5DRZB

Crystal structure of anti-hiv-1 antibody f240 fab in complex with gp41 peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
227
structure length
227
Chain Sequence
QVQLVQSGGGVVKPGASSRLSCAASGFTFTDYYMSWIRQAPGKGLEWVAYITKDGSEKKYADSLQHRFAVSRDNANNLVFLQLNTVEDDDTGVYYCARDDGYYDRSGYYGVFDLWGQGIRVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV Antibody F240 Light Chain
publication title Molecular basis for epitope recognition by non-neutralizing anti-gp41 antibody F240.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 227
sequence length 227
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5drzB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5drzB01
1OL0A 4H1LH 4K3GA 4TUKL 4G7VL 4X80H 4F7TB 4H0HB 1XGTB 1R3IH 4LBEA 4ZS7H 1N8ZA 4PJIF 3WFDH 5I8CA 1T6VN 5DK2B 3CH1A 3VXTB 2VNCA 4DN4L 3GSWB 1CFVL 2X10A 4MCZA 1SYSB 1PZ5B 2AEPH 2Z8SA 3ILPB 3NFPB 5I1DB 4GG6E 3WJJA 5HI4C 4DZBA 1IEAB 2GY7B 4NKDA 2CRYA 1Q72L 1XIWC 5FXCH 1FGNH 4G9FD 2CDEA 4ZPTB 2WSKA 3LS5H 4TSBH 3QHFL 5F44A 1EIBA 4FQQA 4WW2A 4AG4L 1ERNA 1J86A 1KGCE 1MJ8H 2DKSA 1M7IB 3UBXB 2W38A 1LNUA 3EHBC 3TJHD 2XA8L 4JO4H 3MLPA 4YDVA 1PQZB 5B4MC 1KTLB 2V5SA 4GAGL 3MMEA 2NY2B 3NCFB 2J4WL 3P4LA 4C58B 1UJ3C 3MV9B 4PRPD 1QFUL 4PJAB 4XC3H 4OJFL 4U1NA 3SGDH 1I1AA 3JZ7A 4RFEB 4IDJH 3EJYC 1HHGB 5ICYB 3DROB 3D0LB 5AEAA 3ARGC 1OQXA 2C5DC 5JHDB 3HE7B 3OV6A 2MQCA 1R3LA 2OZ4A 1FZKB 2J12B 5J13C 4BQCA 5DF0A 3IXTB 3O0RH 3TBVA 1BX2A 4UB0H 5D7JD 3SKNA 4JREC 5FYLE 2FECL 2EDNA 5GGQH 2V5YA 4KK8C 4KKBC 2BX5A 2R2EA 4HJGB 3TA3C 1GCFA 4I9WE 1CF8L 4QHNA 3MRMB 3ZDYF 1FNFA 2HKFH 3TIEA 4AEIH 4HHAA 1DANT 4B50A 1G7LA 2EIZB 4PTTB 2PR4L 3RY6C 3A67H 4XGZA 1JNJA 2B4CL 2AQ1A 3T3ME 4QF1A 2J1KA 2P49B 5C9KA 4KKCD 5FB8A 1IKNC 2AJSL 1OAUL 5HGBA 1QLRB 4UT7L 2H3NB 2VXQH 3ZDZF 4AT6A 1KENL 1U93A 1XR8A 3TWCL 4OLYH 2IEPA 1RK0B 1OTSC 3SJVB 3C6SB 1VFAA 3U7AA 4CMHB 4IOFD 2F9BT 4F2MB 4P9HL 3B5HA 4JHZA 5CEZD 1ZHKA 3LKPB 5HHOE 4QTIH 4HIHA 5I6XB 2DWEB 4YBLB 2ICWB 4RQQB 1NFIA 1KPVB 5DXWA 5C0JB 5JNYA 4IJ3C 1UWXH 4BA8A 4LOUC 5GS0D 1QSED 4X6CF 1S9VB 2GJ6E 4L4VB 2Z0BA 5D1XB 5HDLA 4MLIA 5GS1B 3DXAE 4X5LA 1NCUA 4KQ3L 3KLSA 4AIXA 2HLFD 3WUWG 5MEQA 3PGFH 5I0ZA 1BAFL 1EUTA 1AC0A 3O45B 1X3DA 3BZ4B 1KEMH 4R4FL 2IAMB 2K1MA 5D72L 3U83A 3HR5B 4GJTB 1JK8A 1JHTA 4V1DA 4LF3A 4RZCB 2XTJB 4MQXC 2JB6B 1S8DB 1BOYA 1EHLL 2EDLA 1WISA 2Y7QA 4Q6IC 5DVLA 5GXBB 2ZG1A 3G6DH 4TVPE 3UYOD 4M5ZL 4KVCH 5TQ0L 4LVEA 1JV5B 1D6VL 4PJ9D 2BOBB 5I9QB 4P2OB 1IL1A 4MAYD 5F93C 5EZJA 2Y25A 3V9FA 4LLMB 1R3KB 2F54A 2QTEA 1S7TB 1P4BH 3ARYA 3H9YA 4HH9B 4IRZH 4TOYL 1R0AL 1HHIA 2OSLA 1LILA 1FZOB 2I9LA 2BP3A 3AXLB 5KOVC 3FRUB 1HSBA 3I75B 4Y5YC 3DETC 4ERSL 4GUPA 2Q76B 5A43C 2BHUA 2FD6L 3TN0C 4X4YA 1CL7H 2EC9U 5E08L 1YEEL 4YGVB 4X4XB 2H41A 1E27A 2BC4A 4FQHA 5FGCB 3ZTJH 4PLJD 4HKJB 1BECA 5ACZB 2ADJB 1HYRC 2VXTL 1T1WB 2ILLA 1AGBB 5D93B 1NAMB 3HC3H 2GEEA 2CDGA 4F15B 1TTUA 4Z8FH 3D0VA 3ECBA 3SCMA 1J05A 4EN3D 3E8UH 4Y4KB 5JPNB 2MOVA 4L8SC 4K7FB 1Z3GH 4IRSC 1A6AA 3ARBA 1HEZA 3BH9A 1OF2A 4OLXH 1DR9A 5EU3B 3L3DA 4M03A 3MOBL 4CVUA 2EDYA 5JQHC 1A9EB 1INEH 1KLUB 1VFOA 2Y72A 4Y5VC 3JUYA 5DR5H 4EEEA 2P1YA 1EAJA 1SEQL 1JUFA 3L7EA 1R5WB 3OJMB 2RCSH 3GMLA 5E1HB 1RZKL 1J5OL 3V7MA 3VXMD 4OGYL 4JFEE 3VFWA 1Q94A 4JDVA 3LPWA 3UYPA 2AEWA 4BZ2H 3R1GH 1R3HA 2A73A 4YO0B 5EO9A 4OSUH 4PLKD 1VFBB 4B53A 4DCQB 1E4XL 3WKMH 4L3ED 4DW2L 1NBYA 2W1NA 1N4XH 4GRMA 5BO1L 2NZ9D 2MKLC 1MPAH 3AMLA 4PIRF 4CGTA 3L3HA 3LV3A 3PL6C 3TZVC 1ZHLA 5E2UL 1H15B 4U2ZA 4XP6H 3VU2A 2CLZB 3CNKA 4YPGA 5DSCA 5F7DB 4LSSL 1WUNT 5FO7B 3BH8A 4U6HB 3MLSL 2DQGH 5DGQA 1BPVA 2BSSB 1F3DJ 5T5FL 4NT6A 1MFEH 4AIZB 2FJHA 4WTXA 2O5ZL 1S9YA 1MI5B 3H9SA 4QXWA 1OSZA 1XIWA 1QD0A 1KF9B 4O5LL 2GJZB 5JOFB 1HZHH 5DD6B 3GSUB 1OAQL 2YRZA 1J0IA 3GSVA 1HCFX 3N1PC 2ED7A 3GFUA 3MRQB 3OKEB 5CGMA 5ETUB 4HKBA 1XF2A 5EA0H 3JWNC 3QULB 1IGCL 3CMOH 4KUZH 1CBVH 1IC1A 4Z95H 4D0BB 5HHVL 1JWSB 1FAIH 1ZHBA 3RVVD 5F3HA 2AI0L 1A6PA 3TBYA 3T1FB 4GRWF 4L4TD 3RVWC 1UJ3A 4I0CC 3ESVF 4G8GE 3MACL 4KRNA 3IJYA 4JG1L 3V4VH 3LCYA 1AQKL 2FEEL 1A7RH 3ARGA 3LD8B 1FL3A 3C60B 3GMQA 4ZAKC 4V1DE 3W39B 5F6IB 5IB4B 2EO9A 1IBGH 3BUTA 1P5VA 1NANI 4ESKA 1L9MA 2ATPB 2XN9D 1T1XA 3MCLH 1H3GA 2JB5L 4LGPB 5IKCB 3BMWA 1Q9KB 3EDEA 3VW3H 2NX5B 1T7XA 1D5IL 5T1KD 1QBAA 1H3PL 3HUJE 3CDYA 1PVHA 1P7QB 3PP4H 3RY6A 2WLZA 5HPMA 2LU4A 1E6JL 2F54E 3EYOB 2AJUH 1IKNA 1LO4L 3SKJL 1U91A 2VZ1A 4AEHL 5IOPB 3QUZD 2WQ8A 4P2YA 2IPKA 3FT3B 5BRZE 1FQ9C 2X4PB 2CLVB 4R3SA 4K3EH 2VLKB 3JV4B 5BXFA 2HRPH 3FQRB 5HVHB 1RMFH 2X70A 2VITB 3QH3B 2VSDA 1KC5L 4PJFF 4UINH 1IGYA 1JNHB 2ZJSH 1B2WL 1HOCB 3MJ9L 1KB5B 1IAKB 9CGTA 3M8OH 3QNYA 5CAYB 1U58A 1I8LC 3MGAA 1IGMH 4H1LA 3QUXB 3WIFB 2PYEA 3RL2A 3TT3H 4N8PA 4WWKC 1E6OL 1I1FA 1FL5A 2B1HL 4HJJL 5FUOL 2A0LD 5FA4A 4HBCH 1JCKA 4I48B 2WK2A 2BNQB 4D8PB 5DJAA 2GK2A 1NFKA 4NRZB 2Y6SC 2J8UB 1YJDL 1HYSC 1KYOK 3UCRA 2EYRB 1MVUA 1VENA 1XGPA 2CUMA 3NCYS 5HDBF 4PJ5A 1YY9C 4YC2B 1MHCB 1G9ML 3ULVH 4GG8A 3GIZL 3C09B 3BPLC 4U1SA 3PQYD 1FSKB 2DN7A 1TENA 4R7NB 3BEWA 3RP1A 4XTRD 3QO0B 3NFNA 4Q6IA 3OKKB 3FB6A 1PD6A 3OBAA 2G75B 3QDMA 2OBGA 1KELH 4M43H 4HUVA 1WZ1H 3MA9H 3ARED 1KN2L 1MJUH 5IM7B 4X7SH 3TJEL 2CKBB 3BZEB 3DHMA 1DL7L 5IEKB 3NAAH 1AQDA 3KPSD 4NKIH 1TJIH 2LVCA 2DI7A 5KSVB 2KZ1B 4QOKB 43CAB 2P8LB 1L6XA 1ND0B 5ENWA 4Y5YA 1NAML 1J0JA 3KJ6L 1H5BB 5FOJA 2E9WA 2EICA 4PP2A 3TN0A 4M4PA 5EWIL 1V05A 2VZSA 2J5LC 4BM7A 1HILB 5HGAB 3ARDA 2F5BL 3H9SE 4OCSL 2PW2A 2NNAB 4XBPA 4K8RD 1FC2D 5EC2A 5EBMB 5F3BB 1NBZA 4MVBD 2EH8H 3V6FB 4QHUB 4Y2DD 1YDPB 1FFNB 1DSFH 1GGCL 5FIEA 3SE4C 1FN4B 3CFBB 1NFDA 5DZLA 4JZOA 4ZFOB 3OSKA 4JFHD 3FKUS 3K4AA 2C9AA 2WNGA 4L8SA 1AY1L 2OMNA 5ISZB 4IRSA 2UY6A 1LK3L 1UVQA 1RJZB 3WFHB 4YX2H 4WW1B 4W6YB 3WNOA 4J8RA 5TPWH 3RWFB 5BS0D 4PRIA 1DDHB 4PJ7A 2NY5H 2A6KA 4H26A 1JPGB 3H7LA 4Y5VA 1BOGB 2R1YB 2WMPA 1UCTA 1T6WA 2ITDA 4IRJA 5MENB 3NH7H 4C59B 4JFPB 4YE4L 2DYPD 1FNAA 4PJBF 3UTOA 1PAMA 2AJVH 2DJ4A 4XI5D 1VGEH 4WI5A 3QZWA 3LS4L 1DVFC 2ZOKA 4LK4A 3VG0H 2X7LA 5F89A 5JXAH 3RGHA 3OZ9H 4HFWB 1AGCB 2BK8A 4B7IA 5C9JB 5IGXH 1U8QB 4RA0C 5ICXB 2LAAA 5HHQB 3KNBA 1I7RB 3PWNB 4R8WL 3K3QA 4KRLB 1VEOA 5F8QC 4DVRH 5GS0H 1I9JL 4NRXB 2AABH 2O5YH 3PL6A 3TZVA 1NKOA 4LU5H 4K9EL 5IVXF 4G6KL 3NIFF 3ULVC 4JE4B 3KR3H 3SDAD 5LKNA 1CZ8L 3L3GB 2UV3A 3T0BA 4LKCB 4I2XA 5ID0A 4KFZC 3S35H 2YPLA 2R69L 1HKLL 4CVZA 3FAXA 4XCNB 1XGRB 2HLAB 5T3ZL 5KVFH 4JFOB 4PJHA 2Q7NA 1FFOA 2W59A 3GSOA 3UPRA 5EU5B 3PDGA 2P5EA 3TJHC 4LEXH 3BI9X 5H35A 2CR3A 2EE2A 5EU6E 3U6RB 3MBEC 4FQ1H 1UADC 3BAEL 1CGYA 1P7KB 3HI5H 1QNZL 4H25B 4LARH 2CH8A 3EO1A 4ZD3H 4PREA 3H2WA 3TM6A 3CC5B 1OSPH 2AXFA 2CIIA 3EIFA 4UDUB 1DQQA 1F8TH 4MXQC 4U31A 2Z4QA 3KPNA 4J3XA 1JRHL 4X0KB 2HFTA 5D7KE 1WCBB 1LVEA 1N7MH 2R0ZH 3LKNA 4NWTL 4PJ5E 4JQVC 3LKSB 5JW4R 1BBJB 3IDYB 2DLGA 1A6ZA 2JJVA 4ZAKA 5IFJB 1BIIA 5T5NG 6CGTA 3CLEL 3JBG7 1UH3A 1VACA 3GSNH 3KYNA 4OCWL 12E8L 3GJFK 4QTHB 4PV8A 2CXKA 1P2CB 4K55A 3QDME 1IAMA 5C8JB 3DMMB 4ONFH 3ZKMD 2A6DB 1TZGL 1XEDA 4GRLB 4LGSB 3BXNA 2Y07L 3NN8A 2NY5C 4HK0B 3WKNA 5MEOB 1W0VA 3PHOB 4HULB 1ZHNB 1JHKH 3FT4A 4OM1L 4ELMB 4HIJB 1A1NA 5LCVH 5CIPB 1L9NA 5L2JB 1OAYL 5IESL 3BUYB 4OFKA 5DJZB 4HCRH 4EDXB 2YK1H 2BNRD 2FHCA 3QRGH 2IWGA 5ADPH 1ZANH 4IOFC 1ZLUH 4YHLL 2CRMA 3QXTA 1DBJL 2BSTA 5BMFL 3LSOA 1KB5L 4BSWA 4XVJH 1FYHB 4N90D 4OCRL 2OI9B 1S9WB 3S5LB 3QUKB 3LAFA 5I17B 2FX9L 3C08L 2DBJA 3S88L 3VFSA 2VN7A 3MLTB 1J8HB 5E2VH 2OTPA 1JYWA 5F9JB 1Q9WB 4HJ0D 4OZFB 4YHZL 1F4XH 4KDWA 3V5DA 5GS0C 5E6YA 1EEUA 5K33A 1I8LA 2E8YA 1BQLL 1JWMB 5GRVL 2DQUL 1AR2A 4LHUA 4WWKA 1LP9A 4R96A 4LVOC 2GUOA 4O4YL 4OLWH 2HLFC 4LLAA 1J0ZA 2JJTC 4UT9L 1NDGA 4PRIE 4PJ7E 5HYSB 2OR9L 4FG6C 1NMAL 5L0QB 2NXYC 2YHGA 1SM3H 3QCTH 3LQAH 4JFXA 3MV01 4K7PY 3WFCL 3PWPA 3U30C 1WV7T 3JWOH 1V7MH 2MCPH 2WW8A 2XPGA 3ZSTA 4EOWH 4UUJB 4WCYL 2CKBL 3GM0A 3HZKB 5DJXA 4AM0A 1FYTA 4PJ9C 3LVEA 1CLOL 3SOBL 3PWVA 4M9OA 3FOMA 3VRLF 5C2BL 3GNMH 2DQDL 4XBGA 4LSRH 3KYMB 2AV1B 1G6RB 2FB4H 4RFOL 3JV6A 4DKFH 5F9OH 5HHMD 2OK0H 4PFEA 4OFDA 1NGQL 4LRNL 1NCBH 4IS6B 2BSRB 2ZUWA 3ZLQC 5I30L 4QRRB 1I75A 2HN7A 3DVGA 4I2XE 5BVJA 4NRYB 3ME0A 1SYSA 1CG9B 2YPLE 1Z5LB 4PLJC 3MRGB 1K4DB 4JPKH 1FNEB 5L7XH 4XC1L 3CZJA 1IQDB 1FFQA 4ZFOL 4JKLA 3MRBB 5MHSD 4GG6F 1D5XB 4PJHE 5DJDB 1HQ4B 3MV7E 4NQVA 5L6YL 4M7ZB 3RA7L 4WHYG 3P9LA 1UXSB 1QR1B 1GPOH 2IQAA 2P5EE 2I9TB 1AR1D 1NGWA 1XH3A 2AK1L 3D9AL 3SE4A 2A9MH 5J6HB 1TTGA 5FF6A 3EKCA 1EO5A 1G9NL 2FWOB 3JWDL 1MAML 4WFHE 1EHNA 2HJLB 2ARJB 2IPTH 3DURA 2ICES 2PCPB 1M1SA 4RIRB 4ZXBD 2D7NA 1MFNA 5HY9B 3U4EB 3I85A 4TUJB 5E4EC 1CDYA 2A1WL 3WNLA 5I16A 3SBWC 3B6SB 5K9KA 4WO4B 3QEQE 3L95B 3I02B 1DVFA 1UFUA 3TNMA 5KANG 5BV7B 3CH8A 5DUML 4PLKC 4JRXA 1KCVL 2NZ9C 4K7PX 4Z7WB 3VFGL 4P46D 4F8TA 3NCMA 1TNNA 3HI6H 2FR4B 3BIKB 2BCKA 2GTWB 3MRPA 5M7QA 1MNUH 5D70L 1LGVA 1FG9C 1CYGA 3GI9H 3LQAC 3RIFF 3ZKXB 5FKAA 1YNLH 1JGLH 4JFQB 5D9SB 1R5VA 3T3MF 2O61A 4M7LL 5ECJE 1A3QA 3C5ZD 3JWOC 2PXYC 1U8PA 3QJFA 4XCFH 5EDXA 1OARH 3P0VL 1ZA6B 1U3ZA 5DDHA 4XCCH 1D9KC 2F74A 3EZ8A 2VLMD 3CJJA 2XKNB 1CGUA 4GW5A 3Q3GA 4RDQG 3QUMH 4G9FA 4M9PA 4X4ZA 2B20A 4HV8A 4HX1A 4JY6B 4MXWL 4R97B 5GZOC 3FT2A 2QR0A 2CXGA 4P3DB 5SWSB 5I15H 3PV6A 4U1LA 5I19H 3ULSB 3UJIL 4H8WH 3VFVA 1FG2B 4Y5XC 3MBEA 4LKXA 4MA8L 5KTEH 2NY3D 3RVVC 4JJ5B 4HZLA 1NBVH 3G04A 2XIDA 2OQJB 4AH2B 1WBZA 3PP3K 4OB5H 1ITBB 3D3VE 3P2TA 4LLWB 4HPYH 3SDDD 2HT4C 1J0YA 2BXYA 1XGUA 2VXSL 1X6NA 3PDOA 5JIIA 3QAZC 2AJYH 5E6ZA 4J3OC 4JQVA 3O4OB 2UUDH 5I2IB 5F1SA 2DAVA 4RZCA 3OHXA 3U46B 5KVEL 3B9KC 4FA8A 3BD5A 3QCVL 1QHOA 4HGMA 4GKZA 4OUUB 5GGVH 2NTSP 4JO2H 1J12A 5GJSH 1IGIH 3K8LA 1FYTE 1R3JB 1MFCL 4PG9B 4ZFZA 2CMRH 1EJOL 4G8EA 4K8RH 1I9RH 1DBMH 3IFOB 4X6BB 3GUTB 4ACPA 1ES0B 1OGTB 1RUQL 1MJ7L 2H9GA 1NMBH 4KQ4H 3L3IA 2O5XL 1KCLA 5D7LD 5TH2A 4YEEA 4KZEL 5EPMB 1HXYB 1J1XL 3DIFB 4E5XA 3TCXA 3DRTB 3X3FL 1RU9L 4YIQA 3VG9B 5GSVB 2PYFA 5C0BB 4NZRL 3VGGA 1IKFL 3MRRB 3WD5L 1FNHA 3FB8B 1K4CB 4R4BB 5L88L 3N9GL 5CHNA 3TT1L 1G7HA 3ZYJA 1QLFA 2GJJA 2VLRD 2MWCA 2YD1A 4WUKL 3ULUD 1A3RH 4A2LA 1Q0YH 2Q8AL 4POZD 4C56B 1CDHA 4P2QD 5D7IF 3BDXA 2V5RA 1I9IL 5ID1A 1IGFL 4L9LC 3VXUD 4JFFB 1AGEA 3K2UL 2A0LC 1O7VA 1U3HB 2HFGL 4PR5A 4WW2F 3WNKA 5JPNA 4OZ4B 2DQEH 4NQED 4UU9A 3VXQA 2W92A 2AXGB 2HFFB 5EULV 3OKMB 3WL9B 3T2QA 1KCKA 2JJTA 5C0CB 4MNHB 4PJIB 3SO3B 2H32B 3P0GB 3KPPA 1JYXA 4TRPL 5FUCC 5GGUA 3K74B 4I3RH 4X6EA 2VDLL 3I2CL 2FATL 4JDTH 4H8WC 2XY2A 5FO9B 5IHZB 4WTZA 5IMLB 4Z7UB 3QEGL 4XNXL 1G6RL 5F1KC 1H3WM 1L0YA 1NDMA 2DM7A 4MJIE 4GKNA 2NY2D 4ZTOH 4NN5C 3S36H 4JRXE 2I26N 3RAJH 1MJJA 3G5XB 2MJWA 3MV9D 4XVSH 4JFDE 2PTTB 1S9XA 2KKQA 4S1SH 1A7OL 1C7SA 5TE4L 1H3VA 3MZGB 5C7XL 3BKMH 1S5IH 2HKHL 5JHDD 3HE7D 4U3XA 3WN5C 5E6IB 1U8OB 1AXTH 1INDH 1J18A 2VIRB 3LMJH 4FXLA 3ULVE 2CLZA 5DMKA 3BP5A 4A6YH 5C71A 1B0WA 3W11D 1YEFL 4X5WB 2W0LA 5I66B 1X5KA 4E0RB 3GSNA 1EFQA 2EKSB 3HTLX 1QBLL 4M7LT 3T09A 3IKCA 3UDWC 3HC4H 1KJMB 4Y16B 4F8QA 4K8RC 1GH7A 4G9FE 4IDLA 4MVBC 3G6JB 1PX4A 3W0WA 1NCWH 5AYUH 2NY1B 4Y2DC 5EZLA 1N0XL 3MLWL 1G1CA 1OAXH 3D48R 1ZMYA 2BVQA 3B8SA 2E3VA 5IQ7H 3C6LC 1H8SA 4HCRA 4MHHG 3O6MH 1WTGT 1V3MA 1YMMB 1WF5A 3P9MA 2IADA 2CDFB 4R90L 5DJYA 1OM3H 4PRPE 3P3YA 4KHTL 4AZ8A 2I25N 2HAZA 4YDIL 1PG7H 2LTQB 3RVTC 4NYLA 3U4BL 3LRSA 4JKPL 5EC1A 4TNWF 4HUUB 3VFUB 3OF6D 2G9HB 5C0IA 1JZ6A 1IJ9A 4QXUH 1CXFA 2EEAA 5BV7L 4RGMC 2JCCB 4RGNB 4XI5C 3EOYG 3SBWA 1PSKH 2NY4B 3VXSA 1A1OB 4KC3B 4OT1H 5FUZL 1U92B 1FVEB 2K9UA 4L4VD 5JZ7D 4OZHB 3GMRB 4M6NH 1YC8A 3SE3C 5IG7A 5DTFB 4ZTPH 4F80A 4L3EA 4F37K 5LGHL 1JI1A 1RVFH 4PJCE 5CS7A 1KCSH 4Z6AT 2IAMD 1QFPA 4ETQB 3MO1B 3Q48A 3E6HB 1EAPB 3CXHK 1M6OB 1N6QH 2XZCL 2KDGA 3AGVA 2HVJB 4MHHI 2MPAH 3NCJH 3SE9H 2Q6WB 1RUKL 3AC0A 1A0QL 3QFJB 1IEBA 2PXYA 3AS0A 3OKDA 4FQ2L 3VCLB 3MRNB 3LKOB 4MDIB 5GRWA 1MCEA 1D9KA 3BFOA 3MLXH 4GQ9L 5CEZE 1D6EB 4KJYB 2NW3A 5HVFB 2VDQH 4F7MB 1H0DB 2Q20A 3G5ZB 3BP4A 1I8MA 2ZUXA 5MI0C 2CD0A 1QSFB 3B9DA 2EZ0C 4LCCB 4XWOD 4OAWB 4J3WA 2K7PA 4MSWA 1XZ0A 4U7KA 4L5FL 1RZFL 2DIBA 3BDYL 4Y5XA 3U2SB 4GAJL 3UJJL 4XAKE 4G6AD 1W0YT 3RWJB 4JY5L 5CJBA 4KHXL 4L4TA 3X13B 2BHYA 3PGDB 4KROD 4OF8A 2AV7A 2E6PA 5TE6H 1RJCA 3OKLB 2EYRA 1HHJA 2J4WH 1F6AB 2QEJA 1JWUA 3G5YB 4P59L 2W9DH 1Y6KR 3KXFB 1I4FB 2Z93B 3H0TA 3MZTA 2CR6A 2FYYA 1MQ8A 4OKVB 1AD9A 2WWKO 4G8IB 3KPLB 3ARSA 4I5BB 1C5DA 3B9KA 2EH7H 4HQQL 4PY8I 4Y4KD 4Q58C 4R7NA 1BJ1H 1A1MB 1JHLH 3RGVC 3V7AE 1I7ZA 3CSYB 2WANA 2D31B 1BJMA 1DBKH 1V7NH 4K71C 5T1KA 5LGKA 1DEDA 5J3HD 4BQBA 3WJLC 2WIMA 4OZIA 3MUY1 1JMXA 3UBXI 1CGTA 2GSGB 4PGCB 1VKXA 3VD3A 1ZVSA 1I3RB 1UWEL 4YBHA 1K2DB 3QG7H 5IW3A 5IMOA 4M6MH 1MCJA 4KWUA 4WEMB 4EQ2A 1FLRL 4QRQA 1KFAL 2FJGA 4PRHD 4MDJB 3UO1L 43CAA 4ZQKB 3RY4A 4WNQB 3JVGC 5I1KL 1AP2B 5IB5A 5E5RB 5K9QI 4CJ0A 1IAIM 1UEMA 4HJ0C 2FEEI 4XP4H 3S7GA 5H94A 3W0WE 5DT1H 4P3CH 4XP5H 3MRIA 3PGCB 4FP8L 4L8BA 4F57L 3IGAB 5CZXD 3CFEB 2J6EH 3DI3B 4NKQB 2NR6C 4L9LA 1U8LB 1DBAH 3KDMA 5C3TA 3TNNA 4MQTB 1ULVA 2VXUH 5ACLA 5AAMA 1OW0C 5INDB 3FQTB 5ISZA 5KZCD 1A6UH 3EJZC 4K23H 2ZOLB 1CLZL 1ZXQA 1R6VA 2BVUA 3NACL 4KQ3H 5D5MB 2GIYA 4K94H 3QUMA 3KPMB 3T8XA 4X9IA 5IFAH 5MENA 1SY6L 5B8CB 4U4BA 2QV2A 1CK0L 3PQYA 3R0NA 4KMQA 4B7LA 3WXWL 2UWEB 4XAWL 4BZ1L 3VXME 1J1PL 5T3ZD 4HT1H 4ZSOB 4ODSH 2YD4A 3KPRB 4J1UB 1Q8MA 2FX7L 3LKQB 4A2MA 3WXVL 1AO7A 2ICWI 5F9WB 4QRTA 4RGOH 3T4YB 4GMTH 4L3EE 4P48A 2BOCA 3JV0A 1BQHA 2XQYK 4XNQB 4OLEA 3KPSA 3RUGA 2A38A 4KPHL 4B41A 4LQ1A 4NRXA 4BH7B 2R56H 1G7PB 4U1GC 1G84A 3WN5A 4OGAD 4M1DH 3KLAA 3M17A 4O9HL 3ZYIA 4GRWB 1Q9LB 3QIUC 4LHJB 1BVKA 2X4TA 1CICC 1IAIL 3L5WA 1DQDL 4PG2C 4KK9C 2Y9RT 1GGYA 5CEXB 4M93B 5DC9B 2PTUA 5DFTA 3UDWA 2NX5D 4HIIB 5HI5D 4MJ6A 3FFCB 2VR4A 2APVA 1N6VA 5AG8A 2R39A 3RHWF 3GHEL 1YEEH 3MSPA 25C8L 1FVCB 1P7QD 2HFEB 5I18H 1ZAGA 4NO0B 3W5NA 3MRHA 3O11B 4Y2DA 4TNVK 4P5KB 3WIIH 35C8H 3B9AA 3SDXB 1ZA3A 1UACL 3IJHB 4M61A 4ONHA 1SJXA 5DWUH 3HE6D 5I8KL 1V3KA 4WI8A 1S7XA 4NM8H 1I8IA 5E00A 2YD5A 3C6LA 2C4FT 4POUB 5ILTL 2WUBH 1U3YA 2X1QA 4L4TE 3VE0B 5BS0A 4PV9B 2GITA 3QUYC 2VLKD 3E6FB 3INUL 5BZWB 4ZXBC 2V7HA 4LIQH 3IDJA 3O4LB 1CGXA 4LHQB 5IVZA 3U7YL 1EEYB 4U1IB 2X4NA 3ZYOA 3W2DL 3R8BB 3UAJD 2ATKB 3TGXA 4QCIB 1RZJL 4QEGA 5DO2D 1RZKH 4HK3J 3NABL 1OGAA 4MNQB 4PJFB 4PS4H 1F4WL 2VDNH 3ULUH 1TQBB 1HNGA 3VJ6B 4P46C 3SE3A 4PJXA 5HHNA 2UZXB 4YXLH 4D0CB 4OZIE 4QHMA 5JO5B 2IBZY 4JDZA 4ZUTB 2ORBH 2HYMA 4EXKA 4K94C 3LEXB 4GMSL 3ROOA 3C5ZC 4U0RB 2WBJB 3P40A 3WLBB 1OY3B 4YXKL 4Z5RB 3RWDA 4LSUL 2FSEB 4I8DA 4WGVB 5EO1A 1YUHB 3OAUH 5TJWK 3BWAA 3QXAA 5I1GL 4ODWB 1KLFA 1MLBB 3FQUB 4LSTL 4ZUSB 3IFNH 1YPZF 1YYML 4TUOB 5T5FH 5TQ2L 4J7RA 1I7TA 2BRRL 3K8MA 2O5ZH 4JHWL 2Z8RA 4ISVB 1X44A 4JPVH 4JN1H 5DURD 3HZVA 5F7EH 4MXVF 1NLDL 3EZJB 1K6QL 1JBJA 4DAGL 2APWA 1A2YA 4KKAC 4QOKD 3PJSA 3EO0A 4A6YA 1NFDF 2JKXA 2R1WA 2QHRL 3SDDC 4APQB 3BIBX 5E95B 2CK0H 1MQKH 2VDPL 2BMKB 2XI9A 4TULH 4YNYB 3O8XB 3DSFL 4NUJB 1KIPB 2J8OA 3EGSB 5I1CL 3TV3H 4KJWC 4DEPC 4WFFD 4NOBA 4PJ7F 1HH6A 1WEJH 3PQYE 4U2YA 1HINL 4AL8L 1AJ7L 2M1KA 1UB5B 1NAKH 3DV4A 3P0YH 3ZHLA 5SV4A 3P4OB 2VABB 4LLQA 1EX0A 1MRFH 3RGVA 5KSAB 4RFNB 4N5EC 4WGWB 2AGJH 3VRIA 1M71A 3RX7A 4LVHC 3THMH 2WWKT 2M8XA 3WJLA 5CEYA 1CDJA 3KGRA 1MOEA 2EDDA 2XICA 3MFFB 4XHQA 2BNUA 2I07A 4ODVL 3KPSE 2NLJA 3RUGE 3UTTD 3SE8H 3DBXA 3D6GA 4MQ7B 4OBSA 3H42L 2R29L 2BNRA 4O58H 4RCAA 1T0NB 5C0DA 1ZT4B 2XFXA 3WFEH 3CCHB 4NBXB 4Y88A 5HYQB 3U36A 3AB0B 3EJJX 1S7SB 4N0UB 4XHJD 3QQ4A 2PO6D 3JVGA 1BEYL 2IBZX 3C5JA 3VWJB 1CI5A 5IBTL 2LQRA 3ULUC 1A7QH 2P5WA 4MD0B 2GHWB 3FO0L 3QSKB 4XT1C 2CIKB 3OGOE 4JR9L 1H8NA 3ARTA 4OV6F 2AW2A 3NZ8A 4BKLA 4OCMC 1KC5H 2GTZA 4LCWB 5D8JH 2WIIB 3MRFA 4NFBA 1I85C 4UDTB 4IM8A 1B2WH 3QI9D 4JB9H 3S3JA 4XP1L 3NIDF 1BFVH 2DTML 4FFVD 5I1IH 3DO7A 5GRJL 3OX8B 2P8MB 1E6OH 5KSBF 3ARRA 2F5AH 3O3EA 5BS0E 1BHGA 3TBWA 5IVXB 3OPZH 4UNUA 4G8FB 2XXMB 4KGLA 1WBXA 3SDYH 2FLRT 3PNWA 4FQJH 5DA4A 5GISL 4YDJA 4TUJA 1KEGH 1B0GA 4I0PD 3FONB 5GIRA 2ZUUA 1TQCC 2E27L 4NQSA 3ARFB 1W8NA 3QHZH 1F02I 3CDGB 5DLML 2DQFA 5EO0B 1X5JA 4U3HA 1KSRA 1G0YR 2VC2H 2IJ0C 3RWCB 4XCEB 1FV1B 1B4JL 4TQEL 4ONGL 3MXVH 4YAQA 1BJ8A 2R2BB 4NJAH 3BIKA 1JL8A 3FB7A 1ETZB 3DX7A 5F21B 3C9NB 5FHAL 4CDGC 3LIZL 1DL7H 5TF1H 3IETA 5FOBA 2EE6A 3QIUA 4FZEL 3VXNB 3VXPB 1CICA 4XPBL 1ED3B 3C87A 4L29B 4PG2A 5JUEL 2OP4H 3FO9A 5L2KA 3WSQL 5ITBH 1JNNL 1JPST 2EXYC 5EIVA 5K9JL 2H6PA 3F7QA 1RFDL 1LWRA 4Q97A 4ETYA 4GRLD 1CLCA 5C6TH 1CFNA 1G7QA 2CRIA 1VADA 5TGBB 1MF2H 1I1RA 1A6WH 1P4LA 4UIMB 5SX4I 3VH8B 3QQNA 4U1JB 3QG6A 4KAQL 3D25B 1LO0L 3FO2A 1A22B 2E7MA 2P44B 1B6DA 4ELKA 5E2WL 3AAZB 5I75C 1LP9F 3QUYA 1AY1H 1UB6A 1RIVH 3SO5A 5K93A 4ZXBA 4LPXA 1K8DB 3RDTB 3BGFB 3HNVL 4PJDA 2XWTA 4CW1B 3LQMA 4OI8A 1LMKA 5DZOA 1YQ2A 2G5BB 3BP6A 1E28A 1TCRA 1CDCA 5JZ7C 3F7RA 3UZVB 2J6EA 4MD4A 1UQSA 1WFOA 3L6FA 1DQLL 1BQHG 4WU5B 1UM5L 5LAXA 5EFIA 1C16A 4P46A 2AEQL 3QIWC 1KT2A 3BPCB 4YHNA 4DK3A 3SY0A 1A7PH 1UWGH 5CJ8A 2BNRE 5KAQG 3C5ZA 3CK0L 2G2RA 4UAOC 5DJ8A 2EDOA 5DQDH 1MEXH 1NMCC 1YNTA 2C1PA 1ONQA 4K9EH 1MH5A 3HRZA 4NN7B 4GAFB 3X12A 3DIFA 4KJPC 4XX1G 5A16A 3DX8A 3REWB 2JF1A 5J1AA 4PBVC 2H26A 3UTZB 1LO5A 4R7DA 2P5WE 1YEHH 3RL1A 3UROR 4FQLL 4CVXA 3GHBL 4XMKL 3EYQD 1JGUL 2VLJD 1FO0B 4YK4C 5T3ZH 2RFXB 2DWDA 3TVMB 5JDSA 2VDKH 3IF1B 1DN0B 4OLZH 3IDNA 3EYUL 1A14L 1S3KH 2HRLA 2KZWA 4NGHL 1NCCL 1QFWM 4KROC 4QRRD 5I73C 4DGIH 2Y5TB 2X44D 4YDLC 4JRYD 3SDDA 1L7TL 1Y6MR 4X8JB 2CLRB 3FMGH 5A2KH 2DMCA 4LCUB 4DN3H 3RWHA 3QDGD 1SBSH 1CCZA 1BFSA 3HPJA 5IW1A 5EUKB 1YEIL 1T20A 1WZMA 1T1ZA 4J3VA 4D94A 3EOBB 3T65B 4AJ0A 4LNRB 2B2XL 4HFUH 2VR5A 1ORQA 5LWYH 3NZHL 5LG1A 5FYJL 3BKJL 4XPFH 4GG6B 1D5ZA 5J3HC 3VMOA 3CLEH 3GIVB 4C83B 1FFPB 2JE8A 2FZ3A 4U7MA 2X1XR 1MCNA 4NHCH 1ZTXL 3N85H 4O51B 3V6ZB 1G6VK 1BBDH 1JF6A 1RZIA 2GKIA 3HCVA 2OL3B 3MA7A 5D7LA 2MTPA 5ESQA 3QEHA 4LVNC 4EUPH 1KTRL 1FZJB 4LLDA 1KPUA 2JIXB 5J6GA 3UC0H 3ZKNC 2ZPKH 3RIAF 1CDBA 4OM1H 2DL2A 5K9OB 4Z7QF 4WENB 4JZNA 2DQCL 5IK3B 2OTWB 3V4PH 1OAYH 2RB8A 3IAQA 4HWEH 5I1HL 1WBYA 4OFVA 3S5LG 3VFTB 1BD2D 4W4OC 5D2LA 3LN5A 3ULVF 1F90L 2XXCB 2P24A 4BFIA 5DYOB 4OZFG 5L2KE 1GHFL 3DUUA 5BMFH 3ZDXE 5MHSE 1KB5H 1KPRB 2EDKA 2EXWD 2FBOJ 2YUVA 3G08A 3G6JA 3BYYA 5AUMB 2DLHA 2VERN 3GDBA 1NL0L 4QKXB 2VR9A 3CFKB 1XCQA 4Q9BA 3BRGC 1VERA 1I85A 3QXDB 1QFWL 3RU8H 2MNUA 2Q7YB 4JO1H 3TH2T 5T1LD 4B0MM 1BJ1J 1N5AA 1MWAH 3ZE0F 2H2SC 3F8UB 4NQEA 5HYSG 15C8L 4HD9A 5CWSB 1CFSA 5DD5H 1KLGB 2R4RL 3QDAA 1CFQA 3EFDH 4ZYKB 4XMPL 3VWKD 1EPFA 1MAKA 1KCRL 2BVYA 3MOAL 2FEDD 4PJDE 4UT9H 1CR9L 3NGBC 4JANB 3QIBD 3VMPA 2N4IA 1WIUA 2OJEA 4N8VB 4N5UA 3OAYK 5F7KC 5SX4H 4J12A 4HGWA 3FB5B 3QJHB 4OZHA 1PYWB 3HNSL 3N1FC 2N56A 3PWUB 5HHOB 2E6QA 5FA3B 3BKYL 4XPGH 4Y19A 3A6BL 3RWEB 4K3HA 5CSZA 5AZ2L 1HWHB 4WHTB 4N9GB 4OGAC 4BQ9A 1BWMA 4RRPA 2YUZA 3GJFH 2DBLL 2ERJC 1BFOB 4J3SA 5DD3L 5DRZA 2IF7A 3MNVB 4RISH 1TZHA 2Q86A 3BO8B 3QWOA 4IIQC 5J11C 2PTVA 5GRUL 5CGYC 3DXAB 3P30H 4UOW0 2J3SA 3S35X 3VCLA 3SQOH 4GBXC 1CXIA 4UV7H 1S7WB 1TETL 5TDPB 5I30H 2IH1B 2ZUTA 1YQVH 5GS2D 4P0DA 1IT9H 2GFBA 5F9AC 4ZUVB 5TE7L 1VA9A 4P5MB 3HAEB 3GRWH 2B7DT 3BHBA 4G6FB 5T3XL 4N9OB 1RZGA 3O3DA 1WZKA 1EH9A 4QNPE 3EUUA 3JTSA 1GIGL 4YHOL 1DQJA 3HE6C 4BQ8A 3HNTH 4LCCA 2BDNH 3KYOB 3VD7A 4ZNEA 4ZO9A 2WINB 1TMCB 2GT9B 2B5IB 4OD3H 1OAZL 1QQDB 1CT8A 1RULH 2QADB 1XF1A 4XRCB 1JPTH 3BQUB 3D9AH 4XPTL 3RX5A 3CXDH 5FCUL 5C0BD 3V5KB 1MUJB 3ARPA 1S7VB 3DTXA 3OF6A 5E8PB 2P47B 3PHQA 4LP5A 3D18A 3LN4A 2X09A 4C56D 1CU4H 2NQCA 4LBEB 5C0AA 1N8ZB 1BGXL 1ZLSH 2J88H 5I8CB 2HMID 3CH1B 4JFFD 5DO2C 3RY5A 3FO1A 1U3HD 4MCZB 1K5NA 1ADQL 4UIKH 5LBSL 3GI8H 1JFQL 4DZBB 1LO2H 3BESR 5C70A 2G60H 4FQIH 5CILL 1T03L 1IGTA 4KV5F 4YPJA 1AI1H 3AMKA 3QIWA 2CDEB 5C0CD 2EEBA 2ENYA 4UILH 1XGQA 4FQQB 1T83C 4WW2B 5TF0A 4LIQE 5D7LE 4QHKI 3RVUD 4WFGD 2VO5A 4NZUL 3ESUF 2IQ9L 3S37L 4RMWA 1LNUB 4NUGL 4J3TA 3LZFL 5HI3D 4YDVB 3SGJC 3MODH 4OD1H 3MMEB 5E7FA 1FO0L 4NP4H 5J0BA 2VLRE 3P0VH 4U1NB 5EZIL 1I1AB 1BQUA 1DCLA 3ULUE 4HIEA 5JPMA 2NPLX 2Y4SA 3CSPA 5DUBA 4ODHH 3GGWB 4Q9RH 2WWMD 3BE1L 1R3LB 4DUWA 3WS3A 3VXUE 4OUOA 2JELH 2ZUQB 3IDMA 2F58L 5E6ID 4LSVL 3TBVB 4D9LL 1BX2B 4MX7A 3SKNB 2AAVA 5J9PA 1IFHH 2VDRH 3E1F1 2R2EB 4NQEE 4G6JL 4QHNB 1LQSR 4KZDH 4KMTH 4XPAL 3TIEB 4HHAB 2W65A 4UV4H 4EBQL 1G7LB 4JHBA 2YA1A 1CVRA 4XGZB 4HUNB 1OWRM 1MRCL 5HVWA 3AY4C 4QF1B 4CUCA 4JZJC 3T77A 5B3JE 3Q6GL 5E2TH 5FB8B 1GOGA 3AS1A 1RZ7L 5IT2H 2UYLA 5HGBB 1T5WA 4YR6A 4AT6B 2UWEA 1XR8B 5KS9A 5F1NA 3GMMA 4OLUL 1VFAB 3DUSA 3D2UA 2DQTH 3RI5K 1YMMD 2OL3L 1EV2E 3QISA 4PY8J 3TO4C 1OLLA 1JF5A 4M00A 3BT2L 4QRSA 3E2HB 4QHLA 1ZHKB 2ED9A 4HXBL 4L3AA 1UZ8A 4PJAE 2A6IA 1KIQA 4HIHB 1NUDA 1JNLH 1OQOA 2DS4A 2D0GA 5C08D 5C0FA 2L7JA 1NFIB 1TVDA 3VFNA 5HHXH 1RUMH 2XTLA 5JNYB 3RX8A 1CFBA 5MEPA 3QO1A 3NMEA 4Z7VA 3BIAX 2D7PA 3NPSC 1T66C 3V4UL 4PRHA 5IB2A 4ORGA 2XZZA 3RFZC 2PO6C 1S78D 4CKVX 4JGMA 1RUPL 5JHLH 1CWVA 1ZEAH 3BPOB 4W4OA 3QPXH 3IDUA 5MEQB 3MXWL 4XXCC 2QKIA 4DFIA 2NXZD 1Y6NR 3NA9H 4MB5A 5FYLL 1OPGL 1CDGA 5L88H 5I74B 1JK8B 5CUSL 2HFEA 4NZTH 5EORH 1JHTB 4V1DB 4LF3B 3QI9C 1X4ZA 3OR7A 1QYGL 4YHKL 4YHML 2XZQH 4FFVC 2Y7QB 5EG6C 4ZNEE 5KVGH 5L8KB 4JHAH 4FXKA 2WUCL 3B83A 1GGTA 4FHBD 4S10A 5GGVY 3BJ91 1A7NH 3HUJB 5ERWA 2X05A 1IL1B 2A77L 2RR3A 3O2VL 3SDCC 3A6OA 5EZJB 5CSBA 5FHBL 3FTGA 3FN0L 2VDMH 1I3VA 5FDWA 2R8SL 2F54B 4GXVH 4I0PC 3DYPA 2J8UF 1HHIB 1G7IA 2OSLB 1UZ6E 1FIGL 3GKWL 5C0AE 2Y06L 3KPQA 2I9LB 4PJ8D 3PP3H 4FZ8H 1HSBB 3F6IA 1M7DA 4L4VE 3I2CH 4GUPB 5E1AA 5IR1A 1CGVA 4X4YB 1G0DA 2ZNWA 1N64L 1E27B 2BC4B 1AFVL 4FQHB 4HMDA 1DEEA 3VGHA 5A2JH 1J1OL 2EE9A 4LLVA 4NN6B 2XRAL 2CDGB 5L9DH 1CLYL 5BW7C 5F72S 2DLFH 3D0VB 3ECBB 3SCMB 5DRNA 1J05B 3ORJA 4FQXB 5F7HA 4RAVA 2PNDA 3QPQC 4NCC2 4HG4K 5CCKL 1FFRA 4HF5H 3S9DB 2ZCLH 4IIQA 2CGRL 3TFKC 3QRFM 1A6AB 3ARBB 1HEZB 1BZ7A 1ORSA 1OF2B 2W0FA 1XF3A 3CLFH 3HB3D 3BH9B 4NQCA 4GBXA 3EO9L 4U6VH 3L3DB 2HH0L 2ZCHH 3L7FA 4JPIA 4TVPL 4QT5A 3M07A 4Q9QH 1C5BL 1JUFB 2ZG2A 4S1RL 1U8JA 2NW2A 3NFSH 3RZCC 3L7EB 2BHZA 3EAKA 2N1KA 3QDHA 3GMLB 2AKRA 1QO3A 4G7YL 3HE6A 4EUPA 3VFWB 4YZFE 1WAAF 2XT1B 3HMXH 5B3NA 1Q94B 4JDVB 5T1DL 1PKOA 4Z76A 3EFFA 1R3HB 2A73B 2QSQA 5EO9B 3QQ3A 5DS8A 1ZLWK 1H3XA 1TPXB 3ZMRA 3DOSA 1NBYB 4XBEL 4GRMB 3PABA 5EUOA 2VSCA 2WLYA 3L3HB 1ZHLB 4L8CA 3VGAC 4P9ML 4XVTL 2RQ8A 3ZL4L 1ZVYA 4O00A 5DSCB 5EH1A 5HYEA 5KS9E 3BH8B 4M48L 4ZOBA 2I24N 4UQ3A 2ED8A 1IAII 3WFZA 5K59F 4NT6B 3I6KB 1MWAA 4BSVB 2HWZL 2FJHB 1WSST 4P2RA 1S9YB 4LASH 3H9SB 4WI3A 1O5DT 1OSZB 2IG2L 4M8QA 1XIWB 3UJTL 5AZEL 3FHQA 3FHAA 1T83A 3GSVB 4HXAH 4HKBB 1XF2B 5JR1H 2OR7A 3MLZH 1HI6A 4PRHE 1ZHBB 2QBWA 4NNYA 3SGJA 1A5FL 1UKSA 2ZCKH 3TBYB 1UJTA 1RUKH 1UA6L 2OZ4L 1UJ3B 4OLVL 2DD8H 2QQKL 3EYQC 3IJYB 4TSAH 5E94A 4C57C 5IMMA 1WFUA 3BX7C 3IFLL 1KBGL 2R2HA 4GQ9H 5JLZA 3ARGB 5KAQF 1UM6H 3LQZA 5KVMC 1FL3B 4AEEA 4UT6L 5D1QC 4HS8H 3GMQB 4OCYH 3PIQA 5HGHA 2IMNA 1BM3H 1TJGH 5J13B 3B2VH 4F33A 1UYWL 3U9PL 3GJFA 2YD3A 1TXKA 4Y4HD 1J0HA 1NCDL 4JREB 1KYOJ 1T1XB 3REVA 2AQ3A 2BFVL 2D7TL 3P4MA 3VFRA 2P46B 4MS8C 5D1ZC 3D39A 3TA3B 2APFA 5HDQL 1B90A 5DK3A 1A6VL 4D2NA 3HR6A 2DQHL 2ESVD 2Q8BL 3QCUL 4KHXH 3FFCD 4WJ5A 5HPMB 1TLKA 4JZJA 4NO0D 2YXFA 3GRWA 4RX4A 1YZZA 3H3PL 1U91B 4P59H 3IU3A 1QBMH 3LHPL 4JFYA 5T3ZE 5E70A 5GS2H 2IPKB 1WWWX 1IMHC 3CZFA 4OI9A 4R3SB 1F58L 5BXFB 4HQQH 4LPTA 1RUAH 3TO4A 1VESA 3IJSA 3S36X 2X70B 4EI5C 3MLVL 3O6KH 3UTPE 1IGYB 4MNGA 4ZFGL 7CGTA 5DI8A 1IZKA 3O4LD 3SQBA 4X98B 3UTTA 1WC7A 4PJXF 3MV11 3QNYB 1U58B 1ZLVK 4IJ3B 4H1LB 2PYEB 4KTEH 3RL2B 1I1FB 2VMFA 5FM5O 1FL5B 5EIQA 3VGEA 4D3CL 1NSNL 3D85D 5FA4B 1QPXA 1CE1H 2PO6A 3MTRA 5DJAB 1R24A 3GKZA 3A6CH 2UUDK 1WLHA 2I5YH 5FM5M 5DD1L 4NQCE 1YNKL 1KFAH 2EXWC 4XXCA 1JGVH 4QWWD 1MVUB 3PE9A 1ZGLP 4X7CC 4U3CA 2YWZA 4PJ5B 1ZV5A 1IM9A 1EBPA 2YKLL 2IAND 3HFMH 2HT2C 1GRWA 4GG8B 5FGSA 3QI9A 4JKKA 4U1SB 3BEWB 1N5YH 4I3SL 4GS7C 3NFNB 4Q6IB 3FB6B 5H37H 4JQIH 3HA0A 4D9QD 4LFHD 3U9UA 1NCTA 3QDMB 5EOQL 3VRJA 5E9DA 1MCOH 2VLKE 2W60A 4JQXC 3VWKC 4WV1C 1DTUA 3WNNA 4HUVB 2YD7A 4HZAA 3F7YA 1PG7X 5AAWA 2NY7L 4LAJH 3SDCA 5EUOE 5KVDL 4O2FA 4ALAL 2EDEA 5HJ3A 1AQDB 3QIBC 1AHWC 2W9EH 4M6AA 5HD8D 4I0KA 2Z35A 4DWHA 1SY6H 2DLTA 1KJ3H 5IF0A 4YUEL 4XMLH 5GHWH 3WXWH 2R2CA 2ADIA 2OJZL 5ENWB 4Y5YB 4PP2B 3TN0B 2R23A 4R9HA 2IBGA 2FJFA 5CLTA 1E0OB 1LDPH 2GSIA 1PZUB 5KN5A 3ARDB 3KPOA 4P2RE 4P23C 1DE4A 2PW2B 5DJ6A 4XBPB 3O8XD 5EC2B 4CBPA 1NBZB 4MAUH 2FHBA 4X9FA 4YWGH 2BJMH 4U1MA 1IVLA 5BW7A 4RA3A 1NFDB 4DKEL 4JZOB 4BFGA 4M7JL 4S1QH 3LPGA 1NGPL 4L8SB 4IOSD 2JK5A 4GW1A 4IRSB 3FN3A 2DQJL 3O2WL 5DQJA 1UVQB 2D7QA 4MMZC 5B39A 1DQMH 4NWUH 2V9TA 4J8RB 4LAQL 4PRIB 1F97A 2FNBA 4PJ7B 5F7FA 1GZPA 2A6KB 4H26B 4EDWL 3QB7C 4Y5VB 4HIXL 2ITDB 3LRGA 1JTPA 5CJOH 1AGFA 4ODTL 4HC1H 5F97E 5CZKA 4PJEA 3RZCA 1VPOH 4Z7OF 3TYGL 1PLGL 1T04A 4BH8A 3QZWB 2ZOKB 4FNLH 3LKRA 2P42B 2X7LB 5F89B 3ZTNH 5AWNL 3I9GH 3ZYZA 4Y8AA 5CGTA 3KNBB 3VWJD 1MHPH 3LH2H 4L4JA 2DICA 1AE6H 5KW9L 3LEVL 1GJIA 3GK8H 2R0WL 2VQ1A 3PL6B 3TZVB 2HMIC 3N0PB 3UYRL 2YPVH 5EN2A 4LSQL 1OTUD 2QQNL 3U7YH 2YR3A 3O6FC 1A9BA 1FNLA 1FDLH 1T4KA 3OKOA 4MD5A 4I2XB 2VQTA 5ID0B 1XCTA 2XZAL 4LDOB 4PY7B 2YPLB 4CVZB 1RIHH 2OXGA 1RZJH 2X4QA 1PFCA 1X4YA 2V5TA 3NABH 2MQ0A 1INQA 5E03A 1F4WH 1KIRA 4PJHB 3K4ZA 4MNGE 1FFOB 3RVUC 5I1EL 3GSOB 3UPRB 3D69A 3MYZA 2H45A 1QZ1A 3UTTE 1LO3H 4LFHG 2P5EB 5CD3A 5H35B 3P77A 1KN4L 1MY7A 5FV1L 4IHOA 4KK5D 1NC2D 4OGXH 2UZIH 3B3IA 3EO1B 5DQ9A 3VFTA 4PREB 1U6AH 1GAFL 1X5LA 2AXFB 2CIIB 3MUZ1 1DQQB 4ZUWA 1MFDL 4HMCA 3RJQB 5D7SH 4KTDL 2Z4QB 3KPNB 3MR9A 4TVSa 2VLJA 3L1OH 3CFJA 3LKNB 3V52H 1A3LH 1UCBH 5TDNA 1FBIL 2X9WA 1PJ9A 4BFBD 3L9RA 1A6ZB 5D1QA 3PDDA 3BGMA 5C3LD 4M1GH 4YDKL 4ZAKB 1BIIB 4I18C 5E8EA 3IS1X 4Q0XH 3BN3B 1VACB 4E42A 3KYNB 1PEWA 4K3JL 4PGEA 4PV8B 4JRYA 5D1ZA 2V17L 4LSPH 4PB9L 4MA7H 3BMVA 4N1EA 2BY3A 3QDGA 1OP5H 3C2AL 4DQOL 3BXNB 3NN8B 4X5XA 1W0VB 3C5SA 1GC1H 1RHFA 3OTTA 2F53A 5CINH 1A1NB 3STLA 1EA9C 3QDJA 1FRGL 3W9EA 4D9RD 3P11H 3DV6A 4PJDF 4PGDA 4GOSA 1LD9A 4NJ9L 1U36A 4R4NC 1YY8A 3L5XH 5T3XD 2Z8WC 2BSTB 3LSOB 3HMXA 4BSWB 4KK6D 5C0RL 4QXGL 1CDIA 4X80L 1LEIA 4EI5A 2BSED 3VFSB 5J8OA 4EZMA 3RDTD 1B88A 3WFDL 1N6UA 4C55A 5F8RC 4JVWA 3V5DB 5FO8A 6FABH 5GSRA 1EMTH 1G7JA 3CDCA 2E9BA 2AEPL 4LHUB 4WWKB 1LP9B 2KQNA 4R96B 2GJ6A 2GUOB 1OLZA 3GO1H 2R0KH 1FGNL 4Q74A 1JN6A 3HZMA 2NXZC 1KCUH 4TSBL 1NDGB 5IQ9A 2X4OB 3ZHKA 2PW1A 1RIUH 1MJ8L 4Y1AD 1IM3A 4JFXB 3WLWD 1BVLA 5I1JH 4JPWH 4JO4L 2VKWA 2LAGB 3MUGA 4PJEE 3PWPB 3FQXA 5FV2A 3BPLB 5FGBC 5T1LA 2XPGB 1IC5H 4R2GC 3ARQA 4XC3L 5DJXB 4AM0B 1FYTB 3HS0A 4IDJL 4J2XA 3PWVB 4P2CG 3EW3B 3S3PA 4M62H 1K8IA 3VWKA 2DTMH 1URLA 5EBLA 4WV1A 3QFDA 1C5CH 2GY5A 1ZT1A 4XBGB 4PRDA 3JV6B 3O0RL 4HWZA 3CD4A 4UB0L 3QIBA 5L8LB 1AHWA 5GGQL 4PJ8C 1SBBA 3GEWB 1VDGA 2A2QT 2DM4A 2DKUA 5GISH 4YXHH 4AEIL 2QSCH 4KI5F 1ZSDA 2HN7B 3TPKA 3DVGB 5BVJB 3NTCH 2FX8H 1NC4D 3A67L 3MGTA 5F1OB 4FMKA 3BD4A 1RHHA 2J5LB 3UTSD 3F6LA 1C12A 4P23A 3HMWH 4Z7UF 2VXQL 4NQVB 1K3IA 1P6FA 4OLYL 4GRWH 3P9LB 1GC1C 1GOFA 1X7QB 2IQAB 4ONGH 3UEZA 1KJVB 1NGWB 1XH3B 1S7QA 3TBTA 1ACYH 5FF6B 1F6FB 4WRLA 3HB3C 5TFSH 4LMQI 3GJEA 3MJ6A 3N1QC 4J4PD 1T3FA 1X5YA 3X11A 3DURB 5D71H 1YEKL 4U1HA 5C6WH 1V5JA 3U48A 5JUEH 3T0DA 1BFTA 5D2LF 2D0FA 2VLJE 3VH8G 4NFDA 3GGWA 5K9JH 1DFBH 4ZS6D 1JGDA 1O0VA 4Z77A 5I16B 4K3DH 1P4IH 5K9KB 4HWBH 4NO5A 3DYMA 4N0YH 3G6JF 4JFEA 5FM8A 4JO3H 4NHUA 1DVFB 3PGFL 2ITCA 3TNMB 1REIA 1VEMA 3D87B 4QRRE 1KEML 3EYFA 5CBAA 1QBBA 2A6JA 4G6MH 4JRYE 1KXQE 4U33A 4JRXB 5C07D 4JFDB 4XZUA 3ZE2E 3QDGE 3HN3A 1Z9SA 2BCKB 3MRPB 3J7HA 2F53E 3G6DL 1YN7A 3QDJE 5FKAB 2B8OT 4KVCL 1R5VB 4HAFA 5ALCH 2O61B 3TPUA 5B3JF 3X14A 4FFWD 1U8PB 3O6FA 3QJFB 1O7SA 3VXRD 5DDHB 2VAAA 2JCCF 2F74B 2HTLD 2KPNA 4GW5B 3FQNA 3Q3GB 4G9FB 3WUZA 2FO1A 4IRZL 4HV8B 4HX1B 5GQBA 3FT2B 4OZHF 2QR0B 1W72H 1CIDA 3PV6B 4U1LB 3BZFA 2UY7A 3ZE1F 3P73A 4PB0H 4IMKC 3VFVB 2WBWB 5C1MB 4OM0H 3MBEB 4LKXB 4QHKJ 1SEBA 4F7CA 1CL7L 5C0NC 1BD2E 4HEPG 4HZLB 1EFXA 3G04B 4XCYA 1WBZB 2L0DA 4EIZC 3HC3L 3OG6B 5CSGA 5HHOD 1E4JA 3R06A 4Z8FL 4G8GA 1OWWA 1XGUB 3PDOB 1Y18B 3E8UL 4P4KC 4GKSA 2E7BA 4ODBD 1Z3GL 1AKJA 4NQDD 1VSCA 3OHXB 3V0WH 2HG5A 4Y4HC 1EJ6A 4OLXL 5JW3H 4I18A 2P45B 3WEXA 4GKZB 1RURH 2XQBH 1JPFB 3MRLA 5DEZA 1INEL 5DR5L 4F58H 4LQFH 3O81A 1RSFA 3F7PC 1T1YA 4ZFZB 4G8EB 5F1IB 3VFPA 4AENA 1NLBH 3OKNA 4WDIA 2ZSVA 3OMZA 4YLQT 5D6CA 4F9PC 3LEYH 1QRNA 3MJ8A 3HUJA 4FFZL 2GI7A 2RCSL 4FTVD 1RJLA 4MQSB 4OGZA 3KJ4C 1KULA 2H9GB 3L3IB 1SYVA 5FCSH 5TH2B 2B0SH 5AD0A 4W68A 4HC1A 2HT3C 3I6LD 1YEJH 1WWBX 1WFNA 3R1GL 3V95A 1RD6A 4E5XB 4H88H 4OSUL 4YIQB 2PYFB 5BRZA 5BJTA 1N4XL 1MPAL 1A6TA 1XGYH 2CO7B 5CHNB 1G7HB 1QLFB 5C08A 3MJ7A 3AU1A 4KDTC 1CQYA 4OTXH 3MLYH 4XP6L 1A4KA 5FYKU 5ID1B 2DQGL 1JP5A 1NEZA 4NIKB 1AGEB 3WDIA 3RKDD 3V6BR 4FQXA 4PR5B 3DUHA 1MFEL 4LVOB 5CKAA 4ZOAA 3SKUD 4IMLA 4JM2C 4ONOA 4UU9B 3VXQB 3T2NH 3MRCA 4QWWC 1OT2A 2MMXA 3X3GH 4LDLB 1FNGA 1HZHL 3W9DA 3OB8A 3JXAA 3FRPA 3KPPB 2NXYB 4KUZL 5EA0L 1CBVL 3CMOL 4X6CA 4Z95L 5GGUB 1F3JA 4X6EB 4ZPVA 1FAIL 3U30B 4GW4A 3I6GA 5FGBA 1H9VA 4Y89A 3G6AA 1WCQA 5ESVA 4G42A 1NDMB 1MFAH 4D0DA 1ZT7A 3V4VL 4GKNB 4PJ9B 1A7RL 1MJJB 1EVUA 4QXTA 1MCPL 1S9XB 5DRXA 5LJYH 1FVDA 2VDOH 2Z92A 4B5EA 5E56A 5HYJA 1IBGL 3QEUA 4XNZC 2D9CA 3RTQC 4N8VG 1FJ1A 3IDXH 4WEUD 5IVOA 2NY0C 4DGVH 3QP3A 3MOAH 4OI7A 4PJ8A 1MIEH 2NY6D 5D5MF 5GGTH 3T2PA 5DMKB 3BP5B 4Q6YA 3VW3L 1LK2A 4AEFA 1VEPA 3RNQA 4U6YA 1KG0A 3GSNB 2UWEF 3PP4L 4OD2A 3IKCB 3I6KA 4BSVA 3CXHJ 2AJUL 4OCXH 3E3QE 1LHZA 3W0WB 5A1AA 5EZLB 4WFGE 1AH1A 4NOFA 2YBRA 5DMIL 1AIFA 2BVQB 4YBQD 4K3EL 2Y36H 2FGZA 2HRPL 1HN1A 4TYUA 5CBEA 4G3YH 1RMFL 1JGEA 3LDBC 3HAEG 3P9MB 3F5WA 2IADB 1OB1A 4Z7VF 3BGAA 4UINL 5DJYB 5CJ5A 2ZJSL 3WV0A 3QWQB 4NYLB 3LRSB 3M8OL 5EC1B 3DECA 3O9WD 1YECH 1IGML 3HG1A 5C0IB 5BVPL 1CGSH 1SQ2N 5FYKH 5E4EB 2DIAA 4XVUD 4HBCL 5T3XH 1QEWA 5DHVH 3VXSB 1Q0XH 3HZYA 3QHTC 1GIGH 4Y4FD 2ADGA 3BW9B 1CD9B 3GSXA 3V5HA 4K2UL 3SDXF 1QFHA 5IG7B 1OAZH 4WUUD 3TA3A 1J10A 4JLRA 4L3EB 3FJTA 3ULVL 4I77H 5DUPH 1QRNE 2V7NA 3PWLB 1QR4A 3VA6A 3VMNA 2YMXH 1OTUC 4WI4A 3EOTH 4DK6A 4XWGH 2CRZA 1KELL 4E41D 2C7UA 1IEBB 2PXYB 1WZ1L 3MA9L 3OKDB 4M43L 4AIOA 4HPOH 1MJUL 1D9KB 2YOCA 4X7SL 3KYKH 1OVZA 2NW3B 5C08E 4NKIL 3ZDZE 3DVFA 1TJIL 3BP4B 4NQUA 1I8MB 1ZGLM 3OAYH 1T03H 4X98A 1F45A 4KK5C 5I8OH 5IBUB 1DUZA 4MSWB 4IMKA 1XZ0B 2CUIA 4N0RA 5EU6A 1I3GL 5A2LH 3G5VA 4Y5XB 3M1BA 5JMRA 4L4TB 1AXSB 4U05A 2AV7B 2EH8L 5C0GA 4MA1C 4F3FA 1DSFL 1HHJB 1AD0A 1OP3K 3ES6A 1JWUB 3EYSL 5IBLC 3QAZB 5GGSA 1J11A 4P4KA 4X6CE 3NIGF 1QP1A 3H0TB 1L4IA 2FYYB 5C09D 1AD9B 3V6OC 2ICEA 1C5DB 4Y4HA 3B9KB 4YX2L 3IFPA 2WM0A 1BWWA 1I7ZB 2NY5L 4KKLD 2VRAA 4MA3A 4JFZH 5EU4A 2NTFA 4XNYH 2VL5A 5T1KB 2ESVA 3V0VA 3NH7L 2EC9T 4OZIB 4RMUA 4G6JH 1LE5A 3L3JA 4RAUA 4F9PA 1VKXB 1ZVSB 2Y23A 2AJVL 1S7UA 5HYJE 2AK4D 1VGEL 1EXUA 4PBWD 5DJ2A 5IMOB 4Y7MA 1TDQA 3VG0L 2BVTA 5JXAL 3GSQA 3OZ9L 4X6DA 5DVMA 5IGXL 4XXDA 4HWBA 4QRQB 2FJGB 1QSVA 1NCNA 3U4AA 3DSNA 1WWAX 3ALWA 3H3KA 2AEIT 5IB5B 4DVRL 5GS0L 1D5BA 2AABL 4QGTA 1YEGH 2CK2A 4LU5L 5BQ7A 1IC4H 5ESAA 4KDTA 1K3ZA 3T0VA 1EZVY 5J12C 3KR3L 5H94B 1GSMA 3MRIB 4L8BB 1NGXA 2VH5H 4L9LB 3S35L 3D85A 1IQWL 3KDMB 1YYLH 3PXJA 3WHE0 2VYRE 2NCMA 3TNNB 4OIIH 4CL7A 4YHIA 4JM2A 3T0EC 1L7IH 5HI4D 4PUBL 2NYYC 4J6RH 3QUMB 2IANA 1XIWD 3T8XB 4FQ1L 3HG1E 2HJFA 3WIHH 4LPCA 4MB3A 3PQYB 1OAKH 3HI5L 1W72A 3MBXL 4UTAH 1CXEA 5ITFA 4ZD3L 4RWHA 1OSPL 4PGJA 1F8TL 2Z91A 3EHBD 1EO8H 3MRJA 1XF4A 3Q6FA 5CEZH 3GBLA 3TP4A 5B4MD 1AO7B 2B39A 4QRTB 1N7ML 2R0ZL 1HIMH 4NN5B 2X1WL 3HI1A 2BOCB 4O02H 4XNMA 4P5TC 3OXRA 1BQHB 4KRPD 3KPSB 3RUGB 3RTQA 1U8KA 3O2VH 3GSNL 2Z8VC 1KXTB 3WN5B 1T2QH 3KLAB 3KLHD 3M17B 1BVKB 1BP3B 1FP5A 5B38B 4KVNH 4ONFL 2X4TB 3L5WB 5E8NA 1JIBA 4KK8D 4KXZI 3U1SH 1J7VR 1NANH 3TYFA 3CX2A 4PY7A 4NQXA 4NPYA 1IEHA 1JHKL 5LCVL 2EKJA 4MJ6B 2GQHA 3IXAB 2X9XA 3BN9D 2A83A 4HCRL 5GRVK 2YK1L 3MV7A 3QRGL 3MRHB 2I60H 1IRAY 4Y2DB 5ADPL 1ZANL 1CE6A 2ADFH 3VGBA 1J1OH 5CP7B 5F7YC 1ZA3B 4M61B 4ONHB 3IVKA 1C7TA 2XRAH 4JG0H 4XVJL 1DLFH 1S7XB 4ZSOE 1I8IB 3LPFA 3C6LB 4KUCF 5E00B 2VXVL 3FCTA 1PW3A 3R4DA 1KJ2H 5E5MA 3MYJA 5BS0B 3CFCH 5F6HI 2GITB 2RHEA 5E2VL 5BOPA 2OS7A 1EZVX 1HE7A 4R26H 5DJ0A 2V7HB 1F4XL 2X2YA 1C08A 5F88A 3IDJB 4M5YH 1H3UA 2DYPB 5IVZB 2HH0H 4R0LC 2DMBA 2X4NB 4RGMB 2YUXA 2EDTA 4OLWL 2RIKA 2PYED 5D7JC 2RBLA 4GRWE 3QEQA 4LOUD 4HUWA 4X83A 1OGAB 2FBJH 5IP4A 4TPRH 1SM3L 1Z9OA 3LQAL 1DUYA 4FQPA 4PJXB 5HHNB 2ESVE 4N8CL 4EVNA 4PJBA 4QHMB 4JDZB 5D7KD 3JWOL 1V7ML 2MCPL 2D2OA 4G5ZH 4KKCC 4JM4H 4EOWL 2A9NH 3ROOB 5HXMA 2VUYA 1A7BA 4EI6A 3F7VA 4X6DE 1CIUA 2Z31D 3Q1SH 4XVTH 2HTLC 1G9EA 5C0EA 3GNML 4WI2A 3RWDB 1MREH 4X6FA 2D7OA 5IW6A 4LSRL 5EO1B 5JQ6H 2FB4L 4DKFL 4LLUA 5EOTA 3RWIA 3BWAB 3QXAB 1CTOA 4QRPD 2VL4A 5F9OL 1NGZA 2OK0L 1I7TB 1CFTA 4U6XA 2IH3A 3S3SA 1ZVHA 3KWWA 5MI0B 2EYTA 5D96C 1IC7H 1FE8H 3HZVB 3UPCA 1NC2A 3KLDA 1GZQA 43C9A 1A2YB 4JPKL 5L7XL 3K7UA 3PJSB 3EO0B 3QBTB 5GGTA 4OCNC 4A6YB 2R1WB 1ODAA 3DETD 1CXKA 3N1MC 3TN0D 3D3VA 4HLZG 3ARDD 3GB7A 2X4OA 3FFDA 1GPOL 5JTWA 1ZE3C 2A9ML 2IANE 3DX6A 3P9WB 3OAZK 1HH6B 1X9QA 2AS5M 4Z78A 2H1PH 3HPLA 4G9DA 3DGCR 4ZUUA 3DV4B 3B5GA 1U95A 4D9QE 2FL5A 4LLQB 4PJEF 4OF3A 2IPTL 3RGVB 1NCAL 3RJDA 4IRSD 3VRIB 1M71B 5SWZD 3CGTA 4K71B 5HDBE 3DGGA 2KUTA 1I8KA 4PRID 4MGXA 4MAYC 5CEYB 5DA0B 4YHYC 2BNUB 5IFHH 2I07B 2YXMA 4FXGA 1PY4A 1QUNA 4IRJD 2NLJB 2Q8BH 2C3XA 1N3NA 3DBXB 2DRUA 2BNRB 1HQRA 4FMFA 4KDVA 4W6WB 5C0DB 2XFXB 2DLEA 3U7WL 5DHVA 1ZLWH 3U36B 3QQ4B 4BK4A 4DOHB 2CO6B 3MCKA 1MCDA 2OLDA 3C5JB 1CQKA 2YWYA 3HI6L 2P5WB 1MNUL 4G80A 2BVPA 5F7MC 1FH5H 3GI9L 1YNLL 1JGLL 4H1LG 5DEGA 1U0QA 3NZ8B 4BKLB 3T4AA 1WICA 4AMKH 3HHRB 3OR6A 2GTZB 3PL6D 1F4YH 3TZVD 3MRFB 1XFPA 4EN3C 1OARL 1RJYA 1SJEA 1X7QA 4XCCL 3DLQR 1KJVA 5DZNA 5DRWA 2K7QA 3MRKA 3DO7B 1E4KC 1MIML 3QUML 4W4NA 4TSCH 2UVEA 3CVHH 3O3AA 3L5HA 5KOMC 3O3EB 2YPLD 2MHAA 3DVNA 3T0EA 5I15L 3TBWB 4EKXA 2CSPA 5I19L 4KXZH 3SHSA 4Y1AA 1WBXB 4H8WL 3U0TA 1SVCP 3DX9A 4HH8A 3PNWB 5MP6H 4OQTH 5KTEL 4KKNA 2IFFH 4YDJB 3KG5A 3OJDA 1B0GB 1A02N 5GIRB 3Q5YA 4NNXA 4M3KB 3I50H 4NQSB 1T7VA 2P5ED 1Z9MA 3MCG1 1KB9J 1KTKE 4ZFFA 5EZOH 4OB5L 5HHPA 2SEBA 4FABH 4HPYL 2DJSA 2DQFB 4MJIA 1JZ4A 5F7UA 1EGJH 2AJYL 4NO3A 3RVWD 4GSDH 4JFDA 4PJBE 5IMKA 4P5TA 2V9RA 4YAQB 3X17A 5ADOH 3WUWA 2L7UA 1QKZH 3FB7B 5GGVL 2NY6C 3ZE2F 4JO2L 5GJSL 1X5FA 2P48B 3DX7B 4U1GB 1IGIL 1YEDA 4JAMA 4U1KA 4ZAKD 3IETB 1T22A 4I4WA 2CMRL 3VXOA 5FOBB 4K8RL 3QIUB 2XWBA 1I9RL 1FC1A 3WDHA 1X5ZA 1DBML 2FCBA 1J88A 3GBNH 1CICB 1MRDH 3RVXD 3FO9B 5L2KB 4YUEH 4PD4J 3UTSA 4W81A 1NMBL 3FL7A 1E4WH 4KQ4L 2H6PB 5ANMA 5EBWA 4LMQE 3EYVA 1CFNB 1G7QB 1VADB 4NNPH 1GL4B 3PUCA 1FNSH 2RAMA 4BUHA 2Y1VA 2R4SH 1P4LB 4HS3A 4MJ5A 4YBQC 2X4SA 3VFMA 4HDIA 3QG6B 4WY7H 4HEME 3FO2B 4UTBH 3H3BC 5E99H 2P7TB 4M6OH 5KANI 2ENSA 3SGDI 1B0RA 2F8VA 4Q7DA 4MJ4A 1LE9A 1A3RL 4ELKB 1Q0YL 1P1ZA 2YD6A 1GXEA 3QUYB 4PRPA 1UB6B 1DANU 3O9WC 4ZXBB 2DQJH 1ZLVH 5M95B 4M1CD 3F12A 4LEOA 5I71C 4PJDB 2XWTB 5I76A 4JCLA 1Y18A 3QZWG 2DQEL 4R0LA 5CJQH 3BP6B 4UQ2A 1E28B 4Y4FC 1TCRB 3V6OE 5D7JA 1HHKA 4HUKB 4LHUD 4WWKD 2HVKA 4RBPK 4MD4B 1UQSB 3SGEI 1T0MA 3L6FB 1JPFA 3LN9A 1EHXA 2WZPD 5C07A 1VGKA 5LAXB 5GJTH 5EFIB 2ZKHH 3MLUH 1C16B 4P46B 5F1IA 1QG3A 4J3UA 3MFGB 1HYSD 1KT2B 4I3RL 4PJCA 4Z18A 4IOIA 3QA3B 4JDTL 4YHNB 2IFGA 3SY0B 4Z9KB 1XT5A 1KTDA 4WU7A 1HXMB 3C5ZB 3PWPD 3WIHA 4ZMAT 2G2RB 4U49A 5DJ8B 3QUZC 4CN1A 1NKRA 5FYKE 4ZTOL 1MCBA 1YNTB 1ONQB 2C1PB 1MH5B 3VXRA 3HRZB 4RWYH 3S36L 3X12B 5T3XE 3RAJL 4XVSL 3TIDA 4FQCH 5A16B 3DX8B 4S1SL 1FYTD 5ALBH 5J1AB 2H26B 1LO5B 3ARZA 3BKML 4R7DB 1S5IL 1B4RA 1FPTH 4QYOA 5BCAA 2X4RA 3RL1B 1BF2A 5CZVH 4CVXB 1AXTL 1INDL 3LMJL 4CNIA 3MV8D 4A6YL 1ZWIA 2DWDB 5IHUH 5JDSB 1UH4A 5DHYA 5KG9A 1ZGLA 1QSEA 4X99B 3IDNB 4YQXH 4X7TB 1BLNA 2DL9A 3HC4L 1I3UA 2FECI 5T1MA 3STZB 3NOIA 1OP9A 3BP7A 3FN9A 4LDEB 2FO4A 1DLHA 3ZTJG 3SDDB 1ZS8A 1NCWL 5AYUL 7FABH 1BIHA 2C1OA 3T0EE 3TESA 4Y1AE 4NKMA 1OAXL 3RWHB 5FKPB 3HPJB 1R5IA 2R1XA 3EOAA 4DEPB 5IW1B 5IQ7L 3EDKA 4NQDA 1T20B 3O6ML 1T1ZB 2YEZA 2YZ8A 1RZ8B 4W70A 3Q0HA 4XTRC 1OM3L 4U6TA 2V5MA 2F8XC 3MREA 1ORQB 4FRWA 3BPNC 3CUPA 4YDKH 1PG7L 5LXGL 1FGVH 1D5ZB 4Z0BL 1TVHA 4PJ9A 3AREC 1KJ2A 2FZ3B 4LVHB 2OX5A 4QXUL 2EE3A 1FZMA 1I7UA 1FORH 4MAYA 4P99A 3CVIH 3IU4H 2MFNA 1PSKL 4XPHH 1RZIB 2ARWA 3HCVB 3MA7B 5D7LB 5ESQB 2F19H 3QEHB 5DD0H 4OT1L 5CD5D 4XP9H 2WAHA 4LLDB 1KPUB 5J6GB 4L8DA 1ZOXA 4M6NL 1GYAA 4JZNB 3GMPA 1QLEH 1WBYB 2LE9A 3MNWA 3U0WH 1DVFD 1RVFL 3LRHA 4LCIH 5D2LB 3LN5B 4H20H 1NQBA 5I1AA 1KCSL 2P24B 4BFIB 3UTSE 4MWFA 3DUUB 4H0GA 2ZNXA 3F58H 2CJUL 1N6QL 5IIEB 2NZIA 1CD1A 5ANME 4LHUG 3G08B 2MPAL 3CFDA 3NCJL 3SE9L 1F11A 4YFLF 4L1DA 3VXUB 1XCQB 5IVNA 4EN3A 1RY7B 4WHYH 3ULVD 3MLXL 2PF6A 8CGTA 1N5AB 2QQLL 1E4KA 4NQEB 5T33H 5LQBH 4PGBA 4EQ3A 2VDQL 2HJKA 2XWJA 3CPLA 1CFSB 3SJVD 5D7IA 1TFHA 1CFQB 4ODUA 2A74A 3HC0A 3SEPA 1HSAA 3PF2A 4NM4H 2BVOA 5HYIA 3S34H 2DDQH 1TQCB 2OJEB 3VXMA 3FOLA 4GQPH 2C3HA 1T7ZA 1F4AA 3MBED 4HUMB 5TE6L 4HGWB 4OF5A 2VUOA 4F7PA 3JTTA 3H9HA 3BW9A 5D1XD 4KY1H 2V2TA 5C07E 1UM4L 2OM5A 1TJHH 1Q9OA 4O2CA 2W9DL 1GGBH 4KRPC 4Y19B 4MXQD 3NVQA 3V2AR 4Q2ZB 5CSZB 3PWLA 2D3VA 3I3EA 2EH7L 4YFDB 5DEFA 5E8OA 4F9LC 3KLHC 3CDFA 1JHLL 1WITA 3HUJF 3O2DH 5F96H 5DRZB 3SDAC 1JZ7A 2XTJD 1AGDA 1CGWA 1DBKL 1TZHB 1V7NL 3QWOB 2Q86B 4CMMA 4TUKH 1BZQK 4G7VH 4BUGA 3VXRE 1I1CA 2GCYA 1Z6JT 2ZUVA 3SGEH 4KGJA 3GMOA 3IYLW 4DN4H 3BN9C 1CFVH 2GFBB 3QG7L 1T21A 1T5XB 3B9VA 3P4NA 1XF5A 2GK0B 3BHBB 4M6ML 2P4AB 1RZGB 3O3DB 4JVPA 4LCYA 4P2OD 4BELD 3JTSB 1DQJB 1Q72H 1IAOA 1MCCA 2YD2A 1QSEE 1CT8B 3QHFH 4AG4H 4C4KO 5EIIA 2AVGA 2XA8H 1AXSA 5I75B 4XP4L 2AJXL 5DT1L 3O9WA 3DTXB 4P3CL 4XP5L 5J06A 1N2RA 4GAGH 5JXED 4UMGA 3OGCA 3T08A 2J6EL 5IJVA 1CVSC 1E4XI 3PHQB 5A40E 3D18B 1DBAL 3LN4B 1YEKH 4YHPA 1TVBA 1QFUH 4OJFH 4I13B 2UVFA 4NQDE 5C0AB 1MHEA 1F3RB 2VXUL 4Y4FA 1D7FA 3T04D 3B8YA 1A6UL 4K23L 5D4QA 2XN9A 3FO1B 2AJ3A 1K5NB 1BZ9A 4XAKD 4HUXA 4K94L 4WUUA 4EIGB 3SN6N 5IFAL 3ZKMC 3CVHA 1IGTB 3QIWB 4FTVE 1CF8H 1XGQB 4FG6D 2IGFL 2NXYD 4HT1L 5GGSY 2FHFA 4ODSL 3S96A 4OQTA 1MLCA 2PR4H 2Z31C 4P57A 3I6LE 2P8PA 2B4CH 1U42A 4E41A 1CS6A 4UAOB 3QUZA 1XAUA 2WQRA 1NMCB 4RGOL 4GMTL 2AJSH 3RPIA 2MSPA 1OAUH 4UT7H 4DVBA 4NKOA 1KENH 3RWGA 5FK9A 3TWCH 2LVEA 2C3GA 4HIEB 5JPMB 4PPTA 3D1MC 2R56L 5DUBB 1EGJA 5TDOA 2R9HD 4P9HH 4M1DL 3TH4T 1LEGA 3FQWA 1NJ9A 4YK4B 4V2BA 3WS3B 3QXWA 3IDMB 4TNVF 4MX7B 5J9PB 1HWGB 5JIKA 1IILE 4JKWA 4KROB 5I73B 5D7IE 3ARDC 4YDLB 5I18L 2W65B 1U8MB 1NGYA 1B9ZA 3WIIL 35C8L 1TIUA 1MI5D 1PKQA 5DWUL 3T77B 2HP4A 3W0WD 1BAFH 4XH2A 5C09A 5IV2A 4NM8L 2UYLB 3AS3A 3FZUD 1T5WB 5SV3A 4YR6B 1U2CA 2WUBL 4CU8A 4R4FH 2XNAA 5D72H 3WNMA 2GAZA 5KS9B 1OHQA 5F1NB 3ZKQD 2F8OA 4KH2A 3GMMB 3DUSB 1T2XA 3D2UB 4LIQL 1EHLH 3UTQA 4QRSB 4QHLB 3H6JA 4N0CD 3AREA 1UZ8B 2A6IB 1KIQB 4RMSA 4M5ZH 5TQ0H 1MFBL 4IRJC 2AK4A 5C0FB 1HDMA 1SJVA 5CMAA 2XG4A 3VFNB 1D6VH 3TO2A 4LVNB 1MCWM 4FFZH 5MEPB 3QO1B 3WO4C 3GMNA 4PS4L 4Z7VB 3RPKA 1M05A 3ULUL 2VDNL 3C60D 5I1LA 3VXSD 4PRHB 5IB2B 4ORGB 2EC8A 5IB3A 4TOYH 5ABDE 1R0AH 4F7EA 4YXLL 5B38A 4W6XB 1X5AA 2ORBL 4DTGL 2QKIB 1RK1A 4ERSH 3QNXB 2FD6H 4HG4J 4OV5A 3IXAA 5H8DA 5E08H 4HKZA 2CPCA 3O6LL 1AR1C 3CU1A 3OR7B 4UNVA 5CP7A 2VXTH 1OP5K 3DHJA 3WMSA 4OIBA 2B4CC 3S97C 1EVTC 3OAUL 1HHHA 2PXYD 4FXKB 5KZCB 2DOCA 3IFNL 4P4RA 5ELIA 3KHOA 1D9KD 4JVUA 5ERWB 1S7RA 4JGUA 4JN1L 4JPVL 5D2NC 5F7EL 3FTGB 2X1PA 5GZOD 5FDWB 3L3OA 4HS6A 3DJ9A 2DYPA 3MOBH 4P9HC 3NGBB 1G7IB 4WTZG 3V7AG 3MROA 1BMGA 4AYFA 4DZ8A 3KPQB 4DGYL 1G7MA 1SEQH 3QR2A 4FFYL 1M7DB 3QUXD 3C8KA 2CKNA 2CK0L 2XN9E 1MQKL 1S5HA 5E1AB 4TULL 5IR1B 4L3CA 1J5OH 4WUUE 4OGYH 2BNQD 3O3BA 3TV3L 5FECA 1DEEB 1U8IA 1WEJL 2ZSWA 2YSSA 1QVOA 4LLVB 2HT4D 5HSFA 4YGAB 3ZHDA 1MCPH 1NAKL 3P0YL 4F9LA 1E4XH 5DRNB 4EXPX 4DW2H 1MRFL 2ERJB 4UBDD 4RAVB 1T7YA 5BO1H 3SDAA 4CADA 2AGJL 4E41E 5E5UB 3THML 3B9KD 3ZO0A 1JPSL 4IIQB 5E2UH 5J11B 2ID5A 2E7HA 3TBSA 3RVXC 2ICCA 1BZ7B 1ORSB 5C6PB 2W0FB 1XF3B 4X6DF 4NQCB 4GBXB 4LSSH 5DHXB 3MLSH 3L7FB 3SE8L 4JPIB 4KRMB 2C3VA 4QT5B 4O58L 2AJZA 3U0PA 1U8JB 2NW2B 3WFEL 1HH9A 5JORA 2AKRB 1QO3B 3HE6B 5INCA 5FDYA 4EUPB 3K2MC 2NY3C 4O5LH 4U7SA 5HGDA 3OWEA 2QSTA 1OAQH 1A7QL 5DMIH 4FN0A 4Z76B 1IGCH 3EFFB 3S4SA 3QWRD 1EO7A 2VZUA 4JCMA 1WT5C 4M1CC 1WFTA 3QQ3B 5DS8B 5HHVH 3MX0A 3QXVA 5D8JL 5F6HJ 3PABB 3MRDA 4JN2A 4JM2F 4OIAA 4X9HA 4NO2A 5EUOB 2AI0H 4C4KT 3NCYP 1IZJA 4JB9L 1PKQE 4L8CB 1LEKA 3WCYA 4PTUA 1BFVL 1CXHA 4WEBL 5C09E 3MACH 5I1IL 4JG1H 1AQKH 1CTNA 1FIEA 4PRBA 4HW6A 5BVPH 2F5AL 1X5IA 5J1SC 1HNFA 1DQTA 5DJCA 4ZDHA 4UQ3B 4MYWB 3OPZL 5IB1A 4M4RA 1MWAB 3SDYL 1WJ3A 5ISZD 5IEHB 4FQJL 2KBGA 4P2RB 1IE5A 1KEGL 4K2UH 4M8QB 2JB5H 2AK4E 3DVIA 5HVGB 3VDBA 3B5TA 3BWUC 3T0XA 1D5IH 3QHZL 1XR9A 2DQIL 1H3PH 5MEND 4GLRI 1YMHA 3O41A 2Z31A 2VC2L 4AQ1B 1W0WA 1E6JH 1HI6B 4NNYB 4RMTA 4N0FA 4MJ2A 5JW5B 1LO4H 3MGOA 3KYAA 3SKJH 4AEHH 4PJGA 1JF1A 1AO7D 3MXVL 3MOQA 1RZKC 4QRUA 4ZO8A 4QRPA 3MNZA 4NJAL 5GPRA 5E94B 4HKXA 3WE6A 2OMBA 5IMMB 4POZC 5IBUG 2R2HB 1CN4A 5JLZB 1JRHI 3LQZB 5TF1L 5DURB 2QJDA 3PIQB 5HGHB 4M7KL 1T89C 1FAKT 4PJHF