1NBVH

An autoantibody to single-stranded dna: comparison of the three-dimensional structures of the unliganded fab and a deoxynucleotide-fab complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
219
structure length
219
Chain Sequence
EVQPVETGGGLVQPKGSLKLSCAASGFSFNTNAMNWVRQAPGKGLEWVARIRSKSNNYATYYADSVKDRFTISRDDSQNMLYLQMNNLKTEDTAMYYCVRDQTGTAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An autoantibody to single-stranded DNA: comparison of the three-dimensional structures of the unliganded Fab and a deoxynucleotide-Fab complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2B-KAPPA BV04-01 FAB (LIGHT CHAIN)
total genus 36
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nbvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nbvH01
3O2DL 5JPMA 4XCYB 2YXMA 2ATPB 3NCJH 4XNUH 3MLZH 3QIUC 1OM3L 4QTHB 3PP3H 5HVFB 4CDHA 4P59H 1KIUA 2CIKB 2VL5A 2UZIL 4LNRB 5E00B 4ETQA 3EFFB 2Q87A 4PJ7E 1JF5A 5DVKA 4QNPF 4XCEB 1LEIA 5BRZA 3D18B 1MI5A 3UTSE 3QDJA 2GK0A 1KLFA 3FB6B 1G7MB 2CXGA 5DVMA 3TBWA 1IM9A 3IFNL 1INQA 1J1PH 2VDMH 1BQLL 5GISH 5J12B 1A21A 3O81A 4ACPA 4QRRA 4HGWA 3C2AL 4OZHB 3ZDYE 1RK1A 3WHXA 3PL6D 2CGRH 1R24A 1U92B 5I18H 1I1YA 5FUZH 1J8HD 5E8OB 4NQSB 1T22A 2OTWA 3QIWA 4QRRD 4KH2A 2OBGA 3MLYL 2QQQA 4X4YB 4HEME 2D7QA 4LMQE 4KGJA 2CK0L 1O7SA 3IJYB 4H5SA 1IZKA 3CH1B 4ZXBC 1UACL 3WXWL 2PKDA 4CN1A 2JCCF 5EU6B 4PGBB 4S0TD 3DTXB 4J3OC 3AVEA 4EDWH 4XAKD 5CJXA 1HXYB 3OKKB 4HAFA 4NHUB 2W0KA 4H26A 4G6FD 1Z9OA 4S1RL 4Z5RA 4L4TE 1NC4A 5FYJL 1XGPB 2HT2D 4XNQB 2BSED 3K2MC 2K7QA 3IDJA 3VXSA 3VFOB 2DQJH 3JTTB 2FO4B 1QLFB 3GJEA 4DN4H 2NZ9C 1IZJA 4U1JA 1KUMA 2P5WD 3HZYA 4P2QB 2I9TA 1AP2A 3NAAL 2PW2B 3FT4B 3HS0B 3NN8B 4OB5H 4XHJC 3QPQD 3J8F7 2BVPA 4XPHH 5KSAB 4G5ZL 1G7HB 3VWKB 4KV5E 4PJ7F 2NR6C 4IS6B 4LF3B 1Y6KR 1GHFL 4NQUA 1MY5A 4TTDD 5DD6B 3V6FA 2DQGH 3O6KL 1HHIB 1FIEA 1U93B 3S96B 3CSGA 3TT1L 4MQXC 4Y4FC 2VR9A 4LBEB 3QIUD 3VCLA 3BVNB 4I3SH 4V1DB 2VDOL 4OFIA 4J4PC 3B3IA 4YEFA 1IGIH 2R2HA 4JAMA 3MBEB 1BD2D 1L0XA 3KYNA 5DJDA 1HI6B 1EBPA 1R3LB 2YOCA 4XWOC 1IAKA 1MELA 5ICZA 3O0RH 1IQDA 4CJ1A 1ZLUK 1V3JA 5FO9B 1A6TB 1L6XA 1ZWIA 2V5SA 5HYJE 3H9SE 4P4KD 3VXMA 1GOGA 4Y7MA 5T3ZL 3V2AR 2JK5A 3WIHH 4F7CB 2PTTB 3ZHDA 3T0EA 5EA0H 3MRJA 5D2NA 1T3FA 2IQAB 3FB8B 4RRPA 3VFUA 1GC1H 2DQIH 2XFXB 3DMMC 5AD0B 4TVPD 4MXWL 4LSTH 3NCFB 4G7YL 1ZLSH 2X4UA 1PW3A 3PNWB 4LOUD 1OTSC 2XA8H 3BP5A 3SKMA 2VXQL 3STBA 1CGSL 2D31A 1FORH 1PAMA 1M4KA 4U6XB 1NAKL 4HBCL 3HG1D 3KLSA 4NKOB 2OL3A 5J6HA 5EC2B 1JGVH 4L3EA 1NUDA 1JGUH 4UILL 4AEHL 3DXAD 1EZVX 1I8MA 4XC3H 4HFUH 5CSZB 2ZCKH 4X6DB 5BW7A 3VFWB 3NPSC 5TGBB 3WMSA 2AK1H 1FZMB 2Y7QB 4YHNA 1KCSH 4LLVB 5KTEL 3FQRA 2VLME 2PW2A 4RGNB 4IRJD 5IEHA 4OGXL 1E6OL 3ULUL 3GMRA 3BD5A 3G08B 3RDTC 4DCQB 3W39A 4QHKJ 3DXAA 3SDCD 5CD5C 1I1AD 5BQ7A 2R56L 5J6HB 2QQLH 4P2OC 5T1KB 2FSEB 4PD4K 3WIFA 4DGIL 4HUKB 1MI5D 1J1OL 3L1OH 1JGLL 4XNZC 3BPNC 5HHOA 4PJEB 5I76B 2GAZB 4OFPA 4NO5A 4XC1H 4X98A 4P2CG 2BDNH 3MRDB 1OD7A 1D5MB 1T7WA 1QLRB 4QXGL 5IHZB 1P6AB 1UENA 2EXWD 1NFIA 2W65A 5TE7H 3WFBH 4P46D 4LDEB 4EN3C 4HKXB 4BKLB 3FB8A 3VFUB 4DGVH 4UNVA 1RU9H 3C2SA 4U7MA 3DECA 4UB0H 1LO3L 4KVCL 2VL5B 1IKFL 4PP2A 1MJUL 3U7YL 1Q72H 3IU3A 5IESH 4JE4B 2HRPH 2DLEA 3OAYH 4HF5L 4XVSL 4HUVA 1OTTD 3I50L 4OZHA 3U4EA 1K5NA 1W72L 1CDIA 1CU4L 1G7QA 2FHFA 2V2XB 5CMAA 2AK4A 1INQB 5I1KH 5GZOD 1QYGH 4EKXA 4ELMB 3X3FH 2IH1B 4XP5L 4BELD 5GGRB 1MCFA 1T20B 3DV6B 4TOYL 3P0YH 1AIFA 4HS8L 4MAUL 5B38A 5JIKA 1VFBA 3GHBH 3N0PB 5C6PB 4Z7VE 5E9DE 3SKNB 4WEBH 1BBDH 1JHKL 4UDUB 1NAMA 4M1CD 5KSAA 3HAEG 4L8SB 4NRZB 4JM2B 4FFZH 2LFGA 3HAEH 4DZ8A 4E41E 1MEXH 3IJYA 4PRPA 3IU4L 1QFWH 3PDGA 5JHDB 1OWRM 2WINB 2XN9B 3ALWA 3QEQE 2X09A 3O41B 3EAKA 4PLKC 3WKML 4Q6IA 3GIZH 2Y1VA 5JW4R 4L29B 3W2DL 4I0CC 4JPVH 3JTTA 4PJIF 1S5IL 4LMQI 3RQ3A 2F8VA 4M43L 4LCUB 3QEGH 3H3BC 2NY1D 3VXTB 2E6JA 5DXWA 3V0VA 3DGCR 3HLAA 3T4YA 2AJUL 2JJVA 4HQQH 2XPGA 3BDYL 4M6AA 4D0DA 5GJSH 5C08E 3OZ9L 1U42A 3C5ZC 3H3PH 2IJ0C 1FNLA 5E5UB 1MCWM 4KHTL 3OJMB 3MJ7A 3BZ4B 3F8UB 5EU5B 2MSPA 5ESAA 5CEXB 1NDMB 4NNYB 1YEFH 1F5WA 4R90L 1WQVT 4R26L 4N8PA 3TA3A 3BQUD 1NCTA 3EYOA 3ALXA 4MWFA 2ILLA 5F89A 5FKAA 1FNSH 3NACL 3OXSA 4PV8A 1RAMA 4YC2B 5GS0H 2O5YL 4XXCA 2IFFH 3PXJA 1ZLWH 4GT7A 1B0WA 2XKNB 5F7WC 1YN6B 2YUWA 4W6YB 3RL1B 1MCPH 3U0PA 5K9QG 3MOQA 4H20L 2FWOB 2O61B 2G9HA 4R7DA 3H42L 4OD2A 4ZYKA 2G5BA 3STLB 4LPVA 3O6FA 1FCGA 3GNML 2MNUA 4RX4D 5C08D 3FOMA 4NFCA 4CKVX 2V7NB 4KK9D 3V8OA 3QIUB 5D72H 3WLBB 3WD5H 2VDML 1YEEL 4K55A 3E3QC 4K3GA 3KPSE 4PGDA 4O2CB 4W68A 1FL5B 5K33A 5EOTA 2WWKT 3GSXA 3N06B 5HY9A 2W60A 3PNWA 1YDPB 3SQOL 2AKRB 3NFSH 3QQ9D 3GMPA 1IGTA 1TZGL 1FV1B 2ERJC 1ONQA 3QHFL 2Z35B 3BHBA 4ZYKB 3TN0C 4YDKH 3GKWL 4UT6H 1HKLH 1OSZB 2B1HH 1WVZA 3O6FC 3KNBA 5IROA 2ICWA 5HJ3B 2Z31A 1QKZH 1IC7L 1QFPA 4NZUL 4UV7L 4XNXL 1FL6B 1XIWB 5D7JD 2YEZA 3QQ9C 1YYLL 5EZIH 5IFJB 1R3JA 5MERB 3K0WA 2VZ3A 5JUEL 4K07A 4HXBL 2A77H 3RGVC 4C54A 2R1YB 4P0DA 4GRMA 1FVCA 3EOYG 3ULVL 4F7PB 3BZ4A 1KFAH 3DPBA 5T1MB 2ENSA 3JV5A 4GAJL 4Q9RL 2H2SD 4V2BA 1XT5A 5IQ7H 1HXYA 2XY2A 4ZS7L 1BVZA 2CKBH 4JJ5B 1PZUB 3KJ6H 1HK6A 5CINL 1F3JA 3NIFF 5EOCL 3O4LA 3K80A 1N6QH 1SM3L 1R5WA 3BT2H 2BVOB 3QFJE 1F6AA 1JCKA 4OIAA 4ELMA 1B2WL 3KXFA 4LSUL 4RMUA 3REWB 2ICWI 3QBTB 5E8NA 3SJVB 4CU8A 5I1GL 4CL7A 1YPZE 3QQ3B 3LMJL 4AIZB 4O58L 3QO1B 4FZ8L 4O51B 1TZIA 2ITCB 3Q6FA 4LKXA 4ESKA 3IGAA 3S8WA 4RISL 1S9WA 1NUGA 1YDPA 3D0VB 3ZLQC 4K9EC 4NRZA 4LP4A 1ETZA 1EAJA 5D93B 3WN5A 5ISZA 1WFOA 5DJ8A 5EU7E 2IPUG 5DHYA 1HYSD 5E9DD 1CLZH 5DVNA 1N6UA 2DL9A 3QULB 1QBAA 1TFHA 4JG0L 3HZKA 1W2KT 4FOMA 4XP9H 1JTPA 3N1PC 1UJ3C 3IYLW 1NCUA 4XPGH 3BZEA 5AZEH 3L5XH 3RGHA 5T5NG 1NMAH 1EFQA 3S7GA 3Q6GL 3LKNA 4IHOA 5I76A 4OZGE 4U6HA 3LN4A 4OCSL 5FK9A 1OAYL 3MODH 2DM2A 4U6YA 4ZUVA 4A6YL 4G7YH 4MVBC 4LQFL 3FT4A 3NN8A 3PE9A 4M9PA 4QRPD 5GS1C 3VI3F 4XT1C 5LGJA 1A8JH 3MCLL 4JZJB 1UVQA 1CE6B 2CRIA 4P3CL 4WTZG 2HJLA 3C6SA 5HHVL 3U46A 4G8IB 4N8VB 4QHKI 3TBWB 2DM7A 2E8YA 1A7PH 5C0DB 4J3UA 1KJVA 1GGBH 2PXYA 1EVTC 1JGVL 3MJGX 3IFPA 4R0LA 1NGPL 5EU4B 5DRNB 3TZVB 3QA3B 4XVTL 3HAEB 4FQJL 4UTAL 5D1QC 4B5EA 3B43A 4HK0B 3QIBB 1AR1C 4F9LC 4HPOL 3ULUD 3QISA 4FQLL 1BQHB 4MNGE 1JNNH 5E1AA 1MRFH 4IMLA 1BQUA 2DQEH 4JO4H 3U4AA 3V7AE 4IOFC 1CYGA 3QDMB 1R6VA 1CGXA 1H3UA 3C8KB 4ORGB 5JA9A 3S88H 2VN7A 4NNYA 5F7DA 3BRFA 2B4CH 4LLYA 1YZZA 4PRPB 1UEMA 3L3GA 1UC6A 4Y5XB 2VLMD 5ID1B 5D5MA 3GZKA 4CMMA 4XC1L 1YEKL 2FEEL 4WU5A 1FNGA 4PGCB 5CCKL 2EDFA 4OLEA 3SJVE 3Q48A 5IV2B 1OCWL 1T1WB 3DXAE 2GK0B 5I17B 4U6XA 4X0KB 4MAYD 4NPYA 4RDQF 4DGVL 1I7TA 3LS5H 4NKOA 1KXQE 3SDXB 3X3GH 4UB0L 4AEFA 5EU3B 3MV8D 3UDWA 5CEZE 3TVMD 3DMMA 3MRQA 4X5WA 3PJSB 1TNNA 1BD2A 3V0AC 4PYHA 4Q7DA 1XGYH 4DVRH 3FN0H 4FQQB 2IEPA 4JGJA 1X4ZA 1G0XA 1MVFA 3CFJA 5BO1H 3VGAB 2CIIA 1QYGL 1ES0A 1C5DB 4P2OD 3TT3H 3IDUA 3SGEI 5SWSD 4IJ3B 4DGYL 5ITBH 5IFAH 5C07E 4XAKE 1CT8A 4Y4KA 3VGDA 3EJZC 3QQ4B 5GJTL 3GMPB 2HP4A 4RA0C 2WLZA 1HZHL 4Y0GA 4WDIB 1C12A 3MZTA 4ZPTB 2I25N 4PJXE 1DP0A 3D2UD 5IHUL 1YQVH 2V2XA 3LQZB 2OSLB 1DBML 4X4ZA 2EDWA 4KRLB 3BPLC 4MD4B 4QRRE 2YXFA 4M7KL 3LKQA 4V2CB 2XQBL 2JB6B 4PG2C 3MR9B 4Z6AT 5HHPA 1JL8A 2H3NA 4LOUC 3D39A 3N1GC 4X7SH 4F15C 1U2CA 5HI5D 3DMMD 1DEEA 2C1OA 1RHFA 4P4RA 1C7TA 5FYKD 1YMME 4BZ2L 5EZLA 1NGZA 4BKLA 1SJXA 2E3VA 5SX5K 4CU6A 4M5YH 4P2QE 3C5ZB 4M7LH 4WCYH 2GSGB 3ULVC 2O5XH 2OTUB 3DIFA 3JSSA 2GK2A 3BDYH 2DJUA 5KOVC 3BN9C 4TVSa 3C5ZD 3REVB 3FO9A 3QP3A 3BW9B 2D0GA 2DI8A 5H35B 1I8MB 2UWEB 3WXVH 5AEAA 3WBDA 3S3SA 3GI8H 3JWNC 1RK0B 3VXRE 1OAUL 2EECA 1DN0B 1RJLB 3PQYA 1A6PA 4LLDA 1FAIH 3KYKH 1AGEB 2EDHA 4R4ND 4L4TD 2WUBL 4K9EH 3VDCA 3RWFB 2XPGB 5IBUG 4NQCD 1G9NL 1MCIA 3STZA 1RMFL 4YDIL 3OJDB 3T4AB 2NW2B 5EN2A 1QVOB 2H8PB 3PWLA 1LHZA 1S7RA 1I7RA 1FO0H 4WHTB 3SDCA 4MJ5A 2J1KA 4L4VE 4RBPK 5EC1A 2AJ3B 4UQ2B 4H8WC 4BUGA 4KZEL 3KPRA 3W5MA 4WENB 4FG6D 2E6QA 1AGFA 1J8HE 1S7VA 1NEZA 3BWUC 3L9RB 1P1ZA 3TV3H 3RUGE 2BVUA 1RUMH 3P0GB 2CLVB 2YSSA 3OHXB 4YBQC 1KNOB 2XG4A 4AK1A 3MGTA 4WW1B 5I9QB 5FA3B 3O8XC 3TPUA 5GZOC 4U6HB 3VE0A 1FVEB 3ES6B 4YHKL 3RI5K 5IUSA 1RJCA 4EXPX 4OV5B 5F71A 2FECL 4FQIL 3MNWB 1LDPL 3BJLA 3EW3B 3TVMB 3CX5J 3SBWC 5DMGD 1OP5K 5EU7C 4WV1B 1NGZB 4XCEA 4XPBH 3CX5K 4KXZH 3SDAB 4ODUA 1J11A 1S7WA 2BZDA 3VG9B 4G6AD 4Y1AD 1HH6A 1DLHB 2BOCB 1QBBA 1CR9H 2GQHA 3TNNB 3ZE2E 5CSGA 1BWMA 4MWFB 1UM4L 3K8LA 3PABB 5FKAB 1DQDL 1CLCA 4M5ZL 4PRPD 4U1JB 3UPCA 5CP7A 5JUEH 1BHGA 4LCYA 2V7HA 4PJDB 1KFAL 4QOKB 1EJ6A 2XZCL 3HE6A 4XH2B 3T4AA 3ARYA 2DDQH 2LABA 2VB5A 4MJ4A 5D5MB 5D1QB 1LK3H 1GC1L 4G9FD 3NZ8A 3RIFF 4AL8L 2CKNA 6FABH 4FZEH 2B1AH 3RGVD 4M7ZC 4XMLL 3TZVD 1KB9K 1KPVB 1KF9B 1QPXA 1NEZB 2Y07L 3EDFA 1FH5L 4MA7H 1DBKL 1G0YR 4UT9H 1JK8A 5KS9E 1KTRL 1JPTH 2NY4D 2X05A 5J56B 2BSRA 2LVCA 1TXKA 4NGHL 3T3PF 1ZGLA 5TF0A 4KU1A 4GMTL 1JF1A 1HQ4A 4APQA 5J11C 2WM0A 5J1AB 3AS2A 5ALCH 1AXTL 2C3GA 5D1QA 2PTTA 1IGYB 4QOKE 1WC7B 5A2KH 4JDVB 4AT6B 1UEYA 4NC2B 1J0IA 1LO0L 4IEFB 3HNVH 1GSMA 1E4JA 2F15A 3R1GL 4XPGL 3MROB 1KYOJ 1OAQH 2WLYA 5I19L 2BNUB 4RMTA 5E2JA 3BO8A 2J8UA 4YHYC 4NM8L 1E6OH 3ULUH 5F6IB 4OCSH 1NMBH 1TITA 4G8GD 4RGNC 2YHGA 2CJUL 1CDHA 3I85A 2X4NB 4KKNA 4G6KL 4GUPB 5BMFL 4LPUA 5DRWA 5E56A 3V4UH 4F57L 1BOGB 4JQIL 1KACB 3H9SB 5FECA 1I3GL 3TNNA 3SPVA 5KVEH 3SY0A 4XMPH 4HKJA 4XWGL 1ZVSA 3DX7A 4LFHG 3RBSA 2J4WL 1IEBA 3N9GH 3SQBA 5BVJB 1XF4A 3U4BL 1SMAA 3LD8C 4PJIB 2GTZB 4M48H 5BV7B 5DLMH 3AXLB 4WW2C 4HIIB 2UUDH 4OJFH 5TF1H 2V17H 3OKLB 2KKQA 3TWCL 1LDSA 1MCRA 5E9DA 4Q74A 1LEGB 3OF6A 4PRNB 4ZFZB 4OM1L 3UTTB 1DBBL 5FHBH 3OMZA 2ZPKH 4XNYH 4K71B 1ZE3C 2DQEL 4DEPB 5HVHB 4ERSL 2KDGA 3QZWA 5DJ6A 1P1ZB 3S34L 4L4VB 4YDJB 1EHAA 2A74A 3GSUA 2HLFD 5A43C 4U7SA 3LPFA 1HQ4B 3FJTA 4HSQA 1MLCA 4NBXB 4N0UA 3DX9B 3TZVC 4NO0B 4DEPC 3NZHH 4Z7OE 4PJ9D 4RFNB 3OR6B 1S7QB 4HKZA 4D0CA 1LE9B 2ARWA 5IHZA 2I9TB 3HC0B 4G8FA 2X89D 2NW2A 4R4BA 1D6VL 1JPSH 5I2IA 5T1MA 3QCUL 1I1YB 1YJDL 5D8JH 4NRXA 1EMTL 3F58L 3KPTA 2FLBT 3K4DA 5ESAB 4X6FA 4JB9L 2DQFA 5D1XA 5C0AB 1C1EH 5DR5H 3O11B 4MAYA 3MLRL 5JMOC 1R3HA 4GG8B 3UC0L 1TETL 2NY7L 1P4LB 3VFNB 3OAUH 1WAAA 4PJBE 1P7KB 3REWA 1FGNH 2X4RB 1T5WB 1U8QB 5GSRA 5DRNA 4D9QD 2P5ED 5J6GA 2DQUL 4H1LB 4JQXA 2ESVB 4MXVE 3FN0L 4F80A 3PWUA 5B8CA 3QEGL 1KOAA 1LGVA 3PHOA 2Y23A 3ARZA 3K2UL 3MRBA 4KPHL 1OGAA 2WWKO 3DYOA 3GGWB 5FM8A 2OK0H 3LV3B 2X1PA 2EDXA 3BWAB 1U6AL 2IAND 1UA6H 1CGUA 5GS1A 2L7JA 4GLRI 4XPFH 1MFNA 4Z0XB 5L88H 3ZE0F 2H2PD 4R4FH 1F4WH 1OAKL 2BOCA 2ZUSA 2W60B 1OAXL 3SBWA 4Z8FH 4R26H 1MAKA 4OZIF 1IGCL 1BECA 1DSFH 1H15A 3VFRB 4JAMB 2ZJSH 1YNTA 1DQQA 2YKLH 4MJID 4NPYB 5C07A 1BIIA 1BJ1J 1IGJA 2IFFL 2E9WA 1CGVA 2P7TA 3VDAA 1YUHA 5HI3C 1WICA 4PGCA 5KVDH 4OLYH 3EYQD 1HKFA 2YC1A 4Z18A 1ZXQA 3MNZB 4P23D 2NY2C 4D9RE 3UTOA 2FDBP 4U1GB 5HGHA 3CLEL 1A7OL 4Q0XL 5ACLA 4NO0D 4PJEE 4MB4A 5L6YL 3MRKB 4Z7WB 2Z92A 4AIZA 2C26A 1NLBH 3HTLX 3IXAB 4LEOB 1S7WB 5KG9A 3QWOB 1I1CA 3EYOB 1SYVA 1YY8B 1KT2A 4OCMC 1SJEB 4OIIH 1ZGLM 1NCBL 4UAOB 1X5ZA 2D7OA 3KPPA 3L7FB 1V5JA 1TZGH 2A6DA 2FX7H 2XN9D 2VWEE 1NBVL 1RUAH 3FT2A 3IFLH 4KJQD 5C8JA 4WI8A 3VFSA 5C9JA 1MPAL 1Z2KA 3W0WB 5LGKA 5IQ9A 4K7PX 1WEJL 3L5IA 4UT6L 4WHCA 1EBAA 3WIFB 4YPJA 3ZE1F 5IB3A 1AD0A 3TN0B 3MRHB 3KPLA 3ZO0A 2P5EA 4TQEH 4GAGH 2IBZY 5IB5B 1GHFH 1X5FA 4X6DE 3JUZA 4I77L 2PTVA 2GUOA 3TJHC 5L2JB 5BVPL 1YY8A 1SHMA 2AXFA 2BFVH 2C3XA 2X42A 4X80H 2DQHL 3INUL 4U2ZA 1BX2B 2XZAL 2EDLA 4QF1B 3TC9A 1JHTA 2DTMH 3GJFA 5K9JH 5BJTA 5JXAL 2RAMA 3HE6C 3ULVH 1MJ8L 4F37F 1ULVA 4JY4A 2AJYL 2MPAL 4KI1A 3BKCL 2ZSVB 4U7KA 1EJOH 1Q8MA 1QD0A 4P57A 5F9WC 4D0BA 4KK6C 3JBG7 2EIZA 2IPKA 4YIQB 2UV3A 3SPVB 2WIIB 1J7VR 5D93C 3DRTB 1KIPB 3GMOB 4JM4L 1ZK9A 4CVXA 3GSNH 4PBXA 4X5XB 3VG9C 1NCNA 2DWDB 3CPLA 1QSFD 2QTEA 4NP4H 3ZSTA 4N90D 5DI8A 4FA8A 5KVFL 4LSUH 1LP9F 2YEZB 5GRZA 4N9GA 3X11B 2VXVL 5D4QA 3TVMC 1NC4D 4ZUWB 5CD5D 4PTTA 2FGWL 5CHNA 5LGJB 4Y4FD 2EDNA 1IAMA 5C0EA 1QZ1A 4L8SA 3V6BR 2WUCL 1D5ZB 3N85H 3M1BB 3T0XA 4JG1H 5I1DA 1HILA 4WV1C 4JFDD 4WNQB 5I8EB 3LZFL 3LRGA 4Y5XA 4WHTA 3SDCB 5DYOA 2XZCH 2NXYD 3QUKA 3FAWA 15C8H 4O5LH 4N90E 2AK1L 5EWIL 3UDWC 3CXDL 5KTEH 4N9GB 3OAYK 2VLRE 2ED9A 1KBGL 4M7JH 3BEWA 2QSVA 3VXPA 1VPOL 1MF2L 3MBEA 3SE3A 1U3HC 1KIRA 2WBJB 2AXJA 1I7TB 4GW5B 5AWNL 5E6IC 6FABL 3NA9H 1ZTXL 5SX5H 1AQDB 2Y07H 4PP1C 3KPLB 4M9OA 4JKWA 4FP8H 4NJ9H 4NZDA 3IU3B 5TH2B 2X40A 3FFDB 3NABL 4QXWA 4BJLA 1AE6H 2A1WL 4F9PC 3DTXA 5HHVH 3AREA 1CL7I 2JIXB 4HWNA 2P8LB 2YD2A 3P9MA 4JFEE 5F3BA 3VWJA 4C56D 4GBXA 3FOLA 4KAQH 1PG7H 4GRWF 3MA7B 4KJYA 1U8LB 3P3YA 4LEXL 4UQ3A 4XXDA 4Y1AB 4JHWH 4HK3J 1INDH 1H0DA 3QPXH 5F1SA 4W6XB 1A6WL 3H9ZA 2FB4H 3RJQB 4OUOA 4ETYA 3HNVL 2QADB 1F2QA 5I8OH 3PWVB 1BFVL 1CIUA 3O4OC 2X1XR 1XCQB 3EOAA 1NGWA 3CIQA 5C0BA 3SHSA 1RQ5A 2MHAA 3W11D 3HE7A 3NFNA 5C6TH 3BGMB 1LP9E 3MA9L 1FLRL 2QQNL 4D9QE 3VW3H 2NMSA 2XIDA 1W72H 5ACZA 4QOKA 5E70A 1OQXA 4NYLB 3FONA 5FDYA 2HTKC 3FOLB 3WHE1 3VH8B 4O4YH 4PJHA 1LK2B 2F54E 4EN3B 3T0EE 2EIDA 5CBAA 1FP5A 5J13B 3BMWA 2EO9A 3U6RA 1T0NA 3MGAA 3OV6A 4WVRA 4FQHB 3ZE2F 3D69A 4OFYD 1ZLVK 1MHCB 3HRZA 1D5IH 4LLMB 2FJFA 2EYTA 4QHLA 3G6AB 3VFPB 4JDZA 3IRPX 2ADJB 2GTWA 2PCPB 4Y4KD 5KSAD 5E8PB 2OXGA 5JDSB 4JPIB 5B22A 2BC4A 5CJOH 4E5XA 2FX8H 1OGTB 1FPTL 3ARVA 3U9PH 5HGBA 4D3CH 3PWNB 3DVNA 4EN3A 5B3NA 2UY7A 5IG7B 1OM3H 4PJCE 2W65B 1KTDB 3QH3B 3HMXA 5C0DA 1CFVH 1I3RB 1NBZB 3WNKA 1JV5A 3S36X 4OLUH 4XP6L 4XGZA 3QXAA 5EUOF 2DYPB 4HC1L 4RNRA 1X5HA 2HWZL 4W70A 3SO5A 2NXZB 3GMNB 4G80A 3WS3B 5HYQB 4JO2L 5DJ2A 4RAHA 4KDVA 3KPOB 3ARDC 4KHTH 4L8CA 1FE8L 1JPSL 5C0CA 3WUWA 1UB5A 1AY1H 1YJDH 5D8JL 3MV9E 3T1FB 1WWCA 4YFEA 2Q3AA 2HLFC 3KLDA 4JANB 3QUXA 2NY5C 2VZVA 3QFJA 4YE4L 3G6JA 1RZGB 4CU7A 1W0YT 3F5WA 4YDVB 1A1NA 1LNUB 2DLGA 4JR9H 4LLVA 3NZ8B 2Z31D 3SGDH 5T33L 1KCVH 3RUGB 5L7XH 4DZBA 1T6VN 2FIKB 5CIPB 1XZ0A 5CS7A 4F7PA 2V2TB 1P7QB 3C08H 5T1DL 3QUYB 5I8KL 4ZAKC 5DUBA 3KPPB 3L7FA 3VD7A 5EU6E 2X10A 1HWHB 1FFNA 1MRDH 4J8RA 5IB1A 2E7LC 5HHMD 3EGSA 3AMKA 1HYRC 1G7QB 2C4XA 2P43B 3UTPD 4OAWA 5E95B 5C2BL 3LPGA 4QRTA 5ESQA 5FYKU 4OI7A 4P99A 2C7UA 4R4FL 1F4WL 2E7BA 1F3JB 3ZTNH 1PY4A 3SQOH 4H88H 5LG1A 3I6GB 4EI5B 4CGTA 1G7LA 4Q9BA 1MCKA 4HWEL 3CMGA 4HV8A 2JK5B 4M6ML 1NBZA 4YDIH 2VXUL 2Q86A 4GXUN 5FOBB 3KYOB 2F8XC 1MWAL 2F19H 1HOCB 4JZOB 4YBHA 1HHKA 3N1QC 5B4MD 2EXYC 4Z7QF 3H9YA 1RFDL 2DAVA 2KUTA 3C60C 4NQDB 4OKVA 4BFIA 4GRWB 3SKMB 1K5NB 3JV0A 2WWMD 4NNPL 4P9HC 3NFPB 1N0LA 1O5DT 4HK3N 1EEYB 4RFOH 2V5YA 4LCWE 1PQZA 5DWUH 5DQJA 3QUMH 2JJUA 3LN5A 5FK9B 3RKDD 4W81A 4UDTA 4NZTH 1D6EA 3O0RL 4BQ6A 1MLBB 1UWEH 2VDRL 3GGWA 3HLAB 3T4YB 4F3FB 3SDDD 4R7DB 1KN2H 1I1RA 3ZYJA 1JF1B 3BFOA 1OSPH 4FQIH 1QA9B 2H8PA 5ECJE 4KUCD 4YHNB 3W81A 2NY2D 5SV4A 3WHE0 4WFEE 3WJJA 1XIWC 2A83B 2L7UA 3WDJA 4E0RA 1G1CA 4GG6E 4KFZC 1MFDL 4HGMA 2BRRH 4HIXL 4UBDD 4XTRC 5HD8C 5MP6L 4M6OL 3OKYA 1JBJA 2NW3B 1LEKA 5I30L 3L95B 4WFFD 1BFOB 3AY4C 1T5XB 1A2YB 3LEYL 1U8NA 1UM4H 2AABH 3V0VB 4ZAKD 2CSPA 2LTQC 1N8ZB 2DLFL 3A67H 2H2PC 5ICXB 3I6GA 4EI5A 5HYJD 4KI5F 5JXAH 4KVNL 3RZCA 3BP4A 1A1OA 4QRPB 2DKUA 3PV6A 4JRYD 4S0SD 1IAIM 3QIBC 4TUOA 2R4RL 1VGKA 3UJIH 3F7VB 3BH8B 1DCLA 3CU7A 1KPUB 2G75A 1E6JH 1BD2E 5I1HH 3B6SB 4TVPH 3FFCD 5AZEL 1AC0A 4J3TA 4ODWA 3UX9B 2BNRA 2FIRT 4J3WA 1YNLH 2VZ1A 1CFSB 1G7JB 4XAWL 1FYTA 3MODL 2B1AL 5E9DB 3OB0H 1G7PA 3VXOA 1RUKL 1CVRA 3T3MF 4GBXD 2J8UE 1RUPL 5GPRA 3GMMB 3QJFB 4RSVA 3DRQA 4MQSB 1A4KB 3K74B 3T2QA 2ITDB 4G8GA 2DRUA 1OGTA 3I6KA 2EE2A 4NQEA 2QSTA 1ZAGA 5KAQG 2QV2A 5JDSA 1INEH 3DVGB 1MJJA 3R8QA 4NZJA 3MRJB 4GRLB 5DJYA 3S5LA 2D7TL 3CUPB 4AENA 1EHXA 15C8L 4LSVL 5EBLA 5EWIH 5DJZB 1D3CA 1TZIB 5C0EB 5HI3D 3SOBL 2IAMB 1NPUA 4L8BA 1WCBB 2DYPA 4K23L 1YQ2A 5D7IA 3T3PE 1DUZA 3MOAL 3MLPA 2C4FT 5KZCB 4LCIH 5D70L 3I50H 1MCJA 4NQVA 4PGJA 1KIPA 3QIWD 5DVLA 2VJXA 3S36L 2VABA 1NLDH 5AAMA 1WT5C 1Z6JT 1LMKA 1JWMA 4MVBD 3T77A 5JW5A 1UYWH 2F58L 1VENA 3HFML 1CXFA 3OWEA 2BC4B 1MCSA 4Y88A 1BM3H 4ZS6C 1XIWD 3RWGA 1KB5L 3BQUA 3ZHKA 3PQYE 3TBTA 2COQA 3TNMB 3ARED 4YK4B 3QUYC 1S7SA 2Q76A 1RZGA 4NQED 4O51A 1BBDL 2FD6H 3EYUH 1CGYA 1P5VA 1T80A 5JLZA 2R39A 1T1ZA 3CFCH 3IAGC 3TA3B 3ZE1E 1JTTA 4Y16A 1TMCB 1A7NH 2QHRL 2RR3A 1JNJA 5I8OL 2JKXA 3EYSL 3CSBA 3QCVL 1L9NA 4NQCE 4JFFE 5FHBL 4PRHB 4OD3L 3P9MB 5GGTA 4AM0B 4G80B 1RIHH 1N2RA 4HHAA 4OZIB 4M4PA 3VWJB 3OKDB 5D7SH 2VRAA 1PX3A 4WO4B 4OLZL 3BRDA 5C3TA 4HUWB 1A7BA 3BDBA 4JPVL 4F7CA 1CG9B 3KLHD 3T3ME 2GAZA 1KJMB 2FX9H 1BJ8A 2ICEB 1NGYA 25C8H 2WW8A 4E42B 3LN5B 4OIBA 3TYFB 4OCWL 4AG4H 4M61A 4HWUA 5HVWA 1RK0A 1OQOA 5IFAL 1ADQA 3BESR 1K4DB 3JXAA 3M8OL 4LVHB 3VXPB 1A3RL 1V7MH 4XVUC 1KCKA 4DCQA 4P5MA 1LEGA 1X7QA 5IHUH 3GSQB 5F7LB 4P4KC 2ZNWA 4GMSH 3OGCA 1OPGL 4H1LG 5F1IB 3CDYA 2YBRB 4FS0A 2ADGA 1Y0LA 5FUCE 3UC0H 1DLHA 4WUUB 4MXQC 3OAUL 1FPTH 5CSZA 5B3JE 2AGJL 1FO0B 3MRNA 1MCQA 3P9WB 3LKNB 5IVZA 3VFGL 4ZSOB 3SGEH 2AEPH 1QLEL 4HKJB 1JNHA 4P5TC 3B2UC 4ZUWA 2DQUH 6CGTA 1NFDF 4LHUG 1MHEB 4LGPB 1R3KB 5DGRA 5CFHA 1GOFA 3LS4H 4JPIA 2CR6A 4KPHH 3U36A 4XPTH 3ROOA 5IGXH 4TNVF 4KKLC 5BZDA 5D72L 4X6CB 4BQBA 2VN4A 1GAFL 3S96A 3UYRH 3G5VA 4XPFL 5L88L 2B7DT 3CSYB 1Q0YL 4JHBA 1OAUH 1OAKH 1XF1A 2P24A 2R1WA 3B9AA 3RVUC 1T3FB 3VXUB 3RDTB 3WL9B 3CFDA 5GIRB 4N0FB 3HPJB 4JQXC 2CQVA 3PQYD 5BJTB 4PJHB 5JHDD 1U3ZA 1HNGA 3QAZC 4XXCC 5JIIA 4POZC 3LD8B 3MV8E 4PJBB 4FN0A 4N0UB 4JM2D 2DMBA 1JPST 4M6NL 4TSCH 5IJKC 2R8SH 1RUQL 2HVKA 3EIFA 3C9NB 1K4DA 2D03L 5C0AE 4K94H 5IB5A 2FCBA 2HJFB 3QFDB 2OL3B 1QSEB 5EG6C 1GPOL 3GMQA 1QKZL 2Z4QB 1BJMA 1AD9B 5C92A 3HCVA 3IDGB 4ODWB 4KHXL 2A9NL 3CMOH 4X6FB 2UZXB 4NKMA 1HSBB 2NY5H 1SEBA 4Z7UF 2I07B 3B9KA 4G6AC 2G75B 5IJKA 1CFTA 2OJZL 3WS6A 1S7XA 4L9DA 4YUEH 4HWZB 4YBQD 1FHGA 3QG6A 3QDJB 1XR9B 4JRWA 1HHGA 12E8H 5EZOH 3MYJB 3HC3L 1CXLA 3PGCA 4ZS7H 2CKBL 4PRDB 4JFPB 4MNGB 1L7TL 3WFCH 3RVVC 1MPAH 5BRZD 4X6EB 2VXUH 5E94B 2Y5TB 4MA3A 1RK1B 3WHXB 3HCVB 5B39G 2YMXL 4QTIL 3TYGH 4ZUVB 1RJYA 1S9VA 4X6CA 4HUUA 1K3IA 4HIHB 5BZWA 3K8KA 4RAUB 1CTOA 5CGTA 5F9JB 3U6RB 2BSSA 2LU4A 3W9EB 1BVLB 3UO1H 4LIQH 3EDDA 1MI5B 3D39E 3Q5YA 4CN6A 5T1KD 2W9EH 4FQ1H 3E0GA 4JFYA 3CLFL 4FQ2H 4HBQA 3P9LA 3S35H 4NN5B 1UADC 3LCYA 4MB5A 1DUYB 2P24B 2R1WB 4TNWK 3SDXE 3VXUA 4ZFOA 3UPAA 5FECB 1FG9C 4JO1H 5T1KA 1DDHA 4G6JL 1FCCA 3TBSB 2D7MA 4TSAL 2H9GB 2X4NA 5GGVY 3Q6GH 3CGTA 3LKQB 4ZNCD 3GSNL 4AH2B 4RFEA 2B2XL 5DRWB 3VMOA 2B8OT 4OAWB 4FFVD 2JCCE 3VXUD 5D7JA 1L9MA 2FGZA 4L3CA 1DBKH 4PRAA 4U1GC 1WITA 2BX5A 5DUML 2J8UB 1DBJH 5MP6H 4B50A 4HZAA 5DK0B 4R2GC 1H3PH 1KEGL 4N0YH 4Q58C 4NM4L 4Y19E 4EDXA 5B8CC 1RZKH 4HV8B 3K8MA 3D0LA 3I2CL 4ZODA 2DLFH 4OD2B 3HE7C 4H25A 2HT3C 3G5ZB 1CE1H 3RTQD 1P4LA 3UJIL 1BQSA 3KPRE 3MLTB 2GJ6A 1E6JL 2XRAL 1A9EA 1PEZA 5E0QA 5E8NB 4PJFB 1I8LA 1SVCP 1MF2H 5IB2A 4LHUA 4ONHB 3WFHA 3K4AA 3QUYA 1SY6A 4PJ5D 1HINH 2APTA 3PP4L 4H25B 4FP8L 4NJ9L 4KZDL 1EGJH 4XCNB 4Y5VC 1U3JA 1QSZA 4QCIA 4OZGF 2OS7A 3P9LB 3QDGD 4YHOL 4V1DD 2YPKA 5EO9A 1U8OA 4PG2A 1BZQK 2BHUA 4I48A 4RA3A 1EHLH 3FN3A 2VIRB 4NDMB 1HXMA 3MNVB 1U3HA 4MD5B 2A83A 1JPGB 3LKPB 4N8CL 4PJCB 4KK8C 3HR5B 5FB8A 3LS5L 3HC0A 1JWSA 3MRMA 4JDZB 2IG2H 2IQ9H 3UTQA 5F96L 4Y5YC 5SWQB 1EERB 2EC9T 1G6VK 2Q3ZA 3MV7A 1OTUC 4NO3B 4S1SH 3TBSA 4I5BB 5I1JH 4L9LC 4KKBD 3DROB 1K4CB 4C4KO 3T0EC 1RZJH 2AV7B 3MRLB 1PSKL 3FB6A 3CSYA 4FFYH 4PG9A 3QULA 4G42B 3GSWB 4WI5A 1DBAH 3QAZB 4FQPA 4GAFB 1AO7E 5AUMB 4PJCA 1AXSB 4O2CA 4WHYH 3IDIA 5DHVA 1FSKC 4Q6YA 5FB8B 3V4PH 2VDNH 4LKCB 2XWBA 4J1UA 4P4KA 5GHWL 3VFOA 3VXMD 3U9UA 3GBNH 1DN0A 1RJLA 4P49A 4YO0A 2V7NA 1D5IL 3EYUL 3HMWH 1H3WM 3FB7A 5IM7A 3LV3A 5DD3H 5T1LD 3DETC 1LILA 1D7FA 2AV7A 1YEJH 3EO9L 1IAIL 5D7IF 3DVGA 2P45B 3EYSH 1MCCA 4POYA 5D96C 5L9DH 1IT9L 1I7RB 3A6BL 3U1SH 4RWYL 5ITFA 1S7XB 4OFKA 2E9BA 3JVGA 3IVKB 1A6VL 4Y5VA 3RDTA 3WL9A 3MSPA 1S3KH 2Y25A 5D7LB 4DKFH 1JK8B 1CF8H 1U92A 2NLJB 1W72B 4YNYB 2O5XL 1CIDA 4OF7A 4L1DA 4S11A 4U1HA 3MUGB 4HX1B 1T21B 1EXUA 4KJWC 3QWRA 1GGTA 2X89A 3FO1A 3UPRA 4HUNB 3NCMA 1AD0B 3BPCB 1I9JL 1MVUB 1PKQB 1CG9A 4MYWB 3FT2B 5C8JB 4U31A 3TO2A 3BP6A 2DF3A 1JRHI 5E8EB 3W0WA 1N5YH 1X44A 4U6VH 8CGTA 2ZOLA 4PR5A 3CDCA 1SJEA 5TDPB 4YHLL 5JZ7D 1YY9D 5IB4B 2NCMA 4X8JB 4B7LA 3ZKQD 1GL4B 2X4PA 4OLYL 4HFWA 1MCOH 3G9VA 2VDLH 3KS0H 5C08A 5EZJA 3X17A 5F1IA 4N68A 1DVFB 4GUPA 1I4FB 3UXFA 1HE7A 4PJAF 4XP1L 4GQ9H 2PYEE 2XNAA 4JKPL 2GCYA 3LEVH 2VLLA 3SCMD 3BXNB 4HW6A 4RMVA 5JQ6H 1AIFB 1NLBL 5B38B 5GGQL 1DL7H 4WI7A 2YPLE 3GMOA 4I3RH 1RZ7H 2LU3A 2PR4L 5I16B 4RAUA 2BJMH 3SGKC 3CFJB 2CGRL 3NH7L 5I0ZA 3K1DA 2XZZA 1FZJB 3NPZB 5FUZL 4JHAH 5HVHC 3T0BA 3AM8A 3GSRA 5E2WH 1L7IL 1FBIH 5D1XB 3L3IB 4M6NH 1QSVA 5K93A 4I77H 3ULVE 4OD1H 2ZUUA 3WFZA 5LBSL 2KL6A 5HHNA 1I85C 1RZKC 2EC8A 2PYEB 5D9SA 4FXGB 3ARDB 2A9NH 4HUMB 1DQDH 1NAML 4ZO9A 5I74C 3RTQA 4XZUA 4HH9A 4QY8B 5H2BA 1DVFD 3OAZH 2C3VB 5I8CB 5LAXA 2RIKA 3WYRA 1CL7H 5FHAL 1MHHB 4F58H 2J6EH 3RY5A 4DUWA 4U49A 4JPWH 4Q9CA 3O11A 2X44D 2HFTA 1CCZA 4ZD3H 4I0PB 4DQOL 4JLRB 4HJ0C 4TUKH 3KLHC 2HFGH 3FQNB 2Z92B 3T08A 3O9WD 2A6IB 3VFTA 1U8LA 5BOZG 2FO1A 3HPLA 3LRHA 1BQHA 4HIXH 1NSNL 1XR9A 5H37G 4UT9L 4WTZA 2F74B 3NIGF 3QRGH 5GGSY 1WT5A 1IEBB 5I1AB 4P4RB 3UYOD 4Q97A 3FB7B 5IM7B 3N85L 4I5BA 4YXHL 4K3DH 1IQWH 4PB9L 3UTQB 5FYKH 4KVNH 1P7QD 5IW6B 3WNMA 3U30C 3GSXB 3FRUB 4KJQC 4BQCA 5MENB 3BW9A 4ELME 2F54B 1YN7A 4JKKA 4WTXA 5H8DA 2BVEA 3B3IB 1AKJB 3BKJL 3RWCA 5TDOB 5AG8A 2IAMA 1U8OB 5GRVL 1YMHA 4Y2DC 2DQIL 3GSRB 1K6QH 1U93A 5T1LB 1VKXB 1NMBL 4ZS6D 5AWNH 3X14A 1C5DA 4YHYB 2HH0L 1KENH 4JGMA 1DTUA 3MCKB 4PJ7A 7FABH 4PGEA 2F5BL 1VEMA 5BS0B 1VB9A 1LQSR 3VXMB 3MRGB 1KGCD 2HLAA 4Y5YA 1AE6L 5DEGA 5CZVH 3MNWA 3RIAK 4MZ2A 3QI9A 2ADIB 4I4WB 4AEIL 3W11C 2DYPD 3BISA 1RJZB 1SJHB 3MV9A 4X4XB 5C0IA 1JYNA 3V52H 2FATH 3CFEA 1CBVH 1KB5B 4LHUD 4OCXL 3QO0B 2FECI 1JGUL 2X4TA 2XG5A 3TP4A 4XP4L 1KTLA 3Q5OA 1LVEA 2JCCA 3L6FA 4JFXA 3V4VH 1ACYH 4LKXB 3MLSH 5TF1L 1LE5A 2V17L 4OLWH 4LSVH 3RIFK 3V0WH 2DQFB 1P84J 1TCRB 2EEBA 5LCVH 2X7LB 3SGDI 2VO5A 1B4JH 4JFHD 4PJ8B 1UKTA 2VYRE 3VFSB 5C9JB 3G9AB 4PBVC 4ERSH 5E6ID 4LCIL 5MEPA 3P73A 2ITDA 2QQNH 5ISZD 2EDQA 2RQ8A 2K3TA 1U41A 3LEXA 3QUXB 2OP4H 1R3IH 1K8IA 1GZQA 3O8XB 4MX7A 1NL0H 4XCFL 1DEEB 4EI5C 3QXDA 3MUHL 4GKOA 1CDCA 1T83C 4KY1L 5ABDE 3MUY1 4XBGA 5KSBF 5JOEA 4DVBA 2WSKA 4M02A 5DT1L 4ZUUB 2KQMA 2DIAA 2RCSH 4R0LC 2ID5A 1PX4A 5KJRH 5F8RC 3T09A 3O4LD 3ARGA 1RU9L 2IGFH 1G84A 5I66A 5JIHA 1HHKB 4X7FC 4FTVE 1LO3H 4WDIA 4R8WH 4NQVB 4N9OB 1ZS8B 5C07B 4OD3H 5J7CC 4CUCA 1YNTB 2FHCA 4C83B 4D3CL 3SDXF 3AM8C 4JANA 1FZMA 4HIEB 4N0FA 1BP3B 4XVSH 2J8HA 5D6DA 3GSNB 5A2IH 2A74B 4EJ1C 4HIHA 3FZUC 5BZWB 3SE8H 3WUWG 4A6YB 4FQCH 4LCWA 1A02N 4FNLL 1R0AH 3GSVA 4FQXA 2YSSB 3OHXA 4OZFA 4XCYA 5GS0C 1GOHA 2N56A 3WDHA 5DJYB 4HKBA 4R9HA 2HWZH 2OLDA 3U82B 1UJ3A 3MV7E 4OBSA 3UTSD 4CADB 5DMKA 5C0FB 1L0YA 1U8PA 1F3RB 1FFNB 2EKJA 4DAGL 4ZFGL 4UUJA 4EOWL 5DO2D 4GMSL 4B7IA 1UXSB 1TIUA 5I1IL 3GSWA 5E2VH 3V6FB 4DOHB 2WBJD 1HHJA 5E8DL 2SEBA 3UEZA 4WUKH 1J87A 4JFEA 3ZT5A 2QSQA 1U58A 1JZ4A 5ENWB 3IFOA 2XTJB 3FT3A 1K8DB 3WKMH 3RPKA 3U30B 3MLZL 4FFVC 3KVQA 5IW1B 2A0LD 2PYFA 4WJ5A 5I74B 3CH8A 3MJ8B 2APBA 5T1DH 3ECBA 1A6VH 1CXHA 3HI6L 3C60D 3K7UA 4NN6B 4DKFL 2Y5TA 4MA3B 1ADQL 3B9EA 1EV2E 4MX7B 1T83A 1QOKA 1WBXB 4NJAL 3MV11 3D5OF 3WFDH 4K7PL 4JM2A 1HHIA 1YPZF 1NC4B 3RWDA 1N7MH 1RHHA 2DWEB 3OKKA 1CFTB 2FH8A 1FNGB 2R0WL 2QADC 2V5MA 2Z8RA 5CJXC 2R2BA 1KG0B 3GJFH 2CKBB 3KPNB 2D0FA 3F7PC 2Y72A 1QSFB 1FYTE 5IVXE 3HUJF 4ELKA 1TJGL 4NIKB 2YPVL 4M6MH 3NACH 1CD1B 3UZQA 3K81A 1PVHA 5DA0B 1A47A 5MHSD 3HZYB 2OSLA 4P2QA 3ZYZA 2X9WA 5CGYC 1QEWB 4PJXB 4EI6B 3WUWB 2VITB 2J3SA 1P4IH 1P9MA 1BLNA 5GGSA 3TH4T 2RGSA 3WXWH 4P9ML 3RVXC 1VGKB 4CNIA 4G8GE 2VSCA 2OL3H 2WINA 4Z7VF 4AH2A 5FGBC 1JYXA 4KV5F 3E2HB 3FQWB 3VH8G 2OYPA 3BKYH 3CUPA 3VXRA 2AJXH 2EH8L 3CMOL 4MLSA 4OI8A 3GSUB 1QNZH 4WFGE 2DTML 5FEBA 3VI4E 1A6UL 1BFOA 3RKDC 3ETBF 4NT6A 1T2JA 4UUJB 1BIIB 1UH4A 3O3UN 3QNXA 2E6PA 5IKCB 4LPWA 3FKUS 2CK2A 1HIML 1JP5A 3QHFH 1EO7A 4Y4HD 2GTWB 2PCPA 1QHPA 4K8RH 5EIIB 3BPLB 2Y6SD 1T89C 3BZFA 4Z7WE 3TO4B 5JW4N 5HGHB 4G9FA 2YMXH 3KJ4B 5D1ZB 1TENA 2VC2L 2QSCH 3S5LB 1NKRA 4Z77B 3PDOA 2X4OB 5D2NB 3QEUB 1V3LA 1EFXA 3IF1B 4UV7H 4XNXH 2DQCL 1Q1JL 1BAFL 4FTVD 2Z8WC 3GIVB 5FM5O 1IFHL 3DRQB 1ZA3B 4ZUTA 4KI5D 1WZMA 3RPIA 4IRZH 3EKCA 3MLUL 4OKVB 1NFKA 1LO4L 4MMXC 2BXYA 5DUPL 2YUVA 1F4AA 2CLVA 1MFBL 4KKCC 4RIRA 5IQ7L 1DLFH 4MJIB 1TTFA 5I1HL 3WIHL 1NGYB 4E42A 1Z5LB 2B2XH 2Z9TA 1VGEL 3O3DA 4HJJL 1CXEA 5L2KE 4PJ9C 1JGEA 1FJ1A 3JTSB 3M45A 3G08A 2VQ1B 3VXRB 2H6PA 3MRIB 4CBPA 4I9WE 5H94B 1S7RB 1BVKA 1TVHB 3O6ML 3UJTL 3QHZL 1B0GB 3NABH 3DUSA 4GKNA 3OKOB 3MV7D 5FO8A 2HT2C 1F4YH 1A0QL 3O6FD 5DRXA 4Y16B 1F8TH 1T0MA 4PB9H 3GRWL 4CVZA 4AEHH 3MBEC 3SE3C 2ATKB 4Q6IC 2P5EB 5J9PA 1CLZL 1EX0A 1C5BL 2Q8BH 2OCFD 1YEGH 4MD4A 4N5ED 3ULSA 1TCMA 4M1GH 3VWJD 4S2SA 1BREA 3TCLA 2M1KA 5HHQB 1AR2A 2V9TA 4NBYB 1AI1L 1W0WA 4PRHD 3L5XL 4CJ0A 4JO3L 4I0KA 2J88L 4PJGF 3D25A 1WFTA 4NHCH 3Q2CA 3HNTL 5DK0A 2ED7A 4FFWC 5F44A 3RI5F 4IJ3C 3F6IA 2FBOJ 2HKFL 3ARRA 3RKPA 4A6YH 1C08A 1KENL 1RIUL 4KZDH 2F5BH 1A7RH 3U4EB 2UY6A 4S1DC 3LDBC 4DOHE 4PP1D 2XNAB 3VFMB 3VRJA 2PO6A 3BPOC 3QG7H 3UMTA 1HCFX 5DF0A 5FO9A 3LQMA 4FRWA 1DVFC 3GSOB 5TDOA 1JHLH 5SWSE 3RWJA 5MEOB 4NNXA 1A7PL 3OXSB 1OW0A 2M26A 3PGDA 3IDYB 4LDOB 4KJPD 5DI8B 4HJGB 3IJSA 3BEWB 3GK8H 3MV9D 5JR1H 2VOTA 4XVTH 1CD1A 2V9RA 5KZCD 1CK0L 1H3TA 4GKZB 1S78D 4UZGA 2YZ8A 2DTSA 4KC3B 2ZUXA 4YX2H 4KVCH 3MREA 3SGJA 4PJFE 5DHYB 1QRND 4Y4HB 3C8HA 3L3HA 2MHAB 3NA4A 4JM2F 2EIZB 2YA1A 5HSFA 5LQBL 1PSKH 5EBWB 4N0RA 1E4XH 1CFSA 3IAQA 5DQ9A 3C6LA 2R2CA 4XCFH 2YD5A 3A0OA 4NQSA 1FNEA 5CJ8A 3MLVH 4BSVB 1I1AC 1KJ2B 4TOYH 3TBVA 4KY1H 1OGAD 3ZL4L 2GJ6B 3HE6D 5JXED 2CMRL 1AY1L 2P47B 3BD4A 1JHKH 1HEZB 1A1OB 1UZ6F 3PG2A 5E99H 3MNZA 4HDIB 1WC7A 3SKJH 3UZEA 1K85A 4ZXBA 1X9QA 1IAIH 1F11B 3OKNA 5C6WH 4U3XA 3MC0A 3TJHD 2VZUA 4JR9L 3FFCB 5INDB 3W0WE 4JM2C 1WWWX 4GBXC 3IJHB 3GBML 1B6DA 2DN7A 5DD1L 5J1SC 4N0UE 1KJVB 1IT9H 4PPTA 2MQCA 1IILE 1SYSA 3KPSB 5C70A 3QWOA 3AC0A 4BSVA 4JFXB 5DFWH 4ZFZA 1V8HA 4IBLT 4I18C 1T1ZB 1TJHL 5D7LE 5HYJB 5BO1L 2HVJB 5CZXC 3NIFE 4ZAKB 1FQ9C 2AJUH 3LH2L 4YDLB 1UXWA 3OZ9H 1KC5H 3FB5A 5ANME 4BQ8A 1YECL 3C60B 1HZHH 3P4NB 5JW5B 5SV3A 4LCCA 1NC2D 1D6EB 1GGCL 4RGMB 4PLNC 4M03A 2X4OA 1Q9KA 4X9FA 5CP3A 3VH8A 2FJGA 2AKRA 2XTJD 4G9FB 3B2UD 4GKZA 1V3MA 3D9AL 1IGTB 1S7TA 2BERA 4L9LA 4LSQL 5E4IA 2CIKA 2HG5B 2AK4B 1QFUL 4CADA 4U2YA 4EVNB 4HCRA 1F6FB 3P4MB 4P46C 4P9HH 1X5AA 4ZPTA 1RI8A 4OGAC 1D9KB 3SDDB 4NT6B 1ZOXA 1MCOL 5C9KA 2EKSA 3QNXB 1CT8B 4ODVH 2ZG3A 4Y5YB 3GNMH 7CGTA 3GMLA 4XP1H 1CLOL 3HMXH 5I1DB 3DLQR 4D0DB 3G6DL 3RHWK 4R4NC 3ARBB 3T0EB 4HXAL 1XGUB 4Z0BL 4APQB 4QYOB 3SDCC 4LLQB 3L3JB 4M1DH 5ESQB 1YEEH 5B8CB 2DBLH 4U1NB 1I75A 1JZ6A 1NFDA 5GSVA 3TH2T 3QFJD 4QXTB 5CEZL 1P7HL 2NXZC 1ED3B 1EAPA 5JOPE 2DB8A 4KRMB 4HWBL 5TQ0H 4R97B 4JHAL 3T2NH 5KW9H 4M93C 1KPRB 1ZT7B 1BF2A 2DMCA 5ERWB 4EI5D 1GIGL 5DA4A 4QRPE 4LSPH 3TM6A 4LRIC 5IMOB 5FO8B 4U1MB 1VHPA 3TZVA 3N1FC 3REVA 4YPGA 3G6JB 4IRSD 5D2LE 4YXLL 3LEYH 1A1NB 3HI5L 4S1QL 1KEMH 5EZLB 4ODHH 4UTBH 2X1OA 1IC5H 3MO1A 3U7WL 1JGDB 2VLJB 1CQYA 2YPLB 3P40A 3MJ8A 3R06A 1MAML 4JDTL 2RBLA 2JJSC 4LQ1A 5DJ2B 5FYJU 4QT5A 3QFDA 1QFHA 4JO1L 4JPWL 1J0ZA 5TQ2L 2M2DA 5GS0D 4NQCB 3MRRA 4ZD3L 4K8RL 4ODSL 3L6FB 4IDJH 1YNLL 1IC4H 2EEAA 4EUPA 5JW3L 3AFLA 4LBEA 4MXWH 3DNKA 3ZDYF 4R2GB 1MCWW 1RUPH 2N7BA 3F62A 3IKCB 1CR9L 4OV5A 3SDDC 4X4YA 1V3KA 3L3KA 4FZ8H 5HHQA 3HE7B 1G7LB 1VCAA 4OGZA 3SE4A 2OX5A 5EUOA 1N4XH 2VLKD 4NCC2 4BA8A 3WKNA 4BZ1H 1A6TA 3HE7D 2X4SA 4LPYA 2ZG1A 2EDDA 3TO4A 2IAMC 3RP1A 4PD4J 1CE1L 4M8QA 5FYKL 3NGBC 1IAOA 1HH6B 4PP2B 1S7VB 2VMFA 3L9RA 43CAA 3QDHA 5FA4B 3GI9H 4HFUL 1T0NB 2Y4SA 1CICB 2AJ3A 4UQ2A 2VIRA 4KQ3H 3OR7B 3SOBH 1WLHA 4ENEC 1NMAL 3KPMA 4G42A 4Y4KB 4ZMAT 1U8QA 3SCMA 1S9YA 5AAWA 3D2UB 4LRNH 1HINL 5FA3A 1TPXC 3ZDZF 4HUWA 1IGFL 2Z0BA 2APVA 3MXVH 4TSBL 1RY7B 5KSBB 1Q9LA 1F3DJ 2DQDH 3LHPH 1QTYT 3O6LL 4BM7A 3WSQH 3LIZL 1F4YL 2D0HA 1KB5H 1FZKB 5ILTL 2OI9B 5F9AC 1KPUA 3VA6A 1H9VA 3KPRD 4QXGH 4JZNB 2XYCA 5L2KA 3DHMA 3DGGA 3ZKNC 2R4SL 2G60L 1Y6NR 4L3AA 3WS6C 1ACYL 5SWZE 3IKKA 5HDBF 2AJZA 5IEHB 4LLWB 1VADA 3O9WB 4ZQKA 3VD5A 4OBRA 3QEQD 2GKIA 1T5WA 1I1FB 3KLAA 3OBAA 1BOYA 3BQUC 3FTGB 3R1GH 1MOEA 1NH6A 2PNDA 5IVOA 5I66B 4I18B 3MV8B 2IANA 4NHCL 2BMKA 4RBPH 3FO1B 3IDXH 2R29L 4LHJB 4AIXA 2IALB 2HRPL 4HF5H 5ETUB 1ZV5A 5EH1A 1C7SA 4FFYL 3UTZA 1P69B 2P8MA 3VXUE 2CDEB 4ZTPH 3X11A 3QXUA 3O4OB 1KIRB 2X4TB 3B4NA 1IAOB 3DI2B 1A9EB 1RJZA 3QWQB 4X4XA 5C0IB 5M94B 3D85D 43CAB 4RMQA 1BPVA 3CFEB 3N9GL 4HKBB 4KDWA 2JLLA 3WFEH 4D8PB 3QI9D 2XFXA 2WBKA 2NTFA 3QQ4A 3UJJH 4KJPC 1YC8A 1TVDA 1JWUA 3ILPB 4FHBD 3ESUF 5JR1L 5T5FH 2X41A 5D1XD 4KKAC 1AGBB 2IGFL 2X7LA 3SY0B 3LB6C 4X7TA 1NCWL 2A6JB 3LQAL 2YS4A 1FRGH 4UIMA 2ZPKL 3W82A 3QDAA 3E6HB 5DJCB 2AEPL 3C6SB 4MQ7A 3QHTC 1NC2B 2FYYB 3S4SG 5DC9B 3ALPA 3OKLA 3W9DB 1KCRH 4XBGB 3NCEB 4ZXBD 3OKEB 1WFUA 5L0QC 1JGDA 2VLJA 3DVFA 3V5DA 5BRZE 4XBPA 3X12B 4DGYH 3R06B 5ITBL 1FG2A 4NHUA 3QDGE 4NC1E 4Y19D 4OZ4B 1F4HA 1UCBH 4WI4A 4TN9A 4KKBC 1YQVL 3F58H 4J3VA 5I1IH 3FCTB 4ENED 1C1EL 5DR5L 2QEJA 3H6JA 4HMEA 3UBXI 4TRPL 3MLRH 3RX8A 3QCTH 2Y36H 1FNEB 4KUZH 1JPGA 4M7LT 3TPUB 3O3DB 4J3XA 3RWFA 2P8MB 3RY6C 5L2JA 3FQXB 2NW3A 2OZ4A 3HHRB 4YQXH 1RUQH 4RMSA 4QXTA 3D3VB 5IFHL 2P49B 3HE6B 4XH2A 1GPOH 3RWHA 5LAXB 2EYRA 1H8NA 5DDHA 3MREB 4O02L 4P5KA 4HHAB 4OZIA 4S1RH 3WD5L 3JV6A 3T2PA 4K7PH 1YECH 4MXQD 1R5VA 3FRPA 5D7LD 2CH8A 4LSRL 2IBBA 3L5HA 3MX0A 1EFXB 3IF1A 4U1MA 4I3RL 1PD6A 3R0NA 3SCMC 2I5YH 4JLRA 1G9NC 2FL5B 4NUJA 3O2DA 1AO7A 1ZWIB 5FYLH 3NH7H 1QR1A 4UIKL 3W0WD 4XB7A 1DSFL 1TJGH 1L7TH 1NC2A 2FYYA 5AZ2H 2E5EA 1G9NH 4YO0B 2WBJA 2YKLL 4G5ZH 3E6FB 5ANMA 5JORA 1A3QA 1MQ8A 3SDAA 5MEQA 2R69L 3ZYOA 1SJHA 3DI3B 3MV9B 1A6ZA 4P9MH 3JWOH 2G2RB 4N5EC 2VAJA 1SEQL 5EFIA 1IMHC 5ADPH 3TH3T 4Z7WF 1CLOH 1LWRA 3HMXL 4G9FE 3D39D 1LD9A 3OXRA 2VDOH 4OF8A 4MNQD 1OTSD 2DJ4A 4LIQL 4N5UA 3MRNB 3ARFD 2W9EL 3P77A 5KSUA 3OB0K 3DYPA 4HG4J 3ZKXC 1IM9D 1B3JA 5HI4C 2X70B 4PUBL 3B9DA 3G04A 3WO3B 5KS9B 3HG1E 1A5FL 2X5PA 3DX6A 5HYJA 2HKHH 3QT2A 3PP3K 1QBLH 1CFBA 2XV6B 3PHOB 4EI6A 1LDPH 1KCUH 1NKOA 4K7FA 3T2NL 2P44B 3QNYA 1EO8L 1N6QL 2YD9A 4O2EA 2GI7A 4G6MH 3TBYB 1CFQB 2EYRB 3MJ7B 4NC0B 1U8HB 3P30L 2VC2H 3ZSSA 1GYAA 1ZLSL 1W0WB 3JTSA 1U0QA 3LMJH 2Z8SA 5L8JB 1TVBA 3RRQA 4XNMA 4XCNA 4N0YL 4R0LB 1BBJB 1FYTB 2V5RA 3FQTB 3FTGA 3KGRA 4YXLH 3VMPA 2R23A 4OF6A 4TTDC 4Z95H 1LE5B 2XZAH 5C08B 1PYWA 4ODHL 1CFNA 5D7KE 4YXHH 1VACA 1ZGLP 4PRID 3MQIA 5K9JL 2PN5A 1VEPA 1N5AB 1N3NA 4FTVA 2FZ3A 1P2CB 2YD3A 4YWGL 1LP9B 1ZMYA 5IIEB 1XF3B 1DR9A 4QGTA 3GM8A 2GUOB 3MLUH 3ARUA 5KSBE 4F9LA 3KXFD 3CX2A 5DUPH 3PWLB 2GHWB 4XP9L 2MTPA 3AS0A 5F9OH 3DX9A 4XCCL 1J05A 3VGBA 2J8OA 3FL7A 5JOFA 1XGUA 1U3HD 2ICEA 2L4OA 3BQUB 5B38G 1K6QL 3HPJA 4IIQB 1N0XH 5KVFH 4ODXA 5FGSA 3PP4H 2Z35A 3CH1A 2EDJA 4RQQA 1N2RB 1JPTL 3VGFA 3S3JA 1QSEE 4ONFH 4P3CH 1ED3A 5MI0B 4NGHH 5DHVB 5D2NC 1N4XL 3L1OL 4PJ5A 2W38A 4GMTH 3LQZA 1QACA 1U91B 4L8CB 2ADJA 1BJ1H 2AQ2A 2X9YA 4TNWF 5DJCA 2Y06H 3EDJA 5FGRA 4XP4H 1AXTH 1R5IA 3F12A 1GCFA 3IFOB 5BVJA 3GSVB 4X4ME 5HXMA 3OQ3B 4ZFFA 2HMIC 4FQJH 1U95B 4KQ3L 4Y4KC 3QH3A 2EZ0D 4XBPB 1JNNL 3EUUA 3ZT7A 4JVUA 1XF5A 3OX8A 4JFYB 4KWUA 1VFOA 3SEPA 4JFDA 1Y18A 4YHZL 5CD3B 2WV3A 2XI9A 3BSZL 3WO4B 4NQEE 5E2TH 4GRWE 3KPQB 1VACB 1R3IL 3A6CL 4JQIH 3ILQC 3LHPL 1C12B 5C86A 3LVEA 3LKOB 2HTKD 3FQTA 3GRWA 1UWXH 5DRXB 4L8DB 4CVZB 4EUPG 4K3EH 4AY0A 2G60H 1OCWH 1A9BA 1A22B 4IMKA 3D3VE 2LV4A 2GFBB 5EN2B 4YBLC 2W9DH 2WQRA 2EIEA 5HDLA 2AJVH 4JFFD 4OZFG 3MRPA 1WBXA 1F02I 4JFFB 3VRLF 4XNYL 1EEZB 1AHWA 3VMNA 2UYLA 3H3KA 4JRXD 1OLZA 1UB5B 3VGGA 1AD9A 3QDME 1NMCC 1FN4A 4PJ9A 3IDGA 4HPYH 3IXTB 4QLRA 4ZTPL 2NY0D 1T0MB 1K8DA 5I75B 4G8EB 4ODTH 1G6RB 3PDDA 3AAZB 4WWKA 3NZHL 3NPSB 3D2UA 2HVKB 5F7UA 5DTFB 2XWTB 3AU1B 2PTUA 4GH7B 3KPMB 1KXVC 4POZD 1QSED 3GM0A 1JFQH 2CMRH 1S5HB 3FOMB 3PIQA 1QR4A 5DEGB 2HFEA 4TUJA 4K7FB 1ITCA 5AG9A 2XXMB 2ZUWA 3QNYB 5E2VL 5MHSE 1DBMH 5HGAA 3MRKA 4Z7WA 3ZTJH 3BHBB 1QRKA 3LB6D 5D1ZA 3BYYA 4IOIB 4IRJB 1YA5A 1FV1A 4NWTL 4Z77A 5HBBA 3OPZH 4OCNC 3LKSB 3ZDXF 5KSUB 2WK2A 2LAAA 3P4MA 3V7AG 5C1MB 2C3WA 3M17A 4PJIE 4NFBA 3H8NA 1Y18B 4BZ2H 2HAZA 4M3KB 5IKCA 1TJHH 1VFBB 1KCRL 2P48B 4ZUTB 3HG1B 4K2UH 3HRPA 5CLTA 5D7KD 1ZEAL 1TLKA 3FN9A 4WCYL 3K2UH 4JKPH 2WZPD 1N64H 2AXGB 3DRTA 4K8RC 3DARA 5ACZB 3NTCH 4ONOA 1KC5L 1AGDB 2BMKB 4WFFE 5ANMB 1SBSH 5JTWA 2ZKHH 4LIQE 1FE8H 2ZOKB 5A16A 1M71B 1RIVL 2ZP0T 3MFFA 5TE6H 3EOTH 5JOFB 2XWJB 5ID1A 1RZ7L 3LKSA 5D2NE 5MI0C 3ARBC 5D6DC 1JPFA 4WU7A 2ZUVA 4WFGD 3GJFB 2VAAB 1B9ZA 4TRPH 2BNRB 4P5MB 4WUUD 5T3ZD 4M8VA 5E2WL 4NBZB 4F33A 3KYNB 4PJAE 5DJDB 3GKWH 3C6LB 2VZTA 3RA7L 1HHGB 3KXFB 3O4LB 3BPNB 3C5ZA 4MB3A 4HIJB 4NWUL 2R0LH 2XQYG 1T1WA 1MIEL 1QHOA 5FO7A 3EFDH 1KJMA 3CFBB 1A14L 5EO0A 5LBSH 3G5ZA 1IBGL 2VKWA 2R2EA 3NOIA 2W1NA 3MBED 1OD9A 1LNUA 3D0VA 4P3DA 1Z5LA 1FYTD 3TV3L 4BSWB 4XI5C 5F8QC 5GGRA 3O8XD 1AGEA 1KTKE 5IHLB 5JZ7C 1EHNA 5F9DC 2BSTB 2DBLL 1F6LL 5C2BH 4KRPB 5D2LA 1CL7L 5FUOL 4KJWD 3U36B 2BVYA 1N59B 2KZWA 1AGCA 3TGXA 4Q9RH 4WO4D 5E2UH 3GMRB 5FHAH 4F58L 3ROLB 4MZ3A 4PY7B 4J8RB 4UIKH 3I75B 3ULUF 4DZ8B 1NBVH 3T0AA 1EUTA 2EIBA 2JTDA 2DI7A 5FCUL 2BNQB 1TVHA 2AEIT 3GMNA 5GXBB 4OZIE 1SM3H 3VFMA 4L4TB 2P5WB 3VRJB 3CFDB 1GIGH 3BGAA 4F7TB 3MCKA 3WJJC 3ULVF 2QSCL 4Y2OA 4N1EA 3VDBA 4KKCD 3UBXA 4NQEB 3V95A 4GG6F 1AGDA 2H3NB 4MSWA 5ID0A 3I02A 4YZFE 5BVPH 5EDXA 3MJ9H 3EOBA 4ZOAA 2DQCH 2YRPA 3MR9A 5HHPB 4Z7NF 2DD8L 1J0KA 3NCYP 4MNQB 5HHME 3BAEL 4RISH 3HR5A 5GGUB 4M5ZH 3VGHA 2HTLC 4PYGA 3ZYIA 3QUML 3BDXA 4NOFA 1UJ3B 2IPTL 4JZJA 4CW1B 5EU6D 1CD9B 2W0LA 5ISZE 1NFDB 4Y2DB 4J6RL 3AMLA 2KZ1B 1XF5B 4ZO7A 3QXWA 4UNUA 5BQ7B 4F7EB 3HZVB 2CLRA 4QRRB 2YC1B 4JFHE 4DWHA 1DE4A 3MRFA 3MLXH 4X6BA 4FMFA 3I6KB 1F2XK 1KN4H 2F54D 4H0HB 4WO4A 1F6AB 1IC4L 3EYFA 1QQDA 3O9WA 4ZQKB 3FRPG 4AL8H 3MYJA 3THML 1XMWA 1P4BL 1NUFA 2FJHA 5JW3H 1J8KA 1MFDH 2C7UB 4Z7QE 5T3XH 7FABL 3ES6A 2MQ0A 4JKLA 4CW1A 1D5MA 4ZPVA 3T8XA 4R3SA 4QRUA 4OFVA 2NY6C 4PJGE 5E8PA 3RL2B 4OCRL 4AEIH 2IFGA 4UT7L 4Z95L 4U1LA 3V52L 3QXVA 3QXDB 4UAOC 4BSWA 1M05A 1JF6A 4JG1L 4NO2B 4G43A 1RV6X 4QCIB 4AZ8A 5DSCA 3LZFH 3O3AB 2D9QB 3X13B 2Q7YB 3VXSD 4JY5H 4L4TA 4OUUA 1C16B 3DHJA 1LO0H 3G6JE 4UQ3B 2OQJA 2VTFA 1FGVH 3AUVA 4H1LA 4PREB 4RGNE 1WF5A 5IVNA 5CGMA 1N3NB 4WWKB 1PG7X 5GRXG 3CAFA 3ZKMD 1EXUB 1XCQA 3ZKSD 5C0GB 1MHHA 1M05B 2YN5A 2B4CL 3QIWC 2ED8A 4OGYH 4Y19B 3L5WA 4PY8I 4MJIA 1Q0XH 4XWGH 4NRXB 4MDJA 1FL6A 1XIWA 1MHPL 4Y5XC 1QBMH 5EPMB 3U7AA 1INEL 1CFQA 1ZLWK 1J12A 5DT1H 2YUXA 2X4UB 5DLML 3GBLA 5T3XD 5DGQA 2D7TH 4LAQH 3H7BB 1A6WH 2VR5A 3BX7C 4QWWC 3MUZ1 4L29A 1TJIH 1T22B 2WANA 3TO4C 2NY2B 2LQRA 1H8SA 3GEWB 4R7NA 3ZMRA 2C1PB 3RZCD 1BQHG 1UVQB 4GRLC 1JZ7A 3IDXL 5CHNB 3H9SA 1RZJC 4WJ5B 2ZCHH 4GRLA 5SWZD 1S9KC 2X4SB 1IM3B 3S36H 3MV01 4DVRL 3BSZH 4FNLH 2WP3T 1R0AL 3BP7B 4X8JA 3A6CH 1LD9B 3OXRB 4HT1L 1ZT4B 3QUMB 4YK4C 4JFED 2F58H 3HFMH 1SYSB 3KPSA 5D2LB 1FVDB 4YHIB 2VZSA 5CEXA 4LL9A 1BM3L 4RQQB 3ZL4H 3GMMA 1UM6L 4KMQA 3QUZA 1SVZA 2OMNA 3KYOA 5EULV 5F7NC 4ZO8A 3QCUH 5GGRY 3VXOB 2AI0L 5L0QB 1DUZB 3FB5B 2JF1A 4DTGL 3IAPA 4LVEA 5E8DH 4Y8DC 4LSSL 3ESVF 2YK1L 4L3EE 3LQAH 4ZTOH 1TETH 1E4XI 5F7DB 3U9PL 3QEQB 1JJUA 4G7VL 1BLNB 2AXFB 4HD9A 4WI3A 1R24B 2XTJC 1H5BB 4MNQA 4XMKL 4D0CB 2MCPL 4ODTL 1XZ0B 3VFVB 1DFBL 1SY6H 4MA8L 5BXFB 5ESVB 2OK0L 2EO1A 5IQ9B 3WFDL 3L3HB 4YZFF 4MDJB 5ERWA 1V7ML 1UH2A 2P5WA 4TTGA 4PGBA 1ONQB 1UA6L 2A9ML 4FXGA 1UCBL 4JEGB 3GI8L 4MQTB 2ATKA 2IH1A 1OPGH 2Q7NA 3DUUB 4YFLF 5FKPA 3V5KA 5JA8B 3FQNA 4CAGA 3QNZA 2VL4A 3T0WA 2FNBA 3I6LD 1MRCH 1ODAA 2Z31B 3D9AH 3QO0A 1Z3GH 2WMPA 1YPZA 1OL0A 5I9QC 1ZA6A 4HIIA 2ICWB 5E1AB 3VFGH 2Q86B 1KIQA 3RAJL 3MRLA 1FZJA 5DHVH 1G9ML 3VRIB 2F8OA 3HZMB 1CD8A 1ZANL 3QUZB 5DO2C 2VR4A 3QEUA 4G43B 4D2NA 2CLRB 3CLEH 1ZS8A 3F7YB 2AJXL 1J8HA 4HXAH 4O02H 1FVDA 4YHIA 4H8WH 3NIGE 4EUPB 1XGTB 2XWBB 4ZG1A 1X5KA 1TTGA 4V1DA 2HJKA 2I5YL 1AJ7H 1WWAX 4PV9B 1EIBA 1DQLL 3BIBX 3NGBB 3BH9B 1XAUA 4H88L 2C5DC 2RJMA 3VI4F 4TPRL 4U6YB 2DQTH 4P23A 4U1SA 1RUAL 1KJ3H 2GJZA 2EDTA 3DBXB 4MA1B 5HGAB 4HDIA 3BH8A 4HH8A 1Y0LB 2CK0H 3P4NA 2F19L 3QQNA 1WBZB 2R69H 5FYLE 1PKOA 2HFFA 1CS6A 1J05B 4MLIA 4X9BA 1RFDH 1B0GA 3PWPB 4Y4FA 1YMHB 3EFDL 2H32A 1LEIB 4OUUB 1IBGH 1TPXB 4P5TD 2A6IA 5HYIA 3T1FA 5F89B 3O3EB 1HN1A 1A2YA 1J1XH 2DIBA 3I6LE 3GJFK 3VD9A 2R2HB 3MUGA 4JHZA 4U0RB 4KXZI 1PYWB 4D9RD 3PWVA 4WEUD 3U7WH 1DQMH 1MAMH 2AJYH 2MPAH 2BHYA 2QR0B 4R3SB 3HC3H 1YYMH 2HKHL 1MFBH 3MRPB 4Z7UE 4JFFA 5GGVL 4AEEA 1U2HA 4IDJL 2BNRD 2DIJA 4OFYA 1WZ1L 2QADD 3ME0A 4HJJH 5FDWB 2XTJE 5F88A 4LLQA 4HZLA 3RY6A 3I3BA 5L2KB 2GSIA 1MWAB 3TIDB 1KT2B 4HS6B 5CMAB 2C1OB 4YHMH 1RULH 1RD6A 4F2MA 3QHZH 4C56B 2IADB 3BKML 3LY6A 1C8PA 3IDJB 3KWWB 4CDGC 1TCRA 5J0BA 4GS7C 1IEAA 4GRWH 2DD8H 3O2VH 4GLRH 3ARBD 4Z5RB 2AABL 3CVHA 3SKOA 1M1SA 2X1WL 4BZ1L 5LGHL 4R7NB 2WBWB 5FFLA 3SKNA 5E6ZA 3KPQA 2QJDA 1CGTA 1X4YA 3RWEA 1NAMB 2Y6SC 4J6RH 4JN1L 3G5XB 1MFEL 5DRZB 3LPWA 3GI9L 2GTZA 5FO7B 3WLBA 4W4OA 1OF2A 3SE4C 3VXME 5LVEA 3HR6A 3WIIH 4OSUL 4TVPL 1A6ZB 1U95A 4PG9B 2F5AL 1V05A 5EA0L 1KBGH 5GS2H 1WIUA 5D7IB 2W0PA 4XAWH 4MA1C 3THMH 4LSTL 1NFDE 4LLMA 1CXKA 1EA9C 3SDDA 1X5YA 3QDGA 5T3XL 3UYPA 5DUMH 5BOPA 5J13C 2D3VA 1H3PL 1I3GH 3BEVB 1J10A 1QEWA 4PJXA 1CGSH 1AQKL 3R8BB 2HMID 1I9IL 1CFNB 2CDEA 4X5XA 4HBCH 2BVOA 3I02B 4QRPA 5CGYD 2NY0B 3MRHA 4NUGH 2I9LA 4ZUSB 4M4RA 4WEMB 1BVLA 4JHWL 1INDL 5F6HJ 5E00A 1OAZL 2QQKH 2XWTA 4ETQB 2Q1EA 3OKNB 4JVPA 5A2FA 3WNLA 1OOAA 2QR0A 4MNHA 4PB0H 1AQDA 4OM1H 1YMMA 1R3HB 4GG8A 4JREC 4CVWA 2PW1B 4RWHA 3OGCB 2VNCA 3C09B 5DMGC 4BQ9A 2VH5L 1AHWB 1W72A 4YNYA 5D70H 4YHZH 3QDJD 2VLKA 4MXVF 3S34H 4XX1E 2VQTA 1R5VB 4DJMA 1VSCA 1R5WB 3MLTA 3NMEA 2GJ6D 4OTXL 4OGYL 2F53A 1H5BC 3MA7A 2FJHB 4KJYB 5IW1A 1VFMA 5I71C 1QPPA 4JN2B 4PTUB 1K9TA 1PLGL 1MCEA 1S7UA 4MNHB 3H9HA 1B88A 1CXIA 4K3EL 3JWDL 3MOBH 1I1AB 2NY3B 3DBXA 4U1LB 4X7CC 4PTTB 3QWRD 3P4OB 5MEQB 4OCLC 4A2LA 3ARPA 1U8PB 1QRNB 2RB8A 5CD3A 2NY7H 5CJOL 2OTPA 1S8DA 3U7YH 5K59E 1FZKA 4XRCB 5E08L 3QUKB 5CUSH 2GSGA 5F72S 3RDTD 1LO2H 4OZHE 5ICYB 5F1NB 3U0WH 2H26B 1JNHB 2FX9L 4NUJB 4OQTA 4ISVA 4OZGA 4P23C 3I3DA 1MH5A 2MQ3A 4C57C 1YUHB 3GMLB 4U1SB 2F53D 5I16A 5JHLH 4JO2H 5HI4D 4U4BA 3GHBL 4Y2DA 1JFQL 2FBJL 1NFIB 5HDQL 4WEBL 1QLRA 1CN4A 4ZDHA 4U6TA 5DD3L 1RJYB 1S9VB 1T03L 1BEYL 5F97E 5AUMA 1U3HB 2YK1H 1IGCH 2BSTA 3L5WB 3OG4B 4KUZL 4WUUE 4HUXB 4BYHA 1QFUH 2YPKB 3BPOB 1Z0NA 1UT9A 2LU7A 4JFOB 1AGFB 1MAJA 4MCYA 4YQXL 1Y6MR 2WP3O 5SWZA 2HT3D 5CIPH 2XQYK 4MNGA 2C4FU 1PZ5B 2AS5M 1S3KL 3H7BA 4Y16D 1CF8L 4PFEA 1BD2B 1RZFL 3AU1A 4XPTL 5I15L 3ARXA 2R1XA 1F90H 1F58H 3OKMB 3GKZA 3PWJB 1FL3B 3ZT6A 1D5XB 2DICA 3RWIA 2ESVD 3C2AH 1M7DB 4I0PA 4NSKA 3VFNA 5TE6L 4DVBB 3EOTL 3S37L 3VXRD 3S9DB 4NKIL 4Y1AE 4LLUA 2KPNA 3HKFA 2IBZX 1TVBB 1JZ5A 2WIIA 1VA9A 2FX7L 1I8LC 5CIPA 2VLRB 5TQ0L 5I18L 5DEZA 5ESVA 2DKSA 3WLWD 3D0LB 1XGQB 3VXQB 4QY8A 1NJ9A 4P2QD 5FAAA 5C0AD 3MLWL 3Q3GA 3BP4B 3RAJH 3B2VL 1EH9A 1B90A 4KK5C 4QGYA 2Z31C 3LRSB 1SEQH 3H42H 4X6DA 4X6BB 1UB6A 1F13A 5CILH 3CSPA 4Z7UB 3ARBA 3ISWA 4ODBD 5T3ZE 3BE1H 2W0FA 4WO4C 1XF2B 2Q6WB 2FHBA 3D39B 2NY5L 5DJZA 3FQXA 2OJZH 4IOIA 1GGYA 2JCCB 5MERA 1FNAA 2XWJA 3OJVC 4L4VD 3KYMB 3BKCH 4JDTH 5BS0E 4DUVA 3JWDC 1O0VA 4U1KA 4PJBF 1HOCA 4JZOA 1B0RA 4WGVB 5TQ2H 1KCUL 1JYWA 1J8HB 3WFCL 4JM4H 5F7EH 5T5NF 3SKUD 4XPHL 4YDKL 1EO8H 5HHXH 1NGQL 1FBIL 4QHNB 3QJFA 5IP4A 1HKLL 3L3OA 3RWEB 3TCLB 5FGCB 5CZXD 2G9HB 4JFOA 4QTIH 1ZHKA 3MPCA 1EFXD 3BIAX 3U0PB 1E4WH 2YD7A 4NNXB 1JIBA 4OD1L 5HYSB 5DK2B 3O45A 1AO7B 1JWSB 3MRMB 1T4KA 5IK3A 4LK4A 2VE6A 4HFWB 2NYYC 5C0JA 2XACC 3MRBB 4KROC 5GGSB 1JYVA 3MO1B 4WW2B 2GIYA 4HXBH 2A77L 3CLFH 1O7VA 4FQ2L 3MROA 2MKLC 4GBXB 5IBLC 4EQ3A 2JJSA 3F7YA 4OQ1A 2G2RA 4P5KB 3S6CA 5EO9B 2D4DA 1NJ9B 1C5CL 4HLZH 4I18A 2CUHA 3ZHLA 5ELIA 1FAKT 3CXDH 1I1FA 3KLAB 4N8VG 4MD0B 3EOAB 2VLRA 4DQOH 2NY3C 4XZUB 4ISVB 2A73B 5EOCH 4N1HB 5L8KB 2VXTL 4TUKL 5IMKB 5C2UB 1I8IB 1VFAB 3QSKB 4FXKA 4BH7A 5IB2B 3KXFE 2LTQB 2W0FB 1XF2A 3C09C 5GRUL 4YHML 2WAHA 3Q1SL 4I2XA 1DBJL 3LKRA 4XVJH 2XA8L 4PRIE 5DJAB 3RY4A 5I2IB 1ZHBA 5I6XC 3RVTD 5ILTH 2YD6A 4OV6F 5HGDB 1HILB 2CPCA 2Y06L 5A40E 1MNUL 2HT4C 2R4SH 3V6OA 4P48A 1E28B 2WWMC 3CJJA 5IBTH 4U33A 2ZCKL 2FB4L 4AQOA 5C0RH 4IDLA 1TDQA 4DW2H 2NNAA 5D9SB 2V7HB 5HPMB 1BFVH 5GS3A 1NGXB 5CEZD 5J11B 3CZFA 2AW2A 3CDGA 3LSOB 4LCYB 3ELAT 1OAYH 4BZYA 5C6TL 3ECBB 3SO3C 4LQFH 1LE9A 4MDIB 5E2TL 4CMHC 2YWZA 2QQLL 2A38A 5DK2A 4BFBD 5CZVL 3UTSB 1ZT1A 3H0TA 1AQKH 4PJHE 3UP1A 3UBXG 1XFPA 2NXYC 3D85B 3KDMB 1G7IA 1I3RA 1FG2B 1U8MB 3HZVA 2ADFL 4HIEA 2BY0A 2A6KB 2EH7L 2H26A 1AKJA 3RWCB 3MLSL 5T5FL 1IJ9A 1EVUA 2W9DL 2IG2L 2IQ9L 2HT4D 3BPCA 1IKFH 4FQLH 1Z9MA 1BZ7B 5M95B 5IBUB 4YR6A 1Q72L 1MRFL 1Z0MA 4PBWD 2VH5H 4ORZC 4QT5B 1GH7A 4LASH 1JUFA 4RGOH 2N7AA 1IGYA 4HPYL 5EC1B 4JDVA 3OKMA 1CFVL 3KPRB 3IVKA 2YD8A 4OLUL 4XP6H 3FQWA 4OCWH 3ILQD 4LCWD 1KIQB 4MNQE 5HHMB 1ZHLA 4H5SB 4XVUD 1VADB 5CJBA 4PV8B 2ZZUT 3P0YL 5C0CD 4HMCA 3ROLA 5EPMA 1UM6H 2UZYB 2X6MA 3CVHH 3GBNL 2BHZA 5IW3A 4PJFA 1T21A 1QSEA 3NCYS 5BW7C 1YEJL