA 3S4SA 3QA3A 4KXZH 2BVEA 1OAZH 2DIBA 2P1YA 3BQUD 4JZJA 4IEFB 4ZS6C 1NAMB 2GTWB 2OTPA 3FFCE 3C2AL 1GOHA 5GZND 3PL6A 1WBXB 3TNMA 4TSCL 2AAVA 3KXFB 5FEBA 2AJYL 5HHPA 3I3BA 3AY4A 4JKMA 2YWZA 5E1AA 1J8HE 1QR1A 4HW6A 5BQ7A 3MR9B 4G9DB 4ORGA 2AJUL 1YNTA 3GBNH 2BRRH 5K59E 3O2VH 3ULVD 4JRYA 2YRLA 4EN3D 4HH9B 5MHSD 3GGWB 5IVXB 1EHNA 4HWBA 5I1JL 5HYIA 1IM3B 3MXWL 4K94H 4FQPA 3SDXB 2EC9T 1AGBA 1I1AA 5EZJA 4JQIL 4FQCH 4G7YH 1K4CA 3NPZB 3MNWA 5D2LF 3NZHH 3MRPB 2YN5A 2FO1A 3RDTA 3GZKA 2PF6A 5FYKD 1MCFA 3BAEL 3WN5B 4NQDD 4XVSH 1UCBH 2R9HD 1S8DA 5ESVB 4KQ3H 3BDYL 4R7NA 1DQJA 1FORH 3GMQA 4OT1H 4LP5A 4FXGB 4G43B 5FYJU 4E0RB 1HH9B 4FZEL 1FBIL 1IAII 1F6LL 3WIIH 5F88B 3GK8L 1QSED 2VDKL 1N3NA 4N9OB 5DYOA 3C09B 3MMEA 4MA7H 2X42A 3T4YB 1LEKA 4I2XB 1B0RA 4LSQH 1XF2B 4I77H 4JRXB 2YD7A 4C56D 5DEGA 5LBSH 4W6XB 1VA9A 1BZ7A 1IM9D 1PEWA 5FOJA 5I6XC 1LO2H 3VGEA 3MJGX 2VTFA 5KG9A 4GRMB 2FEDC 3NFNA 5SV4A 1QACA 1IC5L 3ULVL 5IG7B 3S3PA 4WI5A 2HAZA 4M6NH 5SWSA 1XGPA 1NDMB 1X5YA 1XF3B 3O0RL 4JN1L 1QHPA 1AD0B 2VDMH 3MUJA 5KSBB 2KKQA 4NIKB 2YK1H 5EPMB 5F96L 2ESVD 3ZHLA 4QRSB 2LTQB 5KN5B 3WLBB 1Z5LA 4GXUN 4FN0A 3MBED 1LEGA 4HD9A 3IDXH 4OAWA 1F4XH 5FYKL 1KB9K 5TDPB 1GIGL 1NQBA 3FQRB 3BQUA 3ZKND 1DJSA 4JPKH 4WHYH 3LKQ