3PWVB

An immmunodominant ctl epitope from rinderpest virus presented by cattle mhc class i molecule n*01801 (bola-a11)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title Two distinct conformations of a rinderpest virus epitope presented by bovine major histocompatibility complex class I N*01801: a host strategy to present featured peptides
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 12
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pwvB00
4X6DB 1TTGA 3DV4B 4HWBA 5I1EL 1NLBL 3BE1H 5D9SA 1BBJA 2VQUA 3SE3C 3KPRB 2BOCA 3RX8A 2FATL 1UJ3B 4PV9A 5SX5H 1R5VA 7CGTA 1ZOXA 5HY9A 3T8XB 1DQJB 4PRHE 3MRKA 4J4PC 2RQ8A 4P2QD 1JNHA 5FK9A 1QBMH 5IBUB 3BRFA 5DD0L 5DEZA 3TA3C 4KAQH 2C4FU 1DBML 4B5EA 4M02A 4U6VH 4P2OA 4YGAB 4OQTL 2BVTA 2A0LC 3C60D 3JVGA 1PYWB 1IGCH 2D7NA 4R7DA 4PGEA 1QEWA 3F5WA 4PRIE 3HFML 4PP1D 1FVCB 4DZ8B 1OB1B 3BUYA 4XHJC 1KIPA 1D3CA 3OZ9L 1NAKH 2JIXB 5EC1A 4HLZH 2GFBB 3QFDB 4P4RA 3S35H 4NO0D 4OZIA 3B9KB 3UPRA 1ZVHA 3QXAB 2Y7QA 3O9WB 3TIDB 1XF5B 3P77A 1OPGL 3BSZH 2DB8A 3L9RB 3KG5A 3LV3B 2F53E 3NGBC 4EQ3A 2MMXA 1NJ9A 3QXDA 2A0LD 1F2QA 1YNTB 4PY7A 4PJ8D 1AY1L 3LPFA 3SKUD 1HXYB 5FYJU 3VXOA 4XHJD 4GAYA 4Y16A 1MNUL 4P5KB 3F7RA 4XNUL 2AEIT 3V5KA 2BSTA 3QQ3B 2OSLA 2VYRE 5DQDL 3MLSH 4M3KB 1IBGL 4ZOAA 3RU8L 3FL7A 3R1GH 1Y18A 2OQJB 5F7UA 1SYSA 3IDUA 5EORH 1FFOB 1OARH 3NTCL 4M43H 1FFRA 3DXAB 4M7JL 4YX2L 3WLWC 4G9DA 5E99L 3HE7B 3VXQB 3CVIL 2YD3A 5HGDB 3T3ME 4O58L 1LHZA 4QGYA 3ZHDA 2MWCA 4OQ1A 5D2LB 3MMEB 1F11B 2AP2A 3UYPA 4R26L 4OCXH 3IXTA 3ZO0A 4WIQA 2H8PA 5F21B 3KXFE 3L3DA 3D39A 2R9HC 4HXAL 3O2WL 1UWXK 3EYQC 4PJXA 1EMTL 3GBLA 4NBYB 4LSQL 3WLWD 3DYOA 3MROA 3X13B 4HPOH 1OAXL 4MNHB 2PYED 2YPVL 1J8HD 4HAGA 4TNWF 1C12B 4KTEH 5HHME 4KVCL 5TF1L 4DGIL 4I5BB 5EU5A 1JGEB 3TBVA 3TGXA 4XMKL 5GGSA 2GTZB 3I75B 4MLIA 1MFCL 1FFQA 3ZTNL 4GOSA 3LRHA 4MAUL 2EO9A 3WFEL 3T65A 4S1QH 4KK8C 4MS8C 3MNVA 5FYLL 1FVEB 2Y25A 2F74A 3EYQD 1I3RB 3WXWH 4BZ1H 2ZUUA 4HHAB 1QVOB 4P2RD 5SV3A 1UM5L 2CR6A 1RZFH 5CJOH 4JFOA 1KTLB 3WDHA 4XVTL 4ODWB 5DDHA 4YDLB 4PG2A 2FR4B 4KJQC 1C1EH 4JKLA 4FA8A 2F5AL 5LG1A 2A73B 4MS8D 5E5MB 1FGVL 1I7UB 3BPCB 1M05A 3TFKD 1U8HA 1X9QA 4XNMA 2KBGA 3NABL 2AXFA 3VRLE 3L5WB 1GIGL 1JGDA 1JGLL 1G7MA 2X1XR 3QEGH 3ZDZE 5GHWH 3ELAT 3FQWA 3RVVD 2BNUB 4JFFE 4ZPTA 5EOCJ 3LH2H 2J6EH 4XBEL 3NFNB 5CJBA 4NGHL 3TPUB 5ID0B 4IRSC 2HTKD 4JLRA 2RBLA 1FNFA 1TQCC 3PWNB 2Y06H 1AR1D 12E8H 3QNXB 4OZFB 3IB4A 1WBZB 1NAMB 1P4LA 4OJFH 3UTZB 2PXYA 1UB6A 4TULL 3S36X 2ADJB 3BXNA 1ORQA 3FN0L 4RNRB 5GJSL 3SDXE 5IT2L 1I9EA 4NZTL 2V9QA 5TE7H 1TITA 1E4KA 3T0DA 1DQDH 1A21A 2VXTH 3EAKA 4M48L 3PWJA 1GZQA 1AE6H 1I8MB 4MJ4A 5BXFB 3V6ZA 3CU7A 1TZHB 2D0HA 2VQ1A 2HG5A 4X8JA 1T1YB 5C86A 2EIDA 5GGUA 3WJJA 5FDWA 4I18C 3S88L 4M8QB 2MQ3A 4NUJB 3WIHL 1TFHA 5HPMB 2V2TA 1NCAH 3RVWC 5AWNH 4PTUA 4JM4H 5MERA 5HHPA 5SWZA 4A6YH 3LEVL 4BH8A 3UYRL 2EDNA 1U3ZA 3RL2B 4JY4B 2ESVE 4YFLF 3BUTA 1EGJL 1Q9OB 1OHQA 3RKDC 4S1DC 2VC2H 3JTTA 2Z31C 3OGOE 5FAAA 2WMPA 2ICWA 4P3DB 4P99A 4HGWB 3UBXA 4M1GH 1XGYH 2VZSA 4FXGB 1AHWC 1JGUL 3ZKND 4GUPA 4YHPA 3RQ3A 3FONA 5ICXB 3ARDD 2YD6A 2QADC 3RFZC 3ULVL 1QFWM 5HDBF 3TBSB 5I76A 4DWHA 1LO0L 2NTFB 4FFWC 4F7PA 3MRHA 4XAWL 1S8DA 2IPUG 1HCFX 4DAGL 4XH2B 5CGYC 1OP5H 3RKDD 1FL3A 1YZZA 3L7FB 1N0XL 3MGAA 3QXVA 1WGOA 5C0GB 5JQHC 1GGTA 5DJXB 1ZANL 4H1LA 4K2UL 4PTTA 2WSKA 1FGNL 2ZCKL 3TN0B 4NT6B 4HJ0D 5F6IC 2QADD 3VFTB 3A6CL 2CKBL 2NNAA 1YEKH 1CFBA 4FFWD 3OKDB 2H2PC 2DQDL 3NZHL 1J1XH 1YUHB 3W39B 1CVRA 1HHIA 5CGYD 1NMAL 4FQXB 3WJLA 1NCCL 3WEXB 2DYPB 1S9VB 3JUZA 3SCMB 2ZSWB 4KQ4L 1K4CA 1KIRB 3AFLA 5J1AA 4XMLH 4KMQA 1NCNA 2HRPL 4MA3A 2A6DA 1Q0YL 1S78C 1G6RB 3G6JB 3O11A 4EI6A 2G60L 3KYOB 5F70A 1OAUL 5BMFH 1U92B 2BNQA 4HG4K 3NCYS 5C0BB 1BP3B 2H2PD 3V0VA 4KPHL 3BAEH 5AZEL 1IZKA 3J8F7 1LDPH 4HWEL 3DMMA 1G1CA 3MRRA 5CIPH 4RISL 4GJTB 4Y7MA 2D3VA 4MJ5A 1GHFH 2BSSA 4PJAB 5IVXA 4P2OC 3AROA 4N90D 3AAZB 4DKDC 5JHDB 4NCC2 4M5ZH 2NZIA 3V5HB 1QOKA 2VLKB 2P24A 4HKXB 4MA1C 4PJDA 4PUBL 1I9JH 1S78D 1MWAL 1BQHA 2OX5A 4U1GB 4QOKB 3MRIA 4OAWB 3CUPA 4CADA 4XBPA 3QDGE 2UWEB 3EZ8A 4YWGH 4EUPG 2FEDC 3TLRA 1ZA6B 1BQSA 3BP5A 3B8SA 3VFPB 1ZK9A 3QWOA 3QB7C 4QF1A 2VLME 1U3JA 3S37L 5EOTB 4Z8FH 2HFTA 3IDMA 3CH1A 5IQ9B 5KJRL 3ULUH 1BLNB 4FFYH 1GGUA 2FH6A 3SQOH 3D25A 1FNAA 3C5JA 1FG9C 4Y16C 3NH7L 4NPYA 3CLEL 1JPGB 4XGZA 3AS3A 4HUVB 5F9JB 2FEDD 5E94A 1L6XA 3FRPG 2GJ6E 3U30B 5IROC 3WO3B 2I5YL 1LILA 4C59B 3GSXB 3T0EA 5C0JA 5BVPL 3RVUC 4LLVB 4KRPB 2VN4A 3GMQB 2NZ9D 3V5DB 5KN5B 3C5ZA 3UXFA 3W9EA 4KJPC 1N5YL 4O00A 1AXSA 3PL6B 2R2HA 1QBLL 3PUCA 5LQBL 4GG8A 5FHBH 1OAZL 5IEHA 1K9TA 1MOEA 1NBYA 1T20B 3MNWB 3UTQA 3I50L 1FL6A 5FYJH 2W9EH 3KJ6H 5J12B 5IKCB 4BH7B 1CD8A 5L2KE 4E0RA 4PJEE 2EDOA 1AGFB 4MMXC 5KBNC 3HZKA 5TDPB 2MQCA 3HNVH 2VXSH 2Q86A 4WWKC 3ULVE 4X6FA 5ID1B 3DGCR 1XAUA 4CNIA 5ACLA 2NYYD 1GZPA 3B2UC 2NX5E 3LRGA 3MLUL 3BDBA 3PF2A 4LLMA 3C8KB 4TUOA 3ARFA 1JWSA 3U2SB 5I1LB 4KK9D 4X7SL 4G6ML 2EXYD 4AYFA 1ZSDB 4PJGF 2EIBA 1SJEA 5GGTH 3GSUB 4H20H 1GGIL 2I9TB 2ZKHL 4LLYA 4X6EA 5CP7B 4WWKD 5T1MB 3C2AL 4YHNA 1S7TB 4MWFA 1FAKT 3NCBB 3B2UD 2XTJC 4PG2C 5ACMA 4WGVB 3T0VA 3U0TB 4D0CB 2PW2B 1II4E 3T1FA 2DQHH 3ARGD 4U0RC 1A7NL 1NDGB 3Q1SH 1MFDH 1KXTB 3GJFH 3O3BA 1AD0A 5GRJL 3LHPL 1UGNA 4U1SA 3VRIA 1DN2A 3BH8B 5EA0L 1KLUA 4JFED 1JNNH 3MRCB 4P5TD 5EO0B 1HYSD 3MLTB 2BDNH 3ALWA 3VDAA 2XTJD 3ES6A 3I2CH 4NO3B 2Z92B 3PHOB 4Y5VB 4NP4H 3RWCA 4I48A 4N1EA 4YHLL 3MRFA 5SV4A 3RIFF 1UCBH 3VXUD 4B53A 3T0WA 2ZZUT 4JCLA 3QIBB 2PXYC 3SDAB 2NY1C 5GISH 3EOYG 4CN4A 4F2MA 2XNAA 3OJVC 5DLML 2EC8A 3RWEA 1LGVA 4UTAH 2GYSA 3RWFA 1E4KC 1DE4A 4NFDA 4IIQB 2EH7H 1FJ1A 4F15C 3PP3K 5HXMA 4M8VA 3W2DL 2IALA 2CLZB 1VFAB 5I1DB 2F58L 3EYUH 5D7LB 3HUJB 3G5ZB 1LEKB 4PG9B 1C16B 2DLFH 3WFHB 4OLUH 1FYTB 3VFSB 4QRPD 4OZIF 3IFOB 4L3EA 3P4MA 4XVJH 2NY1D 5DD3H 3QWQB 1I1AA 5DA4A 3QPQC 5AAMA 5BV7B 4JFZH 4GQPH 3WJJC 4JPWH 5B39B 1MRDL 3DETC 4JJHA 4ZTPH 1ZHLB 2L4OA 5C6TH 5T1KA 5KVEL 1K4DB 3IU4H 1N3NA 1U9KA 4M9OA 1MJ7L 3SDYH 1WAAA 3WSQH 4JFDB 1IE5A 4WO4A 1OLZA 1U58B 3UROR 4Q6IA 2NY7L 2FEEL 1T4KB 4CN6A 5MEND 5DHXB 3RTQA 4LK4A 4RIRB 3UAJD 5J3HC 1ZE3C 2MOVA 3B9EA 2VKWA 3CSYA 4XT1C 2ZOKA 3SE4C 1GJIA 3DETD 3DUSA 5JR1H 2VMFA 3GI8L 2E7CA 1FDLH 5SX5K 4RMQA 1NFIA 3OAZH 2ZUTA 1MI5B 1A1OB 1DFBH 4WNQB 2RFXA 1RIVL 2PKDA 5FCUH 1CGYA 3FCTB 5HYQB 4JZNB 3HC4H 1D5MA 3EO0B 3RY4A 4N8PA 4JRXB 2WUCL 3BFOA 3NBNA 4JANB 3P9WB 4BQ8A 5KANG 2A6KA 4PJXF 4XXDA 1GGCL 2R1YA 1N7MH 4LSUL 3GBNH 5EBGA 4HFUH 3WV0A 1OTUC 3EYVB 1NDMB 1I1FA 3MBEA 3R0NA 4PS4L 2G75A 1MJ8L 4HKJB 2HJLB 3BP6B 4MAYA 4X4ME 5F3HA 3D1MC 4ZO7A 3OXSA 3BE1L 4XCYB 1NCDH 4LVEA 1WZLA 1N5AA 3OSKA 3WJLC 4Y2DA 4KJWC 3QDMB 4YJZL 4DN3H 3QNZA 1UJTA 3HRZB 1S9WA 1BZ9B 4A6YB 2VXVH 1QBML 2UYLA 3ARXA 2P44B 4XP9H 4KAQL 1NC4A 4P5MA 2DM7A 4U6VL 4X8XA 4YAQA 2X4PB 5DJDA 3SE9H 1BD2E 4JHBA 3BQUA 4NRZA 1IGCL 4HIXH 3QBTB 4NSKA 1I4FA 3H0TA 5F9OH 2WBJA 4AH2B 2DQCH 1NAKL 4QLRA 4URTB 4KJWD 5DQJA 5FKPA 2YZ8A 3S35L 4KK5C 5CBAB 5I9QC 5I71B 2NLJA 5CEYB 3V7AG 1F8TH 4G6KH 4NFBA 2IAMB 3O8XB 2ADIB 4F9PC 2BY2A 1FO0H 5EU6A 3BSZL 2BNQD 1RJYA 1U8JB 3SGEH 2Z91B 1YEHH 4NKOA 4R4BB 1K8DB 5DEGB 3PDGA 2E7BA 1HHGA 2H1PH 1LNUA 2ZJSH 5KSUB 5HD8C 1MCLA 1G7QB 3I84A 3G5VA 2L7UA 1FHGA 4EI5D 5ILTH 1K85A 5B39G 4K55A 5HJ3A 3HI5H 3MLSL 3ULSA 5DJYA 3R1GL 4XX1E 5JXED 5EORL 1OARL 4GRLB 3QH3B 4M43L 4NRYB 1I1RA 4BYHA 2H9GA 1UZ6E 1VADA 4YNYA 4O2EB 4P9HH 4MNQD 5KSAD 5FB8B 4TTDC 1OGTB 2X4OA 3OQ3B 5HD8D 3AU1A 5D2NA 4N1HB 2V7HA 1KV3A 2BMKB 1BJ1H 4ESKA 5C09A 2NW2B 3SGEI 3IS1X 4JG0H 2XKSA 4K9EH 3T0EC 4OCXL 3W9DB 1FL5B 4U31A 2VLLB 4OLVH 1ZHNB 4HWUA 5C0BE 2YPLD 3C5ZC 3TM6A 4LVOC 5CIPB 3BZ4A 4N8VA 5FM4A 1L0XA 4AJ0A 5C0AA 3KHQA 4HPOL 4LSPH 4WFHE 4ONHA 3IVKA 4KTEL 4TTDD 1BPVA 4U05A 2Y36H 1X44A 1A6TA 2AJSH 4WFED 1DQQB 1EFQA 2FX9H 3D9AL 2IH1A 4Y19A 3FT3B 3ZT5A 2BY3A 3T0ED 4F8QA 3HR5A 1S9XB 3RWHB 3WO4B 5JOPD 3IDJA 1WUNT 2EO1A 4OCWH 5FYKH 4S1QL 1A4KA 1IEAB 1BVLB 3VXMB 1GC1H 2IQ9H 1FSKB 4XPFH 2X40A 3GMPB 2DTSA 3VFWB 3ARFC 1X5FA 4PYHA 5AUMB 5BVJB 3WXWL 5AG9A 2NXZC 4I0KA 4BZ1L 2UVFA 2R1WB 1H8OA 1HN1A 4Y0GA 5EBLB 2PO6A 2VNCA 4YBLB 4N0UB 1RZFL 4LEXH 5CJOL 3CVHA 2DI7A 1C1EL 5HYSB 1CFSA 4OSUH 3FFCB 3EFFA 2E5EA 5F89A 1XF3A 4YLQT 5I1AA 3I6LE 3STBA 1A6PA 2DOCA 1YA5A 1QSFA 1JZ3A 2APBA 5T1DH 5L0QB 1T1XA 5E2JA 4L9LA 1M7DA 1CDCA 3QEGL 4X9BA 1Q0XH 2OYPA 5GHWL 3S7GA 3MV8A 4IRJB 3ECBB 3QUMA 1I7RB 1TNMA 1P5UA 3GSQB 1NCWH 3B6SA 3LH2L 2J6EL 5FUOH 1TZIA 4ZFZB 4HJJH 4OLWH 5CINH 2H26A 4Z5RB 4Z7NF 3X17A 2I9LA 5H94B 4RMRA 4JRYD 2XKUA 5FHAL 3X14A 1QO3B 2CSPA 1YEJH 2Y06L 2ZP0T 12E8L 5DRWB 2F8XC 2VL4A 3ESVF 4OJFL 3BMVA 4XI5C 3FQRB 5TE7L 4MX7B 1AFVH 4ZUWB 1IKFH 2DLGA 1DQDL 3VGBA 4BK5A 3OG6B 4LVHC 2VXTL 3BVNB 2NY2C 5ANMA 3ROOB 1HNFA 3IS0X 2K3TA 2CD0A 1AE6L 5E8PA 1NGZB 5K9JH 4NQUA 3RZCB 5IVXF 3PABB 3NIDF 5K9OB 5KG9B 2BRQA 4CW1A 4DJMA 5IEKB 1A9EB 1A6UH 3DJ9A 3KGRA 1FN4B 4YHYC 1I3GH 1KPVA 2WWKT 3W11C 3TO4B 2J5LC 1EJOH 1OP5K 4FQJH 5D7KE 4K71B 1A1NA 1NCAL 5TGBA 1TMCB 4L8BA 1UFUA 5AWNL 4AEHH 4F37F 4JM4L 1UA6H 5IQ7H 3IDXH 1NH6A 3WFBH 4A6YL 4CL7A 4TVPD 1ZHBB 3HE6C 1Z0MA 3CLFH 2Q6WA 1DN0A 4LF3A 2CO7B 2VC2L 4PRBB 4M6AA 4FTVE 2B5IC 3BKYH 2NQCA 2PYFB 1JWUA 1E27B 4NC1C 4ZXBB 4S2SB 4WO4C 4M1GL 1XGYL 2YD2A 1XR8B 4D9QD 4Q6IC 1EFXD 3U46B 3RTQC 2P8LB 4JPIB 4GG6E 1SBBA 1GGBH 5M95B 5EG6C 5FEBA 4CUCA 3S96B 3FOMB 1QRNE 3SOBH 1A9BB 3HE6D 4RQQB 4Z77B 3DX8B 1M7IA 1RUMH 3VGDA 4L8CA 2ERJB 2VLJD 4W4NA 4YHIA 1DEEB 4WJ5B 3ZKMC 4WO4D 1L0YA 3FT2B 5IM7A 4U2ZA 5FXCH 1X5LA 1IGIH 3IAPA 2CK2A 1A3LH 3RTQD 1VA9A 1AQKH 2K1MA 3FO0H 5HDOA 4KRMB 4FQQA 5CZVH 2KPNA 1YEKL 4NHUB 3DURA 2FECI 1EHAA 1J1XL 3KPQB 3QFDA 3HUJE 3TZVB 3OKEB 1IGYA 3RIAK 4DQOH 1MAKA 5IWLA 1MJJA 5C71A 4X7FC 5J56B 4ELME 3DVNB 2GEEA 4MAYC 4XMLL 4LP4A 4JM2B 3Q3GB 1IVLA 2I25N 1CFTA 4HIHB 4UAOC 1ADQH 4Y2DC 5BMFL 4MDIA 1U91B 5C92A 1RHHA 3EYOB 4GMTH 1KOAA 1HXYA 5BRZB 1S9YB 3BAEL 2E6JA 4X5XA 1LDPL 2MHAA 2BXZA 4JFDE 2E8ZA 3U7WH 1QPXA 3PGCA 1LE9B 3QZWB 2FO4A 1GHFL 5E9DB 4CMHC 4KKBD 4BFEA 1VDGA 4M5ZL 2H2SC 1DR9A 3BQUC 1KBGL 1I9JL 5EZIH 3VXRD 2W07A 1F6AA 2WBJC 3CX5K 1A4JB 4PJ5B 3CDFA 1HSAB 3OF6A 3WS3B 5F1NB 4NRXA 4P23A 4YWGL 1JI1A 2DBJA 4LGPB 1A3QA 1DVFD 3ZL4H 3UPCA 1XGPB 4F7MB 3IRZA 4FFZH 4X6CE 4L8SA 4WUUA 5DJ0B 4Z8FL 4JRXE 2H2SD 3AREB 4PRAA 3BN9D 5KS9B 4IS6B 1WC7B 4V1DB 1D9KD 3ULUL 4LAJH 3X13A 4FFYL 4NN5C 5F7HA 1EEZA 3SQOL 4MNHA 2XFXB 4QYOA 3N06B 1XGQB 2J8UE 4ZAKB 5I8CB 5C08B 1IKNC 1P2CA 3RI5F 4DVBA 2GTZA 2YWYA 3OR6A 3V6OC 3NCMA 3RL1A 5BZDB 2X6MA 4MJ6B 3BYYA 1U3HD 3F6IA 3E3QE 1KGCD 4JFFD 5HGAA 1S7XA 2KH2B 4MCYA 1KCRH 3MLRH 3QEQA 5JW4Q 1N8ZB 3E8UH 4XNZB 3LS4H 4OV5A 3DBXA 4PRPE 1I3RA 2R23B 3D85A 3P0YH 4KK6C 2IMMA 2LAGB 2BNRB 1U8IA 4JN2B 5ESAA 1U8OB 5D2NC 1QVOA 4CU8A 3HG1B 1F42A 1A7QH 1ACYH 1PG7L 1BAFH 3JV4B 5FHBL 4LRIA 4OZ4B 2F19H 4M61A 2XA3A 2P5WB 3MLPA 3HI6H 1RZ8A 5FYJL 2W9EL 2EYRB 3KJ6L 2BK8A 3GMMB 3S5LB 1DP0A 3BEVA 4GKOA 1GGYA 4H0HB 2X4RA 4PJIE 2QV2A 2A73A 3W0WD 2R8SH 2KL6A 1ZS8B 4ZYKA 1B88A 4EDXB 3QIUA 4JHWH 4W6WB 2OR8A 1DBAH 5FO9B 1EAPB 1FC2D 1RQ5A 3HNVL 2VXSL 4QRQA 3GJFK 1JN6B 1MVFA 3IFLH 3SJVE 3GIVB 4KGJA 4YFLI 3RDTB 2EE3A 3PDOB 3SGJA 1WAAF 4M5YH 1JYWA 2ITDA 2IANB 2YUZA 3GSRA 5DT1L 3K8LA 4Q9RH 3ZTJH 1LEGA 5GGTL 1T0MB 3QEHA 4H20L 1NUFA 2R0ZH 2YSSA 3VXSD 4G7YH 4LLDB 3AS2A 4XZUA 1AXTH 5GZNC 4U1KA 2DKUA 4V2CB 2PO6C 4MXVE 3RX7A 2X4UA 4UQ3B 2VDOH 3QUYA 1G0YR 2XACC 4WI3A 5JNYB 2ZUXA 2DQHL 1K6QH 5EUOB 1V7NH 4DVRH 1A8JH 3NMEA 3Q1SL 2DQJH 4LKXB 1MFDL 5DD6A 2E6PA 2Y5TA 3QZWG 1DEDA 4L9LC 4Y5XB 4LASH 4WI6A 3HAEH 4UNTA 2FBOJ 1JNNL 1K3ZA 1V3JA 3MQIA 5CSZB 2BDNL 4EUPA 4GS7B 1LK3H 4OI7A 3I2CL 2D0FA 2AXHA 4NP4L 4K94C 2H41A 2R29H 3BEWA 1JUFA 4U6YA 5SWSE 2YC1B 4MB3A 1MELA 1FRGL 1T7YA 3H9YA 3QT2A 3U6RA 4ZNEE 4MHHI 1EH9A 1O7SA 1D5IH 5GISL 1AGBA 4XRCB 2XWBB 2P48B 4HUWB 4P49A 4H5SB 2V17H 4UTAL 5D7IE 3QUZD 5ICYB 3DROB 3BP4B 4K7PH 1YC8A 5ERWB 3FRPA 3QUKB 5EIQA 2EH7L 3QQ9C 4Z18A 2GK0A 3MUGA 2P8PA 3HC3H 4WHDA 2RGSA 3B5TA 4L3CA 3DTXA 5F8RC 3STZA 3FKUS 1DLHB 2D7OA 1BFOB 3ULUE 3FFDB 2DLFL 4OLUL 1HQ4A 3PWPA 4XVJL 4DK3A 1ED3A 1T83A 4QRRB 5DD3L 2DQIH 1T2JA 3OAZK 3UDWC 5IVOA 2NY0C 5FFLA 4JFZL 2P8MA 4L29A 4AQ1B 4JPWL 1VCAA 4O2CA 5T5NF 4NNPH 2W9DH 3QQ9D 4ZTPL 4F3FB 5CILH 5C6TL 4PP2A 2NXYD 5KTEH 4GBXD 2F8VA 2CDFB 3IU4L 2X89D 4RAVB 1BIIB 4MA8H 2J3SA 2WBWB 5E5UB 3SDYL 4RX4A 4HS6B 4QY8B 3WSQL 3WD5H 4XHQA 1CI5A 1AGEA 1I8IA 3S3PA 2V2XA 5J6GA 4HIEB 1XGUB 1KC5H 3KPMA 1ZT4B 5CBEA 5HGBA 1RPQA 3QO0A 4FHBD 5E00B 1CD1B 5FYJE 1U8LA 3DLQR 3VI3F 1HQRB 2IJ0C 3PQYB 3QDGD 4KY1L 4MXWH 2AJ3B 3TJHC 1MHCB 4WW2A 1N59A 1EPFA 5JR1L 2E7LC 1U8PA 1TETH 1FDLL 3EFDH 1DBJH 2WLZA 1PZUB 1DFBL 2VLMD 5B3JF 5D72H 1HXMB 2KZ1B 5FCUL 3PV7A 1U92A 4LMQI 2D7QA 3E6FB 3UMTA 3ZKXC 3VD4A 3HC4L 5DFVC 1WWWX 2M2DA 2EDKA 1H3GA 4U1MA 3O0RH 5ISZA 1ETZB 1ZHKA 1PKQE 4Z6AT 1NFDA 3QNYB 1IT9H 5D7JB 3TJHD 1N7ML 1NUGA 3LKOB 3GBNL 2XPGB 4ODXB 1VACB 3V5HA 1KJMA 3IFPA 3HLAB 1AGDA 5GGVY 4AG4H 1P4IH 1G7HB 1CYGA 1AC6A 1KJ2A 2FIKA 3KPRD 5D93C 4G8FB 4I2XA 3OHXA 4LPYA 5E70A 2Y1VA 3ESUF 3MLVH 5DJCB 1VGKB 4WU5B 1NCDL 1UB5B 3B83A 5IWLC 3B9KC 2UWEA 5DFVD 1QA9A 3RNQA 1FVDA 3O9WC 4ZNCD 4FQHB 4ZO8A 2CMRH 2DI9A 2MNUA 1ZA6A 5IMKA 5BCAA 4DN3L 2XRAH 4DW2H 3ZE2E 4GO6B 2VXVL 5F3BA 4XP9L 4G8GB 5JUEH 3P9LA 4X6BA 5DJ8B 4EN3B 2Q7YB 4HWBH 1T5XB 2LABA 5F9DC 3SE9L 2JIXD 5I75C 4HIXL 2O5YH 4JZOA 5IFAH 5H2BA 3B9KD 4PBWD 5F9OL 1IGFH 1INEH 2DQCL 4HUVA 1XZ0A 3REVB 3O9WD 4LPVA 4EQ2A 2O61B 5F9JA 5E08H 3VH8B 2EIZB 3U0PA 3QDJA 2EICA 2CXKA 4HLJA 4NQSB 1NBZA 2YD8A 2FRGP 3GMNA 5CMAA 3H9SB 1QYGH 4HFWA 1F8TL 3L5XH 2CRMA 1Y0LA 4I3GA 1AO7B 5E8OB 1FO0L 2MPAH 3P3YA 1MAMH 2AKRA 4GRMA 4JFPB 1Y6KR 1YEHL 3GKZA 3SPVA 3G6DH 1W72B 4KI1A 4F7EB 1CG9A 2H1PL 3M1BA 2ZJSL 2JCCA 5DC0A 1AKJA 3WUWA 4M3JA 4JQVA 3TYFA 4MJIB 5ILTL 3C08H 5CCKH 1R3LB 4POZC 3UPAA 1C08A 1MSPA 4FFVC 4CDHA 3GM0A 3HI5L 2AXJA 3DXAD 5EIIA 4TUJB 3LN5B 3S4SG 1IGMH 5JDJA 4Z7OF 3F7VA 3OR7A 3UTSB 1U93B 1T0NA 2YRLA 4GFTB 1HDMA 4P9HL 2Y5EA 3BPOB 4YHZH 2OK0H 2YOCA 4NFCA 1K2DA 4G8EB 5C0CA 1P9MA 1MCWM 5DMKB 3IDIB 4QHMA 4POZD 4JG0L 3IF1A 1XEDA 4K9EL 3T4YB 2FLBT 5CHNB 4Y1AA 1P7HL 4OLVL 3U9UB 4LLUB 4YQXH 1B0GB 1XIWA 2EH8H 5BRZE 4RFNC 1KN4H 1RK0B 2X4NA 2DJSA 4UQ2A 4LSPL 4YDLC 1GL4B 3KYNA 5E9DE 2GSGB 1ODAA 3TA3B 2Y36L 5DHVB 2AJSL 2LVEA 3QG6B 5BO1H 5GGRY 1Y6MR 2FX9L 3QEQD 3EW3B 3QIUC 5D1XA 3T09A 4D2NA 5EUKB 1SMAA 4RMVA 3WFDH 3L3OB 4HKZB 5HYIA 4DKFH 3OKOB 4PJ5E 4OCWL 5FYKL 5MEOA 1HHHA 1HILB 1PQZA 2D7MA 1GC1L 3HI1A 2IQ9L 4HCRL 4I8DA 4XPFL 3BPLC 3QI9B 5BZWA 5E6YA 5EO0A 4F9LA 3CPLB 3MLTA 2VABB 1Z5LA 3SGJC 3VRJB 3FT4A 4QHKI 1KCUH 4NQCA 2OCFD 4LEXL 4KVNH 4RA0C 3S34H 4U33A 2A74A 3DGGA 1YY8B 4S0TD 1YMMA 4OSUL 2IBZX 2VOTA 5E8EB 2E9IA 2WIMA 3BKCH 4XB7A 3CFBA 5IOPB 1S7VB 4M6MH 2KDGA 3IGAA 1S7UB 4L4VA 3HCVB 2YK1H 4L4TB 1ZT1B 2Q8AH 5DR5H 5T1DL 1PGRB 2BVQB 5FCSH 3H9HB 2H32H 3EOAA 4D0DB 1PVHA 1Q0XL 3CJJA 4QTHB 2XN9A 1HOCA 4N0CC 2Y6SC 1DDHB 4ISVB 2BNRE 3BDXA 4P4KB 2FJGB 2X05A 4AM0A 1VFAA 1CXHA 2BVUA 3HG1E 5FUOL 4HJJL 3MA9H 3MRMB 4G8IB 4HX1A 4OLWL 4KRLB 5CINL 2WBKA 2P5WE 2CDGB 4ONGH 4RFEB 1YEJL 3T4AA 1IILE 1WT5A 5HVGB 4OGXH 4LSVL 4Y2OA 2XYCA 4R7NA 1WQVT 3HPJA 3IAGC 2SEBB 1MHEB 1EVUA 5IHBA 3TCLB 4N0CD 3JV6A 2Y6SD 2VE6A 4HS8H 1AFVL 4C83B 4OZHE 3OX8B 4ZFGH 1IKFL 2FWOB 3HZVA 4MQ7A 1ZEAH 4YO0B 5FO7A 3TVMA 3F12B 3PJSB 1CXLA 4UIMB 3X11A 2LTQB 3U4BH 5K9JL 4TNWK 4K3HA 2IANE 2AV7A 1HINH 3C8DA 5EN2A 5JORA 1Z9MA 4PGDA 5HYJA 1IAII 1A6UL 3B3IA 3FO9B 3QJHA 3O6MH 2GUOB 5JIKA 3H8NA 5LGJA 1I3GL 2X44D 3KYMA 1NBVL 3MRJB 1A1OA 5IB5A 1XCTA 4FQJL 3K80A 4AIZB 3N1QC 2V5RA 1NLDH 2I07B 5I17B 4AEHL 3MGOA 5FUCC 5EUOE 3VI4F 3P4NA 3ARTA 4ENEC 1UA6L 3DRTA 5IQ7L 3IDXL 5EU4B 3WFBL 4XP5H 2G9HB 2UZIH 2DD8H 4KI5E 4OIAA 4IRZH 4DOHB 1LEIA 3CLFL 3AY4C 5ETUA 1D5ZA 1AH1A 4NO5B 2P5EB 1TVHA 1R5IA 1UXSA 3BKYL 5CEZH 3BD3A 2W60B 2W65A 2FECL 5FGCB 3DHMA 4XPGH 1YNLH 1QQDA 4PRHA 3LS5H 3O3UN 4JZJA 2BSED 3SGDH 1A14H 4LSTH 1GGBL 4FQXC 3LSOB 4QT5A 3SOBL 1A7OH 4OUOA 3SCMC 3GSNH 1YEIH 4HBCH 4IRSB 3CZJA 1PX4A 3UTTB 1RUML 3Q6FB 4WGWB 4ZSOE 4KU1A 4PRIA 3TN0D 3O4LB 5FYKE 2XQYK 1ZGLA 2W0FB 4OF6A 3D2UA 2F15A 1IGIL 1A3LL 4ZFOB 1AQKL 1AP2A 3FO0L 4APQB 2GSIA 1EZVX 4ZDHA 1CDHA 5FECB 3IKCA 4FQXD 1IAOB 3OBAA 1XGTA 2VZ1A 2DYPD 1ZA3B 4LCWB 3SCMD 5F88A 2WV3A 4XBGA 1ND0A 4DQOL 5J9PB 2IEPA 4Z7UA 4HJGB 4LEOB 1BM3H 3JUYA 1EXUB 4KTDH 3PNWB 1CE6B 2YEZB 5C0BD 3C9NA 4R4BA 5IW6B 1A6ZB 4FOMA 5F71A 2AK4B 2EDDA 2F54B 4RGNE 1ADQL 3TH4T 4GMTL 4ACPA 1FG2B 4I18B 1EHNA 5JHDD 4F7CA 5EPMB 1HSBB 5F7LB 3U7WL 2VLKD 1UEMA 5A2LH 1JPTH 1LD9B 2YZ1A 5C9KA 5BQ7B 1BREA 1I1YA 4EKXA 2J8HA 4QOKD 1VFBB 5BS0A 1KT2A 1HHJA 4O2EA 5EZIL 3PQYE 2Z31B 3Q2CA 3PGDA 3MO1B 3KXFA 2HFEA 1F4HA 4J3WA 3ARUA 2DAVA 5GRWA 3DV6A 2Z8WC 4PJGB 3DX9B 3CX2A 3EDKA 2IQAA 4TUKH 4N9GB 1MRFH 3ZL4L 3MXWH 4FFZL 5J6HA 4OFPA 5IK3B 3ZKSD 4R0LB 3GEWB 4AT6A 3PL6C 1WLHA 4GQ9H 4U1JB 4LHUG 4MDJB 2AERT 2R1XB 1UH3A 5FO8B 2W0LA 2V9TA 1PY9A 5A43C 3S37X 2KUTA 3MV7B 4JQVC 2OZ4A 3O2DH 2GTWB 4DCQA 1CZ8H 1E28B 2NR6D 3OJDB 5F6IB 4KRPD 1KCRL 3MLRL 1J12A 1U0QA 1C5CH 3E8UL 3LS4L 2W9LA 1X5HA 3VXMA 3PL6D 3GMPA 3P0YL 4WEBH 4ZUTA 3MV11 5LXGH 1CFNA 5E1AB 2X10A 1AKJD 4OZGB 4OT1H 5EBLA 4TTGA 1A7QL 1ACYL 3CAFA 1BAFL 1P7QB 3KPSE 5GGRA 1EBAA 4G8GE 1N2RA 2F19L 5D9SB 2V5YA 3HI6L 3L3JA 1BBJB 2DIAA 2BOCB 1FQ9C 4WI2A 4KXZH 4PV9B 4G3YH 1R5VB 2HT2C 3BESR 5HY9B 1GRWA 5C70A 2R8SL 2D7PA 3MRGA 3MRKB 5A16A 4JHWL 1DBAL 1JNHB 4QHNA 5HI5C 5FK9B 3CSGA 5JIPA 3IFLL 1E6OH 2AJXH 4P2OB 3JV0A 5L7XH 4M5YL 6FABH 5ADPH 1A22B 4R7DB 1QEWB 3F5WB 1HI6A 4LFHG 3SBWA 3GSQA 3LDBC 1ZGLP 4Q9RL 3BUYB 2HT2D 1KIPB 4HMEA 4C57C 5EC1B 1KELH 2R0ZL 2HH0H 5CWSA 4P4RB 4G7YL 4F9LC 4YPJA 1OTSC 3UPRB 2XZCH 1AXTL 4H26A 5HI5D 2EIEA 3IDNA 2Y7QB 4Y5VC 5GS0C 4UOW0 3LRSA 3P77B 4NCDA 1QG3A 2XA8H 4P0DA 5GIRA 2HFFA 2VDOL 5D6CA 1JK8A 3QXDB 1NJ9B 1I1CA 1K6QL 5DXWA 1XH3A 4PY7B 3UTSE 1V7NL 2R0KH 4DVRL 2GQHA 2DQJL 2JJWA 3VXOB 4P2QE 3N85H 4QNPF 1BJMA 4GAYB 2XY2A 4Y16B 3SO3C 1BBDH 2VR4A 3RVXD 3V5KB 2BSTB 4LASL 2OSLB 3AXLA 5EC2A 4XCNA 1NFDF 1R3HA 5C3LD 4KDTC 3RBGA 1Y18B 1SYSB 3JWDC 5DYOA 4IIQC 5E03A 3GZKA 3VW3H 3EJZD 4RZCA 1LK3L 3Q5OA 3OG4B 3S8WA 1G9MC 3T1WA 2X70A 3VD9A 4G9DB 1S7SB 1CXEA 1Q94A 3LPGA 5FA4A 3DO7A 3M17A 4XP6H 2RCSH 1T3FA 2R29L 5JQ6H 3QIBD 3SDAD 2HKHH 2UWEF 2ESVA 3MUZ1 3IXTB 5D1ZA 1WT5C 1E4XH 2F5BH 5BV7C 1J7VR 2H8PB 1D5IL 4UMGA 5B38A 3L3DB 3D39B 1TENA 4C4KO 2RHEA 2YPKA 3QUXA 4K7PL 3MROB 5JW5A 5D7LD 1CWVA 2CUMA 1CBVH 1F3DH 5EU5B 3GRWH 3TVMC 3HC3L 4OD3H 3TBVB 1FYTD 2BVOA 5GGSB 4JKWA 3GFUA 1UM6H 4E41A 4XNYH 3MNVB 2DQIL 2F74B 3QQ4A 3HZMA 1FFNA 1OSPH 2OBGA 4TVPH 5CD5C 2YA2A 1E4XI 1RK1A 4HH9A 3TBTA 4NNPL 2W9DL 4HGKC 5CILL 4JFDD 1YYLH 4JFOB 3FT2A 5KTEL 2VRAA 2FCBA 3KAAA 2JCCF 5DDHB 4MA8L 4NOFA 3U1SH 3WD5L 1CGWA 4UB0H 4U0RB 4Q9CA 1KC5L 3CFKB 1M05B 3MNZA 1Z3GH 1J8HE 3U7AA 1U8HB 4OKVB 5EIVA 4XNMB 4ZO9A 2AXFB 4FMKA 5CD5D 4MXWL 1JGDB 1G7MB 5CJQH 1MI5D 4LCIH 1H9VA 5HHOB 3U48A 1TETL 3MRLA 3FQWB 3X3FH 2JJSA 5JPNA 3EFDL 1DBJL 3BIKA 4JZJC 4ZPTB 1AXIB 5D72L 5J13B 3ZYOA 1BFVH 1TCMA 1Z6JT 4UU9B 4JLRB 4P2RE 3QFJB 2QR0A 3O0RL 1R3JA 3CX5J 5HHXH 1QSVA 1P4LB 1IT9L 2PXYB 1UB6B 3RIFK 32C2A 3BXNB 1ORQB 1WWCA 4BUHA 3GJEA 5F9AC 1LO2H 4AG4L 1UQSB 1P4IL 4J6RH 4YEFA 2DN7A 5I1IH 4G5ZH 3BKMH 3MLVL 4F15B 4J1UA 4U3XA 2A6IA 2AQ2A 3QDMD 3PWJB 1QFOA 3RWIA 1KJ3H 3S36H 1ZKAA 1MFBH 2BVEA 1D5BA 3V6ZB 2CMRL 2IAMC 3O8XC 4DW2L 2XRAL 3ARZA 2R0WH 2VQ1B 2HG5B 1UKTA 5JUEL 5IFHH 4NOBA 2CLRA 1WC7A 3PWLA 4X8JB 3IFNH 4HWBL 4X5WA 5DWUH 5FDWB 5GGUB 2NW3A 1BZ7A 2GJ6A 3K46A 2V2TB 2MTPA 2O5YL 3VXTA 5IFAL 1JRHH 3D0VB 4PTUB 3EYFA 1IGFL 1INEL 5HHPB 5ECJE 4G9FA 3BMWA 5SWZB 3RWGA 5KVFH 3HMXH 2IAMD 5E08L 3O8XD 4JKPH 4BH8B 4GRLC 2B0SH 2ZNWA 4W6YB 3V0WH 3LOWA 1QYGL 4BQ6A 3L5XL 1EGJA 3JTTB 2WLYA 3RUGA 2ICWB 2MPAL 1MAML 4FABH 3PHQA 3UBXB 4PJ9A 3UTTE 4O4YH 5L2KA 3G6DL 1H0DA 4GUPB 4YHPB 3FONB 2X09A 2WQRA 5I76B 5EU3A 5CCKL 4F7PB 5DURB 3MRHB 5E2TH 4Q9QH 3QCVH 4GRLD 1S8DB 2NX5A 5IMOA 1BFTA 1FL3B 4GXVH 3BWAA 1IGML 1XT5A 1L6ZA 3EBAA 2J1KA 4H1LB 4PTTB 3TBWA 4C55A 4W4OA 4ZTOH 2LE9A 4YHZL 1F90H 2QQKH 3IT8D 1JF1A 1DZBA 3PDOA 2OK0L 3WO4C 1WV7T 5TDOA 1PJ9A 3L3HA 4LMQE 2X1WL 1IZJA 4KKAC 2F54E 4ZODA 4K23H 4Z76A 4YQXL 1JFQH 3VG0H 5E8DH 2EH8L 2A2QT 4ZQKA 5CSGA 1R3KB 4YBLC 1KN4L 1K4CB 5J1AB 1OSZA 5HHNA 2E9WA 4OLZH 2ICWJ 1H3PH 4MA3B 2A6DB 1YJDH 4CVXA 3O11B 1XF2A 4W68A 3WE6A 4LKCA 4EI6B 3T0AA 5BO1L 2BNQB 2NY3B 4OFIA 1Z0NA 3V0VB 4J3VA 3VXMD 3WFDL 4KKAD 1KCVH 3DMMB 1UH2A 4DKFL 3MRRB 4OIIH 3PG2A 4MJ5B 2BSSB 4IM8A 4IRJC 4JPVH 3GMRA 2V9RA 1UYWH 4DZBA 1CTOA 3UJJH 2P24B 4PJDB 3FFCD 4XAKD 1KCUL 3VFOA 1BQHB 2I24N 3SBWC 1MWAA 4KVNL 1R5WA 1IM9A 3S34L 2Z93A 3MRIB 3CUPB 5TH2A 4XBPB 2V5MA 2OL3H 1BF2A 3BKCL 3S3SA 3MV7E 4M6ML 1NMCB 2EDTA 1MFAH 3BP5B 3JWNC 2YK1L 2X4QA 3KNBA 2Q8AL 3D69A 5DR5L 2QSQA 3AS1A 3QWOB 2ED7A 4IRJD 4QF1B 2EDHA 4XVUD 3K2UL 3VE0A 4BFIA 2CIIA 2E3VA 4POYA 3IDMB 3CH1B 4WI5A 3MACH 3MZGB 2BVPA 5MHSE 3CVHH 5IFJA 3D25B 3ARBA 3OXRA 3C5JB 3VWJA 3K3QA 4KJYA 1IFHH 5LWYH 4XGZB 3CXDH 1IAIL 4HH8A 4N90E 2VWEC 3MA9L 5E94B 3BGMA 4ONGL 4Z7UF 4K3DH 3T0EB 1YPZB 5C0JB 3UBXG 1WTLA 2Z8SA 4OGXL 4OFKA 3C5ZB 3W9EB 4M6NH 3TO4C 1AXSB 1UM5H 2R2HB 1KEMH 4HV8A 3BW9B 1DL7H 1TJGH 2VAAB 3CDYA 4GG8B 4HS8L 5IEHB 4N5EC 1NBYB 2P7TA 3H7LA 3S4SA 4ZFGL 5GS2D 3UTQB 1JCKA 2HLAA 1FL6B 4RAVA 5FUZH 1ZEAL 1J8KA 1UENA 3QDHA 4LHJB 3WL9A 1EHLH 2DQTH 4OGZA 4E0RB 4LLAA 3U4BL 6CGTA 3I02A 4HC1H 1HINL 3WDJA 3HZKB 4HEME 5E00A 2CKNA 5IBLC 2Q86B 2D31A 4X6FB 2M26A 5K93A 4CNIB 3TO4D 4OZIE 1GZPB 3O6ML 1HYRC 3ROLA 4TUOB 4LAQH 3ARFB 1JWSB 4GRWF 4N5ED 2EC9U 2NXZB 3MLYH 4LBEA 2PUQT 5INDB 4M9PA 5AG8A 1SJEB 1NLDL 5JOEA 5ITFA 1RMFH 4I13B 4HDIA 4XP5L 2UZIL 4LLYB 4OUUA 5D6DA 5ABDE 2DD8L 4M7LT 4X6EB 1VEPA 5IVNA 4IRZL 2H6PA 2H3NA 4ZXBD 4MWFB 3OKLB 3FN0H 2LAAA 3NVQA 5CEZL 1FE8H 3T1FB 1KCKA 1NEUA 4XPGL 1YNLL 3NIGF 3SKJH 5L8KB 3O3BB 3ZMRA 1AD0B 3LS5L 4M1DH 1QUNA 3QIWA 4U1SB 1A14L 4LSTL 3VRIB 2CPCA 5C8JA 2DBLH 2D9CA 1YDPA 1KLFA 3RVTC 1A7OL 1KLUB 3GSNL 1A2YB 5A2IH 1YEIL 4FRWA 4HBCL 1BQHG 2AS5M 4D9RE 3F65A 4YXLH 1BD2A 4BUGA 3ES6B 2AQ1A 3D39E 5I1HH 3GSOA 2B8OT 4PJXE 3RWCB 4I48B 1BIHA 4JDTH 4YFDB 3MRFB 1CXFA 4EXPX 2ZG3A 5IR1A 3ZDZF 5DEFB 5F9WB 5D4QA 3RVTD 4LVHB 3TIEA 2NY2B 1U8MA 4F2MB 2XNAB 5DJZA 4JM2D 3RWEB 3VGFA 2MJWA 5K9KA 3RWFB 1DE4B 2ENSA 1AO7A 3VFNA 1A3RH 1BM3L 4KTDL 1FJ1B 4OM1H 3DYPA 4NCC1 3D3VA 3LN9A 5BRZD 3BDYH 1ONQA 2IALB 4YHYB 1AC0A 3TNMB 3H7BA 4JFEE 4OB5H 3CGTA 3WLBA 5FGBA 2XTJE 5E9DD 4L3EB 3P11H 3P4MB 3HMWH 3DWTA 2ZSVA 1I1AB 3PXHA 3FQNA 2OLDA 2VISA 1KYOK 2ZOLA 4ZD3H 1JPTL 3VMOA 5I1JH 4HWZA 3G04B 4F37K 4GMSH 3VXUE 1S5HB 2LV4A 5C1MB 1OAYH 5F7EH 5T1KB 2D03H 4GXUM 1JP5A 1N3NB 4YDKL 4NQEB 4EEEA 2WAHA 3UEZA 1W2KT 4WO4B 1T22B 1UZ8A 2CRYA 4Q6IB 1CICA 1QP1A 5DUPH 4K7FA 4YIQB 4TUKL 3ARED 5DVKA 1MRFL 4JDVA 4KTYA 4V1DD 3MXWL 1FC1A 4CAGA 2ZOKB 3QRFM 4GQ9L 3DUSB 4ZAKD 5F72S 2JJTA 5C08D 2AJYH 2BSRA 1XR9A 2HN7A 1NFIB 1RIHH 2GSGA 3QXWA 2RFXB 5DVNA 3O2DL 4JREB 3NACH 4LPTA 3QCTH 1CZ8L 3JV5A 3S98A 4GW5A 2BXYA 1D5MB 1TDQA 2X1QA 3H2WA 2JB5H 3OKOA 3PXJA 4GAGH 2A6KB 2BNRD 4XXDB 1C5CL 4CRPA 1QACA 4KROB 2R1YB 3AM8A 1HKFA 4WEBL 1IAKA 3CFJA 5LXGL 3RDTC 2VABA 3SKNA 4YDJA 1I1FB 2P5WD 3MBEB 4OT1L 5J7CC 2B4CC 1OAQH 3NA4A 2G75B 5ADOH 5MENE 2AAVA 4MAYB 5F3HB 2KQMA 2E9BA 3OXSB 3V4PH 3K2MC 4XMPH 3Q5YA 5CEZE 1N5AB 4G3YL 5IB1A 1EAJA 4Y2DB 5DRNA 5IMLA 5D5ME 3QWRA 3I6GA 3QNZB 2VZUA 1S9WB 4F57H 4QXTA 4XVSH 3LQZA 4FQIH 2UYLB 3RDTD 5IIEA 4HQQH 4WTWA 1NC4B 5TQ0H 2DQEH 2EDBA 4P5MB 3I6KA 1E6OL 2AJXL 3FZUC 1CGSH 5D96C 4YAQB 3FB7A 5DJDB 3MR9A 1MQKH 5L7XL 3BQUB 4NRZB 4Z0XB 3NH7H 6FABL 3RHWF 5ADPL 4Y5XC 4EDWH 4P4KA 1I4FB 1PSKH 3H0TB 1QFHA 4HMCA 2WBJB 1T04A 5C07B 4YHOH 4E42A 5DQJB 1KELL 2JKXA 2HH0L 3U36A 5FKPB 4PBVC 4G6FD 1VPOH 2XZCL 2BERA 2NLJB 4M93B 4JFYA 1FP5A 4N0FB 5EU6B 3U79A 4BKLA 4L8DA 2YHGA 2XA8L 3FZUD 5E6ZA 1RJYB 3FQTA 4R4ND 4NKOB 4LQFH 1PY4A 1GH7A 3VFUA 4HW6A 1OT2A 1HHGB 1LNUB 2AXGA 4C83A 2R0KL 4FZEH 2EEDA 2N1KA 2O5ZH 1OTTD 1MIMH 3G5VB 5SWQA 3N85L 1BBDL 5JO5A 1HE7A 3TP4A 5HJ3B 2OTWB 3GSVB 3MGTA 1U3YA 4OZFH 3BX7C 5DJYB 4X4YA 1NAMH 3VGGA 2R2CA 5F6HJ 3GHEH 4WFFD 4LSRH 3ARBC 3VW3L 4LCYA 3FO9A 2H9GB 1VADB 4YNYB 2GUOA 2DJ4A 4LLWA 5IGXH 4TSBH 1IGTB 1IAIM 1EO5A 4XP6L 2RCSL 3WFZA 2X4OB 3AU1B 4LHUA 5JQ6L 5D2NB 3RWJA 4YGVA 2V7HB 2FIRT 5GSRA 2HKHL 2HT4C 5C09B 5FYKD 4BSWA 4U0QB 1E4XL 2F5BL 2BNQE 4FTVA 4PJHA 5MEPA 4JQXA 3BZ4B 4N8VB 2K7QA 4C54A 5F1SA 5DRXA 5C0AB 4WHCA 4ONHB 1SEBA 4TNVK 5IVXE 1U42A 3IJSB 1KLGA 3NIDE 3IVKB 2VH5H 4GG6A 2W60A 5TE4H 1CBVL 3GRWL 4FQLH 4OD3L 1JZ7A 5DMYA 1QRNA 3BOVA 2IH1B 2HT4D 4QRRD 4Y19B 1XGRA 2GHWB 1B0RA 5BOPA 5KSVA 1UM6L 3HR5B 5ACZA 3IDJB 4XNYL 1A4KB 5F7DA 4MNQE 1OSPL 1X6LA 3RUGF 4TVPL 3FB8A 4GW4A 3CFDA 5IB4A 3Q6FA 2PO6B 4MQTB 2CK0H 1T89A 1TPXB 1YYLL 3CVHB 4WV1A 1A6AA 1CFSB 3KJ4C 3U1SL 3EFFB 3ULVF 5F89B 4APQA 1XF3B 5I1AB 1SYVA 1CTNA 4UB0L 3WNPA 3SE8H 2FGWH 4ELMA 3PQYD 1U8KA 2IPKA 1QSFB 5D7JC 5IUSA 4UILH 1T1XB 1Z3GL 4L9LB 1M7DB 1JMZA 1PFCA 2A77H 3REWA 2DQGH 4WFEE 1QLRA 5FIEA 3EJYC 3UJTH 5T3XE 2CRIA 2XY1A 5CJQL 5HI4C 3MV8B 1T7WA 2V2WA 4I3SH 2YKLH 3T0EE 3AS0A 3X3FL 5K59F 1CE6A 4ORGA 5CKAA 1R24A 3QUMB 4O02H 2R4SH 1A6VH 3B6SB 1BFVL 3GO1H 3OKMA 1TZIB 1X5KA 1FG2A 2J6EA 1F97A 1LDSA 4M7ZB 4KKCC 2BY0A 2H26B 2I9LB 4PJ7E 5D7JD 1YQVH 4J3TA 3X14B 1JJUA 3C09C 1QKZH 2OTPA 2HWZH 5CSBA 3PGFH 1IEBA 2WIIA 4HUNB 4JO1H 4KZEH 5FOBA 5HI4D 43C9A 1FLTX 3U82B 1WIOA 3VA2C 2C1PA 4N68A 1G6RH 3HPLA 1LO2L 1H3TA 1VFBA 5DFTA 3FO1A 4HULB 2NPLX 1EEUA 1GOGA 3OAYH 4J6RL 5KVEH 5J1SC 4NJ9H 5I1IL 4G5ZL 3BKML 5ANMB 1SMOA 4X6CA 1CS6A 1FZJA 5E8PB 3S36L 3D6GA 1KJ3L 4MVBC 5I8OH 1MFBL 1D5XA 2PCPA 5GPRA 4G8GD 1NGXA 4CW1B 2R0WL 4BQCA 4EN3D 5ICZA 3H3PH 1A02N 2XXCB 1T1ZA 4UINL 3O6LH 4I3RH 2J8UA 4FQ1H 3RY6A 4EBQH 3JTSA 5IFHL 2NY0B 1KPVB 3GI8H 3S3JA 3IFNL 5DWUL 4NM8H 5FGBC 1AD9A 1G0XA 1A1NB 5TGBB 4L8BB 4NUGH 1JRHL 4GW1A 4MVBD 1UXWA 4PRPA 3H9SD 4BQBA 5KVFL 2LU4A 4H0IA 1WFUA 3HMXL 1AO7D 4JKPL 2B0SL 1UWGH 3V0WL 2Q6WB 5E6IA 1EIBA 1DN0B 2ATPA 4LF3B 5JZ7C 2XICA 1NGQH 2GJZA 4LPCA 4LPXA 1YNKH 1JWUB 4Y4KA 5HHVH 4FABL 1V5JA 4WVRA 4LRNH 4O4YL 4PJIA 3ZKQD 4X7TB 4MJID 4IHOA 1E4WH 1INQA 1P7QA 4GKZA 4F7TA 3MCLH 5E2TL 4Q9QL 3QCVL 1DUYA 3RPKA 1T7ZA 5CS7A 3SJVA 3UTSD 3ZKXB 4GXVL 5JZ7D 1M7IB 4HIJA 1RJCA 1MY7A 1FYHB 4MZ2A 4L8CB 2EEBA 4WTXA 2NY6B 4YHIB 5BJTA 1CDYA 2A38A 3RNKA 4ZTOL 4HGMA 5IM7B 1F90L 1U8QA 2D2OA 2QQKL 4TVPE 5FF6B 4NYLA 1J18A 5D93B 4FQQB 4ODSH 1G9EA 3DUHA 3VFMA 3DURB 3QI9C 3AM8C 4K23L 1IGYB 1JFQL 4F33A 3CH8A 3VG0L 4J4PD 4JO3H 4PFEA 5E8DL 1MJJB 2MSPA 4RDQF 4D9QE 3MSPA 3TA3D 3PWUA 3VGAB 4JGMA 2WW8A 1EA9C 4AMKH 4X9GA 2B39A 4OLZL 2XG4A 4J3UA 1VFMA 3LEYH 1H3PL 1YJDL 2YXFA 1CFTB 5HGHA 4D9LH 4MDIB 1RHHB 2DLEA 4Y4FA 3D87B 1ZV5A 3LAFA 5I75B 4DGVH 1KIQA 3W81A 3QI9D 4X5XB 1KCVL 2MHAB 4RAUA 2VLJE 1B2WH 2Q76A 4NC1E 4OIIL 3MYJA 3C6LA 3PGCB 3OGCA 2DM4A 2FO4B 3ZYJA 4JPVL 3LB6C 2YS4A 1L9MA 5E4IA 3WNKA 1UYWL 1J0YA 3QRGH 3UJJL 2AEWA 4P4KC 1S7SA 2EDWA 1F6AB 5I2IB 4ZNEA 2RB8A 3QWRD 4L4TD 2OL3L 2B7DT 5DK2B 4NRXB 3V4UH 4P23B 1LP9E 4QCIA 5D7IA 5EO1A 1MFAL 1F02I 4L8SB 4OD1H 4WUUB 3G5YA 2XZQH 2X1OA 2YN5A 3LB6D 3L95A 3EZJB 4PRAB 3WHXA 5GS0H 4ZOEA 2WINA 3EDDA 3CIQA 3MACL 4OGYH 4P46A 5F1OB 4P4KD 4E9LA 3ORJA 3CVHL 1EEZB 4QYOB 4D3CH 1IC4H 1P2CB 3G9VA 5I8EA 4DVBB 5KANI 2LTQC 3OR6B 3D9AH 5LWYL 1BOGA 1IFHL 3NIFF 4MNGA 3RL1B 3CXDL 1UWEH 4MD4A 4WTZG 5HGAB 3OB0H 1S7XB 4MCYB 1QBAA 3QEQB 4WI7A 3VXRE 2R9HD 4OV5B 4NQDA 4K3DL 3DBXB 3MRQA 3D85B 4GKNA 3JWDH 1U2HA 1U8IB 5ESAB 4M6NL 3JWOH 3QUML 1YN6A 4RFNB 1G9MH 1KEML 1DL7L 1TJGL 4LPWA 4K94L 4M61B 2AABH 1CFQA 1RZ8B 1F4YH 5FUZL 1HH9A 3BEVB 4Z7VB 1EHLL 2X4RB 5C0DA 2DQTL 1HK6A 4KK8D 4ZYKB 3QIUB 3SDDA 4HC1L 5BV7H 3CFKA 4OKVA 4B50A 4QRQB 1CD9B 3TYGH 2YA1A 3BPLB 5HHOA 4YZFF 4LAQL 1FNEA 1KGCE 3MLYL 4KJQD 4D0BA 2J88H 1V3MA 2ITDB 3GSRB 3VDBA 1LEGB 1OAKH 1PKQA 5E7FA 3FJTA 3QEHB 5GGTA 2YSSB 4CJ1A 2OJEA 3LEXA 1H8SA 1RMFL 2VB5A 4UU9A 4XZUB 2P5ED 3QFJA 3MODH 5FHAH 3O81A 4JGUA 4U1KB 4Y88A 1B4RA 4M1CC 4Q6YA 5EO9A 5FOJA 2X4UB 3V6OE 1IC7H 1T7XA 2GIYA 3M45A 2X4TA 3QUYB 4M7LH 4GKSA 4Q9BA 4OFYD 4UOJA 3RWDA 4OCSH 1FE8L 4APQC 1UQSA 3W0WE 3VI3E 5GS1A 2UUDH 3OKYA 3SKJL 5DD6B 2Y5TB 4ZO6A 4M1DL 3GJFA 1IM3A 4IRSD 1TTFA 2DBLL 3UTTD 5D2NE 4WDIA 5B3JE 2FBJH 5EBMA 5C09E 2WK2A 3O4LD 5I66A 1JF6A 4X0KA 5H8DA 4YXLL 4EUPB 3U7YH 1ZT7A 5JA9A 5I1HL 4APQD 3BHBB 3PV6A 5L2JA 4X4XA 3BEWB 3VXSE 1JUFB 2C3VA 4JDTL 2ENYA 4U6YB 4NJAH 4I0CC 4LCWD 4LFHD 4GAJH 3U6RB 1G7JA 2RR3A 1N6UA 3D0VA 2VDLH 3MJ6A 5CJXA 1NBQA 1AGBB 2J2ZA 1KUMA 2R2EA 2QKIA 1IC5H 4Z78A 4OLEA 1NCUA 4U6HA 3MC0A 2AK4D 3ARRA 1A3RL 2F54D 4P57A 3FRUA 2GK0B 2XTLA 3O6FA 4OM1L 3MUGB 2P8PB 3BDYL 3BO8A 4L3CB 3DTXB 2YWZA 1TVDA 4O51A 1DQTA 3STZB 3INUH 4OB5L 3RVWD 3FTGA 1ZWIB 3MJ7A 1HQ4B 3NPSC 3PWPB 1DANU 3P11L 2QL1A 1ED3B 3HMWL 3RY6C 4N0YH 1CLCA 1WCQA 1T2XA 4R0LC 4ZUVA 3UX9B 3VFVA 5I6XC 5A2JH 2Y72A 4ZD3L 4S1DD 5I1JL 2P8MB 4L29B 2Z31D 1QSFE 3CDCA 4O2CB 2CLVA 2QLVB 5C2UB 3E3QC 3KPPA 3NFPA 2NCMA 1T7VA 4GMSL 1HEZA 4PP2B 3NFSH 1ES0A 1OAYL 5F7EL 2D03L 4KKLC 2EE6A 2HAZA 4U3HA 2EEAA 1AGEB 1I8IB 3STLA 5E6IC 5DUPL 2V2XB 5J6GB 4G6AC 1LO5A 3KPMB 4UUJA 1G9NC 4R97C 5HGBB 5CBEB 5I15H 3QO0B 4XPTH 4Y4KC 1PAMA 1U8LB 2A9NH 3MV7D 1R3KA 4WW2B 2ATKA 1N59B 1U8PB 1OL0A 5IB3A 2AJYL 3KS0H 2YA0A 4GRWH 3HC0A 1RIHL 3LKSB 1SVZA 4KKLD 2HVJA 3HZYA 4Z7OE 3NACL 4HUXA 4RGMB 1E6JH 2IPUK 3QCTL 2QHLA 4U3CA 5MHSD 4PJHF 1M6OA 1J0KA 1CL7H 4G6AD 3V2AR 2JB5L 3BGAA 5ANME 2VXUH 4U1MB 4GAGL 5ISZB 4Y4KD 1CCZA 1ZHKB 1NFDB 4LCCA 1P69B 1P7QD 4GG6F 1KJMB 3IFPB 3JVGC 1AGDB 1KBGH 3NCYP 4OCNC 3ARSA 1KJ2B 2FIKB 1OAQL 3CFCH 4OM0H 4I2XB 5ADOL 3OHXB 3K1DA 4OD2A 4G80B 1HH6A 4IOFC 1X5GA 1N64H 3V4PL 4XMPL 3O4OB 4P48A 3QJFA 4U6TA 1QA9B 3RNQB 2DMCA 3DI3B 2IBBA 1NGYA 1DQMH 1OGAA 1FVDB 5IMKB 4F57L 4LLQA 4WW1B 1IARB 2Q3AA 3K1KC 4XVSL 2HLFC 2DMKA 4P2OD 2NY4B 1IJ9A 3G08A 4FQIL 4NIKB 1X5ZA 5F3BB 1CL7I 4HQQL 1KPRA 3P9LB 3VFGH 4X6BB 5TQ0L 2DQEL 1ITCA 4RWHA 4AIOA 3QYCA 1CGSL 4R96A 2GITA 1RULH 1I9IH 1MQKL 4JFHD 2VLRA 2YBRA 4EDWL 1QLFA 1JTTA 1PSKL 4JZOB 2KKQA 5H2BB 4ELMF 3WHE1 4BELD 1XZ0B 4YHOL 3KLHC 4X6DE 3KR3H 3U0PB 1M71B 1N4XH 3QDJB 4PLJC 4YE4H 5FYKU 1VPOL 2P45B 1NBZB 2C7UA 3GMNB 5CMAB 3KPRE 4HFWB 1YPZA 1CIDA 1Y0LB 3H42H 3NAAH 4OZHA 1KJVA 2DM2A 5DMGC 4Y89A 5C9JA 4UZGA 5EZJA 2AKRB 4GRMB 3SPVB 4LQFL 3U4EA 1PG7H 4Y16D 3BW9A 1TCRA 2VAAA 4ZUUB 2ZCHH 1CG9B 3M1BB 2FYYB 2VZOA 4FZEL 2JCCB 1AKJB 2VTFA 3WUWB 2O5ZL 1MIML 3TYFB 3OKNA 3KLHD 1C08B 4PLJD 1W0WB 2IGFH 4ODHH 3VFRA 5EIIB 4P46C 4QTIH 1VFOA 1NAML 1C5DA 3RVUD 3GHEL 5DMGD 4LSRL 1F13A 3F7VB 3OR7B 2X2YA 4KJPD 1T0NB 5D8JH 3EO1A 1HDMB 5IGXL 4HK3N 3U4AA 4TSBL 3NCJH 3V7MA 4D9RD 4X6CF 1K2DB 1Q9LA 5C0CB 5INDA 4RBPH 5DT1H 2I26N 4QHMB 3D39D 4RMWA 4WCYH 5GS2H 3PWVA 3IF1B 3ILPA 4Y1AB 5JPMA 4C58B 1XIWB 2Y23A 2J8UF 1S3KH 5JW4M 4NKQB 4JPKH 5IB2A 5J06A 2X4NB 5T1LA 3G5XA 4AEFA 4OBSA 4RCAA 2DRUA 4UQ2B 3OKLA 3A67H 3KYNB 2FD6H 1MQ8A 4NNXA 2VH5L 4M7KH 5TE4L 1MCOH 5E8NB 4FQLL 4PJCA 3DXAE 5LGHH 1ZLVH 3TH3T 1TQBB 5D1XB 5IESH 3SHSA 4QHUA 2Q8BH 3QHZH 1NC2A 4ZSOA 4RMSA 1WEJH 3LDBB 5MEOB 2APFA 1X5AA 1HHHB 2ZNXA 1PQZB 3HI1B 5D2LE 1J86A 1A2YA 5BZWB 3LKPA 2B20A 2VDQH 4P3CH 2E7HA 1Z5LB 3VI4E 3ZSTA 4OZGF 3FT4B 4PJIF 4NQCB 2CK0L 5J13C 4Z7WA 2A74B 3F6LA 3DGGB 1YMMB 1TVBA 4CVWA 3IJYA 3GB7A 5FM5M 3WS6A 1FRGH 3CSBA 3CFBB 4CGTA 3IGAB 1BVKB 3T2PA 3SE8L 2FGWL 4L4VB 4EZMA 4MXQC 5DEFA 3WKMH 5KAQG 4UILL 3SO3B 1S7QB 5HHOD 4NHCH 2A77L 1RJZA 3BJLA 3OAYK 2DQGL 1SEQH 3MRNA 4YHKH 3UJTL 3EOAB 3QEQE 1I8KA 4MD5A 1P7KA 1RUPH 4I3SL 3FO2A 2YKLL 2XN9B 1EUUA 1HOCB 2G2RA 1KN2H 4O02L 4YEEA 2R4SL 4I4WA 3TCXA 4PGBA 1KYOJ 4LSDA 1A6VL 4AM0B 3QFJD 4UT6H 3TNMA 3GO1L 3PP4H 5K33A 4HX1B 5DS8A 1P84K 1VGEH 2PXYD 4IDJH 1YQVL 1JPFA 3T4AB 3LD8B 4N8CH 1QKZL 2Z35A 2HWZL 3PGFL 5DGRA 4JO1L 4R7NB 2IF7A 4KZEL 3MTRA 3HPJB 1X7QA 2CUHA 2EYSA 3WUWG 1AR2A 1G6RL 3G04A 3JV6B 1S5HA 2VE6B 4R6UA 4IBLT 1WCBA 3HZVB 4NJ9L 4NQEA 4MQ7B 5FO7B 1D6EA 3QPXH 2HJKA 3TVMB 1T6VN 1EDQA 2X42A 1T22A 3LKQA 5IG7A 5IJKA 2FHFA 3X11B 5I8OL 4HK3J 5CJ5A 3VA6A 4YIQA 4U49A 2AV7B 3QPQD 5MEQA 3CXHK 3MPCA 5EN2B 5JORB 4JAMA 3HNSH 4PGDB 3H3PL 5HYJB 4POUB 1IL1A 3O6LL 4I3RL 4KY1H 5AD0A 4FQ1L 5CEZD 4EBQL 3B3IB 3QJHB 4JB9H 1UH4A 4K3EH 4ODUA 5LGJB 3KYMB 4K7PY 4KHXH 4NM8L 4Z95H 1TZGH 5SWZD 1A47A 5IB5B 1XCTB 5L6YH 1RURH 4YPGA 4PD4J 3A6BH 4KZDH 1SM3H 3ZLQC 4NUGL 5D7IF 2QTEA 3MGOB 1YECH 1HHKA 1QTYT 3P4NB 1MHPH 3PE9A 3DRTB 1WBXA 1MHHA 3WDIA 2DIBA 4Y4HA 5J3HD 1UWGL 1LEIB 1VHPA 5ETUB 4HUUA 1D5ZB 5GRUH 3KPSA 1CD0A 1NGQL 3WNMA 1TVHB 1R5IB 1UKQA 1UXSB 2J8OA 3ULUF 1YNKL 5HHVL 2W65B 4G7VH 5I1KH 4LRNL 4UIKH 1E4WL 3QISA 1QQDB 5DURD 4JO4H 4PRHB 4LOUC 4JZJB 3L3KA 1JPSH 2IADA 4WEUD 1RZJH 3QQNA 3MCLL 4QT5B 3GDBA 1P53A 4E5XA 2XT1B 3F58H 3MJGX 1KPUA 5J8OA 2C3GA 1SY6H 2PR4H 1J0JA 4QXUH 5E2UH 1OTUD 4PRIB 8FABB 1JZ8A 4LSSH 3MREA 4KV5E 1ZGLB 3QULA 4Z0BH 2NY3C 1HWGB 3D2UB 4R90H 4FXLA 3VWKA 1ROWA 3ZSSA 5EB9A 4Z0XA 3LN4A 3KDMA 1AP2B 3DMMC 2GSIB 4ZDHB 4Q97A 3IKCB 4JDZA 4TPRH 1A7PH 2WP3O 4ODSL 2HT3C 1XGTB 5C07A 1OLLA 4JKKA 1F6FB 5F88B 2F53B 4XBGB 4U1HA 1ND0B 1WISA 4JO3L 4Z7UB 5IW1A 3PWPE 3IXAA 1G7PA 3N0PB 5IMMA 4N0FA 1GAFH 5FUCE 5E7BA 4P2QA 5TQ2H 3MV9A 2NY3D 4AMKL 5D70H 2YUVA 3C9NB 4KUCF 3LEYL 1VKXB 1SBSH 4OTXH 1C5BH 2RJMA 4EIGB 4PJBA 2B4CH 4AK1A 1F3DJ 1BVZA 3DMMD 4D9LL 1NMCC 3BT2H 2AK1H 5ENWA 1A0QH 5TFSH 3C60A 4JJ5A 4DGVL 3BZFA 3SE3A 5DJ2A 4A2LA 4F7CB 1B2WL 2X7LA 2OTWA 4KK5D 2VZTA 5CJ8A 3GSVA 3HHRB 1WTGT 3VXNA 4NWUL 2HJFA 4UDTA 1AQDA 1I1YB 4NO0A 3QRGL 5BS0B 1CLZH 1KT2B 3B4NA 35C8L 1HHJB 3SKMA 3OB0K 1JMXA 5TDNB 4B7IA 1IGTA 3PGDB 4GRWB 2A83A 3ZE2F 3KXFB 2HFEB 2ZG2A 3WN5A 5C7XH 4R2GC 3FB5A 1R3IH 3DV6B 1KCLA 3G6JE 3V4UL 2Z0BA 3LQMA 1CGXA 4PJ8A 2IQAB 4FZ8H 4HUMB 4OLXH 3E6HA 4ZOCA 2X4SA 5HHMB 3IETB 5J6HB 1FPTH 1KB5A 4OD1L 1NEZA 2XZQL 4QNPE 5H37G 5GRYA 4AT6B 4PR5A 4NQVA 5KZCB 4DGYH 5GS0L 4OGYL 5JIIA 5ISZE 2Q1EA 1NFDE 2OM5A 4R8WH 4PJAE 3IJSA 3FB6A 2ILLA 4D3CL 4H8WH 1RSFA 5JHDE 1IC4L 4B41A 2D0GA 3K0WA 2VLKE 5GQBA 4DCQB 5T3XD 5T3ZD 5GS3A 2ICEA 4I2XE 2C4FT 1UWEL 2BHZA 4OV6F 4QOKE 2OXHA 4Z9KB 2HYMA 3C5ZD 2UZYB 3V6FA 4HCRH 2UWEE 4M4RA 1XF4A 4ZUTB 3JWDL 3GMLA 3N1FC 5JTWA 1CFNB 1FBIH 3GUTA 4UT9H 3JWOL 1FV1A 4JVPA 1G9ML 5DI8A 4KI5C 3CC5A 3F62A 1ACZA 5GGRB 3V4VH 1RUKH 5ESQA 1N2RB 3P73B 2AABL 2PYEA 3L3JB 4MB5A 1LVEA 1F4YL 4B7LA 4AEEA 3AVEA 5FM8A 3MFFA 2D7TH 2FJHA 3ZE0E 3MRGB 5A16B 5BV7L 4WFGE 4QHNB 4LNRA 2QHRH 3ARFD 2HKFH 5H35A 4BSVA 2UUDK 2NXZD 3TYGL 5KVGH 3H3KA 1J5OH 3MA7A 2J88L 1HI6B 1HIMH 5HTSA 4NKIH 1OAKL 3BD4A 3U9PL 4U1LA 5HI3C 4QRTA 5CWSB 1D7FA 3MODL 4HK0B 4H26B 3E1F1 3IDNB 1YEGH 4MA7H 2IMNA 1DBBH 5IF0A 3CMGA 4LSVH 3LRSB 5GIRB 1JHKH 1GOFA 1IC7L 2HFFB 3IDYB 5D6CB 1JK8B 4M7LL 3G6AA 2AEPH 4OCSL 3WS6C 1EUTA 1BWWA 1XH3B 3WCYA 3VU2A 5F9WC 3WIFA 1FZMA 3DPBA 3VD3A 3T77A 2N56A 4ALAH 4H0GA 1YMHA 5C0EA 4HPYH 2BOBA 5C0CE 3AXLB 5EC2B 3N1PC 1X5XA 4XCNB 1R3HB 2FBJL 2FJFA 1T5WB 2FL5A 3BH9A 3HAEA 3O41A 3D5OF 1JYVA 5DYOB 1KIUA 4RZCB 4PJDF 2M8XA 3U7YL 2X70B 4XI5D 1Q94B 5FA4B 3DO7B 1MCDA 3M17B 2AGJL 1T3FB 1Z9OA 2E7MA 4NC2B 4NJAL 1NBVH 2NY2D 4JY6A 2ESVB 3WXVH 1I1AC 4GAJL 2DQUH 5IJVA 2VDLL 1EEYA 1JTOA 5D1ZB 1KTRL 5C0NC 4KFZC 3K4ZA 4JVWA 3PIQA 5B38B 1IC5L 2YPKB 4WTZA 5MP6H 3QUXB 5DD5H 5JW5B 3W82A 2ICES 2QBWA 2YRZA 3W11D 4UNVA 5CLWA 2E27H 2XI9A 2BVOB 5I1CH 2MKWA 4L3ED 4X7TA 5C0FA 5DHYB 1I1AD 3FAXA 3INUL 5LVEA 4MSWA 4E41B 5C0ND 5K9QI 4ZPVA 5B3NA 4HAFA 2IPTH 4N0YL 1YPZF 3QQ4B 3HZMB 1FFNB 4OZHF 3EDFA 3ZE1E 1BQUA 2GT9A 4HEPG 3CK0H 3PDDA 5T1KD 1RK1B 4HH9B 3RGVB 3TBTB 4NQED 1IRAY 3Q0HA 1G7LA 3HS0A 4JREC 3NFSL 1W72H 1CK0H 2W0KA 3MRDA 4U1NA 5FF6A 4DEPB 3V7AE 4XPHH 3ZDYF 2DICA 3MJ9H 4BSJA 4KROC 3ARDA 5D7LE 3MNZB 3RPIA 2C3WA 4KC3B 2V7NA 5I15L 4XPTL 3D0LA 1AGCA 3LKRA 2O5XH 5IHUH 1FYTE 3LQAH 4TQEH 2A9NL 3MBEC 5HGGS 1G84A 3MRLB 5JPNB 3ZKMD 2GY5A 3X12A 1J87A 3F7PC 3BIKB 4FG6C 3UP1A 1KENH 1W0VB 4KI5F 3TT1H 1LE5A 3H3BC 1AHWA 3P9MA 3KVQA 2Q87A 4BQ9A 1E6JL 1OW0A 4KROD 1CL7L 2QR0B 4LPUA 2VXUL 1RUQH 1R3JB 4KUZH 1S9KC 3MBED 2DIJA 5I74B 32C2B 2HP4A 2Z4QA 3GJEB 4MAYD 4XC3L 4WRLA 4PJCF 5HYJE 5DHVH 4O9HL 4OM0L 1ULVA 3CFCL 5DC4B 3ZYZA 5I2IA 2BCKA 3IDGA 2NY5C 4Y2DD 4J1UB 1N64L 2A6IB 3RWIB 3C5SA 2R2BA 1MI5E 5DK2A 2J4WL 4M93C 3RRQA 1DQML 1D5BB 3CD4A 3GM8A 4DKEH 1NC4D 3HR6A 4OIBA 4BK4A 4Q74A 1IQDA 3BQUD 3VFGL 2CLRB 3PWLB 1VENA 3EKCA 4IEFB 4Z7WF 4PGCA 4X5WB 4NZUH 1RULL 2WBJD 1OWWA 1I9IL 2NW3B 5I30H 3C60C 4HS3A 2W59A 5C07D 1BZ7B 2GJ6B 2DL9A 4UI2A 4PP1C 3VXTB 5EOQH 5B38G 4CBPA 1J10A 1ZVSA 3EYFB 4K8RC 1JE6A 4G9FB 5E0QA 1M4KA 1PX3A 3RWGB 3VCLA 4EIZC 4EVNA 4PGJA 1RI8A 2CRZA 3KR3L 1FNGA 1N4XL 3ARVA 4YE4L 5EU6D 4GSDH 3MV9D 3NPZB 2G5BA 1UVQA 5GRXG 2VDPH 3H42L 3KPNA 3NAAL 3T08A 3TT3H 3RUGB 4PJFA 4RBPK 3QDME 3VJ6A 3QR2A 3PHQB 3WN5C 1B6UA 4PJ9B 5CD3A 2A9MH 5L2KB 1H0DB 4PJEB 1L9NA 2ZCHL 4PJ8C 1FNSH 4K8RD 5I19H 1JL8A 4U6XA 7FABH 5EU3B 4Z7VA 2BY1A 4ZMAT 4AZ8A 5IHZA 1S7RA 2EE2A 2IGFL 4ODHL 2NX5B 2IH3A 5IMOB 4QTIL 3BWAB 4XTRC 1CR9H 1J0ZA 4AL8H 4KK6D 4C4KT 1ZLVK 2WUBH 3CZFA 3QO1A 3TBWB 5D8JL 3V8CA 2X9WA 4Z7UE 2CIKA 3L3IA 5C09D 1JF1B 1HZHH 3NCJL 2O26U 5DMJB 5TDOB 3O45B 3L3HB 4WCYL 1XCQA 3BGFC 2CKBB 4NO2A 1RV6X 1EEQA 4MD0A 4DUXA 4P3WA 1JTPA 4Z76B 4U7MA 3ALPA 4XTRD 5C0AD 4LIQL 1M7XA 1S3KL 1L7IH 4ZQKB 3MUJA 4GLRH 5D71H 5IROA 4JPKL 4YR6A 1T0PB 2PW1A 1TPXC 1OSZB 4G6FB 4X98A 5DSCA 2M1KA 4NKDA 4XCEB 4Q2ZA 5HHNB 1NCTA 2VIRA 4Y19D 3A67L 2FD6L 4CVXB 2OXGA 4M7KL 1XF2B 1MCOL 3WE6B 4LKCB 1YYMH 4QHLA 5DFWH 4C56A 4Y5YA 5BS0E 5D96B 5CLTA 5LGHL 4ETQA 5IESL 2Q8BL 3QHZL 5HSFA 4GRWE 3EOTH 1XF1A 1WEJL 5GZND 3QA3A 2HFGH 2PO6D 4JRWA 3CFEA 3RHWK 3GMRB 3B9AA 2VDQL 4P3CL 4DZBB 1S7WA 3C6SB 4WWKA 5B21A 3VFOB 1MWAB 3BHBA 1R5WB 4GLRI 1IM9B 2Z93B 4M7ZC 3MRPA 1QSFD 5TH2B 4H88H 3P30H 3ARGA 4XWOC 3EJJX 3WKML 4XPBH 3BIBX 3KNBB 2X4QB 4O5LH 1JF5A 1K3IA 3D69B 3NIGE 4OCYH 5CP3H 3TFKC 3MV8D 5L8JB 2UZXB 4NHCL 3VE0B 1HCVA 4BFIB 2CIIB 1SEQL 4YHKL 2H32A 2BVPB 4HZAA 2CGRH 4JFEA 1RUPL 2OTUA 4P5TA 3VXME 5IFJB 3RVVC 3ARBB 3OXRB 3O3EA 4JGJA 3VWJB 1KN2L 1RD6A 2EKSA 4L3AA 4KJYB 3I85A 4QRUA 4UT6L 4XWOD 4N0UE 2NMSA 5IBUG 1A1MA 3PP4L 2HTKC 1UADC 3BGMB 1ZWIA 1LK2A 1VGEL 4IDJL 1WFOA 3FFCE 3QP3A 4XAKE 3VXUA 1AR1C 1X3DA 2B1AH 4PV8A 1Q8MA 3DX7A 4N8CL 2DJUA 1KSRA 4PJBF 2Q7NA 4HV8B 3MCKA 4AQOA 2P7TB 3S4SB 3GMOA 2HLAB 3K81A 3QPXL 3WL9B 4UV4H 4NKMA 4XWGH 1DJSA 5JXAH 1OQOA 2LU3A 5B8CA 4LGRB 3I02B 1ZGLM 3BYTA 4FQ2H 2NY0D 3HNSL 4QRPA 3N9GH 5I8KH 2D31B 4WU7A 2QEJA 4K3GA 4HG4J 4I0PA 4JB9L 1WZ1H 3ROLB 1EO7A 4K3EL 5TE6H 1U8NA 4KHXL 2OMNA 4Z95L 4LBEB 3LKSA 1YN7B 1TZGL 1KG0A 4FQPA 1RURL 5L6YL 4KZDL 3A6BL 1SM3L 5ITFB 1YECL 1MHPL 3KJ4B 1F3JA 1FIEA 1W8OA 4HDIB 3B9VA 4OUUB 1OY3B 2W0PA 2H6PB 2NY6C 3BD5A 5DUMH 2H3NB 5GRUL 2ARJA 5MENA 1T1WA 2APXA 1NUNB 3EGSA 2VWEE 1Q9KA 2GAZA 3MX0A 4WWID 2I27N 4JEGB 1B3JA 4LIQE 2JTDA 4G7VL 5I1KL 3ZKNC 1I85A 4UIKL 4JO4L 5D5MA 3ARDC 1KFAL 4G80A 3KYAA 3QIWB 4X5LA 1JPSL 1RZJL 4NZRH 1WK0A 5C8JB 1F45A 1YDPB 1ZXQA 1F00I 3RBSA 1JV5A 3F58L 3HB3C 3VGAC 1MCPH 2ZUYA 1RJLA 2NY6D 5I0DA 1G9NH 3GSNA 4WW1A 1P6AB 5J57B 1BD2B 1SY6L 1G7IA 2PR4L 3C09B 4QXUL 5E2UL 1ZTXH 5HHQA 4LSSL 3GSOB 3SE4A 3VDCA 5DA0B 4JO2H 4Z0BL 1IGJA 2DI8A 4R90L 1OW0C 1FFPA 4HJ0C 1T21A 4X83A 5EBWA 4TPRL 5IR1B 1A7PL 3V52H 2ADFH 4RMUA 3IU3A 1BX2A 2ITCA 1H5BA 3TIEB 2FX8H 3H9ZA 3HB3D 3VXPA 1U8MB 1SJHA 1M71A 2C4XA 1CT8A 1V3KA 5DJZB 5DTFA 4E41E 1R0AH 2EDQA 2LFGA 5K9KB 4JY5H 2QQNH 4I9WE 2VR5A 5FYLE 4XP1H 3JZ7A 1X6NA 1GAFL 4X9IA 3VFNB 5TQ2L 5D70L 3TBYA 3D3VB 1SBSL 4OTXL 3L5IA 1C5BL 3KPOA 1ONQB 1DQLH 2B4CL 4P23C 4ZUUA 3SKOA 3H7BB 2FYYA 3BT2L 5KSBA 2AK1L 3WLBB 1A0QL 1BEYH 5TFSL 2PNDA 2XKNA 2ZSVB 4L8SC 3ME0A 3FQNB 1W0WA 2VISB 4EOWH 2ZOLB 3ZHLA 1RVFH 1KEGH 3DIFA 4HWZB 4YBHA 1CLZL 1M1SA 3T2QA 5J11B 1BQLH 3OF6D 3BZEA 3K8KA 3D18A 4P23D 2WM0A 1CDJA 4OZFG 5C7XL 2D9QB 1UZ8B 1R3IL 2A6JA 4WUUD 1CICB 2JLLA 4K7FB 4FFVD 3GK8H 4FZ8L 3UZQA 4OLXL 1JHTA 4RDQG 5I0ZA 2R0LH 4JDVB 3HNTH 4EI5A 1KCSH 1FPTL 4S1RH 4DGYL 3MRBA 3BP7A 4LRIC 5JXEA 9CGTA 1X5YA 2BSRB 4F9PA 1XR9B 4R8WL 2HN7B 4CU6A 2ORBH 4H8WL 2J12B 5E8NA 1MCKA 4U1IA 2XWJA 2R15A 3O2DA 4KHTH 4MNQA 5KSAA 4GW5B 1MCSA 4OF5A 3D85D 3RJQB 1GVIA 3T3PF 5CUSH 4AIXA 2X5PA 3V0AC 3O2VL 4DN4H 2GI7A 2VITA 3M07A 5DK0A 3TJEH 4I1NB 4HZLA 1IAKB 3CFJB 2YPLA 2NZ9C 1CDIA 4CDGC 3SKNB 4YDJB 1FBIL 1P1ZB 4UT9L 5JLZA 1J0HA 4PREB 3GI9L 3WUZA 2P49B 1RUKL 3V4VL 5D1QB 5KS9E 4V1DE 5LAXA 3QIUD 1MUJA 5IB1B 4BA8A 5DRNB 1BVKA 3BRDA 2D7TL 3SQBA 5IMLB 5C08E 1N6QH 3I6GB 4XP4H 3SY0A 3DRQA 4QXTB 4BZ2H 1S7QA 3LQZB 4G9FE 3K2UH 2QHRL 2FZ3A 3QUYC 4JHZA 4M00A 2HKFL 5IIEB 5C0RH 1IQWH 43CAA 1GXEA 5DJAA 2NYYC 3I6KB 4Y8AA 3ZDXF 4Y5YC 4IOIA 1P84J 3FB7B 5C3TA 5KVGL 4MCZA 1J5OL 3MR9B 2P42B 4PJ7A 3RUGE 4KK9