3PWVB

An immmunodominant ctl epitope from rinderpest virus presented by cattle mhc class i molecule n*01801 (bola-a11)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct conformations of a rinderpest virus epitope presented by bovine major histocompatibility complex class I N*01801: a host strategy to present featured peptides
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
molecule keywords MHC class I antigen
total genus 12
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pwvB00
1T03L 2IPTL 1CVRA 4KRPB 3LSOB 5EBWB 2IMNA 5I1DB 4NC1C 2BVQB 1FFNB 1A1OA 2KKQA 3FKUS 4KTEL 3ARZA 3IFPB 4LCIH 1A9BB 1YEFH 2EEDA 3OAZK 2X4TA 4JB9L 1MCDA 2BRRL 1JYXA 4B50A 4KROC 1G7HB 1RUMH 4NQCB 3GMQA 1LO5B 4MNQE 1NUDA 1G9NC 2NYYD 3C5JA 1J9CT 5HI3C 2X05A 2D2OA 1YA5A 3P9MB 4NPYB 4ZO7A 1KJ2H 5FO7B 1I9RL 5DD0H 5IUSA 3UXFA 4R2GB 3LEVH 1LO2L 4G7VL 1S7TB 1XF5A 4M1GL 5DSCA 5FIEA 3OGCB 1D7FA 1SMAA 4GMTH 3BZFA 1UM5H 5F1NA 2B4CL 3R06B 1YYLH 4YFDB 2QQKH 3FTGA 3IFPA 5E9DD 8CGTA 2V9RA 5D7SL 1F8TH 5D4QA 3PWPB 3KLAB 5EOTB 1XF2A 4UNTA 3T8XB 3M1BA 3TBVA 5TDNB 2CDFA 4JG1L 1IC1A 5MP6H 4PGDB 3D5OF 3BQUA 2OZ4H 2Q8BL 4X8XA 5IMOB 4LKCB 4U1LB 4L9DA 5FUOL 4XTRD 1TDQA 5EO9B 5DD3H 2CDGB 1JPTL 3Q3GB 1HE7A 5FGCB 4K3EL 4BQ6A 1NCWH 4MZ3A 1KTDA 4NZRL 1Y18B 4OD1L 3QEQB 2CUMA 2XACC 2A9NL 2EDOA 2EYSB 5C0NC 4HKZA 1RJZB 3MMEB 4Q97A 4KROD 2JJWA 5FHBL 1CQKA 3ARDB 1BIIA 2VDPL 3FOLA 3ULUD 3SPVA 1CI5A 3HG1B 3W2DL 3SQOL 3MXVH 5C08E 4NFBA 2Q6WB 2X9WA 5JW4N 4ZUUA 4L4VB 1ZGLB 3T2PA 1RZ8B 5E95B 4XCEA 5I17B 4ONFL 3SDAC 3RWIA 3TV3H 3VXRA 3MNZA 4OZHA 4KTYA 2EDFA 1P4LB 3VJ6B 4URTB 3I3EA 1NBVH 3IJYA 3AS2A 3SDCC 3FQTB 3H2WA 3PWVB 2O26U 2VXQH 3U83A 3C5SB 4NJAH 1AC6A 3QNXA 4XNMA 4L1DA 1JGDB 2V2TA 1KJMA 3KXFD 1WT5A 4W4OA 2XNAA 5HYIA 5B38A 5IF0A 1RAMA 1QVOA 4QHMB 3JWOL 1F4XH 1MCEA 1BQHB 4R7NA 1HHHA 1FH5L 4YHZL 3B83A 3D85B 5CJQL 3QCUL 4H1LG 3HG1E 5SV3A 4PJ9B 1ZK9A 3VXUE 1IGMH 4EDWL 5IB5B 2CLRA 3LPGA 5GGTH 4JFOB 4HCRA 1T03H 5TH2A 1S7QA 4WWKA 2X89D 2V7HA 4G9FE 5FA4A 2XXCB 3TJHC 1A22B 4NQVA 1Y6KR 3K8LA 4QTHA 2XWBA 3RVXC 2ED7A 4XMKL 2PW1A 3B4NA 2VXVL 3U9PL 4HWUA 2HTKC 5FXCH 1RUAH 1CE1H 4P2YA 1MQKH 1QBLH 4OZFA 5C07D 3IFLH 5IEHA 3KPRB 3NMEA 2D7PA 4OT1H 4PD4K 5BRZA 1PDKA 2C1OA 3ZYOA 3MRCB 5D1XD 4CMHC 2E8YA 3EAKA 4JFDD 3TO2A 4XVSH 1A7BA 3QQ3B 4RGNC 1U58B 4DGIH 4JFQA 3DI3B 1MUJB 1YPZE 2XN9B 3FB5A 2VUYA 4PB0H 5C0RH 3KGRA 3LN5A 3EJYC 3RIAK 2A2QT 4U7MA 3OWEA 1AXSA 1DQMH 1B0RB 1PD6A 4QXTB 5ICYB 5DQJA 4LDOB 4OGXH 3FN0H 4HGWA 4C4KT 2AQ2A 3MRKA 3NFSL 4RRPG 2Y7QB 4PBXA 4PJ9A 1FQ9C 2G2RB 4XZUB 1HEZA 4JY6B 3Q48A 3IGAB 5C70A 3M45A 3BAEL 1A6VH 3CDYA 4EJ1C 5IP4A 5AUMB 5BS0A 3CCHA 2C1PA 1XGRA 4H26B 1RUQH 4CVXB 2XQBL 5DK2A 4U1KA 1EFXD 5FO8B 1Z6JT 4GMTL 4B41A 5D6DA 2FHFA 1YEEL 5MENB 3AROA 4RMSA 2GT9A 3SY0B 3CVIL 3RZWA 4Z7WB 3P30L 2QADB 5E2VH 1KIRA 2FIRT 1VGEL 4ZXBC 3IDJA 2LVEA 5FM8A 3B9DA 1TTUA 1JNNL 1FIEA 3MLUL 4CNIB 4OCWH 4ELMB 1MCJA 3LDBB 4I9WE 2BVPA 1A0QH 3ARDC 3GBLA 4YHMH 4W81A 2A38A 1J8HA 4GMSH 1XZ0B 4ONHB 5FYJE 1BWWA 4KQ3H 1MCFA 1A2YA 2N7BA 2FECI 3U30B 1ONQA 4QY8B 5B4MD 3VFMA 5SWZD 1G9NL 5F7FA 3TBWB 3FOMA 3OR6A 5DJ0A 1B6DA 3HI1A 3MXWL 1D9KB 4D2NA 4M5ZL 4WI7A 43C9A 3GUTB 5I0DA 5C0DB 1IILE 1T3FB 4K2UL 3VDBA 4KJWC 5E94B 2HRLA 3SDCB 1J88A 5A2IH 4O58H 2LU4A 1KEGH 5D7JB 5FCUH 5IB1A 2D0HA 2IC2A 1OAQL 3OKKB 1B90A 1JWUB 4ONHA 1XGQA 3GBMH 4OIBA 1QRKA 4Y19A 5ALCH 2PNDA 2F15A 4JFZL 4M7LT 4NFCA 4P4RB 1KC5L 2DS4A 4PJCA 4Y5VB 3IETB 3UTTA 4Y4HC 4HHAB 3PDGA 3ILPB 2YKLL 2GTWA 2H3NB 1MJ7H 4PJAA 5D7KD 4PYHA 4W68A 5EU5B 1QR1A 4CNIA 3UMTA 1ZAGA 5DJAB 1AJ7L 2V5SA 4PG2C 1D5XB 1I1AD 4OUUA 4WCYL 2V2XB 1A6TB 2FJHB 1U8MA 1FFNA 5GS0C 2A6DB 4F58H 5IW6B 1FRGH 2FGWH 4FXGA 3AB0B 1GGCL 4ONGH 3MLSL 2HLAA 1QSEE 2IBGA 3EYUH 3EZ8A 3HZYA 4PJ5B 1V3KA 1NEZA 3H3PL 1ZT1A 4HZLB 3S34L 5E6ID 4PJDF 3ZYIA 2FR4A 4GAYB 5JA9A 4PFEA 1Z0MA 4CDHA 4LSPL 1J1PH 3SE9L 4HAFA 5I19H 1ZA3A 4H1LA 3V9FA 3TESA 3P9MA 2F8VA 1F4YL 2LQRA 3JV0A 4LEXL 5EZIH 5GGQL 2Q8AH 1AGCB 1NCUA 1FLRL 3GHBL 4P2RB 4QNPE 4Q74A 3QFJA 2R69H 2CKNA 3GSXA 4NQSB 1D5IL 5DJCB 4ZS7L 3VFPA 5CZXC 4F7CB 3BUYB 5H37G 3E2HC 1YYML 4HWZA 1N5AB 3VG0H 1Y6MR 4PGBA 5SWZA 1AQDA 1PKQB 4V2BA 4G8GE 2ESVD 1KENH 4FQXD 4TPRH 5TQ0L 1I7UA 1IKFL 3G5YA 3I3DA 4POZD 3ZKNC 1AR1D 1J8HD 4BFEA 2IWGA 3GSUA 4Q9QH 2GUOB 2OTWA 5F9JB 4M4PA 2IBBA 2N1KA 4Z9KB 4CU8A 1PY9A 5JIHA 4DVBB 5GGVL 1OF2A 3QO0B 3EDJA 5I66A 1IC5H 3T1WA 3TCLA 1JI2A 4CU7A 4F9PC 1JNHA 4Z7OF 1JF1B 3WKNA 1VSCA 5HD8D 4TSAL 4IMKA 3HI5L 1VKXA 4AEEA 4J8RB 4KY1H 4AZ8A 3KYNB 3QQ4B 5T3XH 4HCRH 4L3EB 2WUCL 3KDMA 3MRLB 3MRFB 4JE4B 3TLRA 4XRCB 3HI6H 2AV7B 1VPOH 3BP7A 4LEOA 5E8EB 2XRAL 3H7BA 3QIBA 2YOCA 3QG6A 4M02A 2X42A 1TENA 1AO7A 3L6FA 1R3KB 3PHQA 5T5NF 5C07B 3KPSE 1YY8A 1N0XL 3U4BH 5I1JH 4WU7B 1UKQA 1CG9A 3RFZC 1MHCB 3QIBC 4OZHB 4YDKL 3SGDH 3GMLB 2CXKA 3GSUB 3V5DA 4JAMB 2AXFB 1HHGB 1BAFL 1UM6L 1QP1A 2HG5B 3RY4A 3FO2A 2VDQH 3V6ZA 3CFJB 1TQCB 1QSFA 4JFDA 2EE2A 3DUUA 3QFJE 5IF0B 5I1HL 1JWMA 3F12B 3TZVA 3MSPA 3PHOB 5DK3A 1IC7L 2GTZB 4UBDD 5EU3B 5C07A 3FQUB 1KELL 1P2CA 4MLSA 3CFEA 1RHHB 1R5IB 4M7LH 4HULB 1IM9B 1JMZA 4JZOA 3WXWL 1V05A 3Q2CA 32C2A 3KDMB 3SDDB 3BIKB 4NQTA 4JREB 4X7FC 1VGKB 4QRUA 5AYQA 1F2QA 2ADIB 4WWKD 4IS6A 1B0GA 5HGDA 3T4YA 1U8IA 5TFSH 3OAUL 5EUOB 5HYSG 3H3PH 5JNYA 4DN4L 1BBDL 1T7ZA 5GGTA 3MJGX 3SGKC 3FB6A 1AO7B 3L6FB 4G6AD 1DQQB 1MCWM 3D3VE 5LJYH 3V0WL 4HS3B 3T0XA 3TO2B 5D7JD 4NP4L 2Y5TB 4Y2DD 1S9YB 1X5FA 2ARJB 5BRZB 5IB4A 3LAFA 4G7YL 4M7KH 5FOJA 5MEPB 3TO4D 3D2UB 1U36A 3CFCL 5DMIH 4Y19E 1KACB 2HLFD 3KS0H 2EKJA 25C8L 3RNQA 5DD3L 4L29A 2BSRA 3L9RB 2Q7YA 4WO4B 1FC1A 5B3JE 4I13B 2VL5B 4PJCE 2HMID 4NCC1 5GRVK 4S1DC 5ID1A 3BHBB 5HPMB 3QUZB 3VW3L 1EEZB 5GGQH 2Q8AL 5LAXA 3T65A 2W9DH 1T2QL 4WTXA 4HFUL 1T22A 3BZDA 2AQ3A 3GMOA 4TRPH 4RWHA 1DE4B 1CDJA 2VISA 1KN4L 1IAKB 2A73B 4JR9L 1YC8A 5C0GA 1LP9E 3PV7A 4IRZL 4WHTB 3DX6B 1IM3A 1U3HA 3LS4H 5T1KA 2X10A 1UKSA 1N26A 4JN1L 4M7ZC 4P59H 2OCFD 4LCYB 1UADC 4OZIB 4FFWD 3QUXD 5HVFB 1MLBA 4FTVD 3ZKXB 3LEVL 3BQUD 1G7IB 5TF1L 4U6YA 1K2DA 3TM6A 3GB7B 1YPZA 4P2CG 1UEMA 1JNLL 3B9KA 1RK0A 4OD1H 3ARFA 4DN3L 4G6FD 5F8RC 1MF2H 4OAWB 5DJ6B 4XGZA 4M00A 2DJSA 5F7UA 2Y6SC 1FDLH 3UZVB 4PJ5D 5GGVH 4ODWB 2I5YL 1C5CL 2CIIA 4OM1L 5DT1L 1TZGH 2Q76B 5D1ZD 4KHTH 1V7ML 4RIRB 3UTOA 2NY2D 5AG8A 5C0CD 5CKAA 3NIGE 4OLXH 2BNRB 3W5NA 3KPPB 2BXZA 2WQRA 4N5EC 4A6YL 4IOIA 1X7QB 2YSSB 4NZTH 4J3WA 5I8CA 3U0WH 3RKDD 1CTNA 2G60L 1ITCA 3VRLF 3VG0L 3KPLA 4AH2B 2FB4L 2EYTB 4HS6A 2FBOJ 1FPTL 3W82A 5HHME 2P7TB 3TA3C 4OM0H 5ILTH 1K4CB 1M4KA 1ZGLP 4OB5L 3BP6A 4KDVA 4GW1A 5I1KL 4LP5A 4BQ8A 2A77L 2XTLA 3VXSE 4G6MH 2AXGB 4U1HA 3UYPA 4IOIB 4N0UE 4TSCH 4X7CC 1S9VA 2X2YA 3L3JB 2VDNH 2VLLB 3QYCA 4P2OA 4OBSA 5EOCJ 2BNRE 4EI5C 3DPBA 4JFHE 3IXAB 4BELD 2VZUA 2PCPB 1TZIA 2NTFA 3JXAA 4KJYB 8FABB 2ERJB 5C8JA 2DMCA 4NYLA 1LDPL 2H6PB 2CQVA 4LPWA 2CIIB 4NSKA 2P45B 1UZ6F 2R0WL 3VFOB 2ZWLT 2AK4D 4D0DB 3QFDB 5I1IL 4ZXBB 2AJVL 3OG4B 2K9UA 4QXGL 2YD5A 2CKBA 1QBAA 1T66D 1YDPA 4I0PC 4U1LA 1FIGL 4KUCD 1J86A 4AYFA 3DRQA 1HHJB 3C60A 4OZGF 5SWZB 3NFNA 1ES0A 3NZ8A 1EAPB 4G6KL 4A2MA 1TZHB 3FCTB 3O2DA 5I1HH 1MWAB 3KPQB 5EWIH 4KKBC 2X44D 1N4XH 2EDKA 2AEPH 3S97C 4J3VA 2NY1C 3I02A 4NIKB 4OIIL 2VXTH 3O45A 4JFYA 4YHIA 3PABB 3BPNB 3W39B 4XNZC 2IADB 3ESVF 5EOCL 5D1QB 4OGYL 4RFOL 5HI5C 1N59B 4YDIH 4HUUB 3REWA 3IXTB 4NZTL 4EI6B 4ZDHA 1C12A 2DD8H 1JF1A 3LKOB 2VLRA 3BKCL 2ZUQC 1A7QL 3L3HB 3HR6A 3ULUF 3D39E 4BFIB 1HDMA 1QEWB 3I6GB 4GMSL 2HWZH 3VFUB 4NSKB 4ZOBA 1IAIM 2JIXA 3L7FA 3OV6A 5DQDL 5CD3A 1JVKA 3DMMA 3L5HA 5ALBH 5TH2B 1B9ZA 4JFYB 1V3MA 3LMJL 5C0ND 3X13B 3NA9L 4TN9A 4FMKA 5JO5B 3O6KL 3P40A 2QKIB 2VJXA 1U8QA 1UWGL 3RIFF 4FNLL 4LHUG 5FYJD 3VGAC 5C9JB 4POYA 3RWHB 3LOWA 1G7MB 5IEHB 5HY9B 3MRGB 5IFAH 2BFVL 3PHQB 4NO3A 3QUML 3V95A 4P4KB 3X3GH 1YN7B 2OXGA 3RUGB 4HWBH 4NZUL 4Y8AA 3IDUA 3VDCA 4R2GD 3NOIA 3FO2B 1RJCA 3MRPB 4M43L 5FA4B 4AL8H 1N6QL 3V5DB 5AEAA 2ADGB 1IM9D 4U1NA 1YMMD 5DLMH 3PWNA 1HK6A 2G75A 3B5GA 2NLJB 4LSTL 5AD0B 4Y16D 3TA3B 1MHEA 4G6KH 3U0PA 3VWKD 2MMXA 3X14B 1P7QD 2Z8WC 5KS9E 3SKNA 1F4YH 3MNVA 2FB4H 4MQXD 3VFGL 5E00A 3F58L 4QRPA 3EHBD 2X4OA 4PRNB 5CWSB 1SJEB 2R69L 4U1SA 4LSPH 3G6AB 1YEFL 4U31A 1I7ZA 5KSBF 4YXLH 1RUML 3FZUC 4HFWA 3SE8H 1JGVL 2COQA 2AEIT 4OD3H 2P8MA 1GZQB 1M7XA 3LS5H 2KUTA 1OSZB 5E1AA 1CQYA 1FORL 2GY7B 4MJID 3HNTL 2BDNH 3NPSC 2AJXH 4KROB 3RWEB 3QIWA 3SDXA 4X4XB 3Q3GA 3MJ6A 1YEJH 4G6ML 1EZVY 2WWMD 3F5WB 3O6FA 5E4EC 3IJSB 2NY4D 4X0KA 4N9GB 1YMHB 4R2GC 3TT3L 3PDOA 1ZOXA 1XGYH 2BY1A 4FZEH 1XCTA 4NNXA 1MCOH 2DI9A 4FQXB 1ADQH 2ESVB 5DJXB 1W72L 3L9RA 5DJ0B 3RY5A 1RIHL 1MREL 2UZIH 1S3KH 1EVTC 4G6FB 4KFZC 3VXNA 3L3IB 1MCRA 4X7DC 4XWOD 4PY8J 3R0MA 3V5HB 2A73A 4HXAH 4NKQB 4UV4L 3REVB 3MFFA 3MV8A 1KJ2L 3VRIB 3QEQD 1BJ1H 4MWFA 4NKOB 1S9KC 4Y4HD 1YEDA 3IJSA 1N6QH 1NAKL 1X5YA 1Q0XH 4Y88A 5F1IB 4XPHL 4G80A 3FN9A 4U1JA 1DBJL 4PJ8C 3T08A 4JCMA 2NY2B 3RTQD 4O2CA 2MKLC 3BISA 1JV5B 4YDLC 1CS6A 4ZAKA 4LLYB 3R0NA 1T21B 3RA7H 3O6LL 4BYHA 5KVEL 3IS0X 3UPCA 2JB5L 4Z5RA 4GKNA 4O00A 5E5MA 2R0KL 3MCKB 4HPYL 1NAMH 1PBYA 1TPXB 1QA9B 4N9GA 1VB9A 2BRRH 1K3ZA 2X4QA 4WHDA 3F7YB 3IDNB 1KFAH 2ENYA 3ZE2F 5C3TA 1JL8A 4M6NH 4HKXA 5CFHA 3G5XB 4YK4C 4HWBA 1J0IA 4JDTH 4K94L 3HS0B 3IFLL 4LBEB 1VADB 4E41B 4LPXA 2PW1B 4LPCA 4D9QD 4HG4K 5I75C 2W0FB 1A8JH 1Y0LB 4NNPH 1QPXA 1D5XA 4LDEB 2EIDA 3E0GA 2V6HA 3F65A 1BP3B 5DUPH 2AKRA 4OGYH 4PLKD 3JV6A 2VERN 4XXDA 4LKXB 2HRPL 1W0WA 3CX5J 4FQIH 4F7TB 2R0ZH 1HQRB 3WJLC 2XY2A 5C09E 1JUFB 2VWEE 1CLYH 2GCYB 5ENWB 4ODUB 5FF6B 2ICES 3BE1L 4L8BA 4HIEB 1QSED 1YUHA 4H88L 3ROOB 4K9EH 2P24B 2P42B 5I2IB 2AABH 2Z31A 2XQYG 1KG0A 4G7YH 3VE0B 1NBQA 2MQ0A 2XKSA 1A1NB 4XXDB 5HGAB 5GGVY 1DQJA 2GSIA 1ONQB 4QY8A 2JKXA 3NCJH 3TCLB 1JPSH 4LSVH 3FOMB 5F44A 4XVJL 1U8OA 3CMOH 3QAZB 1FCCA 4R90H 4ODUA 3W0WE 5E2JA 3BKYH 1XGPA 5FYKU 4PY7B 1N7ML 2NY0B 1QFWM 5L2JB 3PXHA 4DCQA 3BKMH 4KK8D 1CU4H 1JZ2A 4I18A 1NMAH 1RZ7H 5JPNA 5C0AA 1P7KB 1UEYA 1E4WH 4NNYA 3QEHB 2YPLD 4XPAH 1FJ1B 3IF1B 4QGTA 4DK3A 2A6JA 3ARGB 2ICWA 5IIEA 5FYLL 4BM7A 4G3YL 1OOAA 1KJ3L 3MRFA 4PV8A 4WY7L 1QFHA 4UU9A 3BP7B 4LEOB 3S5LG 3LZFL 3UTSA 3V5KA 1G6VK 3W0WB 3VXQA 1GGIH 1JIBA 4XCNA 1N59A 5HGBB 2OTUB 3KJ4C 1KJ2B 4K23H 1JE6A 4QT5B 1KTDB 4H25B 5E8DL 2RJMA 2EKSA 4K07A 3WD5L 3L5WB 5FUCE 4O5LH 3SKMB 3HZMA 4MD5A 3PL6D 3RWCB 1XGUA 3DV4A 3LQAC 2APVA 3CH1B 4IHOA 5DT1H 3ZDZF 5ITFB 2X5PA 2E27H 2RFXB 4KHTL 1YN6A 4HDIA 2CGRH 2H1PL 1OP3K 5F9OH 4GW4B 2NY5H 5C0BB 1PZ5B 4KGLA 3K0WA 3VXRB 4GXVH 5CEZL 3MJ9H 3RAJH 4QRTA 2F53A 1DBKL 1O0VA 2O5XL 5I17A 3JTTB 1A6WL 4ISVA 4KKLC 2FZ3A 5I6XC 5IEKA 3RGVC 4RMTA 1WFTA 3BP4A 3QO1A 4PTTA 3ORJA 4KKCD 5ICXB 5HDQL 4MS8C 5CP7B 3D39D 1MFDL 1PLGL 2VKWA 4EXKA 3GSWA 4GAYA 4J3TA 3U6RB 1PYWA 2P5WE 1HHHB 3PQYB 3RWJA 3PP3K 2FATL 4EZMA 5IGXL 1TJGH 4DGVH 3HRZB 3PWNB 4MNHB 3T0BA 3OF6A 4WVRA 2BOCB 2BCKA 2F53D 1LK2A 1MNUL 4NZDA 4B7LA 2Z0BA 2CLZA 2VLJE 3U0PB 3MUGA 3CH1A 1AGBA 2KL6A 4IHOB 1UXWB 3VDAA 1DQML 4XI5C 2XTJB 1U8PB 1RUPH 4K7FA 4ZPTB 5F89A 3WUZA 3OKOA 1SQ2N 5TGBB 3IDGA 4PRNA 2MQCA 3WHXB 3S4SB 5I1CL 4GKSB 5AZEH 3QHTC 3WSQL 3U7WL 1P5UA 3X3FH 1ZVSA 5E0QA 1WFNA 2EDYA 3MYJA 5T3ZD 1FGVH 3L3DA 3WIFA 3T65B 3L1OL 4JG1H 3BEWB 5T3XD 4XXCC 1BF2A 4OJFH 4X7SH 4X6FB 2LAGB 1JNHB 1JK8B 4P23A 3TN0C 1LWRA 3ELAT 4YDVB 3CVHA 1YNKL 2HMIC 3C8HA 2MKWA 3V6ZB 3O4LD 2QQNH 4MXWH 3RBSA 2IMMA 1PZUB 3RDTB 3BRDA 1BWMA 3WHXA 4HUXB 2DWDB 2JELL 3QT2A 4P57B 3HFMH 4TNWF 3VXUA 1OP9A 2ZCHL 4GKSA 5FHAH 1ROWA 2B8OT 2G2RA 3VFRB 2C26A 5EC2B 1HH6B 3HUJB 3GFUA 43CAB 2DBLH 5E9DB 3LZFH 4YHPB 4LHJB 2BSSA 3MO1A 2DWEA 1G7IA 1ZXQA 1XGRB 3T0EE 2EH7H 3CXDL 5CKGA 1EEYB 3VMOA 1H8OA 2DI7A 4U6VH 4L3ED 4LQFL 4FA8A 4I3GA 2J2ZA 4OCLC 4G80B 3EOAA 2Q87A 3WKML 4CVXA 5GGSA 1T7XA 1E6OH 4XPFL 2A1WL 3ZE2E 2FLBT 4JJ5B 3LCYA 4XP4H 2F54A 3MREB 4NHUA 1NCCH 5CINH 5A40E 3SBWA 4X98A 5B8CB 5K9OA 4HPOH 5FKPB 1T04B 4UIMA 1J1XH 4XCCL 3HZVA 5D8JL 2NX5A 5IHZA 3GZKA 5I30L 1J8HB 3OR7A 4XMKH 1TNNA 3EGSB 1QPPA 4JKLA 3GM0A 3HAEG 2FHCA 1HXMA 4MD4B 5AWNL 5K33A 5HHPA 5CILH 4ZOAA 5DGRA 3FFDA 5GSVB 5T5NG 1LEIB 2UZXB 2VQUA 3O6KH 1K8IB 4QLRA 5C92A 1JZ5A 3SDDC 1VPOL 4JHWL 4BH8A 3T0EA 1KN2H 5GRUL 2VB5A 2ZOKB 2Q8BH 5B8CC 4N8CH 3P11H 1RJLA 1DTUA 3QH3B 3BWUC 4F7TA 5KOMC 1H3UA 1BLNA 1I8IB 1TQCC 2J8OA 4KMLB 3OAZH 4OFYA 5SWSE 4YQXL 3RNKA 4JHZA 3QCVL 3EUUA 4Q6IB 1BFSA 2F54B 2ZCLH 5CZVH 2EDRA 3P77B 3UTPE 2HVKA 3QULA 3PHSA 1J11A 3PWPE 3K46A 1MFCL 4L29B 1C16A 5EU6B 3EDKA 3BSZH 4F8QA 2MJWA 3W2DH 4HJGA 4E41E 2F53E 3HI6L 2Y72A 3QG7H 4XGZB 1QFWH 1X5JA 1ZANH 2A6DA 2ZCKH 4XCYB 3VCLA 4TTGA 4KRPC 3S37H 4OGZA 5T3XL 5EUOE 5C86A 4JVUA 4FQJH 3EDEA 4KMQA 4HIXL 4YBHA 5EUOF 2P4AB 1P4BH 4LSSL 3MODL 4PY7A 3BWAB 3W81A 2DQEH 2AGJL 4ZODA 4NWTH 1KCUL 1Q38A 2EECA 2E6JA 4WW2C 1KEMH 3TBVB 2EEAA 2WAHA 4DKFH 4RNRA 4PGDA 1R3IL 4DUWA 4HMEA 4MCYA 5I30H 3VFPB 4F7CA 3OGOE 4KKAD 1FE8H 4RMQA 3RL1A 3MA7A 4OCXL 2V5MA 3ZYJA 3MV8D 5AAMA 4QXUH 1M71A 2CDGA 5DJYB 1Q9OA 1RK0B 1GRWA 1NAKH 4GH7B 4NKDA 1NGYA 5C0EA 3UTSE 1IL1A 4BH7A 1QLRA 3S37X 3BH9B 4XPBH 3SGJC 1S9XB 1UJ3B 4LPUA 2UZIL 4ODWA 4QF1B 5C0FB 5TDPB 4X6BB 2HJKA 3LIZL 1NC2A 1YJDC 4QNPF 1ZHKB 3THML 1HYSC 4R3SA 2X6MA 1MFBH 4ZSOA 1MCIA 4YHKH 2JELH 3RWIB 3D3VA 5EZOL 1CDCA 1CVSC 2AS5M 1HKLH 2AJXL 4O9HH 1DUZA 1DVFC 1KGCD 4W4NA 1LILA 2EO9A 2FX9L 3RRQA 3EYQC 1HSBB 4QRRD 5J3HC 1OAUL 5ITFA 4XRCA 2HFFA 1CICA 5F7NC 2AVGA 4JHBA 5GGRA 2DQIH 3X3FL 3WHE1 4IOSD 4QRPD 4EOWH 1HHJA 4ZQKA 3RIFK 1B4RA 2DLIA 4YO0B 3JTTA 3SKUD 4AM0A 3S37L 4ZS6D 2EE6A 4XAKE 3VWKA 3U46A 1KC5H 2OL3H 3RI5F 3WLBA 4JG0H 1G0YR 3LKSA 4KC3B 3JWOC 4HUVB 3BN3B 4L4VE 1A9BA 3ZTNL 1Q1JH 2EC8A 3T3ME 2APFA 1CR9L 2GK0A 4OI7A 3KYKH 1JWMB 3TZVB 1LO5A 3DYOA 4P5TB 3DUUB 4MJ5A 4ZSOB 1HCFX 2AEQL 1HHIB 3UJJL 4CU6A 1JPGA 1ORSA 2CKBB 3CDGB 2FO4A 3O4OB 3QEQE 4RAVB 5IW3A 2J1KA 2P8PB 2VN4A 4C54A 2EXWD 3R06A 2IF7A 1WT5C 2D9QB 2QEJA 4OIIH 1KN2L 4PGZA 3GRWH 1E6OL 1AXIB 3P9LA 4KZDL 4C83A 4KQ3L 1FBIL 2JCCB 3UZEA 4UT9L 3VXTA 4UZGA 4F15C 5LXGL 1U2HA 3QDMD 1I9RH 5EBLA 4Y4KB 3ZTJH 3OB0H 2ADFL 1CDBA 3E6FA 4HUUA 5IB4B 2DLEA 5I8EB 3DV6B 4MZ2A 3UBXA 3G9VA 1IVLA 2NY0C 5DQDH 2IPTH 1FIGH 1A3LH 3CFBB 2VLRD 4BSJA 4HGWB 5CILL 2H45A 4YFLF 2I60H 4XC1L 5DK2B 5FO8A 3OXSA 3VXTB 2XICA 2FSEA 4LASL 4EI5A 4K7PY 4Y0GA 4XHQA 3OJ2C 4NQDE 1RUKH 1DUYA 3N1MC 1GGIL 4MMXC 5TE4H 4RAVA 1UVQA 3VGEA 4M62H 1T5XA 1M7DA 3IDJB 5E08L 5TPWL 5HGGS 3X14A 2AJ3A 4LCWA 2QKIA 3SKJH 4L4VA 5J12B 4X6CB 3E3QC 1IBGH 2AABL 3C60D 3KWWB 1AD0A 2K1MA 5ANMA 2AKRB 3UC0H 1GGYA 4P49A 5ILTL 4JZNA 3O9WB 4PRPB 2DIAA 2ZUYA 4O02H 3OZ9H 4KQ4L 4WHTA 3VH8A 4RCAA 1IAMA 3QHFH 3O4OC 4EDXA 2WANA 4DKEH 5IW1B 1TJHL 2EIZB 4Q7DA 4I4WA 1GL4B 3G5VA 3B9KB 1FVEA 2R0WH 4N68A 4RDQF 4NKMA 2W0PA 1TNMA 1AQKH 5FA3B 4PLNC 3BHBA 5HPMA 1VEPA 2HKFL 1FYTD 2VDOH 4PRHD 4AK1A 1PX3A 2P5WB 3OXSB 4MAYC 3NIDF 5FB8A 2HLAB 4RAUB 1IMHC 3O0RH 1N0LA 2HFEB 5HHPB 4K71C 3FFDB 4F37K 1E0OB 3L3KA 4J4PA 3TJHD 1MOEA 2YRPA 1PJ9A 5JW4M 4A6YB 4OZFB 1RZJL 1C08A 3HB3D 4IM8A 1W8NA 3A67L 5JOPD 1MNUH 3TYGH 2DM3A 5DEFB 3QNYA 4NT6B 1LE9B 4K8RD 4YDLB 1RPQA 4X9FA 5J1AB 5I71C 2NXYC 2RHEA 2CH8A 3BGMB 5C0CA 2FX7H 3OB8A 1CL7H 4GXUM 1RUKL 1AP2A 1K4DB 5D1ZA 4YHYB 1I3RB 4I0PD 3PDOB 2AXGA 1IGYA 4JFPA 4CKVX 1EHNA 2DLFH 5DD1H 3A6CH 3GBNH 3MC0A 4HC1L 2QQNL 1L7IL 1RFDL 1F90H 2R1XB 1ZT1B 3ARBC 5J56B 2X4UA 5D7SH 3L3IA 2Z8RA 2FX8L 1TTGA 5HHQB 4KH2A 3ARFD 4P5KA 5DO2D 3B9KD 1FZMA 4V1DA 1HQ4B 2HJFB 2VZ3A 4GQ9H 5GGUB 4UILH 3LD8C 4U2ZA 2DTSA 25C8H 2RR3A 1IGCL 1KXTB 5TF1H 3GK8L 2ZSVB 4NN7C 5AZEL 4XTRC 4Y8DC 2BSTB 4JKKA 5F71A 1T7WA 3IT8D 3JWDH 4JFEA 1RURH 3G08A 2DIJA 5CHNB 2DQHL 1YN6B 3RDTD 5CJBA 2W9EL 3V0VA 2ZOLA 1FORH 3W9DA 3NFPB 1W72A 4NRXA 5JHDE 4CRPA 1FZMB 4V1DB 4MSWA 2IQ9L 2J12B 1MCWW 1H5BB 4ZD3H 4YEFA 4HT1L 1A3QA 5CP3A 1LO4L 1HINH 2F53B 5KANG 3RGVD 1MPAH 5GRYA 1CFVH 1GZPA 2X4QB 1GXEA 1MHCA 4QRSA 3WUWB 1CD9B 3P0YH 4APQD 5DUML 3CPLB 3O3BB 3REWB 2GJ6E 5CHNA 5FYKH 5BZDB 3FN0L 1D9KA 2IFFH 1RIHH 4N8VG 5FECA 5D1XB 2EC9T 5FCUL 2W91A 3SE4A 3TO4A 3K4AA 4HIJA 1R3KA 3OL2A 4R0LA 1XGYL 3I2CH 2MCPL 4PYGA 4FFWC 3HA0A 1J05A 5D7JA 1E27B 5EO0B 2BCKB 1ES0B 1CLZH 4HSQA 3GHEL 2WNGA 3HAEA 4PPTA 3O3UN 5CD3B 1ED3A 1A6PA 3FAWA 1NFDA 2DM2A 3PWPA 5HDLA 3G6JE 5GS2D 3QZWA 5CP7A 3I85A 2N4IA 3O0RL 4G9FA 3VFTB 4X5XA 3E6HB 4MLIA 4P4KC 2E9IA 4OLYL 2V7NA 4HIEA 3FB6B 1OY3B 3MJ7B 2ADJB 1ZKAA 2VXUH 3GSOA 4E5XA 3NIFF 5CMAB 2R56L 1NFDF 3MA9H 4LSVL 5B39A 1VESA 2HKFH 3MCG1 2A6JB 3H42H 3I6KA 1Y6NR 5BV7H 1OAYH 4P5TD 5EOQL 5ESVB 3V6BR 3SDDA 4TSCL 4JFEE 2ITCB 3PGDA 1CFSB 1NGXB 3TZVD 2YS4A 1JRHL 4NHCH 3VXMB 2JJSA 4JFZH 4P9HC 1XFPA 4FHBD 4JEGB 1QSFD 2VDKL 1TCRB 3WLWC 2DQGH 1EXUB 3AAZA 4QTIL 4J3OC 1NAML 1T7YA 1HIML 4APQB 4KHXH 1SEBA 4MNQA 4XBEL 4QT5A 1E4XL 4DCQB 4XNYH 4WFHE 4Z95H 3CSGA 3HUJA 43CAA 2MCG1 4IIQB 1S5IL 4XPTH 4PLOB 4Z8FH 3SGKA 3K2UL 1FN4B 4M5ZH 3FRPA 4ZO9A 1F3RB 3QCVH 1CDGA 2ITCA 3PGDB 1CN4A 4F7PA 1NFIB 4OZGB 4FQCL 3MGOA 5CZXD 2D31A 1DBML 1H8NA 1YC7A 5ICZA 4HIHA 4I0KA 4X6DA 3HC4H 4BQBA 1BBJB 5DUBB 2E7LC 4OM1H 4R90L 3SQBA 3D18B 1SEBB 4MNQB 4X99B 4PV8B 5BJTB 4OFPA 4PRID 3RVXD 5CGYD 2P1YA 4PJ8B 4U3HA 1IKNC 1G84A 5D7KE 5K9OB 4H5SB 5GRUH 4JDTL 4K94H 4XBGA 1NMBH 5JXEC 4M7ZB 1XCQA 3HR5A 4GBXD 3D85A 3DRTA 5DRZB 1G7QB 3HZKB 2GAZB 4WUKH 3VD5A 3ZL4H 4D9QE 5E2TL 2WIIA 2Z31C 1HXMB 4MD4A 4NUGH 5A43C 4QTHB 3SDDD 1WAAE 4CW1A 4U2YA 4EI5B 3VXNB 3MLSH 5FOBB 3OKLA 2AV7A 1SBBA 5KVEH 1JZ8A 1KNOA 4EIGB 5A1AA 2R0ZL 4XB8A 4YXKH 2ESVA 4FQXA 1SJVA 5MI0B 1H3WM 2NW2B 4PBVC 2FX9H 3HR5B 5C1MB 4LLWA 1VFOA 1T0PB 3DROA 4HQQH 2GY5A 1TETH 1MJJB 3OKOB 1OAKH 4KRLB 4XWGL 5FDWB 2E7LA 2A6KA 5FO9A 5I18H 5BO1H 4JZJA 3PWPD 3S96A 1ZWIB 5ANMB 2VDKH 4EQ3A 1MJ7L 3LPFA 4LPVA 1ZTXL 1JYNA 4MX7A 1HSAA 3O2VL 1HHGA 4ALAH 4J23A 2HH0L 5JMOC 5CJOL 3AU1B 1TQBC 3CFJA 3GI8L 3L3DB 5ISZB 5CEYB 1MFAL 4O58L 4RQQA 4M6ML 5FGRA 3RTQC 3DRTB 4LNRA 4GOSA 3JUYA 4MNHA 1DVFA 4WFFD 1C5BH 2VXUL 4FP8H 4LARH 4Z5RB 5C71A 1JTOA 1U95A 5J8OA 2WM0A 3TT1L 3REVA 3FZUD 3DETC 1I1AA 5GS0D 3T2NL 4PJFB 5HD8C 3QIUB 2HFGH 3MXVL 2ITDB 4UAOB 4YBLB 3JWDL 2BOBA 2BDNL 4F37F 4GFTB 3RGVA 5CBAA 5I76B 1KTRL 5EU7C 3ULUC 4EUPA 5B4MC 3AY4C 4JO1L 2DQDL 3VFVA 5J3HD 4EEEA 4NO2A 3KHQA 4HH9B 5KSUA 4KV5F 4DTGL 4JZJC 1M6OB 4JFED 2H1PH 5E5MB 3QNYB 5L8KB 2EDEA 2OTPA 4ODVL 4GG6E 2JLLA 1YNLL 1AGEA 4G43A 4LCWE 1WBZA 4KI5F 1BFOB 4LSTH 3SE3A 3RNQB 4HV8A 4O5LL 4XT1C 5F9AC 3TIDB 4DQOL 4MQXC 3QXAA 5DJ2A 1NLDH 4ZG1A 4OLWL 1IGYB 4JFPB 2R0LL 1ZLWK 4R26L 1FZOA 3LQAH 4TRPL 2HJKB 3VRJB 2W07A 4LVNC 4X7TA 4ZUSB 5I74B 1OCWH 1IQWH 1F6FB 2NW3B 3QUZA 4NDMA 5CSZA 1MWAL 3MGAA 3BKJH 4LOUC 1LP9F 3QFDA 2QQLL 5J6GB 1L4IA 2XFXB 4LQ1A 4I0PA 4JRYE 1QRNE 3QR2A 4IDJH 2Y06L 5I15L 4NZUH 2Q3AA 3ESUF 4IOFC 1ZVHA 2NMSA 5EG6C 2XN9E 2FECL 2Q86B 2NY5L 4LVOC 3PL6C 2H2SD 2R2HA 1H3PH 3OSKA 3UAJC 1CIDA 2V2WB 5EH1A 2OJEA 5CEZH 3ULVD 2R1YB 4TSAH 1YEEH 3I02B 1LNUA 2FJHA 3P30H 4HLJA 2ORBH 1KG0B 5IK3B 2DQJH 2CO6B 3W11C 3ZO0A 3D0LA 3F7VA 5E6IB 4NNYB 3GMMB 4PJ9D 4JR9H 4J6RL 5LGKA 3L7EB 2X1XR 1C16B 5BZDA 4OLUH 3PGFL 4RBPH 1TJHH 2GITB 2ZUWA 4P3CL 5EA0H 5F3BB 1VFBB 1OAZH 1L0QA 2UY7A 2WWKO 2C3VA 3HPLB 3QXDA 5C6PB 5L2JA 2FEEI 2A9MH 5D6CB 4J1UA 1ND0B 1K5NB 4M7LL 3QUMB 1YZZA 2ZOKA 1EGJH 1JPGB 1ORSB 3D0LB 4U6VL 4P9HL 4XVSL 4I5BA 5MEQA 1KPVB 4BSWB 2ZSWA 3RGHA 4PB0L 2EYRA 3QDJE 4M8QA 4FFYL 3U2SA 5TE7H 2GK0B 2IEPA 2XTJE 5D2LF 2BSED 2IBZX 1OP5H 4TTDC 5GQBA 3RL1B 4MB4A 5JXAL 4PJIF 5EULV 5F9DC 4KZEL 3NN8A 1CYGA 1Q0YH 5SV4A 2X89A 3HAEH 4PP1C 3S88L 1DEDA 3RQ3A 2GFBA 3ULVH 2YRLA 3BPCB 2I25N 3K81A 2DQUH 3FB7A 4FTVE 5F6IC 4G8GD 4U7SA 1TZIB 8FABA 5DC0A 5TFSL 1H15B 1S7QB 1S7VA 3H9HB 4Q2ZA 4PGCA 4WWKB 3WN5B 5E5RB 1GAFH 4JQXA 4EI5D 5F3BA 4D94A 3G5YB 2DN7A 5F70A 5AG9A 3S36L 1H3PL 3QQ9C 4D0DA 2YD3A 5F7LB 2VL4A 2IALB 1E4KA 2I26N 1F58L 5JDJA 3VXRD 1EHLL 2OM5A 3Q6FA 1Q94B 4F7PB 4RFEA 2MHAA 4RGNE 1UJTA 5T5FH 3HE6C 5K59E 4PJ8D 3RI5K 1WCBB 2E3VA 2O93L 1E28A 1NDGA 2ICCA 4LOUD 4P2QD 5T3ZL 4A6YH 4NN6B 5BS0E 1UXSB 1AXSB 1OAZL 5DD6B 2BHUA 2J8UB 1XCTB 4NNXB 5DQJB 1IAII 1Q8MA 3J7HA 5GXBB 3PABA 3FONA 4X4ZA 1MPAL 4KTDL 2WV3A 5I9QC 1FDLL 2IG2H 2XWBB 2HT4D 3LN5B 2DI8A 3Q5OA 3NIDE 1JN6B 1RZGB 2DICA 3W11D 3RVVC 1YNLH 3SGEH 1NCBL 5IVXE 5DJ8A 1PVHA 5FA3A 3RY6C 2A9NH 5LWYL 4U05A 4ONOA 1I3GL 5I73B 3ULVC 1LK2B 3CLEH 1RZJC 5E8PA 3V6OC 4BSVA 3BOVA 4P57A 2A6IB 2HTLD 4YDVA 4DTGH 1DN2A 4JLRB 4X5WB 4NM4H 3D1MC 2NY4C 3JWDC 4MJ5B 1HH6A 3V4VH 2WINB 1CDIA 1CLYL 1OLLA 2YUVA 4M93C 3IDGB 1D3CA 2EDWA 2BSSB 1DEEB 3BEVB 2RCSL 3SPVB 4HEPG 4DUXA 2E7CA 2BY2A 5D5MA 4UIKH 4IDJL 2Q6WA 1H9VA 5IBUB 3HE6A 4LL9A 1MJUL 1V8HA 3I84A 1YEKL 4S1DD 2YWZA 5FM4A 5HHVL 2KZWA 4BUHA 4OCSL 2A0LD 5ECJE 1LHZA 5JPMA 1ZWIA 1FNEB 5D2LE 4LLWB 1E6JL 3GMRA 4JRXE 5J89A 4QRRA 4OKVA 5LVEA 3BVNA 3IGAA 1UM5L 3TWCH 3ULSA 3VFMB 1S78C 1ZE3C 4GKNB 4YGAB 1YYLL 1ZLUH 5EBLB 4QXWA 4MMZC 4CBPA 5C0CB 5C0DA 3D3VD 4WTWA 5J13B 1NGQL 1EHLH 3RY6A 2NLJA 5EC2A 2J88L 1MCBA 3KR3L 3MOAH 3RAJL 4DEPB 5KVFH 5AD0A 5BMFH 3SY0A 1RMFL 5DS8B 4E0RB 1G1YA 1FFOA 7CGTA 1L0XA 1A1NA 5HGAA 3ZLQC 4ZYKA 1FE8L 2X70B 1IAKA 4P4RA 4PJCB 1R5VB 2QR0B 4Y5VA 2VE6A 5DZLA 4R4FH 1HZHL 5GGUA 3QEGL 3KHOA 5DZNA 4C57C 5IFJB 3LS5L 1HI6A 1I3RA 4RSVA 3HPJB 1XGTB 2JK5A 5IQ9A 4YAQB 4RGNB 4LCYA 5CEZD 3A6BL 4GBXC 4HKJA 1A4KA 1CFNA 4O9HL 5E2TH 3GI9L 1S7XA 5FK9A 1IZKA 1BJ1J 1JMXA 5HHOB 1P53A 4NUGL 43C9B 1D5BB 1RIUH 3GUTA 4X80L 1KBGH 1Z9MA 1F3JA 2JJSC 2CO7B 1BD2D 2NZ9D 4ORGB 2X4SA 1DE4A 1AH1A 3RU8H 2O5YH 4GXUN 4L9LA 4CADB 1FZJB 3B8SA 3HLAB 1Q9KB 2FJFB 3BYTA 1SYSA 2Z9TA 2EXYD 5L88H 4O4YL 5JTWA 5E8OA 1WF5A 3CZFB 5DJZA 4YPGB 5F1OB 5BVPH 1A6AB 4OF5A 4UDTA 4QXUL 1WWBX 3Q6GH 2PYFA 3ARGC 3V5KB 4O2FB 4M7KL 3VMNA 2CRZA 5D1QC 1XR9A 4W4OC 5D2LA 2WZPD 3FQWA 5HYSA 5C08B 1KYOJ 3V8OA 1A5FH 1RIVH 1QFWI 1OGTB 1DR9A 1D5MB 1YECL 3WN5C 4MD5B 3ARGA 4LSQL 2XOTA 2BFVH 1N2RB 4JPIA 1ZS8A 4R97B 5E8NB 3WDIA 4BZ1L 5C6TL 1EUTA 4YXLL 3PUCA 4HWBL 4PREA 1JNNH 4FFVC 5KVDL 4RX4D 4HWEH 2HN7A 3QULB 1Q0YL 4G9FB 2P44B 4ZTOH 3GM8A 3MFGB 2Q1EA 3B5HA 3X12A 3RZCB 1T1WA 4WUKL 1OP5K 1XR9B 3BJ91 4R0LB 3RPKA 3MA7B 1CE1L 2AK4B 4M93B 1RQ5A 3MUY1 1BZ7B 4LPYA 4LGSB 2H6PA 3P4MB 1WTGT 3VXSB 1DBAL 2XQBH 3JUZA 2DQIL 5CINL 4NZJA 2AEWA 3UX9B 3BH9A 1JFQL 4GJTB 3HS0A 3U36B 3QG6B 2H2PC 1A7RL 2JE8A 3QCUH 3TPKA 4ENED 2NX5D 1IGML 2E9WA 2P5WD 3IDYC 4XP1L 2DAVA 5IM7A 5JLZB 3BDYH 4OGXL 3R1GH 5JW5A 5MEQB 3BP5A 2BHYA 2W65B 4GAGL 1BFTA 1RMFH 4F33A 3VXSA 3LN9A 3KPQA 1YEHH 4I3SH 2AK4E 3VWJB 5HI5D 1GC1H 5C0BD 4PJEE 2VSDA 3EIFA 3LV3B 1NBYA 5JW4Q 1FP5A 2EXWC 4HIHB 4WU7A 5J06A 1TCMA 4L3EA 4AM0B 5JW3H 3RZCA 4ODTH 5KSBE 2XZAL 3HRZA 4YHYC 5KVMC 3E1F1 5GS1A 1U8NB 3KPOB 2YN3A 1S8DA 3EKCA 5I8OH 5HYQB 4Y4FD 3S9DB 2F5AH 1LD9A 1AGDA 4ODSH 4HK3N 4FZ8H 3H9SD 3G5ZB 2I60L 4XC1H 1UJ3C 1JNJA 1AGBB 5GZOC 2WBJA 4KUZH 1RULH 1SY6A 4NRYA 4UT6H 2MFNA 2NZ9C 4PRDA 1UB5B 5HVHC 3QEGH 2IANB 4MJ6A 4P23D 3AVEA 2GSGA 1AKJD 1JNLH 4WI4A 2UUDH 4KJWD 3WIHH 3WFEL 2DLHA 1IGJA 1C5DB 3HKFA 3IVKA 1A21A 4I2XE 4OF8A 2DJ4A 3LIZH 4X8JA 1FL5B 3ZKMC 1DLFH 3KR3H 3QWRA 5ETUA 1T20A 4OCRH 4Y4FB 5FO9B 5I1IH 3BSZL 1W2KT 4MJ6B 4Z7VA 5EIVA 1VA9A 2OJZH 4IRJC 2VUOA 3D2UA 3UTQB 5DD1L 3WNPA 3MLXH 1MFNA 1LP9A 3U0WL 4OV5B 4LF3A 3OF6D 5KN5B 5IKCA 2ZUTA 3IVKB 2ORBL 4NJ9L 2Q7YB 5A2JH 2ATPA 3L5XH 4NRYB 4EIZC 4YZFE 3ILQC 5KVGL 3C87A 3KXFB 5E2WH 5GZOD 3LRSB 4HS8H 1SJEA 4FFZL 4YZFF 5EZJB 1QSEB 4PJ5E 3GMOB 3TPUA 2DM7A 4U1NB 3AU1A 4Z18A 4HK0B 4P23C 4AY0A 3HE6B 5ALBL 3F62A 5ISZA 2ZCKL 4O2EB 4Y2DC 3MJ8B 4CL7A 1A64A 5E1AB 1NGPH 1MRCL 3MV11 5IWLA 5C6TH 3WE6A 1NAMB 2ZUXA 2VAJA 1GPOH 2YUWA 4YIQB 5JIKA 4GAFB 4U6XB 2HA1A 2WIMA 1ORQB 3H3BC 3VI3F 3O3EB 1VFAB 1INQA 4WWID 3WDJA 1LE5B 4NQEA 4WY7H 4B5EA 2VQ1A 3O6ML 4HJ0C 4HFWB 1EFQA 5EFIA 4XNQA 3UO1L 4I77H 5GRVL 2B4CH 4WENB 1LO2H 5ITBH 4D3CL 1CD1A 5HDOA 3JWNC 1VCAA 3GKZA 2EDTA 2Z93B 2UV3A 4XNUL 2XZCL 4LHUA 4RGOH 5IG7B 3CFDB 5AUMA 5C07E 5C08D 2C1PB 3CIQA 1I8LC 5F7EL 5E9DE 3K4DA 3MLZL 5L2KE 2D31B 1BJ8A 2HVKB 5GISH 1MIMH 1RJLB 5LG1A 3LEYL 4OD2B 1JGUH 2APTA 3TYFA 2D7QA 2YPVH 4S1SL 1KPRB 3WEXA 1CD1B 4OLYH 4YK4B 2VLKB 1DQQA 3W5MA 5JZ7C 1LE9A 5A3IC 3NCJL 3C9NB 3AS1A 5HVHB 4JY5L 1J87A 4S0SD 5JA8B 3IB4A 2ZKHH 3CMOL 1YY9D 4Y1AB 5E6ZA 2EZ0D 2SEBB 4U1MB 1FL6B 3WBDA 3STZA 5IV2B 1BFVL 5CAYB 2OMNA 3LKQB 3JWOH 4I48A 1RVFH 5DJZB 1IFHL 2GT9B 2H32B 4NGHH 1FNHA 1OD7A 3UPRB 3LY6A 1SYSB 4OUOA 2Z92B 3FAXA 3UJIL 3DI2B 5E8OB 4PJEA 1DQDL 5EBMA 1KIPA 2BNQE 5J6HB 3EJJX 5H35B 4ZMAT 4LHUD 2LTQC 5HYJE 3ULVF 1TFHA 2R2BA 4LASH 2VLLA 5E8NA 1QLFB 4IJ3B 5J1AA 3UAJD 1P9MA 4AEHH 4U0RB 4XVUD 1KCVL 3B9VA 5CUSH 1IGFH 3PGCB 1S9WB 4DZBA 2VZSA 1A4JB 3HMXA 3VMPA 5FF6A 4PJGA 1PSKL 5GJTL 4UIKL 4P3DA 1A3LL 3RVTC 2DQTL 4FABH 3V6OA 2FH6A 4L3EE 4ZUTA 2NY0D 1BVKA 1F42A 2ARWA 4H0GA 1LQSR 5IW6A 3DURB 1YJDH 3TH2T 3QPQD 3K8MA 5IVZB 3VWKB 2QJDA 4MJIB 3U7WH 3BN9D 4UT9H 3EFDL 1BFOA 5KVGH 1YNTA 2FIKB 5LXGH 1NSNH 1NEZB 5ISZD 1H8SA 4HPYH 1OLZA 1HDMB 2H3NA 3F6IA 1F4WH 4LLQB 2VWEC 4NC2B 4JFFB 5ADOL 1BVLB 3V52L 4AIZA 2IADA 2OR9H 2XA8H 3G6JA 3EO9H 4FQHB 4XPHH 3RTQA 3LKNB 1NUNB 3VGFA 3CXHJ 4ZFGL 4NQXA 1MFDH 2HT2C 3FT4A 4NNPL 3KLHC 1E27A 3MTRA 1YPZF 2PXYD 4XP6H 3LVEA 1I8MA 1T4KB 1HIMH 4YFEA 1MSPA 1MCQA 1UCBL 4FZEL 1ADQA 2FLRT 1WZMA 5L0QB 3KLHD 3M8OL 3VJ6A 4N1CA 2W0KA 2OTWB 5F9JA 1H5BC 5D7IA 1RJYA 2DQDH 2X1QA 1U3ZA 3QCTL 3HNVH 2ADGA 3EYSL 3SGJA 1RY7B 1SEQL 4J3UA 2P5EB 1GOHA 2XT1B 4DAGL 1ETZB 3CC5A 4XCEB 3T2NH 2NXZD 1R3LA 2OBGA 4MJ4A 2PKDA 2VLRE 2NY5C 4I0PB 4OCYL 5HJ3B 3FFCB 1AKJA 1FYTB 1OP3H 4HF5L 4R7DB 3QIWD 3MV7A 3T3MF 4BKLB 1IAOB 4WCYH 2G5RA 3RWFA 2D0GA 1JCKA 4YWGH 2VC2L 1I3UA 4PB9H 4JDZB 4CJ1A 5L0QC 1TLKA 1KN4H 1J10A 1TJIH 3H9SA 1IAIL 3C09C 3QI9B 4I0CC 2FX7L 2O5ZL 5DJ8B 3V7AG 3FRUA 3QHZL 3T3PE 1LO0L 3UTZB 1RK1A 4ISVB 1CICC 3FO0L 5JORA 1OB1A 3AB0C 5I19L 1G9ML 5DEGB 3KLDA 1GIGH 2VABB 3K2MC 3N85L 5EOTA 1XF2B 4JN2A 2RFXA 4XPAL 3MRRA 4LFHG 4P46B 1I85A 5E8EA 5L8JB 4LF3B 1RZJH 1SMOA 3PJSB 4JRXA 5HHMB 3TIEA 2UWEE 3KPMA 4E42B 1PYWB 4EN3D 4G9DB 4PGEB 4YQXH 5KTEH 3WFCL 1LP9B 3EO9L 3S35H 4N5UA 4JRYB 1WWCA 3SE3C 5GGSY 4PGCB 3WN5A 3ZHKA 4HBQA 3B2UD 4N8VA 3OJDB 4IIQA 4PGJA 1KTLB 1ZSDA 4MA3A 1YMMA 1IM9A 3CK0L 1FNLA 4GRLC 4QO1A 3HUJF 2CLVB 2P5WA 2W59A 2FCBA 3NH7L 2JJTA 1CXKA 4LSUH 4OF7A 3QQ3A 1KCUH 1U42A 2C9AA 3IDXL 1FO0B 5C0IB 3U2SB 4X6DB 4M3JA 5IW1A 1AD0B 4G9DA 2DIBA 3MPCA 4W6XB 1UGNA 2ED8A 1S7WA 2YA0A 2X4NA 2BHZA 3VXPA 1X5GA 1ZVSB 5L7XH 4HS3A 4YGVB 3T4AB 1JZ4A 3VH8B 4DKDC 4DOHB 2Y5TA 5B21A 3C5ZD 4KY1L 4ORZC 5DS8A 4E0RA 5FGBA 4GKZB 1HXYB 3BPCA 4DWHA 4RA0C 5DEGA 2LV4A 2GHWB 1VGKA 1WUNT 2FWOB 5AZ2L 1A9EA 4UBDC 5T33L 4TUJB 2ZG2A 4RMUA 3CCHB 5EFIB 2J8HA 3MV7E 1FZJA 1K8DB 1A7RH 3IFOB 3C5SA 4LSQH 4HUXA 2JIXD 3QNZA 4LSDA 1CGSL 3ARGD 5B38B 4DVRL 4OFVA 3MRIA 2DQGL 3NCCB 2GW5A 5HBBA 1VADA 4ZFZB 4X6FA 1Q72H 3MOQA 4MXVE 12E8L 1BQLL 1IGTA 3WL9A 2ZPKH 3O2WL 1T0NB 2ILLA 4YPJA 2AJVH 4QXGH 4C83B 1NMBL 3VFNA 4CUCA 3F7YA 3S36H 5F96H 1OQXA 1N3NB 3GGWB 2HYMA 3O8XD 4LLDA 4UDTB 2DM4A 4OFIA 1LDPH 3ULVL 3GB7A 5JOPE 1FFPA 2EIEA 1XF4B 2YPKB 3PIQA 2FD6H 1FFQA 1BD2A 3QDGD 1L6XA 5BW7C 3NH7H 4WFGD 5IVNA 3QUXB 3QXAB 3QNZB 1GZPB 2D03L 3VRJA 4WW1B 1SEQH 3ECBA 2EO1A 2HN7B 4JQXC 1QOKA 1KPUA 4YHZH 2GCYA 5ENWA 3SGDI 1HKFA 2APWA 4W6WB 3QUYC 3UEZA 4ALAL 2NW3A 5I1EL 1LDSA 3V79C 5BS0B 2DBLL 3G08B 2DL2A 1KIQA 4OAWA 4L8SA 4XP6L 3WXVH 1OAYL 5EOQH 5C6WH 2IJ0C 5EA0L 5I16B 2ERJC 5TQ2L 5F1IA 5KS9B 2LAAA 3BUYA 3TT3H 4CVWA 2PXYB 3O6FC 1N5AA 3LB6D 5FV2A 5EPMB 3DGCR 2MNUA 4HZLA 2FR4B 4AQ1B 3VA6A 4NFDA 3RWDA 3IDMA 1NGZB 1Z3GH 2PETA 2Y6SD 3KYKL 4KJPC 2ZG1A 4KI5C 1FZOB 4AG4L 3QDME 4H25A 1AO7E 1KUMA 1MJUH 1U93A 5CSZB 5D1ZC 3L5WA 3KPOA 4LCCC 4XB7A 1FLTX 4Z78A 3MYZA 1R5WB 5DK0A 1NMCB 2DKMA 2ADFH 4LRNL 3BW9B 5CSBA 5B3NA 3CXHK 5EU4B 1G7HA 2W60B 2UUDK 3VFOA 1NBYB 4HDIB 1QFUH 2VAAA 5LWYH 3TH3T 1A02N 4D3CH 1F4AA 1BQSA 1U8HB 5DSCB 1DFBL 5D2LB 2CDEA 4UTBL 5I6XB 3MOBH 1C08B 3IRPX 1MAML 3TT1H 5I18L 1S8DB 4WTZA 2E7BA 1EA9C 4KTDH 3BH8A 2VDOL 5FDYA 3QDGB 3IKCA 4FXKA 4OLWH 1ZHLB 2HKHL 4K7PL 5T1KD 5HHNA 1U3HD 1QHOA 3IETA 1V7MH 4HC1H 4UV4H 4ZFOL 2BVQA 1P84K 4AENB 3RWDB 1XGUB 3DV4B 4RNRB 2YXMA 5TDPA 1K6QH 4G8IA 1OWWA 1DN0A 1M05A 4POUB 2B2XH 2R23B 4PJ8A 5EBGA 3BRFA 2ZUSA 1JBJA 4MB5A 3OKYA 1IFHH 1O7SA 1ZGLM 1J12A 1IGCH 1TQBB 1DANU 1JHTB 1DQJB 5DXWA 2IH1A 1J1PL 1XIWA 3DWTA 1IL1B 2RAMA 2HT4C 1I7RA 3CFEB 1R3LB 3LS4L 4L4TA 1S9XA 3EO0B 5IROC 4TSBL 4JZOB 1NMAL 5HJ3A 3OPZL 1DLHA 3TGXA 1ZS8B 2CXGA 4ZUVB 2EZ0C 1Z3GL 4Y5VC 4PREB 3B2VH 4JFEB 2DQFA 3FT2B 4GKOA 3WJJC 3A6CL 3SKOA 1I9IH 5BQ7B 3VWJC 1NMCC 4LARL 4GS7C 4JFDB 3T4YB 1J1XL 4XCCH 4P48A 2F5BH 4OZFG 4YBLC 2VLKD 4G8GA 4GW5A 1G7MA 1C5BL 3DVGA 1A3RL 1UYWH 4D9RE 3D25A 5I1EH 1QG3A 4FQ2H 3TVMB 5AYUH 2Y4SA 2A77H 4Z0XB 4QHUB 4GRWB 4JRXB 3TYGL 3P4MA 2Y23A 5F6IB 2XPGB 4GRMA 2DKSA 2EICA 2JF1A 3SKJL 1G7QA 3HZKA 3ZKQD 3AFLA 5HGDB 1U8QB 2CSPA 4YHPA 4K94C 4PJEF 1XIWC 3UC0L 1JGLL 5SX4H 4B7IA 5IBTH 5I1LA 4OSUL 4NWUH 4Q9BA 1FHGA 3OAYK 4ETQA 1KLUA 5DF0A 2QBWA 5IB5A 3Q6FB 1MRFL 2A9ML 3DBXB 1WZ1L 5ID1B 3DUHA 1IKNA 3EOAB 2DJUA 2GJ6D 4DKFL 5GRJH 5KG9B 1L9MA 3P9LB 4K55A 3CSYA 5BCAA 1N7MH 3NCMA 1KJMB 2QTEA 3JTSA 1OWRM 1UH3A 3ES6A 3KPNB 1JPSL 3LEXA 1CLCA 4OCNC 5DRWB 5E99L 5GGSB 5C09B 3VWJD 5D2NA 1AO7D 2Q3ZA 1NCWL 4MDJB 2R15A 2X4NB 3VFRA 2YN5A 1JN6A 1RZGA 3MREA 4NHUB 3TN0D 4CJ0A 4JQVC 1JHKH 1JZ6A 3HNSH 3DUSA 5JHDD 3BGAA 4G5ZH 4LSRL 5LBSL 1QD0A 3ARSA 3EJZC 3BDBA 4MHHG 1S7SB 3NAAL 2AK1L 2EDJA 3QUKB 2BZDA 2V7HB 3ALWA 4M9PA 1FG2A 4N5ED 4XX1G 4HC1A 3MRKB 5I1LB 1TVDA 3FFCD 1F8TL 2HRPH 4JCLA 3MOBL 3HTLX 5BOZG 3AM8A 4TVPH 5I76A 3NCFB 1AGFA 2BNRA 3VFVB 4LCCB 3FB5B 3DETD 4ZUWA 3ABZA 5B22A 1SYVB 2ATKA 3HE7A 4M1CD 1WITA 3ARFC 4UAOC 5EUOA 2H8PB 1MCKA 1SY6L 4AJ0A 2V9QA 3GHBH 4ZTOL 2DBJA 4WTZG 1UA6H 3RX8A 2VIRA 1JPTH 1JWSB 4LRNH 1M7DB 1B88A 4JQVA 5CGMA 3QFJD 3FMGL 4YC2B 4ORGA 2X40A 4PS4H 3U9UA 5HHOA 4NCDA 4HV8B 4JRWA 2KBGA 4PV9A 4R4ND 4N0RA 5GZND 4OGAD 1BEYL 2VR9A 4OCYH 5SX5K 1WBXB 4WW2B 3SHSA 4KUZL 4Q9QL 5E6IA 1CDYA 4M9OA 1WIPA 4NUJA 2VE6B 4I1NB 4MS8D 4M1DL 4DEPC 3PGCA 4DZBB 1P84J 4FZ8L 3CVHH 2YD9A 3B43A 5KTEL 3RVUD 1MELA 3MLTA 1TJGL 3BZEB 3SJVB 4LNVA 4L3CB 4NQCA 2V2WA 3PP3H 3GJFH 2A0LC 1H0DA 4JGJA 2B5IC 3VFGH 4MNGB 1ZLUK 4XH2A 3U7YL 1WBYA 4MXQD 1BVKB 4P0DA 3RVUC 1Q1JL 4N0FB 1L7TH 1G7JA 5I1AA 2OK0L 4NT6A 5DR5H 3G9AB 5DO2C 2EDDA 2VKXA 3JV5A 1W0WB 4Y5XA 3UTTD 1U3HB 1F00I 1VFAA 3P0VL 3SE9H 1X3DA 4Y19D 4MYWB 1T2XA 1RU9L 2YK1L 3HFML 5FM5M 2OYPA 3IAPA 4M7JL 5A2LH 2XQYK 4IIQC 5F8QC 3Q5TA 4X83A 4R3SB 4JKPL 5J13C 2NY3B 4M5YH 3QEUA 4Z78B 2R1XA 1XF3A 4KI1A 1U6AH 1G0XA 1S7TA 1XF5B 4QF1A 4KXZH 4YEEA 3OKKA 3JVGA 2VITB 1N6UA 4XAKD 1OW0C 3ULUH 4KWUA 3U7AA 5JQ6H 3BDXA 3WO4C 4J12A 4C56E 3MRBB 1R5WA 3HNSL 3OTTA 1Q9OB 5D7IE 2XV6B 3MLTB 1K8IA 4MAUH 3RGVB 5GGRB 3CX5K 2FNBA 3BD5A 3MACH 1N5YL 5FGBC 4DZ8B 1KPVA 4BSWA 4Z7UE 2HTKD 2P24A 4F57H 5BVJA 3W39A 1X5ZA 3NVQA 2L4OA 4PRPD 1RZFH 4F2MB 1KCLA 2NY4B 4HX1B 5MHSD 4NN7B 1UB6A 3D85D 3L5JA 3QXWA 2VDQL 5JW5B 2B1HL 3NN8B 1A6TA 3PNWA 4M1DH 4WI3A 1E4XI 4M3KB 5C2BH 1KB9K 1PW3A 1AGEB 4M62L 4PRIA 1J0YA 4P3DB 3TH4T 1F6AA 1FNAA 4IEFB 4EVNA 5BS0D 3MROB 4G8FA 5HYJA 2VTFA 1P7KA 5HDBF 4G5ZL 4U1IA 3RWGA 2ZJSL 1P1ZB 6CGTA 4RWYL 2IAMA 4JVWA 3N1QC 4PJEB 4IDLA 3DSNA 2CRYA 3NGBC 1SBSH 5CCKH 3MODH 1EV2E 1KB5H 1RSFA 3MMEA 3FQNA 4PR5A 5JXED 4WFFE 1CLOH 3NABH 1BIIB 4ODXB 2WW8A 4M48L 5TE6H 2HJLB 2XG4A 5C7XL 4MNQD 4WO4D 1ZLSH 1AXTH 5HHMD 4MJIE 2Q86A 4NP4H 2D7TL 2IGFL 4K9EL 1YECH 3CSPA 3TBTA 1P1ZA 1WAAF 5D1XA 4MCYB 2OSLB 1A6ZA 3LQZB 5BRZD 4BZ1H 4GLRI 3O6LH 1KCSL 4XP4L 4HIJB 1VFMA 4P5TA 1QNZH 2H41A 4APQC 3T0EC 4PP2B 1A5FL 3CFBA 4YGVA 1TVHA 4PR5B 4RGND 1OTTC 1HZHH 3PWVA 2D4FA 4E41D 4JFHD 2BNQA 3EOYG 3RP1A 5DVOA 3MRLA 5IMMB 5D1QD 3ARTA 3QDJD 4KK5C 1I4FB 2VDRL 2XTJD 3B2UC 3NTCH 4NGHL 5C9KA 2AJUL 1CFQB 2GJZB 1DEEA 3BEVA 4RISH 2G5BB 3MJ7A 2FL5A 5D5MB 3RJDA 5TDOB 2LTQB 4EN3C 1ND0A 4C55A 2AAVA 1I9EA 4U1GC 3TJEH 5I1GL 1N8ZB 3KXFA 3UYOD 1UVQB 1QQDB 3GMLA 3GKWL 3P0YL 2G60H 3PQYD 1KSRA 3DNKA 5FYKL 3D39B 5FGSA 4TUJA 3N0PB 4LLMA 5H8DA 2E5EA 1HSBA 3AAZB 3MXWH 3U0TB 4ZFFB 3MJ8A 1EHXA 4APQA 1XGTA 1KJVA 2IQ9H 4GRWE 2LU7A 3NPZB 2DYPB 3L3GA 4ELKB 4KAQL 1A7NL 4U1JB 4JG0L 3BX7C 4F58L 5KAQF 1MUJA 4S0TD 1RK1B 4KK9C 4H5SA 4FQPA 3C2AL 4HLZG 2OLDA 3O3EA 1QBML 1RU9H 5KZCD 5GS0H 2XZAH 3H9ZA 3K7UA 4PG9A 1MI5D 2UVEA 3V5HA 4X9HA 4GQ9L 3MRRB 3G6DL 1J7VR 3MFFB 3MV8B 4JFFD 1ACZA 4H1LH 3RDTA 4MWFB 1YEGH 5IQ9B 3TA3D 3Q5YA 3IDNA 4LMQI 2X70A 3W9EB 4AT6B 4Z0BH 3VI3E 1YMMB 3WIFB 4OLEA 1B4JH 3IKKA 2GKIA 4O2FA 4GUPB 2YD6A 4V1DD 1MH5B 2YA1A 3SDAA 1T21A 4CN6A 3P4NA 1C1EL 5DVKA 1A4KB 5E5UB 4MQ7B 4RGMB 2XA3A 4ZFFA 3G6AA 5F9WC 5KOVC 1KJVB 1AC0A 1RV6X 1TZGL 4Y19B 5KW9H 5DHXB 4NZRH 3EFDH 4JO4L 1CD8A 4IRJB 5T1LA 1NCAH 1JPFB 2Y1VA 2WP3T 4HGMA 4L9LB 4XNQB 5HXMA 5HVWA 1OSZA 4LCIL 3ILPA 2VIRB 3D69A 5IT2L 1F58H 3K8KA 4GUPA 1GCFA 4HIXH 4PG9B 5D72L 1KCRL 5I9QB 2OZ4L 4XVUC 1DVFB 2R1WB 3GEWB 2E27L 3KJ4B 1IEBA 3QIWB 4JZJB 3S96B 3RVTD 4DOHE 1R3IH 1PSKH 5D7LB 3H8NA 4P5KB 3FQRB 1JJUA 3MLXL 4J4PD 3SDXF 4XMPL 1M7IA 4P5MB 2WINA 1EO8H 3QQ9D 3SDCA 5EPMA 5JW3L 1T5XB 3UJTH 3DTXA 1G6RB 2BSTA 5L2KA 4LAJH 3ARFB 1WC7B 3TBSB 5IHBA 4PRHA 5ID0B 2JB6A 1A1MB 1TVBA 4RMRA 4Q6YA 1C7TA 3QHFL 4N0FA 1FH5H 1F4WL 5DFWH 4TUOA 5DWUL 4F33B 3QUMH 2FWOA 5HYEA 5DFVD 5EC1A 3LKQA 2CKBH 1XR8B 5BO1L 3GIZH 5A2KH 3IAGC 3G5VB 3EHBC 4ODHL 1F11A 3CFCH 5TPWH 5IVZA 3O6MH 3OX8B 1FG9C 3GSVA 2ZOLB 1FAIH 3QUYB 1BLNB 4L5FH 1U8LA 1ITBB 5FB8B 1WEJL 1BBDH 4PJHB 4JANA 4LCWD 1AXTL 4FG6C 2FIKA 5D2NC 3BGFB 5I1GH 4WWKC 3STLA 1I7UB 4M6MH 4DKEL 1CBVH 5C3LD 1W0YT 1VGEH 2GSGB 2HLFC 1A7PH 5ESQA 1UB6B 2LE9A 2PYEA 4L8DA 1AQDB 3VGDA 4PJ9C 3NTCL 4PJIA 3EDDA 4KI5E 4NJAL 4U0RC 4WHCA 4KPHL 3EO1A 4JFFE 3BE1H 1AIFB 3OB0K 1P4IH 3UZQA 3QDMA 3ZKSD 3CLFL 1TCRA 2C3GA 1UZ8A 4XAWH 3EO0A 1UJ3A 4DGYL 4XHJC 4DJMA 1WWWX 2IQAB 4PRIB 3UJTL 4OI9A 1H3XA 4C56D 2XPGA 4GRMB 4EI6A 3OX8A 3GJEA 5BQ7A 3M07A 5DQ9B 2F19H 3L3HA 1A7OH 1U8LB 1B4JL 4ZXBA 3QPXH 2V7NB 4XCFL 3EO1B 1IEHA 2BNUB 3OQ3B 2JJVA 3DVGB 1PG7H 4PJHF 1YDPB 2P5EA 4MA7H 4M6NL 5GS1C 4PJFF 3O45B 4YHIB 1CK0H 3DMMC 3NZ8B 4MQTB 3SOBL 5KS9A 1RZIB 1Z9LA 4JAMA 15C8H 1NGXA 2Q20A 1KULA 4DN3H 5GIRA 1MCCA 3FN3A 3QXDB 1IAOA 3JTSB 4MA1B 4WUUB 5TGBA 4RAHA 4DKAA 5D7IB 4J4PC 2OSLA 3B9AA 3UTZA 3G6JF 5IB2A 3ARBA 4LSUL 3VFSA 3WE6B 4FQIL 4M5YL 2WIIB 4HH8A 1HILB 3ZE1F 1PX4A 3NIFE 4AQOA 1QSZA 3VD4A 4R26H 1CICD 3EYFB 3QIUD 2CRIA 4O4YH 5JW4R 1DJSA 2WSKA 3MOAL 5KVFL 3KXFE 2F54E 3PJSA 3TIEB 5BVPL 1EK3A 3U36A 5BMFL 1KCKA 1T6WA 4OIAA 3LRSA 4ZFOB 3D18A 3WCYA 4ERSL 4ODVH 5D6DC 3VFSB 3RUGA 2EDLA 2B20A 2IANE 3VGGA 3OJDA 3OHXB 3LKSB 3HC0A 2AP2A 1ORQA 5IESL 3P0GB 1UFUA 3EYFA 1MCPL 1NC2D 3K1DA 1ACYH 3SKOB 5E7FA 5HGHA 1FL3A 2H8PA 1MLCA 3V52H 3O41A 3CMGA 3FONB 1HHIA 3C09B 4PBWD 5T1KB 4DW2L 1XH3B 4GG6F 3AUVA 4GKZA 3FOLB 2DYPA 3MCLH 1HSAB 1UM4L 2D9CA 4G6AC 2DQEL 1NKRA 1HOCA 3U9UB 5EN2B 3X11A 3AMKA 1YEIL 1X5AA 1H3GA 1WCBA 5E8PB 2APBA 1P4BL 4HWNA 4LSSH 1ZLVH 1N6VA 3CFIC 4YHOL 4PJXA 1X4YA 5DURD 1FNSH 4NUJB 5FUZL 3WXVL 1CCZA 4DFIA 3QIUA 4LU5H 2XG5A 1XH3A 2CR6A 4YUEH 4P9HH 5FYLH 1A14H 2FYYA 3WS3B 1F3DJ 2F9BT 2YZ8A 4WU5B 3NACH 4XP1H 1ZMYA 2P48B 1KIPB 5J0BA 2PTVA 4M1CC 3WD5H 2XWTB 3BDYL 3T4AA 4BK5A 2AJYH 3T0EB 5IB3B 1D6EA 1EHAA 3JZ7A 3KPRA 3ARBD 2FHBA 3VGAB 2SEBA 4FRWA 4U1MA 4ELME 1YEDB 2D03H 5ACLA 2R2BB 1T20B 5K9KA 4Y5XB 5HDQH 5F7HA 2VH5H 5DD5L 3RWEA 4HG4J 3PWLB 4EDXB 1S9WA 5BXFB 5IFAL 4OQTH 3VD9A 4KJQD 1UWEH 4M1GH 1TTFA 1W0VB 1O5DT 1CTOA 2Y5EA 4XBEH 2PR4H 4R97C 4OLVH 3TNMB 2FJGA 3C6LA 1EGJA 3RL2A 4OZ4B 2I27N 1CXFA 3KAAA 2XRAH 3BEWA 3GK8H 2D0FA 3GMRB 1N64H 4ZXBD 5IVXA 5KSAB 1A7PL 3SE4C 1NCBH 4P2OB 3T2OA 1JTPA 1PKQE 3V6OE 4QRQA 5D2NE 2WUBL 3T0ED 3HI5H 3B3IB 4C56A 1EIBA 1WFUA 2CD0A 4V1DE 1KPUB 3S88H 4TVPD 4PJGB 1W0VA 1F5WA 4WW1A 5F1SA 3UROR 3KJ6L 3BWAA 3L95B 3DSFH 3TBSA 2C7UA 2W0FA 1N3NA 1J0KA 2EYTA 3FQXA 4K7PX 3MO1B 5ID0A 4XAWL 2J5LB 4MHHI 2YC1B 3LH2L 4WNQA 1KIRB 2EE9A 3O9WC 4MDJA 5L2KB 5T3ZH 4TOYH 5IVXB 4X7TB 3G04B 3U1SL 1V7NH 2E6QA 1TIUA 1JFQH 2PYED 1LO3L 4G6JL 3CDCA 4Y7MA 5EC1B 4JGUA 3IFNL 4MX7B 3WJLA 3NCYS 5CEZE 4LU5L 1HNFA 2F54D 3K80A 5JIIA 2ARJQ 3TP4A 2QADD 2XYCA 4LEXH 5L7XL 1C7SA 4J7RA 1U91B 5C8JB 3QUMA 4G8FB 3R8QA 4QTIH 2R39A 5LQBL 4K9EC 3RWGB 5F3HA 5JMRA 3TV3L 4F7EA 2R2HB 2HT3C 3BW9A 1GHFH 3AXLA 3C5JB 5IFHL 1JUFA 3UBXG 1QBLL 4TSBH 5DMKB 1UQSA 2XKNA 2DLTA 3KG5A 1EMTH 4Z7QE 2QV2A 3KPSA 1HCVA 4Z76B 3F7VB 4NWUL 3HNTH 3L95A 4WI6A 3TNNA 2QSTA 3VXUD 1ZA6A 4BH8B 3JBG7 3MROA 2PN5A 2QLVB 2YC1A 4JPWH 1RZKC 1F4XL 3RBGA 5TDNA 4ZS6C 3CX2A 3VE0A 2YHGA 3X13A 4BQCA 5EU5A 1ACYL 1DQTA 1T1WB 4GS7B 3ZE0F 1H15A 3H9HA 3NA4A 4Q2ZB 4ZQKB 1WK0A 2VQTA 1QEWA 2R4RL 3EYVB 3SJVD 4LVNB 5I74C 5I1CH 4M61A 5F97E 4X9GA 1OB1B 3MRNA 3DXAD 1C12B 1NCDH 3WLBB 5DHYB 1ADQL 5I0ZA 3E2HB 4HUVA 2NY1B 2R29H 4PLKC 5ITBL 1J0ZA 3MRJB 3AY4A 3LH2H 4ZUSA 4HUWB 3L3OB 2GYSA 5CGTA 4H1LB 1YNKH 5J11C 1D5ZA 1LK3L 3MRBA 3V4UL 4PD4J 3ZT6A 4IBLT 2P43B 5TF0A 1T5WA 2RGSA 3T1FA 5C0AB 1AHWC 2M2DA 4HXBL 4P2RA 4PJCF 5CBEB 3KPSB 3QJFB 1UM4H 4GRWF 5DFVC 3S36X 4I2XB 3IDIB 5IVOA 1I1AC 3SKNB 1FGVL 5C2UB 4AMKL 3A67H 3GSNB 4QWWC 5ESAA 1A0QL 5KSVA 4UV7L 4NOFA 4PJIE 1X5IA 3MLUH 1YJDL 3NBNA 3L3OA 1KJ2A 4KKNA 2X9YA 1MI5E 4FQ1H 4UU9B 5CMAA 4Y2DB 2OX5A 3P4OB 5CJ5A 3GJFA 4ZNEE 4HS8L 3SDAD 1F6LL 2L7JA 4M61B 4Z7UB 4OQTL 5B3JF 2VITA 2D7OA 5KJRL 2Z35B 4YE4L 4N90D 1II4E 4JRYA 4PJDA 5F72S 1QRNB 2UWEF 3QZWB 5DRXA 3TVMA 3I75B 4LLMB 2W9DL 3MQIA 4DN4H 3TA3A 1WZKA 4U6HB 5CUSL 1CZ8L 2V5TA 3F5WA 1I1RA 2PO6D 3HPLA 3C2SA 1ZHBB 4H0HB 3PQYE 1CDUA 4JFFA 2KH2B 3QRGL 4ZSOE 3PL6A 1SHMA 3LN4B 3OHXA 4XNXL 3CLFH 2FGZA 3BPLC 5E4EB 4JKMA 5LGJA 1AGDB 3LQMA 1CL7L 1R3JB 4Z7QF 4QOKE 3F7RA 2HH0H 3RTQB 4LIQE 5ISZE 5ERWA 3MR9A 1Z9SA 4KUCF 3ULSB 1FFRA 3QI9D 3MGTB 1QSFB 4Q9CA 1I8MB 4OKDA 3UTSD 1BBJA 4K3JH 1CBVL 4OFDA 1FNEA 4MCZA 5C09A 3ZZ1A 5F7DA 4QRRB 2R8SL 1I9JH 5FYLD 1FN4A 1F13A 1SJHB 3TBYB 1Z5LB 2J8UF 5FYJU 2BY0A 1INEH 3C6SB 4KDWA 3C5ZC 3KJ6H 1NDMA 1DZBA 4J6RH 3MGOB 4L4TE 1JGUL 5C0AD 3B6SB 3NGBB 5IFHH 5J4MA 1DQLH 4OF3A 2AJZB 5TQ2H 1FG2B 4FQJL 1OW0A 1MVUA 5DJDB 3LHPH 3GDBA 4GRLB 4ZO8A 2VXSL 4HKBB 2CRMA 3QDJA 3ZHLA 4JFXB 2R9HD 3IFNH 3AREC 1GOFA 2BNQD 5IB3A 1A6ZB 2DL9A 3LQZA 4Y16C 4E41A 4QRPE 4XCFH 2YPKA 4D0CA 1EEYA 4RWYH 4Y4KD 3ZE1E 4X6CE 3P9WB 2B1AH 1FSKC 5CEXA 1NDMB 5GRXG 1NBVL 2BX5A 2Y7QA 2NY6C 1IE5A 1EJOH 1E28B 1Q9WA 2Z4QA 5I16A 1MVUB 5DJDA 1QSEA 4CN1A 1A3RH 1UYWL 2VLME 3UYRH 1N0XH 3U4BL 2HFEA 2B1HH 1CU4L 1XR8A 4UIMB 1SJHA 1LEGA 3GMPA 5GSRA 4PP1D 3C6SA 1ODAA 4LVHC 4MAYD 3HUJE 3U79A 1KCSH 2QSCL 3S7GA 2AGJH 5CEXB 2Z93A 4IRSB 5HYSB 4ZTPL 1KTLA 1ZSDB 4MA3B 1NSNL 4WV1B 1WVZA 2FRGP 1ZHNB 1KIUA 1I1AB 2AJZA 2DWEB 1WBXA 3QUYA 4K3DH 2IAMD 1CR9H 2Z4QB 5MEPA 4PTUB 3MZTA 4JJ5A 1J18A 5JR1L 1FO0L 1MY7A 2H26B 3WHE0 1X5LA 1FO0A 4UMGA 5C0IA 2EEBA 4FXLA 1ZEAH 3TYFB 1BGXH 3STLB 3U82B 2NNAA 1JWUA 1G7JB 5I1AB 1HHKA 3FB8B 3EGSA 2R4SH 2BVOA 3MZGB 4NBYB 3S35L 5B8CA 4Y4KC 3F7QA 2X9XA 4S1QL 4RMWA 1KENL 1DBJH 5D5MF 3UJJH 3MBXL 4RFOH 1IKFH 2I9TA 2OJZL 3BVNB 4PRPA 2FATH 2BVYA 5CJ8A 4ZAKD 4XNYL 4Z95L 5E03A 4FTVB 3MRDA 1WBZB 2BP3A 1KOAA 3FO0H 4QYOB 2I9LA 1UC6A 4Y4HA 1VDGA 1M05B 5IVXF 4N0CC 4MNGA 1I8KA 4U6YB 4YWGL 2Y36L 2CDFB 1Q9LB 1JHLH 5EUKB 2IH1B 1QR1B 1K4CA 1TJIL 4P46C 5EO1B 1ZLWH 4MQ7A 4K2UH 4OLVL 2WLYA 1AE6L 2KDGA 2B5IB 3WYRA 3QFJB 5E2UH 4OZHF 2P7TA 2FBJL 5HI3D 4HX1A 3KLSA 2Q76A 5EDXA 2PUQT 3GIVA 4NDMB 3SE8L 4X9IA 5IOPA 4DAGH 2R2CA 3JV4A 3MNWB 1AQKL 2EYSA 4KDTA 1LNUB 5DEFA 4FMFA 3GNMH 4PJ7E 2I9TB 4G8EB 4K3JL 4TVSa 5JOEA 5HGBA 1C8PA 2B0SH 4P9ML 1F97A 4MJIA 3GRWA 3HG1A 5MEND 4HK3J 3QIUC 2OR7A 3T77B 1MFAH 3UTSB 5IESH 4NQCD 3VW3H 2DQCH 4LGRB 4YR6A 3K74B 3VXQB 4DVBA 3DIFB 1I3VA 3KYOB 4L8CA 2FZ3B 3PE9A 4F3FA 5SWSB 1EJ6A 4OBRA 1JF6A 2VLJA 2YPLE 4MXQC 3TCXA 3BMVA 2J5LC 4PJXF 1BZ9B 1D5ZB 1OAKL 4XWGH 4I8DA 4WI9A 4PLJC 3MRJA 2IPKA 4G42A 3CVHL 1P7QA 4X4YB 4HUWA 1TETL 1V3LA 5GS1B 3ULVE 2YEZB 3QWQB 5T1MB 3NAAH 4PRBB 3HC0B 3D0VB 3DIFA 5DZOA 1BD2E 4NOBA 5IEKB 5SWSA 4X6BA 2O61B 4AIOA 1L9NA 5L6YL 1ZHKA 3S4SG 4PS4L 5FO7A 1FC2D 5E6YA 2IANA 4ACPA 5GS0L 3GKWH 4EUPG 4LCUA 4FQQA 3GSQB 1KXQE 1NGQH 2BNQB 1WSST 3FQUA 1KLUB 3BT2H 1NCAL 4OQ1A 3F58H 3ZDYF 5CD5D 3VG9C 1SY6H 4XP5H 5FM5O 1MWAA 1G7PA 4WFED 3TEUA 4OF0A 3CSYB 1RUAL 3GBNL 3IU4H 3WFDL 3MV9A 3PWUA 5IHLB 4PJ7A 4OCSH 1R24B 5BZWB 5DHVH 3TBTB 3OKNB 2Z8SA 2GJ6B 4UB0H 1WFOA 5JHDA 4PRIE 4TTDD 3OZ9L 3S3JA 3KPNA 5F7MC 1CE6A 4FN0A 2VLMD 4PP2A 2NW2A 5JNYB 4F9LC 2N7AA 4XBGB 1BGXL 3E8UH 5HHOE 4DGYH 3PHOA 2MQ3A 3RHWF 3VWJA 3L7FB 1SYVA 2BXYA 4G3YH 4OCWL 1GC1C 3KNBA 3LV3A 4KJQC 5CGYC 4HKZB 4JHWH 4S10A 2AI0H 1EX0A 3MRPA 1CF8H 1ULVA 32C2B 5AAWA 3WS6C 3INUH 2VRAA 4P4KD 2GJ6A 2VSCA 5I8EA 2R23A 2X41A 5KVDH 4PJBB 1EBAA 3RL2B 5IG7A 2X4RA 4RFNC 3I9GH 3G5ZA 3RWHA 1P69B 1EMTL 4YFLI 4NO3B 3S6CA 5CD5C 1F45A 1NC4B 4UUJB