5DRZB

Crystal structure of anti-hiv-1 antibody f240 fab in complex with gp41 peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
227
structure length
227
Chain Sequence
QVQLVQSGGGVVKPGASSRLSCAASGFTFTDYYMSWIRQAPGKGLEWVAYITKDGSEKKYADSLQHRFAVSRDNANNLVFLQLNTVEDDDTGVYYCARDDGYYDRSGYYGVFDLWGQGIRVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HIV Antibody F240 Light Chain
publication title Molecular basis for epitope recognition by non-neutralizing anti-gp41 antibody F240.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 227
sequence length 227
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5drzB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5drzB01
2OTWB 1UH4A 4I8DA 4HC1L 5ADPL 1HI6A 4BM7A 3QUXD 3U4BH 4MXQD 4BUHA 1KTLA 2ADIA 3HMXL 4QXGL 1H5BC 4ZUUB 1LP9E 5T3ZL 4PJHE 4YEFA 4BK4A 3O3UN 4Z77A 4EVNA 4JO4H 5JQHC 3HMWL 2FEEI 2D2OA 3F5WA 2ADGB 4KHXL 1K8DA 3QEQA 1EEYA 1NCAH 3ZE2F 1N6QL 4HMEA 5I73C 3SCMB 1INEH 3VD4A 5IMOB 2Y5EA 2E7MA 4Q9CA 1XF4A 2ARJA 3QIBA 4U1LB 1DQJB 3I02B 1FNGB 3LKRA 2O5XL 5MI0C 1WC7A 5DUPH 1DQMH 3U7YH 3S36X 1W72A 3F7RA 3RVXD 1KIRA 2D7PA 5E00B 4NGHH 1Y6KR 4NC2B 3EOTL 4I0PC 4ELKB 3IVKA 1RAMA 5DD3L 3CGTA 4HFWB 2VR4A 1BAFL 2KH2B 3TIDA 1XGTA 4ZFOA 5D96C 1JZ6A 5C7XH 2AAVA 4OZHF 4YHKL 3D48R 5HHOD 2VDMH 4I2XB 4EUPA 3QZWA 3HI6L 1FYTD 1VFMA 5FYJL 5LGHH 4EN3D 5H37G 1I8IA 4GRLC 1GGTA 3BQUB 1ORSB 3TZVA 5IESH 1C8PA 4JFOB 3EYSL 5EIIB 1NPUA 4JVPA 1RJCA 4DK6A 4HIHB 1RZKH 4I0CC 4LGSB 4TVPE 2B5IC 2DDQL 3MGAA 3QNZA 2FB4L 4PBXA 1Y6MR 3SDDD 3U1SH 4YHYC 2IAMA 2Y23A 1U95B 4OM0L 1J11A 3QIBC 4M1CD 2BNRB 4DGYL 2FJGA 1YJDC 4LHUA 5FYLE 2XZAL 3NVQA 3L7FA 3MV11 5IB1B 3CX2A 5JW3L 1VHPA 3VH8A 3CVIH 4AZ8A 1G1YA 4MNQE 3D9AL 4JM4H 5HHPB 2ICES 2IH3A 4XBGB 3V0WH 1J8HA 5KSVB 3OXSA 5FV2A 4NKIL 3RNKA 4QO1A 5AYUL 4M8QB 5HHMB 3N1PC 3CSGA 1DUZA 1OP9A 3LH2L 5L2KE 4EIGB 3OSKA 5D1XA 1LEGA 2COQA 1S7QA 5D1ZB 2CJUL 1N5YL 4K7PY 1W8NA 4X9BA 1MRCH 1Z9LA 4JN2B 3OPZL 3O3EB 4HV8B 4QXTB 5F21B 3TZVC 3QR2A 5HYEA 4PJEE 3GMLA 3KPLA 4WTWA 3SO3B 4QRRE 3GSWB 1RY7B 5DQ9A 3NFNA 4OCRL 2IAMC 4F7PA 3QJFA 4FOMA 3HZMA 4IHOA 4KHXH 4XNMA 4S1RH 5DRZA 3PP4H 5KSUA 2P8MB 4M62L 4M03A 4ORZC 1O5DT 3GSOB 2D0GA 3JTSB 1MNUL 5DFTA 3P2TA 3QXTA 3WLWC 1AKJA 5I8EA 4IOIB 3KPSE 5K59F 1IQDB 1SYVA 2HTLD 3RGVA 5DD3H 1I1FB 2R4SL 5D1XC 5FV1L 5CMAB 3F7VA 4X80L 1MCWM 3PWPB 4YDIL 4L3CB 4YHOL 4F3FA 1YYMH 2ICEB 4M3JA 2HT2C 1JJUA 3RX7A 5INDB 2UWEA 3O8XD 1B2WH 2QADB 5I30L 5J7CC 1XH3A 3KGRA 4I18B 5E6ZA 5T1MA 2UV3A 3C5ZB 1R6VA 1PKQE 2ITCB 4KTYA 1RHHB 1IM9D 2FB4H 4HKJA 1UEMA 1JRHH 4OM0H 3LCYA 3DUSB 3RU8L 1I3RB 3IS0X 2WUCL 4NQEA 1FZMA 3DX8A 4W6YB 1A1NA 1U3HA 5SWSE 5JW3H 3VCLA 1NAMB 2EDDA 2R0WH 2FHFA 3RGVC 4AIOA 3HFML 1NFDF 4LKXA 4G9DB 3LB6D 4PRIE 1JWSB 5IVXB 4NKIH 3HAEG 3LH2H 4HG4K 4BYHA 1T03H 5B39A 5KAQF 4MQSB 3KLHC 3VFVA 4U6HB 1N5YH 4JKWA 3OB0H 3OPZH 3NPSB 3CPLB 1BMGA 2P1YA 2PO6B 4FQLL 4ORGA 3UTQB 2MCG1 1V5JA 1T7YA 5KSBF 2G9HA 1QRND 1ZOXA 4JRYD 4LRNL 4OCRH 3T2OA 3L1OL 4Y5XC 2XQYK 5D71H 5J6HA 3NGBC 3A6CL 3UTSB 4YHZL 3A6BL 1YNTB 2DQIL 4ZO8A 3MRMA 4P2QD 3QCUH 3TBYB 4YE4H 3IFNH 2EKJA 1U3HC 5CIPH 5F7YC 4O2CA 5IKCA 1NSNL 3V95A 1KPRB 3QUMH 4WY7L 4JFXB 3RWEA 3SE3A 1MNUH 4NKMB 4XVTL 3MV7B 4X99A 3T4YB 2VL5A 3CX5J 1J05B 2R4SH 3WO4C 1I8MB 1S9XA 3WNLA 3O9WA 4YDIH 3G6AB 4H0IA 2OQJA 1YN6B 3S35X 3W0WE 3VFOB 3OGCB 5DTFA 1V3KA 3DVNA 5CSBA 4X7EC 4GKNA 4J7RA 5I8OL 5B8CB 2PUQT 3EFFB 3W9DA 4EI6B 2BVYA 3OR7B 1X4XA 2W0KA 3U46B 2FBJL 2MCPL 4J6RH 5KVEL 1JTOA 1MFEL 1NH6A 3S9DB 4RMWA 1X5GA 3ESVF 3PIQB 2ZG3A 4KFZC 3DRQB 3TBWA 3DTXA 3UZVB 3WMSA 3KHOA 5F6IB 5ID1B 1CG9B 1K8IA 2VKWA 5DZLA 1NFDA 1Z6JT 4PLJD 2DQDH 4QKXB 5IB4A 3CMGA 5MERB 2QHLA 2Y7QA 4ZTPL 3O9WC 1JNJA 4JANB 3QEQD 1VEPA 1DBAH 1T2QL 3PWVB 4O2EB 3L3JB 3QIBD 4H5SA 1XGUB 1UXWA 1P9MA 4HWZB 4FQLH 1N5AB 5FECB 2H1PH 1X5XA 1XZ0A 1H15A 4TVPL 4Q6YA 4Z7NF 3HHRB 4U3HA 3HCVB 4MJ6B 3VI3E 4HD9A 1D3CA 2V5TA 5D1QC 1UXSA 3FZUC 3MODH 3IJHB 3L1OH 2VDKH 4WU5A 3DV6A 2NNAA 3A6CH 4MD5A 4YHZH 3NZHL 1M7DB 1AGBA 1MHPH 3Q48A 4NRXB 1CD1A 1QRKA 3NIGF 4LRIA 4QOKA 1AGCB 4X6BA 3X13A 3RNQA 2XXMB 3BZ4A 1NSNH 5CD3B 4ODTL 4PGCA 3TZVD 1WUNT 3CMOL 4J3SA 1OM3L 4M02A 4ODXB 1YMMA 4NC0B 1VERA 2LVCA 1PG7L 4PGDB 4HJGB 1JNLH 2IAMD 5J9PB 5C0FA 5GS1B 2V2WB 5FF6A 3P3YA 5MEPA 2MNUA 4RBPH 4F37F 5E03A 1MAKA 1YECH 1P9MC 4LHUD 3UEZA 2JCCB 5JPMB 4Q0XH 4E9LA 5FYLD 5L2JB 1K85A 5F72S 5EBLA 5HHOB 4RGNE 1FYTB 4FZ8L 3WLWD 2IANA 5J1AA 3A6OA 1J8HD 3GI9L 2EE3A 1V3LA 2CO7B 2FBJH 2MCPH 4MSWB 2Y4SA 1W72H 5D1XD 1AQDB 4FFZH 2WMPA 4FTVE 5L2KD 1KC5L 1N26A 2YD4A 4P23C 2APTA 2AJUL 3STZA 2R1YB 2HT2D 2NY6C 3MRRA 1T0MB 3R8BB 3FO1A 4I5BA 2W9EL 4ALAH 1H9VA 3IB4A 4KUCF 2C4FU 3U2SB 2R2CA 1M4KA 3VGAC 4PG9A 3LSOA 1YY8A 3R1GL 1BBJB 2IPTL 2DLHA 4OCWL 3DECA 5I17A 4HAFA 1DLFL 5CEXB 4XWGH 3SKMA 2AJSL 1DBBL 1JPGB 5CJBA 3JV4B 1AKJD 3LN5A 2XTJB 3V5DA 1H0DB 2Z31B 3OJDA 5DFVC 3RGVD 2YPLB 4HUUB 1EGJL 1J88A 3P77B 5FYLH 2R8SH 1JF1A 3BHBB 5E0QA 3FT3B 1KN2L 1E4KA 4PTUA 4ZAKA 5JW4Q 1QLFA 3WIHA 1U8NB 5DR5H 3X12B 3KLHD 5D4QA 2BC4B 2EE9A 1GAFL 3GMOB 4XCNA 1BJ8A 1RULL 3MYJA 3O6FB 3W11C 3CMOH 4GAGL 1OM3H 1NGXB 2IQAB 4PP1C 1C7SA 2NY5L 3TCLA 3MA7A 4KJPC 2FX9H 5IV2B 2DICA 1KB5B 4JE4B 3ZE0E 4X7TA 4NQED 3BKJL 1U3HD 3LEXB 4DUWA 2IADA 4PY7A 3MV9E 1BFSA 4FZ8H 4DJMA 2X70A 1OGTB 1YEIL 4G5ZL 2CH8A 5H35A 5I1EL 1E4KC 1H3XA 4Z6AT 2MOVA 3KLDA 3GI8L 2VR5A 4Z7UF 3WXWL 1F8TH 1KC5H 2Z35B 1G1CA 1J10A 2AJUH 4TSAL 2GCYB 3H6JA 2LE9A 1KGCE 5GGUB 3JWDL 5CINL 2ZKHL 5DJXB 2W9EH 5E2UH 5E5MB 2DIBA 5ERWA 4GRWB 2PYFA 3I2CL 3WJJA 2UZIL 1I1CA 1LE5A 4OSUH 4LKCA 2H2PC 5L8LB 4POZC 1NEZG 5GRVL 4FA8A 3R1GH 4YO0B 5EB9A 5EDXA 1OOAA 3CDGA 2IPTH 1WBZA 4ZXBC 2RCSL 4ZUWA 1JF6A 4OCWH 3B6SB 4JFEB 1DLFH 2AJSH 4X4YA 1RUQL 3KS0H 3TF7C 4PY8I 3FO9B 4XPFL 4LBEB 3KPRA 3IDYB 3NIDE 5C08B 2VSDA 2PR4H 3G9VA 4PR5B 2CDFB 2SEBB 1A6PA 3VFWA 1EGJH 1FBIH 2B1AL 1CE1L 1N64L 1JGVL 4LP5A 1OLLA 3O9WD 3FFCA 5BVPH 5GSVA 2IBZY 1GGIL 1QRNB 4AY0A 3LRGA 4JRYB 4R96A 3O41B 5D7SH 3QRFM 3DGCR 2DQGL 3MLTB 5HYJE 2N4IA 1OLZA 3EOBA 5GZOC 2ED7A 4GAGH 1BIIA 4PUBH 3LRSA 3O3AA 1U8QA 3WJJC 2MPAH 4OJFH 4NO0A 1KOAA 4W68A 3OKDB 2Z93A 2ADFL 4EXKA 1MJ7H 3SY0B 1QSEE 3FZUD 3WD5L 3H3KA 4Y4KB 3BRGC 3RTQA 5C0BA 5TF1L 3BKJH 2C1OA 3MCKB 1X3DA 3B2VH 1FL3B 3NACH 3SHSA 1UKQA 1G9EA 1T22A 1BJMA 1FAIL 4O9HL 1RIVL 2OI9C 5EC1A 2H32H 5D7IA 3RKPA 4DGIL 1R3HB 1KEGL 2XNAB 4UILL 4Z7UA 5MI0B 5HPOA 1JZ7A 4CN1A 4WW2B 3DSFL 3WXWH 4HLJA 2Y6SC 5DSCA 2QBWA 1F90L 1GVIA 3NN8B 4ETQA 3IF1B 4TSAH 2C3GA 2G5BA 2J2ZA 3BPCB 3RUGE 2FCBA 3VFNA 3TO2A 1A3LL 2DL9A 2UZXB 4ESKA 1RZ7H 3JWDH 3VA6A 3JXAA 4KRLB 4DWHA 2DQJL 2OJEA 3L7EA 4KK8C 1HI6B 1X5JA 3RIAF 3BIBX 1KTLB 3I2CH 5DI8A 5F1OB 1KUMA 2R1WA 2B4CL 4OT1H 4I77L 3RTQC 1LMKA 3FB8A 4FQHA 4QOKD 4U1GB 1AY1L 2E8ZA 4MHHI 1CDYA 4EVNB 3MCLL 3HUJF 1GSMA 1H3PL 1RMFH 2GSIA 5I8CA 4HF5H 1UM4L 3F5WB 4P23D 3QEQB 4APQA 4D9LL 2HMIC 5DMIH 2NY2C 2ARJB 3QIBB 4G43B 1YMMD 1WC7B 1R5WA 3IFOA 2F5BH 1CU4H 2B1AH 4LASH 1CE1H 1KIRB 1N64H 3K1KC 1CL7I 4G80A 1TVHA 4LU5L 2ZG1A 1GGIH 3UTSE 5DEGB 5J0BA 2AI0H 4LPCA 1OW0A 3TIDB 3S37X 3ULUE 4ZFOB 2DF3A 5IBUG 4M7LL 4PG2C 4LPXA 3V4UL 4AM0B 4EUPB 2P5WA 1SEBA 4JPWL 3VRIA 4GMSL 2VDQH 2IAND 4RWHA 1I8IB 3MV7E 1JYNA 3BIAX 5DFVD 3QA3A 3C9NA 2QQLL 2Y06L 3D39E 4U7MA 1NUGA 1CFTA 2A74A 3IFPA 3LV3A 5T1DH 5F93C 1JGUL 5CJOL 4BQCA 3D39A 2XY1A 4OGXH 2A2QT 4FFYL 4BQ8A 4S1QL 3QNZB 5E2WL 3QEHA 4WEBL 4DZBA 3IFLL 2R9HC 2D7OA 4C56B 4Y89A 5EG6C 2ZOLA 1FAIH 2FJGB 2GK0B 1RIVH 2GFBA 3W11D 4LHUB 4R7DB 4WHTA 2KPNA 3L7FB 4CVWA 3GSNA 2RBLA 3B4NA 3VH8B 3V8OA 1WBYA 4PP1D 5K9OA 5C86A 4P99A 1OW0C 2J8UF 2H26B 3O81A 3OXSB 4KJPD 3RNKB 3VD7A 4YC2B 2IJ0C 4OM1L 4N90E 3MRGA 2D7QA 1FDLL 1DUZB 5HY9A 3DETC 1YDPA 1LEGB 1S7QB 7FABL 4OUUA 3ES6B 2DQJH 3SPVB 5T1LD 3B8SA 3UZQA 1JZ2A 1CI5A 4YHNB 3C2AH 3GMLB 1PLGH 2AEQL 2B4CH 2NXZC 4ZAKD 2BVUA 3HUJA 5IHUL 5DQ9B 3NFNB 2EIZA 1ADQH 3QJFB 1H3PH 1SVZA 3HZMB 4D3CL 4IHOB 5K33A 1MREL 5TE7H 1CFSA 4XNMB 5DRZB 1CGSL 4YXHL 3RDTA 2X7LB 5KSUB 3I6KA 2J1KA 4NOBA 4OZGE 3KYNA 1KENL 4ZFZB 1EHNA 1AKJB 4OZGA 4CRPA 3SJVA 1SYVB 4F9PC 4POZD 1WV7T 3RGVB 1MVUB 1Q1JL 3TYFA 4ZXBD 2VITB 5BQ7A 2A9NL 2DM7A 3GMRA 4OZHB 2MHAB 5HHNA 4KQ3H 4WHYG 4F3FB 5J13B 4JPWH 3SKOA 2AKRB 4HFUH 2QLVB 4XAKE 3ARFB 4KVNL 3EDFA 4KUZL 3THML 5H2BB 4C58B 4X6DA 4MCZA 4LCCA 3T77A 1XH3B 2QQLH 15C8L 1JP5A 4GAFB 3GJFA 4U4BA 5KVFL 4U2ZA 3L5HA 4LGPB 4S1QH 5E2WH 3O45A 1B0GA 1RZFH 4G9FB 3RDTC 5JHLL 2DWDA 4HKJB 4WEBH 2Z8WC 1OTTD 1JBJA 3TV3L 1D5ZB 4MA1B 4OCXL 2VDLH 1D5XA 4HWUA 1YEJL 4IM8A 4NQEB 5GZOD 3EYUL 3VU2A 3GIVA 1A1NB 1XR9A 2UVFA 4R0LB 4NQTA 3DROA 2EZ0C 3VCLB 5B38B 2J8UA 4H26A 5LG1A 4XCFL 4GUPB 3VD9A 2BXYA 1ZT1A 4WFED 1U3YA 3VDBA 1IKFH 1FDLH 4MA3A 5B39B 4D9QD 3KPRD 2PCPA 32C2B 4M3KB 5E94B 3V6OE 3VD5A 7FABH 1HE7A 1MWAA 5GGVH 3TPUA 4LCCC 2DKMA 1L7TH 4ORGB 3TH2T 3FFCD 3QNYB 4QCIA 3SGDI 1CLCA 2OP4L 5B38G 5L9DL 2G9HB 2KZWA 1DEEB 2X40A 2Y6SD 2W0PA 1UCBL 4XMPL 4D3CH 2YZ8A 5J6HB 3HLAA 3HZVB 3JWNC 1O7VA 4JKLA 2P48B 1CGSH 2VL4A 4OCYH 4YXHH 3VXTA 3MRMB 1VENA 4EBQL 2XTJE 4O2CB 5IKCB 4NO0D 4NQDA 5ICZA 4KK8D 4QWWC 2GIYA 2YPLE 1XF1A 5EFIB 4X99B 3IYLW 5F7FA 4GBXA 3CFDA 3RTQD 5DGRA 5C0BD 3V5KB 1K5NA 1T21A 2A9NH 5CWSA 3N1MC 3ROLB 4KMLB 1AC0A 5ACLA 1S9XB 1NAML 2C5DC 2WM0A 3MO1A 3QDMB 5D9SA 1FLRL 2GTWB 4PTTA 1ZEAH 4JG0H 4NWUL 3Q1SL 3CX5K 2QSVA 4XP4L 2NY2D 3QDJA 4KVNH 4KUZH 3THMH 1NBYA 3BVNA 3DVNB 5CCKL 4XWOC 4NT6A 4MAUL 15C8H 4GKNB 2Y5TA 4MQ7A 3F7YA 3S5LB 4PJ9A 5KVFH 1IC4H 4I4WA 3R4DA 2YN3A 2IEPA 1I1RA 1UB5B 3P73A 5GJTL 2HVKA 3TYGL 3TV3H 3QAZB 3BP4B 4OCXH 5I75B 1T1WA 4HIXL 3U48A 3UPRB 1F2XK 2D0FA 3DTXB 1OAKL 1K8IB 2GJ6A 3NA4A 5ETUB 4XTRC 1NFDB 3S88H 1R3IL 1C5CH 5IB4B 3ULUL 1Y0LB 3S5LG 2YA2A 2X4TA 3U0WL 1BVLA 2D7TH 4N0UA 1JFQL 2X4SB 1UADC 5CEZD 4APQD 2FDBP 2XG5A 2R9HD 4D0CB 4YBQC 4H5SB 5D70H 1MCFA 4X4XB 2YEZB 3RL2B 1P53A 1UXWB 2X09A 2HAZA 4M9PA 4ODVL 1XZ0B 1U6AL 2XACC 5KSBB 4GRWE 1IE5A 4PJ9C 1EJOL 2K3TA 3C87A 2YXFA 2HT4C 1UXSB 5I74B 2X4NA 4JFEE 2NNAB 3WKML 4MD5B 3GSVA 5F9JA 3JWOC 1AGBB 3NFPA 2P5WD 4K7FB 4QOKB 4X6BB 5HYQA 3DETD 5L8JB 3DXAE 1FRGL 3X13B 3BZ4B 4WUUB 4YBLC 3HAEH 3N9GL 1BZ7A 1SHMA 3QXVA 2Q76A 2VYRE 5C08E 3HE6B 1KXVC 4FG6C 5ICYB 3C5SB 3D39D 1XIWC 2NXZD 1BEYL 3T0WA 2Z92B 3FONA 4HPYL 2R0LH 5T3XD 1FH5H 5C0RL 5MEPB 1U8LA 4QRTA 5ISZE 4PJ8A 3VGAB 2YZ1A 1E4WH 4NWUH 4HQQL 1RSFA 4R90L 1IRAY 4ODHL 2DM4A 3C60B 5EBLB 1Q9WA 4RMRA 4XNZB 2IANB 5J1AB 2B8OT 1KTDA 4OLEA 1I3VA 1A7BA 3WDHA 4QRPE 5TQ2L 1QQDA 3S36H 4RMTA 5CGTA 1T7XA 2OXGA 5JLZA 1ZLWH 4JRXA 1NEUA 5E7BA 1KYOJ 4HIXH 3STZB 5AG9A 5IW6B 4XBEH 5GGRA 4L4VA 1OAKH 3MRRB 1B4JL 1DE4A 3FO1B 5IR1B 4N5EC 4I5BB 4S11A 1R3IH 5E9DB 5JW5A 4QHUA 4X6CF 4FQJL 1CXEA 4N8CL 3TT3H 1JFQH 4FQ1L 2Q6WA 4XP9H 4PJ8C 4Z5RA 4LLVA 3LSOB 1YY8B 4YHPA 3RDTD 5DRXB 3VFUA 4KHTL 5I17B 3HKFA 4WI4A 4MQXC 5HVHC 2WK2A 3SKMB 3P4LA 1HKFA 2M26A 4NNPH 1KCUL 4U1HB 5FO8B 3V5DB 5T3XH 1OWRM 3SJVD 3WO3B 1GGYA 5DVOA 1WWWX 2EZ0D 3OJDB 1JVKA 5SX4I 3CK0H 4LLUA 1VGKA 3V6ZA 4DN4H 5JUEH 1KT2A 2WWKT 1CBVH 4WW1B 2X1PA 2YA0A 2AEIT 4PTUB 4ZAKB 5C3TA 3F12A 1QLFB 3UC0H 1FRGH 2E6JA 3NCCB 4NN6B 3IU3A 4ISVA 5KJRL 3MFFB 4XCNB 3BD5A 4YZFE 1B4RA 5FFLA 2VZSA 3FB5B 5BZDB 3N1GC 1DUYA 1RJLA 5EH1A 1I7TB 2VE6B 3EFDL 4XB7A 4MNGB 1G9NL 3JZ7A 3MA7B 3T0EA 2DN7A 5HHQB 3MRQA 3OZ9L 3HC0A 4HQQH 1ZE3C 3G5ZA 2DI9A 3KS0J 3HG1A 3V6FA 2IADB 1PEZA 4ODHH 3VWJA 1LD9A 2QQQA 2DLGA 4PY7B 4QWWD 2X70B 3IJYA 2V6HA 5BS0A 5JIKA 5TQ2H 3U7WL 1D5IL 1I7UA 4J8RA 1BVKA 4NNYA 3VMPA 3TN0A 4C56E 5LCVH 1IAIL 4MD4A 5GRYA 4R2GC 3CVHL 3SGEI 1D7FA 2HKFL 1AGDA 4MAYB 4U7SA 4XWOD 3MA9H 5ERWB 1X6LA 4AYFA 5I1AB 2IMNA 4FQJH 2XG4A 4N8CH 4PRAA 3T0EC 3VXRA 4FQ1H 2WINA 1P4LA 4ZUTA 1BOGA 1F3JA 1WBZB 3BO8A 4ZUWB 5GGVY 1PG7W 1T3FB 1INDH 3ALWA 2ZUSA 3VWJC 1CXKA 1EMTL 4X4YB 4NQDD 5FGSA 2NTSP 3F7PC 4LPWA 1IAKA 4ZG1A 4IEFB 1P6AB 4QYOB 2FECI 4GBXD 4YDKL 4XTRD 1AXTL 4CVUA 4LSVL 1GIGL 2AGJH 2OI9B 1FL6B 3AB0C 3U36A 1IGIL 1BREA 2ZG2A 4XCCH 3FFCB 2VLME 5GSVB 3TN0C 3ZE2E 2EDWA 3EO0A 1HHGA 2BDNL 1LEIA 3L5XL 3CCHB 4R96B 3L3HB 2ZNXA 1Y18A 3JTTB 4J1UB 5ESVA 1ODAA 3QDJD 1T4KA 4YBQD 3L5JA 1EBAA 3EOBB 2Q7YA 3J8F7 3VXSE 1U8QB 1MWAH 2HLFC 4PJ9D 4RX4A 3AVEA 4PRHA 3VFPB 5B4MD 1HOCA 2HT4D 2Z93B 4OBRA 3GMNA 4UDUA 1R5VB 5D72L 4HJ0C 3FT2A 3QIWA 4CVXA 5DQJB 5HVWA 3FL7A 1QFWI 3IRZA 4RMSA 4XXDA 2C1OB 1C7TA 3O4LA 2GJ6D 1T22B 1NLDH 1TTUA 4TRPH 4YPGB 4FQXA 3WFHA 4FG6D 3ET9F 5F7WC 4KPHH 1FGVL 4AJ0A 4HUKB 4UDTA 1D5IH 1BOYA 1XIWD 4Z7UB 4PJ7E 2AV7A 1NCBL 3MBXL 4RMUA 1YUHA 5EIVA 4G9FE 5DSCB 4NO3A 1ZLUK 2KZ1B 1Q0XL 2UYLB 4ETQB 1QBML 4WWID 1DVFA 2IALA 2G5BB 4ZSOA 3BZEA 3VFNB 3TO2B 1S9VA 3CVHH 5FB8A 3MGOA 1OF2A 5CLTA 3ZT5A 3MBEB 4GS7B 2OJEB 3L7EB 3S35H 4PJXE 3HC3H 1DL7H 5DI8B 3VXPA 2E27H 3QIWC 4QHLB 4PJ5E 4BUGA 1JYVA 3FB8B 4FQHB 1BZ9B 1ZHBA 2HG5A 3KJ6L 2ICWJ 2B39A 1TZGH 4JO3H 3HE7A 5B3JE 2KUTA 4PRNB 1VCAA 1MCCA 4APQB 1OAUH 4M1GH 3HA0A 2GJZA 1CXIA 3TNNA 1UB6A 4N5ED 3I75B 3LN4A 3OKYA 1R5WB 2ORBH 3IFOB 3NAAH 1UWXH 5E2VH 5D5MF 1IGIH 3H7LA 3S97C 3BPNB 4G80B 5F89A 4HBQA 1TVHB 1ZS8B 1MAMH 1KN4H 2R2EB 1DVFC 1YEGL 4PJ8D 2BDNH 3L5XH 3ZHKA 4HMDA 3OKKA 4KROC 5C07E 5HI4C 1CICA 3D85B 2P5WB 1SEBB 1CLZL 1KCRL 5AWNL 4JZOB 3ARUA 5K59E 1LDSA 4MD0B 5L6YL 3VXME 3BDBA 3VXQB 1P5UA 2G60L 4JFHE 3KNBA 2PN5A 1EVUA 3C9NB 4QRPD 4AQ1B 4JRXD 4Q7DA 5IB2A 1CFTB 2IBBA 3LV3B 4YX2H 5T5NG 3HE7C 3QDME 1TXKA 2NXZB 1MCNA 5D2LA 1UFUA 3QEHB 1A7OL 3GIZL 4L4VD 4NCC1 3T1WA 2HKHH 4O5LH 1UWEL 2OR7A 3QPXL 2ZOLB 4LK4A 4ZDHA 1KTKE 4M7JL 5IMKA 4X98A 1MRFL 4YNYA 1KIQA 2K7QA 4AEIH 4J2XA 3GSNB 1D6VL 3CFIC 2BHYA 4YDJA 1WBYB 4KK9C 5K9OB 1ZGLA 4NZTL 1KLGA 3WSQL 1JTTA 2OZ4A 2BNQE 3K8MA 1Y6NR 1M05B 1CICC 2X41A 1GOFA 1EHLL 1PJ9A 3K4ZA 5HY9B 1YDPB 3MJ9A 5DVLA 2GSGB 4NHUA 4OUUB 4YWGH 4WFHE 1BQSA 4UINL 2X2YA 5IHBA 3C6SA 3GSXA 4OQTA 4IS6A 3G6JA 4HXBL 1KIPA 5L88L 1H3TA 4L8BA 2N7BA 4U6VL 2W9DH 5HJ3B 3HUJB 3EIFA 4PGZA 4JFDE 3S8WA 3VRJA 3SEPA 2MJWA 2EIZB 3LZFH 3X3GL 3TPKA 1NGPL 3ELAT 4M93C 1CFSB 4OCSH 2VLJB 3QG7L 4Y4HA 1DP0A 3AU1B 5JW4N 4R2GD 2BX5A 4E5XA 3EDKA 5KSBE 3H9SE 5L7XL 1KCKA 1QA9A 4KY1H 3KYNB 4L8DA 4BFBD 1OPGH 1W0WB 3T0ED 5IEKA 3SJVB 1I9IL 4J3VA 5DJYA 1FG2B 4BQBA 1EBPA 3PL6C 1FV1A 4IMKA 3HG1D 3GMRB 4JHAL 3WE6A 3MZGB 4WUUE 3VWJD 1FSKB 5HHNB 5GS0C 4LNRA 3MLXL 1N8ZA 1CLZH 2V7HA 3U4EA 1KCRH 3SKOB 2J12B 4KI5F 4DVRL 2R4RL 5IQ9A 5BS0D 1QKZH 1CZ8L 3K1DA 1C5DB 1QUNA 2G60H 4LCCB 4MCZB 1TZIA 4FRWA 1IL1B 4Z7VE 4EJ1C 3LQMA 3GJFB 3MRNA 3UTTE 4X9HA 4K3DH 3TN0D 1G84A 1U8MB 4HWEL 4LSPL 4XPHL 3OB0K 3O45B 3IDXL 3QT2A 2DWDB 4DEPC 4NQCA 1MLBB 1UWEH 4U2YA 4F7TA 2X4OA 3QPXH 1D5XB 3EO9L 5JOPD 4M7JH 1D6VH 3DYPA 3IAQA 4YFDB 3VXRD 1G6RA 4GKOA 3DROB 3GMMA 3DVFA 2J8UB 1Q94A 4H26B 2OCFD 3NCYS 4NZTH 3U30C 5ANME 4IMKC 2Y07L 1A64A 4HJ0D 2EEDA 4PJGA 5FGRA 2R2BA 3M8OL 4NKQB 4UTAL 1T04B 3Q6FA 2PCPB 5LXGL 4UINH 4UNVA 3TPUB 1KULA 2D9CA 2D3VA 5GGTA 1I1AA 5E9DE 1C5BL 1S7SA 1DBMH 3LMJL 3QWRA 3BGFC 1JWMB 4NQXA 4R3SB 4QCIB 1N0XL 2OTUB 4DKFL 3EHBC 1DZBA 3MRBB 1AJ7L 3I9GL 2VLMD 1F58H 1WTGT 2EDJA 1AXIB 1NGPH 2GTZA 5DK3A 2ITDA 1TJGL 4MNHB 4UOW0 1EVTC 4XX1E 3LDBB 2OYPA 2F54E 1HHKA 3UBXI 3BDYL 3G08A 5C9KA 1J0JA 2GUOB 3HZYB 4RX4D 3ZYIA 1EK3A 4HS8L 4PRHD 4NQDB 5ICZB 3QEGH 5F7MC 3VG9C 3WFBL 1U8KA 4RAVA 5DJ6A 2JELL 1NCNA 1I9IH 2PETA 4GBXB 3CFDB 3QIWD 3NIGE 1Q9OA 5FUCE 1K5NB 2CIIA 3QXWA 1EJ6A 4JHAH 5EZJA 3O4LD 3MO1B 5DJ8A 1DQDH 5D9SB 2I27N 4FQXD 1I1AC 1AGEA 3CUPA 4U05A 4DVRH 4P3CH 3FRUA 3QDJB 2E9IA 1NBYB 2PYEA 3BVNB 3V4PL 5A43C 5BRZE 4NT6B 1G9MC 2DWEA 3BYYA 3OKMA 2Y5TB 5DXWA 3L3OA 1QLEH 4MNGE 5FDYA 4PJ9B 1DVFD 1S7UA 3FQTA 4KRPB 4I4WB 4QTHB 1EEZB 3EO1A 1P6FA 3P73B 4F57H 2HVKB 4XVSL 4KTDL 1A6AA 5HI4D 3S7GA 3ZDYF 1IAOA 1T1WB 1FFPA 3GM8A 3T1FB 3VA2C 1FC2D 4PBWD 4CN4A 2CLZA 1SQ2N 5AD0A 4Q6IB 4YBLB 3BXNB 4WHYH 2D4DA 2GJ6B 4MA7H 2CKBB 4PJ5D 5FUCC 2X4TB 3SOBL 3HE7D 1ZLVK 3M8OH 3SKNA 4N0UB 3JV5A 3VGDA 4UTAH 3BEVA 2AK4A 3UPAA 5JQ6H 3OKEA 5LXGH 2OSLA 4DVBA 1DN2A 4M4RA 3K4AA 3LIZL 43CAA 2NPLX 2Q7NA 3D2UB 3V7AG 3DHMA 4JHZA 2JJVA 4RBPK 3I9GH 3ZT6A 5K9QI 3MOAH 1CDUA 5E6IA 4KK9D 3UYPA 1A7QH 4OD1H 4YDVB 4JJHA 1KJ2A 3AREA 4FN0A 4KK5C 1TJGH 4LLWB 1CICD 1OARL 3KVQA 5SV3A 1BJ1H 3UJJH 5F9JB 3TT1H 4P2RE 5HYQB 3ESUF 1IKNA 3ZL4L 2ESVB 3WN5A 4HS8H 2JB6A 4JM2F 1CLYH 3FRPA 3WFBH 4Z7WF 3BT2L 4MB5A 3RKDC 3RY5A 4LCIH 4F2MB 5F1KC 5I1KL 3TLRA 2G5RA 4PJIA 2ZSVA 1OGAA 4TQEL 4ZPVA 1FVDB 1MHCA 3LQAL 3MRHA 5I19L 4QRSB 1U8LB 4OV6F 4QRTB 1K3IA 4HWBA 3RWHA 3RWCA 2KBGA 3EGSA 5E6IC 1Q9WB 4IJ3C 3NCEB 3AREC 1SY6A 2L7JA 2DMKA 4K3EL 4S2SB 4U1MA 2FO4B 3NZ8B 1JV5A 1RUMH 2BNQD 2DYPB 5LQBL 3PL6D 4G8IA 2H2SC 5JLZB 4JRXB 1IKNC 3WN5C 3R8QA 1C1EL 5GS0D 1AR2A 1LK2A 4E42B 4C83A 1RZJL 3S37H 4L4VB 2X1XR 3VFMB 4LAQL 4N8VA 5A1AA 3RHWF 4OZIF 5JW5B 1JHKH 1KYOK 2CRYA 4QHUB 3PNWB 2AV1B 3SDAC 1LO2H 3FQUA 1BLNA 2GT9A 2Q6WB 2VERN 3DX7A 3P4OB 4L4TB 4OB5L 4XPGH 4Y4HD 4Z5RB 5IJVA 4YHPB 1Z9OA 1F4HA 3L9RB 4Y1AE 2M8XA 1OAXH 1OAZH 4NZJA 3LIZH 4Z0XB 4S1DC 3INUH 4TPRL 4D0DB 2VXVH 5I1HH 4DUXA 3ZHLA 4NFCA 1S7WB 1U42A 3CSPA 3P4MA 2BNUA 1VGKB 3V6ZB 2DJSA 2VDRL 4G8GA 1KT2B 5KN5A 1VEMA 1OARH 2EXWC 3QXDA 3MMEA 3RGHA 2VZTA 2BVPA 3V79C 3FO0L 3RPIB 25C8H 2OZ4H 4ISVB 2IWGA 5GGRY 4Z7WA 3TCXA 3BT2H 3DGGA 4R2GB 4G3YH 3CZFB 5GS0H 1RJLB 2RFXA 3EHBD 3ILPA 5KS9F 4OQTH 4U1SB 4WCYL 3WIIL 5TDPA 3QQNA 5F7EH 1MIEH 5LGJA 3LQAH 1JGDA 4NQCD 1BF8A 3T0EB 5I6XB 1UA6L 3MRQB 4RMVA 2CK0L 2BOBB 1ZA3A 5IK3B 3G5ZB 1LE9A 2P49B 3HG1B 5TFSL 3V6FB 4X5WA 5DHYA 2EYTA 2HLAB 3LKQA 2E6PA 4G6KH 3TVMA 3MOBL 2BHZA 1CIUA 2P4AB 4K3EH 4PLKD 4FMKA 4RQQA 1A4JA 1TQBC 2O5ZH 3SGDH 1WJ3A 5I2IA 1UKTA 1QBLL 5GIRA 4NZUL 4P48A 2DQTL 5KSAA 4BFIA 3AB0B 3FQWA 2B2XL 1J8KA 1C1EH 3FN0L 4H20L 4NNYB 1I1AD 5DJZA 1J1XL 4EDWH 1EZVX 3QWRD 4OZIA 4G42A 1J0IA 5I76A 3T0VA 4PRAB 1AGFA 5F6HJ 5A40E 5FKAA 1H3WM 1P4LB 3KPPA 3AS2A 3MRKB 3P0YL 3BO8B 3REWA 4OLUH 3VRLF 2K9UA 1HILA 3TVMC 3GHEH 4TPRH 4WHDA 1IAKB 3DPBA 2BJMH 3LS4H 3MV8A 1LDPL 1UCTA 4PJCF 4PLNC 3S4SG 3U83A 2VDRH 4L5FH 3VJ6B 1JIBA 3PGCA 1DBKH 3ULVF 1GPOH 3EO0B 3VMOA 1HHGB 4JHBA 2VLJE 4UMGA 5F1IB 3F58L 3FO0H 3UTPE 1LEIB 1FPTH 3TBSA 5ESVB 3AROA 1T4KB 1XMWA 2D9QB 2PYED 3RL1A 5D7LA 3UO1L 3SDYH 3KDMA 2Q7YB 5CKAA 1KPUB 5F70A 4Y0GA 5ICXA 3M45A 4PRHB 4AL8L 1PGRB 5DJ2A 1HOCB 5GGTH 3WIIH 4U7KA 4WFFE 1U93A 1KLUA 4KK5D 4UDUB 3CIQA 1WQVT 3RVVC 1YZZA 3UZEA 4ZNCD 4HX1A 2GJJA 1QNZL 2LTQB 4MXVE 5TFSH 3O4LB 4FQXB 5GRVK 3MOBH 3RKDD 4FABH 3A67L 4TSCL 1MLCA 3NABH 4AH2A 4UDTB 2VC2H 2R23A 2AK4D 3MJ8A 1ZLSH 1FO0A 2EDNA 2B2XH 2A83A 2DIJA 3FN0H 4P46A 1RJYA 2Z91A 4ZSOB 1NBZA 1RIUL 2DQCH 1A9BB 4QNPF 1EHXA 3GNML 5FB8B 5DEZA 4DGVH 5E8EA 1OF2B 4NQVA 5I0DA 3LD8B 5E6ID 2A6JB 3WNOA 2H6PA 3ARED 5DD5H 5KVDL 3FTGA 4XNYH 3P0YH 4DOHE 2H2SD 1NMAL 1ZHBB 4TNVK 1BFTA 5IVOA 4AMKH 3MACL 2ATPA 1A6TA 1KTRL 4MS8C 1L0YA 4GW1B 4OLVL 4LCWA 4LVHB 1MVFA 1BGXL 3VXNA 4PJCA 2GJZB 3TNNB 1LDPH 1UB6B 5EUOF 1OGAD 3EJZD 5GRZA 5BXFA 1NGWB 1X5IA 3BUTA 3E6FA 4XPTH 4OZFB 3BESR 1LNUA 1QFUH 5C70A 4W4OC 1OT2A 3F58H 3QFDA 4JDTH 3OKKB 4EDXB 1ZTXL 4HGKC 1E4JA 3BAEH 1F4YL 4S0TD 4YDLB 5TPWH 1CICB 1IGML 3UO1H 4E41E 1CFBA 3D1MC 4XZUB 3QQ9C 2EKSB 2E8YA 2VAAB 4NKDA 3BH9A 5E8NB 4E41A 4AL8H 4FZEH 2C3XA 3KNBB 3RY6A 5IB2B 3G04A 1P7QB 2W60A 4OZFG 3M17A 4ONGL 2EXWD 4RRPA 1ZT7B 4BA8A 2NX5A 2YN5A 1U8JA 3CSYA 4UIMA 1OB1A 1KJ2H 4HKXA 4Y2DA 3D87B 4PFEA 5T1KA 5HDQL 2YK1L 2CMRH 4ZDHB 3F6LA 3KYKH 1FVEB 3K0WA 5IMKB 4X98B 4YNYB 5DWUH 4WI5A 1S9KC 5SX4H 5IMLA 2C3VA 3DVGB 3Q5OA 1H8OA 1O0VA 4CU8A 4N9GB 1ZGLB 1X5YA 3JBG7 4UIKL 3OAUH 1VPOL 4H25A 5EWIL 4EOWH 4K3GA 1FCGA 5DUML 1A8JH 1PKOA 3GNMH 1J1OL 1MRDL 3P9WB 4NHUB 3MJ7B 2P24B 3V7AE 4ZODA 3H9ZA 3C6SB 1QBBA 4IS6B 1I8LA 4TULH 3RY6C 4G8GD 1KIPB 1CGTA 2HJFB 4M6OH 2AQ1A 1ZVSB 4AK1A 2JJTC 1U0QA 4ELMF 1NMAH 3UMTA 3VRJB 1UGNA 1SY6H 5GS3A 4J12A 3MNZB 3HR5A 3LHPH 3MACH 4FNLL 5I1LA 4LPUA 4Y4HB 2QQNL 4G8EA 4O00A 2ZSWA 4E5XB 1JWUA 1BGXH 5EUOA 2QSTA 1YEFH 1FP5A 2ZNWA 5JPNA 1DN0A 2CSPA 1QA9B 4OD3H 5D5MB 1W0VA 3QQ4A 4L8DB 1CN4A 1FYHB 4JDZB 5J1TC 1FCCA 2XZZA 5DHXB 1IGYA 1LK3L 5IEKB 3MLRL 2N1KA 5DURD 3IU4L 4G6FD 4V2CB 3UBXA 2ENSA 4ZQKA 5GRJL 1WICA 5KOMC 3GSNL 1FV1B 1S78D 2AXGA 3PHSA 1IGMH 2ESVE 3ARTA 3I50L 2R2HA 3TVMD 4AEHH 4L1DA 1I8LC 1T0NA 2V7HB 3U4EB 3QDGA 3ARZA 3SGEH 2GY7B 5IQ9B 3P9MA 1G7QA 2NY0C 4LEXL 4IOSD 5I8KL 4N0FA 1TZIB 5KSAD 1V05A 3DYOA 4GH7B 4P5KA 3BGFB 3MRNB 4S1SL 3GKWH 1NCWL 1MI5E 5E70A 2VSCA 4LCYA 3LEVL 5CP7B 2APWA 2WIIB 4HUWA 4LIQL 4NQCB 2YBRB 4F7TB 5HDQH 2X4OB 2YK1H 4RA3A 3WHE1 5HTSA 2FD6H 4Q2ZA 4R4BA 1ZHKA 3MRIA 3IDMA 5J1SC 1BD2A 1L9NA 3WCYA 3BOVA 4LFHD 5TE6H 3RY4A 1G6RB 2BMKB 1FZKA 5LAXB 1UJ3A 1Q94B 5GRUH 4CDHA 1VPOH 3LQZA 1TLKA 5EWIH 2R2BB 5EU5A 3RVVD 4N0YH 4GG8B 4Z8FL 3Q6FB 1MRDH 3MV8D 3AXLA 2CO6B 3FT4B 2XTLA 4R97C 2W1NA 5D7KE 1C12B 2APVA 2EE2A 1I1AB 2HJLA 3FO2B 4NQXB 4P3WA 4JFYA 4K8RC 5JORA 1EH9A 2VR9A 4L4TE 1GHFL 2V9QA 1NCCL 6CGTA 1HH6A 4MXWH 5D7LD 4RSVA 3G08B 2XT1B 4NP4H 3K2UH 1Q0YL 5TQ0H 2ZUXA 1ZV5A 1HHIA 4UQ3A 1KELL 1UJ3C 4JGMA 4L1HA 4ZUSA 2I26N 2VLKA 1U8KB 5DJ6B 1LK3H 4OFVA 2DJUA 4WFFD 4BZ2L 5BVJA 1KJMA 1A6ZB 2WSKA 1Q9OB 5GRJH 3B9VA 4NZRL 2B1HL 2MQ3A 5BJTB 1FIGL 2F53A 4DCQB 1QD0A 5I1JL 5SWZA 3MQIA 4MS8D 3AM8A 2GK2A 5DYOA 5ESQA 5HDLA 2R15A 4FQ2L 1LILA 3FRUB 4K71B 5BV7B 3FOLA 3IDGB 3RWJA 2PYEB 3FOMA 3ORJA 1EO7A 3CFEB 4B7IA 2DWEB 4NUGL 1WT5A 3OKMB 3L3OB 4GLRH 3REVA 1NCWH 4F7EA 2RGSA 2EC9T 2ZUVA 1LO0H 4TTDD 3EO1B 3LEVH 3VXUA 3BRDA 3X14A 5C0NC 2VUOA 1U8IA 1UJTA 4MB3A 2FLBT 1NUDA 1IAOB 5IHLB 1FFPB 5DD6A 5KANG 3RI5K 3GRWL 4CU6A 1SMAA 3MR9B 3U9UA 2FL5B 1FAKT 3ARRA 2P5EA 2EEBA 1PG7X 2WWKO 4LF3A 1A9EA 1JK8A 5FYKU 1NFKA 4UB0H 4Z8FH 1JPFA 2AK4B 3AM8C 5E8PA 1F6AA 3CFCH 1HWGB 3S34L 1GGUA 3BH8A 3JV0A 5JR1L 1KNOA 5IF0A 3PGFH 1IEAA 4X6CE 1WT5C 3PXJA 5DHVB 2X4UA 1MFBL 4CUCA 2AK1L 2VO5A 2Q8AL 5C71A 2RB8A 3IXTA 1NCCH 3AREB 4YIQB 3WEXB 5EBGA 4ZOCA 4XNXL 2NY3C 1FORL 2E5EA 2FATL 3LKPA 2DM3A 1Q0YH 3CH1A 1QACA 4E41D 3WN5B 1KELH 3WXVH 2YD6A 3OQ3B 3V52L 1CTOA 1N4XL 1ZWIB 1RV6X 1ZLWK 4U1IB 4BZ2H 1TVBA 2WWMC 2NX5D 2ZSVB 4NZRH 4JPIA 4ZNEE 1MHCB 4NPYA 2OK0L 1WAAF 5T1KD 3MRHB 3O4OB 2AJZA 4J3OC 1JYXA 3PGDB 5EC2A 5I1JH 2CKBL 4Z0BL 5ALCL 1UC6A 1VFAA 4FQ2H 1RQ5A 3BKYL 3VFSA 2MQ0A 2AS5M 1IC7L 2FYYA 5AZEL 3EGSB 4P2CG 4I9WD 4GT7A 2JK5A 1BIHA 3LY6A 4H0HB 5DK2A 3MGTB 3QO1A 4U1MB 3T2NH 3MXVL 4OD2A 5FA3A 3O0RH 2YPVH 1DEDA 2HWZL 4G8IB 1MHHB 3BE1L 3H7BA 3U4AA 4YFEA 5FA4A 3QIUA 1DTUA 3BPLC 3RP1A 2X4RA 1LK2B 4QGTA 3VFRA 3WFZA 4C83B 1TPXB 1OL0A 1Z9SA 3GRWH 2HFEA 2DBJA 2VDPL 4L8SB 5F9OH 4N8VB 4QHKJ 2QSCH 5F88A 4R8WH 2NY0D 1FC1A 2ZUTA 4HDIA 4MX7A 5JO5A 3CU7A 4NJ9L 4PJDA 3ZO0A 3FQUB 3SE8H 3DX7B 4GMTH 4GG6F 5DVNA 5IEHB 2HRPL 4PRBA 5ID0A 1MFCL 3RX5A 2VXTL 1JPSL 3N1QC 3OKLA 2R0KH 4Y5YB 3DSNA 1NGYB 3BDXA 4N8VG 5I71B 1EO5A 1F6LL 1WLHA 1CT8B 3DARA 3WS6A 1T20A 1IZKA 5FO7A 1HYRC 4IOFC 2Q8AH 3P4MB 3STLA 3QBTB 3TM6A 5KN5B 3MUGA 3QIUC 3TWCL 3QXDB 4P2OA 2QHRH 1FORH 4KKBC 2FATH 3QDGD 1JMXA 3D3VA 3RAJL 3L3GA 4JM2B 1YMHB 4Z7WB 1FZJA 1EUUA 4HT1L 5CILL 3DGGB 5DLML 4DKDC 5AAWA 3G6DL 4UNUA 1JTPA 4X6FA 4AT6A 2RFXB 3ILPB 4K8RD 4QRQA 5ITFB 2Q3AA 1JGDB 1KG0A 2JIXB 5C0AE 1W8OA 1IGFL 4JO2L 5DURB 2B0SL 4G6FB 5ALCH 4N1CA 1ZA3B 1BD2D 1TQCC 5F9WB 2EDQA 5DHYB 4LCUA 2EYTB 2YRZA 3WS6C 1AD0A 2EIEA 4XGZA 1MUJA 1U2HA 4LDLB 4MJIB 4RQQB 5GHWH 1A4JB 5I2IB 4P2OC 4MA8H 1ZSDB 3I3DA 5GIRB 3GO1L 4WV1A 4ONFL 5KSAB 4BFIB 3FQWB 1GGCH 4OKVA 4HIIB 4JEGB 4Y7MA 3T0BA 4OI9A 4Y4FA 2VDPH 1UWGL 4M61B 2P8LA 3RQ3A 4PGEB 4OZIB 1AD9A 1I9RH 3PWNB 1IMHC 4H8WC 4RZCA 2CLRB 1TMCB 4L3EA 4D0BB 1JNNH 4NJ9H 5H94A 3E3QE 4YXLL 5FKAB 5DDHB 4QXUL 3KPPB 5JOFA 4Z76A 2HRPH 3REWB 5ADOL 2QQKL 4V1DA 3NA9H 1MFCH 5C0ND 5C0CE 2MMXA 1DBJL 2G75A 4RWYH 2ADJA 3IS1X 1UZ6E 3WHE0 2VLKD 5GXBB 1M7IA 3OAZK 1UZ8A 5DMGC 1CD9B 4WV1C 2DS4A 1FNLA 1NDGA 1G7MB 1V7NH 5IFHH 3LKOB 1R3LA 2F53D 4P59H 1CQYA 1SBSL 3HI5L 3V5HA 4JFFB 4K2UL 5SWZD 3QXAA 4Y4FC 2P46B 4CADB 4BSWA 3RL1B 5D7LB 3NCJL 5I66A 4HC1A 5D5ME 3HPLB 3P0GB 3K74B 3HMXA 3DRTB 5HI5C 3G6DH 1ITBB 5KS9B 5ICXB 2E7BA 5DJ2B 4QRUA 1PX3A 3VXUD 1NC2B 2PXYA 1U93B 1KLUB 2P43B 1YPZE 5CSGA 4JFQB 2DIAA 5F3BA 1IGFH 2B0SH 1ZHLB 2NY3D 3P11H 4XPBH 1KB9J 4NN7B 5JDSA 2X4QA 4FHBD 3QYCA 5EU6B 4ZTOH 1OCWL 2WBWB 5A2IH 4LQ1A 3W39A 2EH7L 5ALBL 2D31A 1RK1B 4YXKH 1A1OA 2P5ED 4PJBE 4WDIA 1Z5LA 4HCRL 1MLCB 1HSBA 2VIRB 3NH7L 3DOSA 4AH2B 3T3PE 2WWMD 3GSQA 4XMLH 2R23B 1EFXA 3MJ8B 5DJCA 3W2DL 1FO0B 1MF2L 1YEDA 2A83B 4OLXL 5EN2B 5I1GH 2J7LA 3PV6B 4P46B 4JREC 2AABL 2Z91B 3LN9A 1CLOH 2ICWI 4HGMA 4X9IA 1UWGH 1G7HA 1MCIA 2H3NB 5I18L 2XIDA 4X4MA 5C0IA 1IVLA 3UYRL 4NBYB 2H6PB 4FXGB 5ELIA 1U8OB 5C09B 3ETBF 3DMMA 4YXLH 2XWBA 2XI9A 4QXUH 1TZHB 1IFHL 3HS0A 2NY4C 2QQKH 4KTEH 2YD2A 2NTFA 2UZYB 4X9FA 4ZPTA 4A6YB 5EA0H 3MRCA 2ATPB 1A6TB 1KXTB 1G7IB 4LCWB 3O3DA 3VXNB 1SJVA 4PJCB 2F58H 1INQA 5BXFB 4AEEA 3E6FB 3B5HA 5MEQA 1AO7A 1PSKL 1LNUB 1I8KA 3HI5H 2NY1B 1FQ9C 1MJUL 3QFDB 4TOYL 5DGQA 4XPAH 4HS6A 3IAGC 3F8UB 3D0LB 3NCJH 4QXWA 4BJLA 5I1CL 4X4ZA 4NKDB 1DLHB 3DMMC 3DBXA 2P8PB 4NO2B 4CW1B 4IOFD 4K7PX 2W60B 3QIUD 4W81A 1XGRA 5BZWA 2AXHA 5M95B 4H1LA 4KKBD 4GAYA 1U8JB 4UIMB 5JZ7C 4KI5E 1OB1B 1AI1L 3WV0A 3SDXF 4HKXB 1OCWH 4Y2DB 1NAKL 3BKMH 5CIPA 3QDAA 5EIQA 2EH7H 3DNKA 4HZAA 3RWDA 5ALBH 1XGQA 4LLQB 4ZS6D 1MCOH 1PEWA 3V0VA 3GB7A 4RIRA 3NH7H 4K55A 2EIBA 5TE4L 5IMLB 2C3VB 1VEOA 3W2DH 4GQPH 1T6WA 3MREB 1KCSH 1IJ9A 3TBVA 1Z9MA 4M6NL 5CZVL 4NRZB 5I18H 1LP9F 3U0TB 5C9JA 4WEUD 1OP3K 1OQXA 3OHXB 3QRGH 6FABL 4PV9A 2LFGA 4P2OD 2NY0B 2RAMA 1IFHH 5J4MA 5EOTA 2CIKA 3D3VD 1VFOA 3C8DA 2W38A 5FYKD 3RIFK 3HR5B 1CGXA 5I1LB 4M7ZC 2VWEE 1C16A 1G0YR 4G8EB 1JWUB 3O3BB 5EUOB 4AIZA 4MJ2A 1S5HA 2K7PA 4X7FC 3B3IB 1DN0B 1OHQA 3QQ4B 5D8JL 3EYFB 2YPKA 4X5XB 5DJDA 2XOTA 1GZPB 3I6LE 1MJUH 2EDLA 2XY2A 5CS7A 3UBXB 2APFA 4ZQKB 3BIKB 2HT3C 1R3JB 3RZCA 1BQHA 3FQNA 1H5BA 2Y36H 3L6FA 4P9ML 2R2HB 3S3JA 4YGVB 1ES0A 1T0NB 2O5YH 4NM4L 4QHNA 5I1CH 5JTWA 3QDGB 1NMBL 1YQVH 1G7QB 3P9MB 4HIJA 1IBGL 1AE6H 2R56H 5DMGD 4N0FB 1NKRA 1HQRA 5JOEA 1KJ3L 5GJSH 1WITA 2J88L 3ARVA 3BX7C 3SDXA 2BSTA 4U0RB 1A7PH 2DLFL 4Y4FD 1AI1H 2GHWB 4LCYB 1R24A 5EZOL 1IGCL 2R29H 4OCLC 4XP1L 5J12C 4BZ1H 4ZFGL 2W65A 1OD9A 3EBAA 3GMPA 2APXA 4I0PA 4L3ED 4R4BB 1RZ8A 4ZS7H 5HI5D 5FYKH 2RQ8A 3JV6A 3BSZL 5TE4H 2I9LA 5C6TH 2XWJA 1UJ3B 2HVJA 2BK8A 4CU7A 4GXVH 4V1DD 1KSRA 3RZCC 4WFGD 1J0KA 3LQZB 5E5RB 4Z7OE 1U2CA 4GRLA 1LO5A 4H8WH 1YN7A 5FO9A 4PB0L 5CZVH 1LP9A 4HS3A 1D9KA 4X7DC 5FDWB 4PJHA 2VABA 1S7RB 2OL3H 3PQYB 4I3GA 1ZLUH 2HJLB 4XVUC 4WGVB 1WEJL 5LBSH 4ELMB 2BY0A 1OWWA 3KXFB 5J06A 2E6QA 5C8JA 3U0PA 4MJ5A 1TJIH 4M4PA 2EH8H 4HGWA 4N1EA 4L8CB 2XFXB 5AUMA 1G7PB 1X5AA 4RA0C 1XFPA 5F8RC 1J1PL 4U1NA 2P42B 1HHIB 4UQ3B 4W6WB 5D8JH 5T3ZD 2PXYD 1QSFB 3HB3C 4ZUSB 5SV4A 2VLKB 4P5TA 2X44D 1A6WL 1R0AL 1FE8H 4XI5C 5BVJB 1KJMB 2NW2A 2EO1A 1LWRA 4PB9L 5I1DA 4WI8A 1YC7A 2UWEF 5E24E 3PF2A 4QY8A 4J3UA 3PHOA 4NC1E 1FL5A 1D9KC 5MENE 3RVTC 3ZE1E 5HBBA 5EULV 4NM4H 4OUOA 5SWZB 3QWOA 5DYOB 2VQ1A 5DRWA 2AJVL 2QKIA 2DAVA 3C5JB 3RWJB 1IBGH 4OGZA 1ONQB 3KYMA 4WWKB 4DKEL 1EFXD 3FOMB 4G7VH 3KYOB 2DQFA 2KKQA 5ILTL 1BBDL 1TFHA 4F7EB 4KAQL 2DLFH 1OSPH 4MZ2A 5EZOH 3VXUB 1IGCH 3K80A 3UJTL 5FHBL 4XP1H 5FYJD 3O11A 3E0GA 3HI1B 1XCQB 4ZFGH 2ZPKH 4MNQA 1WTLA 1T5XB 2NY3B 5DD6B 3QNXA 4P5TC 5C0GA 3BSZH 3DMMD 3RVWC 4MJIE 2XN9B 3U9UB 5L2KA 5F71A 1U58A 4WU7B 3MCG1 4HC1H 5ADPH 1PVHA 3DV4A 3ZTJG 2P5EB 3HMXH 4QXGH 4HLZH 4LF3B 1A9EB 3MRFA 1JK8B 4NC1C 4PJEA 4XCEA 2VJXA 5T3ZH 5JZ7D 3DX6A 1JPFB 4JKMA 5E8PB 4RGMC 4QRRA 1KJVA 3FB6A 1UQSB 3HMWH 2PTVA 1AHWA 2XPGA 3D69A 4Z95L 1DQTA 1MCEA 2VDNL 3DURA 3S96A 1N6QH 1I75A 1MH5B 1AQKL 1WFTA 3CFJB 4YK4B 3RFZC 1IEAB 3WFDL 5M94B 2CLVB 1AO7D 1WEJH 4OGYL 2X4UB 1PQZA 2O5XH 2WZPD 5E2JA 1HEZA 3ZDXE 3U6RA 3IXTB 5ACZA 1A3QA 2WQRA 2AEPL 2BOCA 4UNTA 3EOTH 2PTTA 3LKPB 3KPSA 4P4KA 2X4PA 1BAFH 3EYOB 3B83A 3QUKA 4KJYA 3LAFA 3SDCC 3TNMA 4YHKH 1OTUC 2YWZA 4WI2A 4UUJB 4LSTL 1O7SA 1X7QA 3HI6H 3BISA 5FYJH 1LO4L 2ZP0T 1CK0L 1F4XL 4IDJL 4PB9H 3I85A 5E8OA 4Q97A 1ETZA 4JG1L 4JFFE 1QVOB 4AENA 4NPYB 3H9HA 3EYSH 1AHWC 2BY1A 5JHDB 3HPJB 5A16A 4KJWC 1A22B 5EC2B 5IB5A 2DDQH 5TDOA 1PKQA 4G6AC 4OV5A 3QB7C 2AJVH 2ERJB 3B9EA 2DLTA 3VFSB 4NQSB 5DMKA 4Y5XA 5IQ7L 2FYYB 4KK6C 4DGYH 5KS9E 4DKEH 3QEUA 2JK5B 1GC1L 2XZAH 1EGJA 5DK2B 5DZNA 1ZA6A 4KAQH 1IC5L 2Z4QA 5FA3B 3GBLA 4JZJA 4Q74A 4P4KC 3D9AH 5SWSA 2HT3D 5FHBH 3H7BB 3UJTH 5FA4B 5A2FA 5EU6E 2EECA 3QIUB 5E1AA 4NKOA 1RK0A 2VLRE 5AYUH 4PRIA 2P45B 4O02L 3VFRB 4YHML 2HFEB 2VLRA 3CH8A 3VWKB 5I9QC 1CVRA 2CJUH 3GBNL 3O2DL 4OFDA 5DUBA 5F88B 1WZ1L 2MTPA 2V17L 5GGSA 4CBPA 4MLIA 4JB9L 4HDIB 5JO5B 2WNGA 4CVZA 4U1JA 3SE9L 4F7CB 4PRBB 4Z95H 2VDNH 2CGRL 1EERB 3OKLB 3VI3F 4H1LH 1K4CA 1AQKH 3WFDH 2H32A 4FQQA 5GISL 1K2DA 1WIOA 4M62H 5JW4M 3JUYA 1X4YA 5C09E 5CEYA 4PIRF 4JZJC 5FO7B 2ILLA 2GITB 5IM7B 3RZCD 3VRLE 2DOCA 1JN6A 1P7KB 2AEPH 3KR3L 4JY5L 5IGXL 1A1MA 2EDHA 4HEME 3D3VB 1RJZB 2VUYA 4OCMC 4Y19E 4LVNB 3UTZA 4X80H 1Q9LB 2AJ3A 4JCMA 4YHOH 4PGJA 3TH3T 2XA8L 5HGDA 3W9EB 4U6XB 3C09C 2NY5C 2C3HA 4XVUD 5HD8C 1IGTA 2V2XA 3ULVE 3BKCL 1CK0H 4QRQB 3EYVB 4IDJH 3W0WA 5I30H 3ILQC 2FIRT 2WUBL 4JG1H 1I7ZA 4MGXA 1A2YA 2Z9TA 3O2WL 1KG0B 4MWFB 3UYOD 4X6EB 4YEEA 4I0PD 2GAZA 5D1QA 5TDNA 4UV7L 3RU8H 1HIML 4M7LT 1T2JA 3OJVC 3RWIB 2WUCH 3DUUA 1AD0B 4JPVL 4ODUB 3HB3D 3SGJA 3TIEB 2ATKA 4Y8AA 1T80A 4XI5D 3O6ML 4GRLD 5HYIA 1XT5A 8FABA 3HFMH 5F6HI 1D9KD 4OKVB 1CDHA 3JWDC 1J87A 3RVTD 4ONOA 4YHMH 4Y16C 4Y4FB 4DQOL 1HYSC 4MQTB 3N0PB 4CNIB 1NQBA 1SJEA 3WLBB 4WRLA 3WHXA 4P5MB 4RZCB 1EO8L 1BWMA 4L3EB 4JB9H 1QO3A 3GSUA 4L4JA 4LLMA 4GG6B 1IAMA 2ICWA 3SE9H 4LRNH 5JOFB 4Z76B 3QUXB 4V1DB 1HH9A 5L0QB 3ZYZA 2CGRH 2BVOB 2G75B 4TUJA 3A6BH 3QFJE 3RZWA 1QLRB 2DQIH 1IAII 2A0LC 2OBGA 5GISH 5CD5C 4P5TD 3SGJC 3QO0A 1Q38A 2DQHL 4UAOC 2CDGA 1ZLVH 5MHSE 5HHVL 1M7IB 3RVWD 2ARWA 4P23A 3OR6A 1L6XA 4WY7H 3V9FA 5FXCH 4LLYA 2DKSA 4XVTH 4TTGA 3KR3H 4RGOL 1EAPA 1YEHL 3MOQA 2IFFL 4JY5H 5IGXH 1HCVA 2NW3A 2Q86A 5GRWA 4TVPD 1N7ML 4XBPB 1EZVY 4U0QB 4JREB 1RIHL 4PRPE 1R5IA 3CU1A 2C7UA 3E2HC 4P4RA 5C0EA 4Y5VA 1CGVA 4AQOA 2J5LC 2LU3A 2WUBH 1U8HA 1TCRA 2PXYB 4LAJH 5I8OH 4I0KA 1ADQA 4HUVA 1CR9L 3O2WH 3VFTB 2LAGB 4DW2L 4EN3B 4ODWA 4MNQD 5F3BB 5FM5M 4PJFE 4QLRA 2EEAA 3KG5A 1XGPB 5JDSB 4YFLF 2X4QB 3CD4A 5EOCL 5IFAL 4K9EL 1CGYA 3NIFF 4UV7H 3VE0B 5KVEH 1HIMH 1MFEH 3W39B 1ZAGA 3SDCD 4PJAE 2D31B 4CL7A 3GMQB 3R0MA 1A1OB 1NL0L 4FTVA 4WDIB 3SDDB 4I48A 2UY7A 1DQQB 3C6LA 1KB9K 3SO5A 3GSQB 2A73A 2LABA 5DJ0A 5DJCB 4JKPL 4GSDL 4QRRD 4F37K 4ZO9A 5D2NE 4ZTPH 1YEDB 1QOKA 1TENA 2C9AA 4KJWD 4CMHB 5FEBA 4LLDA 3OG6B 2VLLA 1T2QH 1X5ZA 1CF8L 4YLQT 4G6AD 4NN5C 5EO0B 3MNVB 4WI6A 1U91A 4XP5L 4Y5VC 4KK6D 2B4CC 1LEKB 1T7WA 2C4FT 1OSZA 5MEOA 2HFTA 1HINL 2VDOL 4RGNC 3MUJA 4TVPH 43C9B 3DMMB 1D5MA 1J0HA 3WUWB 5E2TL 3TO4A 5T1LA 3HS0B 3KPSD 4P4KD 3QDHA 1FN4A 5DQDL 1X5LA 1X9QA 3NIDF 3BP7A 4P49A 5F8QC 4ZUUA 4ZFFB 1SJHB 3NZHH 3HC4L 3MRCB 3DIFA 3LKSA 3PQYE 2DQHH 3O3DB 2ADGA 1XF2A 3C6LC 4O58L 4WTZG 4ODTH 1IM3B 4PD4J 1WVZA 1UYWL 3SCMA 4ELME 1INQB 5IMOA 4F7MB 4JGUA 4KMTL 5MEQB 4PRDB 5IVZB 4U1LA 1AO7B 3WUWG 2BRRL 1I8KB 1BQUA 4IRSC 1PG7H 5D2NC 3FKUS 5E00A 4JLRB 1N7MH 4Z18A 3T0AA 4HS6B 1RIHH 2N56A 2YUXA 4ODBD 4I2XE 4ZXBA 3CDCA 3IT8D 1T5WA 1QSFE 5C2BL 2Y72A 1WZLA 3LS5L 1QFHA 1TNMA 3QWQB 3TO4C 1E27A 5SWSD 3RI5F 1CR9H 2NYYC 3MV9A 3Q2CA 4LSSL 5D7IF 4DW2H 1XGRB 5DVKA 1BFOB 2GW5A 3GI9H 3BQUA 1ORSA 4PRID 3O8XB 5DRNA 4JFOA 1GXEA 2X1WL 5HGHA 5EIIA 4F9LC 4CMMA 5EOCH 1CFVL 5IFAH 2VLRD 2AJYL 4HIHA 4XNUL 3FN3A 5CIPB 3RWDB 3QUMB 2BNRE 3SCMC 1IM9B 1NL0H 3V0VB 4A6YL 5EUKA 4RISL 1IEBB 4JVUA 5HD8D 4TNWF 3MUY1 4M00A 1LO3L 3P4NB 2VKXA 3RUGF 1Z0NA 3ILQD 4JKPH 4MB4A 4HIEB 5E95B 4K07A 1QZ1A 4NDMA 1A14L 4HUMB 4XHQA 1HXMA 4KDVA 2EDEA 4XBGA 5HHME 3ULVL 3MJGX 5BCAA 3T2QA 4XP5H 5DMYA 1DBBH 2XN9E 2Q1EA 5C9JB 1FFOA 5D1ZA 1HINH 2VDOH 4JZNA 5EZLA 2ZCHL 1DSFL 5DS8A 3BQUC 4QXTA 2CIKB 1S7TA 2DM2A 3GSWA 1MSPA 2DRUA 1NMCB 5DD1L 4Y19D 1KN2H 3OKOA 1QR4A 4Y16D 1HYSD 4NSKA 1VB9A 1GAFH 5DD0L 5J12B 1NJ9A 1CFQA 1RULH 3W0WD 3IETB 3MLVL 4P2QB 4KMTH 2YPKB 4TUKL 5HYJA 3GSOA 1CVSC 2KL6A 2VXUL 3JTSA 5DJDB 2WP3T 3HNTL 5E4EC 1VDGA 4CN6A 3CNKA 3CSBA 2NY5H 5D1QD 1PDKA 4UT6L 1IQDA 1BQHB 1XCTA 1H5BB 2E7LA 1GOGA 3D18A 3WIFA 3L6FB 1QSEA 3PWPE 2A0LD 2W59A 4IIQA 5D1ZC 1UG9A 5CD5D 3PWPA 3CFBA 3LS5H 2AP2A 4HIJB 5I73B 5KG9B 1YEIH 2XZQL 2GY5A 4G5ZH 1A6VL 3QH3B 3CXHK 4AG4L 2V2TA 4ZD3L 5JHDE 1MCQA 3O6KL 5I1EH 1G7LA 1HSAB 3SDXB 3GI8H 2AJYH 4XNUH 2CXKA 4JCLA 4LEOA 4I3SL 2ITCA 3HAEA 1JZ3A 3VGHA 3IKKA 3EOYG 2W65B 3GMPB 4HAGA 4I0PB 1RZ8B 4RISH 3DUSA 5AZ2L 1K3ZA 1XF5A 5CINH 3RUGA 1LO3H 2ZKHH 4FP8L 2I9LB 5D96B 2XWJB 4PG2A 4K23L 3GBML 4NWTL 2ADIB 2LQRA 1SYSA 2E7LC 1NAMA 2UZIH 4AEFA 5HGAA 5IVXE 3EYQC 4GRLB 4G9DA 1YN7B 2EDYA 5FO9B 4IIQC 2RCSH 4Z77B 1LP9B 4HS3B 1CS6A 3LEYL 2DJ4A 1ROWA 2VABB 4HEPG 1RUQH 1K8DB 5DVMA 1EEYB 4XPFH 2B5IB 4YHYB 2NY6D 1MQKL 2AW2A 1DSFH 1XF4B 1P84J 2QADC 3NPZB 1FJ1A 2CXGA 3CPLA 3LKRB 2YD1A 1W72B 1JGVH 3ZKQD 1MPAL 2J3SA 4OZGF 4HGWB 1CWVA 4JHWL 3IVKB 4MVBC 5AUMB 4OIBA 3AMLA 3UTSA 1XGTB 2DQGH 3CZJA 5DD0H 3RIAK 4U1NB 1VFBA 3TBYA 3ALXA 2GEEA 2IMMA 3QZWB 1JE6A 4TUKH 1E6OL 1VACA 3PDOA 3B9AA 4OBSA 2JE8A 4P5TB 4RGND 1KPRA 2FHBA 3DI2B 4HKZA 3HNTH 2NW2B 5IJKC 1JGEA 3FB7A 5I1DB 2ADFH 3TZVB 3MV7A 4X6DF 1RFDL 5IW1A 1J05A 3WD5H 5TF1H 3SKJL 2DD8L 4B50A 2X10A 5CBAA 4MCYA 4FTVD 1JZ8A 2H8PA 3QWOB 2IAMB 2VQ1B 5DRWB 3C6LD 1SMOA 3HZKA 4KI1A 1FFRA 3NPSC 2W92A 2PO6C 3KYMB 4EUPG 4O9HH 3QZWG 2DQFB 2E9JA 3VFOA 2XZQH 2ZJSL 4PS4L 1WAAE 4JVWA 3CJJA 4DGIH 4JQIL 3MJ6A 4ZD3H 3O6KH 1KEGH 4JO1L 4UILH 4RFOL 3L95A 3DSFH 2BZDA 3IRPX 3EFFA 1RD6A 5C1MB 3O11B 2IH3B 1F90H 1J8HB 3U46A 3P30L 5CJQL 4F9PA 3QNXB 3ULUC 1A3LH 2DQEL 5D1XB 5AZ2H 4R9HA 5IROA 5C0GB 1A7RL 1SEQL 1YNLL 5L2KB 1I9JL 1U58B 3DRQA 3TO4D 1KACB 3GBMH 3DV4B 4LHUG 2L0DA 2NYYD 3KPLB 1ND0A 4I77H 4K94L 3VH8G 4K7PL 5MERA 1AY1H 3DX6B 3HNSL 1KJVB 3MCLH 4JANA 4F7PB 5F97E 2XPGB 3BD4A 1UM4H 4XC1L 3S96B 3PWVA 3SCMD 4OF3A 3STBA 2EXYC 4D9LH 1V3JA 2UVEA 2PF6A 1XGUA 3EDJA 1BX2A 3IDIA 4GG6E 1N5AA 1JI2A 5JXAL 1HEZB 5B8CC 4Q58C 1MPAH 5I8EB 4MJ6A 2DTSA 2H2PD 4G7YL 4LU5H 2PTTB 1I3GL 2A6DA 2X4PB 5IROC 1FGNL 4OIIL 4KJYB 3F7VB 4M7LH 1T7VA 3TNMB 3V4UH 2FJHA 1DJSA 4GMSH 3HNVL 3MV9D 1OP5K 5I9QB 3BQUD 2UWEB 4HHAA 2Y06H 3U79A 1MAJA 1A3RL 3H9HB 5T1MB 1JGUH 1I3UA 5CJOH 5A16B 4HJGA 5I15L 4FFYH 5J9PA 5IB5B 5TDOB 5GS2H 4BKLA 4NHCL 4W4NA 2JCCE 2BNRD 3IFLH 5DMKB 4Y5XB 3NGBB 1KGCD 1X4ZA 1FZOA 4QHKI 5HHOE 1FZMB 3C8HA 1QSZA 3DX8B 3SBWA 1MELA 1FYTE 1S7XA 3GGWA 1U3HB 5L8KB 3R06A 3VGBA 3SQOL 2Z4QB 3MLYL 4H88L 5INCA 3H9YA 3IKCA 5SWSB 4LKXB 3N1FC 5FOBA 5H37H 1ITCA 1IAIM 5E1AB 1RK0B 3P30H 2ZZUT 1IT9L 4MSWA 4OM1H 4PRIB 5D1ZD 3WO4B 2DQEH 35C8L 3QCTL 1A7RH 1SEQH 3VFVB 5DUBB 1I9JH 1TETL 3V6OA 3RWFA 3C09B 2AEQH 4K7PH 4KXZH 1NLBL 4U1JB 4WI9A 4CVZB 3RVXC 5IHUH 5GS1C 2J8OA 1ED3A 5KW9L 1MREH 5B39G 5F44A 2H32B 3SBWC 5HYJD 4M8VA 5CEXA 1JPGA 3EOAA 3JV4A 5CEYB 3RWEB 1KENH 2BSED 4MMZC 5A2KH 2Z31A 1F2QA 1JN6B 4G7YH 1F00I 2VL5B 2Q8BL 3EYQD 1QSED 3SN6N 2YPLA 4HUUA 3ZTJH 1I3GH 1Q1JH 3P77A 2ZUWA 1FGNH 3CVHA 3PWPD 4OIIH 5TJWK 3UTZB 3O9WB 2AJ3B 1FNEA 4LL9A 5HGDB 3V6OC 1U8NA 2FNBA 2OQJB 3X12A 2HMID 1G9NC 1IGTB 5GGSY 2V2XB 5DTFB 2QADD 3O6FA 4LOUC 3W0WB 1ULVA 1I7ZB 1URLA 4JN1L 4WHCA 3W9DB 1VESA 2QL1A 1OD7A 2FWOA 1AC6A 2I07A 5JHLH 4MVBD 2GAZB 4RCAA 5D1QB 1YA5A 5TDNB 1U92A 1S3KL 1YEJH 1BQLL 3MRLA 2XTJC 4QF1A 3EYUH 3TBWB 3LEXA 5EOQL 1PZ5A 2Z31C 2ATKB 3MLYH 4H88H 1U36A 2YHGA 1C08A 3FMGL 1OGTA 1NDMA 4XCFH 4OFPA 4O51A 2Y7QB 4Y2OA 1N0LA 1Z2KA 1NEZA 4MDIA 1XIWA 4XH2A 3RWGA 1BP3B 2X5PA 2R69L 35C8H 4YHIA 5E99L 2ZUQC 3O6FC 5F96L 4ODSL 3RIFF 2IQ9L 3WHXB 3ZSTA 5C0DA 5HHXL 3ISWA 4RNRA 4TN9A 1QO3B 4DN3L 5JXEA 1H15B 2V9RA 4LLMB 2OP4H 5L9DH 5E5MA 2ICWB 2VRAA 1QEWA 4EIZC 3RPKA 1HH9B 1EX0A 1UCBH 4XMPH 3UTSD 3KHQA 2HTLC 3DV6B 4WU5B 3DHJA 4TUJB 5J89A 5KAQG 1CD1B 3ULUD 4JO4L 3B6SA 4JFEA 4EBQH 3RNQB 3QO0B 1EHAA 1NCAL 3DXAA 4P23B 3OR6B 3MLWL 1NBVL 4PGCB 4LBEA 4LLYB 1INEL 3MV7D 1ERNA 5LKNA 5C08A 2NY6B 3BWUC 2V5SA 2CDFA 2SEBA 1YMMB 2NW3B 4U33A 5DUPL 1QRNE 2Q86B 4JRYE 5C0FB 1NAMH 5FF6B 1X5HA 5HVGB 1FLRH 3O41A 4TSBL 5IP4A 3Q1SH 2EXYD 1EEUA 1M1SA 4P2QE 4XP4H 5JXEC 5ISZA 4NN5B 4JAMA 3CFKA 4GO6B 3VG0L 4Y5VB 2VDML 5CCKH 4MAUH 4WTXA 1HHJA 4JN1H 1TCRB 2BHUA 5LGHL 4HUVB 5A2LH 2OTPA 3OKDA 4ODWB 1YNKL 5IESL 2Z0BA 2C1PA 5GJTH 4Z7QF 4QRPA 3TYGH 4N90D 1LHZA 4Y4KA 1BPVA 3MCKA 3O6LL 3IDYC 4Q9QL 5EOQH 4UT7L 4LNVA 2F8XC 4LDEB 3LPFA 5JDJA 2MQCA 3FMGH 4HZLA 3ULUH 1R3HA 4K3JL 2XNAA 1N3NA 3U0WH 4HK3N 4NYLA 4WW2A 4LLDB 3C8KA 4PG9B 2R69H 4JM4L 5FAAA 3V0WL 2OR8A 3IF1A 2Z8RA 1U91B 4ODSH 2IQ9H 3T8XA 1HNGA 4ODVH 2F74A 4DN3H 3LN5B 1U6AH 5MEOB 1EJOH 1MRCL 1D5MB 3MC0A 3TO4B 5T1LB 3N50A 1FN4B 3BP7B 4Y4KC 2FBOJ 3WKMH 1JF1B 5EOCJ 2H41A 1TIUA 5E1HB 4TUOA 3QEQE 2EYSA 3DIFB 3LKSB 4L9LA 1XF2B 1BWWA 3N9GH 4S1RL 4XAKD 3MLWH 3KPQA 3T08A 1NBVH 3PP4L 1RVFL 3MYJB 1YYLL 4KV5F 3EZ8A 4G43A 4X7CC 4WW2C 1BEYH 3IGAA 2ZUUA 4BQ6A 1J0YA 4HPYH 3TCLB 4HH9A 2DB8A 5C0RH 4PD4K 1KLFA 5DEGA 3AS1A 2IBGA 4TSBH 3UPCA 4X7TB 4ZXBB 5DFWH 1T5WB 4R90H 3VG0H 4AM0A 5EO9A 1YYML 4CGTA 1E27B 4Q9BA 4FXLA 3MV9B 1WWAX 4PLJC 2J6EL 4N68A 1B2WL 4U1GC 5H35B 1YNKH 5DRNB 5HGHB 4CMMB 4HH8A 2DMBA 4L9LC 1I1YA 3CXDL 4PJ7F 1I4FA 3NCBB 5EBWA 1J18A 3O6LH 4Q9QH 1JRHL 5EUKB 4UT7H 2ED8A 4C56A 1B4JH 2GK0A 4LOUD 1J9CT 4P2YA 4M5YL 4R7DA 4UBDC 4N1HB 1NGZA 4UI2A 3GSRA 4K3JH 2PYFB 1J5OL 4F8TA 1LE5B 1J8HE 4LKCB 5E4EB 2R0WL 4NDMB 3LKNA 4X0KA 2C4XA 1HXMB 1GCFA 4PJXF 2H26A 3CDGB 2I24N 5EBMA 1UEYA 4KHTH 2BERA 3ZLQC 1T03L 4OIAA 1FFOB 2XTJD 1KCUH 2OMNA 3KPRB 2Z31D 4JZNB 3ES6A 5EZLB 3SPVA 5B3JF 5DS8B 1KB5L 2YPLD 4YHNA 4P9HC 1TNNA 3VFWB 5GSRA 1S7TB 2DMCA 1VA9A 1F3DH 4CJ0A 1S9WA 1Z3GL 4H0GA 3OKOB 2YXMA 3IDJA 5D71L 4NSKB 1X5KA 5KJRH 3U9PL 3O6FD 4DUVA 1NJ9B 1CFQB 1RVFH 2AXFA 1YYLH 3QCUL 2X7LA 4YE4L 3IFNL 3V2AR 5HYJB 1BIIB 1T0PB 3LRSB 2QR0A 3O3AB 5CGYC 4DKAA 3QUML 3VXSA 4NO0B 4ZFZA 2FGZA 3EFDH 3NTCL 5D6DA 4ZOEA 1G9NH 4YC2C 1XCTB 3D18B 3WIFB 4OZHE 1MVUA 1QSEB 2VITA 2ZCKL 3OAZH 3RTQB 5C0BB 3OZ9H 5CBEA 4IIQB 4OZHA 2MHAA 5D2LF 3CFBB 2FHCA 5FUOL 2AKRA 1L4IA 3QHZL 2UWEE 5DK0A 5EC1B 5D7IB 3ARFA 5MP6L 3BPOC 5H2BA 2J6EH 2NY2B 4G6JL 2V2TB 3U7WH 1G7LB 3AS3A 4PJ7A 4LEOB 3HAEB 3CXDH 4U6TA 3L3KA 1E4XL 4G9FA 2BVEA 4S0SD 5F3HA 1IAIH 2CQVA 4J6RL 2P44B 3FQRA 1D5ZA 4NQEE 1CDCA 5JXED 2ARJQ 1FNSL 2G2RA 1XF5B 3RUGB 2HKFH 4M5YH 4WI7A 3GFUA 4ZUVA 4R0LA 5IOPA 1GH7A 5D6DC 4MLSA 1SYSB 3G6JF 5B38A 1J5OH 1ZGLP 4GLRI 3BN3B 5HGAB 5D93C 4PJXA 2DQDL 2EDBA 2R1WB 1J86A 4GUPA 4JFED 3ZKMC 2YKLL 3B5GA 4PJ5A 3VDCA 5J13C 2GSIB 5I8CB 1EMTH 3DXAD 2W9LA 1DBAL 32C2A 5E94A 3ARFC 2EICA 5C08D 5KZCD 4EKXA 4KJQC 3OAYH 1KB5H 4I3RL 1FJ1B 4YDKH 1AXTH 4LSVH 1GIGH 2H1PL 3IXAA 3QNYA 4R26L 1Z3GH 1DEEA 4OI8A 1VFUA 3KLSA 3GJEA 3MODL 1FG9C 4MA1C 4B53A 1P84K 2VDKL 3HZVA 5ISZD 3U9PH 1MHPL 1VFBB 4MQXD 5HPMA 5C07A 3VRIB 3CC5A 4R0LC 1CIDA 1VACB 3PDOB 3FQXA 4HKZB 1JGEB 3AMKA 1KPVA 3FB7B 2HP4A 3D0VA 3QA3B 3NTCH 5EFIA 3VXMA 2A74B 3IFPB 5IW1B 4Y4KD 5D72H 3L3DA 1Q8MA 3V5KA 1CYGA 3C08L 3ROOA 3D39B 2ZCKH 1JNLL 4GRWH 5CBAB 3ROLA 4MCYB 2H8PB 4Z7VF 2Z8VC 3QDMA 4DZBB 3HZKB 5FUOH 2GTWA 1YECL 1AR1C 4JGJA 1A7NL 1F42A 3QHZH 2GFBB 1A47A 4N0RA 4Q0XL 4WHTB 5MP6H 1FGVH 4G6JH 1S8DA 1EUTA 1NCBH 3L95B 3MBXH 3S5LA 1Q0XH 3KJ4C 1E4XH 1QBMH 3H3PL 1UB5A 1YJDL 3MRGB 4S10A 1W72L 4LMQE 2BNQA 4PJGF 4J4PA 4FFZL 3PL6A 3BP4A 2XA3A 4OFYA 1FNSH 4DFHA 3SE3C 3UPRA 1NFDE 3D6GA 1OVZA 1RU9L 4ZFOL 5ETUA 1ND0B 4ALAL 3V4VL 1Y0LA 2YKLH 1NCUA 5CKGA 3KJ6H 2R39A 1G6VK 2XZCL 4HW6A 2BP3A 4JFDA 2X4SA 1T7ZA 2Q3ZA 2JKXA 4P9HL 3RDTB 1K9TA 2B7DT 3EJJX 4D0CA 3I6KB 1E6JL 3R0NA 4X4XA 4XWGL 2YEZA 4I3RH 1BX2B 3IDIB 3RL2A 5J57B 4UBDD 5KSBA 3H9SA 4BSJA 4CDGC 4OZGB 4R26H 5E4IA 3OG4B 2E9BA 1A0QL 1YEGH 1OP3H 3I84A 2A6DB 4J4PC 3TYFB 1LVEA 3QAZC 4QOKE 5BQ7B 5I75C 5FYLL 2R8SL 4K7FA 1A4KA 2FJHB 3A0OA 3LPWA 4WUUA 1FFNA 5DR5L 5AWNH 2M1KA 3LQAC 5L6YH 1DANU 2VTFA 3HE6A 1B0RA 1YMME 4U3CA 4X6DB 3T77B 4HHAB 2MSPA 5ICYA 3C5SA 3LPGA 4YAQA 4OF0A 3C08H 2Z92A 4FQIL 4J3TA 1CFNA 4Z7VA 3QSKB 5FM5O 3UTTA 1B0GB 1A7OH 3OWEA 3GIZH 1DANT 4C56D 2VH5L 4BKLB 2FX9L 4GOSA 2VISA 1A7NH 1FZOB 1B90A 3PDGA 3GIVB 1MRFH 5CGYD 3GGWB 1S7XB 1XR9B 2IANE 4X8XA 2HLFD 1JHTA 1YY9C 3C60A 3K3QA 3R06B 4HJJL 4RFNC 5INCB 2X1OA 1JUFA 1IC1A 5I74C 2FJFA 1RZJC 4U6YA 3IKCB 2YC1A 5FOBB 3WSQH 4M48L 2QTEA 3H3PH 1ZT1B 4LRIC 1YJDH 5ANMA 1EHLH 3ARDA 4MA3B 1F8TL 4NFBA 4WI3A 3PP3K 1MWAB 3HE6C 5IW6A 4LP4A 3ECBA 4M1DL 3RWFB 2GI7A 1RU9H 4HXBH 2YS4A 5L88H 5IR1A 3K81A 4EUPH 5E9DA 5E2UL 4U6VH 3V4VH 3SGKA 2EDOA 4PLOB 3V0AC 4G8FA 3X3GH 4HWNA 1NFIA 2XZCH 1ED3B 4OSUL 3HLAB 2FEDC 3MRJA 3QG7H 5DRXA 5F7HA 1WK0A 3VXTB 4P9HH 4DK3A 5C6PB 2F54A 4JJ5A 1E6JH 4Z7NE 3C60C 3EOAB 3WFEL 3WYRA 5L7XH 2BXZA 3VXSD 4U1HA 3W82A 4GW5A 4XNZC 5FO8A 5GPRA 4B5EA 5I16A 5HGBA 1A0QH 2PR4L 2EYRA 3ARDC 1FBIL 1T21B 3ZKMD 4PJIF 5CWSB 5ENWA 3JSSA 3CVHB 5BVPL 4WW1A 5DA0B 1FNEB 1HKLL 3MLXH 2VZ1A 4PTTB 4JQVA 5D7SL 4X8JA 2LAAA 3ARFD 2R4RH 3MFFA 4KJQD 2ZUQB 1WIUA 1CZ8H