1WT5C

The crystal structure of a humanized antibody fv 528
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
DIVMTQSPLSLPVTPGEPASISCRSSQNIVHNNGITYLEWYLQKPGQSPQLLIYKVSDRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHIPPTFGQGTKVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI EGFR ANTIBODY FV REGION
publication title Thermodynamic consequences of mutations in vernier zone residues of a humanized anti-human epidermal growth factor receptor murine antibody, 528
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 25
structure length 111
sequence length 111
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wt5C00
1JTTA 4M7ZC 4GLRI 1PAMA 3ARSA 1LP9B 1K3ZA 3U0WL 4YO0A 4KRMB 3FQNA 4V2BA 5H35B 5E2TL 3REVB 1Y6NR 3HPJB 3U9UB 2P8PB 3WIFA 5C0CA 5TDOB 3SBWA 3ULVE 2BSRB 3LEYL 1T1ZA 2UWEB 4Z7WB 3QIWB 3C8HA 3IGAA 2E7MA 1RU9H 5EO1B 4R7NA 5BOZG 3GSQB 4P23D 2LVCA 5CEXB 2DQHH 5K9OA 4P4RA 1ED3A 3SOBH 4F33A 1XGUA 2DQGH 5J89A 3CDGB 2P7TA 5E8EB 2GHWB 2PR4L 3DPBA 1FIGL 1RQ5A 1R3LA 4U1MB 1P1ZB 2CXGA 1DFBH 2GJZB 2P8MA 1UJ3A 1ONQB 3A0OA 3QZWB 5CD5C 2YPLD 4I2XE 3HLAB 3RDTB 5E2UL 5CFHA 2I60H 3MO1A 1QSEA 4LVEA 4Y88A 4LP4A 2CUMA 1CFQA 4NC1E 2PNDA 5TGBB 3S88H 2JK5A 5C09B 3TA3B 4CMHB 5I75C 3N9GL 1ZT7A 2JIXA 1QO3A 1RVFL 4Z7VB 1J11A 4OLUL 3S36H 1FO0H 1T7YA 4MJ4A 4YQXL 3DVNB 4W70A 2HN7B 3UTPE 1OGTB 1QPXA 1W72B 4S1SH 5F89A 3G6DH 1A1NA 4WIQA 2B1AH 5J9PA 4DFHA 4NNYB 1WIUA 3PDOA 2HG5A 3VXSA 2Z4QB 1LO5B 4O2FB 3IJSB 5CINL 1GOFA 4OCSH 5FF6B 4P57B 2XACC 3VWKA 1T5WB 4YHZL 3MYZA 3MFFB 5C6WH 4OCYH 4HCRL 2H2PC 5T5FH 1GOGA 4UILL 2J12B 3UTZA 1FSKC 4KI5F 5HYSG 5HYFA 4U6YB 2IAMC 4PJIE 3BJLA 4QXGH 1PSKH 2PXYC 3GB7B 3EYQD 4GT7A 1YEEL 3D85A 1QLRA 4EI5B 4J3VA 2DMKA 5JNYA 4WEBH 1A8JH 3DRQB 2Q87A 1FP5A 3LQZA 4OQ1A 1RZIA 2F19H 5JDSB 4JQXC 1AE6L 1TVDA 1P4BL 3WDJA 1X44A 3H6JA 3TVMB 1DLHA 2X4PB 3TN0C 2J8HA 1CXIA 4PJ8A 4LIQE 5AG9A 3JXAA 4S0TD 3LVEA 1X5GA 5C0BE 4Z6AT 3C8KA 4JPWL 4HGWB 4KMQA 2V2XA 4MAYD 2NZ9D 5F44A 5DD5H 3UC0L 5JZ7D 1LO0H 2OSLB 3C5ZA 2EKJA 3NTCL 3TH4T 1IM9D 1XIWD 4UIKL 4JVUA 4TUKL 5L88H 4QRTA 1QACA 1RZGB 5TQ2L 2UUDH 2UZYB 1S5IH 3D9AH 1WZ1H 3NCYP 2R2CA 1UM5H 5IWLA 3VD9A 1TIUA 3RZCA 4Y4FB 4L4VA 2EXYD 3L5XL 2R29L 3BQUA 4FQ2L 2NX5B 4KKBC 2HYMA 4FS0A 4KAQH 4HUUB 1U9KA 2VDOH 4PJ9C 1U2HA 4QO1A 1X5FA 5I18L 3VFVB 4WTZG 1I1AC 2CRZA 3FB5A 4L8SB 3WS6A 3BZ4A 4MWFB 5DMYA 4JFDD 4PRNB 1NCCL 4ELME 1MRDH 4X80H 4Z0XB 1GC1C 1MUJA 1MLBB 3HAEH 1NFIA 1BQHB 4PV9A 1G7IB 4PLJC 5CGYC 1MREH 1IC4L 2YOCA 1UZ8B 3WNLA 2FH8A 2CRIA 3TV3H 4L3EB 3QDMB 4ZS7H 3TA3C 1MWAL 3ZKSD 3BGAA 2JELL 4HZAA 1NCDL 4ONGL 3BUYB 1CFTB 5IV2A 3DRTB 5D7LA 2XN9E 3P4MB 4QTHA 1C1EL 2PTVA 1A7QH 4GKZB 4ZYKB 3O6KL 1OP3K 3KLAA 3TT3H 3FO0L 5D7SL 5FO8A 3FCTB 4TVPH 1A6WL 3DXAD 1Z0MA 3RL1B 3HS0B 3HZKA 1K9TA 1WWBX 3LV3A 2E3VA 5HYSA 1KJ2B 2RCSH 3ECBB 2YK1H 2R0LL 1CXHA 4HMCA 3H9SA 3PF2A 1H3PH 5DO2C 1OLZA 1VFUA 2W07A 1MFBH 3SDAC 3OV6A 2DLFL 2N7BA 5EH1A 1P7QA 4F7CB 2HFGH 3LQAL 3WHE0 4ONFL 3NN8B 5CLWA 2BERA 4LK4A 4JGUA 4OLVH 2R4SH 3CUPA 2C26A 2D9QB 4GH7B 4AY0A 3GHEH 3TF7C 2QADC 4ZUVB 1VADA 3E3QC 1BBJA 1XGQA 4OT1H 4K3EL 2D7NA 3MLZH 4WU5B 4D9QE 2FYYB 1DQQB 5C0EB 2DRUA 2NMSA 5C0IA 5JIIA 1W0VA 1A4JB 4X5XB 3BUTA 2EDKA 3O9WA 3TIEA 3KNBA 1FC2D 4JQVA 4PB9L 4QXUL 1OTUD 4IIQC 1XGYH 2VDML 2QQQA 3VXUA 5ID0B 3CDFA 4PP2A 4H20H 1ZWIB 1T1YA 3AAZA 3ZDYF 2DI9A 4MAUH 4MSWB 4ODUB 2YWYA 2ARJA 4A6YL 2JJWA 3QISA 4HKBB 1KPUB 1NGWA 2YD4A 1ACZA 4XWGL 1MHCB 4QOKA 5HJ3B 4ELKB 4LSTH 2DD8H 5CZKA 3K74B 3BPCA 4PLKC 2DL9A 4ODVH 2RBLA 1S3KH 2EO1A 5DWUH 1ZLWH 1MIMH 1OSPH 4LLMB 1Z5LA 2R2BA 1SMOA 5H94A 3RIFF 3DTXA 5LXGL 4JQIL 2DS4A 4NKMB 5D6DC 1SY6L 2ADFH 2HT2C 1RZJH 1FYTE 4OTXL 2XYCA 3B6SB 1NDMA 2F8OA 3AUVA 3QFJD 2AJXL 1I9JL 3UTTE 3MRJA 5IFJB 2JB5L 5GS0C 4K3HA 4HCRA 4OZFB 3VWJD 4RQQB 5DVNA 5GRJL 3FT2B 3RWEB 4J1UB 5A3ID 4X0KB 2X4OA 5GRXG 5FKPB 2ARJQ 4NC0B 4YXKL 5T5NG 2CJUL 4NGHL 1AI1L 2OTUA 5T1MB 3LY6A 3VXTB 4ZAKA 1VEPA 2R0WL 3P0GB 5KSBE 4OUUB 1GGUA 2NY2B 2FB4H 1TENA 4YK4C 4XAWH 2CDFA 4APQB 1KACB 4HIEB 4G7YH 4JFEE 3BKJH 3EYVA 2XA8L 4G8GA 3W39A 4J8RA 4EN3A 4HUXB 1A7PH 5DHYA 3WN5A 4FZEH 5HHXH 1MVFA 1YN7A 4LU5L 4XP6L 3HZMB 2IADA 3VRLF 4U4BA 1S78D 2X4SB 4M8VA 4P0DA 4EUPH 5HI3D 4XC3H 5GHWH 5ABDE 3VG0H 4DCQA 1T5XA 5E2WL 2XA3A 4G80A 1A6UH 1QSFB 1WK0A 4JAMB 1TZIA 5DYOA 3GIZH 2WQRA 2XXCB 3U36B 3NZ8B 2BSTB 4MX7B 2NR6C 3O8XA 1MLCA 5IB3A 3C87A 3FN0L 2VDRH 3MODL 1NGPH 5ICXA 4PFEA 1RJYB 4UDTB 2DKSA 4XC1H 4EVNB 1DDHA 4K71B 2QR0A 3VW3L 1CLYL 1JWSA 3MV9A 1NCWL 3AXLB 1GGCL 5JW4M 2B7DT 1A7BA 4UQ3A 5CZXD 4NQVB 3O45A 1CIDA 1CQYA 1XFPA 2CK0H 4ZXBA 2X05A 2W91A 3ZL4H 5E08H 3HCVB 2IPKB 3JVGC 2A6IB 1J1XL 4U1KA 5TFSH 5JPNB 1E4XL 5KS9F 2BP3A 3PL6A 5B22A 3ARWA 4RMTA 3Q6GH 4RIRA 5F1IA 1DTUA 3L3KB 1MHPH 3UTQA 1SJXA 4HXAH 4KZDH 2F54D 3QEGL 1FDLH 4OM1H 4ZQKA 5FA3B 3QUMB 4RAHA 2IPUG 5TPWL 4OF6A 3ZLQC 3HR5B 1S7SA 4J4PC 2AV7B 4ODBD 4MDIA 1MCDA 4OKVA 3QG7L 5JHLL 8FABA 2WIMA 2EH7H 4ZUSA 3GSNB 3CIQA 1JUFB 1Q9OB 4PJ5D 4Q6YA 1NCBL 3RTQD 2P47B 1ODAA 1WISA 3OJDB 4GQPH 4QRQB 2OZ4H 1NSNL 2XZAH 4X99B 4G6FD 2ZUVA 3B9KB 4LCIL 5IROA 4N1HB 4PJ7F 4PR5A 3BDBA 4P4KA 3IVKB 4FTVA 2JKXA 5DJDA 5FUCC 5DD3L 1V7MH 1NDGA 5EIIB 3DX9A 1E6JH 3V5KA 4U0RC 5K9QG 3CXDL 3T77B 2NY2C 4K2UL 3T3ME 1SEBB 2MCG1 4IRSB 1A6TB 3GRWH 1EFXA 3TP4A 5A2JH 4CJ0A 2GJ6A 4JN1L 4YNYA 3LKOB 4FQHA 5D72L 3ULUF 5FXCH 4GMTL 1Q94B 1NBZB 4WTXA 4ZNEA 1QBMH 4HIJA 5IMLA 5JW3H 2V2WA 2YD9A 4GBXA 3S4SB 5AZ2L 1RUPH 2A9NL 4NKIL 1SEQH 3BT2L 5AZEL 2PTUA 1BFOA 1A6AB 1WFTA 4XI5D 2XTJB 2H41A 2W1NA 1U92B 3LIZL 1BD2E 5JQ6H 2ATKB 3CXHJ 1CGSL 3HG1B 4LMQI 3THMH 4GKSA 1XF4B 2ATPA 3K46A 1YC8A 4QRPB 4A6YA 2BVOB 5EUOE 1P84J 5D1QD 2QQNH 4N0YH 2OL3A 2ERJC 3M17B 1PG7X 3QO0A 4OSUH 4JFQB 2XZZA 3J7HA 5IF0A 4I4WB 2A83B 4XMLH 5LGJA 2XPGA 3JV5A 2W0FA 4K7PL 3SKUD 1RU9L 1SY6A 2W9DL 2GTZB 3LEVL 5L2KB 3W9EA 4HKXB 3VFMB 2AJZB 2DQHL 3QFJE 4PG2A 1N8ZB 1KB5H 1RFDL 2DQGL 4ONHB 1CDIA 4Y5XC 5EU3A 1M71B 1KTDB 5DVLA 2WZPD 1DBJH 2MCPL 2BC4B 3V7AE 5EPMA 2FIKB 1DVFA 2VLJD 4MHHI 3CLFH 1JK8A 4XZUB 3MOBH 2I60L 2VC2L 5MENA 3NFPB 2VQUA 2AABH 2FIRT 1B0RA 4XP4H 32C2B 4KXZH 3DI3B 4FQXB 3S88L 1UH2A 1L7TL 3REWB 5I8CB 3ZTJG 3V8OA 5F96H 4QRSB 2YC1B 2CH8A 1FO0L 3OKEB 1R6VA 2YD5A 4GRLB 1IGMH 1T04B 1UB5B 4PRDB 2DQCL 4AYFA 3RAJL 3MLWH 4XNQA 1RZ7H 3WCYA 3G6DL 2B1AL 1ND0A 5IBTH 1P53A 3P9WB 4XCFL 3LKRA 2ICES 2IMMA 2B5IB 1HOCB 4LLUA 3C60B 3MJ9A 3UBXG 4OCSL 3PG2A 4JPKL 4LOUD 4LVHB 1G1CA 2ZUQB 3VJ6B 3ZTNH 5I17A 4F9LC 4JHAH 3O4LE 4OCYL 4E5XB 3RWHA 1AXSB 1S7QA 1ZS8A 4IMKA 2DQFA 1HXMB 4J3UA 3W81A 2XWTA 4KKNA 1JZ7A 4Y4HA 4KRPC 4QXGL 4RGNB 4G6AD 1LK3L 1R3HB 4I48B 4KK6D 4U1HB 1JGEB 2N56A 5AUMB 1RZFH 2HJKB 4ODSL 1EAPA 2VZTA 3D3VD 3DMMA 1H0DB 3CSBA 3QIUA 2Z31D 2WBJB 2IBZX 3M07A 2F19L 3B9VA 3V5HB 3EJYD 3WJLC 2LU3A 4LKCB 1ZT1A 5TDNA 3L6FB 3RIFK 1V5JA 1MJJB 1VKXB 5D2NE 4G8IA 2YSSA 5GGTA 3ARDC 4HMDA 1BM3H 4LSSL 1UH4A 1PZUB 2ZOLA 3TCLB 2CIIA 4KPHH 1I7TB 5KS9B 3TBSB 3KJ4C 4KTEL 3KPMB 4KUCD 5E56A 5FECA 3RUGF 1LO0L 3UPAA 4JFXB 1OWWA 5L88L 4F2MA 3DYOA 1WFNA 1M7IA 1S5IL 4WJ5A 3D9AL 4X6DA 2NY6D 9CGTA 1A1OA 5GZND 2FJGA 2LQRA 4KTDH 1NC2A 4JRYD 4M93C 5DGQA 5E6IC 3BP4B 3FQUB 3JWOC 5TF1H 1CGVA 2I5YH 4H5SB 5F6IC 5GSRA 4KAQL 3STBA 5I30L 3LEXB 1X7QA 4M5ZL 4LKXB 4RGMB 3VFNA 2HLAA 4EIZC 1E4WL 4YBQC 2QL1A 3EKCA 4OB5H 4U7KA 3RY4A 4ZSOE 1YEIH 4HX1B 3RVTC 4PJ7B 1MRDL 4X80L 4Z76B 2UY7A 1Q0XL 4TYUA 1S9KC 2NY5H 4YO0B 3FQNB 1RZ8A 1FFOA 1YEHH 4FQXC 4NO3A 3I85A 3WIFB 3TV3L 1HYSD 3IS0X 3KPSD 3DO3A 4U1SA 4JHBA 4WUKL 1M05A 2VH5H 5C0CB 3EDDA 3RX7A 4I3GA 5D2LF 1T1ZB 4O9HH 2DF3A 2FX8H 3EDEA 5ELIA 1P9MC 3CX5J 1A7QL 1A1MB 3CFJA 4PJEE 3L7FB 4R7NB 5K9OB 4JM2D 4P4RB 1T83C 1ED3B 4F33B 1XGUB 3TT3L 2P7TB 3UBXA 1W0YT 1R3LB 2FJHA 1HWGB 2BVTA 2ZG2A 4UQ2A 5FGBC 5AYQA 1UJ3B 1JE6A 3O3UN 4ESKA 3KLHD 3SDCA 4NBZB 3MO1B 2HFFA 1QSEB 1ORSA 3TESA 5I1CH 1CFQB 2YK1L 3DUUA 3FFCE 5E4IA 1H3PL 5F7HA 1KT2A 5EOTA 4CL7A 5JW4Q 1ZT7B 1R24A 1QO3B 2JIXB 4RRPA 2DICA 5FYJL 5TE7L 4MQXC 1MFBL 1S9YA 4H26A 2Y36L 5I8KH 4M1CC 2QSTA 3VA2C 4DGYH 2HFGL 4HUNB 1X4XA 4PD4K 5C1MB 4BK5A 1A3RH 3DX8B 3ZMRA 2H2PD 2NYYC 4OLVL 5J9PB 2R4SL 4N0FA 35C8H 3PDOB 1A9BA 5CEZE 2WBJC 2HG5B 3GHEL 3VXSB 1ZSDA 1YJDC 4FFYL 2IAMD 3R1GH 2H1PH 5I1IH 4OT1L 4WTWA 3MBEA 3KPTA 3VWKB 3EOTL 4LPUA 2WBWB 2WWKT 5GGRY 5KJRL 7FABH 3UTZB 2ORBH 4ZNCD 1EGJA 5I1JH 3PWPD 3QDHA 5BVPL 3JBG7 1CS6A 5CJOL 3W82A 4KDVA 5IG7B 2VITA 1LE5A 3FTGA 4MAUL 3TN0D 2WM0A 4DN3H 1CTOA 1QLRB 1RURL 4UT7H 5JNYB 3UDWC 4LSTL 2DD8L 3LQZB 3WKMH 1RZIB 1EMTH 4P9HC 1W0WA 1JHTA 4M00A 1GVIA 1S3KL 4BUGA 4C59B 4D9LL 4WI5A 1DLHB 3WDHA 1OSPL 3CU7A 4PJ8B 4JFFE 3QUZD 3X14A 2OR8A 1XH3A 1F3DH 2FWOA 4YH6A 1QFOA 3TO4A 2ADFL 4YHOH 1RZJL 1SBSL 2H6PB 4XXCA 5FO9A 4RGMC 5B8CA 4KQ3H 3C8KB 4JFFB 3ME0A 1OW0C 4OZIE 4FZ8L 2O5XH 5HXMA 2XWJA 4KKBD 1OT2A 3QIWD 2OCFD 3F7PC 3C5ZB 3O6FA 4P46C 4OZIB 3MV8E 1A22B 4QRTB 4AIXA 4PJ9D 3EYSL 2IQAA 3WLWC 1I1AD 2Z8WC 2ZUSA 4UV4H 4OBRA 1J1OL 3RZCB 2P5EE 4L4VB 4JKWA 1QRNA 3BQUB 3P73A 4XAWL 3IJHB 2GAZA 1UB6A 2DI8A 2PW2A 4JY6A 4K94H 4XPBH 3RDTD 2ED7A 4FQPA 3GGWA 2C3XA 3G5XA 1A7PL 2OQJA 4FZEL 4PLJD 5CGYD 1ZHBA 5CUSH 2VL5A 4C4KO 3FB5B 3BZ4B 3TA3D 1S7TA 4M6OH 3ESUF 2AV1A 3KYKH 3FRUA 5FYKD 3MXVH 1IT9H 3R8BB 5DS8A 1MUJB 4PS4H 5HDQH 5ISZA 1NFIB 4PV9B 3NFSL 4XC3L 3LD8B 4M43L 3EIFA 1VDGA 2PO6B 4ZO8A 4R7DA 3VMOA 3AC0A 4LHUD 4M6MH 2LAGB 4PUBL 5IV2B 1PYWA 4OD3H 5D7LB 2X2YA 1AGDA 2GIYA 4Q9CA 4QTHB 4X4ZA 1N64L 3BIKA 1G6RL 2VSCA 4CN4A 1QQDA 1OLLA 4R2GB 5BOPA 2CD0A 1FLRH 4NQUA 5DO2D 1NFDE 5EWIH 5FO8B 1PGRB 5EU5A 2M26A 4LLDA 1KEGH 4K23H 3NBNA 5B3NA 5D4QA 3OAZK 1YUHA 4YUEH 5GGVH 3SDAD 4K3DL 3HZKB 4GG6E 3VRJA 4YGVB 5E5RB 5HYSB 5E8NA 2CK0L 3ES6A 5E08L 3ZL4L 4AG4H 1FE8H 2QADD 5F9AC 1O5DT 5TFSL 2R56H 3E2HC 4NNPH 2V5RA 4XPGL 1P7QB 5I19H 3QQ9C 2CUIA 1MHPL 4JDZA 1UVQA 4HXAL 4P3WA 4KZDL 1FDLL 4I18A 3VFUA 4TUJA 2VZVA 1HIML 1GH7A 4ZFOL 4GS7C 4LEOA 1HZHH 3ZKMD 1VADB 1XGQB 3V79C 3P0VH 3P0YL 4YPGA 4LNVA 5A2KH 1IVLA 5BRZA 2V2TA 4LCYA 2GSGB 5C0IB 3BZDA 1W0VB 3TC9A 5DI8A 3O2VH 3T0XA 3DLQR 3O9WB 3TIEB 1G9NH 3ZT6A 1W2KT 4G8EB 4PLKD 3WFHA 7CGTA 3SEPA 1T1YB 3AAZB 4Y4FD 3BWAA 4LVNC 2NX5D 4M1GL 2ARJB 5ICYB 2APXA 2OYPA 1NGWB 5C9KA 1FV1A 3UZQA 3CDYA 2HT2D 4QOKB 1UCTA 1PKOA 1V7ML 1ZANH 5JHDA 3BPCB 3UX9B 5ID1A 3VXRA 3TNNB 4MJIA 4NRZA 4PJBE 1OL0A 5GS0D 4KVCH 1Z5LB 1XGTA 1D3CA 2R2BB 1CF8H 3NA4A 5H94B 1S5HB 4PJBB 2Y9RT 1MCHA 1NDMB 2D0GA 1OAZH 3EOBA 4PYGA 1UXWA 3MRJB 3VMNA 1J8KA 2ADGB 3HUJE 4R9HA 1ZTXL 3KXFE 2VTFA 5L9DH 3STZA 3TNMA 3H7LA 2X4OB 5C0DA 3QIBC 3DNKA 5JQ6L 3BPLC 4RFNC 4ZAKB 4QGYA 4O4YL 2VXTH 2QQNL 2CDFB 3EYVB 3D18A 4G8GB 3W39B 1MF2L 4J8RB 4OSUL 5FCUL 4EN3B 5DHYB 3EO9L 3WN5B 2AW2A 5JXAH 1HEZA 4JO3H 5D1XC 2R2HA 4XMLL 4OLZH 4J23A 1H3TA 1FG2A 1YN7B 3VXOA 5ERWA 3U82B 4GW5A 2IADB 2HKFH 2WP3T 3OR6A 4HH8A 3O4OB 3T04D 1T7WA 2GITA 2NR6D 4YFEA 4KHXH 4DCQB 4E41D 3PHQA 1KIQA 1YDPA 4JB9L 1OP5H 4LGRB 4G80B 2LU4A 5DC9B 1TZIB 5DYOB 3W0WD 3CLFL 5C08D 3ARRA 5CCKH 5FHBH 4B53A 1MJ8H 3N1PC 5IB3B 1MLCB 2E6JA 3TGXA 1P4IL 4P2QE 4I0PC 5F96L 1WBYA 1DDHB 3WSQH 5JW4N 3N50A 2QR0B 1T3FA 5D5ME 3TYGH 1JWSB 1DUZB 1UWGL 3MV9B 1YNTA 2JCCA 3MLWL 5JR1H 1RZ7L 3AREA 4U1GC 4YXHH 3O45B 1WZLA 3BP7B 1ITBB 4ZXBB 5FFLA 1I1YA 3MLYL 3P3YA 4QWWD 5C92A 4J4PD 4TUOA 3ZTNL 4YXLH 4L3CA 25C8H 4EUPA 2YHGA 4JHAL 4CW1A 3LQMA 4RIRB 2FGWH 5F1IB 3UTQB 4AEEA 3QNXA 2XQYK 4AM0A 3RX8A 3GBNH 1NBYA 4Y2DC 4F7MA 2NY0C 5ALCL 4X6DF 2C3HA 2QHRH 4MDIB 3RU8H 5I1HL 3Q1SH 1JF1A 4OKVB 1OT1A 2VDNH 1QLFB 3RBGA 8FABB 3P40A 4ZUSB 4HIHB 3SE3C 4Z0BH 3SE9L 3G5VA 4KI5D 1CLCA 4HJ0C 3GHBH 5FUOH 3MXWH 1CXLA 3NA9H 5KTEH 1NKRA 2W9LA 3BW9A 1AGCA 4N5UA 4TQEH 4V1DA 4XGZA 5JOPD 2NY2D 2Y25A 1K8IA 4OIAA 4PR5B 2GJJA 4P4KB 2MQCA 1E28A 4AZ8A 4FTVB 2VDPH 4APQD 2EDJA 3GUTA 1YEFH 1GGTA 3E3QE 1TETL 1QHPA 1IEAA 5K9KA 4NUGH 4KPHL 1NDGB 4MA1B 2H8PA 3DX9B 4YDLB 3GM0A 3WO4B 3L3IB 3WFZA 1AR1C 3V5KB 3VFPA 5GXBB 2R23B 4HKJA 2BX5A 3QCTH 1JL8A 4NKQB 1EFXB 4OQTH 3ZYZA 4MNGE 2GJ6B 4YNYB 3SPVB 4FQHB 5GGRA 2F74A 3OKDA 3WN5C 3V4UL 3HE6C 4RGOH 4KTDL 5FYLE 1QR1A 4JZJC 4IDJL 5D70H 4HIJB 5IMLB 3RWFA 1RI8A 2V2WB 4GBXB 1HSBA 2AJYH 1MCLA 2I5YL 2I25N 5MEPA 2WINA 5FV1L 1X5XA 4X6EA 1RUQL 3O4OC 3F6IA 3DSFH 2FEEI 5H2BA 3IDNA 4NCC2 5SWSD 4OB5L 2OZ4A 4OCRH 4GKSB 1YEIL 4WI9A 5GPRA 5LAXA 2M2DA 4FXKA 4LDOB 1FYHB 2X9XA 4HWZA 2OL3B 1HKFA 5JIHA 2NY5L 3GNMH 2O61A 3QO0B 3O8XC 1YEHL 3DGCR 3GI8L 5F7UA 4WV1C 5IF0B 5DFWH 2IG2L 3WD5L 3IU3A 3UYRH 2VH5L 5J11B 5LGJB 2XPGB 4DZ8B 1U2CA 1ZVHA 1YPZE 5HGDA 2FX8L 2ZWLT 2W0FB 3QRFM 5L0QB 3GRWA 3W9EB 15C8H 1XR9A 1HE7A 2XZQL 3SN6N 4F8TA 3MRBA 4WU7A 1YPZB 2CMRH 4QXTA 1J18A 1EO8L 5HYQA 1EERB 2EXWC 2GY5A 5HYJA 2ZUUA 5EPMB 3UO1H 5E4EC 1DVFB 3WMSA 5J6GA 3F58H 2X4NA 2IMNA 1JK8B 2VDLH 3PL6C 2X89A 5MENB 4JO1H 1RIVH 1B0RB 5I1CL 1KXVC 1D5IL 3ULVH 3NPZB 3HNTH 4M6NH 4Y4KC 4BJLA 4JFOA 3EYOA 4DGYL 2GT9A 4C54A 3SE8H 4S1RH 1Q1JL 4LNRA 3B9KD 4NSKB 1A3RL 4XNQB 3W11C 5L8KB 1NGXB 1FAIL 1UFUA 1ND0B 3KLSA 5MEOA 3QPXH 1YYMH 3C6LA 3LKRB 4G5ZH 4KRPD 2H1PL 5I1IL 4LLUB 2RIKA 1UM6L 4O58H 3K3QA 4KUZH 2BVEA 1H8NA 5GSVA 5I17B 4OCLC 4ZOEA 3DUSA 1KB5A 2PYFA 2YRPA 3RWHB 1ZS8B 1S7QB 2W92A 5IROC 3S37X 4E41E 4HMEA 2M8XA 3HC3H 3UZVB 2EDFA 2ORBL 4JO4H 2XWTB 5DRXA 4PGBB 3W0WE 5I1JL 1W72H 2ID5A 4Y4HB 1RUKH 5HVHC 3MSPA 2WNGA 2DAVA 2HT4C 4DEPB 3NAAL 4LGPB 1MCOH 3MNVA 3LQAC 4MNQA 2ICEB 4MXWL 5EA0H 5DUBB 4UT7L 1IKNA 2CK2A 3ARDD 1EAPB 3ARFA 3DMMB 2X41A 4IM8A 3QIUB 4NO0A 4HLZG 4FQQA 1DQTA 3OB0H 3PABA 1EMTL 5D7IA 4Y19A 2VKXA 4NZUH 1ZT1B 3HG1D 2HKHH 1ZGLM 5TDNB 4ODTL 3VG9C 4PRIE 4G8IB 2YSSB 2F8XC 4HAGA 3V6ZA 4BFIA 2VZ3A 2ZOLB 4Y5YA 3HMXL 4Y5VC 5EDXA 4YFDB 4J7RA 1VERA 4IMLA 5CBAA 1U3JA 4HLJA 5KW9H 2CIIB 4BKLB 1A4KA 2O5XL 3MUY1 3TO2A 4MNHA 5AWNL 5E6ID 1MELA 2Y07H 2W0KA 3MRIA 5DMGC 2K9UA 5L2KD 1OF2A 1QVOA 4F2MB 5EC1A 2N7AA 3LPGA 1F97A 5DMIL 4EIGB 4LLQA 1M7IB 4X6DB 4YBQD 1OAYH 3NIGE 1A1OB 4UV4L 5E8OA 3WLBA 4LIQH 4P3DA 1NC2B 1V3MA 3RVTD 5FUCE 3X12A 5GSRB 4GJTB 4K94L 4XPBL 1MH5A 4YFLI 1X7QB 3VFNB 4PG2C 2HLAB 4HT1H 3QDJD 4FQXD 4PJFA 5CUSL 1Y18A 3MRRA 3IYLW 3HHRB 4RMSA 4NOBA 4ZO7A 4ZDHA 3MXVL 1KTRL 2NXZC 1IILE 4GRLD 2CDEA 4PS4L 3ARBC 1P5VA 1OM3H 4X9FA 4ZUUB 1DANT 5D1ZA 1RZ8B 2JJSC 4NO3B 2PUQT 5C0JA 2VN4A 1M05B 5HGAA 4OLXH 2YBRA 3C60D 4M6ML 2CKBH 4OD3L 1BVLA 5I1EH 3JTTA 3S35X 3HFMH 1WF5A 3CFJB 5E1AA 4UNVA 2MWCA 1PG7H 3I84A 5GRZA 1JZ5A 3UBXB 5BS0A 3CC5A 4UQ2B 1KEGL 3GFUA 2V9QA 1KJ3L 5GGVL 3MRHA 3SDCB 2HFFB 1X6LA 5SWSE 5C0AD 1ORSB 2EIEA 3FQRA 2NYYD 4YLQT 1D7FA 4AG4L 1KT2B 2WBJD 5EOTB 1FE8L 2GI7A 4RBPK 2R56L 1R24B 4Y4HC 1KLUA 5CSGA 3MBXL 4NNPL 4OD1H 1S9YB 5D6CA 4H26B 4DEPC 3ILQC 1WWCA 4WW1A 4NQCE 4YDIH 2HA1A 5DHVH 1PKQE 1T22A 4YBHA 4N0FB 1EV2E 1MCNA 3E6FA 1A9BB 5E9DE 1A14L 1KJ2H 1ZSDB 4YC2C 1KNOA 4LSQH 3MBEB 1NLBL 2FLRT 4XP9H 2VMFA 3ZE1E 4I3RL 4XBPA 2V7HA 4HPYL 3OTTA 1LILA 1U8OA 1G9NL 4Q9RH 3U4EB 5T1KD 1BQLH 5DXWA 1BFTA 1IGJA 1IAII 1R5VA 2ICWA 2P5WA 3K1DA 3KS0H 3UTSE 2VITB 1LE5B 3FTGB 5DEGA 4MDJA 3LN5A 3BMVA 4BSWB 1EVTC 4YX2L 2X9YA 3EOYG 4H1LG 1W0WB 1JHTB 3VGEA 2BNRE 2MQ3A 5J1TC 3P11H 4KJQC 1YEKH 4OAWB 5FM5M 2FLBT 1CF8L 3X14B 1XH3B 4P46D 3BZFA 1PG7W 2FWOB 4UT9H 3TO4B 1CDJA 2LE9A 5FO9B 5B8CB 5JIPA 4CNIA 3LMJH 4K7FA 1OAZL 3DV6A 3WLWD 4OF7A 5CGTA 4WI7A 1DN0A 1T1WA 2XWJB 5ESQA 3O6FB 3N85L 5DTFB 3ULUD 3BSZH 2IQAB 5DZOA 4FNLL 4MB3A 5D93B 1C08A 4N0UE 2VXTL 4UAOB 5DJAA 3P73B 4KK5C 3IFOA 3QHFH 2FECI 2GAZB 1UB6B 2PW2B 2JCCF 4JY6B 2YD3A 3GGWB 4Y1AA 3IDUA 4HWEL 3L3HA 2QEJA 3G5XB 4OZFH 3LCYA 4WGWB 2OQJB 5F7KC 1ZHBB 4JO3L 1OCWL 2VL5B 5HHOD 1S7TB 5FDWA 3QUXA 4RISH 3PP3H 3EO1A 3U4AA 3FRUB 2FJFA 5DS8B 4LARH 1G84A 4KZEH 4KDTC 4A2LA 1CK0H 5ISZB 5IFAH 4D9RE 4CMMA 4JRXA 1JIBA 3QA3A 1QLEH 4R7DB 3VXSD 3F7QA 3MR9A 1DL7H 4LPVA 4UTAL 5CCKL 1AGDB 4NQEA 3MCKA 1BJ1J 3BIKB 5EOCJ 4HS3A 4IRJA 4JZNA 1BIIA 4KKCC 3WNOA 4PY7A 1UT9A 3EDJA 1NMBH 3QQ4A 4OZ4A 3CK0H 1IAKA 3WSQL 5F70A 5EU5B 4LLDB 3WUZA 3NABH 1YUHB 1KN4H 3BP6A 1CD1A 5JR1L 1NC4B 3QQ9D 3VRJB 3TPKA 5FAAA 3D85D 5E8NB 4YDVA 1FVEA 2F5AH 2B4CL 1FZJA 2CO7B 1FVDA 1ZGLA 1NUFA 3WXWH 3BH8A 1K4CA 4JDZB 1UVQB 5GRVL 3I02A 5DQDL 4I18B 1UKQA 3VFUB 4H1LA 4TUJB 4TOYH 2UVFA 4LEOB 4LVOB 3VA6A 2OK0L 3GI9H 5H37G 1PJ9A 5I71B 1SM3H 5L2JA 4M3JA 4YPGB 4AEIL 1U3HA 4R0LA 5BRZB 2V2TB 1F6AA 3K1KC 2BSSA 2VDNL 4LCYB 1UZ6E 5EIQA 2EIZA 5DI8B 4PYHA 4XP1H 4Z0BL 1AHWA 3GIVA 4U6XA 4MB4A 4MHHG 4Q6IA 1QP1A 3GSOA 3GHBL 3MXWL 1WV7T 3NA9L 3WFHB 4AL8H 3QUMH 5C0AE 1FZMA 4G3YH 1F58H 4PBXA 4TNVK 1HDMA 2CPCA 4IBLT 3RZCD 1UWEH 4L4VD 3BWAB 5I0ZA 4HJJL 1HILA 2AK4A 3RKDD 1T1XA 4JFYA 1CICC 1EAJA 2VDPL 3B2UC 1LD9A 5LQBH 1FV1B 4P2RE 1YEFL 3VGAC 1A6PA 4JRWA 2V17L 4OF5A 1JTPA 3GSNH 4LBEA 3NCJH 5JHDB 3D48R 5ID1B 3CMOL 4KDWA 4MJIB 4NM4L 5JOEA 4P5TA 3CNKA 1MCKA 3GMMA 3QEHA 5AD0A 3B9DA 1T2QH 1XGTB 4CBPA 3C9NA 2UUDK 1J8HA 3FQXB 5FIEA 2CLZB 3D39A 4NYLA 2IH1B 4RMWA 3JV0A 3QFDA 3TEUA 4RGOL 3BKCH 3EOBB 5IJVA 2W65A 4LSVH 1UXWB 2HJLA 3LKNA 2EDTA 1B4JL 2YRLA 4K9EH 4P3CH 2JJTC 1HHHA 3OB8A 3HB3C 3PGFH 5D7LD 3STZB 1AKJA 3TNMB 5DD0L 1TJGH 1KCSH 3TM6A 4WO4A 4JFHE 1J7VR 3TZVC 1ACYH 4OCRL 1R5WA 1U8KA 1AC0A 4C56A 2D7OA 2UZIL 3MRMA 5EOCL 3B3IA 3AY4C 1DANU 3ALWA 3IETA 1MI5D 1CGWA 2VLKE 5HDLA 3CFCL 3BEWA 3D18B 3GNML 4ZS6D 2N4IA 4U3XA 1TZHA 1AO7E 2V9RA 1BWMA 1QPPA 3H9SD 1HEZB 3I3BA 2VLKB 2R2HB 1Z3GH 3KPNB 1LNUA 1FG2B 4X6FA 3VXOB 5ERWB 5HPOA 4Y16A 4GW5B 2B1HH 3NIDE 4KROC 3OR6B 2SEBA 1P7QD 2GITB 2KUTA 1MY7A 4NZRL 3PHQB 1KIQB 1YDPB 2APFA 4I0PD 4B7LA 2VUOA 2IANA 4DKAA 4JO1L 2CGRH 1IFHH 1IE5A 1JWUA 5C0RH 5DLML 2K7PA 4I18C 4MLIA 3ULVL 3O9WD 2EDNA 5I8OH 3BMWA 2VLRE 1WBYB 3HNTL 4M6NL 4X6CA 2PW1A 3S8WA 1CN4A 3RP1A 5B38A 5D7IF 1T3FB 1A6VL 3VXUD 2VN7A 1YNTB 4Q0XH 2JCCB 2ZPKH 3SE8L 3NPSB 4XX1G 3AREB 5HHOE 3ZDZE 4NQDA 4PJDE 4OLYH 3IS1X 8CGTA 2YWZA 1WQVT 3MROA 5D7KD 4WFFE 4QOKD 2VO5A 1W8NA 3VI3F 4G5ZL 3AMKA 1FZOA 1YMME 5DFTA 1MAJA 3DYMA 3MACL 4KUZL 3EUUA 4TUOB 4Z9KB 2J3SA 4L3CB 2BOCB 4EUPB 1U93A 2ZSWA 4CW1B 5FYKL 1NCUA 4B5EA 4EEEA 3QNXB 1I8IA 3PNWA 4AM0B 4JO4L 5DC4B 1TVBB 1WEJH 3PWJA 4YZFE 4F7MB 1NBYB 1W72L 4XAKE 1RUKL 3DHMA 4HJ0D 4G9FD 2NW2A 2F53A 2J88H 3DVIA 3L3JB 5FGCB 1JF1B 4POZC 5EA0L 1Q9LA 3QP3A 5I2IA 3HE7B 2VDKH 3SY0A 3R4DA 2DQTH 3P4NA 4FQIH 4U1IA 3BW9B 3BPOB 4V1DB 1AR1D 4XGZB 2VKWA 1BX2A 3UJJH 4AEHH 1K8IB 1MRFH 1A3LL 2AP2A 1U3YA 5DHXB 3GUTB 1NAKL 5BV7B 1IEAB 4G8GD 2WUBH 5K9KB 4PJCE 1FLTX 5EZJA 4AT6A 3HE6D 2BK8A 1IC7H 6FABL 3VFPB 4PJCB 3KS0J 2IBZY 4HKJB 2Y07L 5LCVH 1U6AH 1O7SA 1IGIL 4DTGL 2AVGA 2NW3A 5EZLA 5GGRB 2OXGA 2F74B 3OKDB 3H9ZA 5EU4A 1WLHA 2WIIA 4IHOB 4LIQL 5DUPH 1QR1B 1EEZB 4QXWA 4JKMA 3RWFB 2ITCA 1HSBB 1OAQH 4N0CC 5EORL 2WINB 5MEPB 4X6EB 1RZJC 5HVFB 3QXDB 2JJVA 4NJAH 3O8XD 2LTQC 3A67L 4PTUA 3MRNA 5H2BB 2YN3A 2MFNA 3IDNB 2NXYC 2NY1B 4JG0H 3TPUA 4N90E 3RNQA 3QHZH 5LAXB 3LAFA 5HYEA 4WFGE 4FXKB 4WCYH 4DGIL 4CU8A 4HWZB 2J7LA 3MA7A 4DOHE 1J5OH 2O61B 4OIIH 4M4PA 4N68A 3RQ3A 1NGZB 1Z2KA 1CLOH 4PJGE 3IU3B 2EXWD 1INEH 4S2SA 3S3JA 5JLZA 4OLXL 1A3QA 2VXUL 2R69H 5F7MC 2J8OA 4YE4H 5HGDB 1MCIA 3ZE0F 5I1EL 5EZOH 2ZKHL 3PL6D 4HG4K 4OQTA 2CSPA 1MJ7H 3K80A 4L4TA 5TE4H 4WU7B 4QXTB 5IKCA 3NIFE 4KGLA 1XEDA 4LPYA 3RUGE 5JXEC 4F7PA 5HYJB 1J0KA 1DBML 4M03A 1BVKA 3O2DH 5J6GB 2X4NB 3RA7H 4QRRA 4GMSH 3W11D 4JY4A 3U7WL 2MKLC 4JGJA 1RK0A 5D8JH 2X70A 1I9RL 1MI5E 4OD1L 3STLA 3KPRA 1NAMB 1NGQL 4JFOB 1IAIH 3EYOB 2GY7B 2GT9B 2XKUA 4PJXA 3U1SL 4LNRB 5ANME 2IQ9H 4J3WA 4NWUH 3I75A 3IRZA 3SGKC 5IJKC 5CSBA 2R8SH 4H8WH 4U7MA 5J57B 1KJ2L 3MOAH 3C6LB 2GTWA 4LAQH 3QI9A 4OV6F 2R9HC 1CBVL 5GSVB 4XP9L 5M94B 4CDGC 4KY1H 1IARB 1NPUA 3DUSB 1KB5B 2PYFB 4TSBL 5BW7C 3UJIH 5F7YC 3DARA 3FZUC 4L8CA 5K9JL 1V3JA 1X9QA 4Q9RL 5D2LE 1EX0A 3HPJA 5DRXB 3WXVH 3VFGL 2P8PA 3U7YH 1WC7A 2GJ6D 3BP5A 5DJXA 1MCPL 4MXVF 3MNVB 2N1KA 3Q5TA 4GBXD 4MA8H 4EXPX 4MNQB 1U91B 2YKLH 5C2UB 1FL5A 2W0LA 3KR3H 5CEZH 1WFUA 1IC5H 5CEXA 3ARFB 4OZGE 1U58A 4FQQB 3VXUE 3FB6A 1MFEL 5D7JA 3PABB 1KBGL 1TZGL 5D7IB 4Y19B 5IB5A 4UBDC 5HHMB 1MQKH 5DJ0A 1GIGH 3P11L 1A2YA 1F2XK 2C3GA 1ZLUH 2PYED 2GJZA 1YEKL 4XRCB 3QRGH 1QG3A 3K7UA 1UWXH 1C5DA 2J5LC 4UT9L 3OMZA 3V6ZB 4BFIB 3ZE2E 2Q8AH 4Y5YB 5CBAB 4I2XA 1A7OL 1VEOA 3CCHA 4MCZA 3LMJL 4LCWE 5GRUH 1A4KB 3TO2B 4MNHB 3VD4A 5JTWA 4PJAE 2A1WH 4Z7NF 2DBLH 1QVOB 4G9FE 5EC1B 1W72A 3L3OA 4WNQA 5IMOA 3BSZL 1JYVA 2AJVH 4PGJA 2FATH 4LLQB 3SDYH 2Z4QA 4OCWH 1T6WA 3LPFA 2WQ8A 5E8OB 3WLBB 1HQRA 3WKNA 4P3DB 4O5LH 1AGFA 1DR9A 1GSMA 3X12B 1AIFA 3QHFL 5E0QA 3V8CA 4JO2L 1MH5B 3ARBD 4M9PA 4JFZH 5T3XH 1DBKH 3GBLA 5CJQH 4PJFB 4CVZA 2BNQE 5JUEH 1Y18B 3MRRB 4OJFL 4RISL 2BHZA 4WFED 5D96C 4ZDHB 1AY1L 4LARL 1EZVY 5I16B 2CDEB 4PJIA 1CK0L 4O51A 4YHKH 3NGBB 5D1ZB 4IRZL 1I8MA 5DA4A 5C0JB 3O11B 5HGAB 2ZCKL 1DL7L 2YBRB 2H32H 2Q1EA 1YNKL 1FNSL 4L9DA 3EYQC 2EDQA 1BVLB 1HXYB 1OWRM 3JTTB 1VFMA 5EZIL 5E2JA 3I6LD 5E1AB 4U1LA 2BVYA 4KI1A 4F9PA 5BS0B 3CC5B 3CK0L 3ZSSA 4O02H 4Y4HD 4HJGA 4F37F 3NABL 1AJ7H 5C0BA 1KN4L 3MRHB 3ILQD 4X9GA 3OZ9L 3E8UL 2BMKA 5CJXC 3LS5H 2VQTA 1BEYH 4R4BA 4PTTA 3FQRB 4AQOA 2ZOKA 1TQBB 3A6BH 1RZGA 1MJUH 1NBVL 2VR9A 5C3LD 2R39A 4WUUB 4YHIA 2R0KH 3SGDI 2F5AL 1KLUB 3MLUL 4U1JA 4LRIA 3U30C 5D6CB 2CLVA 4F7TA 2QHLA 2EDBA 4WW1B 3WXWL 1JGLH 1NCTA 4XNXH 2DBJA 4HWBH 3AM8A 3F62A 1TITA 3B9AA 1XIWC 1IKNC 3LKQA 4HUUA 1JWMA 1QEWA 4TOYL 3ARFC 3E6FB 1GRWA 4PREB 3OAYH 3VD5A 4L8SA 1SM3L 1KNOB 2CKBA 3MUJA 5ADPH 3PWVB 3SKJH 4PRNA 5IFHH 3FB8A 1GGBH 3ZT5A 4ZTPL 2V7HB 4R26L 3ARUA 1U8OB 3ARZA 1TMCB 4ELMA 3L7EA 3BOVA 2FX7L 1IGJB 1R5VB 2P5WB 1C5CH 3OF6D 3VXMB 3V4PL 3RY6A 3QDMA 3QUML 2AJUH 2D7TH 4U1NB 4G3YL 4KJQD 1UWEL 1D9KB 1I8LA 1NC2D 2MQ0A 5F9OH 1CFTA 2OR9H 4XP5H 4NZTH 5DEGB 3DRTA 4MDJB 2W38A 12E8L 3P4MA 3BN3B 4RFOH 4MCYA 2E7LC 3C8DA 3E6HA 3GSNL 3NCJL 4S1DC 2XN9A 2DJSA 3MLPA 4LFHD 5BO1H 3PDDA 3MRCA 5DHVA 5E8DH 4R6UA 5EFIA 1T2QL 1CE1H 4M62H 2ESVE 3BZFB 4RA3A 1MIEH 5IB4A 1E4JA 2J2ZA 1SQ2N 4RX4A 2AEPH 4CNIB 3QXTA 4K7FB 1PBYA 3BKCL 3DV6B 1PD6A 4LSVL 3D2UB 4L9LB 1DN0B 4P3CL 5ESQB 5C8JA 4F7CA 3O3EA 3IDGA 3PGFL 3H3PH 1XR8A 1L0XA 4JM4H 1TJGL 2EDHA 4XPAL 5DZNA 5D1ZC 3CFDA 3RGVA 1MFAH 5L6YH 4BH8A 4U49A 4Z7OE 4ODWA 1C08B 3DYPA 4AMKH 4UMGA 4WU5A 4X6CF 3OAUL 5DJAB 1DQQA 1VB9A 1KC5L 3IFOB 1J86A 4N8CL 3SDCD 4PRPD 2X9WA 4P23A 4GAJH 3X11A 5IIEA 3S5LG 4AIZA 2FGZA 1Q9KA 2PYEE 4ORZC 2HRPH 1X4YA 3QUYB 4KK9C 2Q8BL 4D0DA 5FDWB 1Z3GL 3QUXB 4TRPH 3V52H 4XXDA 3EO1B 3OKLB 4KJWC 3VDAA 1I3GH 4RDQG 3IAGC 5I1GH 2FJFB 1S8DA 4ODUA 5IM7A 2XICA 1SMAA 1B3JA 4GRWE 4HXBL 4CMMB 1JZ3A 4KKCD 4JRXB 1YEDB 2HVJA 3QA3B 1YQVL 4JDTH 3MR9B 3VGFA 3GBML 4C57C 3MBED 2CGRL 4NQEB 4H25A 3MCKB 1TLKA 2NY5C 1E0OB 1MCFA 2XIDA 4HS3B 4IRJB 1QBBA 1EHXA 4JZNB 1BAFL 1BIIB 4PY7B 2ZCLH 5I8OL 2Z92A 3T2PA 3QQ4B 1IAKB 4JVPA 4KV5E 5J1SC 1FYTA 4Q0XL 1WT5C 5CZVL 3BP6B 1CD1B 3MLSL 4XNZC 3PV7A 3UTTA 4LAJH 3RWEA 1WSST 1LEKA 4WFEE 2OX5A 1TTFA 1V7NH 5JA9A 2IFFL 4NN6B 4MZ2A 4YDVB 5DQ9A 1FVEB 4UB0H 2QBWA 3GJEA 4IOFD 4QYOA 5C07E 1FZJB 1FVDB 1ZGLB 1IGCH 2H2SD 3BH8B 1K4CB 3VWJC 3I02B 5A3IC 1NEZA 5KSBA 1RIUL 4H1LB 1WEJL 1KUMA 3HI5L 2BJMH 3TO4D 1GXEA 4MGXA 4H0IA 1CG9A 4GQ9H 4JFEA 3QAZB 5L2JB 2OJEB 2HJFB 1K8DA 1U3HB 4R0LB 1F6AB 4Q9QH 3IDXH 3ZKXB 2D4DA 3OJMB 3B2UD 1D5XB 2VDKL 1JPFA 2P8LA 3GIVB 4U6XB 5H8DA 5I8EA 4TULH 5IT2H 4Q6IB 2HWZH 3OSKA 3LKPB 4MAYA 3T4YA 1MCCA 5HGBA 2B20A 1QRND 5DDHA 4AEHL 1HILB 2AK4B 5KZCB 4XMPH 5LGHH 4JFYB 3I2CH 1LD9B 1IM9A 4KVNH 4S1QH 1WCBA 5HI3C 3FO9A 1SVCP 4FQCH 2WUBL 1HSAA 2C3VA 5GIRA 1IC7L 3MMEA 3QUKA 3LSOA 2NQCA 4P5TB 1GHFH 3GMMB 4NP4L 2Z0BA 3S5LA 5LCVL 1U6AL 2JB6B 2A77L 3BEVA 3WIIH 1J8HB 2D03L 3D39B 4NYLB 4BZ1L 1RAMA 3EOAA 3QFDB 3BISA 2W65B 1FPTL 2X1QA 3TZVD 3HPLA 1J0IA 3T2NH 5HHPA 1CU4H 5DVKA 2HJLB 3LKNB 1T66C 1OAQL 4WFHD 1KOAA 2VXQH 1HHHB 1A47A 5CJ5A 2HVKA 4X7TA 1UM4H 4HS6B 4NJAL 2EE2A 4WO4B 4D3CL 2AJ3A 1IAIM 5IB1A 3IF1A 1RJCA 1U8KB 1H3WM 3AS0A 3QHZL 4BQBA 1BWWA 3RBSA 3MRMB 4F15C 1CD0A 3B3IB 1GZQA 3QDAA 3IETB 4WCYL 5AAWA 5I73C 2YEZA 1K5NA 3BEWB 4GSDH 4PJXF 3T0EC 3IXAA 1BF2A 4LMQE 4IRJC 5FYLH 1I4FA 2EE3A 1Z9MA 5E1HB 4D8PA 1H5BC 2R69L 4NPYA 2YUVA 4X6FB 5CILL 4YE4L 4Y16B 4OLWL 4X99A 4JVWA 2FR4A 4K94C 4KGJA 1YN6A 2SEBB 5INDA 5A16A 5FOBA 1BLNA 1BBDL 1F4WH 2OL3H 4ZFGL 5GS3A 4F37K 5EIIA 4C58B 2XZCH 4HF5H 2CRYA 4BK4A 5DUML 3FHQA 2JJUA 3U2SA 2R1YA 1AD0A 1LO4H 1JWUB 1R3JA 5GS0H 3ZYOA 3H7BA 3ULVF 3VFSA 3ULUL 4X6CB 4YEFA 2PW1B 5B38B 3QAZC 4PRPE 4TVPD 4GW4A 4DN4L 1I1FA 2NTFA 3AS2A 4R0LC 5TE6L 2IQ9L 2EYSB 3A6OA 4NQDB 2AAVA 3QCVH 3V7MA 4ZFFA 3HZYA 1AHWC 1CL7H 3MROB 3AB0C 3MOAL 1CDCA 5IOPA 5IW1A 3V4VH 4MA3A 1FZOB 5F6HI 4NZJA 3MRKA 1G7PA 3VXRD 4L5FH 5IHLB 4KY1L 1U93B 2BVOA 1FFRA 2ZSWB 4TTDC 1BD2A 4Z7VF 2GQHA 3UJIL 2VZOA 1I8IB 1PQZA 1PY9A 5LGKA 1N4XH 5EUOA 3PWJB 3TBTB 4WHCA 3U7YL 5AAMA 2A83A 2NW2B 2F53B 5EB9A 3E0GA 4NN5B 1RIHH 3K8MA 2X4TA 1N6QH 4GW1A 5D1QC 5DD6B 1BOGA 3QCUL 3O3DA 1Q9LB 4ZODA 5CEZL 1RZKH 3KPPA 3AMLA 1B9ZA 2LU7A 5ADOH 5I2IB 5EBGA 1TTGA 3PHSA 1N8ZA 2RHEA 1K85A 3SY0B 5F3BA 3P4NB 4LLVB 4R97B 4U1IB 1MQKL 3FRPG 3QFJA 2VIRA 2FX9L 3LB6D 4M7KH 4DQOH 3TFKC 1BX2B 4I0CC 3B5GA 4WEUD 1FL6A 1KTLA 3WNNA 1G9NC 4UOJA 2Q8AL 1JHKH 4PJIF 4LSDA 1N2RB 3BKML 3EDFA 5EZJB 5I8CA 4JR9L 2L0DA 3BJ91 1JPSL 4JCLA 3V0WL 2OI9C 2DM7A 5GS1A 5DRWA 1ETZA 3CU1A 3NFNA 1PX3A 1U8IB 2HT3D 2AJVL 2NW3B 2IBBA 5EZLB 4BQ8A 3SDYL 1A5FL 1L6ZA 2DQEH 4HBCH 4OCWL 2WIIB 5EU4B 1JNNH 1OGAE 3S3PA 3NCMA 4NKOA 1KJMA 2ITCB 4ZD3H 2NPLX 3ARTA 1FRGL 4R4FL 4S11A 5I15H 5IQ7L 3FO1A 1KN2H 5C3TA 1EEUA 3OKOB 4E9LA 2WV3A 4JFZL 5T3XL 2AEWA 5CJQL 4PTUB 3MRNB 3O4LA 4LCCC 3WNPA 1ZKAA 4OFVA 3Q0HA 3TPUB 3NZHH 1L7IH 3RNQB 3CJJA 4ETYA 4GOSA 2Y23A 3RWCB 1QFWI 1CVSC 5DJCA 4RZCA 4FMFA 4U1HA 1INDH 1IC1A 5C7XH 1BF8A 4DVBA 3EYUH 3T08A 3ULSA 4YHKL 3MA7B 4XX1E 2EE9A 1H0DA 1YEGH 1NLDH 5SWZB 1OP5K 1YYLL 5JLZB 4S2SB 5JXED 4G6AC 4HV8A 1CI5A 1JP5A 3UYOD 3L6FA 5HY9A 5I6XB 1MJJA 1T2XA 4GO6B 3LDBC 4I77L 4L4TB 4JCMA 1EHLL 4GAGL 5F9WB 5KAQG 3TCLA 3ZTJH 4ELMF 3EZ8A 4WFHE 2QLVB 3F12A 4F7PB 2IGFH 4OBSA 1BVKB 1AJ7L 2ZUWA 1G7JB 4BZYA 1H3XA 2OMBA 3PWLA 4NBYB 4QRRB 2A38A 4GG8A 3ARGA 3LS5L 5DD1H 1BEYL 2VDQL 4CKVX 1MJUL 4XPHH 4D2NA 1RK0B 4QEGA 3MUHL 2X70B 4OFKA 4G6MH 2R0KL 3F65A 3W2DH 3OKYA 3WUWG 2OJZH 4CUCA 2VABA 3STLB 1N3NA 3KPRB 3RL2B 5MHSD 2R9HD 4BSVA 1S9XA 1JGLL 2XFXB 4XNXL 4PJXB 5F9JA 4L8DB 1QBAA 3I75B 3FZUD 2E7CA 4BM7A 1XGRA 3PP4H 3JWNC 4UINH 3KHOA 3RTQA 1TPXC 4P2CG 4Z8FH 2NY6C 2XWBA 5KVGH 4NC2B 2GTWB 5GZNC 3VE0A 3D6GA 3QI9B 3SKJL 2J4WL 1F42A 3MV7E 3IDYB 2BRRH 4YEEA 4NO2A 1X5YA 4ZSOA 4L8CB 3EFFB 1T20A 1A9EA 4XMKH 1WC7B 3BP5B 5GGUA 2B4CC 3V0AC 3O2DA 4UBDD 4X4XA 5DJXB 2EE6A 1U8NA 3TJEL 4X5WA 5DURB 2PETA 5EG6C 1F13A 1FL5B 1KTKE 1F6LL 3MJGX 1RK1A 4RFOL 1A1MA 3L7FA 4GAYA 4N8VG 3VXQA 1U58B 1C7SA 3DVGA 3L1OH 2FEDC 1I7ZA 3EDKA 4UU9A 3FB6B 5D7JB 1HYSC 3TCXA 4NRXA 2D4FA 4PJEA 4X4YA 5IB5B 2NY3B 5EN2B 5DJ0B 4B41A 5BO1L 1A2YB 1EGJH 2RFXA 5JMOC 1WTLA 5J13C 3I3EA 1CE1L 1IZKA 4M62L 1C5DB 1EDQA 1MIEL 4JM2C 5TH2A 2DQDL 1MNUH 5FYJE 5KSAA 2BHUA 3X17A 4GAFB 4I2XB 5I1DA 5IHUH 1HINH 3CCHB 4MCZB 3WFEH 2BXZA 4XVSL 4C83A 3PJSB 1CGXA 2YPVH 3N1QC 3FFCA 2P44B 4HEPG 3KLHC 3HC0A 3QJHA 5F7DA 1B4RA 3QWOA 2XQBH 4JM4L 1UA6H 3DX8A 1OY3B 2BY3A 3ARXA 3L3OB 4WNQB 1F45A 5IMOB 4RCAA 1WFOA 4OI9A 3AGVA 1KYOK 1TCMA 4BZ2H 1HWHB 4F3FA 3S6CA 1AQKH 3UZEA 1LDPH 1HQRB 2WAHA 1EJOL 1EHAA 3AFLA 1AGFB 4YDKL 1AIFB 1H8SA 1LO2H 3ZHDA 2XT1B 1PW3A 2X89D 1OARL 2G2RA 4LASH 4GAJL 4BQ9A 1EUTA 3EO0A 4HUVA 3PUCA 1HK6A 2HRPL 4CVZB 1N7ML 1X6NA 2W60A 4TRPL 4HIIA 3O81A 5IG7A 2G60L 1I3GL 5I1GL 3UP1A 2D31A 3ZKQD 5JW5B 4PJIB 5GS2H 3SO3C 4FXLA 4O51B 4EBQL 2AGJH 3BPNC 4M3KB 4JLRA 1BQSA 3KYAA 4P49A 4N5EC 1K2DA 1VACA 1I8MB 3RX5A 3RVUC 4JHWH 4NQTA 1JHLH 3MRLA 4HULB 1E4KC 1JTOA 5T33L 1A0QH 5GZOC 3MNZA 5FEBA 4DKFL 4U1LB 2H6PA 1R3KA 1EFQA 2E9BA 1T6VN 1I7RA 1P4LA 1EEQA 4JFFA 1ZA6A 3K2UH 3WJJA 1P5UA 3QB7C 1S7XA 4HJGB 5C0BB 4WWKA 2IPTL 3QUZC 1Q9WB 2BMKB 1CYGA 4OZIA 3U6RA 4R4BB 4PTTB 4FABH 2ZOKB 2XKNA 1C7TA 3ARFD 4NO0D 2YN5A 5ALBL 5EU6D 5C0FA 4YHIB 3MV8A 4Y19D 4U1JB 5HHQA 2CLVB 3O6MH 2AEQH 4F7TB 3NCEB 3QIWC 1JNHB 5HI5D 3ZT7A 3IJHA 4JG1H 1XZ0A 2P5EA 3LKQB 3ULVC 1JWMB 1QEWB 4Z77B 3KJ6L 2H32A 5D7JC 3O6LH 5E99H 2CKBB 5DF0A 1CDBA 2BFVL 5DR5H 3PQYE 4OCXH 3BHBA 3FB8B 2OR7A 3IDXL 1DUYA 4K7PX 3H42H 3RDTC 1VESA 3OB0K 5FK9A 4GRMA 4TULL 4CVWA 4ELMB 3L7EB 1MCEA 4HKZA 4KKLC 2HWZL 4S1DD 4HBQA 2PO6A 5CP3H 1FNEA 4CMHC 3QULA 5FB8A 4KK8C 5CJXA 4XMPL 5LGHL 1J0JA 4MCYB 2AJSH 4KVNL 4S1QL 3E6HB 2XN9B 5M7QA 1G6VK 3DX6A 1B2WH 4Z7UE 2XY1A 3MRCB 1GHFL 5DHVB 4HWBA 3S36X 1A02N 5EFIB 3D87B 1NCAH 3HNSL 1NFDA 3U0PB 3WIIL 2YD2A 4YGVA 5IB4B 2EDDA 5D1ZD 1IEHA 4GKNA 3T2NL 1I85C 2V6HA 3V6OC 4JREB 1KGCD 4ERSH 2NNAB 3RKPA 5C8JB 1J87A 2VXQL 1RULH 3O3EB 3IDGB 1EPFA 1XR8B 1UM4L 1UADC 4JPVH 5GGSY 4EI5C 1KCLA 1F4AA 3CFDB 3RGVB 4JZOA 3RVWC 4BH8B 1XCQA 1EBAA 4KK9D 3U9PL 4ODWB 3T3MF 1QRKA 4KJWD 4YWGH 2BCKA 3EFDH 4J6RH 3TVMC 4XCEA 5HPMA 1LVEA 2GSGA 1CFSA 3JV6A 4M5YL 4P23B 3X11B 5IIEB 4AIZB 1WZKA 1Q9KB 5SX5H 2YPLE 3ZKMC 4M1DH 4D0DB 4G8EA 1UG9A 3TYFA 4XXDB 1MFCL 3JUYA 1LMKA 5DK3A 4EOWH 4P9HH 1S8DB 4XVTH 1EXUA 5IM7B 5ICYA 1CFVH 3RGHA 1ZV5A 2Z9TA 2PN5A 2BZDA 2OL3L 1HNGA 1VGKA 3GMLB 2PTTA 1T4KA 2BDNL 2HVJB 1N5AA 3TNNA 2XZCL 4DGVH 1NGYA 4RA0C 1IEBA 4HF5L 2DIBA 4PGEA 4Y4FC 4TSAH 1LDSA 3ARQA 1II4E 4H25B 5ENWA 1LO4L 2VQ1B 1TNNA 3KPOA 3AM8C 4LHUG 1S5HA 3S96A 3QWRA 4WTZA 4OUOA 1MFNA 4PJBA 1AFVH 1YECH 3RY5A 2Z92B 1KELL 1BFVH 5F88A 2P5WD 1OOAA 3LN4B 4L8SC 3GDBA 1FYTB 2ADGA 1QNZH 2PXYA 5HSFA 3BI9X 2O5ZH 3UTTB 1OB1B 4J3XA 1CL7L 1LEKB 4R8WH 1DCLA 3BGFB 3HUJA 2VB5A 5GJSL 2FL5A 1BMGA 3V4VL 2CR3A 3KXFA 4HUMB 1UGNA 3QEUA 4MD5A 1LEGA 5DQ9B 1P7KA 1NMAL 4RWYH 4X4ME 3GJEB 1I9IH 4QYOB 1CTNA 3S97C 3UCRA 3TT1L 1I8LC 1YZZA 3TN0A 1EA9C 3VFRA 5I1AA 5F71A 4NN7B 1R0AH 2GKIA 1G0XA 1NEZB 5KSBB 1X5KA 4PJHE 1V3LA 3MJ8B 5DVMA 2BNUA 3HC4H 3IFNH 3K81A 1CG9B 3SJVD 4JFEB 4XVJL 5AEAA 1RIHL 1K8DB 3MJ9L 1HH6B 4PRHD 1RZKL 3O3AA 3SCMA 2DKUA 3DX7A 5I8EB 4HUKB 1JPFB 2P8LB 1E27B 5DRZA 4DK6A 1J0ZA 1HHIA 4MAYB 4Y0GA 1BOYA 4NWTH 3PHOB 4DQOL 1P7HL 3WL9A 5C0GB 3T4YB 5HGBB 3MZTA 2Z8SA 4JREC 4NQSA 5DDHB 1MAML 1WITA 1M4KA 5EU6E 1JHKL 5TQ0L 1IM9B 1QSVA 3RWIB 1WCBB 1VPOL 3FO9B 4Y1AD 1HSAB 2NLJA 4PJ9A 2C1OA 1HI6A 4ODHL 3RGVC 2EH8H 2C3VB 2FSEA 5GIRB 4YFLF 1E6OH 2EKSA 3MMEB 3QUKB 3LSOB 1U8QA 3PGCA 1DUZA 4P2QA 1T66D 3S5LB 1F4XH 3BEVB 1CXFA 5GGTL 5D5MA 3BP7A 4JFDE 2DB8A 3EOAB 2DQEL 3D25B 5I74B 5F3HA 4M02A 5BV7H 2XG5A 5J0BA 3HPLB 3ARYA 3D0VB 1BQHG 5HHPB 4ZD3L 4TNWF 2XNAA 5CD3A 5B21A 1LGVA 5LG1A 4PPTA 1KN2L 2HVKB 4NQED 2Z8VC 4X7TB 3T0ED 2AJ3B 3OAZH 4IRJD 2VR4A 4XNMA 5IB1B 3PP3K 3HZVA 5E94A 4QWWC 3IF1B 4LHJB 2FNBA 2I9LA 5C9JA 3V9FA 1ZXQA 5C7XL 1INDL 1GZQB 4LHUA 3VDBA 1QLFA 3EYUL 2YEZB 4CRPA 1K5NB 5LKNA 3I9GH 4HIHA 1TJHH 2CRMA 3IXAB 1YEGL 1M7DA 3T3PE 1I4FB 5LJYH 4HPOH 4M48H 1RMFH 3DXAE 4D8PB 2KL6A 2IF7A 4NPYB 1JRHL 3UXFA 5J6HB 2EC9T 2J8UE 3DXAB 3SDAA 2FR4B 3B2VH 1YN6B 1LO3H 1ZHNA 5INDB 5A16B 4LSUH 1R3IL 5FOBB 1BECA 1BLNB 2YUZA 3QDGD 4KI5C 4O2CA 1A7RH 1OAXH 5IVZA 3UJTH 2CXKA 2UVEA 3Q5OA 1M7XA 2EYTA 5I66B 2YPKA 3L3IA 3FMGL 2DLTA 2R23A 2J6EH 3U2SB 2R1YB 5DD1L 1AD0B 4FQLH 3LN9A 3F7RA 4OIBA 4APQC 1R3JB 3H7BB 2DQIH 4XPHL 4PV8B 3SPVA 4G6ML 3VFSB 3W2DL 2E7BA 3ZDXE 4GLRH 4NT6A 3LRSB 3MFGB 4GW4B 4PJEF 1I1FB 4MYWB 1WWWX 4MNGA 4LSRL 2NTFB 4TTDD 5I9QB 3WHE1 2AK4D 4O2EA 1IBGH 4ZFFB 3HZYB 3GSWA 4UINL 2OXHA 3BKYH 2VLMD 3NVQA 4YHYB 4Z8FL 3A6CH 5IOPB 2QQLH 5IW1B 4MA3B 5KVGL 1S7WB 1JNLH 3MRKB 1G7PB 1JVKA 4U6VH 1BD2B 2BRRL 3P4LA 4QTIH 5FOJA 1NAMH 1PQZB 4GXVH 5D6DA 5EUOB 4XMKL 1EUUA 4G43A 4LP5A 1F2QA 1Z9SA 4K71C 3TFKD 4DZ8A 5DQJA 2X4TB 4GW1B 4NUJB 1HKLH 1BOGB 1MCRA 4RAVA 3O3DB 4E0RB 3KPPB 5KSUA 5L7XH 3SOBL 1YPZA 1AKJD 3L1OL 2EIDA 5F3BB 1OAUH 4NHUB 4WO4D 3U0WH 4HK0A 5E2TH 2I07A 3ALPA 3QFJB 2VIRB 1EGJL 1DFBL 4U6HB 4C56D 3FN3A 5FUZH 2BXYA 1K6QH 1FNHA 1FL6B 1KTLB 4QCIA 2LAAA 2VUYA 2W59A 5IHUL 1HINL 3IRPX 3WE6A 3OX8B 2PR4H 4NRYA 1FIGH 2YPVL 3S36L 3OKKA 3F8UB 1JYXA 3SDXE 4Y16D 1TQCB 4NSKA 5GS1B 5DRWB 3SJVE 1ETZB 5E2UH 4S1SL 4NJ9H 1NGXA 3KWWA 2W9EH 3NFNB 1KG0A 4E0RA 2FHBA 2FO4B 4IJ3B 2HMIC 5T1DH 4PRHE 4FN0A 1G9MH 1LDPL 2ZUTA 1ZLSH 3M8OH 1KJMB 4NKOB 1RVFH 1WZMA 4HZLB 5MI0B 1UKSA 2IAND 4OLUH 3G6JE 5BQ7A 3B9KC 1CQKA 4YQXH 5DVOA 3FO1B 4LASL 2X09A 5T5FL 4HGKC 4L3AA 2K1MA 4LHQB 4OZIF 4WHTA 4H0HB 3O4LB 4PGBA 4E41A 1JCKA 1GJIA 1D5MB 1PSKL 3G6AA 5MP6H 3MA9H 5DJCB 4RZCB 3E1F1 5CINH 3W0WA 4Y1AE 3FN9A 2ICEA 3JTSA 4DVBB 5DUBA 3ULSB 4WHDA 2D7QA 3TIDA 4EKXA 2AGJL 2V5MA 4FG6C 4WEBL 4NQDD 4IRSC 1NQBA 5F72S 4POYA 1VENA 4UILH 4JHWL 4HV8B 3JVGA 5HY9B 1J1PH 3OXSA 5EC2A 4DW2H 5I9QC 2EDEA 4ZO9A 1MHEA 1YEEH 4BFEA 5D2NB 4PRIA 4LEXH 4BELD 1VFBA 2VJXA 4F57H 2O26U 4U6TA 3K2UL 2XTJC 1WGOA 4BKLA 3F12B 3TLRA 1JPGA 1AE6H 5DD5L 2F54E 3T0EE 3VMPA 1OHQA 1BQUA 4KWUA 3PWLB 4GG8B 1IL1A 3ARGB 5IESH 5HGHA 2F54B 2X4RA 1EO5A 4IS6B 4JKKA 4YBLB 1WZ1L 1UM5L 2R0ZH 4JPWH 2C7UB 3W5MA 3QWQB 2VABB 1N3NB 2KZ1B 4PJ5E 4BSVB 1S9XB 4S0SD 4Z7QE 4JG1L 3UC0H 2QSCH 5F9JB 1ULVA 1G7MA 1NFDF 2VDOL 1XGRB 3NTCH 4QNPE 3DGGA 5DC0A 4UIKH 3RTQB 4W4OC 3QQ3A 1N6UA 2XWBB 3D69A 4KJPD 2YRZA 5E99L 3PDGA 3VE0B 5HHVH 3FT4A 5F1NA 2XV6B 3QDGE 1S9VA 1X4ZA 3H42L 3L5XH 2R29H 4NO2B 4ZSOB 1IGYA 4ZUUA 1T20B 4HLZH 1MREL 1OAKH 2FEDD 3ALXA 1A9EB 4I9WD 5GGUB 3TBVA 4ZS7L 4X4XB 3QEQD 1U8NB 1QYGH 4F58H 2X4QA 4X5WB 4GRLC 5J7CC 3G5YA 1RK1B 5J8OA 2WP3O 4ZMAT 4GAYB 3VXQB 3S4SG 3DVGB 1I7ZB 4UU9B 1KCUH 4NRXB 2DLEA 4CDHA 3N1GC 4X4YB 4PJEB 1IC4H 3SE4C 1CVRA 2B5IC 2RFXB 3C60C 5E8PA 4TVPL 1MWAH 2JELH 2ZUQC 4LVHC 1NCAL 1NCDH 5CLTA 5ECJE 1N5YH 4ONGH 4XVUC 5TH2B 2RCSL 5KSAB 5I1DB 4PG9A 1T89C 3X3GH 4X7SH 2JLLA 4TNWK 4C83B 5D7SH 1QZ1A 1XMWA 4RGNC 5F7NC 3FFCB 3SGEI 3RVVC 4ERSL 3JV4A 3HC0B 1FNLA 3QJHB 5F7DB 2DWDA 3QWOB 4JPVL 1A6WH 1WVZA 5IMKB 3QXVA 4MJ5A 1I9EA 3WEXA 4Y5XA 4NQCA 2LVEA 5LBSH 4PJBF 2Q3ZA 1PKQA 4F3FB 4HG4J 3MLZL 3W5NA 4HWNA 4YWGL 4OFYA 3EFDL 4M7LT 5E9DA 1F4YH 5IVXE 3CH8A 4X8XA 2VRAA 2DLFH 3SGJC 1B0GA 2G2RB 4QRRD 3EO0B 4HUVB 5IVXB 3U4EA 4N5ED 4OZHE 2VLJE 1XGYL 2EC9U 3RVUD 4M1DL 3HUJF 2W60B 4HIIB 3CPLA 4H20L 2BRQA 4XCNA 3GK8H 4K3EH 1QSZA 2D31B 3ARGC 3UTSA 5GZOD 4JLRB 3VGBA 3WUWB 4BSWA 3TH3T 3U79A 4G8FA 1K2DB 1VACB 2HTKC 2P42B 4IDLA 3UTOA 2FCBA 3B83A 2QV2A 4QHUB 2FZ3A 4DGVL 4PB9H 4FFVC 3MRLB 4ODVL 3CFKB 4K8RH 2VDMH 4TSAL 5ITBH 5DWUL 1MIML 4OAWA 4F9LA 2IJ0C 2X1PA 4NZDA 1DQLH 2BNRA 3MNZB 3I50H 3BWUC 3HKFA 1D5ZA 1R3KB 1I7RB 1P4LB 4JDVB 5ESAA 1ZA6B 3P9MB 4XWGH 4HIXH 1KIPA 4F80A 1S7XB 2ZG3A 4WWKB 3SKNA 3ABZA 2O5ZL 2P48B 3CFBA 5DTFA 3U6RB 2XG4A 3ULVD 5LXGH 4R8WL 2XKNB 1FBIH 2Y06H 5C0FB 5D7JD 1CGTA 4QHKJ 3MV8B 4RWYL 3WJLA 5HHQB 3VGDA 3SBWC 1QFWM 1I9JH 3D3VE 3QXAB 2FB4L 2NY4B 4KFZC 2JB5H 2AXFA 4G7YL 1YY9C 1XZ0B 1QBLH 3BKJL 3ARDA 4N0UA 2P5EB 3D3VB 5GRJH 1GL4B 3ULUC 5D5MF 4KKLD 1ZHKA 3O3BA 2H32B 1QHOA 4YIQA 1BIHA 5C09D 5HHXL 4YXKH 1JJUA 2A6JA 2H26A 5EU7C 2RAMA 1UJ3C 3BHBB 4KK8D 1BPVA 2R0WH 1DUYB 2G5BA 5FK9B 4GRMB 1H3UA 2Y7QA 5GHWL 3VG0L 1ZLUK 4HKZB 4ZPTA 2XA8H 5DFVC 2BY1A 4I1NB 2EZ0C 4H1LH 4FFWD 3UTPD 1FNEB 1JV5A 4NWTL 1A6UL 1UWXK 3LZFH 4XWOD 3QULB 5FB8B 2DQUH 3GIZL 1INQA 4YHMH 4LU5H 4XP6H 3MRPB 1U42A 2VDRL 1NGPL 1PY4A 2V5YA 4JRYE 4MA7H 4XC1L 1IM3A 3B43A 4XTRC 3DX6B 3C5SA 4TN9A 3I6KB 1YY8B 5E2WH 3BDXA 1KEMH 4P2OA 3VWKC 3VFTA 3C08H 1F4XL 1NFDB 1NC4A 4RMQA 4EZMA 3IDJA 1WCQA 4M7ZB 4EI5D 3SQOH 4N9GA 4CJ1A 5T5NF 3FN0H 4GG6B 3RVWD 5BV7L 4PGZA 4GKNB 1FFPA 1I3UA 2K3TA 5K59E 2JTDA 4HGMA 3Q6GL 3TVMD 4EI6B 1NCWH 5E5MA 1P9MA 4OV5A 2DMBA 1DQMH 1CGYA 3KPSE 2UYLA 3C09B 4OM1L 1GGCH 3QEQE 1T83A 4ALAH 3MNWA 5CP3A 1AP2A 2YA0A 3ZHLA 4JZOB 1XCQB 4LCUA 3OL2A 5HVWA 3DUHA 5I1KH 3L5HA 2BCKB 5C0BD 4XCYA 2BVQA 4XCEB 5HPMB 2VAAA 4PJ8C 2EH7L 1CFSB 4IOIA 3JV6B 3OBAA 5E6YA 1W8OA 3KPQA 2APVA 2MPAH 1FQ9C 1XCTA 3WJJC 5I75B 3K0WA 3TYFB 4WDIA 2OZ4L 4ONOA 2XZAL 3DROA 4UDUA 4YAQA 3IDIA 1EXUB 1T21A 1LO3L 4LSUL 3C5ZC 3QG6A 5C0AA 3H0TA 3C2SA 3SDDA 5JHLH 4OFDA 3ZYIA 1VGKB 3UJTL 3OKMB 2RGSA 2PTTB 1T4KB 1D5BA 4S10A 1IMHC 5MEQA 1N5AB 5IVNA 1PZ5A 1NGYB 1E6JL 4P2RA 1IEBB 2OLDA 3ELAT 4PGEB 3ETBF 5IWLC 3MLTA 5EBLA 3RZCC 3GEWB 3PWUA 3BQUC 2NY4C 2OM5A 5ENWB 1NSNH 5CBEA 3RKDC 1Q38A 2KPNA 2VWEC 3KPOB 3FQXA 3S96B 2CLZA 3GRWL 2DQIL 2IH1A 1YPZF 1FSKB 2QQKH 1H8OA 2E6PA 3JZ7A 5F88B 2H3NA 5DD3H 1UXSA 2IAMB 1QBML 3WS6C 4L3ED 3QDMD 5JW3L 3VCLA 3FFDA 2PXYB 1RUPL 1SEQL 4RMVA 1BFSA 1IBGL 3PWPE 4PY8J 2HFTA 1S7VA 3OAYK 5F8RC 3UDWA 5TF0A 5C6PB 3BKYL 2PF6A 1F90H 3BESR 1Q72H 3HUJB 1OSZA 2FL5B 3LD8C 5T1KA 3KXFB 2XN9D 3QEUB 4JN1H 1LEGB 4MD5B 2PO6C 5H37H 3T0WA 1P7KB 3THML 5ILTH 3Q48A 3DWTA 3FOLA 4GMTH 4WI4A 3TN0B 1KXQE 3VFRB 4N0YL 1NAML 5I1AB 5IUSA 1IAOA 4LLAA 4NKIH 2WK2A 1EHNA 1FAKT 3EZJB 3BT2H 2BNUB 4FHBD 5AZEH 4CVXA 4R2GC 1C16A 4RX4D 2VLKA 1YNLH 1OW0A 4NFDA 1NJ9A 3KPNA 1AO7A 1CGSH 2YR3A 4PRBA 1A21A 1LP9E 3O3AB 3SCMB 3DX7B 4P46A 4ZS6C 1KB5L 3F5WA 2IFGA 5DRZB 1OAUL 4LDLB 5CEYA 1DBJL 2VERN 1RV6X 5EO0A 3RGVD 2UWEE 1HHIB 4Z7WE 4JE4B 1MHHA 3T4AA 2X6MA 3WL9B 5FUZL 1K6QL 1BZQK 2GFBA 3MOBL 4NQSB 4U31A 4X7FC 2AABL 4XP4L 4K7PH 2W9DH 3LEVH 4D9QD 3C09C 2NLJB 4PJ9B 1F11A 1RFDH 1HI6B 2C1OB 2FSEB 2VNCA 1DSFH 2Q20A 2Z93B 1MEXH 2EKSB 1I1AB 3OWEA 4WI3A 1DQJA 1U8QB 3PGCB 2MCPH 4P2QB 1LHZA 4F7EB 3BXNA 1IGML 3GM8A 4W6XB 2VLRA 1KF9B 5FO7B 3SKOA 4NJ9L 1D6VH 2VC2H 2W9EL 4NCDA 5D5MB 5C09E 3VD7A 5IR1A 1UKTA 5IBTL 1NEUA 2E27H 3O9WC 4Z7VE 5T1DL 4MZ3A 4JQVC 5FYKE 1G9ML 1OQOA 5F3HB 1L7TH 5HHOA 4PJDA 1ZLSL 3M8OL 3VI4E 1A64A 5B3JE 1SJVA 2BOCA 2XNAB 5CD3B 1ITCA 2ICWJ 1YMMA 1L9NA 2DQCH 3GMQA 3RAJH 1TVBA 4XNMB 4AQ1B 3HZVB 5E94B 2ED9A 2CIKA 3L3JA 2I9LB 2IEPA 5C9JB 4XCFH 5MP6L 3MA9L 4LHUB 2ZUYA 1FYTD 4KXZI 4JPKH 1RZFL 2OS7A 1VA9A 3FO2A 4F8QA 3HE7A 3NIGF 3DURA 3UTTD 1WAAE 1M7DB 3T09A 5KVDH 3V6OE 4KKAD 1T0NA 1VSCA 2Z35A 3FB7A 4HSQA 5CHNA 4EQ2A 1J1PL 1LK3H 4DW2L 3SDAB 4MD4B 4Q7DA 1ZHNB 1BM3L 2P4AB 4LEXL 4CVUA 4ODSH 4F57L 4O2CB 5IVZB 2Y4SA 1DE4A 3KG5A 2QADB 4OGYH 5CKGA 2EYTB 3F7YA 2YPKB 4JFED 1RHFA 4FP8H 1JZ4A 4ZAKC 4PJCA 2WLZA 2BY2A 5IESL 2ZCHH 5J06A 4LSSH 4EN3C 43CAA 4MJ2A 3BAEH 2R0ZL 4IIQB 4NT6B 4IHOA 4FA8A 1EEZA 3R8QA 1QSFD 4MNGB 5T3ZH 5TF1L 4KTEH 1KPVB 1I7UA 2QSCL 2YA2A 4YHLH 1N0XH 2IC2A 3X13A 4QT5A 4O2EB 3SCMC 3T0VA 1WWAX 3T2OA 3GSWB 1TVHA 3DETC 3QXDA 4PLNC 2AQ1A 1F3DJ 3CFEA 3NOIA 3I6GA 4PY8I 2NX5E 5HHVL 4OF3A 1FNGA 5HVGB 2O5YH 1CFBA 5KOVC 5BXFA 4U33A 4NOFA 4R96A 1OAKL 4JKPH 3CVHA 3V0VA 1JN6B 5I30H 2DLIA 4M5ZH 4G43B 1NGZA 1E4WH 4OD2A 1QYGL 2L4OA 2J6EA 4O9HL 4F58L 5IEHA 5DQJB 2X44D 1SJHB 1EVUA 2F8VA 4PJGA 2CLRA 4RAVB 5KSUB 1Q0XH 3SGEH 4L3EE 4QGTA 3QDME 4RMUA 5J4MA 3GO1H 1KCUL 2DM4A 3QIBA 4HK0B 2GK0A 4ZXBC 1I3RA 4DJMA 2I07B 2QTEA 1G7LB 4G6JH 2XQYG 3ZE1F 5ACLA 4WUKH 4X9IA 5IEKA 4KU1A 3RUGA 1U36A 1N5YL 4YK4B 4QCIB 1ZE3C 5F97E 3GMRB 3WE6B 3X3GL 4P5KA 4X7SL 3FJTA 2HMID 2W0PA 3KAAA 3GZKA 5D1XA 4NRYB 2C4XA 5HD8C 4W6YB 3KVQA 3OKKB 5DJZA 1NAMA 1KIRA 5I8KL 1MI5A 1JF5A 4X83A 2Q3AA 2HLFD 3KWWB 3SKMA 1C8PA 1KG0B 2Y5TA 35C8L 5FM4A 5LBSL 4HDIA 4OGAC 5ANMA 3R1GL 4X9HA 3WO3B 5E2VH 5JMRA 3BO8A 3H3KA 1F4YL 5FYJH 5TE7H 5C0NC 2FO1A 4Z18A 3HMWH 4PLOB 5BQ7B 4OF8A 2Y36H 1U8LA 3L5WA 4P4KC 4FG6D 7FABL 4WHTB 4IRSD 1DQDH 3Q6FA 5C08E 4DZBB 2ICWI 4E41B 2YA1A 4I0PA 4MA1C 4YDLC 3G6AB 3QNYA 5D2LA 4FFYH 3WO4C 3GK8L 3W0WB 1UYWH 5C08B 4DN3L 1UACH 1HQ4A 3JTSB 1U91A 3WYRA 3TIDB 3EOTH 4GUPA 1S7RA 4TVSa 3T8XA 3WKML 3OPZH 5KJRH 3W9DA 1Z6JT 2XTJD 4HWUA 4K8RL 1IKFH 4OZGA 3BVNA 5JA8B 5BVPH 2ILLA 5ITBL 5CJOH 4WI6A 4XRCA 3OXSB 4GBXC 1UH3A 5EC2B 4QRPD 3O2WH 1BD2D 1DQLL 1MHEB 4YHOL 3I50L 4U0QB 4PRIB 1RURH 4UI2A 4KQ3L 1VFBB 4E42A 3WNMA 5GGSB 4HIXL 4Y2DA 4NM8H 1MFDH 2YD6A 1JPGB 4LCWA 1IL1B 4D9LH 1N26A 1TJIH 1MVUB 5HGHB 5FGRA 2IPUK 2WW8A 3SE3A 2X4RB 1FBIL 2Y06L 1SBSH 2C3WA 4PJAA 3HI1B 3ESVF 3U4BH 4G9FA 4IOSD 2V7NA 5J11C 5FA4A 2G75A 5A2LH 2Y5EA 4FZ8H 4KI5E 3NCBB 5L0QC 4UZGA 1QBLL 3MTRA 1HHKA 3MOQA 3UPRA 1G7MB 2R2EA 1ROWA 1U8HA 2B39A 3DGGB 5JOPE 3QQ3B 3D69B 4YJZL 3GSVA 3EYSH 3FT4B 5F1NB 4M6OL 3KYKL 5JO5A 2BNQA 1DVFC 1J1OH 1IT9L 2Q7NA 1S9VB 1KCKA 4U0RB 5I16A 1B88A 5HDQL 1IGYB 4HFWA 1NH6A 4HS8H 4Z5RA 3TBVB 3O11A 1T2JA 3HE6A 3LZFL 4XPTH 4JZJA 2DQUL 2F58H 2FD6H 2X4QB 4YHML 1HXYA 3G5YB 3O41A 4XVUD 3G04A 4QY8A 1OPGH 5T1LA 5E03A 1S9WB 4OGXH 4J2XA 4MA7L 3OG6B 1QSFE 3Q3GA 1FLRL 3IXTA 3NFSH 3O4LD 5EWIL 4K7PY 4M43H 1UZ6F 4K23L 3MGAA 4RGND 5E8PB 1KEML 3RVVD 4YUEL 1RZKC 3C08L 5IBUG 3EGSB 1X5AA 3ROLA 3IFPB 4PUBH 4IMKC 1IGTA 2QSQA 3SQOL 2ERJB 2DWEA 1N64H 1G6RH 4OM0H 4PG9B 4AK1A 3GKWH 4WV1A 4WUUA 5SWSB 5EOQH 3ILPA 5KVMC 5AYUH 5K93A 3JV4B 3JWDH 5I19L 2DWDB 3MGOB 2IH3A 1DQML 1FC1A 3FHAA 4NIKB 4K3DH 4MJ5B 4ALAL 1ZMYA 4WHYG 4J3SA 3DMMC 3WEXB 4Y5XB 3QIUC 4NQCB 4PREA 3P77B 2A0LC 1PKQB 1HZHL 2VSDA 3KDMA 3T65A 5I1KL 3P0VL 3PWVA 3L9RA 5E9DB 1M1SA 4U05A 3QHTC 4YR6A 4JEGB 2B2XH 3O2VL 1P6FA 1B0GB 3DV4A 4XPGH 3ARGD 3OKNA 1G0DA 2MPAL 2HTKD 5IK3A 1F5WA 1AXTH 3VXMA 1MWAA 1HIMH 2ZSVA 2MTPA 3QO1A 4Y4KA 4FFVD 3CPLB 4U1NA 4WWID 2EDYA 1D9KA 4XCNB 3P0YH 1YMHA 3PIQB 5HHNA 3KYNB 3UTSB 1X5HA 3HR6A 4G8FB 1ZANL 2LABA 2FZ3B 3RZWA 3RVXC 4M8QA 3B5TA