1NBVH

An autoantibody to single-stranded dna: comparison of the three-dimensional structures of the unliganded fab and a deoxynucleotide-fab complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
219
structure length
219
Chain Sequence
EVQPVETGGGLVQPKGSLKLSCAASGFSFNTNAMNWVRQAPGKGLEWVARIRSKSNNYATYYADSVKDRFTISRDDSQNMLYLQMNNLKTEDTAMYYCVRDQTGTAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2B-KAPPA BV04-01 FAB (LIGHT CHAIN)
publication title An autoantibody to single-stranded DNA: comparison of the three-dimensional structures of the unliganded Fab and a deoxynucleotide-Fab complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 36
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nbvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nbvH01
1RZGB 1RUMH 1FZJA 2PETA 3KLAA 4I77L 5C0BA 3HG1D 4XI5C 1OTTD 4JN1H 1HYSD 2NXZC 2F8XC 1PY9A 1S9VA 1PVHA 3K81A 2E6QA 1YYLH 3OKNB 3CSBA 1UVQB 4RIRA 4ZD3H 1LMKA 2FECL 1DBBL 1VGKB 1PG7H 1KB9K 4KMQA 1JZ3A 5CGMA 3C5ZC 3IKKA 4PV8A 5T3XL 3VFTA 1FLRH 2O5XH 4MHHI 4OCNC 5C0FA 3GMOA 4IBLT 1C08B 2AXFA 4OZFB 4ZOAA 1OT1A 3BE1H 1BP3B 1MVUA 4PD4J 3T0DA 1WZ1L 1QSEA 4PJHB 4Z77A 3SDXE 3BSZH 4MMZC 1INDH 2XXCB 1K9TA 3O3AB 4KHTH 3VE0B 4NQXA 5B39B 4HH9A 1UXSB 3A67L 2QBWA 2YXMA 1EO7A 4UIMA 4LHUD 3W2DH 1Y18B 1JZ5A 3Q48A 1YEEH 4MNQB 2AV1A 2IBZY 3VXPA 3T0WA 4U3HA 4LOUC 4OFVA 5EN2A 1ZLVK 4LVHB 4XCCH 2ITDB 1VSCA 3MPCA 1TZGL 3RTQD 4XP4L 4M5ZL 5IK3A 2R69L 4OZIF 1U91B 4KQ3L 3RY5A 4G6JH 2QV2A 4JDVB 3MRNA 5EOTB 4Q9QH 3C8KB 4DOHE 4NQVA 3L1OL 1UC6A 5I8OL 1NUNB 2VZVA 3D3VE 1DBKL 4DKEL 2PF6A 3UBXA 5KZCB 4LKCA 2BVOB 2Q20A 3U48A 2PW2A 3EO0A 5TJWK 2R8SH 1ND0A 3G5XB 1OAKL 2A73B 2BNQD 3WHE1 2BXYA 3U30C 4MA7L 2NY4C 5IHZA 1J1OL 3OV6A 3UTTB 3ARWA 4KVCH 3HTLX 5D70H 3ABZA 5F9OL 5K9OA 4NO2B 4XBGB 2CDFB 1JGUL 5JDSB 2V9TA 1A6TB 3AROA 1SY6H 2ATKA 4ZODA 1GGYA 3IU4L 5CIPA 3WE6B 3SO3B 4HMDA 3VDAA 4XNUH 2VLKD 5EG6C 2VDQL 3VFPA 1VESA 3RKDD 3QNXA 4L3ED 3TIDA 3EYUL 3O6ML 3LV3A 4PG9A 2PXYB 3VWKA 1INEL 1NH6A 1NBZB 2HJKA 4Z78A 1RZIA 4ONGH 1JNNL 3S5LB 1U8HB 2J88L 5JHDB 3MROB 4OGXL 1A7OL 1FV1B 1W0WB 1WQVT 2JELL 1YJDL 3GIVB 2J6EH 4PJFB 4OIBA 1MFEH 4IOIB 5D2NB 3CMGA 4P3CH 1D5ZB 4CW1B 4XP9H 5AWNL 1RJCA 5F7WC 3OAUL 3S88H 5E2TH 4LSRL 1JHKL 2FX9H 4G8GE 5E2JA 1GGIL 1X5IA 3BEVA 5JZ7D 1KB5L 3MRIA 5I1KH 5CGYD 1IL1A 3QR2A 3TYFA 1CDYA 1AO7E 4WENB 4KKCC 1S7QB 4WEUD 5C08B 2HFEB 2X70A 3SDDC 4AY0A 3VXRD 1MJ7L 1HQ4A 1YY8B 2EDTA 1N59B 3BN9C 1NDMA 2WBJA 4HUVB 2O61B 3U6RB 4U1JA 3H7BB 2L4OA 3RWJA 1FN4A 5J11C 3VGFA 3SGKA 4MNHA 3P9LA 3OG4B 1OGAE 2CQVA 4OF0A 2I5YL 4CVWA 4PP2B 3WLBB 4P2OA 2Y4SA 4M8QB 5MEND 4L4TA 3LEVH 2NXYB 4N8PA 5LGJB 2AGJH 4PJAB 5D2LF 3D3VA 3O4LB 4Z7UA 1AD0B 5CJQL 1PDKA 4TRPH 3BT2L 4M1GH 4OGYH 2G5BB 2FO4A 5IJKC 2L7JA 2OSLA 2X4NA 4M1DH 1QSED 2LVCA 3BDBA 1Q8MA 3SE3C 5DJAB 4AENA 2NY3C 3PWPE 4DGIL 4U1KB 2CO6B 1RU9L 1G84A 3WIHH 4A6YA 5DRNB 3FT3B 5LGHL 4P5KB 3FAXA 3VA6A 3G6JE 1EAPB 1A02N 1PZ5B 5E8DH 4JR9L 4XCNB 3HZMB 4EKXA 4U0RC 2BRRH 2YK1H 4NZJA 5J7CC 1ZANH 4WFFD 3ZYOA 2SEBB 4J6RL 5K9QG 4WGWB 3O9WB 4K71B 3BKCH 1T2QL 4GRWF 1KLFA 5ETUA 4WU5B 5DGQA 2NTFB 4XVSH 4EI5A 4G8IB 3KPQB 1U8NA 3KPSE 4UQ2A 5FECB 1EEYA 2FJHB 5JPMB 1DBAL 1KEGH 1MCLA 1KTKE 3CFKA 4PLOB 5C0NC 4WW2C 2ID5A 3ARZA 5B8CB 5EBGA 4OSUH 5KANG 3V4PH 5CBAA 5I74B 1NMBH 1DVFC 3MUHL 4GS7C 2R0LH 2C1OB 5HGAA 3I75B 4U7MA 1HHJB 3MBEA 4GKSB 2VN4A 5FM5M 2CD0A 3HRZA 2R0ZH 4U1SA 1DQDH 3L7EB 2WUCL 3EYQD 2EDHA 3OL2A 3DIFB 5D7LD 4PLNC 3CU7A 5F7FA 4P57B 3V6BR 4OZGE 3U7AA 2VISB 2XQYG 5FK9B 3KJ4C 5JUEH 4XH2A 1SYSB 5HDQH 1AO7A 1Y0LB 5IOPB 1E27B 2RFXA 1N6UA 2IF7A 2VDNH 3OGOE 4G9FE 4U2YA 4YHIB 4FQXA 2VITA 3Q5TA 5E5MB 4Y16B 3ZO0A 4BQ9A 4LPTA 3I2CL 4X80L 1UXWB 4QF1A 3B43A 5E9DA 3QWQB 4CL7A 1T5XB 3S96B 4F37K 1CICD 3QO1A 3VXUA 1OGAA 3HR6A 4XWOD 1A9EA 3DJ9A 5FGCB 4EZMA 4OZ4A 1KTRL 2W9LA 3RL2B 1T1YB 1YYML 2UZIL 3LN9A 3SCMB 1RK0A 3LKOB 2GYSA 1GGCL 2VE6B 4NWUH 3HC0B 4PJGB 1IM9D 3F65A 4RGMB 5JNYA 3JWOC 1OD9A 4PJEF 2NY1B 4XZUB 4P2RE 3SDAA 4KMTL 1HH6B 3HFML 3HE6C 3RU8L 1FVDA 4XVTH 5BW7C 4YIQA 5I8CA 4LSPH 4CNIB 4ERSL 1DLHA 1FNLA 1FZKB 3PWPA 5C0DA 4LSSH 5GRVK 1F00I 4M02A 4C56E 1RJZA 4O2EB 3V8OA 4P4RB 3G6JA 5D71H 4R7NA 3CFDA 3LEXA 3WSQH 2APVA 4O2FA 3MGOA 5DD5H 4N0FA 3GJEA 3MACH 5IB5B 3G5ZA 2P8PB 4JKWA 1WBYA 4K94H 5ALBH 3OKKA 1EH9A 2HFFB 1JGEA 2YS4A 3NCCB 1F8TL 3DROB 5CJBA 1EVTC 4R8WL 4XAWL 5F1OB 5HI4C 2CLZB 5CS7A 3ZE1F 2F54A 4EDWH 3B3IB 4MD4B 5T1DL 2Y5EA 3HE7C 1KUMA 4MD0B 2OJZH 4J8RB 3B6SB 5DWUL 1UCTA 4L8CB 3WD5L 4KK9C 3RWIA 3D3VD 3UTZB 4DTGH 4XTRD 4NUJB 5EOCL 1A6VL 5IMKB 5F96L 4OCXH 1UM4L 1PSKH 1HZHL 3RZCA 1A1NA 1TJIH 3EFDH 5HYJB 3VFRB 5CLTA 1AE6L 3CFJA 2APFA 3MA9H 4X4YB 3QEQD 4FS0A 4XRCA 4Y4FC 3BGMA 2HRPL 3U9UB 5H2BA 4OZGA 1ZT1B 4D2NA 4MNGE 2R56H 1K85A 5CZXC 1CG9A 1QLEL 4QYOA 5IEKB 2FD6L 5CWSB 4NQCD 4NZTH 5GHWH 4DZ8B 4XCEA 1M05B 3TWCH 4KJWD 4YXLH 1A1OA 3C6LA 3D2UB 4FN0A 4GAJH 4ENEC 4ETQB 5D5MB 2W0LA 1KPUA 3MR9A 4HWUA 1ONQA 3MREA 1DBJL 5GJSL 4H1LB 4PJ7A 2EIZB 4U6TA 5IFHH 4NBZB 3TVMC 5DK0B 1R0AH 4XVUD 1T5WA 1NAKH 4PS4L 2GITA 1FORL 1TZHA 3BPNB 1O0VA 1U58A 4PRPD 4G6KL 3TZVC 4POYA 4ZYKB 3SKOA 1X5AA 5JOEA 4NQSA 4YO0B 2DI7A 2ATPA 2VQUA 3QUKB 4G8GD 5FYJD 1XCQB 3G5YA 3BZDA 1N2RA 1VB9A 3MUY1 3NIFE 4D0BA 4IS6A 2C1PA 5TH2B 3D25B 3JSSA 4Z7VA 1G7PA 1I9IH 3D5OF 3GKZA 4WIQA 4HUNB 4C56A 4FABH 4PBXA 1KN4H 2VXVL 4S1QL 5DQ9A 3AFLA 3BUTA 2VXUH 2X1WL 1D9KB 4ELME 1CXEA 1TTGA 1IEHA 3H6JA 3SKMA 5IEHB 3GSNB 4OQ1A 1NUDA 4WHCA 1QEWA 3QCTL 1NFDF 1MHEA 2Y6SC 3SOBH 4K7PL 2Z91A 4FQLH 2WWMD 1KPVA 2DQCL 1XGRB 5J13C 1BJ1H 2NMSA 1OB1A 5C0IA 1FO0B 3R8BB 4M1CD 2W9EH 3UPCA 5I0ZA 4RISH 4G9DA 3TA3A 1C5CL 3L9RB 1NGWB 3T0XA 1T7WA 2ARJQ 2JJTA 5GJTL 3LDBC 4QY8A 4LLWA 1S8DA 3TM6A 5DSCB 5ITFA 2ADJA 1NC2A 3BGFC 1OM3L 3L5WB 3PL6B 3L5JA 4ZUWB 3AAZA 1MI5B 3AS3A 3IETB 3NACL 5D7SH 1T80A 4OCYL 3P2TA 3RWFA 3ULVL 1JHLH 3K8MA 3A6CL 2PW1A 3DUSA 4HIEB 4KQ4L 1OAUL 3HI6H 1PFCA 3BUYB 3GSXB 3N85H 1LD9A 3GMRA 4MNGA 1PLGH 3MRFB 3PXJA 5EC2A 3DVNB 4PJIF 4D8PB 1ZHBA 3ZHKA 3KYKL 4WW1A 4LMQI 2VR5A 1JF1A 4WU7A 3QNZB 3IFOA 4OLUL 1MJUL 1IGTA 4M6AA 2BNUA 3HS0A 4H0HB 3DRQB 5D6CB 5EZLA 2WP3O 3FRUA 3RDTB 3PWNB 5DQDH 1EK3A 4OM0H 3SPVA 5GQBA 3TJHD 5IUSA 2J8UA 2PTVA 3KPSD 1BQLH 5FGBA 2AK4E 1F02I 5INCA 1AQKH 4HPOH 5JIPA 4LIQH 4FQPA 3PP3K 1A7PH 1CL7I 1QBML 1UH4A 2CKBL 1HDMA 1EFXB 1RK1A 4NT6B 1UJ3B 5CKAA 4D9LL 5C07E 4JFDB 4LKXB 2JTDA 3QRFM 3G04A 3W5MA 2NY6C 5EZJA 1UEYA 5BVPL 1HSAA 3U7WL 2IALB 4HS8L 4J1UB 3HAEG 3BAEL 4JY5L 3QIBD 4LSTL 1MLBB 3LQZB 4Q74A 1DLFH 3BKML 2NZ9C 4OB5H 3CDGA 2K9UA 4M6NH 1I1AA 4G6AD 1L7TL 2BJML 1Q9KA 4ZUUB 4MA3B 4PV9B 5I30H 2ZG3A 4G9FD 1UWEL 4J3WA 5AZEH 3AREA 4KK6D 3P73B 4R97B 4I4WA 4ODWB 3RHWF 1J0JA 3MNZB 5A16A 1R24A 5E95B 4HS6A 1XGUA 1FFNB 4IDLA 2XWJB 4JZOB 5KG9B 4X6EA 1B4JL 2HLAA 2HJFB 4YEEA 1WWBX 5CSBA 1J1PH 5IFJB 4X5LA 3HI1B 4LDEB 4M61A 5DEGB 2YZ1A 5F9AC 5FYKU 1VFMA 4NWTL 3BWUC 1KG0B 2EYSA 5EWIL 5F3BA 3MFFB 4HMEA 5IESH 2P8LB 4M6OL 4TUKL 4U6HB 3ZDYF 1LDPH 1CFSB 1D6VL 4NIKB 4P2RD 3RKPA 3H2WA 4WNQB 1RJYA 3WNNA 1RZJL 2WQRA 3HAEH 4TYUA 1JL8A 2VB5A 5FCUL 4PBWD 4P5MB 1YEDA 3QXUA 3V0WH 1CT8B 5E8EB 1EJ6A 1I7RA 2AJSH 3P40A 1RHFA 1LE9A 4JY4B 1GXEA 2VN7A 2CKNA 4L4JA 2ICES 4NHUA 5FKAA 1R3IL 3GK8H 3IF1A 4KROD 1XGYL 4OF8A 1U3ZA 3U7YL 3IJSA 5AG9A 1CGSH 4FFWC 5DLMH 3OKMB 3PG2A 1CQKA 3DURA 2C26A 4Q0XL 4ZXBC 1JRHH 3MRRB 2V7NB 2FGZA 5KAQF 3NIDF 4KI5E 5D4QA 1YMMB 2AK4A 5LBSL 4N1EA 2D3VA 3PIQB 3OJDB 3D18A 1KFAH 2W92A 4N0CD 2NY5H 3HC3H 2DWDA 3IDYB 4JANA 4LARH 1F11A 3HI5H 1F4WH 2H3NB 4Y2DB 5I9QB 4YAQA 1CFTA 3MV9B 6CGTA 3KYMA 1QACA 5BCAA 5T5FH 3QQ3B 1T0MA 4LLUB 2CLRB 5C09E 3SQOL 4NO0A 2V2XB 4N5UA 2O5ZL 1BVKB 1T6VN 1U41A 3HR5A 5EU7E 2F19L 5JIIA 5I18H 4PB0L 2GFBB 2AJUL 3IJYA 1QFUH 1A6ZA 2BSTB 4MVBC 4LCYB 5C0AE 1A1MA 4HZAA 4YBLC 2RAMA 1WWWX 1RUPH 2GT9A 4WFGE 5GIRB 5JORB 4PJCB 3C09C 5ISZB 1IEBA 3OBAA 1UACH 2PO6B 4D9RE 2X7LA 1P7QD 1KJVA 3EYOA 4JKPL 4X98B 2KUTA 2WINA 4QHMA 3QCUL 1NUGA 2Z31A 4HK3N 4OBSA 5HYQB 1FDLL 4KZDL 5EZOL 4B41A 4HZLB 4MAYA 1KEML 1R5VB 1CS6A 1UG9A 2NY7H 3BPCA 3WHXB 2HRLA 3TYGH 1ULVA 4PYGA 2Z92B 4MJIE 1T7VA 2ADGB 3EHBD 4KAQL 1ROWA 4HUUA 2Z4QA 5DFVC 3UTQA 1P84J 3SDCB 1JPSL 3QUXD 4DJMA 2CDEB 4X9GA 3VGAB 2EYRB 1TITA 2K7PA 3DSFL 3QO0B 3X12B 3WMSA 1IGJA 3BZFA 4DFHA 2HTLD 3TBTA 4M43L 2MCPL 1XF2B 1B0RA 4JHAH 1DL7L 4UV7H 3W39B 3UJTH 5EBMA 3VD7A 3MZTA 4HKZB 3S35H 1XR8A 4MA8L 5HHOA 3REVA 3CVHH 4OKVB 1NEUA 1EEZB 1U93A 4HUKB 2C7UA 5GGTH 3O8XB 1MWAB 4FHBD 1IC7H 4OCWL 1BFVL 4AT6B 2ESVD 5GS1C 4YXKH 2XPGB 1KNOB 4J3SA 4X6DB 5CSZB 5GGQH 3LN5B 3TN0C 1WIOA 1H3GA 1HHKA 1K2DA 4LPYA 4FQ1H 3SN6N 5A2KH 3FOMB 1QLRB 4UBDD 5FUOL 4LFHG 5FF6A 5HYFA 2NY2B 5C8JA 5EU3B 4NHCL 5DMIH 4X7EC 4JRXA 1MAML 1T1WA 3ZE2E 1L9MA 4DW2L 3AY4C 4K7PX 3DO7A 2DM2A 5D1ZC 3B9EA 2ERJB 4QCIB 4YX2L 2V2TB 3QSKB 5D8JL 1NGQL 4F9PC 3BW9A 3MV8D 4Y89A 4FQQA 1F4AA 5C09A 4C83B 1FNGA 4MCYB 3K2UH 2ZUVA 5TGBA 3MBXL 3HHRB 5C0GB 1REIA 1ZT7B 1GJIA 4KTYA 4PGCA 3RWEA 3CSPA 4JFPB 3MV7A 4G43A 2OR9L 3HNTH 1WBZA 4JHBA 1KSRA 4QRUB 2OMNA 1RIVL 2AK4D 3CLFL 1VFAB 4LHQB 4OLWH 5DJ6B 1ZVSB 1CIUA 2EH8H 4Y4KD 3PGCA 3PDOB 1QSZA 4W6YB 3VXTB 1KTDB 3GB7B 3NAAL 5C07D 4LAQH 2RHEA 3OB0K 3WN5B 5D1XA 3CIQA 4MLIA 4MJIA 1A5FL 1QBAA 4P23D 1H9VA 1Q72H 4PJHE 4GRWH 4R9HA 5D96C 1JNHB 4X6CE 3C5SA 1UZ6E 5C3TA 5D9SA 3BPOC 3GKWL 1BEYL 3JV4B 5DD0H 2R0KH 3WNPA 1MFDH 4Z0XB 1MAJA 1YPZF 3OKDA 1LVEA 3K3QA 4MNQE 4I3RL 2IPKA 3IDNB 4YDLC 5C9JB 4FTVE 2RBLA 2WUBH 4NQUA 4CU6A 1VENA 2NCMA 2X1QA 3WO4C 2F53D 2C4FT 2XQBH 4Y19E 4IMKC 3I02A 3HB3D 1MPAL 4JQIH 1T04A 2DBLH 4HMCA 3MLVL 3MRGB 3BIKB 3NZHH 4BZ1L 3EO9L 3L3IB 3S9DB 4LRIA 5I2IA 3VGHA 1AFVL 4RBPH 4NO3B 4ZO6A 1A7BA 2IGFL 3X11B 5E6IC 1M6OA 1C8PA 3QQ4A 4OLXH 2V2WA 5EUOF 5M7QA 1YA5A 1KULA 3VRIB 2OXHA 1D3CA 2AXGA 2F15A 4MXVF 5GGSY 1C12A 3UTTE 2DOCA 3QUZA 3OZ9L 4QHKI 4OF5A 5JQHC 3MO1A 1FH5H 4HIIB 4TSCH 3UTOA 3KPPB 3QDGA 4LLQB 2NX5B 3MJ7B 5HGHB 3LVEA 4BH7B 4YHPB 5DC0A 3MUZ1 5KVMC 1W0VB 5KVFH 1YEJH 4ZOCA 5DHYB 1H5BC 3C6SA 1KCVL 2RGSA 5ESAA 2DICA 5FYLH 1CLYL 3TH4T 2PKDA 2R29H 3QIUD 2YMXH 5F1SA 1NCWH 1HEZB 5KSVB 1X4XA 3DVIA 3S37L 5E94A 3P4MB 4M00A 5E0QA 4DVRL 3R4DA 3CK0L 3D69B 4GG6B 4PJFE 4NUGL 2CJUL 4L3CB 4NPYB 4W6XB 5D2NE 1BD2B 2XWBA 3GBNL 1YEGL 2KKQA 5L9DL 1I8IA 5ICZA 4LSVL 3T2OA 3VXSD 4EN3D 4YQXH 2ZPKL 1TETH 3HAEA 1JGDB 4P5TD 3PF2A 4PJHA 5E8PA 4XCYB 5CSGA 4Z7WF 1JYVA 4JFOB 2A74A 4X6CA 1IFHL 3WJLA 1MFAL 3V5KB 3VCLB 4HEPG 3EOYG 2MKWA 5E00B 2EXWD 1VHPA 1GH7A 5F9WB 4PG2A 5B4MC 3TCLB 4MNQA 4CN1A 5IVXB 4RX4D 5C0AD 3RX7A 4FTVA 3K2MC 4JFFD 5AYUL 4WFGD 5J3HD 1FJ1A 3U79A 5DRXB 2UYLB 3X14A 4JG1L 4Y19A 3VXNB 3ZHLA 2ITDA 3RA7L 1TJHH 4L4VD 2YUVA 1A14L 2EDEA 1BQSA 1MCIA 1MREL 3ULSB 1JMZA 2A0LC 3KPNB 5EOTA 3PQYD 2AVGA 3SHSA 2NZIA 3HZVB 4CADB 3JXAA 4PRAB 3RVXC 4PJAE 3P0GB 5E24E 2OTWA 5ESVB 3BYTA 3I85A 5D1XD 3P4LA 2UY7A 3E8UH 5I71C 2A73A 2I60L 4YHNB 5HD8C 5ACMA 5IMLA 3MLSL 2FEDC 3ZTNH 4Y5YB 1C7SA 2A9ML 2WQ8A 3MLRL 1Z0MA 1Z9LA 5DJZA 1IGCL 3WJJC 5EOQL 3ULVC 3DETC 5GGRB 5L6YL 4N0YH 4KDWA 4QRQA 4ETYA 3ILQD 2QQLL 1BGXH 4IIQB 4IRJB 4K3DH 4LGPB 2V9QA 5JA9A 4OCRH 1SM3L 3O6FD 4NQEB 1NGZB 3NCJL 4LLYA 3ULUF 4MX7B 5IVZA 4PJ9C 4N90E 4TQEH 4ODHH 3ARGC 5KOVC 1JGLL 5SWSA 1UWGL 4MS8D 2YPVH 5T1LB 5I1DB 1NBZA 3DMMA 3MJ8B 1U8HA 1CCZA 2NTSP 3MROA 1I75A 4XPBL 5ENWB 5BS0A 4FFZL 1XF4B 2FHBA 4HGKC 4PLKD 2K3TA 4H20H 3FFCB 3OAYH 3EYSL 15C8H 3FCTA 4O58L 3U0WH 3DV6B 2B4CH 3DXAB 2M8XA 3GI9L 5GRJL 2XRAH 3MJ9H 1KJMA 5GS3A 5L8LB 3IGAA 1DUYB 2J8HA 1NBVL 1BLNB 1HSBB 5MHSD 5HHVH 1L0QA 4XNXL 4ZFFA 2HYMA 1A9BA 2P47B 2NYYC 5DI8A 3VRJA 1RY7B 5CMAB 3CVHA 1QLFB 1EHLH 3NCMA 1JZ6A 1KTLA 5CJXA 5GGTA 3FO2A 4WHTA 1FZOA 1YC8A 4P48A 3QEHB 2BOBB 2DWEA 3BQUC 1HH9A 3QH3B 1N59A 5K59E 1IKFH 1C1EL 4PY7B 4YUEL 3BP7B 2O61A 4C58B 5D7JB 3H7BA 2Y06L 1FGVL 3NA9L 3GGWB 4UQ3A 4FQJH 1LWRA 2NY0B 3DBXA 3WEXB 1OAXH 1QQDB 2CR3A 3RIAF 5FGCE 3DTXA 1M71B 2PYFB 4I48A 4M8QA 4XPHL 3OMZA 1I9RH 3TNMA 2D7QA 4MYWB 1BJ8A 1J12A 3MXVL 4HCRH 4MJ2A 5LGJA 4XPGH 2ZWLT 3ARBA 2HMIC 4PJGE 4L8SC 4PR5A 3FJTA 2HT3D 3ES6A 4L1HA 3LRGA 4RAUB 5DHVH 4PJ5A 2Z35A 2VR9A 1K5NB 4L8DB 3QQNA 1AHWC 4I18A 1G9NL 1UZ8B 3GO1L 3RWHA 1JZ2A 1X5XA 1YNLL 3KNBA 5DD6A 3FT3A 1ORQB 3KS0H 3E2HC 1RZJC 1FYHB 3RQ3A 3VRLF 4DZBB 4OZIB 1PYWB 1IKNC 2X4PB 4XCNA 5LAXA 3WXVL 4XP6L 4MNQD 2HLFD 1T7XA 1J8HE 1IGYB 2X1XR 3L3HB 2CK2A 1P53A 1XEDA 1KPRA 3VG9C 2YD8A 3P77A 4RA3A 4YFEA 2D7MA 1H15B 4X6BB 2AJYL 3HPLA 4M7JH 2VLME 4G8IA 2W0FB 2CIIA 1LO2H 5FECA 3GNML 5JR1L 5JPMA 3N9GL 3DHMA 2HT2C 1SMAA 4M7ZB 5K9JH 4AL8H 4JPKH 2A6KB 3QDJB 1TDQA 4KTEL 1AP2B 4BUGA 3U4AA 1U9KA 3LSOA 5HYJE 1Z5LB 3GSWB 4L9LC 3QDMD 3TCXA 5BZDB 4Z7NF 4ZDHA 1MCKA 3ARDD 4XC1L 1KBGL 5TF1H 5IROA 3UTTD 3L7EA 5I1JH 4HT1H 2VQ1A 4GLRI 4APQA 3R1GL 1S7RA 1NQBA 4JO3L 4ONOA 5FK9A 3VGEA 4UB0L 5C92A 5JXEA 5DK3A 5DD1L 2QR0A 4P46A 4XPTH 1MQKH 4R0LA 2EIDA 2VR4A 2CUMA 1YEFL 5D5ME 2H32H 5IT2L 3P30L 4RZCB 1OVZA 1NL0H 5HYSG 1IE5A 3DECA 3H3PH 1UXWA 3MNWB 3HN3A 2QQNL 3OKYA 2PXYD 3L5HA 2I26N 3PHQB 5KSAC 5F7EL 4FFVD 5A43C 3JWOH 3P11H 3B9KC 4YDIH 5JHDD 3LKSB 3GFUA 5FYKH 3T0ED 1G9ML 4KV5E 5EB9A 3TO4B 3KPLB 3SJVB 3EYFB 4R96B 2VC2L 3RL2A 1T1YA 4N1HB 3LKOA 5D6DA 1WWAX 5HI3D 4UUJB 4Q97A 3Q0HA 1YYLL 4PJGA 4Y5VC 5JXAH 5D93C 4X8XA 4XZUA 5JLZA 5KSUA 1BIHA 3QXDB 1MY5A 3VFNB 4CKVX 2HH0L 1U3HC 4P2QB 3FOLB 3OF6D 3D85B 4HUWA 4RMWA 3OWEA 2JJWA 3UTSE 3JV5A 4LLDB 5JPNB 2JCCF 5C08D 2N7AA 3MGAA 4KU1A 5TDPA 3K4DA 4MQXD 2Y36H 3W11D 4CMHB 4F9LA 1J8HA 3BE1L 2P8PA 3LPFA 3MUGA 4YDJB 4ZOEA 5HPOA 4LASH 5D2LB 4XB8A 1IQWL 2HFFA 1INDL 3QWRA 2P5WA 1LEIB 4KHTL 3KPOA 5IHBA 1ED3B 3P9MA 2WIIA 1YQVH 4HIHB 1UGNA 3BH8B 3F12B 1CYGA 5IBLD 3UO1H 3MRHA 3IFPB 5ANMB 2NXYD 3EOAB 4NM8H 4J8RA 5DJYB 4RWYL 5MEQB 5HYEA 3TBSB 1G1CA 3O4LD 5E1AA 4AM0B 4HH8A 3V6FA 5IMKA 2NW3A 1AGDA 1SQ2N 2OTUA 5HYJA 1E4WL 1OW0A 1MI5E 3VFRA 4Q9QL 4KK8C 4ONFL 5D72H 1T66D 1D5MB 2NW2B 4GRWB 5FA4A 3RNKB 1GCFA 2AV7A 4M3KB 1MRDH 4ZFZA 5I1AB 5IVNA 3FT2B 3RVUD 2R8SL 4YK4C 3G6AB 4OT1H 2OMBA 3ULVF 5BV7H 2F5BH 2I25N 2JB6B 4KPHL 4WUUB 3MGTA 3O9WD 1NAMH 1WEJH 4KVCL 3D2UA 1QRNB 4N90D 2R1WB 2YPLE 4YZFF 5HDOA 1WCQA 3L3JA 4K8RD 3ELAT 2OK0L 2X6MA 4LSQH 3U46B 43CAA 5ILTL 2EIZA 4WJ5B 1RUAH 3FN0L 3VXOB 3W9EA 3UTPE 2ADIA 4XNUL 5H8DA 2BVPA 3KWWB 5F6HJ 5C6PB 4LSUH 3LMJH 4JFDE 4YXHL 2ZCHH 4O4YL 2E7HA 3SY0A 4CDGC 1J8KA 4I0PB 2OTPA 2Z8RA 3IKCB 4W6WB 3X13A 1DN0A 3MV01 4YO0A 3QXAB 4OIAA 1HWHB 3GMMA 2DTSA 4HFWB 3MQIA 4Z7QE 2L0DA 4NQDE 5JDJA 1P9MA 2CPCA 3O6LH 1OARH 2H6PB 4Q7DA 2DBJA 3WXWH 3X3FH 3QNYB 1AKJA 1NMAH 4UT9H 5EUKB 4LCCC 3K74B 2M2DA 1MFEL 2NXZB 4U0QB 4RQQA 4P3CL 1JTTA 2HJLB 4XP9L 3IB4A 2RQ8A 1CE1H 3UTSA 4PRIA 1CZ8H 1QFOA 4QRSB 4AEHL 4OUOA 2CMRH 3MLUH 1D9KA 3KYOA 4KK5D 4Y16D 5I76B 4RCAA 3C5ZB 3GSNA 3ROOA 4TNVK 4TUOA 1F3RB 4PJEB 5EH1A 4DVBB 1XIWC 1UKSA 5MEPB 1XGRA 1RIHH 3I3DA 4I9WD 1GAFL 1LO4H 5J6GA 5JZ7C 3H9HB 4YDVA 4EDXA 4IRZL 3PV6B 3SCMD 3QIWA 3VFVB 5IB2A 4TSBH 3VFSA 5DXWA 5GS0D 4QTHB 4ZTPH 2X4UA 5T3ZE 4FQHB 4KTDL 4RAVA 3SDDA 5CHNA 1F58L 5F8QC 4DAGH 2NPLX 2NY1D 4PY8J 2CR6A 4QGYA 5L7XL 1IMHC 2FR4A 3L5WA 2Z8VC 3MRLB 3PWJB 2GJ6A 1EXUB 1ZHKB 1GIGL 1MRCL 3CH8A 3AMLA 4JM2A 4KRNA 1HXMB 4I77H 5KS9F 5DJ0B 2EC9U 5CINH 2MKLC 4JE4B 4LEXH 3HZYB 5IB4A 4YHLL 4BFBD 2I07B 1DQJB 3BUYA 1U8IA 4QRTA 5F70A 4Y8DC 2FNBA 4N8VG 4MJ5B 4ONHB 3DVNA 3BP4B 3ZSSA 2LU7A 3LKRA 1DBBH 1F4YL 3SE9L 3QNZA 3LS4L 5BZWB 3VMNA 4NNXA 2YUXA 2DQIL 3DRQA 3O11A 2YPLA 3CH1B 3CUPB 5T3XH 4ZNCD 1F13A 3F7YB 2Q3AA 4GKZA 1YMME 4HX1A 3KYNA 4H5SA 3U30B 1UJTA 3L5IA 2NY4B 1XF3B 3BKCL 4NT6A 1WZ1H 3EDEA 2QSQA 2GJZA 1NEZG 4LKXA 3KHQA 5DJDB 3T3MF 1X4YA 5HYJD 5C0EA 1CD0A 3INUL 3H9SB 3MV9E 3A67H 4IRSB 2IALA 3MLYL 1CGUA 2H2PC 3FMGL 4NQDA 3IRPX 5F71A 2AJ3B 3RVTD 4FXGB 4OSUL 1IAMA 3M8OL 1NMBL 2PYEB 4QXTB 2GSGA 1TCRA 3WFDL 3PUCA 4U1IB 4PV9A 4F2MB 3N1QC 4XP4H 5FO9A 4E0RB 4MLSA 1FYTB 2R69H 4OD2B 4KQ3H 1BFOB 3VMOA 5EC1B 5ISZE 5D7KE 4ODWA 3L1OH 3D0LA 3KJ6L 3MNZA 3GHEL 3TBYB 3ILPA 3ARTA 1V3LA 3MMEB 1DBKH 3DX7B 2XWJA 3VH8G 5HDQL 1Q9WA 2EC8A 2HJFA 2R2BA 2P49B 5IFJA 1PAMA 3GMQA 2JKXA 2A6JA 2QSVA 1U8LB 1OAKH 5DEGA 2H2SD 2KL6A 4MA7H 2XZQH 3WIFB 5F9OH 1TVDA 4XMLL 1JGUH 1NBYA 2BSRB 1NGYB 2BNRB 2Q86B 4GAGH 4WNQA 5MI0B 43C9A 3IU4H 1GHFH 32C2B 3GJFH 1NFDB 2BVTA 2D03L 2UZXB 1O7SA 1LEKB 1T2JA 2VDQH 7CGTA 5E8EA 5IM7A 5TE4H 2H32A 3O6MH 3LKNA 1CLZL 2GUOB 3EYUH 2DQFB 1P7KB 3V2AR 2J88H 2MPAL 4OGXH 1MJJA 4KKBD 1ZEAH 2JELH 1YJDH 1RV6X 4QGTA 5D71L 3RHWK 1GOGA 3HE6A 5FO7B 2B8OT 1NJ9B 4ISVB 2HAZA 4X7SL 3OAUH 1CI5A 3L3GA 2O26U 3L7FA 1CGVA 1XMWA 1X6LA 4U05A 7FABL 4LSRH 1JHKH 4LGRB 4BSWB 1JJUA 1GGIH 1G0XA 4QHLB 1T22A 3OHXB 4GW4B 2YPKA 1YEKL 3V6ZB 5E8NA 3C9NA 1JPGB 3PL6D 4PJIB 3OX8B 1MI5D 2BVQB 4U0RB 4Y2DA 1ZHLB 2WBJC 3MV9A 3EIFA 2BP3A 1MJ7H 3FO0H 4DTGL 3EOBA 1QNZH 5IW6A 3IDUA 4QOKA 5C2BH 1U8OB 4OCXL 1JE6A 3IJHB 5HYSA 4AEEA 2YKLL 5GSRB 4JQXA 3IDMA 5IIEB 4R4NC 3DX8B 2R2HB 2I5YH 4JRYB 4XTRC 1S9XA 4LHUB 1X4ZA 3NMEA 3RDTD 2ORBH 4FP8L 5GXBB 4KZEL 4BKLB 3P4OB 2OP4L 1A6PA 3VXQA 1EEUA 3B9AA 5CJQH 4MHHG 4NZTL 5GHWL 3UTPD 5IKCB 1EZVY 1AD9A 3V0VB 5SX4I 4F33A 1EFXD 3WLWC 1VADB 1Q94A 4HZLA 1BPVA 4JFDD 5FUZL 3TT1L 5JOFB 2VDPL 4DGIH 3UAJC 2ZSWA 2H9GB 5CEYB 4KKLD 3KJ4B 2CRMA 5LGHH 5I19H 2F5AL 3GSRA 1TVBB 1QPXA 3DWTA 5EORH 2Q6WA 2P48B 1R0AL 3HCVB 2Q1EA 4JFHE 4OLVL 5JMOC 1J88A 5DR5L 1BQHG 2BNQB 3MUJA 2X44D 1I1YB 2QADC 3VXMA 1G9NC 4J6RH 5F89B 4EI5C 1PQZB 4MJ6A 1RJLB 3W39A 4G8EB 1T2QH 3MRJB 1NAMA 2XT1B 4LLVA 5CD5C 2I24N 5KVDH 5TPWH 2GK0B 1FGNL 5JW3L 4HGWA 3TV3L 4FFYL 1N5AA 4U1LB 2GTWB 1KCSL 4NC1E 1LO0L 2GTZA 2XPGA 1JV5B 3L95B 4S1SL 5CSZA 5J06A 2IAMB 2YHGA 5I17A 2CO7B 5EPMB 1ACZA 4KWUA 2ICEB 2VDKL 5E4EC 1TFHA 1XF5A 5J1TC 3V7AE 2GIYA 4OUUB 2HT4C 1MVFA 4P4KA 1RI8A 5T3ZD 1LQSR 2WUCH 5ALCL 5EU3A 3GUTA 4GG8A 2V5SA 1BM3L 3GBLA 4RGNE 4FQLL 1DDHA 3VWJA 3FT4A 4QCIA 2BHUA 4XCFL 3VFWB 5EDXA 3FQRA 3ZKXC 1WGOA 4MAUL 25C8L 4MQ7A 4O00A 1W72H 5F44A 3RVWC 4C83A 4NN7C 3I2CH 4X80H 1I8MA 5B3JF 5E8OA 3EW3B 1CD9B 2WLYA 3VFUB 1FL3B 1IAII 3HE7B 2X4SA 4M1CC 4G7VL 4NO5B 1JHLL 4P9HL 3LB6C 2ICWB 3QG6A 1A6AB 4Z8FH 3VXRB 5C7XH 3V5HA 1YYMH 2UZIH 3SDAC 2I9LA 2OJEA 1GGCH 3N85L 1YMHB 1WFNA 4QRUA 1YMMD 2WANA 4GG6E 2DLIA 1VFAA 2VIRB 4Y2OA 4CU7A 4MA1C 4F7MA 1SJEB 1NLDL 1BD2E 1G9MC 4KMTH 3HFMH 1OPGL 4Y4FB 3KYAA 1FC2D 2YEZB 5DQDL 4ERSH 2GAZB 4GMSL 4OM0L 4Y2DD 2QQQA 1AQKL 1LO5A 4N9GB 2Z0BA 4N5EC 5A2FA 4R4BA 3N1PC 2UUDK 1DE4B 4WDIB 3TNNB 3S34L 2I9TA 1AGCB 1ZK9A 2F58L 2D7TL 4LPVA 2W65B 5D1QA 1F8TH 3IDGA 4XAWH 1AH1A 4PTUA 3TVMB 4UT7H 1CD1A 1BVLB 3FHQA 5ESQB 5ISZD 3RPKA 5T1DH 5DJ2A 4UU9B 5FHBL 2PO6D 3RZCC 2EDLA 5DWUH 5I16B 4X5WA 3T3PE 3TZVB 5LG1A 4YR6B 5EOCH 4ZUSA 4MCZA 1GZPA 1X3DA 4WCYH 5F96H 3L3IA 4WI2A 5C0JA 1G7QB 1HZHH 4ZS6D 4OI7A 3SO5A 3RWGB 1P5UA 3VFOA 4G6AC 2OS7A 2HRPH 3ZKND 5INDA 1MELA 4XHJC 3SDCD 5DVNA 1T2XA 3C6LC 4J4PA 1JGVL 1C16A 4KK6C 4X7FC 3DYPA 2EIEA 1OSPL 2FD6H 1R3KA 4N8VA 5I1CL 1DR9A 4Y4HB 2VAAB 4OAWB 2VDRH 4HW6A 4NCC1 2Q8AL 2ICCA 5EIQA 2MHAB 5J12C 5HGHA 1DBJH 5GJSH 3DX9B 3O8XD 5J13B 2AABL 1JNLL 3LZFH 5JOPE 2HVJA 5DHYA 5KSVA 3A6OA 1FORH 5JO5B 1G7MA 5CP3A 4HULB 1MHHA 4G6KH 4GW1B 1KJ2B 3CX5J 3LDBB 4JZNB 1EERB 1RZ7L 4L5FL 1A0QL 1NEZA 5T1MB 1UB6A 4Y1AB 2NY2D 1BD2A 1U6AL 1F6LL 3DXAE 1JUFA 4YHML 1R3LA 3CXDL 4UDUB 4CVZB 3WYRA 4D0CB 4KHXL 5TQ2L 5GGVL 5F88B 5AAMA 4S1QH 4H8WH 1KV3A 4PGEB 3VCLA 3BVNB 4ORGA 3HC3L 3QCTH 4K7PH 4GSDL 3HI5L 3PNWB 2DQCH 2LVEA 5J9PB 4J3UA 3TA3C 3VH8A 3WS3B 5DRXA 8FABB 3LKPA 4N0CC 4EVNB 4Z7UF 4YC2C 4AIZB 1F45A 2Q8BH 2P44B 2XN9A 4X99B 4O2CA 1HQRB 3KPNA 4O02L 4POZD 1FNSH 1C5CH 1JWSA 2NY6B 2ITCB 5BRZA 4CMMA 2P5EB 5HHME 3G5VB 3QFJB 1OM3H 2HN7B 3O0RL 4PRAA 3MRQA 3Q3GA 3NACH 3O3DB 1J0HA 1UQSB 4OCYH 4DN3L 1YPZB 3VD9A 3FB6B 3H3KA 1N64H 3A6CH 3MYZA 4KQ4H 3NFSL 1OAUH 3EZ8A 1GGTA 1D6EB 1CFBA 4MDIA 5F1IA 3O45A 3RNQA 5CLWA 1ZLUK 2V7HA 2B1AH 3OR7B 2Z8WC 4E5XB 3UZQA 2B7DT 4JFHD 4OZIE 4MD5B 1WCBA 3IDJA 5IB3A 1U92A 5FGBC 1QFWI 3TYGL 2CUIA 3FZUC 3P9WB 5IQ7L 1OLLA 1IAIL 1LEGA 4FMFA 1DEDA 1OP5H 1I3RB 3QUYD 4U1GB 4R2GC 5FIEA 4G42B 4NQCB 4PRHB 5EIVA 5C9KA 4ZAKA 5EUOB 1QBMH 4HDIA 4OLYL 2CKBH 5DUMH 2DMKA 3V52H 4JHAL 5I1DA 4UV7L 2XNAB 5C0CB 5HGBA 2VERN 5I15H 4D9LH 1U8QA 2FZ3B 3FTGA 2H41A 5TDNA 1XF4A 4NZRL 1RVFH 3U7WH 5EU5A 1I1AC 3FAWA 1DUZB 1PKQB 4HS8H 4YXKL 4JY5H 3MCLH 2GI7A 4LSTH 2EZ0C 1ZSDB 2LABA 1BLNA 2FX7L 3MCKA 2FJFB 2BJMH 2VZ3A 1CFQB 3SKUD 1BOGB 5I6XB 3E0GA 4HKBB 2AEQL 4LBEB 1OTUD 3GJFB 1Q9OA 2NX5D 1QLFA 4IHOB 4LLMA 2YC1A 2R1XA 2BY3A 4ZPTA 4GFTB 3IAPA 1S5IL 1V05A 3QEHA 1YC7A 1LE5B 4OQTH 1B4JH 2F74A 3BP7A 2DYPB 4NSKA 5DMGD 3ARFA 4EIZC 4QRPB 3DRTB 3B5HA 2DQJH 5MEOA 4NWTH 3PGDA 1U3YA 3EFFB 5EWIH 3OKEA 5F3HA 3FO9B 4Z7WB 3I3EA 4M6OH 4TUKH 2XACC 1KCUL 3WUWB 1D6VH 1N0LA 3LRSB 4HFUH 3H9ZA 3L6FA 4NKQB 4RNRA 1OGTA 3EJZC 2D2OA 4PGDA 1KB5B 3PE9A 3FB7A 5DDHA 4RAUA 3FB8A 1BQHA 2CGRL 4YFDB 1E4XL 1NDGA 4GBXB 4K8RL 4MXQC 4OLWL 2P8MB 3P0YH 1SEBA 1W72A 3NTCL 4PGBB 1UH2A 5FOJA 1T3FA 1OWWA 4PPTA 4Z9KB 3QJHA 5LGKA 1ORQA 4PD4K 3IU3A 1GZQA 4OZIA 1PYWA 3OKOB 5TE7L 2X4PA 5FO8B 1X5LA 2BHZA 3ECBB 4R90L 4JZJB 4PJ8B 1TVHB 5DO2D 2MTPA 1FL6A 5D2LE 4CN6A 3D0VB 1SJHB 1HN1A 1X5ZA 1J5OL 4X4ZA 4HJGA 1J05B 3HPJA 4KFZC 4L8BA 2R0KL 1NCAL 1G6RH 5JW4N 3U36B 1I7ZB 2G75A 2W0FA 1MIEL 3ETBF 1INQB 4GXVL 1FNAA 1EUUA 6FABL 3I6LE 1YN6A 4IEFB 1I7UB 3RIAK 4KMLB 3SKNA 2QKIB 4GAYA 2DQDH 4TSAL 1JFQL 2DBLL 4HIXL 3M1BB 4YHZL 5TE6L 1U95A 1Z5LA 1U0QA 1QO3B 3BJ91 3SQOH 4J3TA 2APXA 4HJJL 1CF8L 1CN4A 1XCTB 4HIJB 2O5ZH 2VXTL 4BH8B 3FQNB 1P1ZB 2F19H 4PB0H 3VFMB 3HB3C 4OKDA 2Z93A 4LSDA 1QP1A 5GS1B 3MSPA 4WGVB 4IRJD 5FDWA 4PJ7F 2EEAA 2IANB 2Z31C 3JBG7 4WUUE 4GQPH 5IHLB 4QLRA 3TN0B 4M62L 4NQED 1MHPH 4MAYC 5HGGS 4M93C 5E6IA 1F4XH 5JOPD 4JKPH 4RZCA 5C6TH 3STLA 1HKLH 4JFEB 3GIZL 3QCUH 4OBRA 5ICXB 4JDZA 5CGTA 5T1LD 5GZNC 3QT2A 1FDLH 1IT9H 3NFPB 5EZOH 4LHUG 3QFDB 3GSUB 1T21B 5K93A 1JWMB 4LCUB 4HWEL 4TULL 4HBCL 3KS0J 2B5IC 5D1ZB 5KVFL 3P4NB 4KAQH 3D1MC 3FFCD 3QQ9D 1YEJL 2H8PB 5ICYB 3TJEL 2R29L 3DXAD 4FOMA 4Z7VF 5EBLA 1JPSH 1NCWL 2OL3A 4HUMB 1CWVA 2X89A 4NCDA 3DSFH 1XGQB 4M43H 2MCPH 4BSVB 1DL7H 4URTB 3MJGX 1AQDA 1Q9LB 4YPGA 3GBMH 1B2WL 2W60B 5J6HA 4POUB 3FOLA 1BBJA 2ZOLA 4OCWH 5CILL 3V7MA 2DLFL 4W68A 4KI5C 4M7LT 5DFWH 4YDJA 5ACZA 1ES0B 4P3WA 1BOYA 5H35A 5GRUH 5D7JD 4ZFGL 4ZUVB 4CN4A 4TVSa 4ODXA 4EN3C 1LEIA 5FUOH 3WIIH 1CL7H 4WI8A 3RUGE 2NY0D 5SX5K 5ID0A 5H94A 5IGXL 4HIHA 5HJ3A 3K4AA 2EDYA 3CXHK 4FQ2L 5DRWA 3EOAA 3CCHB 4UDTA 4UNTA 3UROR 3V6OE 1P69B 3KPRB 1VCAA 4HKJA 4BELD 3WFCH 3QAZC 4YX2H 3HUJA 1WBXB 4PRNA 5D8JH 3QI9B 3BPOB 5AD0B 5EU7C 2JJVA 5LQBL 2VH5L 5IV2B 4ZSOA 3N50A 1J1XL 4ZMAT 4CBPA 1KYOJ 3NN8B 5J3HC 1F90L 3L3OB 4WHYH 4YDLB 4HXAL 3RI5F 1L0YA 2XFXB 4O5LH 1L4IA 3MBXH 3L3DA 3AU1B 4GRMB 4C57C 2O5YL 2YOCA 3ZE1E 3FT2A 1S7SB 3NOIA 1D5XA 2PNDA 1XGPB 1YECL 1L7IL 3DYMA 1XGTB 3TESA 2J8UF 3SGJA 2G9HB 1KLGA 2EECA 1W8NA 1RIVH 3Q6GL 1N8ZA 3CLFH 1TTUA 4ODTL 1HI6B 3NZ8B 5D1XC 4P9HC 5A1AA 4WJ5A 3NAAH 4Z5RB 4K3DL 2Y25A 1HYRC 3T77A 3PWLB 3C08L 5BO1L 4DQOL 4JB9L 3WJJA 1A5FH 1OTSC 3NIFF 3WS6A 3OAZK 5T33H 3UJIH 3QDJD 3NFNB 4OF7A 3AMKA 4TQEL 4F7EB 3JWDL 3E6FB 5KW9L 1MOEA 4DGVL 3T2NH 2Y1VA 3GKWH 3GSNL 4RRPG 1BEYH 3H9SE 4JPVH 1ZTXH 3O6FC 4YBQD 2W0KA 3ARGA 4FQIL 1MCBA 2DJSA 2ZCKL 4LF3B 2X4TA 5J0BA 1MHCB 2PYEE 1H5BB 2HJLA 2KDGA 3CFEA 4NDMA 2B4CL 3I9GH 3BD5A 3CSYB 1Z0NA 4LRIC 3MXWL 4UZGA 5IW1B 2IMMA 4JVPA 1MPAH 3LKQB 5GSVA 3MLVH 5CP7A 4U1HB 4BZ1H 3EO9H 5I76A 5E4IA 3FKUS 1AFVH 2IQAA 2YRZA 2ZOKB 4XNQA 3G9VA 4PJXA 2IGFH 3PABA 1DSFL 4P3DA 3RUGA 2K1MA 1B3JA 4IJ3C 3QUZC 4BZ2L 2IADA 4NRXA 2HFGL 3BP6A 5E2VL 5EU6B 2ESVB 4GUPB 3I84A 3SJVD 3TO4D 4HAGA 1ZXQA 5F9JB 2UVFA 4HS3B 3O81A 3V6OA 3C60A 4X7TA 1FFPB 4D94A 3U82B 1FFOB 2JCCB 3OZ9H 4TTDC 4EEEA 5SWZE 4S1DD 1PBYA 4PB9L 2BNRE 4WHDA 1CIDA 3C5JA 2E27H 2XTJB 3QZWG 1OAXL 5ABDE 1HXMA 5DJ0A 5I0DA 4P2QD 1NFDE 1WF5A 3D85D 3QPQD 1EBPA 3HZYA 1VFBB 4X8JB 2Q76B 5DZNA 2L7UA 5ADPH 1KCVH 5HHNB 4OQTA 2EDRA 3T0VA 3F58H 1QSVA 4OCMC 4ONHA 1CDCA 2XXMB 4OLEA 5HDLA 4YNYA 4DVRH 5BQ7A 1KIPA 3HG1E 3CK0H 1FE8L 5FB8B 1AR1C 4JKMA 4NUGH 2CJUH 3MRKB 1YDPA 1YEGH 1IAOB 3EO1B 4GRLD 2CLVA 4TUJB 4LSVH 5I71B 1NCDL 4HK0B 1NKRA 4OFKA 3C87A 3WJLC 4NFDA 2BCKA 1I3VA 2HP4A 4BK4A 4PG2C 3GSVB 5JIHA 3KLDA 4PJIE 4H25A 3BD4A 3UPAA 4WV1A 2JJUA 1IFHH 4F8QA 4NZDA 4LMQE 3I6GA 1ZT4B 2MQ0A 3EOTH 1JWUB 1QFWM 4ODUA 5LXGH 1MUJA 4UOW0 2MNUA 3NH7L 4PJ9B 4CRPA 4OFIA 4JPKL 1HOCB 5AYUH 3M17A 4NZUH 4AIOA 4X5XA 2DM7A 1KT2A 4WUUD 5T1KB 5IR1A 4LCWB 5T3ZL 4HLZG 4EUPB 1A14H 2B20A 3MRBB 3QB7C 3R06A 4JRYE 4OD2A 5TF1L 1MREH 1BFOA 5CZVL 1QRND 5EC1A 1I8KA 4F57L 3BZEB 1G6RA 1RZ8A 1TLKA 4OLZL 4H0IA 1A4JA 4L9LA 1RUQL 5CIPH 1UM5L 1LP9F 1Z9OA 3TBYA 4UV4H 1EEQA 1EX0A 3CD4A 4NKDB 2F53B 3K1KC 1D5BA 5EO1A 2YD3A 3VGDA 4UILL 5DT1H 1T1ZB 1KIRA 2LE9A 1U8LA 4PJBA 2I60H 4YEFA 4KY1L 3LPGA 5CD3B 4I0PD 5DVMA 3BJLA 1NC4A 1DP0A 2A9MH 5IG7B 3MLRH 5SWZA 4YDIL 5FYKL 2AS5M 1U8KB 3O41B 1AXTH 1EUTA 1IGCH 2FIRT 5EOQH 5IMOB 3NBNA 4XI5D 3EDKA 5L6YH 1QVOB 1MCWM 3H0TA 1LK3L 5FM8A 2BNQE 2NXZD 1KACB 2PXYC 1DN2A 1M4KA 1SM3H 3DMMC 5L2KA 3N1GC 4XT1C 2R23A 1AGBB 1JGLH 2AAVA 2DQFA 4KI5F 5D2NC 3C5ZD 1S5HB 4WVRA 5E08L 1UENA 1TENA 4YPJA 4G80B 4JFXA 3MA7B 3HG1A 3ZDYE 4XPBH 4XPAL 3WBDA 2VLKE 4HGMA 4PTTB 1A3LH 5M94B 3EYSH 4ISVA 4O58H 5J8OA 5GRJH 5CFHA 3WDHA 1YN7A 5KS9B 1ETZB 1AHWB 3ZT6A 1NBVH 3OPZL 4XNXH 1WC7B 3X3GL 5CJXC 3QCVH 1G7HB 1H3PH 1MFNA 1MH5B 2HTKC 3GMPA 4YFLI 3OG6B 4PJIA 3VW3L 2M26A 3IXTB 4YFLF 3U1SL 1MCOL 5DK2A 3VXSB 2JLLA 4K3JH 4X7CC 3MYJB 3PJSA 1EGJL 3D39B 5B21A 1C1EH 1A2YB 3BXNB 4YUEH 2DIBA 1MLCB 4LVEA 2BC4B 3NIDE 4KJYB 5LCVL 4F7CB 3QULB 1FGVH 5DMJB 5GSRA 3NA9H 5IIEA 1CLOH 1ZKAA 3NABL 3ARBC 3FONA 5D72L 4S1RL 1AGFB 4LHUA 3VXRE 1I4FA 2DL9A 4XPHH 3KPMB 1MRDL 4RMTA 4O51B 4OF3A 3MXVH 2XZZA 2FSEB 4MB4A 4U6VL 3FO1B 5IJVA 5DJXB 1FRGH 3STZA 5BV7L 1T66C 4AH2A 1UB5B 3RTQA 4L4VB 1NAML 2NY4D 3V0VA 3O6KL 4WTWA 2BZDA 4DK3A 5IBUG 3BO8B 2HVKB 2AP2A 4LPUA 1G9NH 4XP1L 3FFDB 3GO1H 5IVXF 1VERA 5MP6L 3EGSB 1TVBA 5HPMA 3H9SD 3TF7C 2X5PA 4IRSD 3O9WC 4K71C 1RUAL 2EDWA 3SE4A 4HSQA 3WXVH 2LTQB 5DMKB 3S7GA 1KF9B 3V5DA 2BNQA 4K8RC 1UA6L 1FAKT 2PYED 3U4EB 2WZPD 2XV6B 3OKLA 3L3KA 3QUMA 4NCC2 5ADOL 3PGFL 1HHHA 5KSAB 2R2EA 5BVJA 5EBWA 5DS8B 1I3GL 2JK5B 3B9KB 1FYTD 4XXDA 4YH6A 4LDLB 4U6YB 2AJYH 4PJDA 3RGVB 1G6VK 3GMLB 3O6LL 3WXWL 5JR1H 1V7ML 3MLXL 3PWUA 1IQDB 2VLKA 1CVSC 4Y5VB 2IAMA 5IROC 5D93B 2FJGB 4JEGB 3UZEA 4L3EA 1J18A 4APQC 3IRZA 4Q6IA 5GRWA 3Q5YA 5FKPA 1BX2B 4I2XE 3P0VL 1KBGH 1T0NB 3W5NA 4S2SB 3U9PL 3FB5A 4KKCD 3MODL 5DUPL 2BNRD 4P46C 4FXKB 4R0LC 1ZS8A 2PUQT 4HWZB 1M7IB 1LO4L 3MNVB 4UB0H 4H26A 2BXZA 3ALXA 5JHLL 2YD2A 3BN9D 4QXWA 4YWGL 1G7JA 4ZTPL 4K7FB 1YNTB 3D9AL 5IT2H 5DRZB 4MQTB 5GRYA 1XH3B 3OXRB 4JY6A 5GRXG 2QQNH 5F7EH 1Y6NR 3JTSB 4JVUA 4OCSL 1P7HL 4J12A 5D6DC 1QRKA 1G9MH 1OAQL 2EKSA 5CINL 3VXRA 4LEXL 1U8PB 3C8HA 3KGRA 2VC2H 5HHXH 2NLJB 5EO9B 2YUZA 4Q2ZA 4CU8A 1DQMH 1E28A 1IC5H 1K4DB 4XBPA 2WNGA 2C3VB 3BH9B 4Y1AE 4KXZI 2NY3D 1FVCB 4RRPA 1JTPA 4X6CF 1JYXA 5I1GH 2VRAA 1K4CB 4NRZA 2VLLB 2YEZA 2AI0H 5MENA 4F9LC 3ISWA 2HH0H 4M7KL 4D3CL 2DN7A 4YK4B 1ZLWH 2XKNB 2VWEC 3O3BA 3WHE0 3CPLB 1TQBB 2X05A 3EBAA 1JRHI 4M9OA 3U4BL 5GS2H 1OT2A 2G2RA 1UCBL 1AGCA 4J23A 1IQWH 1A64A 3NPZB 4R4FL 1GOFA 4G7YH 3TBWB 1BBDL 1BAFL 3VG0L 5EU4B 3T65B 4JRYD 3JTTA 3LCYA 3FQTA 1D7FA 5C0ND 3NIGF 4UU9A 4E42B 2NNAB 3DGGA 4RWYH 1OOAA 1HXYB 4KUZL 3HMXA 3MRDA 1OW0C 3B2UC 1NSNH 1YUHA 3ORJA 5GGRY 1JCKA 4E41B 2DQTL 4HKXB 5I1LB 2P5EE 3QFJE 1X7QB 2WBWB 1FP5A 2V17L 1E4WH 4JN2B 4QKXB 4ONFH 3P3YA 4I2XA 3QZWA 1YPZE 3CFBB 4LCCB 2FLRT 3TPKA 1H0DA 1KLUA 1SMOA 2B39A 1GRWA 4OI9A 2GSIA 5KN5B 2PTTA 1G0YR 3QWOB 1RZKL 2ZKHH 4KPHH 1P84K 1S7UA 3QDMB 4S10A 2YWYA 2E7CA 1N4XL 4Y4HA 1WJ3A 4OAWA 3ARDB 1EA9C 5DQJB 2XZQL 4X4XB 3QEQE 3ZSTA 5D7LA 3DUUB 3U2SB 2MHAA 5FA3A 4CVXB 2OK0H 3HLAB 5AUMA 2JJSA 4GAGL 4GW5A 3BPNC 2X40A 4DEPB 4X4ME 3RWCA 5ILTH 1BF2A 1GHFL 3TFKC 4NQCE 4PRHE 3FN0H 3S36L 5EUOE 4LVNB 2K7QA 1FZJB 1HKFA 1B90A 3QHFL 4UIKL 4R7DA 3WUZA 5C0CE 2IAMD 1JN6A 1YEHL 3KLAB 4MXVE 5C0BB 4YXHH 1P2CB 4O4YH 5TE4L 1P9MC 4JZNA 2EYTA 3TP4A 4XXCC 4KDTA 4BA8A 1BFTA 3HNSH 4XNYH 4Y1AA 2CRZA 4CUCA 1CICA 5GGSA 1F42A 2ADFH 1PKQE 3T0EB 4HUXA 1MNUH 1ZEAL 3T0BA 1E4JA 2YA2A 4RIRB 4ZS7L 4UDUA 4D0CA 2J4WL 4MDJA 3JWDC 4PRPE 1D9KC 2A83A 1IM9A 3RX8A 4AEHH 3VFTB 4KKBC 5C71A 3TT3H 3BP5A 5FYJE 5EOCJ 5C0FB 1QSFD 3GMOB 4DFIA 5DYOA 1T1XA 1OP3H 1BIIA 3SDXA 3TO2A 1FIGL 3ROLB 3QIWC 3U0PA 2B4CC 1MVUB 3HE7D 4ODSL 4Z77B 1AI1L 4N0RA 1GAFH 3WS3A 3KLHC 3FO0L 3S3PA 4QRPE 1QNZL 4IRZH 4NQXB 5E2WL 4HH9B 4B7LA 5C2BL 4UIMB 1J7VR 4KTDH 4JM2C 4Z7WE 1F58H 2A6DB 3MRCA 5L7XH 3ZDZE 3T2QA 3MRMA 3CLEL 5EN2B 1EDQA 1JHTA 2X4OA 4OIIL 4Y4FD 1GIGH 1MRCH 2ORBL 4LK4A 3T4YA 4PIRF 5IK3B 2VL5A 4GLRH 2BDNH 3MRNB 4JPIA 5KSBE 4YHLH 1Y6MR 1D6EA 4ORZC 3UBXB 4LKCB 4ENED 1T4KA 3D48R 2PW2B 3EO0B 4MD5A 3SKJL 1F4YH 2FIKA 2IPUG 3LH2H 3SE9H 1ND0B 3LS4H 2X4QA 2DQIH 3QEQA 5I19L 1EIBA 3F5WA 1ITBB 4JAMA 5EORL 3TVMD 5IHZB 4X4MA 3QISA 2OM5A 1KC5L 1T6WA 4NQCA 3TZVD 4KKLC 5EUOA 1S7TB 2XNAA 2EE6A 4GOSA 4RFEA 5I66A 3CC5A 5KVDL 3V8CA 5TPWL 4NYLA 2CDGA 4N0UE 4NNYA 3INUH 2BY0A 3QNXB 1FNEA 4XGZA 3MLYH 4NKMA 3LV3B 4PG9B 1ORSA 3FMGH 4I3GA 3VWKB 4NJAH 4X9IA 2HJKB 4Z78B 3NCFB 1RZIB 5E1HB 3M8OH 3OXSA 4GT7A 3ULUE 4PRPA 1I7TA 4R97C 2LAAA 1CFQA 3WFDH 2GCYA 5CAYB 5IHUH 2ENYA 4Y4HD 3KVQA 1SYVB 4HKBA 4HQQL 4LBEA 3GRWL 4ODBD 5IB1A 4G8GA 4RWHA 2ZG2A 4IHOA 2Y6SD 4A2MA 4JGUA 3KJ6H 1G0DA 3GHEH 4U7KA 5I1EL 1FPTL 4NP4L 3MRIB 1IAKA 1N3NA 1IL1B 1WIUA 4U6XA 1FG2A 2VXSL 3TYFB 1W72L 4I13B 4JGJA 3ARVA 4EXPX 2X70B 3W9DB 1L0XA 3EFFA 1HQ4B 3SQBA 3RY6C 3MOAL 4P2YA 1N6VA 3FO9A 5HSFA 4Z7WA 4Y1AD 4XMLH 5HDBF 2WBJB 3DX6A 4U1JB 4K2UL 3RWJB 1FN4B 1H3XA 4Z8FL 1Q0XL 4MNHB 3P9LB 5F7YC 5C7XL 3OJVC 2D03H 4P2OB 4M48H 4JO1H 5KSBA 2C4FU 5F21B 4DOHB 4L4TB 5F7NC 3LN4A 3CGTA 1CLZH 4Z7UB 3KG5A 5DZOA 2MPAH 2FO4B 1FSKB 4KH2A 2AW2A 2OSLB 2X4NB 4PJ8A 4OFDA 4UAOC 4TNWF 1TVHA 3BEWA 1J9CT 4AENB 1H3TA 5ID1B 2BY1A 3W82A 4A6YB 1NFIA 1S78D 3QDAA 4X7SH 1NUFA 1J05A 2EE9A 1A6UL 3IDYC 7FABH 3U36A 4Y2DC 1IM3B 2NY6D 2P5ED 3LQMA 1YEKH 3QFJD 3KPRE 2R4RH 4RMSA 1LDSA 1I7UA 4N0UA 4UT7L 3VRLE 2RB8A 5ETUB 3KPSA 2XI9A 2VZOA 1NMCC 2OXGA 2NZ9D 4EI5B 4JQXC 1T0PB 4M6MH 1EEYB 1XCTA 4WCYL 3CFKB 3BZ4A 3UJJL 1OL0A 2FX8L 2YKLH 5CBAB 3RVVC 4QHNB 2PO6C 2XWTA 3VFMA 2IH1A 2VZSA 2ZNXA 5HGAB 1CU4L 1NANI 1G7LA 1CK0L 2BY2A 3MBEB 3UMTA 2AQ3A 3QIBA 3HRZB 4FP8H 4K55A 2P46B 3VFGL 2OL3L 1HHGA 5GGUA 2QL1A 4ESKA 4KZEH 2HFTA 1CE6A 2OP4H 4KV5F 2P7TB 2E6JA 5E4EB 4PRHD 1YEIL 1DTUA 4HG4J 5ICXA 2Q87A 4OZHE 1KXVC 4XH2B 4G9FA 2VDRL 5F7UA 3ZKNC 5C0CD 2BSSA 4Z7NE 1BZQK 3AM8A 3PHSA 5FUZH 5CBEA 3TT1H 3VU2A 2VDPH 4I8DA 3VGAC 3CMOL 2DTML 3S4SG 4FQXB 2F5AH 4OF6A 3LZFL 5KVEL 2H8PA 5BV7C 4WFHD 4QF1B 5E9DB 1QBLH 4AMKH 4HC1A 4U4BA 3S36X 4L3AA 4OLVH 5DR5H 5DJCA 3QO1B 3VXUB 1OGAB 4LPWA 2WW8A 5HVFB 1A9EB 1X5FA 4OZ4B 3ZYJA 1RK0B 2XZAL 4P2RA 4QRRD 1FGNH 5JW3H 5CEXA 3TV3H 4FFYH 4FFWD 5LKNA 1U8JB 1KCSH 3D87B 3S3SA 1LO0H 3SDAB 1DQLH 4ZXBD 2QHRH 5CCKH 1ZHNA 1FVDB 2DKMA 4S1SH 1UFUA 4P4KC 4YIQB 5I8CB 1DLHB 3ARUA 2DYPD 4MA1B 3PWPB 4Y8AA 5HHQB 5C0DB 4ZUVA 5HHPB 2IWGA 1ITCA 2VDKH 4QRPD 1RJZB 4QWWC 4H8WL 4R7NB 3OGCA 3LEXB 2FWOA 3VWJC 3REWA 4O2FB 3MGOB 2ERJC 5ERWB 5EU6E 2ESVE 5ALCH 1XR9A 3GJEB 4MB3A 2XZCL 1BM3H 3BMWA 3CCHA 4JM2F 3IDIA 3OKKB 1NGPL 4KJPC 2FH6A 4XC3H 1ACYL 4FNLL 1H3VA 2JCCE 3FN9A 4XCFH 1JGEB 1YY9C 2EH7L 4ZPVA 4U1MA 3QI9A 5AD0A 2Q8BL 2F54B 2UV3A 4G6FB 2XTJE 4MAUH 5IV2A 25C8H 5FOBB 3NA4A 4P59L 4GBXD 1FNSL 2EDXA 4MVBD 2IBZX 4NRYB 3RWIB 2XFXA 5TDOA 3QA3A 2FBJH 4GRMA 4TOYL 4Y5XA 4G7VH 4P9HH 3RZCB 1A1NB 3MV8E 1OF2A 1N64L 4PJ8D 2ZCLL 3MLWH 1XGTA 4DN4L 2A6IA 1FL5A 2X4RA 3CFJB 3JV0A 2B1AL 1BVZA 4JCMA 3QP3A 5DTFA 1L6XA 3BGMB 1FIEA 3WN5C 4JG0H 1NLDH 1CTNA 1XZ0A 4OZHA 1HHIA 1CG9B 1CLCA 4QYOB 1OPGH 1DEEB 4XCEB 5DFVD 4GMSH 5M95B 3WV0A 3JV6A 1A1OB 3PWLA 1M7DA 3UC0L 1P7QA 1KPUB 4CVUA 3MREB 2ZUXA 1BZ9A 5L2JA 4PJ7B 5D1QC 5DUML 4JFYB 3V52L 1A22B 2EKJA 3PDDA 3S34H 5I15L 3ULUD 2F58H 5J12B 1T5WB 4WW2F 2D7TH 4LHJB 4YZFE 5I73C 4NC1C 1BJMA 4LF3A 1U58B 4ELKA 1MCEA 1RVFL 4JKLA 3SKOB 4HF5H 1I8LC 5A40E 1MCJA 3RI5K 3MCLL 3QUXA 1LO3L 2IAND 4OZFG 5FHBH 2ATPB 1L6ZA 4LCWE 3TN0D 3N1FC 3G5YB 1N2RB 3WFZA 4D0BB 5IF0B 4E9LA 4JFED 2BX5A 4Z7VB 2C3GA 5B39G 4BUHA 5JTWA 4RGNC 4C56B 4RDQG 4QO1A 4ELMA 2F53E 1MY7A 4J4PC 5DQ9B 5E99L 2ESVA 5D1ZD 3LEYL 4MZ3A 2GY7B 3SKMB 5F9JA 4OQTL 3TPUB 3HC4L 4G8FB 1ZWIA 1FFPA 1BF8A 1QEWB 2BVYA 1JGVH 1MHEB 3MRPA 1FFOA 2JCCA 4KRLB 2Z91B 1OSPH 1KPVB 4JHWH 1FBIL 2DQJL 5I1CH 3ALWA 3QPXL 1OB1B 5C0IB 3BMVA 2Q8AH 3O2VL 4HJ0C 4WTZG 4K9EL 4MXWL 4HFUL 1IBGH 2C5DC 2AABH 4G9DB 4ZTOH 3TA3B 3THMH 1VFBA 1JNLH 1RZKC 1RMFL 2Y7QA 1TQCC 4QY8B 4B5EA 4LLWB 1B6UA 1S8DB 5ITFB 2ADJB 1NC2B 1IEAA 3MV8A 1DBML 2VMFA 3F7QA 4N1CA 3RWFB 3VD5A 3P0YL 5L88L 5EA0L 2PW1B 3DUSB 3VJ6B 1RZ7H 3F6LA 4L5FH 5CJOH 1A0QH 2FGWL 12E8H 4NOFA 2IFFL 1LD9B 3GMRB 4PRBA 4MNGB 1U6AH 1TPXC 5EC2B 4XNZC 4YHMH 1E6OL 2I27N 1ZHBB 4QXGL 4PUBL 4WW1B 3CXDH 1IGFH 5KS9E 5HYIA 1K8IB 4WU7B 1JF1B 4F58H 3KPRD 4KHXH 1IGTB 2BNUB 1E6JL 5EZLB 1SBBA 4F3FA 3FRUB 5TQ2H 5GGVH 1QYGL 5I1IL 3QI9D 5DUBA 1QR1A 3HRPA 5F9WC 2DQHH 4Y4KA 3S5LG 2ICWI 1G6RL 3SPVB 3ARXA 2J8UB 3T08A 1T89A 5INCB 4PGZA 1YJDC 1AIFA 5C07A 3VXSE 2EE2A 1ZT4A 4LGSB 3ZE0F 4KRPC 1JWUA 1RK1B 1CFVL 3D39E 4GSDH 2R9HC 4R2GB 4P23A 2DQDL 4TVPE 4DGYL 2PR4L 2XY2A 4M3JA 2H26B 5EZJB 2AK1L 1CDUA 1OAZH 3VI4E 1T20A 3WNKA 1HILB 1HCVA 3OR6A 3ZTJG 3FQWA 4O02H 4Z95H 3PP4L 3T3ME 1WZKA 3CDGB 3O0RH 4JFFE 1I1AB 1P5VA 1Q9KB 2F53A 3QEUA 4DN3H 4L4VE 4Y5YC 4HBQA 1MHPL 1T1ZA 3IVKA 3AREB 3NFSH 4WI4A 4I4WB 1F4XL 5C6TL 3PQYE 1HKLL 5A16B 2XQYK 4XNMA 4HS6B 2VSDA 1S7VA 1XGUB 4IRJC 2JE8A 4G6ML 1IT9L 4X6EB 5EIIA 2HLAB 1NLBH 3FQXB 2IFGA 5F97E 1QVOA 2KBGA 3KLSA 4PLJC 1CDBA 3UCRA 4ZAKC 4PYHA 5IQ7H 1JNJA 5HY9A 2EYSB 2P24A 4ZUTB 1RHHB 1G1YA 4W4OC 5F3BB 1IAIH 4YGVA 5L0QB 4WI5A 1ZLVH 4G3YL 4M4RA 4ZO7A 2FDBP 4B0MM 1VACA 4OLYH 1RJYB 1J0ZA 2G60L 3V4UL 1A4KA 1DZBA 1FLTX 3GBML 5FUCE 3MA7A 2NQCA 2Q7YB 2R4SL 2CUHA 4L9DA 4NZRH 3V0AC 5E2UL 3MX0A 5FDYA 1ODAA 1LE9B 5EU6D 1I9JH 3QIUA 5J1SC 3X17A 3EJYD 4NHUB 5FKAB 3IXAA 3IF1B 1CGYA 2DQEL 3F6IA 5GRUL 1B0GB 2FX7H 3JVGA 2CRYA 3IJSB 4LVOB 1G7HA 1MH5A 3DURB 3WIIL 1CL7L 2ENSA 1U8MA 4MSWA 2XTJD 1KCRL 1V3JA 2AEQH 1OCWH 3ARRA 1G7IB 2VDMH 3LPWA 4LLAA 3ARFC 3VXSA 4EN3A 1S5IH 2D4FA 5MHSE 3D18B 4P5TA 3WFCL 2IC2A 4MMXC 4EJ1C 2DWDB 2YD5A 4JANB 4JHZA 3QULA 2XTLA 4X9FA 1F11B 2W1NA 4WEBL 2A0LD 1CFTB 2DKSA 3KYMB 2FL5A 5BMFL 1T0MB 2EICA 3E1F1 3RVXD 4O5LL 4NO0B 1KCUH 3I6KA 4RX4A 1NCNA 2H1PL 5C0AA 1I9EA 3S4SA 2EDOA 4I0KA 4JFFA 1ZGLM 5DJXA 3QUML 1A6ZB 2VLRD 1S9KC 4I3SH 2BMKA 4HHAA 1A1MB 1UB5A 1EMTL 5HD8D 4EXKA 4L4VA 1FVEA 2GT9B 2CGRH 4X6FA 4YHKL 3SDYL 1E4XH 3BO8A 1IEBB 4K8RH 3PQYA 3NTCH 2FECI 3ULVD 3DETD 3EGSA 3EYOB 2WINB 3BWAA 4M7LL 4QHMB 3WCYA 5F7HA 2Z31B 5TE7H 4GXUN 1MFCL 4R90H 5JW5A 4QHUA 2VTFA 4MAYB 2FYYA 4PJ9D 5T33L 1LP9B 3UJIL 3RGHA 5F7LB 2YSSA 1JK8A 3BPCB 3T2NL 1J5OH 5T1KD 2DF3A 4HUUB 2Z4QB 4LCWD 3F7VA 4JPVL 1ZTXL 1NCAH 4M7ZC 3AXLB 1WFOA 2PTUA 1CFNA 1MIEH 4GXVH 3BZFB 3TBTB 4F7TB 1R3HA 6FABH 1S9WB 1U2CA 3G08A 3O6FA 5EBMB 3I9GL 2OZ4L 1Z3GL 1XR8B 3QUYB 5HHOB 2LU3A 1JFQH 4TSAH 2FJGA 3REVB 3HZKA 1Q0YL 4HIXH 5F9DC 2C7UB 4YHZH 5TE6H 4OM1H 1ZV5A 5GZOC 4KUCF 4ZFOA 5HVHB 1OQOA 4LEOA 4HJJH 1FZMA 1CF8H 2VXTH 2DQUL 3AC0A 2BHYA 3GM0A 1K2DB 1TNMA 1VDGA 4NN5B 1FQ9C 4OJFL 5GS0H 5FF6B 2DLTA 3QDME 5C8JB 2CIKB 4M62H 2D7NA 3NPSC 4K7FA 3VGBA 3AB0C 4JRXB 5DRZA 1T1WB 1XH3A 3GIZH 3MV11 3DO7B 2E27L 1RZGA 2LU4A 3JTSA 3O4OB 1WUNT 2JIXD 4QHKJ 4FQQB 1JVKA 4HWEH 4TULH 4HBCH 5C09B 2HMID 3MZGB 3QAZB 1FNGB 5K33A 3DVGB 5ADPL 2VOTA 3TJEH 1F3JB 2J3SA 2A77H 3F58L 3OKNA 1Q1JH 1UVQA 3L5XL 2CRIA 5DFTA 5JHDE 1VGKA 3T0EE 4PGCB 3RWEB 3GI8L 3SBWA 3U0TB 1K4CA 3MV7B 4EQ2A 3WO3B 1JZ8A 4H1LG 1B2WH 1B88A 1WBZB 2XA3A 5B3JE 2VAJA 4U31A 4WWKB 3TH3T 5DD3L 1A8JH 3HMXL 5CILH 3PGCB 5C70A 1C08A 2DLFH 1RZFL 3ALPA 2GK2A 4NBYB 4OZFA 3D39D 4FG6C 2DB8A 5E7BA 4EOWL 4ZFGH 4TVPD 4MZ2A 3TBWA 2EDQA 4MJIB 2YD9A 3O3AA 3VE0A 5B39A 1UXSA 5C08E 5IGXH 2AERT 3UXFA 3C5SB 1Y18A 3EOTL 5D9SB 5LXGL 2RCSL 4E42A 2NNAA 4OFYD 5A3ID 2DDQL 4FQ2H 4V2CB 1MCWW 3UYOD 4NZUL 3SGDH 3C2SA 4K3EL 2IPKB 3V4VL 4BSJA 4H8WC 4NNPL 4MGXA 2IG2L 1X5KA 1RPQA 5LQBH 1SEQL 2VH5H 3CDCA 1U91A 4JN2A 4JDVA 1J1XH 3I02B 3C8KA 1T04B 1F90H 1O7VA 4HXAH 4UV4L 1KENL 3SGJC 4WTZA 3O4LE 4ZO9A 3QJFB 2ZSVB 2BVOA 2O5YH 5I2IB 4WI3A 1YECH 1L7IH 1W8OA 5DT1L 2BERA 3G5XA 5HVWA 1KJ2L 3T0AA 4U3XA 3TC9A 4NN6C 4WI6A 2YA1A 3QDMA 4NKIL 1M6OB 4LNRB 3ARDA 4P9ML 3QQ4B 5KSAD 3UTTA 2V2WB 4X4XA 1PY4A 3Q6GH 3RRQA 5HXMA 4ODTH 3DUUA 4NO2A 3U2SA 4XBGA 2CDFA 3B9KD 5DZLA 5JDSA 5EZIL 4HV8B 3RY4A 1A6TA 2AXGB 3HLAA 4LQFL 1C12B 1AXTL 3RGVD 3WS6C 4UNUA 3WE6A 4CAGA 4FRWA 2X09A 4I0PC 2MJWA 4YJZL 3QRGH 3QDGB 4YLQT 3C08H 4H0GA 5BO1H 1PG7W 4DQOH 4JB9H 3IDXL 1A7RH 2APWA 1AGEB 1P2CA 3JWDH 5KW9H 4GJTB 4DGVH 2PXYA 3GSNH 5ESAB 3C6SB 3S5LA 3CDYA 2QEJA 5JHDA 3T0EA 1FV1A 1U3HD 1W0WA 4FQIH 5E94B 1MCPH 3GIVA 2ZCKH 4PJFA 2KZWA 1KN2L 3UP1A 4IOIA 1A3LL 2HWZL 4X7DC 1FO0H 1D5ZA 3KXFB 5D2NA 4CW1A 2VLJD 3IT8D 1WTLA 4YHYB 3AS0A 3MXWH 2UVEA 2XWBB 1OSZB 2B2XL 1N6QL 1I8IB 5ICZB 1IGIH 3QCVL 1H3PL 2W07A 3HAEB 1HWGB 3ROLA 3MLTB 4LNVA 5DVOA 3OF6A 3V6OC 5E8PB 3C60C 3CJJA 3E6HB 1DSFH 1S7QA 4QT5B 2HFEA 5C08A 2A74B 4JQVA 1P4LB 4X6CB 4BZ2H 5E2VH 4K3JL 2HFGH 1YY8A 5CEZE 4ACPA 4HUVA 4RFOH 3U6RA 4EQ3A 4JVWA 2A6DA 2X9WA 4GH7B 4KK8D 4FTVB 1CLOL 4PB9H 1FJ1B 1QTYT 3KR3L 4I9WE 4PP2A 3X14B 4Y19B 3WLBA 3VI3F 2XKUA 5B38B 1QKZL 4KKAC 4NOBA 4PJAA 4HLJA 3O4LA 2OQJB 4YDKH 2YWZA 1AD0A 4L4TE 4XAKD 1FRGL 1U2HA 3BRGC 1LHZA 2G5BA 4Z7UE 1JF6A 4JFQB 1CGWA 2OTWB 4K9EC 5DJAA 5J1AB 2YZ8A 4U1KA 5DRNA 1FE8H 4P5KA 1XFPA 2IMNA 1EAPA 5DC4B 1PZ5A 3LY6A 5IMLB 3STBA 3HZMA 1AC6A 1VKXB 1EHAA 5DJZB 1NCDH 2SEBA 3BX7C 2MSPA 4WV1C 3O9WA 4QRQB 4LCIL 1S7TA 4E41D 5JW4Q 1ZA6B 3HA0A 4IRSC 2EXYC 2NR6D 4WU5A 5FYJL 2NTFA 1NCBH 2MMXA 4LLYB 4WWID 5IVZB 3OJMB 3MLZH 3KPQA 2FJHA 5SWSB 1MCCA 3CX2A 5DA4A 3DMMB 5B8CA 2E7MA 2LAGB 3NH7H 1LNUB 2C1OA 5ECJE 3I75A 3BDXA 1ERNA 5D7IF 5IW3A 1HHJA 4GKSA 5BS0B 3HMWL 2FATL 3K4ZA 5T3ZH 1SYVA 3FCTB 3CU1A 2A1WL 5CZVH 3BKJH 3KDMB 3DIFA 1KJMB 4F57H 1XIWD 4OLZH 3IGAB 4P57A 1RUQH 3B2VL 1UM5H 2VISA 4LP4A 4HEME 4ZFFB 1SYSA 1UYWL 1A9BB 1Y0LA 5IOPA 2D0FA 1E27A 3PP3H 5DI8B 1KCLA 4UILH 3VRJB 3CVHB 4YHIA 4YGAB 1KTLB 3UPRB 5C0BD 3FO2B 5E5MA 4Y16A 4KY1H 4L29B 4WHTB 3W9DA 1FZOB 5MI0C 4C59B 3W81A 2DWEB 1HH9B 1T5XA 2HG5B 3S96A 5E9DE 3CX5K 3NGBB 1LK3H 3CXHJ 5HHXL 3VXUE 2Y07L 4FQCL 4UQ3B 3SCMA 3DBXB 2VE6A 3DTXB 4IOFD 3HC0A 1DQML 1IC5L 4I48B 2F9BT 3TNMB 2J2ZA 4ODVH 1JZ7A 3ARBB 1HH6A 1OTTC 1HYSC 4PR5B 4Z0BL 5I1GL 2AKRB 2AI0L 4CNIA 5E08H 3ES6B 1FZKA 4PJ5B 2Z35B 4XPAH 2N56A 1WAAE 2ED8A 4I18B 4O2EA 4P4RA 5T5NF 3RWHB 5ID1A 4RBPK 3IYLW 3KNBB 5DD6B 2DM4A 3ULUL 5IB5A 1JP5A 3HUJF 5LAXB 3ME0A 4G7YL 3OPZH 3X3GH 1IM3A 4Z6AT 3DROA 1QHPA 2CLZA 3TGXA 2H2PD 3VW3H 1QPPA 1KPRB 3B3IA 4MD4A 2XICA 3UYRH 1F5WA 4GRLB 3P77B 5I8KL 3U1SH 1MCOH 4MD0A 4UTBL 3B6SA 3HPLB 2F54E 4L8CA 3UTZA 1EGJH 1NSNL 2CIIB 4NUJA 4M4PA 5LCVH 1ZAGA 4WO4B 1CGTA 1B6DA 4QHNA 4HWBA 4DKFL 3O2DA 5IWLA 3NABH 4FMKA 4S1RH 4AZ8A 3LSOB 4X4YA 1B9ZA 3RTQC 4HC1L 4ZDHB 3U9UA 4KRMB 4U6VH 1ZT1A 2P7TA 1RURL 2VQ1B 2ZKHL 1DQQB 5IEKA 4TNWK 4APQB 5CWSA 1S7RB 4DZ8A 3WDJA 1M05A 5MERB 3O6KH 5BJTB 3PDGA 4U33A 3ARSA 4BQBA 3SE8L 4ETQA 2WAHA 1LK2B 2QR0B 5D5MA 3SE4C 3ZYIA 4XP1H 5MP6H 4JRWA 3LHPH 4P46B 1MWAH 4R0LB 3SGEH 3RL1B 4H1LA 4J2XA 1OWRM 2YD1A 4IMLB 4BFIB 5DK0A 3VWKD 4PJ7E 2YBRB 1UA6H 1UM6H 4ZYKA 3IFNL 1NCTA 5ADOH 4QNPF 3PGFH 4QXUL 2X1OA 3FQUB 4F80A 4KJQD 3B4NA 4P49A 3HNSL 4XNYL 1I3GH 1IRAY 2DLEA 4DWHA 2ADFL 3QUKA 2D7PA 1XCQA 1MNUL 2IAMC 4MQSB 4PJXF 5TH2A 1U8JA 3D25A 4XXCA 1N5YH 3RKDC 1V7MH 3MLXH 3RUGF 5JLZB 5KSUB 4Q6IC 3K80A 5KJRL 5KVGL 1IILE 1WAAA 3TEUA 2V5RA 3E3QE 5HHQA 4Z7VE 1Q38A 2OI9C 5BOZG 5HHPA 3MTRA 3TT3L 2VXQL 4HUWB 1RAMA 5CEZD 5TDPB 3P0VH 5IEHA 2E7LA 1D5IL 1AR2A 5ERWA 2UY6A 1J8HB 2XY1A 3U9PH 1C5BL 3MUGB 2WBJD 3MODH 4XMPL 1V8HA 5DUPH 4K7PY 2P5WB 1ZVHA 1FO0A 4AJ0A 5JHLH 3KPOB 5CGYC 1CDGA 3P9MB 4YWGH 2WIIB 5TFSL 4P2OD 5FOBA 3D9AH 1SBSL 4L4TD 3MRHB 3L9RA 1NGWA 3DI2B 4R4ND 3V7AG 4NRYA 5DSCA 5E1AB 3V6FB 3PL6A 4ZUWA 5GISL 4OCSH 1MI5A 3IETA 2NW3B 1AGDB 3TH2T 4Q6YA 2OTUB 1OAQH 5LWYL 1UWXH 4MB5A 4HIEA 2BDNL 1TIUA 2ZNWA 4OTXL 1FG9C 3GSXA 4BZYA 2X41A 5FA4B 3MRFA 1X6NA 1EV2E 2QHLA 1ZGLB 2BOCB 2AV7B 3WLWD 3NCEB 4ZFZB 3OAYK 4D8PA 1V7NH 3LH2L 3UAJD 1ADQH 5D6CA 2ARWA 1PX3A 1P4IL 1DEEA 3RDTA 3MGTB 3PWNA 1BMGA 5C0RH 5DEFB 4TNVF 1A6WL 4M7KH 2R0WL 4D3CH 3JUYA 1K8DB 3L3JB 2QADD 2VZUA 4EI5D 43CAB 2J8UE 4JFYA 3U4BH 1EFXA 4N8CH 1UJ3A 1UCBH 3W9EB 3DSNA 5CD5D 2ADIB 4JFDA 4R4FH 1BBDH 2BVPB 1BAFH 3VG0H 2YA0A 3BIBX 3SY0B 3H8NA 1K6QL 2YR3A 3FL7A 1E0OB 3HNVH 3MBED 4J1UA 4NJAL 3X13B 1DN0B 5KTEL 1MLBA 3LQZA 4TPRH 3GMMB 4KUZH 2EDNA 4GAFB 1WV7T 1SY6A 1RULL 3RPIB 5IF0A 1AKJB 4ZUUA 2DQTH 4MA3A 4PJBF 5IHUL 2HT4D 4RQQB 4XX1G 1AO7D 2V17H 3UTSB 4PRIB 4PJCE 2XIDA