3PWVB

An immmunodominant ctl epitope from rinderpest virus presented by cattle mhc class i molecule n*01801 (bola-a11)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class I antigen
publication title Two distinct conformations of a rinderpest virus epitope presented by bovine major histocompatibility complex class I N*01801: a host strategy to present featured peptides
pubmed doi rcsb
source organism Bos taurus
total genus 12
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pwvB00
3D87B 3L3GB 4PJFE 1RI8A 1FSKC 3V5DA 3RWCB 1KCUL 3RL1A 1UB5A 1PLGL 4YFLI 5L2KE 4R26H 4YXHL 3HC0A 5MHSD 4MJ5B 1R3LB 4PD4K 3FN3A 4XMKL 2VDLH 2UYLB 4O2FB 2HH0H 4RDQF 1B0GA 3TFKC 3I3BA 1C5DA 1VEMA 5HDQL 5FO9B 4CMHC 1MWAA 1TCRB 5ISZB 2P8PB 3GBLA 4KKLD 4HXBL 1ZA3A 1H5BB 4IMKA 2WIIA 5CGTA 3ZYIA 5CINL 5ITBH 4HS3B 4XZUB 3B4NA 4X9IA 5E6YA 4HKZB 5BS0D 2W92A 3FT4A 3CZJA 3U4EA 3B2UC 4B0MM 5F7MC 5IB2B 4LMQI 4P23A 1IGFH 4KI1A 5BVPL 1Q0XH 1P1ZB 4WWKA 3MA9L 4FFZH 4YHNA 5C09A 1DBJH 1N0XH 4S1DD 2OK0H 5BRZB 2YSSA 3B3IB 4UI2A 2OI9B 4D2NA 2ZOLB 3UJJH 5GGQH 2I60H 4UOJA 5DEFB 3MJ9H 5E8OA 3VI3F 5B39A 1SJHA 4PJEB 3VXRB 3VXNA 5TJWK 2VOTA 3BX7C 4GMSL 5F8QC 1UJ3A 3R0MA 5IM7A 1A6TA 2D7TL 3WL9A 5C6TH 1JRHL 4MNGB 4JFDB 2BRQA 4DGVH 5IB4B 3CDGB 3ULUF 5DJ2B 1DQLL 5J3HD 4PLJD 1NDGA 5CJQH 3MMEB 2HKFH 5H35A 3BPOB 4JO3L 4MDJB 5ICYB 1OHQA 1QQDB 4G5ZH 3O11B 1ED3A 1NAMA 2BVYA 1E4JA 1F8TH 2Y1VA 2GW5A 4XMLL 1Z5LB 2HFFA 1YMHB 3KPNB 3S35L 4YWGH 1JNLL 3QUZB 2CKNA 3G5ZA 4XC3L 2IAND 2UUDH 1FNSH 2G5BB 5DHVH 3K80A 1I7RB 1EFXB 5KS9B 4ACPA 3AXLA 4EKXA 1OGTB 2NTSP 3TNNB 1JZ6A 3C60A 2HTKC 2NW3B 1N8ZB 4P4RB 2DWEB 4ZODA 5ICXA 4OKDA 5EO9A 1J0YA 5DC9B 4M7JL 4WUUE 5BVJA 4GQ9L 1JPSL 5CHNA 4ZD3H 1UCTA 5IVZA 5J6HB 3I6KA 5KS9F 1I9IL 1YY9C 1TJIH 1WZLA 5GGVY 5E95B 3CPLB 1FO0A 5KAQG 4NWTH 3I85A 3U36A 4HLJA 5E0QA 3SDAD 2EIZB 4Y19B 4J3XA 3G9VA 4UT7H 3V4UL 2Y9RT 1FFPB 1R24A 3VRLF 3MJ6A 2CKBB 2YPLB 8FABA 3JV4A 1WF5A 5CGMA 1KFAH 3K8MA 2XIDA 3ELAT 3L3DB 3LZFH 4I4WA 3KPSE 4PY8J 2ZCKL 2B4CL 3FAXA 4BSVA 1E4WH 3DX6A 2DL2A 2XACC 2HVKA 3U9PL 2QQKH 3D69A 4H25B 4K3JH 5BS0E 2R8SH 4YDVA 4F7CA 3MFGB 2DQUH 5C08A 1X3DA 2NY3C 4YIQA 2AXGA 3MV7E 1WEJL 3MOAL 5HI4D 2W07A 1UCBL 3WCYA 3V0AC 1CR9L 3VFMA 5F9JB 4NP4H 2GEEA 3QYCA 1DQDH 1G0DA 4JKMA 4M02A 1RUQL 1AXTH 4NNPL 2ZUTA 3NIFE 4P2OA 3IU4L 2OL3H 3SQOH 1XIWD 1XR9B 3IDGA 3DARA 1QR1B 2VE6A 1ZVSB 1ZK9A 4U05A 5BQ7B 3ZTNL 1RIHL 1CDIA 4DFIA 1RUKH 3FFCD 4KRNA 5T1KD 1GAFH 2Q76A 3IDNB 1V7MH 4MNQB 1J1PH 4CADA 1LD9A 4EN3A 2YEZB 1U58B 1YYML 4UQ2A 3BZFB 3PL6D 4JDZA 4TUOA 3DO7A 3H9SB 1JV5A 3QH3B 4OCSH 4ODHL 4HS8L 1A9BB 4LQFL 4WFGD 4P5KB 4YFEA 2PXYC 2JIXD 4QO1A 4OZ4B 5KANG 2G60H 3T3MF 3I6LE 3L5HA 3BD3A 4PYHA 1C5BH 1ZLSL 4PS4L 3JZ7A 3S37X 1MNUH 4HFUL 1AO7A 1ZOXA 4MAUH 4K3GA 4RZCB 1WLHA 3W9EA 4UQ3B 4NM8L 1G7LB 3UBXB 4KQ4H 2E6JA 7CGTA 2EEBA 2R9HD 1W8NA 2C3GA 1D9KA 4GAJL 5DMIL 4ISVB 1DSFL 1LMKA 4I48B 4GMTL 1BBJA 1DLHA 5FKAB 4M5YH 4DN3H 2YK1H 2CK0H 2CSPA 3W5MA 4XBGB 3TZVD 4XGZA 2ZNWA 3D85A 4I3SH 4DOHE 5HPMA 5IOPB 3RVVC 2R29H 4IOIB 2ESVA 4NQUA 5I1EH 2BNUB 4L1HA 2BY0A 5HGAA 3TT1H 3DV6B 1MUJA 4WU5A 4WIQA 2VN4A 3AM8A 1QACA 4AH2A 4JFZL 4FXGA 4M8QB 3TJEL 1QBLL 2VUYA 1WCBB 4PG9A 3LD8C 5D2NE 1A8JH 5DD1H 5HDBE 3OGOE 4AT6A 5FYJL 4Q9QL 4I8DA 1T3FA 1W72A 4Q97A 2ADJA 5IW6A 4F7PB 2R56L 2Z9TA 4Z0XA 3DHJA 1VKXA 1NFKA 3CUPA 1OP9A 2APFA 3IFLL 3KLHC 3KLDA 1VACB 5ALBL 4OM0L 4ELME 4MD4B 1VERA 3MBXL 3I02B 1ODAA 1YMMB 3JWDH 3EOAB 4XNZB 3V4VL 5JW5B 1IKFL 2FLBT 4JKWA 2V7NA 1A6WH 3ARFB 3BOVA 2A0LD 1OWRM 1XCQA 4CBPA 1LO0H 4LF3B 4J1UB 1A1MB 1G9MH 5F1OB 1S7WB 4M5ZH 4RFOH 1B0WA 3BGMB 5F7NC 5DHYA 5IK3A 2BDNL 1IM9A 4U1IB 3VGAC 4UIMB 2W65B 4UV4L 3BDBA 1IKNA 1CE6B 3BWAA 4OF6A 4O00A 4P2YA 4ZUUB 3QO0B 1P7KB 3MUGA 3VXME 3I6GB 2VWEC 5FYLH 2I9LA 3HR5B 2AQ1A 1RZ8B 1N6VA 4L1DA 4YFDB 3D3VD 2APTA 1KF9B 4GSDH 2L4OA 1ZANH 3W0WB 4CVUA 3ET9F 1RUPL 1SHMA 1YEEL 4TVPE 5C0FA 3HUJE 5D5MA 2OTWA 5HYEA 2EC9U 1E28B 2JELL 1PY4A 1F13A 1YA5A 1MIMH 4IMKC 3RUGE 5C9KA 2HJKA 3VFPA 4CMMB 4QWWC 4WUUA 4CVZA 1RK0A 1CGVA 3MRLB 3WLBB 4P46B 1QSEE 4N0CD 5E9DD 4P23C 3MV9D 1C7SA 2GJ6E 1XFPA 2NMSA 1E4XH 3H3PH 2NX5B 3O2VH 1QVOB 2DAVA 5I71C 1HIML 2LVEA 1YEHL 4EIGB 4W4OA 1CFBA 2DWDB 4M1CD 1JI2A 2JK5A 5CZXC 5F7YC 3W9DA 2XY2A 2VITB 5IQ9A 5LXGL 4JM4L 1BD2D 4K23H 3ZKQD 4RWYH 4QLRA 5IB1A 2H26A 3MGOA 1UQSB 2VLKD 3FKUS 4LEOB 1I8LA 4PD4J 1NGZA 5D7LD 1J1XL 1L7TH 2VLLA 4DQOL 3RU8L 1KTLB 1C5CL 4UDTB 5D7JC 1IC5L 5ENWB 3ARUA 3X12A 1MFDH 2H2PC 4P9HL 1I9JH 3AREB 4YZFE 1FL3A 3L5WB 2G75B 1I7TB 2PETA 2PTTA 4Z7UA 4ZO8A 4YDIH 3UTPE 4MXWH 5ANME 3SE4A 5IJVA 1XEDA 4OZHE 3GSOB 1A6ZA 2XI9A 2B1AL 4NHCL 4ONFL 5IHZA 5GGTA 1QFHA 2R0WL 3L7FB 4N8CL 3DJ9A 4KKNA 4DEPB 4LDLB 4MJ6A 5DJZA 3EO0B 4F33A 5MEPA 1RURH 1OAQH 3CLEH 5C07E 3WSQL 4LBEA 5EN2A 5FA3A 5BO1H 4RMTA 2W9DH 1HXMA 4PJ9B 3GSNB 4HQQL 4LVNC 3LKNA 3V6ZB 1J12A 4OCRH 3MRGB 2IFFH 2N4IA 5ETUB 5CEZE 5FGSA 3EJZD 3QA3B 1PG7W 2CGRL 2WP3O 5C0BD 3IU3B 4ODWA 4HZAA 1HQ4B 1LO3H 1NEZA 3U0TA 3FRPA 1EMTH 3ZKND 1AI1L 4R0LA 4NZRL 3S4SB 2EEAA 2DTML 4YXKL 4XP5L 1RULH 4J3WA 1OLZA 1PVHA 1FQ9C 2DL9A 5CSBA 1OP5H 5E94B 3IKCB 4ZAKD 5CJOL 1BVKB 3QG7L 5I1HH 4TNWF 1IL1A 2AW2A 7FABL 4MCYB 2WM0A 4JJHA 1S9WA 4LOUC 1ITCA 1DLFL 2YD6A 4M1GL 1DQMH 3LB6D 4FZEH 2F15A 1AY1L 3T4AA 1U8IA 3WFCH 4JPIA 4UTBL 3DETC 3TBTB 4PJCB 5CEXA 2F53E 4KI5C 2B8OT 3UYRH 1OSPL 3MRQB 2F54E 1BJ1H 2G2RB 2UWEB 1MJ7H 4LLYB 1ZV5A 4LNRB 3VFTB 3STZB 1JWSB 1QSFB 2FH6A 3ZYOA 3MRHA 4JDTH 5IKCA 3KHQA 4NJAH 4P2OC 2MMXA 5E6IB 3SE9H 3UZEA 2MFNA 4PJCF 4XVJL 4AIOA 3BKYH 5JMOC 4ZPTA 3UTSA 5L9DH 3RQ3A 4YNYA 2BNRD 3MA7B 3ZE2E 1J0HA 4J4PD 1D5ZB 3LN4A 1YN7A 5D2NA 3RVUC 2BSRB 3H2WA 5A3ID 1J8HE 1MCPH 4EN3C 2WP3T 3KPLB 3IDXL 1BZ7A 6FABL 4MB4A 5L7XH 2ED9A 1T0MA 3T2QA 3AS2A 3FQWB 3PGFL 3MV11 2PCPA 4OGYL 1U8PA 4ELMA 5DQDL 2Z0BA 3HNSL 1HHKB 3ABZA 3IS1X 4XNYL 1PBYA 1EEZB 5AUMA 2MKWA 4L8SA 1D5IL 3VG0L 5JUEH 5IVXE 1J5OH 3V7MA 4KVCH 4JFXB 2UV3A 2AKRB 4NKIL 1I8MA 1JMXA 1RZIB 3HAEB 4DZBB 1FGVH 5DFVD 3VGGA 4XNQA 2E9IA 2P5WE 3K74B 1FVDA 4S0SD 4R7DB 3QWOA 4UDUA 1FFNB 5FGCE 4I2XB 1DBBH 5IHUH 1H0DA 1FFOA 4TNWK 4CJ1A 3DUUA 4LRIA 4PRDA 4G8IA 1D9KC 2VL5A 3ZT6A 4Y4HA 2EZ0C 2DBLH 5DEGA 1SYSB 5LAXA 3ARDB 2FZ3A 4ODTH 3GK8H 4KU1A 1YPZB 1CF8H 1DBML 3G04B 1JK8A 1EVUA 2BHUA 3HUJA 4R2GC 3GMOA 5C0CD 1NCNA 1YUHB 1CQKA 3N85L 3NZHH 4JY4B 4LKXB 2B1HL 5T3XD 3PWPB 4OD3H 1WQVT 4TTDD 4R90L 2CLZA 5J7CC 3RAJH 2LABA 1HE7A 2EDQA 3C9NA 1YPZF 4NNXB 1A1OB 3AM8C 3U0PB 3QHFL 4NC1E 4ENED 2W9LA 5I15L 3T08A 3ULUD 4TRPH 1OVZA 3LSOB 5DMKB 1OTTD 2GJ6A 4G80A 5GRYA 1ZEAL 2D0HA 2DDQH 3HI1A 4G3YL 1K5NA 3VXPA 2A73A 3R06B 1QRND 5JOPD 1NGQH 1E6JH 2F74A 4NCC2 1QLFA 1Z9MA 3MV8E 3SGKA 3ARWA 4M03A 4S0TD 3KYMA 4P4KC 3TH3T 4G6ML 5IGXL 4U2YA 3O3EB 4IRJD 4PJDA 1RJLB 4OJFH 1UA6H 2O61B 4U1KA 3MQIA 4H8WL 4MX7A 15C8H 2A83A 4Z76B 2XT1B 1YECL 3DBXB 3QUZD 1CZ8H 1UM4H 4HJGA 3B9KB 4B53A 5IESL 1EFXD 3TH2T 2Z31A 1XGYL 2AQ2A 1R3JA 3RL1B 3OJMB 4OLYH 3CX5K 1CDHA 4WDIA 3ZSSA 3U83A 5F89A 1NLBL 3EJYD 1UADC 1C5DB 3ARZA 2GJZA 3SDDA 1R3KA 2VZ3A 1EK3A 5E8EA 2AK4B 3S34L 4M9OA 1AJ7H 3MJ8A 3NIGE 2IH1A 1OTSD 1YQVL 1MAJA 1RUAH 3TO4B 3U7YH 5ACMA 2C1PA 2FDBP 4LSQH 5C0IB 4P5MB 3FT4B 4GH7B 3VFUB 1JGLH 3OGCA 3O2DA 1OAZH 1WWBX 4P23B 3P11H 4OSUH 4IS6A 2X4QB 3FO9A 3FOLA 4WWKB 4FFVC 5CAYB 5D7SH 4YHNB 4TTGA 1KT2B 4FP8L 3TPUA 3QUKB 5D6DA 4XXCA 3DX7A 1U93A 1TJGL 1LNUB 4M6NH 3S5LG 1HXYB 2NY0D 4I13B 4P5TD 4DAGH 4NWUH 4F3FA 1XGUB 2VC2L 5E8OB 1ITBB 2EKSB 4FQJH 3ARBB 1UB6A 1LEKB 3P30H 2K1MA 2XYCA 1I8LC 3LOWA 1FV1A 4BQ8A 3JV6B 5DJ8A 5TE6L 4UIKH 5HHOA 1UJ3B 2FNBA 4PV9A 4XPFL 2PW2B 1R3IL 1R3HA 5E2TH 3X11A 1V3LA 4PP1C 1K4DA 1ZS8B 2DMCA 4YHZH 5EH1A 4S1RH 1XF2B 2AGJH 3QSKB 4HK0A 3IFPA 5K9JH 1V3MA 5AD0A 2VZ1A 5DMGC 4ETQA 3U6RA 3SE4C 3TVMA 3RBSA 2V2XB 4ODBD 3MLRH 5CJ8A 1ZT1B 3VD5A 4HH9B 4YAQA 2D03L 4MVBC 3WKNA 4Y4FA 4YX2L 1VPOL 4FQCL 4PRIE 5JA8B 3AXLB 3S36X 3RWDA 4C59B 3DGGA 1DQQA 2I9TA 4YXLH 1AD0B 3C60B 3H9SD 2OP4L 2Q87A 2ZOKB 1DP0A 5BV7B 3QWQB 1V3KA 1C16A 5EO9B 2H2SC 1MI5D 3NPSC 1J10A 3FFDB 5TQ0L 1KC5H 4R3SB 1NBQA 1PG7H 4WHTA 1OP3H 5CHNB 1BZQK 3GM8A 1ROWA 2E9JA 2XPGA 3VCLB 2D31A 1SBBA 3IGAB 5CEYA 1FH5L 2VR5A 3ULSB 1J8HA 2QADC 3HPJA 4NQEE 4KKCD 2I5YL 3MGTA 4U1HA 3B9VA 4ZFOA 2RBLA 4KTYA 5DJXA 5ICZB 1IZJA 1KCVL 2AXJA 4PJIB 1IGTB 4XCNA 1OD7A 3VFNA 5D6CA 5L8JB 3C5ZB 3O3AA 3NZ8B 4R0LC 2Q8AH 1GC1C 3I84A 3BN9D 4JZNB 2AJVL 4S11A 2XV6B 4LU5L 3QUML 4K94C 8FABB 5IVXA 4LCCB 2LTQB 3I75A 5C1MB 4I4WB 3F5WA 3PWJB 4OUUA 1T6VN 1A6VL 2CIIA 4PJIF 2HVKB 2L0DA 4ELKB 3CH1B 3H9YA 4HIEB 4F7CB 5CD3B 5DVNA 1LP9E 2V2WB 3W2DL 3PE9A 4G6JH 4YIQB 2VSCA 3ROLB 4OB5H 3MOQA 4N9GB 5D71L 1VFMA 4JHZA 1NBVL 5DRXB 1T1YB 1OB1A 2MJWA 2VO5A 1S8DB 3NVQA 5HVWA 3GHBH 1JYXA 4IHOA 4XPGL 2Y06H 2UVEA 2X4SB 4JRWA 3U4BH 5I1DA 3GEWB 3WFDH 5HVGB 2BFVL 2NXYC 3NACL 5SWSA 5JZ7D 2DKUA 1QEWA 5IHBA 3KPQB 4U1NA 3H7BB 1HHGA 4NBXB 1GOHA 3RNQA 1KSRA 1SQ2N 4QRUA 1KNOA 1KPRA 1XF4A 5F72S 3JUYA 1AGCB 1PYWB 1RVFH 1IQWL 1HOCA 1YMMD 3O81A 1HYRC 1LD9B 4NZTH 4LSUH 4Z7VF 1CGXA 1UM6L 4QHLA 4UQ2B 5IROA 5D2NC 4TUOB 3EHBC 1CLZL 3BWUC 2K7PA 3V6OE 4GKNA 1AP2B 3W39B 4IRZH 5MENE 3A0OA 2RCSL 1P4BH 3D25A 4PJHE 1HINH 5JHLL 2AI0L 1ZTXH 3Q3GA 3KJ6L 1FLTX 3RGVA 4F15C 1LEGA 4JFYA 3F7VB 3LKPB 4MQXC 3S37L 5FCUL 1AO7B 5TE7L 1U92A 3FO0H 4L8SC 3UTQB 2V17H 1ULVA 3W0WD 3W9EB 1UT9A 3A67H 2W60A 3C87A 25C8L 2BRRH 4M62L 4U6TA 4O2EA 2PO6B 1D7FA 2F8OA 3RZCA 5HHNB 1BBJB 2QKIB 2CIKA 4LRIC 1JIBA 5KAQF 3MCG1 4Y4HC 1KCRH 2O5YL 4U6HB 3D2UB 2A77H 4JGJA 5LGJB 2UUDK 4KTEH 3UBXI 1JNHA 5MEQA 2DQTH 4KTDH 5J0BA 4GRWH 3VRJA 3ZE0F 4GAFB 2IBBA 4QT5A 1QSVA 1GXEA 1YNKL 3M1BB 1U8HB 3TGXA 1MUJB 2DTSA 4WU5B 2FEDC 1OPGH 4OCLC 1RPQA 4E42A 3WNLA 4FS0A 2NY4C 4AH2B 4R96B 2C9AA 3C8DA 3PGDB 1N3NA 3HA0A 1KPVA 4QRQA 4L4VB 3SO3B 3BYYA 5FUZL 3RJQB 3BQUA 4JRYB 2PW1A 1P6AB 2W9EH 3OZ9L 5C0RH 5IVOA 1U3HB 4AQOA 2VKWA 2YPVL 4NQDD 4UINL 3SGKC 2EDBA 4MCZA 4P9MH 5I1JH 5KZCB 3F62A 3OKOB 3RTQA 2A6JB 1B9ZA 2BHYA 3CFCH 1ZT4A 5EUKA 1T5WA 4WY7L 5KSAD 3O6FA 3U46A 5J06A 4K8RD 3P4OA 5IV2A 2V7NB 3WHE0 2Y5EA 1XCQB 1BQHA 2ZSWB 4M6OH 4D0BB 2ITCA 5C0GA 2OMNA 3CSYB 4LSSL 4PG2A 4M3KB 1GSMA 5AZ2L 4JLRB 4KGJA 2AV7A 4UT9H 1AHWC 2WLYA 5FYJU 5JW4N 3QNXA 3P2TA 4N9OB 2R0KH 3WUZA 2Z31C 1IT9H 4PJ9D 1MCOL 2I9LB 1M1SA 3KYNB 3QUXA 2COQA 3L7EA 5EU7E 3QEQE 4ORZC 1MCIA 1FRGL 4W70A 5CLTA 4PJ5A 1DCLA 1MWAH 3SDDC 1S9YB 1LO4L 4S10A 1F2QA 2OR9L 5IR1B 2CKBL 2P45B 3HG1E 1X5KA 5T1LA 3VFPB 4GS7B 1ZVHA 3GIZH 3DIFA 3RA7L 5L2JA 3EYFA 4LIQL 5GRUL 2E6QA 2FEEI 3TCLB 4XCCL 3P4MA 2CH8A 3RWFB 4G9FA 5D7IE 4Y4KA 4NQEA 5J56B 4ZG1A 5A2KH 1K4CA 5D6DC 5IQ9B 4XXCC 4KK6D 3MODL 3JWOC 3REWB 5J89A 1S3KH 3ILPA 5IB1B 2H26B 1AKJB 3MGOB 3IJHA 1I7UB 5FDYA 4XP1H 2GSIA 3T09A 4KVNH 1KXVC 1NGZB 4CNIB 4LLVA 5DUBA 2VLLB 2GYSA 4W6WB 1KN2L 3BKCL 4XC1H 1MCWW 1MFEH 4WFFE 5E8DH 2ZJSH 1T22B 5GS0L 4JRXE 3X12B 1N0LA 3BHBA 4UTAH 2JCCF 5CGYC 5C0ND 4S1SH 4R97C 1QSFD 4LVHC 2PTTB 2VH5H 1KTDB 3DRQB 3QEGH 5J8OA 3EFFB 5FUCE 4KDWA 5LG1A 4B41A 1TVBA 5DFTA 5IJVB 4LMQE 1D5BA 1A5FH 4NRYA 3RWGB 5IHZB 1KCSH 4XWOD 1NAMH 3OSKA 1SEBB 4KHTL 3TVMC 4Q2ZA 1UKQA 4NDMA 1K85A 5DJZB 5TPWH 2EDLA 4F33B 5MEPB 4FA8A 3H9HA 4Q9BA 5EBLA 4LBEB 2C5DC 3S7GA 4Y4FC 3UZQA 4ZNCD 4M4RA 1PSKH 1DN0B 1NUGA 3LIZL 1S7UB 1WSST 3QWRA 1CN4A 1WIOA 2EICA 1MCHA 1RIUH 3KDMA 3V79C 1OTUD 1YEDA 1MHEA 4M43H 2EXWD 4TSBH 3QXTA 4YGVA 2BC4A 1UXSB 4K3DL 5JTWA 4HX1A 4L3EA 3QI9B 4X5LA 5H37G 5HYJB 4ODWB 1NEUA 1TZHA 4XVSH 2P43B 3QDME 2DIAA 4MNHB 2Z35B 5F3HA 1LK3L 1DANU 4F58H 4R0LB 1JGVL 5I75C 4PRHB 4KK9D 4Q0XL 1FO0H 1F6AA 3KXFB 3EDEA 4HBQA 5L6YL 3OR7B 3SKMB 3OPZL 3QXWA 3L3JB 4RBPH 4QRPD 3QXVA 2CDFA 3MCLH 3ARGA 4EQ2A 1NUDA 4YUEL 2VLJE 2XQBH 3H42L 3ARDD 3KPRB 4P2CG 1ES0B 3TA3A 2ZCLH 3UAJD 1PW3A 2YOCA 1DE4A 3P0VL 4N1CA 3RKDD 5DT1L 3KNBA 3BT2H 1RHFA 4GBXB 1HI6A 1U8IB 2X4TA 3L3IB 1TXKA 4PRNB 4Y5YB 3QIUA 2PR4H 5CEXB 1ND0B 1QUNA 3FQUA 4M48H 2ZG2A 3KJ4B 2Z8WC 4ZUWA 2K9UA 3BPCA 1P4IH 5E5MB 4EOWH 2C4FU 1LO2H 4FTVD 3LEVH 5FB8A 2NXYB 4PJBB 2NY7H 2ZKHL 4BZ2H 2VLRE 4P2RD 2CLVA 1NMAH 2VDNH 4V1DD 3T65A 4ZPTB 5F44A 3UTSB 1UZ8A 3TBVB 3IDYB 4ONGH 3VXOB 3LN4B 2X9WA 1I75A 1WUNT 3NN8A 4NQSA 1FJ1A 1S9VA 2P8LA 4PJBF 1GZPB 5IROC 4KROB 2JKXA 3ZHLA 2VQ1B 1JN6A 2CDGA 4JY6A 1U8PB 2B20A 2XOTA 2FEEL 2XNAB 3B9KD 3D48R 1NLDH 3RGVC 3ZHDA 3CH8A 1OT2A 4L8SB 1HH6A 3ULVL 2ZSVA 4M6MH 3QJHA 4LSDA 2XA3A 3Q48A 4ESKA 5J1AB 1BFOA 3VXUA 3K1DA 1KCLA 2HWZL 4QHUA 5I8OL 2AK4D 2ICES 2V5TA 3QO1A 4UDUB 4P57A 3RIAF 4XCFH 4AEFA 4Q9CA 1AGEA 2NR6C 4U7SA 4I77H 2BZDA 1NL0L 3CLFL 5BJTA 5FO7B 2GSGA 4JANA 1H3PH 1CGSH 4X8XA 4OFPA 4E41D 1QTYT 2ADFL 1MREL 2NTFA 1H15A 1U8NA 5JNYA 4QF1A 5KSBE 3O2WH 1NKRA 4J23A 1A7NH 3MTRA 1SVCP 1QR4A 1CVSC 2W0KA 1NCAH 2NY2C 3FO2B 4YBQD 1OGAA 3QQ3A 4PJGF 4UOW1 1D5XB 1HZHH 3TO2B 3C9NB 2B5IB 4YDJA 2HVJA 1N5YH 3FT3B 3RI5F 1MELA 2CXKA 4K7PY 3FQRB 1NGPL 1M05B 3ARBD 4KHXL 5D72L 5IMMA 1YNTA 4FQIH 2APBA 3O8XB 4K8RL 4WFEE 3DI3B 3BQUC 2F74B 5E56A 3QISA 1QLFB 2AABH 4ZUSA 5C0AE 3K2UL 3DVNA 4OF8A 2Y07H 1IEAA 1W72H 5DUPH 4YPJA 4PRPB 5JHDA 4PB0L 1U3JA 5M7QA 1QFWM 2ZCHL 4KJYB 3CFIC 1OP5K 5E8NB 1MRFH 3RTQC 4JJ5B 3SDCA 4ZMAT 3O6FC 3GO1H 1QNZL 3TWCH 4C56E 4JM2A 3GSNL 4KJQC 4OCMC 2CUHA 2A83B 5IB5A 3MXVH 1M71A 3C08H 4PG2C 5SV3A 4XH2A 3WD5H 4DFHA 4EI5B 4YPGA 4WTZG 2HT4C 3QCVL 5BW7A 2PKDA 3ZTJG 2XWTA 3V8CA 5DJCA 5I2IA 3TV3L 3IJYB 4X8JA 3ZL4H 1UFUA 2BK8A 3HCVA 3QUXC 5F89B 2BNQB 2OM5A 5JOEA 4PJ7B 5KG9A 4X98A 3D39E 2BOCA 5DA4A 4NPYA 3RIAK 3U7WL 5EZIL 5JR1H 3C5SA 1BLNB 3MJ8B 3EYUH 5TDNB 5INCB 1F4AA 2XWJA 4XP6L 5F7LB 1G0YR 3RWEA 5K93A 3EOTH 4Y16A 3GSRB 3VWJA 1JGUL 4GUPB 2X4PB 1SM3L 3C5ZD 4PJ7F 3QRFM 3CFBA 4WW2A 1R0AL 5DQ9B 1B2WH 1ACYH 3F58L 2X4RB 3BZDA 4LSRH 4WENB 4KRMB 4RRPG 1BQSA 3RWHB 3P73A 3O0RL 2GTWA 4X5XB 3O41A 1F45A 4Y4KC 3SKNA 3VXSD 4B50A 3RI5K 4GXUM 4BQ6A 5DK0B 2BHZA 2V7HA 3S88H 2WANA 5EOCH 4P49A 1VFAA 3SOBH 4F3FB 2P44B 3Q0HA 3V95A 4FFYL 3R1GH 4NO3A 2FX7H 4RGOH 1YY8B 2X44D 4YHKH 3BP4B 3FQXA 1FDLL 3V2AR 3L3KA 1I4FA 3CFKA 5HHOB 3BZEB 4PV9B 3WIHL 1IBGL 3W11C 3MNWA 2E9BA 4RGNC 1K4DB 5B38A 3B2VH 2PYEB 3BH8B 4JFOA 4HUVA 1CXFA 1BX2B 5JA9A 2VXVL 1KIQB 4TUJB 3BW9B 2FBJH 1S5HB 4Y1AE 1PY9A 5FKPA 1RU9H 3PWUA 3WXVH 1K6QH 3VFGH 5GGTH 4YAQB 2KZWA 2WAHA 4ZFGH 4Z7NF 3G6AA 4KK8D 4HUXB 3S36L 4EEEA 1U8OB 3FRUB 4R9HA 2YRLA 4DGIH 1IGIL 2VXSL 3DGGB 3OJDB 1DQQB 5I1KL 3DLQR 2Q7YA 5IQ7H 5EU6B 4PYGA 1C16B 5E24E 2R1WB 3OKKA 2FR4A 3MNVA 4CN6A 3BSZL 3LDBB 4Q6IA 3QCUH 5HY9B 2IG2H 4N0YH 1IGMH 4LLAA 3A6BH 4LHUG 4WHTB 3UTTB 2EE2A 1U42A 2BSTA 2RB8A 1WTLA 4Z8FH 5IFHL 3J8F7 1DVFB 3ARVA 5IBTH 5HHMD 4Y2DD 5JXAH 4LLDA 3S96A 4Z78A 4ZFOB 4G8GD 1Z3GH 3KVQA 3VRIA 5I6XB 2BP3A 2O5ZH 3OKDA 2DD8H 3SKJL 4JREC 1J05A 2AJXH 2PTVA 4XB8A 1GC1H 4L3CA 4GQPH 3SHSA 1G84A 4LCIH 4QRRB 1L7IH 4L5FH 5F6IB 5K59F 1N6QH 2PO6D 3QDGB 3DSFH 2V5RA 4HT1L 1T03L 1TJHL 3S5LB 1IAII 5DYOA 4Z5RA 3GMRB 3OKYA 1EXUA 3U30C 5K9OA 3LHPL 1VSCA 4OD1H 3TA3C 3MXWL 5E2UH 5JO5B 1KBGH 1FE8L 1HHIB 2VIRA 2C7UA 3ZT5A 4X99A 4N5ED 4GG6E 4XPTH 4U1GC 2R2BB 4Z7WE 5IFAL 3OKLA 4G6AC 1Q72L 4OLXH 4YR6B 5HHQB 2CJUL 3HLAA 3SBWA 1N2RB 3QIUC 1J86A 4HWBL 5E2VH 1AC0A 2ENYA 3O4LB 3TEUA 2VISB 4KY1H 4LSVL 1OF2A 4L4VD 3CU7A 3NAAH 1NSNL 2RFXA 5A2FA 1YEJH 1X5XA 4N90E 1X6LA 1S7XB 2IH3A 5DK2B 2R1YB 3H3BC 4MSWB 1XF5A 4JFQA 5SWSB 3S8WA 1U3HD 4FOMA 1QEWB 2IANA 3EZJB 4P2QB 3I9GL 2J8UF 3QFDA 1DBKL 4J6RH 2EH7H 4LLQB 2EXYD 3HZKB 4Z77B 1KPRB 2YKLL 1XF4B 3ME0A 5C2BL 1CVRA 1HOCB 2IADB 3BH9B 1EEYB 2QQQA 3UZVB 1FYTE 5C0AA 3HMWH 4ZFZA 5LCVH 2XN9E 2X1PA 3FCTB 4Z95L 2X41A 1ORSB 2WSKA 5KVEH 3Q3GB 1Q1JL 5DVLA 1FNEA 12E8H 3VXTA 5EZOL 5HHXH 4JFYB 4QXGL 1GYAA 3SDAA 3WDIA 4C56A 5KVMC 1E4KA 3TNMA 1DUYA 3BKJH 2WUBH 4U7MA 5EG6C 4FQXD 4IMLB 1T1WA 3Q6FB 3WIFB 1PQZA 4S2SA 1DDHA 4LGSB 5D70L 3K4ZA 4APQB 2W60B 4OGXH 4O2EB 4BQBA 4X6DB 1I1AD 3RZCB 3LY6A 2Y6SC 2Y72A 2IQAB 2CIKB 2DQIL 4QXUL 2E5EA 1GZQA 3C2AL 3MYJA 2A9ML 2Z91A 5FHBH 2F19H 5FYKU 3BZ4A 3DXAE 4JN2A 3R8BB 1CD0A 2J4WL 3BDXA 4LCUA 4XT1C 1SYVB 1JNHB 4JQIH 2NY6C 3OHXA 4FMFA 2HJFA 4TVPH 4G6FB 2L7JA 2EDKA 3QIWA 1S7SB 3LRSA 1F02I 2YPKA 2B4CC 4X6DF 4YHIB 3BI9X 4GAGH 5FYLD 1ZLUH 4OF0A 3M17B 2W0FB 1AQKL 3GNML 1OP3K 3WUWA 2QSVA 3RDTC 4HWEL 4D94A 3MNZA 3N50A 1AKJD 3LV3A 5TF1H 4QRQB 4FQHA 3T0ED 3TJHC 1QSZA 2EH8L 1S78D 5D1ZB 4MD5A 4XNUH 4FFZL 3FFCA 4HV8A 1DBJL 3MJGX 3DVFA 3TN0D 3O3BA 3RTQB 1QZ1A 5KOMC 4JO2L 3RNKA 1WICA 1INQB 4GRWB 3MRPB 4HDIB 1D5MA 3MJ9L 1WBZB 3WXWL 2FWOA 3P4OB 3WO4C 4P3CL 3SDCC 2PYFA 2OTPA 2JIXA 3P0YL 2A6KA 2ITCB 5DHXB 4D9LL 1CXEA 3NOIA 4JM2C 4KUZH 5BV7L 5A16B 2P5EE 3MR9B 1YEFH 4DN4L 4FQLL 5C6TL 2I25N 4DW2H 5H8DA 1RFDH 4YDLC 5TE4L 3GM0A 4GRWF 3DROB 1A6UH 4GRLD 1CFVH 3GMPB 5I9QB 1CIUA 5BW7C 3QUXB 4G5ZL 3C6SA 4LLUB 4YEEA 1QLRA 4XP9H 4R4FL 2AJSH 4HSQA 1JPFA 4FFWC 5KANI 5IFJA 2A6IA 1BBDL 4JFED 1NFDE 4PP2B 4PJ5B 3BXNB 3FB5A 3QI9D 4Y5VB 3BPLC 3QULA 1NBYA 2WUCH 1MRDL 5HYJD 5SWZD 3IS0X 2KKQA 3VE0B 4EUPG 4HKXB 2FX9L 3D5OF 1MFNA 4MJIE 4Y16C 2ERJB 3VWJC 4LVOC 4PRHD 4AIZA 3QCTL 1B6UA 3EO1A 3O2DH 4HPYH 4WW2C 1KELL 5CEZH 1PG7X 4NQCB 4I9WE 5L88L 4M7KL 3KPRD 2ZP0T 1NC4B 2FL5A 5I1CH 4BUHA 4ZS6D 3PHSA 4MJ2A 3VWKB 1A4KA 4F7MB 3PNWB 4MWFB 4M61B 4BFEA 2GSIB 4N0RA 3MLPA 5C0DB 4AM0A 3GKWH 4WJ5A 5CIPA 3DV4A 1PEZA 1P84K 5JXED 4NZDA 4NYLB 1J1OH 4ODXA 4OAWA 3OJVC 4DTGL 1E4WL 2AV1A 4WCYL 3QJFB 4JEGB 4ZTPH 4OZGB 3VG9C 3TYGH 5DJAB 5LGHH 4XVTL 2ZPKH 4GG6A 1ZHBA 1AQDA 4ZQKA 4MA3A 4Z7WA 5EUOA 3HE7B 1TVBB 1D5BB 1A7PH 3K7UA 2NY1B 4OFIA 5ISZE 5FYKE 5F3BA 2BMKA 1OCWH 3QNYA 1CGUA 4EDWL 1I9RH 2IMNA 4KKBD 4TSAL 3MLUH 4XTRD 3NCCB 2O5XH 4OZGF 5SX4I 3D3VA 3H9HB 3X3GH 1JZ5A 3NCYP 2XA8H 1CFSB 4NZUH 5I66A 1X7QB 1T83A 2VXQL 4WHYG 3SQOL 3H6JA 1F90H 1EAJA 4KROD 4ZTOL 2KL6A 4JG0H 4KKLC 3N1QC 1RUKL 4Q6IC 2BC4B 4M3JA 2H9GA 4L3EB 4PY7A 1J1PL 5BRZE 1T4KA 3C5JA 4FABH 5GZOC 1NCBH 2DRUA 2IF7A 1ONQA 4HEPG 5E9DA 1I1YB 2Y7QA 3MV9A 4PJEE 1CL7I 3ARSA 3G5VA 1FAIL 1A6AA 3NA9L 3VXRE 4R4BA 2EO1A 3QRGL 4XVUC 1U2CA 4X7TB 2VDML 4QY8A 2BCKA 1BD2A 2G60L 4X9FA 2CRZA 5ADPH 3ARGB 3BRDA 3KPMB 4G42B 3NFPB 4CN4A 2M2DA 4JFDE 4ZNEE 1KJ2H 2VLKA 3OX8A 3P9LB 4NN6B 5TDOB 4ZSOA 3GHEH 1S9XA 1G9EA 4L8DB 4MAUL 2FJHB 1Q9OB 5D7LA 1MIEH 3LAFA 2OSLA 1DE4B 5D4QA 3DOSA 2ARJB 1CLYH 2X05A 4LARL 4LKCA 1HI6B 1MCCA 2X4TB 5GS1B 4N0UA 4W6XB 1JPGA 4PUBL 4L29B 4O02H 4KKAD 1PKQE 2NYYD 4C83B 4M5YL 2YK1L 4HZLA 3GI8H 1DFBL 4KMLB 2AP2A 5J3HC 3SBWC 5KTEL 5KJRH 1UXWA 3LH2L 5CKAA 1ZHLA 1KEGH 43C9B 5C0JA 1Q8MA 3X14B 3CFDB 5CJXA 3TT1L 3ZDXF 4P9HC 1N59A 2CLVB 2ARJQ 4FQPA 4NQXB 5SWQB 4WI2A 3RVTC 2YWYA 3L3OA 3MRNA 2YD9A 4ZFFA 4HIHB 1AD9A 2J88L 4JHWL 4U6XA 3UTOA 1W0WA 2XICA 3TH4T 3SGDH 4QOKD 4GKZA 1FJ1B 2GT9B 2P8LB 4ONHA 3VI4F 4Y19E 4KK5D 4PJAB 3L3HA 1TQBB 2UZYB 5F9DC 2YPLE 3TIEB 5C0BA 3V52L 1I3GL 1MJJB 2CDGB 5EU3B 1BAFH 4KRLB 3UMTA 1Q9LB 3SDYL 4EI5D 4H0GA 3CK0L 2QQNL 2D2OA 1CFNA 4HAFA 4TPRL 2VMFA 4LCWB 5AWNH 4JPVL 3BP6A 2ITDB 4UU9B 4DZ8B 3SDAC 1E4KC 3NH7H 1LO0L 4ODUA 5ID0A 2BNQD 1G9NL 1G9ML 2P5EA 1NCDH 1BFOB 4QHKI 5J13B 3VXUB 4Z7QF 4GLRH 1X5FA 2ZG3A 4ZAKA 1BZ9B 2P47B 4R7NA 2YD4A 3DYOA 2Q6WA 5DTFA 3GJFA 1MHPH 3MUZ1 1AGEB 5IW1B 5C7XH 2A6DA 3PXHA 5FYLL 5BJTB 2B0SL 2VXUL 3QUMA 1BF8A 5J12B 1NJ9A 2ICEA 1D6EA 5I1LA 3P9MB 3DURB 1HHHA 4LPWA 3LEXB 4ERSH 4NHUA 1JNNL 2MPAH 5KSUB 4E9LA 5JDJA 2VDQL 4U6YA 5DS8A 5HI4C 1CD9B 5MERA 3QIWC 5GSVA 5C86A 1MIML 4ZOCA 1CXHA 5E08L 4RSVA 4BYHA 4KRPC 3ZDZE 5ILTL 3E6FA 5SX5H 1GGCH 4WTWA 3MFFA 1U8JA 4OD2A 4AG4H 2XG4A 2VDRH 3HPLA 2EECA 4HF5H 2B2XH 1INDH 4PJFB 5EPMA 2IAMB 3E3QC 2D9CA 4BH8A 2VQUA 2NXZB 1P9MC 3H3PL 3O2VL 1CDGA 2BNRA 1SBSH 3WHXA 4ZUSB 2R4SH 4J4PA 2BY2A 1GGBH 4UOW0 4RWYL 1MLBA 2PYED 3QZWG 3U79A 1S7RB 1MLCB 1MFBL 1YEGH 4JHAL 1NMCB 4TUKL 4PJFF 1GJIA 3MBEA 4XNMB 3FN0L 1UENA 3L3GA 1RQ5A 3OAUL 4LVEA 2B7DT 4RGMB 3RWCA 1IGCH 1CL7L 3QXDA 5C2UB 1MFDL 1R3LA 4MJ5A 4NQVA 2UYLA 4YPGB 4O2FA 5DD0H 5MP6L 3TT3H 2ADIB 3FQNA 4MXWL 1TCRA 5EU6D 5ISZA 2P8PA 3QFJE 3TCXA 3RWIB 3F12B 4OLZH 2R4RH 5CZKA 2IGFH 4L9LB 5DR5H 4R6UA 2WIMA 4HS3A 4XZUA 3UTTD 4HKZA 4I0PB 4OT1H 5EIIB 1UEYA 4IBLT 4JKPH 1DVFD 3MRFA 4BSWB 5GQBA 4Y8DC 5IB2A 4M93B 1Q0YL 3CFJB 1P1ZA 1I8IB 1ZLWH 3C8HA 1CLCA 5CBEB 2DI7A 4NN7B 4F2MB 2XTJD 3CFBB 4LGRB 1IAKB 43CAB 5EORL 3AB0B 4U0RC 2EC9T 3B3IA 4QRRD 5BRZA 3QDGD 4MA8L 4CUCA 2ZOLA 3BE1L 2HT3C 2HTKD 5DEFA 4F8QA 4WW1B 4PJEA 4XX1G 1H9VA 1EMTL 1IGJA 1MEXL 5T3ZD 3T2NH 3RJDA 3O6MH 1A02N 4JDVA 1TQCC 5IT2L 1OAUL 1AGBA 2VDOH 4MB3A 1MRCH 4IRSB 1JUFB 3EO9L 5EU4B 3VW3H 1KJ3H 4MNGA 4OCXL 3SDXB 3FJTA 5IB4A 1WK0A 3CDGA 1ADQL 1WZ1L 3MREB 4L4TD 4LPVA 5EO0A 5DJ2A 5I1HL 4WNQB 1VADA 3O4LD 1QQDA 3BIAX 3O11A 5HGBB 4JFOB 3VMNA 2A0LC 3DUSB 2VAAB 1P7QD 1YMHA 2QHRL 3WFCL 3QUZA 3SCMD 3K8LA 4M7ZC 5KS9A 1I7RA 1EFXA 1P5UA 3PWUB 4LSTH 1OGTA 2HLFD 1EO8H 1IC1A 3IDIB 4JFFD 3ULVE 1CLOH 4NGHH 1N8ZA 3G6AB 3WN5B 4P4RA 2DWEA 3MLSH 4WWID 4H8WC 5D2LE 5HVHC 2XWBB 1T7WA 1INEL 5ESVB 4KXZH 5EU5A 1A2YB 4N8VG 4IOFC 1M6OB 1T83C 4LDEB 4L8BB 3MZGB 4JDTL 1WBXB 1WWAX 2E7CA 5D93B 3VFVB 3KPSB 1OY3B 3OKKB 5J6HA 3MNVB 3UC0L 2NX5E 4O4YH 4YXHH 5BS0B 1DL7H 2BSTB 3QDJD 3CVHB 3PJSB 2YXFA 2EIZA 4AL8L 3WJJA 4LHJB 2BXZA 5HDQH 4HULB 2DKMA 3MV7B 1FFPA 4WI8A 3X17A 3OKNA 3C09B 5F93C 4HXBH 2YN3A 3GMLB 4N0CC 3SEPA 1U36A 5E4EB 4S1QH 5CINH 2AXFA 1TZGL 4L3CB 4FN0A 4DKFL 4G8EB 5F88A 1KB9K 4M1CC 4MQTB 4WHCA 4H25A 4OV5B 4PJXE 3V0VB 1IC4L 1OM3L 3S3JA 5JUEL 2JE8A 5BVPH 3O9WB 5ADOL 4NIKB 4Y5XB 3N1FC 3MA9H 1MFCL 2C26A 4X99B 3CDFA 3B6SB 5F9JA 3UO1L 3X3FH 3WS3B 1CE1L 2J5LC 1V05A 3NIFF 3G6JE 1GHFL 2GK0B 1N6UA 4HUKB 3LQMA 3GK8L 1CF8L 4X4YB 5B8CC 2WINB 4GMSH 3OB0H 1BVLB 1ZVSA 4G7VL 1QBML 2A9NL 3NZHL 5FM8A 2D7TH 2IH3B 1NC2B 3IDJA 3GSQB 3NABL 2R2EA 1JRHH 2WW8A 3IDNA 4MNQA 5CJXC 2Z8VC 4KJPC 1NDMA 2GCYB 4RMVA 3WYRA 2YMXH 1UWEL 2YEZA 3RVWD 5F7EH 2DJ4A 3BZFA 1BMGA 4JO3H 3RVVD 3H9SA 4GAYB 1KEML 5F9WB 3QH3A 3DX9A 4ZOBA 4XPAL 5CD5D 1A9BA 1YN6B 1MI5A 4P5KA 4POZD 4UAOC 1RAMA 4NSKB 3UYPA 3OMZA 2IQ9L 4XMLH 3S35H 4OZ4A 1LILA 1JNLH 4ZFZB 3MLXH 3QDHA 2EYTA 4LHUB 4EXPX 3EOBB 4XC3H 5K9KA 3DNKA 2GFBB 2YN5A 3LEYH 3SGDI 1UM5L 2D0GA 3ALWA 4FXKB 4XBEL 1BEYL 4OFDA 4UQ3A 4M7JH 4KPHL 2VABB 4GQ9H 1JPSH 3T8XA 1DUYB 4MAYB 2VXTL 4JG1L 5F1NA 4ISVA 4I48A 1QG3A 5AZEL 5AYQA 1I9IH 1PQZB 3KLHD 1PAMA 1Z6JT 1KPUA 5FKAA 3MLYH 3Q2CA 4K71C 1YJDL 3PABA 4XBGA 2AEIT 5I74C 3PQYE 3SKOB 3EYSH 5IOPA 4OLYL 3UEZA 2UWEE 4DKEL 3V4UH 2BNUA 4M6AA 3SJVD 3DV6A 3OHXB 3WV0A 3BJLA 5FUOH 4RMQA 3ES6B 1J0KA 4NQCD 2ZCKH 2B4CH 4M7LT 2H45A 3U9PH 3U7YL 1RUAL 2HKHL 5HDBF 4M8QA 5FECA 2BSED 5FEBA 4OKVB 1WCBA 5JPMB 1NC4D 5GS3A 5JDSA 3MNZB 1JGLL 3WKMH 1XIWB 3MOAH 4F7PA 3GB7A 1MVFA 4ELMF 2IJ0C 3PHQB 1CR9H 2G9HB 3T0WA 1EJ6A 5T1KB 1VACA 3JTSA 1EBAA 5I1AB 3VXMB 4MD4A 3I02A 4K3EL 4QWWD 3REVA 1YMMA 3KLSA 2Q1EA 3EOAA 5JW5A 1NBZB 1RUQH 4M6NL 4J4PC 4NNPH 1RUML 3ARFA 1OARH 3G08A 3IU4H 3PL6B 4DAGL 4NWUL 4LF3A 4J1UA 3RNKB 4OLUH 1S7WA 4HGKC 1J0JA 1XT5A 4FQJL 2CR3A 4WFHD 3ZTNH 4U1IA 3HE7D 5J4MA 4HMCA 2W65A 4UIMA 2A6KB 2NY1D 3MBEC 1CE6A 1U41A 5IIEA 4BA8A 5JLZA 4ZUUA 5C6PB 3QO0A 1P7KA 3HMXA 4P3DA 1YYMH 5E6ZA 4NJ9L 1RZ8A 1I1CA 1RZJL 1QSEB 4G6KH 1KYOK 3HUJF 4ODHH 4PGBA 4HS8H 3W0WA 4LQFH 3UDWA 2XKNA 4RWHA 3RUGF 2BVOB 5DFVC 4ZFOL 5D7JD 1E28A 2H32B 3IVKB 5IFJB 1H5BC 3MLRL 2A6IB 4HMEA 5FXCH 1ZLSH 1BIIB 3PWPE 3M45A 4Q7DA 4HFUH 4CMMA 4JKLA 3VDBA 2OZ4L 3CMOH 3AFLA 3HTLX 3TZVB 3MRLA 3WLBA 4P46A 4QHNB 4OZFG 3LQZB 4QNPE 2QQLL 3GSXB 2NX5A 4GAJH 4I5BB 1QVOA 2N7BA 5DMIH 5T3ZL 2EE6A 1ZGLM 1DSFH 4U0RB 3FONB 3IFNL 1KC5L 4DVRL 2DWDA 2F9BT 2VITA 4J3OC 4TTDC 5TH2B 4HHAA 2OI9C 1UQSA 3JVGA 3ESVF 3QPXL 3FT2B 4P0DA 4RMWA 5HVFB 1H3GA 3MRCA 1OTTC 5HYFA 5DJYA 1JWMB 4QCIB 1KTLA 4UDTA 2DLIA 1F3JB 4JPKL 4YZFF 5ENWA 1MF2L 2O26U 2X9YA 4JFZH 4X6CE 5CIPB 3L5WA 2G75A 4OZHF 1TZIA 3TJEH 1QBLH 5IW3A 1MCFA 3GRWL 1NMBL 4K9EL 1G7QA 3I2CL 3CVIL 2VWEE 3BPOC 4HIXL 5GXBB 4Q9QH 5ITFB 4W6YB 2R56H 4PLKD 1AQDB 4OZFH 5D96B 5LKNA 3L7FA 4G6JL 3SGJA 4OB5L 3EO0A 1UH4A 5T1MB 5ALBH 3IETB 4OM0H 3QUZC 3MBXH 3LPWA 1MCNA 3V4VH 2F58L 1IKFH 3WNPA 3GHBL 4PJ9A 3THML 3GSNA 1MAKA 4UB0L 1NGWB 3V6ZA 3MRGA 1KB5B 5IJKA 2EDOA 3EJYC 5ETUA 2MCPH 4BKLB 1AR1C 3DETD 5ID1B 3K4AA 2NW2B 1MHCB 3QA3A 4JO1L 4RAVB 3VFWB 5C09E 1HQ4A 1OTSC 2MHAB 2H9GB 4PY7B 4KXZI 3CXDL 2P48B 5HI3C 4EUPB 4LCWD 3S4SA 2VNCA 2ATKB 4P2OD 1B4JL 3WJJC 3ZHKA 3MV9B 5D1QD 4PFEA 5F6HI 2FHFA 1FIEA 2JELH 2Y4SA 3STLB 3IKCA 1BFTA 2MQ3A 3HFML 1AGFA 2BCKB 3RVUD 4JAMB 4MCYA 3RY5A 5AAWA 2NY0C 4YE4L 4P59L 3NBNA 2BY1A 3EKCA 5I30L 1NANI 3IXAB 4UNUA 1NH6A 1S9XB 2EIEA 3UCRA 2J6EA 2LV4A 5D7LB 2EDHA 2R15A 1HIMH 1EHLH 1YEHH 2AJYL 3TBTA 4PJCA 4AQ1B 4HXAL 3WDHA 1QLEL 1MAMH 2FX8L 3A67L 5LXGH 4JM4H 4LKCB 3MRQA 1G6RB 2G2RA 1JPST 2IMMA 4N0UB 3EAKA 3ROOB 1JPGB 5GRJL 4LNRA 3VFTA 1TVHB 3STZA 1JWSA 1QSFA 1F4WL 2BVEA 1VEOA 3L5XL 2RR3A 4BELD 4B5EA 5F9OL 1J1XH 4U49A 3WIHA 4DQOH 3RKPA 3PV6B 4R4ND 3RU8H 1PZ5B 2XZAL 3ZKMD 3JTTB 2VL4A 3ZE2F 2IAMD 1IC5H 1EZVX 1P5VA 5EC1B 5GS0C 4OZIA 2F5AH 4X80H 5L2KD 4P9HH 3MA7A 1D5ZA 3H0TA 3FB7B 3L3OB 2BSRA 3MRNB 1BIHA 4R2GD 3NCEB 2UZXB 4I3RL 2IBGA 4NHCH 1FBIL 4GKZB 1MY7A 5FGCB 3SGEH 2R0WH 3NGBB 4X6BB 4N8CH 1DTUA 3TM6A 2PTUA 3V6FB 5C0RL 5IVXF 4LDOB 1EEZA 3E1F1 3WSQH 4O51B 2E3VA 5DZOA 5C0BB 4HWNA 1JF1B 5E1HB 4OGAC 1ZMYA 1HDMB 2YD5A 4JFXA 2EYSA 1NGYB 4KKCC 4HQQH 2AKRA 1RZIA 4DZBA 5HHVL 3BUYB 2LQRA 3O6KH 1XAUA 4OFYD 5ID0B 1FFNA 1KLGB 1UGNA 4I2XA 5C08E 3AS1A 1U6AH 2CGRH 4P4KD 4DWHA 4ZAKB 3MCKB 1HKLL 4KI5E 5CBAA 1SYSA 2HN7B 3ARDA 3STBA 2Q6WB 5DTFB 1AI1H 3DRTA 3GBNH 1YPZA 1WFNA 3G04A 1UWXH 4NZRH 5D7KE 2A6DB 2WQ8A 3WDJA 2DTMH 4YXKH 2HAZA 1YUHA 4HUWB 4XP5H 3T4YB 5J9PB 2ICEB 1UKSA 3MV8B 4LKXA 2OS7A 2HFEB 4X9BA 3E6HA 2J8OA 1IAOA 2UY6A 3S6CA 1ETZB 2YUXA 4X7SH 5CJOH 2VQTA 3QG7H 1R6VA 3HE6B 5MERB 3QEUA 3KLAB 4NNXA 3ALXA 5EOCJ 7FABH 4QGYA 2P24A 3OV6A 3Q1SH 3LSOA 5DMKA 1DLFH 4OTXH 4M1GH 1FG2A 1XGRA 1RZ7L 2X4OB 4LPYA 3T0VA 5J57B 3GIZL 3R06A 1AY1H 5FM5O 1PX3A 1U8JB 4UTBH 5IEKA 5EFIB 4X4XA 3HPLB 1MFAL 4P2RA 1RZGB 3GSWB 1J7VR 4HWBA 2OTUA 5JZ7C 1HSBB 1OSPH 1ZT7A 3HB3C 3O3EA 3AC0A 2R23B 1RJLA 4YK4B 3JBG7 4WUUD 4XNZC 3MACH 1S3KL 1L9NA 2VZTA 1YEKL 3ARFC 4ZS7H 1M7IB 1AO7E 5GGRY 4XVJH 4Z76A 3DBXA 4KVNL 5HYIA 1CFQB 1CK0L 2ADGB 3B9KA 3ORJA 5B3JE 4XC1L 4Q6YA 4H20L 5C9JB 4EQ3A 3AY4A 3QXDB 4NQVB 5T5NG 3IDXH 4QTIL 6FABH 4PGCB 4S1SL 5AEAA 3PGFH 2Y23A 3FQNB 3NIGF 2BJML 4OGYH 5DURD 3UDWC 3K0WA 3D1MC 5DQDH 2AK4A 3HNSH 3KPSD 5CZVL 2VZVA 4RISL 2ESVE 4XNYH 3TO4A 1IAMA 4PP1D 5C0IA 1J9CT 1D5IH 4MA7H 4P5MA 3VG0H 3ULVC 5TPWL 3VFUA 3MRFB 5C0EB 1TCMA 4NKIH 4XNXL 4JB9H 3MV7D 2X4QA 3GFUA 5C0CB 3AGVA 1BFVL 4P46C 3M8OH 2NLJA 1KT2A 4Z18A 4ZDHB 3QUKA 4JRYE 4MVBD 2FECI 3DVGB 1LNUA 2YRZA 3TESA 2E6PA 5DJ6B 4D9RE 1HXYA 5D8JL 2HMIC 5TQ2L 1DBMH 4EZMA 3LN9A 1XGUA 1VFBB 3O9WD 2EKSA 3ARBA 2O93L 3N85H 3JVGC 2H2SD 1LEKA 1IGJB 4F58L 4LK4A 3CMGA 1QRNB 3HNVH 2B1HH 4H26B 1K2DA 4JDVB 1KYOJ 3JV6A 5CP3A 5IBUG 1RZFL 1AGBB 4RMSA 2PW2A 4R90H 1PGRB 1HCFX 3EDDA 1HHJB 4YBHA 1DBAL 1ZS8A 2ZZUT 3ZDYE 3PIQA 4AENB 5EBWB 5I15H 3QHFH 1XF2A 2H6PB 2XQBL 1LE5A 1HNFA 1IFHL 1RMFL 3AREC 4IRJB 1RZKL 5EO0B 1ZEAH 3BGFB 4G3YH 2HRLA 4KZEL 3WNNA 5KBNC 1VADB 3QZWB 3LVEA 2ZCLL 4K8RC 5IEHB 1FVCB 2V2XA 1NC2D 1ZT1A 3PV7A 3I6LD 1ZVYA 4HH9A 5GGUB 5I18H 1BM3L 1A1NB 5FUOL 3SGJC 1BFSA 1JF5A 1XGPB 2ENSA 3MJ9A 4G6MH 5IGXH 4DEPC 3HZYB 3BP7B 5D5ME 1FVEB 2YA2A 4GFTB 4M48L 2QR0B 1AD0A 2ZOKA 2J7LA 5BCAA 4H8WH 5T33L 4PJ9C 2EDXA 4QHMB 3FFDA 4RX4D 2R69L 5EU5B 4R3SA 4QHKJ 5SX5K 2NY7L 1TITA 1N4XL 5IJKC 2X09A 3VCLA 3TBYB 4U6VL 3IGAA 1IC7L 4LHUD 3TF7C 5IESH 4DCQA 3ULSA 4D9QE 1MCJA 1XGYH 2NQCA 3VXQB 2BY3A 5ICZA 4PJIA 4ONGL 1IGTA 4FG6C 1LP9B 1XZ0A 1NLBH 3C5ZA 4JFHE 4KV5E 1T2QL 1TPXB 3NZ8A 3D6GA 4JZNA 3PXJA 4MAYD 3OKNB 4H88L 4FQQA 1I85A 4C58B 5DHVA 3S34H 1DEEB 5IWLA 1YQVH 4JN1H 4LCCA 2AXFB 4B7IA 4NO5B 2CMRH 3VXSA 5F1IB 3PWJA 1YQ2A 3MX0A 5LQBL 1ZAGA 5GISH 5F88B 1A7BA 1FL6B 2AEPL 2NY0B 4HS6A 4P5TB 4ELKA 1LP9F 3CH1A 4KAQL 1GGIL 4AMKL 4HIEA 3AMKA 3FO1A 1DANT 1JZ4A 5CD3A 1YEIH 3RHWF 2V2WA 5TGBB 4Z7UE 3PGCB 3ROLA 4LEXL 1MCQA 2GIYA 5HDOA 1ZGLP 3GBML 4FP8H 1MPAH 2CRIA 2OJZL 4U1SA 2NY5L 2DI9A 4N9GA 3GUTB 5DRXA 1T1YA 4A6YH 1S8DA 2JTDA 4K7PL 3FMGL 1WCQA 4NCDA 4WI7A 4CDGC 4HGWB 2VC2H 5C0NC 2JJTA 2X4SA 5I1IL 4NNYB 5MENB 3SPVB 4RAUA 3BJ91 5DWUL 1K9TA 4D0DA 4PJHB 2DM7A 5TE6H 3VFOB 3KPQA 3H7BA 5E6IC 4XPFH 1A7RL 5DK3A 1R3IH 4BZ1L 3IDJB 3GI9L 2R2EB 3LQAL 2J2ZA 3VXMD 3BUTA 4J2XA 4HPOL 3BEVB 1NDMB 3TP4A 4BFIA 4Y4HD 1AGCA 1PYWA 1JZ8A 5CMAB 4EXKA 1J11A 1T7YA 1V7NL 4TVPD 2C4FT 3UYOD 4PJHF 3BIKB 1AP2A 3QG6B 3DX9B 4N8VB 3W39A 1MI5B 3TIDB 5FOBB 3L9RB 3BEWB 3KXFE 2D03H 1HSAB 4MXVE 5DLML 2EYTB 1MHHB 1QOKA 2EXWC 2AABL 1WISA 1JL8A 5K9KB 1CBVL 4YX2H 1VPOH 3F7VA 3LKPA 4FQCH 1RHHB 5C3TA 2NY4D 2OL3A 1VGEH 4Y2DA 1IJ9A 5DUPL 1A14L 2DJUA 1T66C 2QLVB 1QSED 2OP4H 2FECL 3UTQA 1V8HA 3SGEI 1MRFL 2GJ6D 4Z9KB 3HRZB 4FQ2H 1FFRA 3T8XB 4UV7H 1WFTA 4BSJA 5F1NB 5I0ZA 2PO6A 3OL2A 1WWCA 5HHNA 1UZ6E 2QKIA 1KPUB 3C08L 2E27H 4WO4B 2I5YH 4DK3A 3FZUD 3WD5L 3U82B 3PABB 1KCVH 4U6HA 3D2UA 3RHWK 3ARDC 5LGJA 5DRWB 3GJFH 3UAJC 1R5VB 4LU5H 3M1BA 1U8HA 5I8EB 1JWUB 1WTGT 2MWCA 5BOPA 5JR1L 3V0WH 3UTPD 1DN2A 3O45A 4R96A 1U8KB 3PGDA 3UTSE 4L4VA 3WE6B 5FECB 1CU4L 4XCYA 1F4XL 5IBLD 1B90A 1FZOB 4G8FB 1FLRL 3WHE1 5JDSB 1L0XA 1JHLL 3KG5A 4JRYA 5HJ3B 1TNNA 1EUUA 1GH7A 1U3HA 2E7MA 1U8MA 4XP4L 3VH8G 3SDDD 3GB7B 5C07D 3QIBB 5D71H 2LE9A 4N0FB 1NBVH 3F6IA 4WTXA 4X0KB 1XCTB 3OKOA 4DKAA 5EWIL 2A6JA 3HZMA 3JTSB 3VGFA 3REVB 4XPGH 3QEQB 4NRZB 5IMKB 3G08B 2XY1A 3BMWA 2BFVH 2ZSWA 5CEZD 3SOBL 4D0BA 2CUIA 5I16A 3AVEA 3CSYA 2H8PB 4M4PA 3UJTH 5E03A 4JLRA 1Q9KB 4RQQB 3HG1B 4PY8I 5IIEB 2AK1L 4UILL 2KDGA 3B9KC 3MLTB 5JLZB 1IQWH 3BKML 4BK5A 1GIGL 1UM6H 4P3DB 2YRPA 5DGQA 3KYNA 2VDKL 3AY4C 3GIVB 4OQTL 1EAPB 4OLVL 1CLZH 4HUMB 4FQXA 5IMOB 1I7ZB 4PGBB 3EZ8A 3CVHL 2NNAB 5CSZA 2XKNB 2RCSH 4CKVX 2FBJL 1JP5A 5JHLH 1WC7B 2HLAB 1S9YA 3KJ6H 5I8CB 5FYKH 2BVQA 5IR1A 3BFOA 3OB0K 3QB7C 1K6QL 3TO4C 3VFGL 1QRKA 4XB7A 5FCUH 4FNLL 5TE7H 1OAYL 2OYPA 4WEBL 3RPIB 3TCLA 5D7IF 4OZIE 2DQEL 2Y36L 1L6XA 5LWYL 2FH8A 3RWFA 2F53D 1B0RB 5DVOA 2CK2A 4WWKC 4JRXB 1IGML 2F54D 4DUVA 4YFLF 2IPKB 2LFGA 5DO2D 2IWGA 5EZJB 3REWA 4HHAB 4YBQC 2O5YH 1AKJA 1I7UA 1T04B 3V5KB 5JXAL 4A2LA 3MRCB 4XAKE 2DD8L 4PJDE 3ARBC 4CNIA 5DJYB 4GT7A 4NFDA 4AIXA 1YNKH 2OQJB 1W8OA 4XWGL 2PUQT 4NQDB 1T22A 1UJ3C 3RX8A 3ILQD 1J8HD 3BD4A 4L4JA 2R2HB 1TZIB 3RY4A 5KSAB 2NCMA 4OF3A 1KTDA 3DRQA 3EFFA 1G7QB 4JR9L 3HR6A 1Y18B 5FUZH 1DQJB 2VR9A 4C55A 1EGJL 3RWGA 1JPTH 5E2UL 1T1XB 4PGDB 1A4JA 5FDWB 1VB9A 1SEBA 4FZ8L 1OL0A 5FCSH 2Y5TB 5HGDB 1ZHKA 4WY7H 3MLWH 5JOFB 4PB9L 2AJZA 3L6FB 5DD3L 3CX2A 1X5IA 4GRLA 5E2VL 1DN0A 5EB9A 1S7UA 4RIRA 5E4IA 2P5WD 4ZXBB 3C60C 2EYRB 5BV7C 1AXSB 4LSSH 2JJWA 5CILL 4JFEA 1UXSA 4TN9A 2VLJB 3QI9A 4YC2B 3UPRB 4KC3B 4WI4A 3OAYH 2E7LA 5HYJA 5SWZA 1AE6H 4MNHA 2Z35A 1F4YL 5KVFH 5HXMA 3RP1A 4NUGL 2FATL 9CGTA 4OZFB 4PRHA 1K8IA 3OTTA 3KXFA 3C5ZC 3OR7A 1FRGH 3SKMA 3L5JA 3L3JA 1IEHA 2MOVA 1ZLVH 5LCVL 3S35X 1I85C 2OR9H 3EBAA 2CKBH 3MRMB 5D9SA 3VFRA 5IWLC 3F65A 3OJ2C 4QKXB 4LCCC 5HHOE 2LTQC 3KPRA 1AGFB 2YD3A 1ES0A 3RA7H 4LIQH 4HJJL 5GRUH 3MRJB 5FF6B 4XCCH 2UZIL 2VLRB 3MV8D 5KVDL 3UJIL 3LKQB 1BWWA 4GBXA 3DHMA 3L3IA 3N9GL 4PRNA 4Y5YA 5JXEA 3P3YA 4H1LG 2VLME 3HE6D 1ND0A 4M1DL 4JZOA 3U2SB 1KXTB 4HC1L 2WWMD 4F8TA 2V9QA 1X4XA 3SQBA 5E5MA 2VDPL 2IEPA 2FJFB 4AZ8A 4PJBA 4AEHL 2JJTC 3QP3A 1JGDB 1ADQA 1CQYA 1WAAE 4JQIL 1KN2H 3QQ9C 4TVPL 4UUJB 4XHJC 3KS0J 5GS0H 3MUHL 3TBVA 2NR6D 3MSPA 1VENA 3VXOA 1EJOL 3H0TB 4TNVF 4KK8C 4JO4L 1UACL 4KH2A 1GZPA 4NT6B 3ARYA 4PR5B 5DZLA 2VQ1A 4JVWA 4IDJL 4JE4B 4KHTH 4XNUL 3B8SA 4LL9A 1NCUA 2XNAA 2NY2D 4Y7MA 3A6CH 1IGYB 3SN6N 5KVGL 2MNUA 4H1LH 4IIQB 2X4NA 3MRRB 2EYSB 3R4DA 4Y2DC 3LIZH 5KSBB 1JCKA 5J1AA 5MEOB 2W0PA 3KWWB 3CFEB 3BQUD 1JGEB 4NFBA 2ZUQB 4I18A 4QRPB 1CICB 1QFWI 2PO6C 3OG6B 3VDAA 5CBAB 3V7AE 5FO7A 4O9HL 2YC1B 1LK3H 4WRLA 5KSBF 3DRTB 3O6FD 1T0PB 4Q0XH 4D8PA 2QJDA 5L6YH 1SEQL 3HN3A 3HZVA 1WGOA 3QEHB 4WEUD 3E6HB 1IAOB 3QR2A 4YUEH 3H42H 3FO2A 5SWSE 4UZGA 4YDKL 2HT4D 4P2QE 1IE5A 1D5XA 3TO2A 5TF0A 3QEUB 3NCFB 1D6VL 4GXVL 1FN4A 2P24B 3FT3A 4YGAB 1A9EB 3FQRA 1M05A 4FTVB 1FG2B 1XGRB 3SO3C 1OLLA 5DT1H 2QSCL 1FL5B 3O4OC 5E1AB 3O8XA 1XGTB 2GITA 3FOMA 5IEKB 4X4XB 4P2RB 4V1DB 2AEQH 2OTUB 1U3HC 4PRID 2GTZB 1ZT7B 4TNVK 4PRPA 4YBLB 3EIFA 4J12A 4MQ7B 1BHGA 3K81A 2EXYC 4KJYA 5E8NA 2ARWA 4FXLA 4JJ5A 3GZKA 1VHPA 1UWGH 4QOKA 4OQ1A 3ARTA 4CU8A 3CXHK 3D39B 2KBGA 2ZKHH 5MI0B 1WJ3A 3LKSB 1KB5L 4OFVA 5GGRB 1XMWA 5E7FA 1NAKL 4NQED 5IB3B 2FCBA 3GKWL 4EI5A 3PHOB 2EO9A 1WWWX 1J1OL 1IKNC 4MS8D 5DJDB 3ZLQC 3T0DA 1ORQA 4U1JB 1T7ZA 4ZTPL 3VA6A 5F96L 3IJYA 1N5AB 2BNQA 2X6MA 3NA4A 4PJ7A 5CUSH 4BQCA 1LEIB 2ZPKL 3OKEA 4FQXC 2FBOJ 3BAEL 3BDYH 1U0QA 1Z2KA 1BLNA 1Q38A 1IQDB 4PRBB 5TDNA 4ETYA 5INCA 1F11B 3WFBL 5AG8A 4QXWA 5A43C 1I9RL 3GSRA 4NZJA 1CS6A 3ULVH 3MLUL 4GUPA 4RMRA 5DRNB 2X4PA 1KENL 3O6LL 1G9NC 1G9MC 4GS7C 4E41B 1Z9LA 2D7PA 5DQ9A 5HYSG 5HHPB 5E00B 2X4RA 5I8OH 2EKJA 2C3HA 2DN7A 1G7IB 3RWHA 2NLJB 4X5XA 2FD6L 2YUZA 2MKLC 1NL0H 3DX8B 3QUYB 3CLFH 1VDGA 5DK0A 4W4OC 3VJ6A 1WFUA 5F9AC 1CTOA 1P7HL 3F7PC 1G6RL 4Y1AB 1ZKAA 1MREH 2ADFH 3DYPA 3LS4L 4PTUB 1YY8A 3BP4A 1K2DB 5I8KL 5DFWH 1S78C 2G5RA 3BZEA 2CR6A 3FB6B 4WGWB 5ADPL 3HS0B 3PIQB 1JFQL 4Y89A 2R1XB 2PYEA 3BH8A 5DC0A 1LE5B 1L4IA 1NGPH 1BX2A 1CGYA 2OJEB 4KHXH 1KIQA 4TUJA 3BW9A 1KGCE 5MEND 1F4HA 1S5HA 1VESA 2DM4A 2VR4A 4K8RH 3EYVB 2AJUL 4N1EA 1KTKE 3K2UH 5DMJB 3MOBL 2DMBA 3S3SA 2FO4A 4HUXA 4PB0H 5C92A 3MYZA 4PJ5E 1U8OA 3FRUA 2ZCHH 3EYOB 5EZLA 4O02L 1N64L 3IRPX 3OJDA 3AU1B 3WBDA 1WAAA 1NCCH 4U1MB 1QFWL 3CU1A 1QNZH 2AJ3B 5EU6A 4GRLC 2HG5B 2R1WA 3PP4H 5HY9A 1T2JA 3UTTA 2GUOA 3IF1B 2CDEB 3OXSB 5GHWL 1DVFA 4IJ3B 4DCQB 4LPUA 3QI9C 5T1DL 5T5NF 4G9FE 3T1FB 3ARRA 3QCVH 1MJUL 4LPTA 5GRVK 4U4BA 2E7LC 4BJLA 3T0XA 3MRDA 4L8CA 5ELIA 3ARXA 3TV3H 3GSVB 1XZ0B 1FC1A 1FPTL 5TFSH 5AYUL 4B7LA 3RWJA 2X5PA 4PJ8B 2M8XA 2Q20A 3WNMA 2VAJA 4FQQB 4QRRA 2WBJB 5DHVB 2OZ4A 3QDGA 3LS5H 3DYMA 1A7OH 4JFPB 1W2KT 1QYGL 3S5LA 4XP6H 4WO4D 5JPNA 1BAFL 3VXSB 4FHBD 3P9WB 3GMRA 3KYAA 4RGNE 4MZ2A 4HS6B 3BRFA 1JGUH 4R8WL 3TBWA 2DQJL 3JV5A 2YWZA 4GG6F 5JO5A 3MUJA 1HHIA 3FO1B 4Z7WF 3NMEA 3NH7L 3F58H 5IBUB 2R2BA 1GOFA 3O0RH 5HGHB 4GBXC 4U1SB 4YR6A 3RGHA 2A38A 4L4TA 5HHQA 4Y5YC 1N2RA 3OF6D 1OSZA 3O4LA 1S7VA 3KJ4C 2VISA 2FLRT 3E0GA 4PTTB 1JHTB 4FFYH 4Z7VB 4X5WB 5H2BA 2CQVA 5DK2A 1S7XA 2R1YA 3MLVL 3RL2A 4MSWA 1P7QA 4RAUB 1RK1A 4UBDD 1FDLH 5F8RC 4D0DB 5ALCL 3SCMA 1MCWM 3GRWA 1FORL 4P2QA 3QIBD 4MGXA 1T89A 2Q8BL 4AEIL 1IBGH 1EO5A 3QBTB 4HJ0C 3DTXB 4LLQA 3HZKA 4F37F 2GKIA 1Q9WA 4Z77A 2OXGA 4GKOA 4BFIB 1A3LL 4CGTA 3MO1B 3Q6GL 5FO8B 3IDYC 4KKBC 2IADA 4L3EE 4XTRC 3BH9A 1EEYA 2VXVH 3QEQD 4TULH 3CJJA 2DIBA 2NY6D 4JCMA 3HC3L 1H8NA 5DUML 3ZKSD 3SKUD 4KQ3L 2VDRL 4XBPB 4A6YB 3OB8A 3FCTA 1ORSA 1EBPA 2B2XL 2IPTL 1INDL 2WZPD 4KROC 2W38A 1I8KA 2GI7A 3HG1D 5TDPA 3RDTD 3S36H 4XMPL 2R4SL 4G7YL 2OCFD 2IBZX 2VXSH 5HHMB 2OL3B 4YJZL 2R39A 4Y2DB 1GGBL 2NZ9D 2W1NA 5I1KH 4G8GB 5CJBA 2DQDH 3TJHD 4IMLA 1BECA 3Q6FA 3WIFA 3BSZH 4QXTB 5GJSL 3HAEH 4P48A 4APQA 4YHOL 1T7VA 5GRZA 4X6DA 2M26A 4PRAB 1IVLA 4I18C 2IQAA 5T3XL 1Y6KR 1RIVH 2BVTA 3NCJL 1SYVA 1GPOH 4KZDH 4RNRA 4HIIB 3ULUL 4GW4A 2DYPB 4D3CL 1S7SA 3Q5OA 4WFFD 3RIFF 4JRXD 4YHIA 4HT1H 1T03H 1TJHH 1YNLL 3M17A 2W0FA 3QHTC 1JBJA 4KKAC 2D7OA 3O45B 3T0AA 3LHPH 4XCYB 2B5IC 1BPVA 3MXWH 5DVKA 1FE8H 3O4OB 2R2CA 1S7QA 1ZGLB 3IJSB 5D1ZA 1TLKA 5IFAH 4F37K 3IDMB 3O8XC 1U8MB 1I3VA 4EBQH 4PJAE 2VRAA 2CJUH 3KYOB 4HWBH 4LLWB 4MJ4A 4X4ZA 4ZO9A 3GGWA 3D18A 3HZMB 4C4KT 1AGDB 4LSVH 4HDIA 1INQA 3MRPA 1WBZA 5GIRA 1NSNH 4PBVC 3VWJD 3QHZH 3HC4L 4ODVL 2D7QA 1NFDB 5I16B 5A16A 4X6FA 3MR9A 4KK5C 3I9GH 1DBKH 4OIIL 3VXUE 3EW3B 1KG0A 1T5XB 3QDMD 3WJLA 2YKLH 3F7RA 5C2BH 3MRKA 4ZUVB 4EI5C 3DROA 4WU7B 2DQFB 4OCYH 3GMPA 2RGSA 1U8QA 5B39G 4LLUA 2Q3AA 4ZXBD 1NFDF 4FQXB 3TBSA 2CLRB 3QDAA 5E5UB 4Z95H 1FIGL 5CSZB 5DJ0B 5B4MC 1JZ7A 3DSNA 1FCCA 4PP2A 2VLJD 3BXNA 4Y5VA 4OIBA 1Q1JH 2BVQB 5EZOH 1I1AB 5FGRA 3VE0A 5JW3L 4HKXA 3QQNA 4LPXA 3RZWA 3MLSL 1OGAE 3CD4A 3LKRA 32C2A 3SJVA 4DUWA 2Z4QB 2FB4L 3RIFK 1HYSC 2HFTA 3CXHJ 5DRZB 4KGLA 5D70H 4PGEA 4NQCA 1YJDC 1G7PB 4O4YL 4HUUA 2DQIH 1DL7L 4QXUH 3M07A 2DS4A 1I3RA 3C2AH 1NC4A 2A9MH 4HKJB 2JCCB 5EBMB 3VWKA 2JLLA 2J4WH 4F7MA 5JHDE 3HI6H 3INUL 3PNWA 4MWFA 4M61A 3DUHA 2VLRD 3T0EB 1LGVA 2DM2A 5L8KB 5EO1B 5C0DA 3Q5YA 2DQHL 1EFQA 5CWSB 5FHAL 2XRAL 4GW5A 3VH8B 3ZE1E 4S1QL 4AYFA 3FHQA 5T5FH 2DQCL 4NYLA 5CP3H 3TN0B 1AQKH 3GNMH 1GVIA 4GJTB 5GZOD 4ALAL 4HWEH 3QJFA 1IZKA 4OZGA 3NFNB 5DJAA 1VEPA 4IEFB 3NTCH 3NCMA 1QFOA 4Q58C 1TIUA 2EH8H 3HE7A 4LSPH 1NGXA 4NKOB 3BESR 2WMPA 4NC0B 4XVUD 1QKZL 3QNZB 1A4JB 3P77A 4OCWH 3GJFK 3D9AL 3KR3L 3X3FL 4K7FB 4JO2H 5JW4R 4HGMA 1CFSA 1X7QA 1ZHKB 3EYQC 3WXWH 2AJZB 1QHPA 4GRLB 4P3CH 4NOBA 4RIRB 3P0YH 5JW4M 3NIDE 5D7JA 1JZ2A 5BV7H 4D9LH 5F7KC 2ICWA 2FGWL 1EHNA 3U1SL 1CFTB 1URLA 1WIUA 3LDBC 4FQLH 4JFEB 4DN4H 2YZ8A 2V9TA 5JQ6L 1RZJC 3QXUA 5TE4H 2YMXL 1DVFC 1QPPA 5SWZB 1UYWH 3BISA 4PJEF 5F7EL 1BGXL 1FNLA 2EDYA 1I1YA 1IAIH 5I6XC 1SJEB 4R4FH 3PWVB 4TOYL 1FZKB 5EBGA 1K8IB 1JNJA 1BBDH 5GGVH 4N68A 1I1FB 2XTJC 4X7TA 3V4PL 1QFUL 3MLXL 4LRNL 4OF5A 4HMDA 1CICD 1WV7T 2I07B 3RVTD 1PKQB 5F6IC 3KPMA 5HDLA 4G42A 3NFPA 3S98A 1MRDH 5D9SB 3VFRB 3C6LB 2HRPL 3SDXE 4DK6A 4YO0B 5TDOA 1C1EL 3P9LA 3LEYL 1U95B 2WWKO 4YQXL 4L8DA 1F58L 2FX9H 4XRCA 2FJHA 1Q9OA 5L0QB 2AQ3A 4G43B 2B39A 3QCTH 5FYJE 4WFED 1FZJB 1DQTA 4PV8B 2ARJA 3BD5A 1KELH 5C0AD 1MQ8A 3IFOB 2CPCA 1FNGB 4O5LL 5GS1A 3OKMB 2QSTA 4L29A 5IG7B 3N1GC 3QAZB 5L88H 4M7KH 3MLYL 4JZOB 2R0ZL 3RX7A 4C83A 3SO5A 3MRIA 35C8H 5EA0L 5DXWA 3B83A 2DLHA 1S5IL 4U31A 1P4LB 3EYSL 4C56D 5MHSE 4EI6B 1X6NA 4Q9RL 43C9A 3LRHA 3X14A 3CFDA 3PWNB 1XR8B 5HGGS 3CSGA 1JE6A 1T6WA 5KOVC 5SWQA 4NQXA 2KPNA 3SCMC 3BPNB 4UNTA 5F7DB 4DTGH 3CSPA 4K9EC 1T89C 4HIHA 4WCYH 2H1PH 4ORGA 2HLFC 3PDOB 2IALB 1G7MA 1A0QL 1KJMA 4XVTH 2ZUYA 2GT9A 3D39D 1WBYB 3HMXL 3WKML 1XF3B 4PJAA 2ATPB 4CU6A 3WIIL 3TIEA 1MJJA 3QIWD 1ZXQA 5EOQH 5EU3A 4EDWH 5DD5L 1Q9LA 4TSAH 4KRPD 5IF0B 4LCWA 2VXQH 2ITDA 4NN5B 5E2WL 4YHML 4UU9A 2X4NB 1Y6NR 1CCZA 1OARL 4DZ8A 1L0QA 4OLUL 5D1QA 4ZTOH 3FAWA 2WWKT 3IYLW 1HILA 5D1XB 4F57L 1MCLA 1BZ9A 1S7TB 5I17B 2RJMA 2Z92B 1JHKL 1YYLL 4YHYB 4I18B 5EDXA 1CTNA 4APQC 3HI5L 5IW1A 4WUKL 3PWLA 4ONOA 3RZCC 1IEBB 4NRXB 2NZIA 3EFDL 1Z0NA 4PJGB 1C08A 4G6KL 3P9MA 4GG8A 3DURA 1PZUB 1T21B 3LEXA 1FAIH 4D8PB 3NA9H 5HSFA 2FSEB 2YD7A 4KWUA 5KSUA 3HZVB 3QRGH 3GJEB 2VDMH 4E5XA 1OD9A 4G9DB 3ZDZF 4H1LB 5ABDE 3WLWD 5E99L 1HNGA 5GZND 3QUYD 5BZDB 1BOGB 1FP5A 3VU2A 2IANE 1KIUA 1NPUA 5GPRA 5GJTL 3CMOL 1FN4B 4XCEA 4Y1AD 3OAYK 3D0LB 2DQGL 3DMMB 4PJFA 2IAMA 1OAKL 4LARH 3LCYA 5D1ZC 5L2KA 2GITB 3FOMB 4LAQL 4PUBH 3MPCA 1NCWL 1TMCB 1CDJA 4H5SB 1P2CB 4YEFA 3CC5B 1KIPB 2ORBL 1DFBH 1ZLVK 4NO2A 3RVWC 4LAJH 5LBSL 5KTEH 1X5JA 1XGQB 3LH2H 3QFJB 4HCRL 3VD3A 1CI5A 1S7RA 1MLCA 4QOKB 5I1GL 5CD5C 1UKTA 5LVEA 5J1SC 3OR6B 2E7BA 1Z9SA 1KXQE 4WV1A 4XNMA 4Z7OE 4POZC 4LCYB 3WFHB 1QP1A 4YHPB 5AAMA 2HT3D 1T20A 4JPWL 3ARQA 3AUVA 2J88H 4JHWH 3V5HB 3JWNC 2YUWA 1O5DT 3WJLC 3E8UL 4LASL 2ADIA 1A3RL 1ORQB 1MY5A 3ZYZA 4DGYL 3BVNB 2DLFH 2D4DA 3RWIA 3F12A 5I9QC 4OFYA 2GAZA 3KPOB 4MHHG 4XXDB 4L9LA 3OKEB 4P4KA 1KULA 4K2UL 3V52H 1I3GH 3I50L 4U7KA 4I0PA 5EIIA 3SDYH 4BSWA 2HTLD 3CK0H 2QQNH 4Y5VC 1QBBA 2BVPB 4OGZA 2FYYA 1G0XA 4TPRH 1ZWIB 3CFJA 4JPVH 4OCNC 4ODSL 1I8IA 4JQVA 5DDHB 3MRBB 5CBEA 1G9NH 4F2MA 3BP5A 1IAKA 2ERJC 4PJ8D 43CAA 4KJWD 4MQSB 2MCPL 3NFSH 3RVXC 2WBJD 3E3QE 4M8VA 1FSKB 2KQNA 2W0LA 2J6EL 3FFCE 4F7EB 2DB8A 4WW1A 2B0SH 2VXUH 3RBGA 1EA9C 2QL1A 3VJ6B 4N90D 4IOFD 4CMHB 4BH7B 3VWKC 1JNNH 3IB4A 1YDPB 4IRSA 1JUFA 5EU4A 3KYKH 3ZMRA 2VDQH 4WFGE 2A74B 3SDXA 1U9KA 4OM1L 4POUB 3MREA 5E08H 2WQRA 3R0NA 5ILTH 2XZQL 4WNQA 1QO3A 1ZSDB 5D2LB 1B4RA 3FQTB 2H3NB 1NEZG 3MLZH 3FN9A 1FYTD 5JIHA 3FRPG 5HGBA 3UROR 4LLMA 5BMFL 3DUSA 2XN9D 3LKOA 5FA4A 4DVBA 2VAAA 5SX4H 3T3PE 4I1NB 4W68A 1CT8B 4U1LA 3IDUA 5ESQA 5CCKL 3HE7C 1EHLL 4OLWH 3ULVF 3WFEH 2MQ0A 3GMMA 2NY1C 1JTPA 1MAML 3IDIA 4CW1A 5D2LF 4WTZA 3QPQD 2FO4B 3WN5A 2CRMA 1WVZA 5EZLB 2XWBA 3C8KA 3MROA 1MFBH 1T1ZB 4JHAH 5ESVA 4TQEL 2NPLX 4TUKH 1A2YA 1LE9A 1M6OA 4L8BA 3VFVA 1WBXA 3FN0H 3KPSA 1TTFA 1VGKA 1BQLL 3SE8L 3OAUH 1KJVB 1G7JB 1GCFA 4OQTA 1CL7H 5H94B 2GUOB 4UNVA 2LU3A 2F5AL 4X80L 5BS0A 4PJXB 1FGNL 4GW1A 3CVHA 3PJSA 5MP6H 2IPUG 1HWGB 4O58L 3DXAD 3MV7A 2EDRA 4OV6F 2XTLA 4L8CB 3MRDB 4YHLL 5HYSB 3GMLA 4NO0B 2P7TB 2XTJB 1X44A 3RWJB 2RAMA 5K9QG 4RRPA 4JY5L 4KJPD 4PJXF 1J8KA 4G8EA 3G6JB 4K94H 1A7QL 2A1WH 4MD0B 3X13B 4OV5A 3EGSB 3V0VA 3V9FA 5JPNB 1Q0YH 3ARGC 2P42B 4NBYB 4XAWH 3S3PA 4GRMB 3O9WA 4HBCL 3RRQA 1AR2A 5EC2B 3IT8D 4Y5XA 4NN6C 1KIRB 2VZSA 3TBWB 4ZUTB 1DJSA 5IMLB 2DYPD 4XPBL 5EORH 3AAZB 1ACZA 3O6KL 3G6JF