1NBVH

An autoantibody to single-stranded dna: comparison of the three-dimensional structures of the unliganded fab and a deoxynucleotide-fab complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
219
structure length
219
Chain Sequence
EVQPVETGGGLVQPKGSLKLSCAASGFSFNTNAMNWVRQAPGKGLEWVARIRSKSNNYATYYADSVKDRFTISRDDSQNMLYLQMNNLKTEDTAMYYCVRDQTGTAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2B-KAPPA BV04-01 FAB (LIGHT CHAIN)
publication title An autoantibody to single-stranded DNA: comparison of the three-dimensional structures of the unliganded Fab and a deoxynucleotide-Fab complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 36
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nbvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nbvH01
3HPLA 3QEUA 4LL9A 1YY8A 4Z7OE 4R0LA 1F90L 4X80H 4YX2L 3VRJA 1QQDA 1CLOH 1G7LB 3UPCA 3W9EA 2OQJA 2D7MA 2ESVA 3QUML 1FZJB 3P11L 3QHTC 4KJWD 5ISZD 1FJ1A 3CNKA 1KG0A 4Z7UA 1F3DJ 2P42B 4M4RA 1FIGH 2J2ZA 4MMXC 2P45B 3I84A 4I18A 2YS4A 4NKOB 1AR2A 1MFDL 4UZGA 2PO6B 4HC1H 5D2NA 1EX0A 3ULVC 3VWJA 2IBBA 2EKJA 1YNKH 1EEZB 2HYMA 3I02B 4KJPD 5I16B 1DE4B 5F9WC 5HHVL 4OUOA 3V4VL 5D93B 2I9TA 1IKNA 3LH2L 3HG1E 4WV1B 3QCUL 4NUJB 3D3VA 2IANE 2IALA 3IFOA 4F7MB 5F1OB 3QIUC 4YWGL 4KGJA 3SDCB 3UBXA 2DLFH 2APXA 3SDXB 3U46B 2X10A 3KJ4B 5EO9B 1NKOA 3BE1L 1FO0L 2OZ4L 4JGMA 3TCXA 3EFDH 1Z3GL 3LMJL 3U0TB 4HW6A 4M61A 1KELH 4LF3B 3O2DL 4TNVF 1E28B 1OP5K 4C4KT 4MAYC 4X8JB 4G7YL 1MSPA 1YEFH 5FYKD 5T1DL 3SKMB 5D1QC 3PE9A 1A7OL 2QV2A 3HMWL 4MD4B 4Z5RA 1OP5H 2A6KB 3H9YA 1KGCD 4WY7H 1RZ8A 3AUVA 4HWNA 4PS4H 2F19L 2GFBA 4IOSD 3U7WH 1VFBA 3PHQA 3FB5A 3ZKQD 4FZEH 2A74B 2ZWLT 4HF5H 3WLBB 4OIIH 3RDTC 4GXUM 2YD3A 3CK0L 2A6IA 3D39D 4I5BA 2BVEA 3RGVA 5ID0B 2EC9U 1T2XA 1INQA 2AK1L 4QTIL 4PREA 4GAGH 4Z76A 1KTDB 3FKUS 1F4WH 3SE3C 3T0VA 2EXYC 3O8XC 5GGRA 3GMPA 3SDAC 1JL8A 5A3ID 4PJFF 3WDIA 5B8CA 1RUKH 4JJHA 2V5MA 1UZ8B 1HINL 4M5ZL 3FOMA 5INDA 1ZA6A 3CX5J 3PWPA 3U7YH 5FO8A 1MQ8A 3EYVB 5BW7A 2BOBB 4JB9H 1IFHL 1X4ZA 2EDOA 2MPAL 5JXED 2H41A 5DC0A 3TEUA 1B4RA 4KWUA 5DI8B 1QEWA 2BY0A 4LLYA 5EU5A 1A5FL 2KL6A 4WI2A 4WIQA 5E9DA 3SE4C 3OAUL 3EO1A 3NFSH 3TBWB 4ZNEA 3BRGC 4QHLA 3TJHC 5IFAH 1KCLA 4KGLA 3TN0B 3QXUA 4X6DA 4JLRB 1LEGA 5D7LE 3N06B 1TQBB 3QIBD 1MREL 2BX5A 1S7UB 2GJ6E 2EDQA 2A6JB 1QG3A 1QFOA 3VXRD 2Z92B 3DMMC 1IC7H 4JKPH 1OGAB 4L9LC 3QRGL 2R2EB 1R5VB 1FZJA 5F6HJ 4J6RH 3MUHL 1XCTB 3A6CL 1A7RL 3EYQD 1RZKH 4X6CB 4KU1A 1K3ZA 1CVSC 1MCDA 2VLRB 2DBJA 5DUML 4NKOA 3ZHLA 4S1DD 1WTGT 2PO6A 4U0QB 5CAYB 3TYGL 5F7WC 4AEIH 2F15A 4XVUC 1MHPL 4JM2B 1EEZA 3I02A 1KC5H 5GIRB 4JQVA 5I16A 1DE4A 3CXHK 3CSYB 2EDYA 3TT3H 3MLUL 1G9NL 1OSZB 4WV1A 1P5UA 4KUZH 4NUJA 2I9LB 4LMQE 3UJIL 4CVWA 4F7MA 4G6MH 3SDCA 4PJDE 3UTTE 1NCBL 3PL6B 5HXMA 6FABL 2GHWB 3O3AB 5EO9A 2ZPKH 2EDJA 1FAIH 3AFLA 1UKQA 4LF3A 5E2WL 2GSGB 1E28A 2I07B 4KROD 4X8JA 1S78D 2K1MA 3OKDB 5L9DH 4OCWH 2NW3B 3SKMA 4IRJB 5E1AB 4O51B 1MCOL 3SGEH 3K8KA 2R2CA 4MD4A 5DSCB 2A6KA 1YJDH 1RJYB 1HE7A 1VSCA 4M1CC 1Z9MA 2FIRT 1A6UL 2A74A 5AZ2L 4DVRH 5DR5L 3WLBA 2R8SL 2JB5H 4GW4B 1SJXA 3NIDE 5ID0A 3IT8D 5HPMB 4KRPC 4TVPD 4OGAD 3FMGL 1VERA 3OMZA 1WWCA 1CZ8H 2KBGA 5GS2H 1KTDA 4J12A 1UJTA 3CVIH 5L8KB 4WI6A 3KPPB 1GZPB 1QFWM 4KRLB 2Y5EA 3BSZL 2VQ1B 5FHBH 4ZDHB 4HAFA 5BOPA 3BYYA 3HN3A 1T1XB 1RVFL 1KB5H 1AGEB 1UZ8A 4JHWH 4U0RB 1KXVC 2JCCE 2OR8A 4OCNC 3EYVA 2BOBA 4JFHE 5GRXG 3F58L 4X6EB 1JPGB 3Q6GL 4OM1L 5DI8A 4NQCD 5LGHL 1QOKA 2EE3A 3TBWA 3LY6A 3TN0A 4JLRA 2DDQL 5E95B 4PRHD 3UTOA 3VG9C 3BGMA 3OL2A 1NL0L 1IM9A 4R9HA 4KH2A 1S7UA 3QUZD 2Z31B 5KN5B 5HHMD 4WEUD 5JXAL 2QADD 2A6JA 4FFYL 3LPGA 2Z92A 1FYTB 1OGAA 2R2EA 1R5VA 2C3GA 3UC0H 3VFUB 1AO7E 4ZFOL 5C0FB 1Y18B 4PJ7E 2WWMC 1XCTA 4OCRL 4P4KC 5BV7C 4X6CA 2JJTC 4L4VD 3JWDL 3O3EB 4PBVC 2VLRA 3RPKA 4GJTB 4MB5A 4OF5A 3TFKC 1UEYA 5D7IB 2JJVA 3B2VL 2O5ZH 3NPZB 3SJVB 3LN9A 1LP9B 1JVKA 2YUVA 1KB9K 5GIRA 1YEIH 4Y7MA 2OJEB 2ZCKH 1OSZA 4HUVB 4N5UA 2DL9A 5DS8B 2I9LA 1WEJH 3RNQB 1VCAA 4C56B 5ESQB 2OTPA 4P23D 1AKJD 2XZCL 1MCLA 4MA1C 1YQ2A 3BKYH 4HHAB 3G6JF 3PL6A 3U4AA 3RY6C 3F65A 5F6IC 1QYGL 4HJJL 3O3AA 1B90A 2HKFH 3PNWB 4YXKL 3EFDL 3LRHA 1E4WH 1MIMH 2WBJC 1TJHL 1IQWL 2GSGA 3JTTB 2I07A 5I18L 3WNMA 4PLKD 3OKDA 3QH3A 5DEZA 5EZLB 4K3EL 2NW3A 1J1PH 4IRJA 5E1AA 3OG4B 5EWIL 4O51A 5DSCA 1UKSA 1RJYA 3DXAD 3REVB 4TUJB 1SVCP 4X7SL 3UAJC 2YN3A 1BGXH 4FFVC 4EIGB 3VXUE 3S88L 3MNWB 1A3QA 3V6OE 3IETB 1GJIA 1G7MB 4P2RB 4ODHL 3CU7A 5GRYA 3RWIB 4GW4A 4N0YL 5HPMA 3B9KD 3EYUH 2QJDA 1ZVSB 5GQBA 4HJ0D 2A2QT 3KS0J 5DT1H 4P2QD 3KPPA 5JHLL 4FNLH 1GZPA 3JWNC 1YC8A 5IQ7H 4HBQA 5CJBA 2VQ1A 4ZDHA 1REIA 1T1XA 1AGEA 4P2YA 3TNMB 3PP4H 4JB9L 1AFVL 2A1WL 3WDJA 4F57L 2X42A 4UINL 5L2KD 1WZ1H 4GRMB 3KYKL 1JPGA 4JY5H 5HHOE 3UXFA 1YY9C 25C8L 1EERB 5J13C 3BISA 3VI3E 3N1MC 2EH7H 4N8VG 4FQJH 5DC4B 1CFVL 4MHHG 3W2DH 1TJIL 2HLAB 4BQ8A 3MGAA 1INDH 5TDOB 2ZKHL 3QQ4B 3M8OH 5C09D 1S7SB 2CXKA 3V6OC 4H0IA 1NGQH 2J88H 2Z31A 3FRPA 5FB8B 5KN5A 1UJ3C 2RCSH 5FYLL 2BNRE 2EDBA 2MTPA 1FYTA 2VDPH 3DYPA 5IUSA 4PJ8D 1C1EH 3SKUD 3VFUA 5C0FA 1Y18A 1YUHB 2RJMA 1FZOB 3EDJA 3MRQB 3OZ9H 1MF2L 4HEPG 4O5LH 3IKCB 1LP9F 1RULL 2K3TA 3O3EA 1NMAH 1A0QL 1P4IL 4LCCB 4MJ6B 1IC5H 2JK5B 5KZCB 5D7IA 1KC5L 3DX6B 3SJVA 1LP9A 4JN1L 1I1AB 4LASL 3SCMB 3QT2A 2EIZB 3RQ3A 5C0IB 4U1GB 2Q7NA 3D48R 4WI8A 5EC2B 4YJZL 2OJEA 3WFBL 3AREC 4NGHH 3UDWC 4WUKH 5DS8A 1A7QH 5HVFB 4DN3H 5H2BB 1H3VA 1LO3H 3RNQA 2ZG1A 4C56A 1BHGA 3DJ9A 3MR9B 5SV3A 2X4SB 4HHAA 5BVPH 4XX1G 5EO0B 2W9EL 3L3DB 1T7YA 1FAIL 2GQHA 3PNWA 4KI5E 3BZEB 1FRGH 3QDJA 1UCTA 3CDGB 2BHYA 1H0DB 2IEPA 1KTLB 4KAQL 1D5ZB 3HFMH 4NCC2 4YBQD 3JTTA 5FK9B 1HKLL 1EV2E 4OFDA 2FEDD 1Z9LA 3C6LC 2AEPH 5EZLA 2AJSL 1I85C 1B0RB 2ZZUT 3TYFB 2O93L 2DI7A 4HWBL 1PX3A 1SM3L 1Y6NR 3REVA 4TUJA 5F9JB 4AL8H 1MRCH 4RGMC 3VWKB 3RVUD 3O9WC 2V6HA 3MNWA 1F58H 4XCCL 4X7TB 3IETA 1G7MA 2VDKL 3MRBB 4P2RA 4C59B 4YAQB 3RWIA 2QHLA 3LQZB 2IADB 5A2JH 4OZIE 2I26N 2PXYD 4DGYH 3N1FC 1CZ8L 5MENE 1ZVSA 3CVIL 4O2CB 2ZG2A 1QFUL 4GRWH 1TCRB 5MI0B 4M1CD 4XC3H 2VB5A 3MJ7B 3BPCB 4JHWL 1MLCB 3ULUE 4H26B 3CH1B 4OBSA 2IAMD 3TNMA 4HS8H 3EOYG 1IJ9A 4DK6A 2ZUWA 3T3ME 4KI5C 5BZWB 5J1SC 1GPOL 4GRMA 3ZT5A 4OIBA 4M7LL 5CCKH 1UXSB 2BRRL 5C9KA 4ZD3L 1KIQA 4XHJC 2ENSA 5LJYH 1X4YA 1AXTL 4M8QB 3MOBL 4HZAA 5HYFA 2A9MH 4E41E 5JW5B 5DF0A 2G60L 4YDKH 5TDOA 2DKMA 3QQ4A 4Q0XH 5I66B 4FP8H 4LKXB 4JRWA 3FOLB 1U3ZA 2Y6SC 3R06B 2VH5H 5FB8A 3QDGD 1T6WA 2VLKE 1DLHB 1WIUA 1GGIL 2K7QA 3JVGC 3U1SL 1OPGL 1YUHA 1FZOA 3KLHD 3MRQA 3GSUB 3ZHKA 3C9NB 3LKSB 4DKEL 1EVUA 2CLVB 4P2OB 3C08L 3ULUC 3QA3B 4MJ6A 4LCCA 4DFIA 5KS9E 2MWCA 3G6DL 3QUXC 2JK5A 4ETYA 3U79A 1NMCB 1K6QL 3DX6A 1H15B 5GS0D 3PP3K 3ARFD 1TCMA 1I1AA 3SCMA 2W92A 2EIZA 4ZFFB 5C0IA 1GGBL 3QO0A 4YZFF 1EBPA 3GRWH 2BVOB 2AK4D 3HLAB 5EC2A 2WW8A 4MDJB 4M1GH 3PP3H 2W60B 4PP1C 4MQTB 5H2BA 4PGJA 3ESVF 3MR9A 2FGWH 5J6GB 2V2XB 1I7ZB 1Q9OB 2APWA 2X4SA 4NWUL 5DRNB 1MVFA 4GG8B 3NTCL 2D7TH 1SJHB 2VDLL 5D7JB 2HKFL 4HXAL 5A43C 1A21A 5EO0A 3L3DA 1Z6JT 3BZEA 4Y1AB 1PFCA 4DEPC 5C2UB 3S8WA 1UG9A 3CDGA 1H0DA 3BZFB 5FOBB 1ZGLB 1QFPA 3WXVL 1D5ZA 2DD8H 3S36X 3DETC 5FK9A 1J0ZA 2DKUA 4OZHF 4UUJB 3QDMB 1MFCH 4HK3N 4HBCL 5CP3H 3S37L 1B0RA 3FQWB 3TYFA 5I76B 3THMH 4OLWL 2CUHA 4M1DH 2FWOB 1DQTA 3ARGC 4OZHA 1AD0B 3RBSA 1NCDL 3ORJA 3VWKA 2HTLC 3KXFD 4BUGA 4WI3A 4X7CC 1NCNA 4X7TA 5JHDE 4NQDD 2WBJD 5KVFL 3Q48A 5E2VL 1MRDH 4YAQA 4K94L 3VXMD 5A40E 4D9LH 3LQZA 4O00A 1UM4H 4Y2DB 2IADA 1EO5A 3FCTB 3MBEB 1MEXL 4YO0B 3X11B 2X5PA 4O2CA 3ZHDA 5BJTB 1MCNA 3DSFH 4W6YB 1TCRA 3P4LA 1RFDL 4NNPL 2A0LC 3UAJD 1VFOA 4OAWB 3V7AE 1EO7A 3BN3B 3MRRB 5A2IH 1U6AL 3MJ7A 4QGTA 3BPCA 5JOEA 1MLCA 4XMKH 4K3GA 3SE9H 3FQXB 4H26A 1CK0L 3CH1A 3QEQB 2DQFB 5E2JA 3RWGB 2M1KA 5HYJB 5D5MB 2PTVA 3ZDZE 1XGTB 5BZWA 1BZQK 3CJJA 4N9GB 4NO0B 2GUOB 3VRLE 4G42B 1UXSA 1RZJC 2CPCA 4HAGA 2FRGP 2OXGA 4GG6F 1AR1D 1JYNA 4M8QA 4OD1H 4PLJD 3IDXH 5FYKE 2XKNB 4Y4HB 5JW5A 4WUUD 4ZOAA 2NY4C 5IJVB 5I66A 3W0WA 2F5BL 4LKXA 1BIHA 1IAIL 5F7KC 3FOLA 3R06A 1G6VK 3FTGB 1AD9B 1DLHA 1YY9D 3NMEA 4FQ1H 3NABH 1WFTA 35C8L 4PRPD 1G9EA 3TJEL 1NMBL 3E3QE 3RWHB 5DURD 4L4TD 4LVEA 1FL3B 3GSUA 3C9NA 4XBPB 4XP4H 3V4UL 1H5BB 5SX4I 2XQYK 3MZTA 4JAMB 1V3LA 5AZEL 1XGPB 2CLVA 4P2OA 4NT6B 3QA3A 5F7LB 2E7MA 5EU4B 3BD4A 5EOQH 5F8RC 4KRMB 1H15A 4GQ9H 3ARDD 2X40A 4FTVB 4NOBA 2D0GA 4ZFFA 2B2XH 2QLVB 4KKBD 2BVOA 3HLAA 3NH7L 3O3BB 4G8FB 1S9YB 4JPWH 4MDJA 3L3OB 4APQB 2Q86B 3VRIA 2W60A 3MRKB 3UYRH 1GC1H 4OD3H 3SGJA 5IBLD 3I50H 3T0EC 3WIHH 4LCUB 5J6GA 2V2XA 1I7ZA 1Q9OA 4N90E 5DRNA 4GG8A 4MSWB 5DO2C 1SJHA 5D7JA 4HPYH 3CDCA 1CXLA 1DQQA 1HH6B 3MLSL 5CMAB 4Y1AA 5FUOH 3QFJD 1T80A 4U7SA 3FAXA 3BZFA 2G5BB 5FOBA 4K7PX 1ZGLA 4PYGA 1CT8B 5SWZD 4M6NL 4QRPD 4Z7WE 5MP6L 1XIWC 1HQRB 2X1PA 5J8OA 3RVXC 4UUJA 1KJMB 3QDMA 3E3QC 2QQKH 5H37G 5GS2D 1MAKA 1UH3A 3FQWA 5I76A 4M8VA 3R0NA 4ODXB 4ZNCD 1ZA3B 1ZEAL 2BNQD 4NCDA 1I9JH 2FWOA 4NQED 5DRZB 1W8OA 5ECJE 2OK0H 1AD0A 1CDUA 2NY3B 4U6TA 5EOCJ 4WFHD 3KYMB 1D3CA 2ADFL 1JI1A 4MXQD 3H3KA 1NSNH 4Y2DA 4G8GE 4PJBE 2O61B 3FCTA 1ROWA 3C6LD 3MBEA 2C3WA 4YO0A 3X11A 4UIKL 2DS4A 4AH2B 2J5LC 4XMPL 1QHOA 3EW3B 3VD3A 5D5MF 2VZUA 1ZOXA 4OAWA 1EMTL 3BPLB 3MRRA 1ZVHA 3RVVD 3FQXA 3KPSD 4JE4B 2Y1VA 4Q9QH 3QEQA 1FNFA 1PBYA 2DQFA 4GBXC 3RWGA 5I19H 5HYJA 4ZOCA 3JWOH 5D5MA 1XGTA 4FQLL 4POZD 2QKIB 2OR9H 4NO0A 2WNGA 2GUOA 2JTDA 2VQTA 4G42A 5I0DA 4TQEH 2EH8H 4BYHA 1ZTXH 4XNZB 1JMXA 4EVNB 3QXDB 2QSCH 4HZLB 1RPQA 2XKNA 5KG9B 1MFEH 4Y4HA 4KI1A 3NOIA 5CZXC 3SOBH 1F45A 5IJVA 4JG0L 4POYA 1KCKA 4Y4KD 2VDNL 4J3SA 3FTGA 2E7LA 1AD9A 5K9OB 4H0GA 4Z0BH 1J18A 5HY9B 5BS0D 4XHJD 2BVPB 5AG9A 3H6JA 1BX2B 2ERJB 4K3DL 2X70B 5I1CH 2WUCH 5FDYA 2YBRB 3RWHA 4LP5A 1JGUL 1T7VA 3H9HB 5L7XL 1FL3A 3GZKA 3GI8H 4FQCH 4XBPA 3BWUC 3WNKA 2XTJD 3KR3L 5MHSE 3WUZA 4JAMA 1RUML 1XGPA 2Y6SD 3QIUB 4NT6A 5EU4A 3MGTB 4HMDA 3WFEL 5K59F 1KCUH 2DB8A 4ODBD 5TE7H 4P2CG 4ZYKB 1FE8H 3BQUB 3B2UC 2YD5A 4FG6D 1K2DB 3O3BA 4G8FA 3IB4A 1S9YA 5I6XB 4MQ7B 3L3OA 3NA4A 4APQA 2Q86A 3MRKA 5LXGL 4IRZH 5C08E 4OF0A 1YMHB 3LEXB 3GSNB 3TZVD 1UB6B 4MSWA 4H20L 4YBLB 1KNOB 2DYPD 5E7FA 1U58B 4BZ1L 1HH6A 5CMAA 1QFHA 2PYED 4OF8A 3TO4C 2X4TB 2DD8L 2YPLE 2G5BA 4JJ5B 5LWYL 3CZJA 3IJSB 3P0YH 1CT8A 1T83C 5DZOA 2C1OB 5C0NC 2R69H 4L3EB 4PP1D 1HQRA 2NR6C 3FFCE 3PHOB 1KJMA 2J7LA 4BA8A 5T3ZH 4ALAH 1MHCB 2VRAA 3THML 1A7PL 1AQDB 3HG1B 4ODXA 4P3DB 1ZA3A 3UZVB 5C3TA 2IANB 5DRZA 2XV6B 3O6MH 4L4VE 1NEUA 3O8XB 4AY0A 1D7FA 1UKTA 1MCPH 3G9AB 4NRZB 3FRPG 3H42L 3Q2CA 3KYMA 3C8HA 3DETD 1UM4L 1XF5B 1FDLH 5E6IB 2O61A 5C8JB 4Z7VE 4HWZB 2PTTB 1D5BB 4AH2A 2EO1A 1CFTB 2DRUA 4R7NB 5JNYB 1P7QB 3BUYA 3ARGD 2NY1C 2X1OA 3SE9L 2HTLD 1H3TA 4AZ8A 4V2BA 4PPTA 5KW9H 1LDPL 2R2HB 2EC8A 3FN0L 4X9FA 4ZXBD 2ARWA 5ALBL 3A67H 1T20B 1T7ZA 1PSKH 1MJ7L 2QKIA 4OZ4B 4QO1A 4ORZC 5TGBB 4S1QH 1A9EA 1TFHA 5IHBA 3EO9H 4M03A 1FN4B 2X6MA 5CILL 5I1GL 1QPPA 1KBGL 4EVNA 1X5FA 3QXDA 4HZLA 4JFFE 2OP4H 4J3UA 2R1YB 5DJXB 3ULVF 5FFLA 1FHGA 2NW2B 5JA8B 4GQPH 3UTQB 5IT2L 3P3YA 3QCTH 2N4IA 1JF1B 5TF1L 3TGXA 5K9OA 3KLSA 2AJXH 3BDYH 3QPQC 4OLUL 5HY9A 9CGTA 2BVPA 1BX2A 4QNPF 2X70A 2ZJSL 4S0SD 1LE9B 4JREB 3QI9C 2YBRA 4PD4K 5DD5H 1JZ5A 2VDRL 5JIIA 3H9HA 2H9GB 2ZSWB 4HV8B 5DUPH 3BGAA 4P2QE 3WMSA 2NX5E 4XPTL 1LVEA 2EDEA 1MCEA 5EN2B 3QIUA 3A0OA 3D85A 3MGTA 4RGOL 5TE4L 5CUSL 1BP3B 5D7LB 5KANG 4XVJH 3FO0H 4QWWC 4EDWL 2W9DH 4ZYKA 3BQUA 2IPUK 4WDIA 5HI4C 4HFWB 3O0RH 2V9RA 4Q7DA 3GBNH 4JVUA 1K2DA 1FC1A 4MQ7A 3I50L 3U9PH 4OLYH 3CXDL 4K23L 3VJ6B 2D9CA 1J10A 4KHXH 1YMHA 3LQAL 3LEXA 3GSNA 4LLUB 1UB6A 1KNOA 3WHE0 2JIXB 1U58A 3S35X 3K46A 1ACYL 2P1YA 4FQXC 2X4TA 2Q8BH 4JJ5A 3IJSA 2C1OA 1HSAB 4L3EA 4QXTB 4KRPB 2XOTA 2BY1A 3PHOA 3T0ED 1MHCA 2V17H 3G6AB 2J8UF 3AU1B 3OHXB 1AQDA 3HG1A 1E27B 8FABB 1RUPH 4P3DA 1BFSA 2EIDA 2IANA 5DVLA 3MJ6A 4UOW1 1FYHB 1XR8B 3O8XA 2BHUA 2Z8VC 4B7LA 3N0PB 1DVFB 1EJ6A 1G9ML 2WUBH 4NRZA 1OLZA 4PJDB 1ZLUK 4Y5VB 3UTTB 4QXGH 4HIEB 5I74B 5FGSA 5GSVB 4K8RD 1XF5A 1XIWD 5I1LB 3VFOB 1F3RB 5F21B 4D0BB 4CKVX 1ZLUH 3UX9B 2EC9T 5F6HI 3MRMB 5MERB 2X4NB 4HWZA 4JCMA 2PTTA 4ONOA 1D5BA 3PDDA 1CFTA 3X3GH 4R7NA 3SGKC 5JNYA 1P7QA 4MXWL 5DHXB 3SE4A 1H8NA 4Q9QL 2R2HA 3O2VL 1QLFB 3PXJA 4IEFB 1T20A 5GGRY 4MNGE 4U1IB 1CGXA 4OZ4A 5C2BH 4UTAH 1OAXH 1WBYB 1BF2A 5IB2B 1WZKA 5DZLA 1QRNB 4B41A 1FN4A 5EUOE 4YXHH 2R2BA 1E4XH 3NCMA 3RA7H 4M7ZC 1M7XA 3OJDB 3T0AA 2IH3B 3O4OC 4CMHC 3N1PC 1HIML 3QUYB 4LPUA 3UBXI 2R1YA 5DJXA 5T33H 2NW2A 4LPXA 3WFDH 3UTQA 3VGHA 1KEML 5C0RH 2CKNA 1DBJL 4R4FH 4PRDB 1JF1A 4POUB 2JCCB 4ENEC 5TQ0L 5FF6B 2WUCL 4KQ3L 5DMGC 1RURH 3MV8E 1LE9A 4X0KB 3WKMH 4HIXH 4V1DB 2H9GA 4X7DC 3WBDA 1EJOL 1U2HA 2HJKB 5D96C 4HV8A 1TTFA 3O6LL 5EN2A 4I9WD 4Z77B 4IIQC 4RGND 5D7LA 2LU7A 3RHWK 1JWMB 1BD2E 4MA7L 1ZAGA 3MLVL 4NZUH 2UV3A 4HFWA 4JO3H 5JDJA 2DWEB 3ZDXE 2CLRB 3BW9B 1W0WB 1UGNA 5KSVB 1IAII 3DRQB 5IGXL 1IQDB 4PJHE 4N5ED 3STZB 5BRZE 1N5YH 1FBIL 3H9ZA 3VJ6A 1AO7B 3VFSB 3W11C 1QVOB 1B3JA 2JIXA 2F53E 3BO8B 3RWDA 5DD6B 1A4KB 3P0YL 3B2UD 5C07B 2IGFL 3BN9C 5CJXC 5C0BE 1HSAA 1OLLA 4QXTA 4O2FB 4KK5C 2DKSA 1JHLL 3VMOA 4PJDF 3G6AA 2PR4L 5F7EH 3OHXA 3S34L 1E27A 8FABA 3SBWC 1T0MB 1X3DA 1XR8A 4S2SB 3RL1B 3PQYE 3WDHA 1DVFA 5I1IH 2DBLH 3TO4D 4U1KB 4J3TA 1ED3B 4PJDA 2CK0H 3UTTA 4HIEA 1P6AB 2F8VA 5GSVA 1W0YT 5GJSH 2DQGH 4NFCA 3VFOA 5I1LA 3ARUA 4D0BA 3LKRB 3MRMA 4S1RL 5MERA 2X4NA 4LIQH 1NAKH 3VFGH 4N1CA 2B5IB 3CSBA 4KXZI 4TOYH 2F58L 5J13B 3ZZ1A 4X5XB 1RUQH 4PRIE 3DVGB 4LHUD 1T4KB 1HDMB 4NM4L 2DQHH 4UOJA 1QLFA 2DICA 3MNZB 2HMIC 4IMLB 5KOVC 3NIDF 5CSZB 1MRFL 3PV7A 5I15H 2ZSVB 1PX4A 4YHZH 3BGFC 3VXUB 1T21B 2B4CH 4NBXB 2ZUUA 1WBYA 5E94B 3P73B 4EEEA 3RTQB 5IB2A 1R3IH 1QRNA 1YPZE 3EJZC 5EOCL 1MPAL 2NY1D 3MV7E 4G6JL 3OJDA 1FSKC 3HNSL 1S3KL 4Y16C 2IH3A 3TVMC 3OKKB 3BI9X 2H2SC 3QUYA 3S4SB 1JBJA 3SDDB 2JJTA 2F8XC 3GHBH 1DBAH 1CGSL 4NJAL 5B4MC 4GRLB 4PRDA 2JCCA 3GGWB 4NQDE 5FF6A 4KMQA 4YHML 1SBBA 4PY7B 4P46B 4X0KA 2VZ3A 1MJUH 4AIOA 1N64H 4ZAKB 4NJ9L 5HHOB 4XCFL 1A7BA 4QXUL 2H1PH 4V1DA 3AREB 2HJKA 3HC0A 3CFCL 4OFVA 1FL5B 4XP1L 5TE6L 1GOGA 1WFUA 4IRSC 4RDQF 1X5YA 4OCYL 3EYSH 1GOFA 4PJ9B 4OD2B 1N4XL 4OI7A 4JY6B 4Z77A 2D2OA 2EZ0C 4BELD 1JWMA 4K9EL 2VERN 4N8PA 3T4YB 2DIBA 3QI9D 5E0QA 2AJUH 3NCBB 2DWEA 4PJ7F 2CLRA 3BW9A 1W0WA 2J12B 5KSVA 2BNRB 1JPTH 2DLIA 4OLYL 3RZCD 1IQDA 3STZA 4MNQD 4M02A 3OR6A 1AO7A 3UZQA 4EI5B 3VFSA 4TYUA 4R90L 1QVOA 1V3KA 2B1AL 3NCFB 3SO3B 1IGCH 5F7MC 1RY7B 5JTWA 4UDUB 3T2NH 2XWJB 2Q8BL 5DD6A 1A4KA 2MQ0A 3T09A 1IKFL 4FQ2H 2E9IA 4RQQB 3E8UL 1G0YR 4O2FA 1CD9B 3PV6B 5E6ZA 2DI9A 3SEPA 3I6KB 1IEHA 2X1QA 3RNKB 2CJUL 3F7PC 4EIZC 1L7IL 1F97A 3VW3H 2W0FB 2A83B 5L2JB 5DJAB 1T0MA 2HT4C 1S9XB 1A4JB 4S2SA 3RL1A 3IKKA 1JF6A 1BJ1J 2YRZA 4QXGL 1ED3A 4U1KA 3BXNB 1OP3K 1LEIB 3HCVB 4ELKB 1MOEA 3RIAK 4IHOB 3SKJL 3ZKND 3LKRA 4EQ3A 4URTB 5IQ9A 1OP3H 4WI7A 5FDWB 3VG0L 3GMMA 4GSDH 3EOTL 1EA9C 1CFBA 3MX0A 3L5WB 5J11C 1MFBL 3HNTH 3V79C 4X5XA 2ARJB 1B2WH 4R26H 3DVGA 1JV5B 1T4KA 2YK1L 1HDMA 1RZKC 5IVNA 3MNZA 3CUPB 2DQDL 4IMLA 1CIDA 5CSZA 4BH8B 2ZSVA 1IC4L 3PWUB 3RP1A 1IT9L 3VXUA 5DD1H 1T21A 4LFHG 1NC4D 2C26A 2X4PB 2YN5A 1UJ3A 5E94A 4YPGB 1IEAB 3P73A 4FXLA 4YHYC 3RTQA 1IAMA 5FM5O 2VXVL 3I9GL 4BFBD 4OZIB 5D1XD 5C1MB 5MENB 2AKRB 2VDMH 5CBAB 4LCWE 2X89D 3BD5A 5C7XH 5GGVY 1E6OH 3S4SA 4WFGD 2C3XA 4HIJB 2OX5A 3SDDA 3WFDL 4OCXH 3L5IA 4NQEE 3MUZ1 4X8XA 3SDYH 4GRLA 5FM4A 3MLYH 4N1EA 3GGWA 4UQ3B 3QUXB 5GGUB 5DJYB 4CUCA 2XN9B 3VI3F 5JIPA 4X4ME 4PY7A 4P46A 3MOAH 4JFED 1NCWL 4ZAKA 5HHOA 2EYSB 5KTEH 2NY2B 1C08B 4DGIL 4NZTL 3AREA 1A22B 2NY0C 3UDWA 4BQCA 2O26U 1MIEH 3C5ZC 1FL5A 3GUTB 4HLZH 5DFVC 4PJ9A 4X83A 4YLQT 4OD2A 4E41B 4JY6A 1K5NB 3S36L 2HRPH 1A6PA 3IFLL 3PDOB 4YDIL 1FGNH 4JO3L 2VLKB 1RV6X 4LSUH 3BRDA 2BNRA 5L8LB 4PJAB 5T3ZD 3ALXA 1KIUA 4ZODA 4EI5A 4PUBL 5IJKA 1I85A 2OL3B 4XX1E 2Y07H 4UDUA 2XWJA 5GXBB 1X44A 3BEVB 1BBDH 5J4MA 5KS9B 3EYFB 3S3JA 3HRPA 4RQQA 2PW2B 2AEQL 5BS0E 5M94B 3QIWD 1BIIB 2ZNXA 3PV6A 3LEYL 1OWWA 5CEZH 3I6KA 5C0AE 5F7EL 3RNKA 4KZDH 1CE1H 2FX9L 4LCIL 3Q5TA 2W0FA 4YDJA 4XP6H 3TA3B 2A83A 5L2JA 2NY6C 5DJAA 3EKCA 4KI5F 1S9XA 4JR9H 1J1XL 2XZQH 4NBZB 4RX4A 3F8UB 3BXNA 5HGAB 5FM5M 2P44B 1CN4A 4LOUC 3HCVA 3N1GC 5HHPB 3WNNA 4ELKA 3K81A 4IHOA 4Z7UE 5FDWA 1RZIB 2P5WE 2CRMA 4OF6A 3ZTNL 2E3VA 2Q20A 4PJGF 3L5WA 1HHJB 1RUQL 1T1YB 5D7KE 4DAGL 2ARJA 3FO2B 4PG9B 1NJ9B 4Z78B 1JV5A 1DBBH 4KPHH 1GGCL 4IMKA 5ISZB 3WHXB 4L3AA 3GO1L 4I4WA 4R8WL 3CUPA 2A9NH 1FIEA 4BH8A 3PWUA 4NO3B 1B0GB 1ONQB 4MAUH 4HIIB 3UPRB 2PYEE 3H3PL 1S7QB 3K7UA 5JHDB 2X4PA 4IJ3C 1NCCL 3TWCL 4YPGA 1IEAA 3GSXB 3WIIL 3FT2A 1H3PH 1MFAH 4KK6D 4WI5A 4DQOH 4OZIA 3HPJB 4NPYB 3CU1A 2GEEA 2FIKA 2VLMD 1GOHA 3V8OA 5MENA 2AKRA 3ULUF 5CBAA 1WWAX 3MV11 4YK4B 4R0LC 4HIJA 3T3MF 1PJ9A 2ADGB 2AXJA 2YD1A 5ADOH 4L8SC 2BZDA 1WVZA 1MAML 4X4ZA 1JGEB 2VAAB 1TPXB 1EO8H 2LTQB 5GGTH 4UQ3A 4IOIB 3QUXA 4JKMA 4JPKL 5DJYA 4JO4H 2XN9A 4ETQB 3MV9D 2DLTA 3DI3B 4HQQL 2Z8WC 1TENA 2F5AH 4Y16D 1NGPH 2YOCA 3MPCA 3ME0A 3BKCL 2EYSA 5DVNA 4YHKH 1C08A 1CF8L 4CAGA 2UUDK 4I18C 3MJ9H 1XGYH 2VR4A 5D2NC 4N0CD 3GUTA 1HILB 4DWHA 4HKZB 1QR1B 2YA0A 2UUDH 4K7PL 4E41A 1K5NA 3O4LD 4HUWB 3BZ4B 5DK2B 3PDOA 4Q9RH 4NQVB 4LNVA 1U92B 1XMWA 2AJZB 3RI5F 5C0EB 5JZ7C 1IKNC 4JG1H 5T1KD 2VLKA 3REWB 4LSDA 2QL1A 2VN7A 3D39B 4K94C 4EN3D 4PJAA 2B1HH 3MBXH 5JPMB 2HT2D 3RAJL 3D87B 4K07A 4PJCF 1CICC 4LSSH 4XNXL 5KS9F 5IMMB 1IGFH 1IGCL 3TM6A 2UZYB 3TF7C 5I73B 3LD8B 2H32H 2A38A 4RWYL 4OM0H 3BEVA 5KS9A 4H8WH 1WAAF 4XBGB 3VGFA 3EYFA 4UB0H 5GISL 2PW2A 5GZOD 3VFVB 4WO4C 1A6VL 1TXKA 2YD8A 1BIIA 4WFED 5F7DB 1AJ7H 3WN5B 1WIPA 5ACLA 3ARZA 3TA3A 4LGSB 1S7TB 3FT3B 5I0ZA 1JGLH 4JN2B 2VNCA 3BJLA 3KAAA 5I8EA 4M7LT 2K7PA 4NKIL 5HGAA 4AEFA 3RGVC 5HHPA 4KVCH 5LGJB 3GSNL 2VUYA 3I6LE 1FP5A 4XTRC 3QIBB 1RZIA 2HVJB 3JSSA 4ZTPL 5HI3C 3LS4L 1DBKH 2PW1B 3TIEA 4Z7WB 1HHJA 1T1YA 3HI1B 1KV3A 1IAOB 4Z95H 3VXRB 3B4NA 3JV6B 3FO2A 4PG9A 3WO4B 1NJ9A 4ONFH 3RZWA 4Z78A 1INEH 5BW7C 1A14L 1GGYA 1U91B 4LAQL 3WHXA 3DOSA 3DGCR 4EUPB 1FNAA 1UWEH 3ZKXC 1TTGA 4NO3A 1B0GA 1ONQA 5DMIL 4HIIA 5FV1L 3UJJH 4B53A 2G9HB 5KAQG 3UPRA 3DUSB 3W9DB 3EO0A 5JHDA 1S7QA 2VN4A 3STBA 1DLFL 4KQ4H 3GSXA 5FYLD 3VD9A 4G8GB 4PJBB 2XWTB 4KVNH 4MS8C 3DRTB 5J12C 3HPJA 4NPYA 1R0AL 5EH1A 3C8DA 3I6GB 3RPIB 2ATPB 3SDXE 4KMLB 4TSAH 4RNRB 1O5DT 4RFOH 2GT9B 1T1WB 4N0RA 4GRWE 2EDTA 4AG4L 2ADGA 4EXPX 3ZDZF 5DMYA 4NP4H 2ZOLB 2MJWA 5CS7A 4Y19E 1JGEA 2VAAA 4HX1B 5GGSB 1JGVH 4IOIA 1UWGL 4G9FE 2BXYA 4ETQA 1TZIB 2GITB 4OCSH 1EEQA 4M9OA 5KSBB 1S9WB 1KULA 4MJ5B 1NCTA 3WSQH 4U7KA 1YEJL 4PP2B 5C0CE 3I75B 1GGUA 1YQVH 4BFEA 5HDQL 4HFUL 2PO6C 3QJFB 3MACL 3MXVL 1HILA 3ARBD 4HKZA 2IPKA 2DQTH 3OF6A 1QR1A 5GGVH 1PVHA 3ARPA 3GNML 2UYLB 4HUWA 4HKBB 2IPTL 4S10A 1HWGB 4UILH 4Q6IB 5DK2A 1KN2L 4NQVA 1FH5L 1U92A 4HMEA 2AJZA 3IU4H 3B5HA 5C0EA 5D93C 2CK2A 3CSGA 3IRZA 2QSTA 2NPLX 5GZND 3REWA 2APBA 3CMGA 2VR5A 5KVEH 4R3SB 5E08H 1DQJB 2CKBB 3JTSB 5IV2B 3SDCC 3BMVA 3HC3H 5IP4A 5JPMA 3QZWB 4LPWA 5HD8D 4L3CB 1A9BB 5DFVD 4XVTH 5IMMA 1UVQA 1JRHI 2DM4A 3KJ4C 3FT4B 3KYNB 3PG2A 5ALCL 5I71C 1RIHL 1RIVH 5ITBH 1HKFA 2R0WL 4ZUUB 4ZPVB 1XR9B 2QSQA 4XBGA 1TQCC 2D03H 3DX9B 4D9RE 1OTSC 4QY8B 3QG7L 4UNUA 1S5IH 3RWEB 1YMME 3RKDC 3X3FH 1HXYB 2JELL 3NPSB 2PCPB 5F7DA 3FL7A 4ZFGH 3BUTA 1K8DA 5ACMA 4JFPB 5E8EB 3O2WH 3IFPB 1S7TA 3FT3A 4XP9L 4HWEH 4WTWA 4JN2A 5C08B 4D8PB 3VFPB 3CFEB 5F89B 3GK8H 4XVSH 4JRYD 1X5HA 4Z7WF 5HI5C 5LGJA 4PRHB 1CXHA 5I75B 5GGQH 3QIBA 4Y8DC 2YPLB 1DBML 2HVJA 3HMXH 3QR2A 3QUZB 2ZCLL 2PW1A 4Z7WA 1S5HB 1DZBA 4M93B 3BESR 1IAOA 1IAKB 1GZQA 2EDWA 1I8LA 3FFCB 1RHFA 3JV6A 2ADJB 5SWSD 4KPHL 3LZFL 5DVKA 1PG7H 1W0VB 1CLYL 4NSKB 1OM3H 1U91A 4EUPA 2OBGA 3RGHA 4L4VB 1YNLL 4N68A 2MCG1 1AQKL 2DQJL 1JTTA 4ELMF 2G9HA 3DUSA 1ITBB 1KLUB 4XB7A 5CGYC 3W9DA 4WVRA 4JRXD 4Z8FL 5LCVL 5FYJL 4G6FB 1MFAL 4DQOL 3MUGB 4YXLL 1QSFD 2V7NA 5ETUB 4G8GA 1NCAH 4PJBA 4Z7VB 3DRTA 4K3JH 1JZ8A 3I6GA 3RPIA 2ATPA 1U0QA 1TQBC 5CD5C 4RNRA 2GT9A 1T1WA 4GMTH 1F4HA 3MV01 4XPFH 4YHNB 1F2QA 2MQCA 1C5DB 4HX1A 5GGSA 1U8MB 2QQNL 3H9SD 3AXLB 3GSWB 1LK2B 1TZIA 2GITA 1ZLWK 2VXQL 2DQUL 5KSBA 1NGPL 1S9WA 4UT7H 4MJ5A 4YHKL 6CGTA 3CLFH 5L6YH 4GAYB 4PP2A 1ZLWH 3I75A 3L6FB 3DHJA 1F4XL 4J7RA 2HT3C 1SEQH 3QJFA 4ZUSB 3S35L 1AGDB 5C0GB 4JFFB 3TIDB 2ESVD 4Q9RL 2UYLA 3MO1B 4JM2C 5IVOA 4HKBA 3DXAB 4Q6IA 4LSRL 3PUCA 3OJ2C 4HUKB 5CD3B 3RU8L 4OV5B 1YYML 1EUUA 3ZT6A 5E56A 5IG7A 3V2AR 4JFZL 1YEDA 4NHUB 1FPTL 3FQNB 1PAMA 3LIZH 2UVEA 4R3SA 1DQJA 2CKBA 1OWRM 5D72L 1F4YH 3JTSA 5IV2A 1OAYL 4LSSL 3B9KB 1K3IA 3QZWA 1WT5A 3PL6C 4L3CA 1A9BA 3VWJD 4F7CB 2C4FU 1WISA 2YXMA 3NCYS 4OIAA 3FT4A 3KYNA 1EFXB 3P0GB 3RBGA 4Y4FD 4LCYB 4P2QB 1SMOA 4N0FB 2NX5B 3TO2B 4RMRA 2Q6WB 4ZPVA 1XR9A 5IESL 5I2IB 3WFCH 5IIEB 1ZE3C 4OLZH 1JWSB 1DL7L 1P6FA 1V7MH 4HS3B 3DX9A 4XAWH 4QY8A 1FZKB 1RU9H 3WV0A 1K85A 4IRJC 3RWEA 1HXYA 2PCPA 5FGCE 5HYQB 5L2KB 3S4SG 3Q1SH 4B7IA 4JFPA 5E8EA 3IFPA 3TPUA 2DQEL 5IVZB 1V3MA 4LPVA 5C08A 5FCUL 4D8PA 3VFPA 1UENA 3CFEA 3JV0A 4FMKA 5T3XL 5HDBF 4YE4L 3H2WA 5F89A 1E4KA 4ZOEA 5GRVK 1OAZH 4RA0C 3DVNB 3NGBB 5JIKA 3LHPL 4KTDL 4BQ6A 2OL3H 2YPLA 3OGCB 3QUZA 2C7UB 2AS5M 3MLWH 1S5HA 5L88L 2CIIB 1IAKA 3FFCA 4JDTL 3T0BA 2ADJA 3MLPA 1EEYB 4PJ8B 3HTLX 1W0VA 1U36A 4NSKA 1CTNA 4LQFH 5D7IE 4CMHB 4NQUA 3U4BL 3RGVD 2P8MB 3U9UA 1FAKT 1QBLH 4L4VA 5J3HC 4CVZB 2I5YL 3EBAA 4LSVH 4U6YB 2ED8A 1NFIB 1M4KA 3OSKA 4XTRD 4MJID 1KLUA 3RY5A 4WWKB 1D9KC 1LK3L 3MUGA 2C4XA 4BZYA 3B9AA 4Z7VA 2GJJA 3PHSA 2NXYD 2XRAH 5F7NC 4DKFL 1HHGB 3PWPD 5JPNB 3W5NA 4OQTA 4P9HL 1GC1C 2VITB 4YHNA 2VL5B 1H3UA 2Z31C 1L6XA 5KJRL 1C5DA 1J8HE 3V6ZB 1U8MA 3LQAC 5E9DD 3AXLA 3GSWA 5AYQA 4IDJH 1LK2A 3PF2A 5I1KH 3UYOD 3CMOL 4MNGB 1MCJA 1R6VA 1BMGA 4GAYA 3ECBB 3L6FA 3PGCB 5EUOB 4UBDC 2AVGA 3NAAH 3UYPA 4ZUSA 1AGDA 2ILLA 1F42A 3HR5B 4JFFA 4PJ5E 4KK9D 4TPRH 3TIDA 1BF8A 4P2RE 4M5YH 1MI5E 3OG6B 3HZYA 3MO1A 5B22A 5CP7B 3CLEH 3DXAA 4GXUN 4Z7NE 1U3HD 2CGRH 1UACL 3MRGB 4XPHL 3QDAA 3DBXB 4OSUL 4I0KA 5CD3A 4OV5A 2XIDA 1MWAH 5E08L 1X5LA 3ZLQC 4MGXA 4NHUA 2VE6B 5JQ6L 2DLGA 2FDBP 4HJGB 3HC3L 3MV8B 4WFFE 2L0DA 3B9KA 4XVTL 3W81A 5EB9A 2PXYB 4ERSH 1MCQA 4U7MA 4F7CA 1U8OB 3V0VA 3BIKB 1EFXA 4O9HH 5F71A 4LCYA 4P2QA 2E7HA 4HPOH 4BKLB 1CU4H 4N0FA 2NX5A 4MB4A 3TO2A 2Q6WA 5IIEA 5I2IA 3FQTB 2ICWA 1N7MH 3DX8B 2DL2A 4HEME 4HS3A 3VCLB 2IAMB 2M2DA 2V5RA 3TNNB 5DMJB 1BJ8A 1IILE 3LKNB 3QHFL 1SQ2N 4PB0H 1QBBA 2DN7A 2P48B 2UY7A 5HYQA 5L2KA 3S9DB 5F9AC 3JV5A 4MVBC 4PJHB 5BRZB 1VGEL 5IVZA 1SHMA 5JUEH 32C2B 1U8NB 4U1JB 5HDLA 2F53B 4E0RB 2D7NA 2DF3A 3DHMA 4U4BA 3BIAX 1N6UA 3N1QC 3ARQA 1JFQL 4BSJA 2HJLB 1SJVA 2XZAL 2E27H 3OGCA 2UY6A 5C6TH 3DVIA 4F7TB 2IJ0C 1CQYA 2C7UA 3O6FC 1KT2B 5C0BB 2NY5L 3ARVA 4KDTA 3ZL4L 2CIIA 2HFGL 1EEYA 4PJ8A 2GCYB 5CWSB 1T6VN 2A73A 5HVHC 2P8MA 2X44D 3DGGB 5HI5D 4TUKL 1RZFH 4CVZA 1ES0A 3BFOA 1MCKA 4U6YA 1NFIA 1U8KB 2DJUA 3K2UL 2UZIH 5GJTH 3MUY1 4WWKA 3RKPA 1QTYT 3VXRA 3CC5B 1P84J 3LB6C 1HHGA 3HNVL 1IGTB 5JPNA 4XP5L 3QPXH 3DUHA 4D9QE 4OGXH 2Y7QB 4Z18A 3LCYA 2VITA 4PRIB 5GS1C 4IRSB 4I77L 3KJ6H 1KENH 4ZQKB 3V6ZA 1CGYA 1F8TH 2AABL 4FZ8L 4IIQA 1OTTC 3OKOB 3U0PB 3R1GH 2J4WH 3TN0D 2N1KA 3GJFK 4MNGA 3CVHH 1DFBH 2MCPH 5CD5D 1L7TL 1SEQL 3PGCA 1YPZB 5EUOA 1IM9D 3MV7B 4LCCC 3DROB 2PNDA 3HR5A 3RX8A 4F7PB 4QOKE 5TFSL 2YZ1A 1I1AC 1OGAD 5CP7A 3SCMC 1A6TB 4OLEA 1PLGL 4U1GC 3MRGA 3AS1A 3DBXA 5EULV 5BZDB 2FBJL 3GSOB 3QNZB 4QXWA 3LIZL 3MLZL 4NQDB 1ULVA 5CJXA 5CLWA 1F4YL 2VE6A 2HT3D 4OFYA 4HJGA 1ACZA 3VXMB 3MV8A 5I30H 4LSQL 4GS7B 2YR3A 4NWTL 1ZGLP 3B6SB 2VLME 2PXYA 1F13A 1CGUA 1U8OA 3BIKA 4LARL 5IMOB 4G80B 1DJSA 1EAJA 1TETL 1FVDB 4BKLA 1I9IH 3V0VB 5TDNB 3FQTA 2ICWJ 3DX8A 3VCLA 5F3HB 1JPSH 1LO2H 3HS0B 1BAFH 3TNNA 4MJ2A 3CZFB 3GI9H 1IGML 4GLRH 1OAKL 3LKNA 2Z4QB 2XKSA 2B39A 3GHEL 3JUYA 2IBGA 2BJML 5I1DB 2Y36H 3VWKC 4PJHA 4U31A 5BRZA 4HLJA 3V7AG 1IGIH 5JA9A 5HGDB 3P30L 4PJXE 32C2A 1U8NA 4HWUA 4U1JA 3ALPA 4XNYH 3HE7D 5MEOB 3BKJH 2F53A 2IMMA 1OSPH 3IDJB 4TSCH 4WUUB 4E0RA 1Y6MR 1MJ8H 2EIBA 1YN7B 4TVPH 4ZTOH 2R56H 2HJLA 4FQHB 4TSBH 2GK2A 2Q3ZA 2MQ3A 4HC1A 4F7TA 1QLEL 5MI0C 5C0BA 4YHYB 1IAIM 4KK8C 4K2UH 2Q8AL 2GCYA 1GVIA 5CWSA 3VFTB 3TVMA 2BMKB 3QBTB 4XH2B 5DURB 3DGGA 5DGRA 3KLDA 1QFWL 1KJ3L 2JE8A 2HH0H 3D6GA 5IROC 3NZHH 1KFAL 1FGVH 3CC5A 4K9EC 4O02H 3ARDB 3SQOH 1ZLSL 4P59L 1IGTA 4QEGA 3IF1B 4O58L 5IHZB 2VL4A 5DEGB 3CFJB 4XHQA 5CINL 3WD5L 4XI5C 2GI7A 2AJVH 4Y1AE 1I3VA 2Y7QA 3PGFL 4ODVL 1XFPA 4PRIA 3BH8B 3RWFB 1RZJL 4IRSA 4ZQKA 4ODUB 1TZGL 2W0LA 1FNSL 1I1CA 1YPZF 3OKOA 5CJQL 5B38B 4KTEL 3U0PA 4JHAH 2FB4L 4XPBL 1J5OL 1MCRA 1Q8MA 3QFJB 4XNUH 3C5SB 2BHZA 1NANI 1CL7L 1FFPA 4GKSB 1X5JA 5SWZB 3GKWH 1YPZA 4LMQI 4QRPB 1CFNB 4JGUA 3MV7A 3FZUC 3DROA 1NBYA 5CFHA 3MJ8B 4LCWB 4F7PA 3A6BH 5I8CB 3DPBA 3R8BB 1FYTD 1YEGH 5E5RB 1A6AB 2CGRL 2EO9A 2FATH 4G8IB 1A6TA 5ELIA 1BFVH 4YHIB 1BLNB 4FFZL 4NQEB 1AI1H 1UM5L 4LSTH 2WLZA 4LK4A 2NZ9D 1KB5B 5AYUL 3GSOA 3L5XL 3QNZA 5EZIH 5BZDA 2AJYL 3S6CA 4NQDA 4QRSB 2BY3A 1P4BH 4M6OH 3SGJC 1I4FB 5FUCC 5FHAL 3VXMA 2GW5A 3UTPD 2FX8L 2F54E 2YD7A 4ERSL 2H2PC 5D7JC 4UT9H 3B6SA 3V52L 1UFUA 3W5MA 4EZMA 2V7HB 5IMOA 3SJVD 2VDOH 4G80A 1MNUH 4HPOL 2NY6B 1UB5B 2ZG3A 2FBOJ 3PWJB 1FVDA 1S7XB 3WNPA 5JMRA 3K3QA 4EQ2A 4XMLL 5TDNA 1NFDE 1A7NL 1VPOL 5FXCH 5BMFL 3RX5A 3MCLH 3T08A 1YNTB 1NCUA 5F3HA 2EDXA 3KPSB 4C56D 5D70L 3HS0A 5FYKL 2DM2A 3CZFA 2UWEB 4KRNA 2Z4QA 3S3SA 15C8H 1WSST 4MZ3A 5I1DA 3ROOB 3QDJD 4OLXH 4MWFB 5IOPB 4MQXC 5F1NB 4RMWA 5HGDA 3ARYA 2HKHL 1NQBA 2VC2H 1Q0XL 1DDHB 3QAZC 1GL4B 3FQUB 2AQ3A 3VGBA 5MEOA 4Y2DC 4QYOB 2BSTB 3IDJA 4PV8A 4WUUA 1NPUA 3MBEC 4LDLB 1YN7A 4JO2L 4A2MA 4XAKD 5C6TL 1Y6KR 4FQHA 3VFMB 2V9QA 2Z93A 4Y4KB 4MNHB 3HB3C 1NBQA 1D5IH 5BS0B 2EYTB 4OTXH 3VI4E 1ZT1B 2VXSH 5EZOH 5E1HB 2BMKA 2EDLA 4XH2A 4FTVE 4JO1H 1I9RH 1DUYB 4L8SB 2XTJB 4F3FB 5LBSH 1KPRB 3OPZH 5CZVL 2UZIL 2H26B 2JLLA 4YHLH 5DJ0B 1TJGL 5CJ8A 4P4RB 4JPVH 1N6QL 4W4OA 5D4QA 3P4OB 4KY1H 4Q97A 4UV7L 3VFWB 1DCLA 1GHFL 2YMXH 2OI9C 5AWNH 3QZWG 3ARDA 4Y4HC 4C55A 4XXDB 4LIQE 3LKQB 5CJOH 2P5WB 4FMFA 5IHZA 3B3IB 5DEGA 3B5GA 3CFJA 1IBGL 1FNLA 3CSPA 4OGXL 1T03H 4PY8I 1JJUA 5DLMH 5FGBA 5F1SA 2E7LC 2BVTA 1KENL 3BH8A 3RWFA 2OJZL 1F8TL 3HE6C 4P48A 3I2CL 1B88A 1NLDH 4ODUA 1SJEB 4NUGH 4DCQB 3TZVB 4LRNH 5E4IA 2J4WL 4JRYE 5B38A 1CLZH 3OXRB 1DFBL 4YHPB 2PTUA 3QFJA 5SV4A 3SGDI 2PYEB 4XXCA 2CMRL 4AIXA 5D71L 4AEHL 1H5BC 5KSAD 2YRLA 4GKSA 1KPVB 1V7NH 4ZS7L 5TQ2L 5D2LE 3WE6B 5SWZA 4M48L 3K8MA 4QRPA 1CFNA 1OD9A 4AEEA 3MA9L 4OI8A 4JQXA 4G6AC 3V6FB 4JZOB 4DGVL 3MJ8A 4LCWA 5I8CA 1MCWW 1A6AA 1OTTD 4G8IA 1U8LB 4YHIA 1BLNA 4HDIB 4NC1C 4NQEA 2VLJE 2A77H 4NN5B 1KB5A 4DZBB 3KHQA 2DAVA 2WAHA 2VXUL 4H88H 4L1HA 4QRSA 4BZ2H 1I4FA 5I30L 4PFEA 1QSFE 3IJHB 1W8NA 3QULB 5KZCD 1DANU 2V7HA 3PWNB 3ZTJH 1I1AD 2XI9A 3SCMD 1UB5A 3PWJA 5LVEA 1S7XA 4HG4K 5FM8A 5F9OL 3V4PL 1YNTA 4ONGL 3KPSA 4A6YH 1I1FB 2R0LL 4UV4H 4ZXBB 1UC6A 1E6JL 2KPNA 1QLRB 2ORBL 2B4CC 4PRAB 4YIQB 4G3YL 4FFWC 1KEGL 5IFHL 3T2PA 1IGIL 2NY3C 3ROOA 4MWFA 4R4ND 5IOPA 5F1NA 1UYWL 4OI9A 4DW2L 3UJTH 2Y9RT 2DJ4A 4NQXB 1DDHA 1AHWB 1HHKB 2D4DA 3FQUA 2CKBL 4KKCC 2NXZD 2BSTA 5I8OH 3ZKXB 4JQIH 5MEPB 1Q1JH 4KUCF 3VFMA 1MVUB 4Y4KA 3EHBC 1X6LA 1UZ6E 4MNHA 1N0XL 3OKLB 4J4PA 4ODTL 1QO3B 3BPLC 5DQDH 5DEFB 5BS0A 1CXFA 1ZT1A 2ATKB 2YD2A 1ADQH 3C2AL 1FORH 4OGYH 4LSPL 3KPRE 1DUYA 4L8SA 1JHKL 4F3FA 1KPRA 3Q3GB 4U33A 1NBVL 4Z7UF 2H26A 2HH0L 5DJ0A 4P4RA 4B5EA 4XNZC 2DM3A 1RMFL 1LHZA 3P4OA 1C16B 1BEYL 2ARJQ 4P3CL 3VFWA 4HUXB 1BJ1H 4XXDA 1B0WA 3LKQA 2P5WA 5DHYA 3B3IA 2V9TA 2AJVL 4I2XB 1QACA 2QHRL 2R4RH 2CDFB 1JYVA 5C0DB 5JW4N 1X7QB 3DVFA 2IBZX 4X9HA 1S7VB 4M62H 1ERNA 2YKLL 1SJEA 4IM8A 4L3EE 4DCQA 2ERJC 4RISL 3TZVA 2DQIH 2D7QA 3OXRA 1EH9A 4YHPA 1CTOA 1T0NB 3MYZA 2JB6B 2PYEA 1URLA 2ED7A 4HT1H 1EHLL 1KPVA 4XI5D 5IK3B 3W0WD 3WE6A 1K9TA 2WBKA 1T2QL 5F3BA 3D9AL 3P4MB 2V5YA 5E8DL 3CX2A 3F6IA 3V6FA 3BAEL 4JZOA 3OX8B 3UEZA 3C6SB 1CICA 2EYRB 3ELAT 1UCBH 4GRWB 5IBTL 5I71B 3BQUC 1ODAA 5GS0H 3QHZL 2YC1B 1U8LA 4HDIA 5GRWA 3FB8B 3IFNL 4OQTL 5I6XC 4Y19B 1JNNL 1HNGA 4DZBA 1TQCB 5BV7H 4G9FB 3U0WH 1J0HA 4JGJA 4WO4A 3C60D 4P2OD 5HJ3B 3T2QA 3FZUD 2L4OA 3IJHA 1WF5A 4YBLC 4K55A 3QULA 4NRYB 5C0CB 4YR6B 2CIKB 4DN4H 1W72B 4H25B 5DWUL 4BK4A 1Z5LB 3BT2H 1A1OA 3GBML 4M43L 3B8YA 4ZXBA 5F44A 2G2RB 3DI2B 3IXAB 5JR1H 1QLRA 4PRAA 5D7JD 15C8L 4YIQA 2AEIT 2VISB 1OB1B 4YFEA 3W39B 4R6UA 4ZO8A 5TDPB 2W65B 4X4YB 5K9JH 4E42B 4NQXA 2VLLB 1AHWA 1HHKA 3ZKSD 1BQLH 4W4NA 5E6IC 3HC4H 2EXWC 2XICA 5AUMB 3QDMD 3QNYB 4GW5B 4B0MM 1HQ4B 3VD4A 4YC2B 5MEPA 3LN4B 1J9CT 2J6EH 1CDHA 4KKAC 4X6DF 5DK3A 1MVUA 2OYPA 4M7JH 2ICES 3RWCB 2VIRB 1MUJB 3OKLA 3D25B 5JMOC 1QO3A 1A64A 1O7VA 5DEFA 4KDVA 1YMMB 1LO4H 5DJ8B 2HWZH 5CEZE 5DHVH 4NZRH 2E9JA 3LS5L 1VACB 3BKML 3P0VL 1KB9J 4JO1L 4X7FC 3MBED 1QNZH 4D3CL 4G5ZL 4R4BB 3Q3GA 1G7LA 1ZANH 1GIGL 1I8KB 1IC1A 3H3BC 3HB3D 4XZUB 3VDBA 1Q9LB 1CDJA 4GT7A 4HUXA 4HUMB 3TV3L 2EEBA 4G6KL 5EU6D 3QEQD 5JW3H 5DA4A 5E2TL 4I2XA 1OARH 5EFIB 1IE5A 4GKNB 1I3RB 4N8CL 1RZ7H 2CDFA 4XPGH 5C0DA 1OVZA 2IWGA 1X7QA 2VZ1A 4NO0D 4GAJL 1S7VA 4WU7B 12E8L 1NLDL 2VDQH 5I8KL 1I3GL 1NAMH 4HGMA 3KGRA 4JREC 1YECH 1LO0L 2D7PA 1ZHKB 4OB5L 1KCRH 3DWTA 4XT1C 4AIZB 1T0NA 4Y4HD 2LQRA 4KKLC 2JB6A 3FB6B 3VGAB 3SDXF 1Z2KA 2WWKO 2DMKA 4R2GD 4KMTL 5IK3A 1JYWA 4GFTB 4GRWF 1MLBB 5I1AB 5FYJE 4YBHA 3ZMRA 3P4MA 4OLVL 2B0SH 5D8JH 1P9MA 7FABL 4I3SH 3OX8A 4LEXH 3C6SA 4WGVB 5E2UH 5EDXA 2MNUA 3SDXA 3U46A 4NM8H 3MMEB 4FQIL 3EUUA 4PGDB 5J7CC 2YC1A 4P9MH 5DDHB 3U0TA 3FB8A 4ZS6C 1ZLVK 4BFGA 3BDBA 3ZE0F 4Y19A 3EGSB 3WS6C 4G9FA 1AE6L 1ZLVH 1YYLL 5HYSB 5HJ3A 1AY1L 4JEGB 3UZEA 4GKZB 4QRRE 4NRYA 2FD6H 3HR6A 3SPVB 5C0CA 2RGSA 3VH8B 4JY4B 1BOGB 1JF5A 4NO5B 4YR6A 3I85A 4LLAA 4ODSH 5IFJB 4JM4L 1CL7I 2CIKA 2Z35B 4TTGA 1W72A 3ZKMD 4APQD 4LHUB 2W59A 1Z5LA 1QRNE 4OZFH 4OT1H 1RHHB 2R39A 4XC1H 2PYFB 2G2RA 5INCB 3IXAA 3HI6H 5JOPD 2P24B 1Q72L 2VISA 2XXMB 5E99L 1OB1A 2NY7L 5L0QC 4FHBD 3W39A 4HCRH 1K4DB 1DVFC 5TDPA 3QG6B 4I3RH 5TPWH 5F9DC 1L0XA 4Y5VC 4E42A 5I74C 2VLLA 5DGQA 2VZSA 2EEAA 1M71B 3JV4B 1OD7A 5GS3A 4F58H 1XEDA 2CH8A 1XGRB 2Y06L 5AUMA 4FN0A 3QNYA 1HQ4A 2ZOKB 2CUIA 4V1DE 3NIGF 4NO2B 3RWCA 2VIRA 1MUJA 1DQLH 3D25A 1D9KB 2ZUYA 1VADB 1YMMA 5DJ8A 1Q0YH 5D6DC 1UA6H 5D6CB 5FGCB 3GRWA 1F5WA 1VACA 4KHTH 4KKCD 4X80L 4LLWB 3NBNA 2W1NA 5B21A 1CLOL 2YWYA 4R4BA 4HH9B 4WEBH 3DTXB 5EORH 4X6CF 3VXTB 1I8KA 4I1NB 1CR9H 5T3XE 1DQDH 1PZUB 4U6VH 4XZUA 1Q9LA 4XRCB 4JKWA 4WW1B 3QUYC 1SBSH 1FIGL 2X7LB 1IGJB 1Q38A 4GKNA 1I3RA 4JM2F 4O4YH 4HC1L 3RZCB 2D7OA 4MNQB 5C07E 3WUWB 4WU7A 2DQCH 4GOSA 5CP3A 4F37K 1YNKL 4Y89A 1EHNA 4M7KH 1WUNT 4M6MH 2AQ1A 4JM2A 1JZ2A 3V0WH 1QBMH 1ZHKA 4M4PA 3CSYA 4AIZA 4FRWA 5AG8A 3Q0HA 1TIUA 3FB6A 2FO1A 1FLRH 1S7WB 5GGSY 2WIIB 1MLBA 4NKQB 5I1AA 2FGZA 5K9QG 4NN6C 4UDTB 2DLFL 5E4EB 4QT5B 4TRPH 2B7DT 3ULVD 4WHDA 1IM3B 5GS0L 2I60H 3MMEA 4U6XB 1T0PB 1KELL 1R24B 5DDHA 4EOWH 1J8HB 5ADPH 4DUVA 1BWMA 2IG2H 1IGYB 5GRJH 3U0WL 4CADB 1YEFL 1RIUH 7CGTA 5HYSA 3QIUD 3D85D 3LRGA 4WY7L 3B5TA 2A6DB 4PS4L 4GKZA 1MCIA 3U7WL 3SPVA 1EGJH 2LVCA 3VH8A 2KQNA 4JY4A 5FUZH 1BOGA 4FZEL 4NO5A 4DUXA 4HF5L 3BQUD 4OIIL 5IFJA 4PJ5B 2EICA 2Z35A 4OFIA 4JFDE 1MI5B 4LHUA 4MAYD 2W0PA 3GMQB 2FEEL 1RHHA 4GAGL 5D1QD 4R96B 2PYFA 3NCJH 5INCA 4U1HB 5DVMA 1F4WL 4LVNB 2L7JA 4LP4A 4G43B 1C7SA 4C4KO 2P24A 2HA1A 3O6FB 3QCVH 4HXBH 5F88B 1K4DA 1CD0A 4GXVH 1RUKL 2DTMH 3QG6A 4EBQH 2CSPA 2YZ8A 3RDTD 3U7YL 5J56B 5D1XB 1M71A 5HVHB 1XGRA 5B38G 4P9HC 4CJ1A 4X6EA 4F33B 5ESAB 1I1YB 4S1SH 3D0LB 2ZOKA 2B5IC 3O81A 3MREB 3HG1D 1IZKA 3M17B 4NO2A 5C6WH 2IAND 2EXYD 5D9SB 3NFSL 4N1HB 3O8XD 1D9KA 4UT6H 3SDAD 5IFAL 2F9BT 1VADA 1NUFA 4QHUB 4BQBA 5HVWA 5D6CA 2N7AA 4JFEB 2P49B 1KJVB 2RB8A 2FJGB 1CD1B 2VXTH 4LLWA 1TNNA 1QSEE 2HN7B 3QQ9C 1P1ZB 3WIHA 5GS1B 4HH9A 3NACH 1KYOK 4KKAD 4JKPL 3DTXA 1IC7L 4LNRB 1TLKA 1QSZA 3RTQC 3WCYA 4ISVB 3VXTA 3GM0A 1P7QD 1UM6H 4J6RL 3ZT7A 4XRCA 2XYCA 5IHUH 1PGRB 3TJHD 4WW1A 5J0BA 1RZKL 1MCSA 3MODH 4I0PC 3SDDC 5D7IF 2X7LA 1IGJA 4XPGL 4QRTB 2BNUB 2MKWA 2GKIA 4WW2C 3RZCA 4M6AA 4GRLC 3BZDA 3IAQA 2VDQL 2LE9A 3WUWA 1CCZA 2Y5TB 4AEIL 2OMBA 4PBXA 1NDMB 3DMMD 5HHXH 4P46C 3T2OA 3TT3L 1GAFH 4GMSH 4ZAKC 2FLBT 2KH2B 3DIFB 4KUZL 3WS3B 3T0WA 1S7WA 4HUVA 2G5RA 2WIIA 5LG1A 1SEBB 4NIKB 4XCEB 2AI0H 4G6ML 2M26A 4IOFC 5ESQA 1SY6H 4PJ9C 4UDTA 3F7VB 4QT5A 3CD4A 5F7HA 4Q2ZB 2ZPKL 1IM3A 4XVUD 1BVZA 4U6XA 3OGOE 4RCAA 1KN4H 4OJFH 1R24A 3WLWC 3OR7B 5I1JH 4ZSOE 1J8HA 3I3DA 1IGYA 4CADA 5L9DL 4OCWL 1DUZB 4EI5C 5IJKC 1YJDL 2XKUA 2XACC 2A6DA 3SO3C 4LVHC 5D7LD 1G6RH 1T5XB 4I3GA 5IVXE 2NY5C 1XF1A 2MFNA 4DVRL 4Z7NF 2OTWB 2GJ6D 5A16B 3ARXA 4PJ5A 2JB5L 4ZS6D 4QOKB 3MRIB 1MI5A 2OSLB 2AP2A 3GMQA 4JKLA 4YUEH 1OTUC 5TJWK 4R96A 2R4SH 2BK8A 4U1HA 4G43A 1CFSB 3S3PA 1AH1A 2BSED 1G0XA 3O6FA 5F88A 5FHBL 3BP4B 2F74B 5TPWL 5D7SH 3GM8A 2BFVH 5D1ZC 1KB5L 1BJMA 1JTOA 5D1XA 4KZEH 2XN9E 4WCYH 2X89A 2O5YH 4H1LH 4KRPD 4K8RH 2X1XR 2H8PB 2HFTA 4QCIB 1WCBB 4H0HB 3DYOA 5ESAA 1I1YA 4ZUVB 3D0LA 3FONB 3MREA 3D2UB 3ZE2E 4C54A 1DQLL 3AVEA 3M17A 3HAEH 5D9SA 3ZYJA 3LDBC 1OT2A 1UA6L 4QHUA 1RUAH 3UTSE 4IMKC 1W72H 5F96H 2HLAA 1PKQB 3UTTD 3IGAB 4ZO7A 4JFEA 1KJVA 1NBZB 4PB9H 2FJGA 1CD1A 1QKZH 1WLHA 2HN7A 1S7SA 4RA3A 1P1ZA 4PJXB 4WEBL 1VFMA 5GS1A 4LNRA 4ISVA 4X5WB 4PJAE 1J88A 5I1EH 3UC0L 4FABH 3DUUB 4I13B 1E0OB 3C09C 1OAUH 1WBXB 3ILPB 4QRTA 2E5EA 2BNUA 3IKCA 2LAGB 4NNXB 4XBEH 4WJ5B 3DARA 4EN3B 5F1IB 1TITA 3RVTC 2Y5TA 4LKCB 3MRCB 1A3LH 2O5ZL 2ICWI 5GRUH 1NDMA 5T5FH 1FLTX 1YEIL 3K80A 5A2LH 4Z7QF 3MLRH 2OLDA 4TULH 2ZCKL 2APTA 3F12B 2NY2C 2WWMD 3DIFA 3LKPB 3WS3A 4P4KD 1WEJL 3INUH 4DTGH 4PIRF 3HI5H 5HDOA 3OWEA 4XCEA 5E70A 2HTKC 3BKYL 4LLQB 3FO9B 2QQLH 3F7VA 2D31B 5JW4M 3TFKD 4Q2ZA 1BM3H 1WFOA 5BXFB 2ZUXA 4JFHD 4WEMB 1E4WL 1MIML 4ORGB 3IDMB 1KTLA 3OR7A 1T22B 3L3HB 1KJ2H 1DUZA 5M95B 1J1PL 3PIQB 5ISZE 3L1OH 1BGXL 2YPKB 5T1LB 1T5XA 5F9JA 4QTHB 2OTWA 2Y72A 3EJYC 5A16A 1MQKH 1CBVH 3MRBA 1BVLB 2AV7B 4QOKA 3MRIA 3QAZB 3MRPB 3B43A 4YEEA 2EKSB 3EYUL 1AO7D 5DT1L 1CFSA 4FNLL 1NH6A 3TA3C 5IQ7L 4GXVL 5J57B 2XQBH 1JNLH 1DQMH 2DTML 2F74A 4GG6E 4QGYA 4MJ4A 2XA8H 4FFVD 2E8ZA 1KCVH 3GIZH 2F54B 3PP4L 1N8ZB 4JFXB 4K7FB 5F70A 2IQ9H 1TMCB 2BRQA 3ES6B 1PW3A 3GSQB 1WZ1L 1ZT4B 2H8PA 3L3IB 4NN7B 4QCIA 3U2SB 4JY5L 1WCBA 5DD0H 1NFDB 4ZUVA 3VDCA 3FONA 4PRBB 3D2UA 2DIJA 2EH7L 4FQJL 3U36B 3N85H 1A1MB 5IROA 3W2DL 5C3LD 3UO1H 2OI9B 4KJWC 1INDL 1MHEB 1PKQA 1R3JB 3IGAA 3M8OL 1KGCE 1NBZA 1II4E 3KWWB 1NGQL 2J88L 2RCSL 5DVOA 4PJXA 3HE6B 3HA0A 3ARBB 5A2FA 2VDPL 4YX2H 3MRHB 4X5WA 1C1EL 3D39E 4D2NA 3DUUA 4KJPC 3KDMB 1F3JB 3MODL 3QUMH 3OZ9L 4YK4C 4O5LL 1WBXA 4RIRB 1Z9OA 1PZ5B 2DTSA 1NMAL 2B8OT 3LKSA 5L8JB 2LABA 3FHQA 4NNXA 1IC5L 4NC0B 4WJ5A 4EN3A 1QR4A 1NC2B 1TPXC 5F1IA 2LTQC 4DKDC 4LKCA 3MRCA 3U7AA 1MFDH 1S9KC 4HMCA 5FV2A 1VA9A 5F97E 4KC3B 3S96B 1HHHB 1LILA 4F2MB 4NGHL 3AY4A 3F12A 4WUKL 1A7QL 3LKPA 3X17A 4DN3L 4CMMB 2KKQA 1LO3L 2WP3O 3SDDD 4K3HA 5HHVH 5LAXB 1A2YB 3LH2H 4DUWA 3QCUH 3QXAB 4LLQA 2FECL 3BWAB 5BVPL 2D31A 1P84K 2XTLA 2WANA 3E6FB 4YWGH 1FRGL 3KNBB 4XPAH 5BXFA 5EBMB 4P46D 4ORGA 3NZ8B 3HFML 3BE1H 1FO0H 3B9VA 2OZ4H 1T22A 4WTZA 3L3HA 3ARED 1Z3GH 3LMJH 4NBYB 1FCCA 2AEPL 4UAOB 3VXRE 1F11B 1JE6A 1X4XA 4JRYB 3DO7B 1H8OA 3PIQA 4G7YH 2BXZA 1SYSB 5T1DH 4Y2OA 2VO5A 4AL8L 1A7OH 1MRCL 4AM0B 3HMWH 2YPKA 2GTZB 3F5WB 5T1LA 2WZPD 5I73C 3LD8C 5D2LB 4QTHA 1F58L 4TNWK 5E5UB 5A3IC 2F19H 3ZYOA 4MYWB 5SWSB 1BVLA 2AV7A 3MRPA 2C9AA 3CK0H 2EKSA 4DGYL 4DK3A 1YEHH 3WN5C 1BQSA 2VLJB 2AK1H 4WI4A 3WXWH 3V5HB 2WBWB 2DOCA 5BJTA 1J0JA 1LGVA 4XC3L 3OBAA 1CDBA 4JRXB 3UROR 1A47A 3O9WD 4PG2C 1QSFB 2F54A 1NFDF 4HS8L 4P5KB 4KZEL 1N8ZA 4JFXA 4K7FA 4YDLB 1G1CA 1EZVX 3ES6A 3GSQA 4M5ZH 4MA3B 1ZT4A 3L3IA 5KSBE 3QIBC 3U2SA 5CCKL 2GY5A 1IFHH 4N9GA 1NFDA 4OBRA 4PGBB 2MKLC 4PRBA 2MPAH 3RHWF 5F93C 3U36A 3X14B 1I8LC 5J6HB 1A1MA 3WO4C 1U9KA 2VZTA 3H9SB 2A9ML 1W72L 2LAAA 2IFFH 1T04B 4NFBA 1XAUA 3OAUH 4KJYB 5DZNA 3VFNB 4YDKL 1MHEA 1R3JA 3EDFA 1V3JA 1RK1B 3ETBF 4G8EB 4Q0XL 3EYQC 4FP8L 3BJ91 4KI5D 2AAVA 2VH5L 1U93B 3EDDA 5KVGH 1MREH 5LGKA 3HE6A 4FXKB 3ARBA 4R7DB 1D5MB 3MRHA 2ESVB 3KDMA 5HYSG 2WWKT 1F3JA 4TVPE 1OAUL 4KV5E 4RIRA 1PZ5A 3VH8G 4F9PC 1H5BA 3A6CH 1A7RH 1CDGA 1H3XA 4M3KB 4LDOB 1CGWA 1NC2A 5DUMH 3TH4T 3V5DB 4LHUG 1AP2B 5T5FL 2XY2A 3VWJB 3MLRL 3TYGH 4FTVA 4NKDB 3GRWL 4Y4FB 1HHHA 3KPRB 5MEND 1MHPH 2E8YA 5ESVB 4M1GL 4F2MA 3WO3B 4CMMA 3MLUH 1G9NH 5LAXA 3SKOB 1A2YA 4NQCE 2FGWL 1S78C 1FC2D 4LCUA 3QXAA 4M00A 5K9QI 2D7TL 3ULUD 3BWAA 3QUXD 3WJJC 3E6FA 4Q6IC 1BFOB 3KNBA 4PRHE 1NCBH 5EBMA 6FABH 4JCLA 3NZ8A 4AQOA 3K8LA 1WWBX 4X7EC 5HHME 3CFIC 2XQYG 2WQ8A 1MFCL 5D2LF 5E2WH 2E6PA 4JRYA 1VEOA 1WT5C 3DO7A 2HTKD 1J05B 2HRLA 4E41D 1SYSA 4M1DL 2GTZA 3F5WA 1MCOH 3BPNC 4U1LB 1DANT 5D2LA 3E2HB 4AT6B 1A6UH 1CE6B 1MRDL 4QLRA 2VLKD 4D9LL 5AZ2H 3IDIB 5DR5H 2X05A 2R8SH 2YWZA 3IS1X 5ITFB 3NPSC 2VLJA 1J11A 3DSFL 3P40A 3V5HA 3FMGH 4MJIB 3L7FB 2LU4A 1JMZA 4JRXA 1CG9B 4XMKL 3GIZL 1QSFA 3WUWG 3BSZH 3Q6FB 3QYCA 4P5KA 2FHCA 1E4KC 3FOMB 1RVFH 3SGEI 3MRNB 4MA3A 5I75C 3GDBA 1FV1B 4PJFB 3QUZC 4PGBA 2R15A 3F58H 2QADC 3UTZB 3N85L 2ICEB 4M93C 4LEOB 4OD1L 5SX4H 4RMVA 3Q6GH 3HZVB 3X14A 2A0LD 5J6HA 3H9SA 3IDXL 4OM1H 5E9DB 5LGHH 2PKDA 5SWQB 1T04A 3VFNA 4KJYA 3VDAA 5KG9A 4MHHI 1RK1A 4G8EA 3DXAE 5H8DA 5F8QC 2DDQH 4KFZC 1U93A 1KIRB 4FQ1L 3NABL 1NL0H 3OKNB 4FXKA 1UZ6F 4R7DA 3DECA 1D5MA 5JXAH 4FFYH 4JANB 5ANME 1U3HB 2ADIB 1T2JA 4XP4L 5E7BA 2NY4D 4OCRH 4Z7OF 5KVDH 1T5WB 8CGTA 5EOQL 3JWDH 4P23C 5JHDD 1PDKA 3BRFA 2BOCB 4MZ2A 3V5DA 1AP2A 1WJ3A 4GQ9L 1CGTA 1P4LB 1TDQA 1G0DA 4L8CB 2B2XL 4NKDA 3CFDB 2AW2A 5IW6B 4Y4FA 3B2VH 3KPRA 5ESVA 3TH2T 4JPWL 5T5NG 5L2KE 3UYRL 1GC1L 3OJVC 4OD3L 3IRPX 2VJXA 3RIAF 3SKOA 3KPMB 3WIHL 4PLKC 1KTKE 3MLTB 2NCMA 3E1F1 2PETA 4C57C 4D94A 4HPYL 3ZDYE 3QEGH 3LRSB 1JPST 2J8UE 4XPAL 4QHNB 3QRFM 5EO1B 2XZCH 4Y5YB 5FUOL 1BFOA 1PG7W 5C09E 1QYGH 4HJJH 2WV3A 2P5ED 4YXKH 4JHZA 3VFRB 2B20A 1L6ZA 5TF0A 4BSVB 2QQKL 1TJHH 1IQWH 3B9KC 5I18H 3OF6D 1J05A 5JDSB 4K3EH 4HJ0C 1I9JL 5DO2D 2OK0L 5EWIH 2X4OB 4U1LA 5L0QB 5E03A 2ICCA 3QXTA 4X7SH 4AT6A 3PGDB 1YEEH 1CE6A 4BM7A 1AIFB 3S88H 1NSNL 3IDIA 1CVRA 5H35B 5E6IA 4CVUA 4ODHH 3RVXD 3BPOB 1YEHL 5C8JA 5ITFA 2FO4B 4N0YH 5DTFB 3WXWL 4OFKA 3BOVA 1I8MB 5K9KB 1BFTA 3OAYK 3MXWH 4MJIA 2X2YA 3L7FA 3UCRA 1CG9A 3D69B 1SYVB 1XCQB 3L3JB 5JHLH 3V95A 3OAYH 3Q6FA 5EBGA 5I19L 4QRRB 3JWOL 1BZ7B 3MRNA 3NGBC 1R3LB 2OR9L 1AFVH 2QEJA 2A1WH 4HULB 4F57H 4CN4A 1FV1A 4UOW0 4PJFA 5IWLA 5TGBA 4TQEL 4UINH 2EH8L 1ZTXL 3UTZA 3KYKH 2ICEA 4KDTC 4LEOA 2J8OA 2QSCL 3HZVA 3KPTA 25C8H 4Q9BA 4F8QA 1HOCB 1RSFA 2IFFL 4PJ8C 1MFEL 4N90D 5SWQA 2FNBA 3SOBL 1FQ9C 5ENWB 1CFVH 4GBXD 1TJIH 4GAFB 1EK3A 3BGMB 1C12B 2ZKHH 5KVGL 1WC7B 1IM9B 1KIRA 4JVPA 4Z0BL 5H94B 4WWKC 1BOYA 3OKNA 5I1CL 3TT1H 5FYLH 2YD9A 2YUXA 4JANA 2H32B 1ND0B 1U3HA 2ADIA 3GI8L 4FQCL 1C5CH 2ZSWA 5CZXD 5LKNA 1MF2H 1T5WA 1J87A 3TPKA 1RULH 4PTTB 1KCUL 4NN6B 5CBEB 5KAQF 2BOCA 1O7SA 5TE7L 4ZO9A 1A0QH 2LFGA 1P4IH 1C5BH 1A6WH 3BP5B 1VDGA 1FE8L 1P4LA 5HGBB 4G8GD 4L8CA 2WIMA 5IW6A 3CFDA 5E8OB 4JN1H 1H8SA 4LASH 2H6PB 4YBQC 2ED9A 1N59B 4BK5A 4IRZL 3WFBH 3KPMA 4L1DA 1HYSC 3WS6A 2FEDC 4ZFZB 3MLTA 1Q9KB 4LLUA 1M1SA 3R4DA 3EYOB 3LRSA 4N0UE 5ERWB 4QHNA 2DIAA 4Y5YA 5EO1A 3BEWB 4PJEE 2MMXA 2YA1A 5CHNB 2W9EH 3O3UN 3RVUC 2R69L 1F3DH 3HRZB 3G6JB 3QDGE 3STLB 3VFRA 4BSWB 4KAQH 1S8DB 2QBWA 4BSVA 4J3XA 5T3ZL 4ALAL 3HE7B 1HKLH 3VU2A 3QH3B 2PXYC 3LEVH 3VA6A 5JDSA 2Q1EA 3AU1A 1XT5A 1KPUB 2AJSH 2X4OA 3O6ML 4I8DA 1MCPL 4HWBH 1SM3H 2IPUG 5K93A 3PGDA 3C2SA 4U49A 3S5LG 5SX5K 4Y5VA 1AIFA 3G5VB 1ZWIB 1HHIB 1FDLL 2IAMC 1AGBB 5C0ND 4XCCH 5H35A 2VDKH 2FECI 2NR6D 3MQIA 2FO4A 2EECA 3ESUF 5SX5H 2RHEA 5DTFA 1I8MA 5K9KA 2AK4E 5GGTA 2IBZY 5MHSD 2OXHA 3D69A 1QFUH 1SYVA 1OGTB 3L3JA 1XCQA 5KW9L 2CRZA 1RJLB 1IRAY 5D6DA 2HJFB 3GMNB 5CGMA 4QRRA 4LRIA 1BZ7A 3A67L 4AQ1B 1PSKL 3MJ9A 1R3LA 4S1QL 4U1IA 2VMFA 4C58B 1HCFX 1GRWA 1X5KA 4U3HA 4RSVA 3EO9L 1GPOH 4JFDB 4M7LH 2R23B 2BRRH 1C8PA 2IFGA 4ZD3H 2OP4L 5C08D 1HOCA 5IBUG 1AXTH 3C8KB 3MOBH 1L9MA 4F80A 2JCCF 3Q5YA 1JYXA 1YN6B 3I3EA 4I0PB 3KLHC 1R3HB 4JZJB 1XZ0B 5ENWA 3QCTL 1U41A 1VB9A 1J0IA 1NGZB 1PG7X 4X9BA 4J2XA 2G60H 3G5YB 1C12A 4WW2B 2YPLD 3MJGX 2AJXL 1WC7A 3KXFE 3BDYL 5H94A 4WTZG 2BC4B 3AB0B 3CX5K 1GGIH 3FFCD 3VXME 5GS0C 1OF2B 5DD5L 3ARFC 4OKVB 2H32A 1ND0A 2OTUB 5DUPL 3U1SH 1OPGH 3IYLW 5KVDL 2OS7A 3GFUA 4XWOC 3K2MC 4FQPA 4J3OC 4JVWA 1U95B 4IDLA 3CCHB 4PTTA 5CBEA 4DKEH 4XVJL 3C08H 3FO0L 4G6FD 3QPQD 5TH2B 2W9DL 3BP5A 3G6DH 4CDGC 5HGBA 1QSEB 1L9NA 3ZO0A 2G75B 3O0RL 5E8OA 1K6QH 3GBNL 2DLEA 4RMTA 2H6PA 1FFQA 1X5XA 1GGBH 3U9PL 1HSBB 1N59A 1H3GA 3DRQA 2JF1A 1JCKA 2AEWA 4KHXL 4ZFZA 1Q9KA 3QEGL 1N3NB 3EYOA 4L8DB 5ERWA 4LVHB 4NWUH 4WUUE 3BO8A 4UI2A 5HYEA 3BEWA 3NTCH 4QWWD 2VDLH 2JJSA 2CR6A 2YXFA 4HXAH 1MHHB 5CHNA 3MRFB 3QDJB 5HI4D 5C07A 4LHJB 1I7UB 3HRZA 3G6JA 3STLA 2ZP0T 3AMKA 4BSWA 3WXVH 1S8DA 1CIUA 3HE7A 5C86A 2V17L 3SE8H 4PRPE 4JFFD 4GS7C 4PTUB 2W91A 1RUPL 1KPUA 4HBCH 4L4TE 3K4ZA 3S37H 5BOZG 2ZUQB 2WUBL 4CBPA 4OLWH 1YEEL 3MFFB 4FQXD 5D1ZB 4W6WB 3RWJB 1NCDH 3G04B 5IKCB 2NTFB 1FFOB 1ZWIA 1HHIA 3G5VA 3T0DA 1AGBA 1B9ZA 5KVFH 5E2VH 2Z91B 4K94H 5C70A 3MXWL 2I27N