1NBVH

An autoantibody to single-stranded dna: comparison of the three-dimensional structures of the unliganded fab and a deoxynucleotide-fab complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
219
structure length
219
Chain Sequence
EVQPVETGGGLVQPKGSLKLSCAASGFSFNTNAMNWVRQAPGKGLEWVARIRSKSNNYATYYADSVKDRFTISRDDSQNMLYLQMNNLKTEDTAMYYCVRDQTGTAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG2B-KAPPA BV04-01 FAB (LIGHT CHAIN)
publication title An autoantibody to single-stranded DNA: comparison of the three-dimensional structures of the unliganded Fab and a deoxynucleotide-Fab complex.
pubmed doi rcsb
source organism Mus musculus
total genus 36
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nbvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nbvH01
4G6AC 4N8PA 4Y5XB 5F3HB 1YY8B 1P9MA 2OQJB 2IANE 3ZYOA 3LRSB 3SDCD 3SQOL 2NY7L 1F6FB 3FFCA 4NM8H 2R1YB 2YXFA 5J13B 2GI7A 1M7DA 3GRWH 4JO1L 2NCMA 2OTPA 4PLKC 4ZQKA 3GJFB 1T0PB 1RUQH 4U7MA 1BZ9B 3GHEH 2RFXA 4XCFH 1H8NA 5DO2C 2X70B 1R5VA 4O9HL 5HDBE 4NP4H 4J3VA 4K3HA 4NFBA 4TNVK 4WIQA 3WO4B 5DQ9B 5C0DA 4U4BA 5TDOA 2FX7H 5KSAD 2CUMA 4HXBH 4PJGF 5EO0B 3GM0A 2GAZB 3WIHH 4YZFE 3I84A 2XZZA 2X44D 4HMEA 1G7MA 1TVHA 3OB0H 4P2QE 3LIZL 1YNLH 2V17H 1D6EA 3VXMD 3WIHA 3Q1SH 3BQUB 2DQDL 5FGSA 3MLWH 1G0DA 3K7UA 4H8WL 3P11H 4X99B 5DD3H 3PDGA 5AZEH 1Q72H 1MJ7H 3IJYB 3VFNA 3BDXA 3FO2A 4P2QB 2IBGA 3MYZA 5EPMB 4K94L 3PQYE 1JZ4A 1LE9B 5F1OB 1CFSB 1OGAD 4JPKL 1W0VA 4LAQH 5FM8A 1NGYB 4I2XB 2EDTA 2YRPA 3NA9H 4U1GB 5HGAA 4E5XA 2PYEA 3DARA 3RWDB 1NC4A 1PD6A 4JQVA 1IM9A 4XWGH 1EPFA 4HAGA 5EIIA 4ORZC 4K3EL 3DVIA 3F7YA 4R4FL 5GGTL 1JWMB 2GKIA 2AGJL 1QSZA 2BSTA 1XZ0B 2OR9L 2CMRH 3VI4E 4X6FB 2E7LA 5D72H 5F7NC 5FFLA 3CLEH 3ROOA 5FF6B 2DQEL 1FZOB 4XCNA 4HIXH 2FL5A 4Y5YA 1TZHB 1NKRA 2PXYC 3CXHJ 4P23D 5IBTH 1G7HB 3BYYA 4UTAH 4YHOL 2UWEE 1Y6KR 3LKRA 3I50L 1N5YH 2AXGA 4XPTL 3VFRA 3U36B 4QO1A 1T4KA 5JZ7C 1KJ2A 3BH8A 4XPHH 4NKMA 2OR7A 1D9KA 1BQUA 2CXKA 3MLSH 1KCLA 3ECBA 2UWEB 1JGVL 4FQ2H 2NXZB 4F9PC 1KLGA 1CS6A 5DJ8A 4U2YA 1U91B 3OZ9L 5DC4B 1LNUB 4LAJH 2NYYD 1DDHB 3QQ9C 1CU4L 1RZKC 1NKOA 1XF5A 3VH8G 1WBYB 5CP3H 3VU2A 4WFHE 2BNRE 4FQXA 4CDHA 5KVGH 3VE0B 1IAOB 5BS0B 5E00B 3SO3B 3SKJH 1BFVL 4CW1A 3O6KL 2BNRB 1OAZH 2Q1EA 3QZWB 3KYMB 3GSQB 3MRIA 1ZLUH 3OAZH 3U9UA 3CH8A 3S96A 1F4WL 1FL3A 5MERA 1FPTL 3N85L 2EDQA 2A38A 3V6OC 3LEXA 1P2CB 2IPKB 4R7NA 3WS6A 2GUOA 1MELA 5IW1B 3T0XA 3F65A 4IMLB 4BQ8A 2BOCA 3CDYA 4PFEA 1A3RH 4YDLC 3RVXC 1JNNL 3SQBA 2XPGA 2BXYA 1G84A 1QO3A 1WJ3A 1WF5A 5DJZA 1CFTA 3IU3A 3MV7E 1A6PA 1ZLWH 4X6BA 2UZIH 2FRGP 1B0GA 1BFSA 1JHKL 5T1DH 2FR4B 2VXVL 4OZHE 4J3XA 3MUHL 2XY2A 5DVMA 5I8OH 1MCPH 4QRTA 4F7PB 2P45B 3QUXD 2V9TA 3FB7A 3UMTA 1JFQL 1E28B 4L4JA 1QSVA 4JRXA 4WO4C 3HAEB 3U4EA 4OZHB 3D25B 4X8JB 3W39B 4YHYB 1B90A 4MNQA 2A6KA 4MA1B 1MJ8L 4PB0L 2VN7A 2VDLH 1NEZB 3DROA 3NCEB 5I1HH 1OAXL 4P2RE 1JJUA 4BUGA 1H0DA 3MLYH 3DX8B 2N4IA 3RL1A 1U8QA 5DHVH 4JRYA 3JBG7 4UAOB 3FFCB 4QXGL 3F12A 5I75B 3AAZB 1FSKC 4UDUA 1ORSA 1M7DB 2H9GA 1BBJA 1C5BH 3WE6B 5E4EB 3RY5A 3GB7B 4ZQKB 3PWNA 4Y2DA 2JB5H 1VESA 3OPZH 1RAMA 1AFVL 5FUOL 2ZUTA 3OBAA 4XPGL 1I9EA 1H5BB 3TN0B 4LFHG 5E08H 5C0CA 5KSUA 4DKAA 4OLVL 3DI2B 1QR1A 5C0DB 3WFDH 2NXYC 5LBSL 5DZLA 2R0WH 4GS7C 3RGVD 1VPOL 5TH2A 1G6RL 4ODVL 4P5TB 5D70H 1BIIB 4YK4B 4U6VL 1KGCD 3LKSA 3BDBA 2YA1A 2VXTH 4ZS7H 1TVHB 1A1NA 1CXHA 3EDDA 3X11A 2DN7A 3C09C 3ABZA 3SE4A 3SDAD 3U46B 3FO2B 2MHAA 2IMNA 2PETA 5GRJL 4UINH 2ZUYA 1WISA 1IM3A 5HBBA 4HK3J 2HFEA 1MFDH 4G7YH 5C3TA 1EH9A 2B2XH 4Q6IA 3FQUA 1XH3A 2XWBA 1NGZB 4PLKD 5A2LH 3TP4A 5F1IB 1A14L 4GUPA 5DO2D 2WUCL 5EIIB 1I8KA 3RI5K 2VABB 3ARBC 3BZ4B 1YC7A 3VDCA 1BOGA 5KW9L 2QQNH 4ZG1A 5GXBB 1OCWH 4MA7L 1NUDA 1OSPL 2IGFH 3MROB 4U1HB 4XCNB 4O51A 5DVOA 1DVFB 3BEWA 4Y5YB 3QXVA 4JFYB 1A8JH 3C5JB 3PHSA 3QI9C 1SJEB 4LFHD 3LKRB 1N59A 5DMJB 4WI4A 2AXGB 4L9LA 1JMXA 4ZAKA 4G9FE 1T4KB 4P5KA 3QFDA 1DQJB 1KJ2B 1IBGL 3BH8B 3M45A 4G6KH 4NKMB 2GFBB 5DI8B 3P0GB 3S5LG 1MFCH 5J9PB 5EOCJ 4LSSL 4OCSH 3ECBB 2DLEA 1JNHA 3P73A 1FZKB 5DJ6A 5C8JA 3TA3C 4G9FB 5EUKA 4HKXA 4G9DB 3L7FB 5ENWB 3WNOA 4X5LA 1EO5A 1XF5B 4FRWA 5A43C 1NBQA 3I85A 4LMQE 4EUPH 4L8DA 4D9QD 1H3PL 3H3KA 3K8KA 1B6UA 1JK8A 3SHSA 3BRFA 4P9HC 4LCIL 1MAMH 4NZTH 4ZPTA 4PJCA 6CGTA 3ZKXB 2P49B 5FYLL 4HFWB 2YR3A 5FYKD 4MA8H 3HZVA 3S96B 4BM7A 2AVGA 1XEDA 2ZUWA 4NCDA 3TVMB 3GDBA 3G04B 1N5AA 1WAAA 1HXMB 5AZ2L 4MAUL 3FMGH 2VQUA 2GUOB 5JZ7D 5L2KD 1QO3B 4U7KA 5DJZB 1CFTB 4M6NL 3U30C 1A7NH 4GSDL 1BD2E 3RL2B 3C6LA 3MXVH 3BE1L 5DDHB 2R29H 4LVHC 3EHBC 3K2UL 5CJOL 1PYWA 2VXSL 4QHLB 3U7WH 5LXGL 4QRTB 2AAVA 2X9XA 4YHKL 2E6QA 4JAMA 5I17B 1BD2B 5HSFA 5SWSD 1NDMA 4S2SA 3QFJD 4G8GD 5CS7A 4PJDA 3B2UC 5JHLH 3LDBC 2NTFA 4NUGH 1S7VB 4PD4K 2EDEA 1UEYA 5DLMH 5C6WH 3L3JA 3PWJA 4LHQB 1FHGA 4WEBH 4NQXB 3SCMC 3W9EA 3B6SA 3QA3A 4JRYE 3GRWL 3VMNA 4CMHB 5JUEH 4KJQD 5D1QB 3DROB 1RUQL 3C5ZB 3BZFB 3GHEL 4XCFL 2AV7B 5FYJE 3OG6B 3OKEA 4HH9A 4J3WA 1KIUA 3MV8A 4NP4L 3RL1B 1U8QB 4JRYB 3IDYB 3ZO0A 5HXMA 2FX7L 3F12B 4UDUB 5TQ0H 1LP9E 3RVXD 3WIHL 3DVFA 2H9GB 1BBJB 2ZUQC 4I5BA 2O5XH 5DS8A 3OAYH 4UV4H 3RKPA 5K9KB 2NPLX 2ILLA 3S3SA 4JFXA 2V17L 5CEXA 3OGCB 4UUJA 1LP9B 4L29A 3MLWL 4P23A 3VXUD 3BPLC 3TT3H 3UBXI 3P11L 1JGEA 5DD3L 5DEFB 5AZEL 1IE5A 1Q72L 1X5GA 3QDJD 1BREA 1MJ7L 2EKJA 2CD0A 3I02B 3ZDYE 2J5LC 2C1OA 3WL9A 2WNGA 4XGZA 4LAQL 4Z6AT 1MY5A 1MAKA 3X11B 1RZJC 3NA9L 2Q3ZA 1UXWA 4AIZB 1CK0H 4PJ5A 4HWEH 4OZFG 5GRUH 4O5LH 4JPIA 2YS4A 4MJ6B 2FO4B 3CZFA 4XWGL 3ZLQC 3ARPA 3JWDC 3TH3T 1JRHI 2H1PH 2R8SH 3TGXA 2C3XA 2CMRL 4Y4FC 43C9A 1Q8MA 1KLUA 5D72L 3CLEL 2HFEB 2R2BA 4HIXL 4LVNC 3U2SA 2XWBB 1UYWH 5E8DH 4QXWA 3T3ME 3GSXB 5IBTL 3JZ7A 3UYRH 1XF4B 1I8KB 1MF2L 4XNYH 3SDXF 2M8XA 1M7IB 4UTAL 4X4ME 1XR8A 4U05A 3KLHD 3LCYA 3K8LA 4MXQC 1TJIH 4X9IA 1N5YL 3W9DA 4HK0B 5AWNH 5CWSA 4XPHL 4L8SC 3MLSL 1HYRC 3BEWB 3HRZA 2BVEA 3LOWA 4FQ2L 4LVEA 2FIRT 2EE2A 3LVEA 4X4XA 2A83B 5H35A 1MCEA 1N59B 1F58H 5DEZA 3DRTA 5ADOH 4PYGA 4P5KB 4GG8A 3QFDB 1CGUA 4UIKH 5HHOA 2P8MB 3MC0A 4KRMB 3JV5A 1CICC 1JNHB 3G5YA 5DJ6B 3SKJL 5C8JB 4RMUA 1FGNH 4KI5E 5FGBA 3VWKD 4HWBH 3RDTA 1T1WB 1CDCA 4P57A 3TLRA 1JK8B 2JELH 3V4UH 1Y0LA 1C08A 2VKWA 3DWTA 1R3IL 4ZPTB 5E03A 4PJCB 4M61A 3SGEH 3MRQB 3QUYC 1A3RL 2JE8A 3U9PH 1HILA 3NGBC 4AZ8A 1XF2B 4OF8A 4Z78A 3HZVB 3IDUA 4XBPA 1A1MB 1QHPA 2UZIL 1L9NA 3RTQC 5T1DL 5J57B 1WC7B 4MXWH 4V1DA 3HMXH 1AP2B 3EW3B 3PNWA 1N5AB 4K55A 1L0QA 3QI9D 3ZSTA 3VA2C 4I3RH 3O4LD 5DUBA 2ENSA 4FP8L 4Z0XA 2VLKE 3QT2A 4JKKA 5I8OL 1MCPL 3MRCA 4Z7QF 1U3HC 1KCUH 1NMBH 3NMEA 3HMXA 1GC1C 1BF2A 3HNSL 4OCYH 2G75A 3K46A 3RGHA 3VGGA 3SGKA 4XWOC 3P4OA 1OW0A 2VLKB 3O9WA 5IQ9A 1DLFH 4NQSB 4YPGA 4O00A 1FFQA 2OTUA 5I1HL 4JAMB 4L4VE 2PCPA 2DKMA 5F97E 1A6ZA 3MLYL 1H3UA 3G9AB 4FMKA 1T0NA 1JHLH 5ETUA 4RAVA 5K9QI 4ZYKB 3DGCR 3RWGB 4QNPE 3FZUC 1LEKA 3RVWC 3NPSC 4L4VB 1NJ9A 4W68A 3O8XD 3CUPB 4LQ1A 3ULUF 1C5BL 1HNGA 5TPWH 2JCCA 2YN3A 2JB5L 3W0WA 3OPZL 2DQTH 4IMKC 1PG7W 4HH9B 2V2TA 5E08L 1IZKA 1NDGB 3QNZA 5J12C 1VACB 1X44A 2AKRB 4IOFD 3WFDL 1PKOA 2R0WL 4CADA 4P4RB 3TBTA 5SX4I 5D70L 4HWUA 4EN3B 5DS8B 4KC3B 4P48A 1A6VH 2VXTL 1MRCH 4ZS7L 4C54A 3BAEH 5D6CB 1HH6B 1F11A 1MHHA 5CEXB 3IAGC 2YXMA 3N1PC 3N1GC 4L29B 1TQBB 1CFNB 4Z77A 2CR3A 2H32B 3GSUA 1JGEB 5HYSG 2Z0BA 2I9TA 1SJHB 4PUBH 3VWJA 3N9GH 5DRZA 2YN5A 3B2UD 3VA6A 1MLCB 2Z31D 2EDRA 4UINL 3S35H 3FO0L 4LLMA 4ELMA 1Z3GH 2K3TA 2WBJC 5HHPA 1KBGH 3VG9B 1I9IH 3SCMD 1D5BA 1MFDL 3CMOH 1FDLH 4G6MH 2B2XL 3EFDH 4OQTH 4JPIB 2PR4L 3CZFB 3HC0B 4RA3A 3D39D 4TTDC 5HHVH 4P46C 4OGYL 3E3QE 2DJ4A 4HF5H 5GS1A 2QQNL 5FYKH 5TGBA 1OCWL 43C9B 1ZHKA 4KKCD 2BVPA 2IAMA 4UU9A 3TBVB 4F7EA 3MCG1 3QPQC 3L5JA 3BT2H 6FABH 4L5FL 4N9GA 3U2SB 4OF3A 2E27H 4G42A 5J3HC 5JOEA 2DQUH 3MUJA 3TM6A 4B0MM 2QR0A 1L7TH 1P69B 3S88H 5D2NC 1OAKH 3W9DB 3EZ8A 4G6KL 3RWIA 3BJLA 4LCWA 3SKNA 4NO3A 1MFCL 2MTPA 1CE6A 4OCSL 4QKXB 4N0YH 5HHOE 1WEJH 1J5OH 1XGQA 2FB4H 3P4NA 4WHDA 4X4XB 1RZKH 5H35B 1FLRH 5IROA 2X05A 5D7KE 1B0RA 1U8KA 3LB6D 1QLFB 3DRTB 2G5BA 4GG8B 5DT1H 2HJKA 3GIVB 3I75A 3BPCB 5HHOB 2X4TA 2I9LA 1CFBA 1MAML 4NZTL 4GAFB 3G5YB 4LSQH 3EYVA 1UH4A 4WWKA 1I9JH 5D1ZA 4DGIH 2O5YH 4WU5B 1BBDH 1JCKA 4Z76B 1TQCC 3EGSA 3UTTD 3MGOA 1PDKA 4Y5VB 1PW3A 5C08A 4HUUB 5AAMA 2Z92B 4PJAE 4UOW1 1Y0LB 3S36X 1T5WA 1P4IH 1C08B 3UBXG 1Q9KB 5BV7B 1EEUA 4MXQD 2ZNXA 5C7XH 3FMGL 4M61B 3DI3B 3FFDB 5DXWA 5F1NB 4OD3H 2M26A 2PN5A 1HILB 3FTGA 5IMKA 4UQ2A 4Z7UA 4J1UA 3D2UD 4MB5A 4Z78B 1A7NL 3I6GA 2L7JA 5E6IC 3MXVL 4P0DA 4LDEB 1FVCB 4V1DB 2R29L 5KTEH 5FECA 3IJHA 2BNQA 5ERWB 1HSAB 3QNXA 3HS0B 1VFOA 5JW4Q 4E9LA 4N0UE 1VSCA 3U7WL 2AV1B 2BY3A 1UZ6F 3IDMA 3QDGD 4IM8A 5JHLL 4MCYA 1JPGB 4BSWB 4NUGL 1CICD 3QDJA 1JZ7A 5D7JD 4NDMA 5E5MB 4N0UB 5DLML 3UTPE 1NMCB 3O9WB 4J7RA 4YFEA 2AJSL 4WEBL 5IQ9B 5EUOA 2C4FT 4YPGB 8FABA 2OTUB 5JUEL 3O3DA 4XMKH 3WMSA 2OMNA 1T0NB 4KMTH 3O41A 4J3OC 3VD4A 5BQ7B 3MO1B 5HY9A 3BMVA 3TEUA 4MJID 3H9SE 5TQ0L 4PRIE 5E94B 4U1IA 5EU4A 1TVBA 4YGAB 2O5XL 4UV4L 4YEEA 4U49A 2DL9A 3BKMH 4FQHA 1PZUB 4OKVA 4RMWA 3KPSD 1YEJH 2PO6C 3IAQA 1EUTA 3OX8B 4Z7WA 4JO4H 5JO5B 3D9AH 2RIKA 4RAUA 3TT3L 3LN5A 2AJYH 3CFEB 3MOBH 4XNXH 1DUZB 1U3HD 4U0RB 4LVOB 3UTSA 5GGQH 1HH9A 9CGTA 2HJFB 5I76A 5BRZA 2MSPA 4ISVA 1F11B 4M48H 1WSST 5H37G 4FABH 3HKFA 1BVZA 3G6JF 3GSUB 4OFPA 1CK0L 4LBEA 4PLJD 2HP4A 4Y7MA 2LTQB 5JPMA 4HWEL 1N0XH 2AJXH 3OKLA 4O5LL 3DHJA 1L7IH 1GH7A 2HJLA 1CGSH 3LS5H 4G8EA 3ARGC 5B38B 3BD5A 1JHTA 3MOAH 3KG5A 2H1PL 4LLMB 4OZGE 2R8SL 5K59E 4FA8A 4PJEE 2B8OT 5CINH 4U1JB 3QSKB 4X80H 1H3XA 1D5BB 2BHUA 4BYHA 4OZFH 4I13B 4AIOA 2FECI 4M03A 2QSCH 1UYWL 5E8DL 3PL6A 4RDQF 3VWKA 2DI9A 3QG6A 1UZ8A 4XNYL 4PJEB 4OZFA 3GSWB 1HOCB 1TJIL 2DLIA 3QNYA 1OP5K 3UAJD 5GS1B 4MGXA 1H9VA 4V2BA 5TGBB 5AWNL 1CT8B 2BVPB 2IAMB 4MZ2A 4Y16A 3J7HA 1OAYH 3MUGA 5CSGA 2UYLA 1Q9LA 2IG2H 4C83A 1ZLSH 4UB0H 2RHEA 2F19H 5HVGB 2P46B 5CD5C 1QFHA 1F58L 1NCCH 5ADOL 2VIRA 5ALBH 4WV1B 3TBWB 4Y4HC 2NY1C 3SKNB 5I71B 1CE6B 1F3DH 1BZQK 4CU8A 2F9BT 4F33A 5EOQH 2EC9T 3FHAA 1RHFA 3C8KA 4HWBL 1KYOK 1U8KB 2ED8A 4Q2ZA 4X7DC 5DHYA 5H94A 2G5BB 1RFDH 3HI1A 2A73A 2CGRH 2I9LB 2JELL 5F1KC 3V4UL 5GJTL 5EU6E 5C08E 4LLUB 5JIPA 2JCCF 2WSKA 1WTLA 3U9PL 3MREA 1WWBX 5KSVA 1H3VA 2N56A 5C2UB 2JJSA 3QCTH 5EU6B 5C08B 4M93C 5J3HD 3O8XA 1CL7I 4KVCL 4MXWL 3G5VB 3HMXL 4XXCA 1A7OH 2L7UA 4I1NB 4I3RL 3DRQA 3O81A 5FA4A 3S4SG 2KDGA 4X7TA 1HEZB 1KCUL 1NMBL 1HHJA 3FTGB 5E5RB 5IMKB 4OCYL 3KLAA 5IW3A 1KG0A 5E2WH 1EA9C 1KTRL 5IG7A 5FECB 1YDPA 3IJHB 4P3DB 2D0GA 3QNXB 4OFVA 3RWJA 3RFZC 1DLFL 3LQAC 4YHPA 1NFDF 2CKNA 5HDOA 4PJFF 1EMTH 4ELMF 1CXIA 2GY7B 5EUOE 3GKWH 1Q9OA 3L7EA 1FV1A 4OFYA 3PJSA 5EB9A 4TVPD 1YY9D 2EE9A 4PG2C 4L9DA 1JHLL 3SDDC 5FA3B 3JUZA 5K93A 2WP3T 1JYWA 1C16A 4NDMB 4ONOA 3PE9A 4ZXBC 4A2LA 5EUOB 5ISZE 5T3ZD 4JDTH 4U6XA 5TF1H 5TPWL 5T1KD 1WZ1H 4LSTH 5D7IA 5DD6A 2DQTL 1DTUA 3NIDF 5F89B 2XT1B 4KY1H 5IT2H 3U7YH 3CD4A 4OLUH 2WBWB 3ZMRA 3QJFA 4PTUB 4XC3H 3RZCA 5HJ3B 3D39A 5IR1A 5F88A 5LGHH 1UKTA 2EIZA 2X5PA 4NOBA 1TVBB 4NFCA 4U1IB 5DFVD 5EU4B 4E41A 5M94B 4FQHB 4IRJB 4RX4A 1A6VL 3B9KD 1MRCL 1NGWA 2JB6B 3BAEL 3KWWA 4GW1A 2HTKC 4X6DE 1IGJB 2ZG3A 5IW6A 3RPKA 3ILPA 4GW5A 4K71B 2FNBA 4NQVA 2FJGB 1AD0A 2IBZX 2ZCLH 4PUBL 5E7FA 1OGTB 3UTSB 1HH9B 3N9GL 4E42B 4X6DB 3LQMA 1JPSL 1CIUA 3FQWB 4PGCB 3LS4H 3S35L 1Z3GL 5GGRY 1RZJH 1KBGL 1T5XA 2MOVA 4BQ6A 1I9IL 2OK0H 2CLZB 3CMOL 1FDLL 4G6ML 5JPMB 3EFDL 3H7BA 4OQTL 3OKLB 3QPXH 1ORQB 2DS4A 2HJLB 5IF0A 3ULVD 2YSSA 5HHVL 1JHTB 3ARFB 2DF3A 2FZ3B 5GSVA 4HF5L 4UILH 1AHWB 5FYKL 3FRPA 2BHYA 4XVUD 2YEZA 3SKMA 5IHBA 3TBYA 3DXAE 1MRFH 1JN6B 6FABL 3BT2L 1NAMA 4XX1G 2BERA 4ZNCD 3PL6B 5SWZA 2E27L 2GEEA 3CFDA 1S5HA 2DQUL 3K2MC 1KIQA 2H3NA 35C8L 3ZKNC 5CBEA 3EYUH 3P0VH 4Z7UF 2VO5A 1L7TL 3DXAB 3S88L 3QNYB 1OAKL 2X4OB 4WI9A 4U6HB 2PNDA 3G6DL 1IKNC 1LEGA 1IC5H 2OTWA 4Y16B 1BX2A 1R3LA 4LSUH 3HUJA 3MRFA 4N0YL 1WEJL 1J5OL 2FB4L 3O6LH 4I0PB 1TJGH 3D2UA 1RZKL 3NCJH 4ZOEA 1FLRL 2DOCA 2LVEA 1KT2B 5C0ND 4WI3A 2AJZA 5T33H 5C0AD 3ZKQD 5GZOC 5DMGD 5GRWA 1AGBB 2VDMH 4JFEE 4WNQA 4J12A 4OLXH 4W4NA 1IGTA 5DUPH 3CU7A 4QWWD 4AT6A 3OKOA 1AO7D 4F37F 1U42A 1I9JL 1ZLVK 1U93A 4DGIL 2O5YL 1BBDL 4JFEB 4YHMH 1ZA6A 5D7JA 5GGRA 2VZTA 5H94B 5GGVH 3HI1B 2GTWA 2A73B 2OXHA 1DN2A 4OLWH 4MA3B 4ALAH 1P4IL 5E7BA 1K2DA 5HDQH 3V6ZA 3BPOC 2AXHA 4HJGB 3NTCH 5C7XL 5C09A 4JGMA 1SMOA 2AQ3A 1QA9A 1QFWM 4OD3L 4Z7WF 4YNYB 2P5WA 4NFDA 3QDMD 4BH7B 1ZGLP 5EFIA 3TO4D 3DX9A 3I9GH 2V2XA 4W6WB 1O0VA 4R0LB 4HPYH 4JY4A 3HR5A 5KTEL 1KEGH 5GZNC 4OCMC 5CD5D 4ENED 3KYAA 1IRAY 5FYLE 3BHBA 2CDFA 1BZ7A 5SWQB 2B4CH 1G9NC 3CSBA 3CVHH 3UBXA 3MRHB 4APQD 3JTTA 2FBOJ 3F7VB 2V7NA 5EORH 1U95A 2NY3D 1KG0B 3KPRE 5DJCA 1CFQA 5IG7B 5CUSH 5F96H 2X4RB 3S8WA 4CN1A 1ACZA 5KJRH 4PLOB 3E6FA 4PRHD 3CNKA 4XMKL 3ARYA 3O6FB 1R3HB 4KMTL 1LDSA 3V5KB 1T0MA 5CILH 2P8LA 4HJ0C 5FO7A 4JQXA 4I9WE 5I8KH 4WRLA 5IHUH 5EU7E 4DKFL 1IAII 1YEFH 3HCVA 5F3BA 3BKML 1CI5A 1ITCA 5D7IB 4DFHA 1YEJL 4E41E 5B8CA 4IRSC 1R24A 4JO4L 4BZ1H 3D9AL 4UIMB 5TQ2H 2DIJA 3RZCB 3MBEA 5AYUH 2AJYL 5A40E 3MOBL 5IR1B 2EZ0C 4XNXL 1GXEA 5F88B 2EDYA 3BEVA 1GZQB 2EIZB 4E41B 5GGQL 3RKDC 3BPNB 1S5IH 2BP3A 4GO6B 1NGWB 4JZNA 5MHSE 2DM4A 4GW1B 4M48L 3QIUA 1I8MB 4Q0XH 3EOBA 4FABL 1YMME 1X5XA 3GMLB 5ACMA 4GW5B 1B3JA 3TZVD 2VYRE 5JW4M 3R1GH 4NQVB 1N0XL 2AJXL 1AD0B 1L7IL 1SHMA 1CBVL 2FHBA 3GMNA 4PGZA 1CGSL 3LS5L 4D9RE 1I7TB 5JOPE 4U1MA 2GT9A 5H37H 3GJEA 3V95A 1DR9A 4LSDA 4YBHA 2VLRE 5CINL 5JXEC 4X80L 5DEGA 2XA8H 2F74A 4YXLH 3JV6B 2QSCL 2NW3A 1F90H 4NO0B 3BIAX 4OGAC 3F7QA 4Q9BA 2YSSB 1U8PA 2VLRB 1KPVA 3L3IA 1JF1A 1BPVA 1OD9A 3T65A 2YEZB 3CAFA 1FVEB 1QBLH 1JVKA 2IG2L 1ZLSL 4UB0L 3DPBA 3CFDB 2GY5A 3HUJE 5CBEB 2Y9RT 4K2UH 2QADD 1WQVT 5ICXB 4FXKA 4YIQA 1NCCL 2N1KA 5ALBL 1J18A 1IL1B 1LEGB 4JHWH 5D1XA 2OTWB 3IETB 1IQDB 1R3LB 4CVXA 3VG0H 3HUJB 1EXUA 4C57C 1CXFA 1A64A 2VAAB 2ERJB 5EOQL 1KPUB 3BOVA 1NGQH 4LLWA 3IS0X 2FLRT 1MIMH 4XNQA 1S7XA 4KI1A 1F2XK 1QYGH 2AERT 1RFDL 2ED7A 4TVPH 2CGRL 1IGTB 4KROB 5HGDB 4CKVX 2LVCA 3QIBC 4HPOH 4AT6B 1I1AA 4Q74A 4EIGB 3STZA 4PD4J 5T3ZH 2FATH 2EDOA 4X83A 4BELD 5C09E 1ZA6B 1CQYA 3K3QA 5GGRB 3AS3A 2ZUSA 3QCTL 1S7UB 3MRGA 5IBUB 2Z9TA 3H42H 2E6JA 2YD2A 5AG8A 2P5WE 1HWHB 1NUNB 5T1KA 1KN2H 4ZSOA 1A7OL 1J88A 5C09B 4I48B 1S9XA 1QA9B 2NY2C 5INDB 4OF5A 4PJXE 5DFWH 4MQ7A 1WIOA 3CX5K 1AGCA 2P5WB 5EFIB 3SDXE 2A6JA 5E2WL 1AGFA 2J88H 1FO0A 4BFEA 3BUTA 4HS6A 2YC1A 1DUYA 4P4KC 4JN2A 3B9KA 3RJQB 3HE6D 4PJXB 2CDFB 1BZ7B 4H26B 5CZXC 1GL4B 1EMTL 2IFFH 4F9LA 1I3VA 3FL7A 5GZOD 3GKWL 3SDXB 5D96B 1X7QA 3SJVA 1E0OB 5KG9B 4QRRD 2F54A 1ONQA 2H6PA 3UZVB 5E9DE 3WIFA 3L6FB 2WV3A 3AY4C 4JDTL 4ETQB 1WZ1L 4N90E 1AC6A 4QRPD 4LSTL 3ULVH 2LE9A 1ETZA 1A2YA 4KY1L 4PGEA 3U7YL 5IT2L 5LGJA 4OLUL 3GUTA 1B2WH 1J8KA 5A2JH 4XC3L 3K1DA 2RQ8A 1ITBB 2VZ3A 5LGHL 4WEUD 4HDIB 5F3BB 1O7SA 4GRLC 2OLDA 5MEOB 3CC5B 4NN5B 3G6AA 3MBEB 4M7LT 4RCAA 3NFSH 3ZT7A 3LHPH 2ZCLL 3BEVB 2AI0H 2VLJE 3GI9H 2QKIB 3E3QC 4GXVH 1LVEA 3LS4L 1WT5A 3FCTB 1T04B 1JWSA 4KTEH 1RZJL 3QIUB 4NO2A 2F5BL 2C3GA 2APTA 3EOBB 1NCTA 2OK0L 1AGEB 1P1ZA 2DTMH 5IKCA 3C2SA 3MJ9H 2VLJB 3HRPA 4R2GC 5FHAH 2NR6D 1TLKA 3QPXL 1FL5A 1WITA 5A2FA 3FQXA 4PGJA 4POUB 3ARUA 5FUZH 2GT9B 3M1BB 1NUFA 2ZSVA 4UILL 1TNMA 4NQDD 2F74B 4NQEA 3AM8A 5BJTA 4DKEL 5IBLD 2ARJQ 5DUML 3GMQB 3DX7B 4BKLB 2YD3A 1U92A 3U6RB 3EYUL 3E2HC 5E8PB 4IRSD 1E4KC 3L3IB 4JJHA 5GHWH 4NN6B 4EVNA 3MFGB 3TIDA 1FRGH 3K80A 1IC5L 1KLFA 1BJ1J 4UI2A 5KZCD 4M6OH 4LSUL 1VFBA 5DQDH 8CGTA 1CXKA 4P2YA 3OTTA 3SBWC 4JM2A 4RQQA 3O6LL 1DP0A 3D87B 4Z7VE 1TJGL 1RI8A 2OI9C 1OTSC 3NCJL 3BGMA 4MZ3A 3TO4A 5T1LA 4YDKL 5TE4H 3DMMD 2VZSA 5T33L 2VE6B 1VFMA 2VDML 5D1XB 4QYOB 1ZLUK 4OLXL 4Z7VB 3OAZK 5DUPL 4Y19D 5FUCE 3RP1A 5F7HA 3RA7L 4APQA 3MV9D 3SKOA 2G2RA 4GBXA 5ID1A 4JGUA 4MD5A 2ICES 1YQVH 2H41A 2WWKO 4YHML 2CKBH 2NY6C 3U0TA 1T21A 2XWJB 4KHXH 5GGVL 1K4DA 2FX8H 1MH5B 3PGDB 1Y6MR 5HI3C 4XTRD 1J1XH 3KNBA 4X6CE 5F7LB 2XNAA 3DSNA 1ZLWK 1D5XB 2J8UE 5EZOH 4OLWL 4M5ZH 2DLFH 4ALAL 2R23B 4PRHA 5C0BD 5HDQL 1T66D 3NTCL 5JMOC 1UCBH 4RGNE 3F6LA 1UA6H 4LPXA 2W1NA 2BCKA 4X6CB 5HYQA 2HT4D 2J8UB 1A02N 5ESVA 1A4JB 3DGGB 2FJHB 1XCTB 1CDUA 3I9GL 4GQ9H 4HPYL 1KEGL 4RGNB 1B6DA 1AQKH 1GC1L 4P5MB 1X9QA 3CVHL 2VR5A 3O2VH 4MQ7B 4RA0C 3ETBF 4Y4KA 1FCGA 3SDCB 3TJHC 1FBIH 1ND0B 5EORL 1YEGH 4MDJA 2A6JB 5HD8C 4D0DA 1AGFB 4FG6C 4FTVD 3FQNA 1FO0B 3W81A 1MFAH 5CUSL 5F96L 1BHGA 2DWDB 2IBBA 4HS6B 4JZJC 5KOMC 4JN2B 2XQYK 1L6ZA 4BK4A 5FXCH 2JTDA 5KJRL 5DSCB 2HMID 5A3IC 2X4NB 3WV0A 4LCCA 3V79C 3Q3GA 2NY5C 1D5IH 4PRPA 1I7UB 3VXME 3QIBD 2F53D 5CHNA 4PJ9C 2XN9D 3FOLB 5CILL 1UWGH 3KR3H 2WIIA 3QIWD 3WIFB 2HKHH 4KK6C 1N6QH 5I8KL 5IHUL 5I1JH 2EDHA 3P4MA 2ARJB 1YEFL 1XIWD 4FN0A 4YQXH 4EDXA 1QHOA 1X6NA 4JDVA 5C07A 4BZ1L 2Y5TB 5GS0C 5TQ2L 5AYUL 3HI6H 4OT1H 4EI5C 2NY2D 2EDFA 1U6AH 2YUVA 1SYSB 4HWNA 2KZWA 2PUQT 3B8SA 1H3GA 4L3ED 1S5IL 1K5NB 3B5HA 3O2DH 1UT9A 4I3GA 1KENH 4LKXA 4KZDH 1P4LB 3BP4A 4Q0XL 4OI8A 4P4KD 2A0LD 2VXQH 2VL4A 3KPLB 1I9RH 3R1GL 5CZXD 4IIQC 3E6HA 1T22B 4ZUSA 4G8IB 5KVFH 1GGTA 2VUYA 3OV6A 5JTWA 5EZJA 1JWSB 4DKDC 4NO2B 1Q38A 2BMKA 2HWZH 1G0XA 2ADJB 4LPCA 2AQ1A 2XA8L 5IGXH 5IKCB 5DJ0A 4YXLL 4EEEA 1UZ6E 3DBXB 3T4YA 1F90L 3EOYG 4F57H 3O3EB 4NQEE 5TDPB 5CAYB 4JFHE 1AC0A 4HCRH 1VKXA 1WGOA 1K6QH 3MJ8A 4M1CC 4PGBA 3S97C 2CIIA 4JFOA 4HS3B 5F9AC 1NH6A 5IEHB 5CLTA 4PG9A 4NQEB 2EKSB 1QBLL 5BJTB 1ED3B 1XGTA 2DJUA 2X10A 5H2BA 3CFCH 4HGWA 1J11A 3O45A 1FNSH 1T7WA 3OF6A 4XRCA 4JRWA 2R1XA 3BKYH 1WIUA 4EVNB 4HIJB 3TIDB 3BIKA 4JHWL 2OP4H 3H8NA 4YE4H 4OLEA 5D2LE 1VFBB 2R1WA 4NWTH 3JTSA 2OZ4H 3WIIH 3TH2T 4RQQB 5AAWA 1V3MA 4PRNA 4OSUH 1NGQL 3BGMB 1U8MA 4JM4H 1QNZH 2KBGA 5JXAL 1MIML 3G9VA 2DLHA 4KRNA 4WI7A 5F7DA 3VDAA 1TTFA 4X6EB 5D2LB 1KSRA 1QYGL 2Q86A 4TVPL 2K1MA 3UJJH 4R2GD 1A1OA 4TTGA 5C0RH 1J0IA 2GJ6A 1OP3H 4HPOL 4M7ZB 4DZ8A 4MDIA 5ID1B 3OJDB 2C3VA 4QT5B 5T3ZL 4MD5B 4X7FC 2FATL 1OOAA 1T21B 4O2EA 4KXZI 1MFNA 2DAVA 4R4NC 3SE9H 4ZO8A 3ULVF 3H42L 2P5ED 2XNAB 3HE7C 4JR9H 4P9ML 3QUXB 1KN2L 2EYRB 4POZD 4A6YA 1D5MB 4G8FA 2RCSH 4X4ZA 4KKBC 4BSVA 5DK2A 5CEYA 1LD9A 2D03H 4U6YB 1YPZE 5IWLC 5JNYB 3QQ3B 4Y5XC 2J88L 1Z6JT 3V0WH 2YD6A 3S37X 1IC1A 3KPPA 4F7TB 4HXAH 1UVQB 1MCQA 1R3KB 1YPZB 3DV4A 2H26A 2IFFL 3TPUA 5EU3B 3V6OA 4X4YB 4Y4KB 5HI4C 4KUZH 1IGFH 1T7XA 4Y2OA 4MDJB 1I85C 5DVLA 4F7CB 1N64H 4HSQA 3R4DA 1ZHBB 3ZDZF 1IGIH 1N6UA 3SY0A 3RPIA 2LFGA 1KGCE 2NY4C 5MEQB 3VFGH 3ULVL 4KK8C 3OAYK 1T1YB 3C60D 3VXQA 5FO9B 3Q3GB 3UDWC 3IXTA 4PRPB 5EN2B 1JL8A 5FOBA 3RGVB 5CHNB 2R2CA 1FVDA 2XOTA 1B2WL 1P7QA 1G6VK 5EULV 1N4XH 4WO4A 3WKMH 3DUUA 4MSWB 4NHUB 2VISB 4F80A 5DGQA 1KIPA 2HVKB 2RJMA 5I1EH 4WTZG 5F7KC 1MY7A 4NQDA 4EDXB 2BVQA 2R56H 3TESA 1OSZA 1JF5A 4JM2F 1SY6H 1WCQA 3NFSL 3LHPL 4N0CC 3T0EC 1MWAH 3TYFA 2AI0L 1CD8A 4XBGB 3TJHD 2B7DT 3GI9L 4GXVL 4HKJA 3LPFA 4LKXB 4KTEL 1MCRA 1G7IB 3BP4B 3WUWG 3DSFH 4P2OC 4RFEB 3VXSD 1FNLA 2DTML 4Y8DC 5C9JA 1CD1A 3MJ9L 1U8LA 4O02H 3ARDC 5FHAL 5A3ID 4HIHA 4ZUSB 3X14B 7FABH 3DMMA 1OQXA 5FUZL 4OGXH 4MHHG 3MXWH 5IMOA 2EC8A 4Y19A 1NFDE 2BMKB 4PJFE 3IDJA 3TT1H 4LF3A 2NX5A 1JMZA 5DJ0B 3C5SA 1YUHA 1KYOJ 2OYPA 5CJXA 2ZG2A 5ILTH 5D5MA 4RRPG 1RUAH 3EYFA 3GSNA 1EBPA 3QISA 5GHWL 5E6ZA 4K7PX 1W0WA 4PGBB 5GS0D 4WFGD 2ITDA 1FRGL 4EI5D 4D9QE 1S7WA 5E2VL 5DK0A 4M6OL 5DQDL 1Y18A 3SO3C 4JCLA 2FIKB 1J8HD 1NCUA 3KPOB 5EA0H 5J06A 3IJSB 5K9OB 4XRCB 4KWUA 5FGCE 2R1XB 2W0PA 4RAHA 5FB8A 2ICWJ 5TE4L 4CRPA 4WW2A 3ARBA 4GRMB 2R1WB 3JTSB 4HW6A 5FGCB 4I4WA 3GSVB 4M7LH 5IJVA 1DZBA 3UXFA 5F9WC 1S78C 3FB8B 4RGMB 3TCXA 5F7DB 4FTVA 1FYTA 2CKBL 1QACA 2PXYB 3P77A 1UB6A 4KHXL 2FX8L 5EBMA 1DCLA 2I24N 1J1XL 1MQKH 1PZ5A 1DBMH 3CDGA 4PJHA 5EZOL 2FHCA 4M5ZL 1QVOB 2DLFL 3DYOA 1VFAA 1UCBL 2C3VB 5DRXB 5EDXA 1UA6L 1ADQA 2F53A 5SWSE 2MPAL 4F2MA 4GOSA 3QFJE 4G8GE 4GG6A 1BLNB 4DCQB 3QIWA 3QBTB 1W0YT 3ARVA 3TA3A 1PLGH 4M5YH 1A3QA 2IBZY 4GQ9L 4LCUA 4WFED 5FO8B 5ESQA 2YPLD 4A6YB 4ZO6A 3QFJB 4G8GB 3S5LB 1AQKL 4R3SA 4BSVB 3X3GH 1GAFH 3O2VL 5JDSB 3RNQA 1FBIL 3U0WH 5DR5H 1NC2B 3FOMB 3KGRA 4X5XB 5GGUA 1WIPA 4ZO7A 1P9MC 5E95B 4NPYA 1VGKB 1MFAL 2D2OA 4PJ7A 2PTTB 3MRMA 4JFPA 4TULH 4R4BA 3DV4B 4F8QA 4LMQI 3TPUB 5I6XC 1K3ZA 4IDJH 3REVA 5FK9A 2VRAA 1D5IL 2ID5A 5D7LA 2HRLA 4JY5H 3WLWD 3PWPA 1ZWIB 3EFFB 3VXUE 4YDLB 3QXUA 3AS1A 5C9KA 1UWGL 1TDQA 4NNYA 2HKHL 1N6QL 3VFPB 4OD2A 1KELH 3Q5YA 4QHUA 5I1JL 3ILQC 3QO1B 4YQXL 3VXUB 4R4ND 5IMMB 3V5DB 3IXTB 5FOBB 3FN9A 2NNAA 1FVDB 2YPKA 3LKNA 3I3EA 5HYIA 2OBGA 3HI6L 3I6KA 3KYKH 4OT1L 1XGPA 4WO4B 1U6AL 1L9MA 3RVTD 2DB8A 4JFDD 5BW7A 3P9MB 2OCFD 2NZ9D 4OCWH 1C12B 3O2DL 4PJ8A 2BVQB 1KENL 3D69A 1LE5B 4KZDL 2A6DA 4MD0B 4BQBA 4M1DH 2OXGA 5J0BA 4TSAH 2EO1A 1PBYA 1OSZB 4XH2A 3VFWB 2VXQL 3KDMA 3RU8H 1I9RL 1MVUB 3WFBH 3KXFA 3TYFB 1DBAH 4NT6A 5KVFL 4JQVC 4LASH 4K7FA 4HKJB 3VGFA 1LHZA 3FT3B 1FSKB 1D7FA 3SPVA 2M1KA 5ESAA 2HWZL 5IGXL 4MAYC 2XTJC 2E7LC 3W11C 4GKSA 1CD1B 2NY4D 3SE3C 4F57L 1S9VA 4HIHB 4Y5YC 5HYJE 3TNMB 2E8YA 2ZOLB 5BZDA 2NXYB 4HCRL 4TUJB 4GS7B 5EBGA 1WV7T 3W82A 1K6QL 4ZFOA 4Y1AE 5DTFA 1EAPB 1JF6A 1ZHNB 1JZ2A 4A2MA 3OXSB 3TCLB 1MCWW 2NX5B 5IQ7H 3EIFA 5HYJB 3O11A 2VOTA 1D9KC 1RY7B 3CFCL 4P2QD 1TZGH 1RU9H 1BQHA 4Y1AB 1FNSL 3R8BB 4EDWH 5JHDE 1X5JA 1RUKH 5GGVY 3C09B 3EYFB 1A9EA 2MMXA 3GSNB 1EVTC 1U8HB 1TPXC 3OKNA 2X42A 4GT7A 3BKYL 2A9NL 4JCMA 1W0WB 1KTLB 3CJJA 4LPYA 4YE4L 4FQXC 1KFAH 4HC1H 4NWTL 5JHDB 4Y4FA 4EI6A 3D3VE 4M00A 2IALB 2OZ4L 3WIIL 4LRNH 1SEBB 5F6HJ 1OF2A 2BSED 4OSUL 2EH8L 2PW2A 4JM4L 1QNZL 1G1YA 4M9PA 4GXUN 1EIBA 2W91A 4ZS6D 3LN4A 3ARBB 3UJJL 3D3VB 4KKLD 4FZEH 5EWIH 5C0RL 4JPWH 1CXEA 1CZ8H 3T77A 1XGRA 5MENA 3IKCA 1PGRB 3O4LE 1KCKA 2D7QA 4MB4A 5E2UH 3NABH 5CKAA 3DETD 1VB9A 3OHXA 4NKDB 1MEXH 1BGXH 3GI8H 4QHMB 2Y6SC 5ELIA 3P77B 1MCIA 1RJZB 3QI9B 4UT6H 3SE9L 2GIYA 1PZ5B 3HAEG 3AREA 4YEFA 4YWGH 4JR9L 2NXZD 4KFZC 4CMMA 1I7RB 5F93C 1VFAB 1EEZB 4Q9CA 5GQBA 5HI5D 3H9HA 2HT3D 2RCSL 1NEZG 4U7SA 4G80B 2D03L 2CLRB 2BHZA 4KGJA 3TA3B 5T3XL 1HQ4A 5BS0D 5B21A 3V0WL 3WEXA 5ITFA 4F37K 4LIQE 3PWUA 4RGOH 2EXYC 1RVFH 4HXAL 3A6CH 4WFHD 1X3DA 1KNOA 4R3SB 1J0JA 2BVOA 5E6YA 3T4AA 3L3DA 3RNQB 4KUZL 1IGFL 3H6JA 2E9JA 3QUYA 5GGUB 3VFSA 3MGTB 1N64L 3LMJH 1E4XI 1AKJA 1IGIL 1INQA 3C6SA 3P40A 1UJ3C 3PWPE 3MRMB 3RTQA 1P6FA 4OZIF 2O93L 3BO8A 3VFGL 4B5EA 4L8BA 5FK9B 3L1OH 4Y2DC 5GRYA 3GSOB 5D7LB 1R5IB 3UC0H 3PWPB 3BGFC 5CP7A 3ES6A 4UDTA 4NNYB 3D5OF 5D5MF 3U30B 4WI6A 1N4XL 3LZFH 5SV4A 3WKML 2XG5A 1DLHB 5J56B 4LVHB 1YEIH 3SO5A 5I1EL 2E7HA 3VGDA 4L3CB 3OJMB 5GSRA 2R56L 1I8LA 3VGEA 4EXPX 5GS0H 1U0QA 5F44A 2NNAB 2AXJA 2YPKB 5MEPA 4LCYA 2OJEA 3LKNB 3Q6FA 3PABA 5IVXE 1F4XH 3I6KB 2LQRA 1SY6L 3LDBB 1MWAL 3SE4C 3QEQE 3G5ZA 4XVUC 2E8ZA 5IJKC 3V6BR 3SCMB 3GMOB 4WW2F 5IHZA 3RVVD 3A67H 5IVXB 1HKFA 3AU1A 1QEWA 2A6DB 3DSFL 3QUZA 1CTNA 3FFCD 1SVZA 4XH2B 1MUJA 3SEPA 3QEQB 1FIGH 3LKOB 4XCYA 3CFBA 4O02L 4Q6IC 1RHHA 5DJAA 7FABL 5I8EA 3LKPA 4HUXA 5L9DH 3TN0D 3ULUC 4HWZB 4OGXL 1OP9A 1ZHLA 3ZSSA 2ZUQB 3MXWL 3N1QC 4HUWB 1M4KA 1WWAX 3WD5H 3TT1L 4PJHF 1TMCB 1P84K 1U41A 4QCIA 1S9VB 5ILTL 5GPRA 4JFQA 4D8PB 3BPLB 1RUAL 2EDNA 3T8XB 4GG6F 4ZFOB 5DTFB 1TCRA 2EDJA 4L9LC 2WQRA 4ZAKC 1UACH 2VZOA 1MFBH 4HGMA 1MI5A 4X5WA 2J5LB 3O11B 5I18H 4KK9D 1N2RA 2WBJA 2C7UB 2WUBH 3UPRB 4UNVA 4JHZA 5IB5A 4K8RD 5I2IB 1U3YA 1A9EB 3WUZA 5HYSB 3EZJB 3UTTE 3HLAB 2VUOA 3OKNB 1LEIB 3MFFA 4N8VB 2BSSA 4HKZB 4X0KA 1QFUH 4LSVH 2YPLA 2XXCB 3BJ91 4P46A 2PYED 1EFXA 2VLLB 3QXDB 1NC4D 3CX5J 4L8CB 4PJ7F 4Y4FB 4EI6B 1IM9D 2A6IB 4M7LL 1HXYB 3M17A 4LVNB 1W72B 2OL3A 2EDBA 3PG2A 5MENE 4DEPC 3OKYA 2PYFB 2XTJD 3OKKB 3LN4B 1Y6NR 4UQ3A 2NY0C 1OARH 3MRNB 2J6EA 1DVFD 4PJBA 3OR7A 1MQKL 5D2NA 1DBML 3ZE0F 4JPVH 5FM5O 4DUVA 5MENB 1IQWH 1JGDB 4DN4H 2AP2A 2F5AH 2D7PA 4L8SB 2MFNA 3UTZA 5I1CH 2P7TA 5DK3A 5C0FA 4FZ8H 3QDGE 1ZLVH 1KB5H 5KS9E 1BVKB 1ZA3A 1PLGL 4M5YL 4G6FB 5KSAC 1ZGLB 3C6LC 1X6LA 4I18C 1NPUA 3CCHB 4CMMB 5KSBF 2X4QB 3VFOB 3D0VA 2DTSA 2Y36H 3D85A 4ONHA 3H9HB 3QDGB 5KS9B 1JV5A 5HHME 1QBBA 5I66A 1CICB 3X3GL 1GAFL 2ENYA 4JLRA 3U0WL 5DR5L 5DRNA 3UJIH 4M8QB 3GMPB 5ITBH 1J1OH 4MJIE 4R8WH 3ISWA 5HHMB 2EECA 3PWUB 4WENB 1C8PA 3MUZ1 3GJFH 4TULL 1DQQB 1KNOB 3LRSA 1JYNA 4IDJL 3KPSE 3L3DB 4MQSB 2R1YA 4JY5L 3QUYB 4RMVA 3VFSB 3TVMD 1AKJB 4JKMA 4J23A 1BZ9A 1INQB 3NGBB 4NBXB 2IANA 1FH5H 1IKFH 1FJ1B 2X70A 1KELL 3RTQB 3FJTA 1T03H 1F8TH 2Y6SD 4QHNA 4TSBH 5DQ9A 1Q0YH 3ZE2E 2GAZA 1PEWA 4ZUWB 4P59H 4MXVE 5MP6H 1DJSA 1U3HB 3T2NH 5CP7B 4P23C 3CVHB 3KYKL 2Y25A 4NN7C 2WWMD 4C59B 1BD2D 1CLYH 3BQUA 5DJXA 4F58H 3BFOA 5L8KB 2B39A 4D0CB 4XP5H 3O3AA 4JO3H 4OCWL 4X99A 4JRXD 2N7AA 4JKLA 4P2QA 4M1DL 3IF1A 3UYPA 2R39A 4LCYB 4MNQD 4TSAL 1LE9A 2EXYD 3P4LA 1CFSA 3RU8L 4YBLC 1P7KB 3WFBL 3HC3H 5HHNA 5D1QD 5LQBH 1DBAL 4XVTH 2NYYC 4LASL 1OQOA 5IHZB 5C0GB 3PQYA 3RWDA 2COQA 1QFWI 1VHPA 3ZHKA 3N1MC 4JRYD 3TC9A 1TZIA 3CDCA 4GMSH 1MUJB 1JWMA 1XZ0A 4TQEH 2HFTA 3LN9A 4KDVA 4YHZH 4X6FA 4Y2DD 1BVLA 2ICWI 3G08B 1FZOA 3LKPB 4S11A 3O2WH 1TNNA 3IVKB 4KXZH 4JHBA 3IS1X 1G7HA 2CR6A 5IQ7L 1GGIH 3U36A 1FNAA 1TZGL 1RZGB 4JFQB 5BOZG 4KDTC 5JQ6H 4EDWL 3SGDH 3RNKB 1QUNA 1KXTB 2UWEA 3H3BC 2C3HA 1MI5B 3ARGA 4X5WB 2D3VA 3BESR 1U91A 1KFAL 4HC1L 1N2RB 2WBJB 1K8IB 1DDHA 5F70A 1P53A 4EQ3A 1WBYA 4LRNL 3EO0B 5D71H 3QB7C 5IB5B 1EFQA 5DRWB 2SEBB 5E00A 5FGBC 3BP5B 3MFFB 3R8QA 4LSPH 4FQCH 1XFPA 4NO5A 5T1MB 2DL2A 3RDTC 4X0KB 4PP1D 2XV6B 1Q1JH 1P6AB 2EO9A 4FZEL 4P46B 5EWIL 3C9NB 3JV4A 4JPWL 1YMHB 2BNRA 1CZ8L 2Z93A 3QZWA 4S1RH 3KYMA 4M62H 3GSQA 4JFZH 4ODTH 3NVQA 1IGYB 3ULUD 1UADC 5E2UL 2B5IC 3NABL 4OCXH 2OL3B 1UM5H 1MEXL 4R9HA 3GI8L 2LV4A 4MNHB 4UQ3B 3TWCH 1P2CA 2IPKA 4UT6L 3NIFF 5CJ5A 4IMLA 5D2NB 4XBEH 4YWGL 3TBSB 4PP2B 4RNRB 4Y4HA 2VC2H 2VWEE 5DD0H 1XCQB 4LLYA 4K23H 4ZAKD 2FR4A 5I16B 2XKSA 3RUGA 4WGVB 2YHGA 4TVPE 2R69H 3HAEH 1RIUH 3O3BB 1EEQA 5F9OH 1ZA3B 3ELAT 5F6IC 3SGKC 3MV7A 3RY4A 1C5DA 1OW0C 1E28A 3FO9A 4HZLA 4RGOL 4WFFD 1RVFL 2HH0H 5T3ZE 3A6CL 3D85B 4OZHA 5M95B 3L5HA 1QLEH 1U8NA 3W39A 2X4UA 4DGVH 3PP4H 3L9RB 4ZOCA 4JLRB 3T3PE 3DUSB 5DRNB 1NEZA 3HPLA 2IH1A 1TQCB 3LMJL 3SDAC 2DJSA 4KI5D 4KGLA 5LG1A 3VI3E 3DX8A 4HUVB 4NCC2 1K4CA 2NY5L 4K9EH 2NY0D 3ARQA 3L1OL 1RK1B 3AAZA 5DF0A 2AEPH 3CSYB 4P2RA 5AD0B 1AD9A 3UC0L 3OKDA 3WE6A 2G5RA 3GB7A 2E3VA 4MX7B 3DVGB 2IANB 3LZFL 1H5BA 3TN0A 5E6IB 1A6AB 2P1YA 3RBSA 5ABDE 1YEIL 4QHNB 1G7JA 3B9DA 4P3CH 3C6LD 3PHOA 3S4SB 4P5TA 3STBA 1BIIA 5GS0L 3D6GA 2VLKD 4WHCA 4GLRI 1F4XL 3ZL4H 15C8L 4XAWH 1OAUH 3IDNB 5IK3B 1T6VN 4OD1H 4LLQB 3LQZA 5CD3B 1EX0A 4TNWF 3QJHA 5DJXB 3RZWA 3VWJC 4K8RH 3O3AB 5BVJB 2J8OA 3BP7A 3A67L 3U46A 2EDLA 3IF1B 4KUCD 3WJLC 1FIGL 5HHNB 1KJ3H 5J1SC 4UT9H 3CSPA 1KXVC 4MCZA 3DO3A 1T7ZA 1G1CA 5I1IH 5AUMA 5L9DL 1NGZA 1P5VA 3MV8D 3PQYB 2JKXA 5F1IA 3QULA 4PJBF 4QGYA 1TZIB 1QG3A 2VABA 3WD5L 5IIEB 5CGYD 5C70A 1V3KA 1X5KA 3BZ4A 2PO6B 1RZ7H 4EN3D 4BFBD 1N0LA 1RK0A 2WINB 4M4RA 4QOKE 2YBRB 1BVLB 4WHTB 3MROA 4U1HA 5BVPH 4MD4A 1DVFA 1U8OB 3MNZB 1KJ2H 4JFYA 4ODUB 1AXTH 3C5JA 5C0AE 1UACL 1MFBL 3BZEB 1SJEA 1E4JA 4UBDC 5I18L 4QOKB 1P4BH 2WUBL 2AK4A 5I71C 1DQJA 2MKWA 3WNMA 5I1AB 2GFBA 1AO7E 5DI8A 4HS8H 5DA4A 4M1GH 2KL6A 5J9PA 2E7BA 1ZGLM 2KPNA 1CD0A 3PGCB 5IROC 3DIFB 3QXAB 5EU5B 2W65B 2B1AH 1FZKA 1QFUL 4LSVL 3ARGB 4PJ5D 1UFUA 4UNUA 4G9FA 4G9DA 3L7FA 5ENWA 1RJCA 2Q3AA 3CDFA 1GOFA 5EZIH 4NJAH 4ELKA 2UZYB 1CN4A 1EJOH 3IFOB 4RDQG 3ULSB 3A0OA 4WWKC 5D4QA 5D1ZC 4DOHE 1BFOA 4NO5B 2E7CA 5L0QC 4XX1E 3MRRB 3QDME 1OARL 1RMFH 5IOPB 3JV4B 4HFWA 4BA8A 4HUKB 5E99H 2Z93B 1I1FB 3EO9H 4JPVL 4KJQC 2GSGB 1VADB 4HV8A 1IQWL 4DN4L 3VFTA 1T1ZB 5DJDB 2F5AL 4DOHB 3H7LA 4DUXA 1E6OH 2Q7YB 3ZZ1A 1T2XA 3IKKA 3TVMA 3G04A 1U8IA 4LNRB 1AQDB 1HXMA 3NOIA 1UQSA 4FZ8L 4FQ1H 1KB5L 1YEKH 5I15H 2C26A 5HDBF 3RUGE 4MLIA 2YPVH 4L1HA 5CFHA 4Y4HB 2MWCA 2NY1B 5JW3H 3RL2A 3NCCB 2Y36L 4YZFF 4TPRH 1ZKAA 4JFFE 4LLYB 4RMSA 5DDHA 1YN6B 3I2CH 3RUGB 5IFJA 3L3KB 5HHOD 3RVUC 4NUJA 3AS0A 1DQDH 4QHLA 1RIVH 3UJIL 3EYOB 3MRPB 1KN4L 2HVJA 2YMXH 3MV7B 1C5DB 5I17A 1BD2A 4TOYH 5ITBL 1AIFB 1J1OL 4R8WL 4JFFB 3FO9B 4HZLB 1HSBA 3RWEB 1S7VA 3BXNA 3REWB 3RDTD 1S7SA 1U8NB 3J8F7 2X4UB 4NQTA 3NCFB 4NQXA 4PRDB 2CO7B 2VDPH 2XTLA 5D1QA 3HPLB 2IH1B 2AW2A 5DHXB 4RMRA 3C5ZA 3BZFA 5FDWB 2AV7A 5I19H 1FH5L 1IFHH 4M93B 1T03L 1F8TL 1K4CB 5B39A 4K7PY 5JORA 1IGMH 4JEGB 5GGSY 4TSBL 1Q0YL 1BEYH 1BWMA 4P2RB 1AD9B 1L0XA 4P59L 5MP6L 4V1DD 5FKPA 2HLAB 3OKDB 1HDMA 2HAZA 3WNPA 3T2NL 4LSRH 5K9KA 3ZDXE 1CLZH 3NFPB 4PS4H 1UM4H 3KLHC 3OGCA 1CLYL 4F58L 1LP9A 5IB2B 2UWEF 1EHXA 1G7JB 4XP5L 4YAQA 4JO3L 5B38G 5DEFA 1DBJL 3PHOB 1FORH 1FZJA 1HHKA 4YFDB 3O9WD 2VH5H 3I02A 2Q8AL 3MLXH 3UTQA 1SM3H 3HC3L 5HGBA 2EIEA 5GS2D 5LQBL 3LQZB 3SDDB 4XVTL 3QJHB 1HI6B 4AIZA 4ZXBB 5C0EA 2FYYB 1MCSA 1X5YA 1HIMH 3UTPD 1EGJA 4Y89A 3BP7B 4LDOB 1N7MH 4MJ6A 2FO4A 5TJWK 4Q9QH 4R97C 4XP6H 4GMSL 5CMAA 4OBSA 4TQEL 1J0YA 1KF9B 3VWKC 3W0WD 3ULUH 4JO2H 2AJUH 1J9CT 4OCNC 3VFUA 4MCZB 1JUFB 1MCHA 5AUMB 3WFHB 3E0GA 3O2WL 5GS3A 2FLBT 1MJUH 3GSXA 2ZG1A 3QULB 4U1NB 5FAAA 1S7TB 1XF4A 1M7IA 4U33A 1GGIL 1P7HL 3VD3A 2V6HA 5I30H 1RK0B 4HK0A 4N0FB 5JQ6L 2AEWA 4U3CA 2AK4E 5GGSA 4HX1B 1FC1A 4LKCB 4MD4B 3SKUD 1MCDA 2YUZA 3K1KC 4X4MA 3HNTH 3LKQB 3QDAA 4XNMB 2A83A 5DGRA 5L6YH 2ZSWB 1NBYB 1PFCA 3WLBA 1PG7H 2AK4B 3VWJD 2EDXA 3LRGA 4OZHF 3V5HA 1LK3H 4GMTH 5D71L 1CYGA 2I07B 4AEFA 2P8MA 4LSPL 4FQCL 1EEYB 2FBJH 1T7VA 1Q1JL 5BXFA 3BD3A 1NANH 5E1HB 4S1RL 4M62L 2VDRH 1MIEH 4JFZL 4ODTL 3GGWB 3EOAA 1T1WA 4ELKB 2NQCA 4OCXL 1UM5L 3CXDH 1BFOB 2IAMD 3TWCL 3QHZH 1T1XB 2BFVH 2H2PD 4RIRA 5LKNA 3MRQA 2JJSC 1Q0XH 3B43A 4XBEL 3O8XC 2C1PB 2NLJA 4HV8B 1XF2A 4JJ5A 2VC2L 3VFTB 1A1MA 5DD0L 1V3LA 4CNIA 5E8NB 4K23L 1WC7A 1U8IB 1AP2A 1UQSB 4UBDD 4JREC 2R69L 4LCWD 1RIUL 5KVMC 2WAHA 4IOFC 4QRRE 5F9OL 3VXNA 4M7KH 3ZTNH 3U4AA 3T0WA 12E8H 2CSPA 2HH0L 2PW1A 1QLEL 2VLKA 2Y07H 5IFJB 4DGVL 3PP4L 4Q9RH 2X4PB 4U1LA 1ZVYA 4NQSA 4NUJB 3IAPA 2DM3A 2HVJB 2FX9H 3QQNA 1JI2A 5B3JE 2FEEL 3CFKA 1KCRH 1UJTA 5HVHC 1GGCH 2Z31C 4WWKD 5D1ZD 3GMRA 1HSBB 3AMLA 3BXNB 4BFGA 1S7SB 4ZYKA 4K9EL 2IFGA 3RWGA 4QEGA 3BPOB 5C08D 4NM8L 2AEPL 4L4VA 2HTLD 3KJ4C 4J6RH 3CUPA 5T3XE 3TFKD 1ZK9A 3V7MA 3LSOB 5A16B 1UB5A 3EAKA 4PV8A 1NDGA 3QRGH 1VACA 5B39B 2X2YA 5JORB 2AKRA 4XNUH 1U8JA 4P3CL 4KKCC 4XI5D 1D3CA 4HXBL 4P4RA 1SEQH 3MRLA 3V6FB 4EN3A 4O2CA 5FKPB 1HDMB 2BNQD 2V7HB 4XAWL 3FT4A 1WFUA 5D6CA 2WWKT 2ZKHH 1HH6A 1YNLL 3MRJB 3VJ6A 3NACH 4OD1L 3S7GA 5J8OA 2XACC 3S9DB 3Q1SL 3QO0A 3RVUD 3AS2A 1CFNA 2H32A 5EIVA 2XFXB 3QAZC 4K8RL 4YAQB 2P43B 4DZBB 1SJHA 1FZJB 1HHKB 2JIXA 2XKUA 1MLCA 4RFOH 4CBPA 3R06B 1J86A 4PJIE 2ZP0T 2AXFB 1GGBH 1FG2B 3UTQB 5HGBB 1TTGA 4FFVC 1KJ3L 4MMZC 4OUUB 3QWOB 3STLB 4UT9L 1WCBA 3H0TA 3LB6C 1T7YA 3WDHA 5C0EB 5I1IL 2VAJA 4ZTPH 4PJIB 1JGLH 3VDBA 3HC0A 3QDHA 1FNGA 4GKNB 4GRLA 2PKDA 1RZ7L 1UCTA 5CMAB 3VXRA 4BFIA 4IRSB 4IRJD 3WNLA 4BJLA 3WHE0 3TBVA 3WDIA 4HIEA 1HN1A 3VFUB 4K3JH 5BVPL 2CDGB 1A7QH 4U1SA 3S34H 4CUCA 1KJ2L 1AXTL 1JP5A 3OGOE 1I75A 2CRZA 2ZUXA 5HHQA 3T1FA 5EOTA 4XVJH 1P4BL 2IWGA 4R90H 3UTSD 4XC1H 3MV9E 2VZUA 5CZKA 5BRZD 5GGSB 4HS8L 4M1GL 5M7QA 1VA9A 2FEDD 2B1AL 3V2AR 3T04D 3MV9B 3SE8H 3WLBB 2ATKB 5EZIL 1QLFA 4NJAL 1OP3K 3V5HB 3GIVA 4CN6A 3BPCA 4MNGA 4JB9H 4ZFZA 3CIQA 1EJOL 2V2WA 3ARFD 4NQCA 1DBKH 5KVGL 1Q9WB 1Z9OA 2HFFB 3W2DH 1T83C 3UP1A 2GW5A 5D7JC 1HK6A 4LLDB 1RMFL 5BXFB 4C4KO 4WU5A 2NZIA 4Z76A 1CDYA 3PL6D 5E99L 1NFIB 1OAZL 3EO9L 4XB8A 3T0VA 3QEUB 4Y5VA 5BV7H 5KVDH 3EOAB 1DEEB 4J3SA 5DMKB 4HUUA 1KJVA 5I1LB 2R2EB 2Z92A 2HFGH 3BN3B 1E6OL 3DXAD 3L5IA 1RJLA 1F97A 1FZMB 4JDZB 3HZYB 2B0SH 2GTZA 1XGUB 2LAGB 1Q9KA 4Y16D 1YEKL 3GM8A 4RIRB 3FFDA 2YPVL 2ZPKH 5F1NA 4XPFH 4PJAA 2NLJB 4JJ5B 1LP9F 5JW3L 3ZKSD 4CNIB 2V5MA 4TPRL 1FVCA 4KQ4H 3I2CL 3I6LE 3U1SH 1H8SA 1RJYB 5ERWA 1HSAA 2G60H 3JV0A 3HS0A 1LDPH 1WFOA 3MMEB 2L4OA 1DQDL 1MCLA 1RIVL 2XN9E 3BIBX 2AV1A 3VXNB 2YMXL 1HKLH 4C56E 4TOYL 1BWWA 4QY8B 2B4CC 4GKOA 2BSRB 5GS2H 2XZQH 1JPGA 4BSWA 3ZE1E 2PW1B 3QIBB 5E5MA 1QSEE 4N0UA 2BC4A 5I8CB 4C56B 4Z9KB 1A21A 4U1LB 2VDPL 3ALXA 3VXTB 1MCKA 4PLJC 2W60B 5FV2A 3THMH 2VDLL 1PX4A 1T2JA 1QFOA 3CFKB 5I19L 4PRAB 4J4PD 4EBQH 1QSEB 2VLMD 1IFHL 3GMRB 4JQXC 3MV11 4L3EE 2V5YA 5BQ7A 1IGML 3MO1A 3RWHA 2EIBA 4MJ4A 1T20B 3PV6A 2CIKA 3H9YA 1BEYL 2NMSA 4XXDB 5E94A 2NY2B 3ZHLA 2ZCKH 1CD9B 43CAB 2R0LH 3EO1B 5B8CC 4ORGA 4LSRL 4N1HB 1A5FH 2ICWA 2X89A 4L3EB 1CLZL 4PS4L 2DDQH 4FQLH 1UB5B 3X12A 3T3MF 1UM4L 3OX8A 2VKXA 4NZRH 4PV8B 3EJYC 2VR9A 1TFHA 3H9SA 5JO5A 3UAJC 4PRIA 3L3OB 2ICCA 1P84J 4Z18A 4JZJA 4P4KB 4Z7OE 3CFEA 1U8JB 1DUZA 2JJVA 4RFNC 3MRLB 1FORL 3MLUH 4O2CB 3ARTA 4XMLH 3KLSA 1LO4H 2HJFA 2VH5L 3MLXL 3FT4B 1BAFH 2X41A 3JXAA 1SM3L 3VJ6B 5F21B 3BN9D 3PHQA 3GIZH 3QO0B 5JW5B 2XKNB 4OFYD 3O6FD 1X5LA 5ANME 5KSBE 1K85A 2P24A 2D0FA 5E8OB 4X98A 1N7ML 1F3DJ 4POYA 1ZVHA 4TUKH 4Q9QL 2JIXB 3RX7A 3FRPG 1YEEH 4UT7H 2ADFH 4XP6L 5B38A 32C2B 5GIRA 5ANMB 1EO8H 4LGRB 4U1JA 1WCBB 1YYMH 3KVQA 3ULUL 3H0TB 2AJUL 4G7YL 1A3LH 4JO2L 1IJ9A 3VXRE 4M02A 4KI5F 4H8WH 4QRSB 4PJCF 1MJUL 4OZGA 2WZPD 4S0SD 3RZCD 1FNGB 1OVZA 4PJEA 3QUMB 4ZTOH 4K94H 2X4SB 2HKFH 4GRLB 2D31B 3GSWA 1HOCA 4JPKH 4M3JA 3VXRB 4E41D 4BFIB 5I30L 2CLVB 4GW4B 3ARXA 4H1LB 4RX4D 4KQ3H 1CT8A 4HIEB 1AXIB 1WAAF 2IGFL 3ZYJA 4U1SB 2A74A 4J8RB 3HNTL 1ZS8B 1EDQA 5HHQB 3S35X 5ICYB 4R4FH 3T1FB 5EOTB 5L6YL 1CFVH 5IV2B 1PG7L 5MHSD 2O26U 4WV1A 1LK3L 3TBWA 5J11C 1C7TA 2GCYB 5CIPA 5C0IB 3UZEA 1S3KH 1CG9A 4R2GB 1HHHB 4KV5E 5FIEA 5GGTA 4MNGE 1DE4A 4QTHB 4NQCE 3T2QA 2ITCA 2VSDA 2FBJL 1HWGB 4D9RD 4FFVD 5F1SA 2GJJA 4NO0D 4PJDF 2VWEC 5JOPD 3B4NA 5C86A 1MOEA 2VDRL 2VDNH 3KYOB 1MIEL 1G7LB 2X7LB 3IFLH 4MNGB 1I1AC 4ZFZB 2V2WB 4KUCF 4TN9A 4NQCB 5C6PB 4GRWE 1YY9C 3CXDL 5FKAA 2CK0H 2Y1VA 3QHZL 4LLUA 2W92A 2BFVL 4W4OC 1K8DA 3E2HB 1IC7H 1Q0XL 1SQ2N 5SWZD 1XGYH 4TUOA 4QNPF 4ZUVA 4PLNC 1FFOB 3H2WA 2DWEB 1TJHH 4GRWB 3SGJA 4MA8L 5EU6A 1KJVB 1RJLB 3G5VA 1M71B 4XCEB 2GTZB 1AGDB 1AJ7H 4OV5A 2OI9B 2IF7A 3MLVH 4GLRH 1I7ZB 1S9YB 1HEZA 1H8OA 4PJAB 5DFVC 3ZTNL 3OSKA 5DURB 3B9KC 5KN5A 1I4FB 1F4WH 4L1DA 3PWLB 4NBZB 5IUSA 2Y07L 3G5XB 4P3DA 4Q9RL 3CPLB 2DQGH 3WJJC 3HG1E 4KROD 1WICA 1WK0A 2FX9L 2DYPA 2NY6B 4JY6A 4OI9A 1KCRL 1GGCL 2XYCA 4AH2B 2LU7A 3F62A 5FA3A 3U83A 3HE7A 1JIBA 3MJ7B 3FQTB 3HG1B 2BC4B 1KEMH 1T2QH 1U2HA 2VL5A 2QQQA 4J6RL 2PF6A 4CU7A 1VEPA 1CGVA 4KJPD 3ESVF 4OF6A 2DMCA 5KBNC 2Z4QB 5F89A 5IWLA 5C09D 5C2BH 5I73C 1CVSC 3ULVC 1R5WB 4L3AA 3QRGL 4PTUA 5ISZA 3RWHB 5HJ3A 1A6UH 4QRUA 2P5WD 4LU5H 3PV6B 4XNUL 1O5DT 4NHCH 2QQLH 4NRXA 1R0AH 2CIKB 4QRQB 5BOPA 1SEQL 1PJ9A 3Q5TA 4BK5A 2WQ8A 4ORGB 4IRJA 2ICWB 4FMFA 4D3CH 2JB6A 3LEYH 2ZKHL 3X12B 1I85A 2L0DA 3NACL 1IGJA 3H9SB 4PRIB 1X5ZA 4JZJB 4QXGH 4NNXA 2LAAA 1HYSD 2FJGA 4LRIA 3EJJX 1WT5C 1OGTA 3WBDA 4E42A 1YN7B 4X6DA 4RFOL 3SGEI 3D0LB 1GGBL 1CLCA 3FQWA 4PGCA 3L95A 2Q8BH 3UDWA 5J1TC 1HZHH 1PEZA 2GJZA 2APWA 2IH3B 4CL7A 4PJ9B 3PHQB 5E56A 5C0NC 3HTLX 2Y72A 1JTPA 2CLZA 2VR4A 2P24B 5DMGC 4ZTPL 2DQFB 5GRUL 5I0ZA 2R0KH 4X98B 1ORQA 4WFGE 1JGLL 3LD8C 4YDJB 3RWFA 3VFVB 4QWWC 3DYPA 1PY4A 4NC1E 3FRUB 3AM8C 3ARFA 2FZ3A 5I74C 5GIRB 1AHWA 1G6RA 1J8HE 2ZNWA 4HGKC 1JN6A 3R0NA 4S1DC 3KPMB 2DQCH 4EI5B 4K3JL 5F9JB 4ETYA 5HPOA 3T0EA 1A7QL 3S34L 3QWRA 4P99A 4OZGB 1K9TA 3GFUA 2BXZA 3UYRL 3MBED 5HTSA 3OL2A 1J8HB 3RX5A 4XVJL 3EJYD 3DXAA 4R90L 4F15C 2X4OA 5F71A 4U6HA 2Q76B 4XC1L 4CJ1A 4P2OA 3NN8A 2VZVA 4JM2C 4QHKJ 4IIQB 2R4SH 2QHLA 2UUDH 3QIUD 2A74B 5FYJU 1GZPA 3TO4C 4YDIH 3FB5B 4I0PA 1LO5A 3QH3B 1WLHA 1YEDA 5C71A 1F4YH 1HHIA 3GNMH 5DC0A 3SE8L 4ENEC 1KT2A 3MJ6A 1CTOA 4PJGE 1IAKB 3WUWB 1AGBA 4APQC 4UIKL 4HH8A 4JB9L 5CIPB 1JNLH 4ZUTA 4GBXC 1CG9B 1DBKL 1KXQE 2NY3C 2YD5A 3B5TA 3W2DL 5K9QG 4OCRH 1DE4B 4E0RB 2ITCB 4DAGH 4PJGB 1FGNL 2B1HH 5CJQH 4JFEA 4WFEE 3K0WA 5D93C 3MRBA 2Z8RA 5KVDL 4G43A 1GSMA 1XT5A 4LGSB 2HFGL 1V5JA 1CCZA 1WBZA 1CDHA 4G3YH 4MA3A 2B0SL 5FKAB 4IJ3C 3NZ8A 3NH7H 4HJGA 4J4PA 1A6TB 1T89A 2EYTB 1K8DB 2CRYA 5ICZA 2XI9A 5DFTA 4TUOB 2ZPKL 4XPFL 4ZUVB 4YNYA 4BH7A 3BUYB 4FQJH 2H8PB 4KQ4L 4R0LA 1OM3H 3U1SL 2G60L 3JWNC 5D1XD 1UXSA 1LDPL 5HYFA 4OV5B 2APXA 5SWQA 1PY9A 1HKLL 4WGWB 2F8OA 3MRHA 4HLJA 1BF8A 3F7VA 1GOHA 5KN5B 2XZQL 1GHFH 5SV3A 1I3RA 2WW8A 1YEHH 2X4RA 5HVWA 4LCCC 4KKAD 2G9HB 3THML 3TZVC 3WSQH 2OSLA 2KUTA 4J3UA 2DYPB 4JY6B 3O4OC 1I1AD 3KPRA 5SX5H 3O6FA 1E6JH 4BQ9A 1PQZB 4ZFFB 4OIBA 4EBQL 4JFDE 4Z7NF 1R3HA 1KB5B 4LPWA 3HE7B 3V5KA 4YHIA 2YRLA 1B9ZA 1NUGA 4FQPA 1FL6B 2VL5B 1QSFA 3B9AA 4PJEF 1VCAA 2ZCKL 2R0LL 3F7PC 4JFDB 4O58H 3FT2B 1A5FL 4R7DB 2XXMB 1MHCB 2EE6A 2DDQL 4FQLL 2AEQH 1JPFA 4NZRL 1E27A 4UIMA 3MA9H 2KQMA 5ISZB 3B2VH 5B4MD 4QRUB 1OTTD 3KPTA 4NRXB 1S9KC 4S1SH 1GZQA 3MLUL 3BKJH 1OWRM 4XMLL 1LO4L 1BAFL 1V7MH 1I8MA 2QADC 2AJ3A 4Y0GA 3GIZL 3GRWA 4WHYG 3GMLA 4YX2H 3KPQA 4MQTB 4NZJA 3SJVD 3EOTH 1SBSH 4NNXB 4XZUB 1KPRB 3L3GB 1X4ZA 2NY4B 1BIHA 2F54D 4TUKL 5EO9B 1CGWA 3HR6A 1I1CA 1YEEL 4UT7L 2ADFL 1I7TA 1YMMA 3L95B 4OZ4B 3VGAC 3WXVH 2GJZB 3D18A 4WUUE 1EO8L 2F8VA 3OAUH 1YYML 4QTIH 5EC1B 1A3LL 2VN4A 3JV6A 4I2XE 4NO0A 1DQMH 3RWFB 2EEDA 3FO1B 3T0EE 1NAMH 4WUUB 4ZTOL 4GKZA 2HKFL 2VLRA 2HT2C 4TNWK 3QQ4B 4JANA 1G6RB 4FS0A 4Y88A 4KQ3L 1FVEA 2EXWD 3WS3A 3BKCH 3T0EB 2FH6A 4HULB 3AB0C 1M1SA 1QRNE 3M07A 5I1DB 1D5ZA 1CFVL 5ICXA 1Z2KA 3WXWH 4P2OB 4WEMB 1IL1A 3K81A 3NN8B 4MAYA 1OB1A 3TH4T 3MRKB 2J1KA 4PR5B 3IETA 3RY6A 4RMTA 1IQDA 1QRNB 3SE3A 1S3KL 3ARDB 1CGTA 1GZPB 4RGMC 4DVBB 1LO5B 1YEDB 1HHIB 2VAAA 1MF2H 1KPUA 4RBPH 2BOBB 3HE6C 2F8XC 4K3GA 4OUOA 2VDNL 1OD7A 1HE7A 4UTBH 5DT1L 5JQHC 2UVEA 3BGAA 3IFLL 3GKZA 3OQ3B 4ZUTB 1BP3B 4WJ5A 5EUOF 5HGDA 4UV7H 3MNWB 2CK0L 2BVUA 1KJMB 4NQED 4LSQL 4JFHD 2X1QA 5BS0E 1IC7L 5DQJB 1XGYL 5JDJA 1NGPH 4KRPC 3UJTH 3MRBB 1UWEH 4S1DD 2ADIB 1TJHL 4G43B 4N0RA 5FEBA 4ZNEE 5I9QC 4WU7B 1S7UA 1U9KA 1WBZB 4JGJA 1JZ6A 1DN0A 5MI0C 1DQLH 1LMKA 3NZ8B 1AJ7L 1MCOH 4I48A 4NRZA 1CDGA 5CP3A 3MLVL 5ICZB 3Q48A 5INDA 5CZVH 3PDOA 4JM2D 2IEPA 2W9LA 2CPCA 3AROA 5HGHA 4AEEA 4LEXH 5T1LD 3RWCB 1S7RB 2EDDA 1UH3A 5I1KH 4JZOB 4YO0B 3GJFK 1EHLH 1UKSA 3VXPB 1KCSH 4DK6A 1MAJA 1UXSB 2DQGL 3IDXH 4X6DF 4PJXA 1R3IH 4LK4A 5F9WB 2Y06H 3RAJH 4H26A 3PP3H 4KDWA 4OLYH 5J6GB 3SDXA 3ORJA 1FNEB 4GBXD 4JKPH 5KG9A 3IYLW 1I3RB 1VEOA 4OM0H 4YHLH 3NZHH 1MJJB 2ESVA 4XP4H 1KEML 1T2QL 4AQ1B 1JPST 4XAKE 3L6FA 4FP8H 3ALWA 2OSLB 4OQ1A 4ETQA 2ICEB 5IB1B 2NR6C 1A7RH 1QSFE 3MPCA 1JRHH 3KPRB 2VDOH 5C2BL 3HNSH 3KJ6H 1W8OA 2GITA 5E9DA 1V8HA 4YHIB 2I25N 4UOJA 1A6UL 4LU5L 1R0AL 4NHCL 2QQLL 1QSFB 3GMMB 2XZAH 4HDIA 5F7FA 1A9BB 3FFCE 1AE6H 5IBLC 4D3CL 4U2ZA 3PF2A 1OY3B 3LEYL 5IM7A 2OX5A 1JZ8A 1JPFB 4PYHA 1E27B 4HJJH 5MEOA 3CC5A 2D7OA 3MV01 1F42A 4AJ0A 4Y4KD 1UJ3A 2YOCA 4O2FA 5ACLA 5D6DA 1KIRA 4O4YH 5CSBA 7CGTA 1ZAGA 5I6XB 2QKIA 4HHAA 2EYSA 3IFPA 2RFXB 1U36A 1EHNA 5DHVA 1YJDH 1DANU 2Q8BL 4HZAA 3FCTA 1T04A 1HZHL 1R5VB 5GISH 1UG9A 4PB9H 4DQOH 2AJ3B 3N06B 3LPWA 1AGEA 1FIEA 3VD9A 3KPQB 2QBWA 3DMMC 1BOYA 2VLJA 4PRPD 5TDOB 4B41A 2DIAA 4YDVA 1TVDA 2R0KL 2UY7A 1SJVA 4ONGH 4HBCH 4DGYH 3RIFF 4H20H 2E5EA 3MOAL 1YMMB 1JNJA 1G7MB 1JPTH 3M1BA 3D18B 3VW3H 1D6EB 5CJXC 2DQCL 1Z0NA 5C07D 4XTRC 3GMQA 3DX7A 5IJKA 3VFNB 4BKLA 3QG7H 4G6AD 2K7PA 3PWVA 3U6RA 2PYEE 1QBMH 4GKZB 1GOGA 1T66C 3F7RA 5E8PA 3FO0H 2X9WA 1FNHA 1W0VB 4KPHH 4JANB 4FFZH 2LABA 2QSTA 5FM4A 3IT8D 3WS3B 1OAYL 2HT4C 1HQRA 1F2QA 1TXKA 5HGAB 2R4SL 2XTJE 4E5XB 2PYEB 4YDIL 3E1F1 4X9GA 4B53A 1NC4B 2PR4H 2IADA 1IM9B 1F4YL 4WW2C 2F19L 1D5ZB 3GNML 3F7YB 4WTWA 4OGYH 4L4TA 1NGXA 2BSTB 2VE6A 4MAYB 2XTJB 1OB1B 1KTDA 5BMFH 4QYOA 3ROOB 1JNLL 3MUY1 4Z7VA 4L5FH 4M6AA 2FL5B 1UM6H 2YUXA 4OCRL 3HZKA 1IT9H 4H5SA 1CIDA 4DAGL 3MQIA 1MHEA 2B1HL 5CJQL 2CQVA 4XPAH 3VFRB 2XWJA 2Q6WA 3PGDA 1MH5A 2HMIC 3K8MA 2VXUH 2E7MA 3F5WA 1D9KB 4WJ5B 1CGYA 1DFBH 4G3YL 1D5XA 1DQTA 2R23A 4N68A 5IHLB 3NH7L 2HT2D 1JYVA 1KLGB 3QIWC 4CJ0A 5D7IF 5DJ8B 4YXKH 1TPXB 5IESH 1S8DA 4MQXC 4RWHA 4X6CA 4YFLI 3BH9A 1XIWC 2J8UA 3IB4A 3OF6D 4FQJL 5DMIH 3VGBA 1A4JA 3QCUH 3DGGA 4FQXB 4LL9A 2FJHA 1XCTA 1OM3L 1VDGA 4LHUA 1DN0B 5SX4H 4NRZB 5AEAA 5IFHH 1FO0H 2DICA 4CW1B 1OLZA 5JIHA 4P5MA 4EUPA 1I1YA 1I8IA 4DWHA 3PDOB 4EOWH 3MNVA 4XMPH 3SDCA 1IILE 1B4JH 1ND0A 3MRIB 3BP6A 5HGHB 3U9UB 1GHFL 1FL3B 5F7EH 5MERB 3V9FA 2PXYD 4LEOA 2DWDA 1YEHL 4OAWA 3LEXB 5BO1H 5I1GH 2A0LC 4R7NB 3D1MC 4M3KB 2ESVE 3WSQL 2BJMH 2GJ6D 5DSCA 1ZXQA 3C87A 2BOCB 3SOBH 1AH1A 5E8EA 2X4NA 4GQPH 2XPGB 3UPAA 1E6JL 3HB3C 3IU3B 1I7UA 4LPVA 5KSAA 4X6BB 4I18A 1RPQA 4FFYH 3FOLA 1B0GB 2ESVB 4JRXE 2YZ1A 4X7EC 4D0BA 4ODSH 4KRPD 3S98A 3QQ9D 2ARJA 5TF1L 4MNQE 3W5MA 3VXMA 3HFMH 4O58L 3FB7B 2Y7QA 2GITB 2AEQL 5E9DB 4JRXB 2X40A 3U4EB 2MQCA 1NL0H 2Y5TA 2D4DA 3ARRA 3MA9L 3MACH 5BW7C 3B2VL 3WHE1 3WFCH 1FQ9C 4MNQB 4ACPA 2AJSH 2A6KB 2R4RH 5I0DA 1NC2D 4S1SL 1SYSA 1OGAA 4QGTA 4I0CC 2R0ZH 3LPGA 4PJ8C 3BKJL 1FGVH 1K5NA 1JGUH 5IM7B 3LY6A 1H0DB 1V7ML 5EZLA 5C3LD 2Q20A 1P4LA 3K4AA 3HUJF 2XIDA 4YX2L 1UJ3B 1ERNA 4O2FB 3EOTL 1SBSL 3KPLA 5GRVL 5C0CE 1KIRB 3CX2A 1LO0H 1ORSB 1T22A 4G8IA 4HHAB 2EYSB 3PWNB 4MS8C 3IFPB 4Y2DB 5DA0B 3DNKA 3K74B 5DHVB 3WXVL 4WHYH 4QHKI 3BGFB 4R26H 5C0CB 3OAUL 2ADJA 1BQLH 4Z7QE 4QTIL 2I27N 5KSUB 2RB8A 4BSJA 5DZNA 1QR1B 1IEAA 5LCVH 3DBXA 5TH2B 4YDVB 4YBQC 3O3EA 5TDPA 3JWOH 1DQML 1P7QD 3TF7C 4KZEH 3LKSB 1NAML 4YJZL 3FAWA 4WO4D