1WT5C

The crystal structure of a humanized antibody fv 528
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
DIVMTQSPLSLPVTPGEPASISCRSSQNIVHNNGITYLEWYLQKPGQSPQLLIYKVSDRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHIPPTFGQGTKVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTI EGFR ANTIBODY FV REGION
publication title Thermodynamic consequences of mutations in vernier zone residues of a humanized anti-human epidermal growth factor receptor murine antibody, 528
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 111
sequence length 111
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wt5C00
2FL5B 2H9GB 3TA3D 3QEGL 3W39B 4NRYA 4X6FA 4XPGH 1GC1L 2O5ZH 2AI0L 3Q6GL 5D1QB 3BRDA 4JPIB 2F19L 5K93A 3FCTA 2YD9A 5CZKA 5E9DE 3GMNA 4YHYC 1N0XH 1ZEAL 5L88L 5FUZH 1QFUH 2J8UA 3TIEA 5I16A 2WWMD 5JLZA 4ODXB 4U6VH 3HI1B 4LCCA 3IXAB 4OZIF 3QUYB 1KG0B 2DQHL 5GRUH 4X6DE 3QUMA 4U1GC 3D25B 4XVTL 2XZAL 4M93C 1KXTB 2QHRH 1GIGL 4Y19E 4JO1L 4JKKA 5IBUG 5ADOH 2PYEA 5INCB 5L7XH 3H3KA 4Q9BA 3DURA 4CW1A 3WXVL 4N8VB 2WBJB 5C3TA 5CILH 5EWIL 1I7UA 1AXTH 5A16B 5CFHA 2AJ3A 4S0SD 2X7LA 3KLSA 4PLKC 4UAOC 4G43B 3O2VH 1RY7B 1TITA 3SDXA 4DZBB 4J3UA 3AREB 1I75A 1U42A 4H8WH 3K2MC 3KDMB 3IDUA 1A6ZB 1PYWA 5DO2C 3F5WA 3JWNC 2FD6H 5GGSB 1LD9B 4TPRH 3U0TA 4WFFE 3MPCA 1DN2A 1K4CA 4HS8H 1T04B 1W0WB 1X4ZA 5F7YC 3H7BB 4B7LA 1U3HB 4PV8B 3O6FD 3KYOB 5FYJU 5IG7B 3KPNA 3MODH 3RHWK 3GSXB 2GEEA 1OSZA 1ZANH 2DBLH 1Y6MR 4YHPA 4M1DH 3L3KA 5CLWA 5BW7C 5CP3H 4JANB 5EZOL 35C8L 1DVFA 1KBGH 1KB5L 2PYFA 1UH2A 4K3GA 3LMJL 4P9ML 2Y5EA 2CIKB 1YPZF 4J4PC 3O9WB 2FDBP 5F72S 3TCLA 5LCVH 5ABDE 4LVOC 1CBVL 1DBML 5ILTH 4K3DL 3U4BH 5DDHA 4K71C 4P2QA 1N2RA 3HRZB 3P0VL 5BRZA 2ZJSL 1AGEA 5JTWA 3G04B 2VLRE 4RBPK 1CD8A 2VIRB 4PV9A 1EX0A 4QHLA 3B5HA 3SGEH 4NZRL 2CUIA 3CH8A 3T1WA 2GTWB 1IFHL 5HGGS 4ZUSA 5HYQA 4IHOA 3GUTB 4H5SB 4ZFGL 4O00A 3GSWA 2EEAA 3MYJA 2ZKHL 1J8HE 2NZIA 1S7VA 4RQQB 1KTKE 3BIAX 4KKCC 3S4SG 3S7GA 3PQYB 2C3GA 4Z6AT 2WWKT 2BJML 3O4OC 1CF8H 4KY1L 3S3SA 4E41A 1G7HA 2DLHA 1F58H 4FFYL 2FEDD 3MLSH 5BV7B 3LKPB 4X9HA 1MUJB 2AJZB 2CD0A 2VR5A 3N0PB 3UPAA 1NLDL 1W72B 2G2RA 3V0WL 4JO4L 2B1HH 3GB7A 5FOBB 5DUPL 4DVRL 4PJGF 4IRJC 5FF6B 2BXYA 2MFNA 1L4IA 3UYRH 1FO0A 1EA9C 2F74A 2BERA 4FP8H 2Z35A 4XAKD 3QNYA 3VFMA 1JFQH 4OLZL 5BS0A 2DTMH 2QTEA 4MB5A 1MSPA 3IDIB 3FZUC 2A1WH 4MAYC 2O5XH 4X5WA 4XB8A 1MJ7H 3LD8C 4JRWA 1H0DB 2PW1A 3DVIA 4JFPB 1P4IH 3CCHA 2XI9A 4LSPH 2R69L 4OLYL 4H0HB 3BEWA 4GOSA 4PJFF 1AD0B 3QUXC 2AAVA 1HCVA 2DLIA 2H6PA 1YEDB 3PP3K 1EHAA 4Z7OE 4WGVB 5IQ7H 4D0BB 3GSQB 2ZCLH 4WW2A 3KJ6L 1D5IL 4FZ8H 4Y5VB 1MCFA 4PGBB 5IEHA 2NLJB 3S5LA 5KVEL 4J1UB 1SMAA 5FA3A 5IT2L 3VXRE 1A1MB 4NNYB 1EEYB 3FT2A 1H3VA 2I07B 2MOVA 4JDZA 1BM3L 4KI1A 1HHGB 3BO8B 2C3VA 4M02A 1FFPB 5ALCH 4M7ZC 5D5MF 5IM7A 5CSZB 2A74A 2APTA 4NO5B 1X5GA 1UVQB 2VN4A 4HJ0D 3WDJA 2EIEA 1KPUA 1JI2A 5I30H 4L4TA 4QGYA 5CKGA 2MKLC 3KS0H 1I3VA 3KYNA 2R0ZL 2XA3A 4GG6B 4JFOA 1A7PH 4HMEA 5JW5A 1RURH 3PV6A 3H0TB 4I9WE 4NM4H 2L0DA 2MWCA 3FQXA 4QWWD 3X12B 4EN3C 2XZZA 3VI3E 3ZMRA 2YA1A 3UTOA 5BW7A 3NIGE 4R4ND 5C0IA 4XBEL 4LLVA 5IGXH 5KSBF 1ORSA 4NZTH 4JO2H 4XZUB 5BOPA 3V6ZB 4J4PA 5F9WC 1JTPA 1WV7T 1RK0B 2X4QB 2VITA 1PKQB 2EIBA 3GI8H 1BZ9B 5E9DA 4F8QA 1JJUA 1H3PH 3OAYH 1PGRB 2FJGB 2OM5A 2AJVH 1U3YA 1P5VA 5JQ6H 4HH9B 4P23B 1I8MB 2OBGA 1J05B 4YGVA 5GJSH 2WWKO 1CGSH 4HHAB 5CBEA 8CGTA 5I8OH 4MJID 4P3CH 3WUZA 3JWDH 1ZHKA 4X6BB 2DMBA 3VD9A 2Z92A 1OT2A 4QRRA 4OCSL 5EC2B 1T1YA 3SDYL 1FNEA 3ESVF 1UZ8A 1KPVB 3FOMB 4MA3A 1S8DB 4AIZB 1RZJC 4XPFH 3FONB 4YXHL 4ESKA 5IHZA 3QAZC 1WBXA 4DKFL 1KTDA 5FO9A 3VXPA 5HHMB 3OAUH 4E5XB 1UZ6E 5T3ZH 4YH6A 3MNZB 4ELME 4JFDD 5F6HI 5I19L 1DQJB 1B2WL 1LK2B 3BE1L 5BXFA 2EDYA 4O58H 1WTGT 3HFML 1VGEH 1FV1B 2K7QA 5IBLC 4JPKL 2NMSA 2OCFD 3VWJD 4IRJA 4EUPA 3T4YA 5IHBA 4G6ML 4JRXE 4L8BB 4NQCA 2YPVL 3D87B 1JHTB 4OQTA 1AXSA 3QIWB 1P5UA 3IRPX 1ZTXH 3JWOC 4MAYA 2VXQL 1ADQA 4LLYB 5I75C 2UUDK 5IF0A 5EB9A 5IJKC 1U8IB 1T5XA 3S35H 4PGEB 1KYOK 2R9HC 4MQXD 5I8CB 2CRIA 4HKJB 3QUXA 4FNLL 2HTLD 4WIQA 4DJMA 2EXYD 1X44A 5EUKB 4X99B 1I1RA 3G5VA 2H41A 4LSUL 5DMIL 2AXFA 3QUYD 1SVZA 2GT9A 4PR5A 3W2DH 2ERJB 4ZFZA 4NC1C 3MLZH 2R1WA 3QUML 5IW1B 5CJ5A 3QHZH 3DUSB 4N0CD 2JCCA 1FFOA 2UWEE 5DQDH 4ZMAT 4PB0H 1P69B 3E2HC 4LLMB 4Q97A 2ZSWB 2WUBL 1MFBL 5GGQH 1MFCL 4HFUL 4HT1H 1KEGL 1FZOA 1UCBL 2HMIC 4CAGA 5E5RB 3C60B 2XIDA 1F4HA 2WBJD 1JHLL 1CD1A 1EAPB 1YY8B 2GJJA 4UILL 1YA5A 4XNYL 2AABL 5H2BA 4AH2B 4HXAL 4F58L 3SBWC 1UYWL 3T2PA 5I1GH 2MCPH 2D7NA 3ARED 2BNUB 2VLLA 2FO4A 5CMAB 5HPMA 5DD1L 1N26A 2A9MH 2BSTB 2EDRA 1ZT1B 5DTFB 3C5ZC 5JPNA 4HW6A 5TE4L 1S9YB 2IPUG 3MR9A 43CAB 1PEZA 4W6WB 3FB8A 4YXLH 4G8IA 4XVSL 1P53A 5HI4C 1ZV5A 5CEXA 5GRZA 4LLWB 4EN3A 2JB5H 3R8BB 4QOKE 1YEJL 5C0CB 4HWUA 4XRCB 5EIVA 4RBPH 5TF1L 5IVXF 2BY2A 3VFNA 3Q1SH 5JHLH 3BZFA 3V6FB 3JUYA 4JRYB 4AEHL 1RUKL 4GMTH 4IS6A 1FFRA 2J8OA 4ONHA 3NACL 3HZKA 3QP3A 2UZIL 1AE6H 3ZKQD 3EYFA 4OLUH 4WFHE 5DMKB 3Q3GB 5EZIL 2W1NA 1BVKA 1E4XI 2XKUA 1FORL 2Z93A 2MKWA 1QG3A 4S1QH 3X11A 1AI1L 2XRAH 3MRPA 3ZE1F 2NXYC 4LCUB 1Y18B 5C0AD 5MENA 2P1YA 5J6HA 4F7MA 2OTUA 4PJDF 3GSNH 2JTDA 3P40A 4X6CF 3T8XA 3KPPA 1KELL 4GT7A 5DUML 4LHUB 1XF3A 1RUQH 2GTZB 4MJIE 5ANMB 5D7JA 3K8LA 3RVTC 3KPRD 5AZ2L 3VRIB 1OAXL 3GI9H 4OZIB 5I18H 3KPSA 2AK4D 4O9HH 5K9QI 1D9KC 3H9SB 3QWRA 3TPUA 5A1AA 3EYVA 3MCLH 4KZEH 1NLBH 1KIRA 2DKUA 2FBJL 5FXCH 3QRGL 4X9FA 5L8LB 4NRXA 5DLMH 4S11A 4MNQB 4AT6B 5FDWA 4MA1B 4DKAA 6FABL 4DCQA 5E2TL 2AJUL 4H26B 2HLAA 2VAJA 2LQRA 1SJEA 4U1KA 4LCWE 4UNVA 3WE6B 1UENA 1A1NA 1CR9L 3BKCL 4G8GE 3FL7A 4Z77A 4QKXB 2OJEA 3PP3H 4HX1A 2NYYC 1KF9B 5I8KH 2EDEA 3NN8B 4OZFG 2AQ1A 4KVNH 3GHEL 3VXTA 2X4SA 2NX5B 4HUWB 1S9KC 1M7XA 5EU4B 3G6DH 4QF1B 2GAZB 2AW2A 4P2OD 1FO0L 5DJ6B 4ALAL 1UQSA 5IJKA 3LOWA 4PJXF 2F54B 4M8VA 3EDJA 4G5ZH 1KEML 2NY2B 4AMKL 5DVKA 4F57H 3MRKB 3PWJA 4KPHH 3BP5B 3ARDA 3ZO0A 4U0RB 1P1ZB 1I8KB 3SQBA 4MQSB 3FN3A 3T2NH 4HCRL 3QQ3B 1U8MB 4K8RC 2G60L 2VZVA 4DOHE 3DHJA 1YPZB 2FGWH 3SKUD 1IKFL 1VGKA 1I4FA 5GSRA 5SWSD 5F7UA 1CE6B 2QSCL 3WSQH 2D7TH 4YX2H 3TO4B 3ZTNL 5CGYC 5FGBC 4I0KA 1JGVL 4QCIB 3SBWA 5GJTL 3MLTA 5C07A 7FABH 4I3RH 5KSUB 1BWMA 4OSUH 1T0PB 3RIFK 1MCSA 3LV3A 3SOBL 5J0BA 5KS9E 3QXAB 4BZYA 4OJFH 4CVWA 3C5ZA 5FO7A 2YKLL 4FABL 3DNKA 3HZVB 4XNQA 3HS0A 2EC9U 1LHZA 1N59B 1WQVT 3FT3B 4EI5B 5IOPA 1HKFA 3D39E 3IVKB 3STZB 2PO6D 1KIPA 3R4DA 4RAHA 1BFOA 2WIMA 3DO7A 4LIQH 4WHYH 2VABB 2P5EE 3NIFF 4YFEA 3LB6D 3OGCA 5D1ZD 4PRDB 1JN6A 2EDLA 3L6FB 1A8JH 3HE7C 4R3SB 2YUXA 3MROA 3UPRB 4S1RH 5I9QB 3AU1A 3IT8D 5F7WC 4PJGB 5T1KB 5C0EB 4JN2B 4Z8FL 1NC2D 5FO8B 3O4LB 3BGFC 3UZEA 3BAEL 4FQ2H 4MB4A 2V5SA 32C2B 3GJFH 4JZJB 4N8PA 5HHNB 3RZCD 1HWGB 3WL9B 2P44B 1AC0A 1P84J 4ZXBB 1RIVL 1GGIH 1XGPA 5HHOB 2AGJL 4LHQB 4P23D 3DVNA 2BHUA 1F2QA 1MREH 4PJFB 3NCCB 1RK1B 1IGYB 4N8CL 1D6EA 2ZCHL 1U92A 2NY1D 1MI5D 1NCDH 5DJ2A 4ZQKB 3BD3A 3C6LC 4C56D 3FO1B 2UWEA 1WIPA 4ZNEA 4Y4KB 3S37X 2DQEH 3SE3C 4KK5D 4XAWL 2VDML 4G9DB 4RMUA 3CVHB 5HYSB 3KG5A 1CXFA 1NGYB 2UUDH 4OGXH 1S9XA 3LEYL 4PRHA 4PJ7B 4ZUWA 1EUTA 5D5MB 4DFHA 3VW3H 3P9LB 3MOQA 4NHCH 5LWYH 2HN7B 2W92A 3J7HA 1FJ1B 5FUCC 4NKOB 5E08H 4OFIA 2IG2L 1CT8B 2UY6A 4M7JH 3V6OE 4BFIA 1T2JA 1RZKH 4LSQL 3B9KB 1GGUA 1SEQL 4LKXA 1OTSC 4ZYKB 2XN9E 4F2MA 4A6YL 4FTVB 4WW2F 3EIFA 3MTRA 3RBGA 2EDQA 4LKCA 2V5YA 3GIZL 5L8KB 1LGVA 2LU4A 4WFGE 3EOYG 2R23B 1U8LB 1XCTA 4NRZB 5CIPA 1AP2A 1PAMA 3G5ZB 2VDNL 4JZOA 1FL6A 4BZ2H 4WI2A 4NC2B 4K94H 1NAMH 2L7JA 2DL2A 2DQCL 2HT2D 2EH7L 4HGWB 5KSBB 1KJ2L 5IKCB 4LBEA 4LEXH 2BVPA 1PQZB 4HFWA 1ZT4B 5HHVH 5SWSE 1YECH 5HJ3A 2ICWJ 3IDYC 1EVTC 2VC2H 2P47B 4FXGB 4LEOB 5FGBA 4RGMC 2X4OA 2QADC 1ONQB 3C60D 2B8OT 3ZTJH 2V17L 1SEBA 3O11B 1JNLH 4TN9A 1CS6A 1QRNA 4P5KB 4JKPH 3GSVA 3QDMB 3VJ6B 1IM3B 2I9LB 4JFEA 1OCWH 4Q9CA 1DEEB 3L9RA 2X1PA 5DJZA 3WFBH 4IOFC 3ZL4L 4M3KB 3OTTA 4HMCA 3QYCA 2VSCA 4PJBE 3FRPG 4ZSOB 2A73A 2K1MA 3MJ6A 2BCKB 2NY0C 3NFPB 4PP2A 4LAQL 2CRMA 3C5SB 1NGZB 2XOTA 3UTSB 4JFFE 3F7YA 1D5BB 5I1IL 2E8ZA 3BD4A 5JDSA 1J86A 5HHQA 2ZOLB 3FFCD 3HE7A 4M48L 5DD6A 3EW3B 4G8GA 3IFPA 2QQNH 1GZQB 1H8SA 3QCUH 5CEZD 5FK9B 1YUHA 4LLUA 1U41A 4WUKH 5ETUA 1Q0YL 3ZKMC 1JTTA 3KPMB 5E4IA 2D4FA 3KLHC 5IUSA 4MAUH 1X4YA 4N0FA 4O2FB 4JM4L 2BRRH 4EVNB 3Q6FB 1HHJB 1R5IB 1II4E 1UKQA 2FIRT 3RU8L 3ILPA 3RQ3A 3CLEH 3U30C 2DB8A 3VG9B 1NKRA 4LHUD 4Z18A 4HIHA 4N90E 4NWUL 3FFDA 4KJQD 4OCRH 3MV8E 1HSAB 3OKDA 1I8LC 1OAUH 5GS3A 1OP5K 3DTXA 2QEJA 1Z5LB 1YEIL 1QKZL 3C6LA 4XPBL 4PRPE 4A2MA 4LCIH 3WN5B 3WUWB 1AR1C 1NDMB 3LKRA 3SE3A 4A2LA 2VDPL 1MHEA 3LEVL 5DRWA 1FDLH 1D6VH 5EU7C 4WO4D 3MBEC 1KN4L 5ISZD 1R3IL 1Q94A 2JE8A 1LK3L 1R24B 2W0FB 2IEPA 1FFNB 5HHPB 5ITBL 3MGTA 3INUH 2XZCL 1SJVA 5D1XC 5J13C 3VCLB 1GGBH 3EO9L 4WI9A 1IC4L 2CKBA 1Q9OB 3BKJL 1QBLH 1F11B 4G9FD 1U8KB 3BEVA 4XWGH 1IC7H 2WMPA 3PXJA 4NM8H 5GISH 3D39A 3JWOL 4MWFA 4GRWF 1KENL 4PY8J 4IIQC 2OJZH 4Q0XH 2RCSL 3VXQB 2JCCF 3SN6N 5E4EC 1TTFA 2Z0BA 1TJGL 3D69B 4TVPD 4UB0H 5F96H 1U3JA 2NY2D 4I2XB 5IVXB 1A14H 4FA8A 2XICA 3CDGB 2FECL 4TOYL 1VFAA 3BHBB 4LLAA 4U1HB 1BFSA 4ONFL 4PJAF 4PUBH 2CO6B 1YNTA 4ETQB 1ZSDA 2ICWB 2XTLA 2R29H 4GAJH 3U46B 3I3DA 4WHCA 4OKVA 4PTUB 1DL7L 4U33A 1DSFH 2NY3D 4MQTB 5LGKA 3MRIB 5E99H 5F1OB 4KVCL 4M7LL 4Y0GA 4PJDB 4X6CB 3ULVE 1J88A 1UEMA 1ACYL 2XKSA 4JN1L 4XT1C 1R3KB 2J6EH 5ICXA 2D2OA 3NPZB 5GPRA 3QIBC 3BDYL 1WFOA 3HNSH 1BFTA 4D9LL 1PY4A 5F6IC 4ODUB 1HH6A 1V7NL 1WZ1L 2JLLA 3C5JA 1ZS8A 1E4XH 5I71C 4EI5D 1BF2A 5DJCA 1FE8H 3W0WA 1MCPH 3FAWA 1HIML 2ZPKH 4WFED 3RWCA 1YMMA 3FFCE 1MCRA 5ALBH 5I1AA 2FATH 5J7CC 4POZC 5BVJA 3GMNB 1X5YA 4YHML 4NKQB 1CLZL 4DKDC 3QEGH 1XIWC 3OV6A 4HIXL 3MCKA 5FYKD 1BX2B 2F53E 1GC1H 1HOCA 2XZQL 3TIEB 5JLZB 3Q6GH 4OD1L 2DQTH 5DJXA 4H0IA 4KDVA 4KRPC 2F19H 4GW1B 3QDJA 2E7BA 3IAQA 3VDAA 5E8NA 3VXMA 5L88H 2ZUWA 3RWEB 1CDCA 5DGQA 2QLVB 5KVDL 4PJXB 4JHAL 4Y5XC 3WD5L 5GHWH 1RJYB 3TN0C 1IGJB 3S34L 2Z31C 3OJ2C 4Q6IC 4EKXA 1BVLB 1I8LA 2DQHH 5JHDA 3DVGA 4JREB 2AKRB 3E3QC 3QXVA 4XVTH 2BNQA 1M71A 1X6LA 2XZAH 1TCRA 5B4MC 5HVWA 1MRFL 1GIGH 2HFTA 4JO1H 4ZPTB 3G6AB 3ARRA 4F7PA 1S3KL 3T65B 3TYFA 3MBEA 3BPCA 1PYWB 3WXVH 4M43L 2X4PA 1R5VA 1S9VB 1OW0A 3U0TB 5EWIH 4YZFE 1HXYA 3ULVC 4KV5E 4KXZI 3QEQD 5CLTA 2D0HA 1DUYB 1DCLA 5D1XA 1QQDA 4P5TD 4OZFA 1MQ8A 4WI6A 1FL5B 4BH7A 3GIVB 3KPNB 5B3NA 3MQIA 1KLFA 3LKQB 4U1MB 3KPOA 1CDIA 3T2OA 3VA2C 3VRLF 1XF4B 4PJBA 2J3SA 4G9FE 4LVEA 3MLPA 1WCQA 2DDQL 1BJMA 1UKTA 2CIIB 4IIQA 3CSYB 5TE7L 4GSDL 1J0YA 2DIAA 3O2WH 2PYFB 1QSEB 4XP6L 5CBAA 5HVHB 1A21A 4FFVC 4XP5L 2YPLD 3QPQD 4PJ5D 4P2RD 1VKXA 5DDHB 4P2QB 1N2RB 3TNNA 1CU4L 5C3LD 5EZOH 35C8H 4Z5RA 2PXYB 4ZS7L 4P9MH 3LMJH 1PY9A 1CBVH 2NY6B 4JGMA 1DBMH 4K8RL 3DV6A 4Y4FB 4XBPA 3TZVC 5HYQB 3GM8A 2YRLA 4IHOB 3P0VH 4YHOH 1LNUA 2HKFL 2ZJSH 1EFXA 3GSWB 4M9OA 4XTRC 1S7VB 3T3MF 1JTOA 1PLGL 3RDTC 3UCRA 2CR6A 4NZRH 1J8KA 1IFHH 3ARXA 4OB5L 4PJCF 3FB7B 2LAAA 4X9BA 3QIBA 2FSEA 5GSVA 5F97E 1G7HB 2R2CA 2YD2A 2J1KA 4GFTB 3UTQA 1YNKL 2AQ2A 1D3CA 4JCMA 2HFEB 1U8HA 4J3TA 3UTSD 4FFYH 4XCYB 5A2LH 2DWDB 2MHAB 4M00A 3ARGB 4GW5A 3QNYB 3G5YA 3KPTA 5ID1B 5K9OA 1NLDH 3QXDB 3CC5A 1XIWA 3F8UB 2C9AA 1AO7A 3L3JB 5DUPH 3SDCB 4X5WB 4JB9L 3SPVB 3UC0L 1AGFA 4KQ3L 1OP5H 3RWFA 3BEWB 1YEKL 1F00I 5TH2A 3SQOL 3V95A 1A9EB 1H3UA 4OLZH 2V2WA 4NN6C 3JTSB 1RUML 4G6AC 4XMPL 5TQ2L 3SY0B 1YJDC 3DX8B 4M93B 2OR7A 4UT7L 2P43B 4Y5XA 4LSVL 3TN0A 1EHLL 1ZMYA 2ADGA 2R69H 4WW2B 2WINA 4OLYH 5IQ9A 2Z31A 5IEHB 4PJ9C 4Q6IA 3ZE2F 4APQC 2GFBB 4ODHL 4NHUA 5FA3B 1U8OA 1L9MA 1ZE3C 5D6CA 3U9UA 2DMKA 3MV7D 2LU3A 1I9IL 3LKOB 2C3VB 1B0WA 3RWJB 4JM2C 3HG1B 1S5IL 3KLAB 3PGCA 4NKIH 5IM7B 5KVEH 1BREA 4NPYA 1HHKA 3A6OA 2A74B 1HCFX 5B39G 1AR2A 1MJ8L 5GZND 5JR1H 2CDGB 3BKYH 4UTAH 1BM3H 5IMOA 1KPUB 4RMQA 1IAKB 2EYSB 5DFTA 3ESUF 2YD4A 3QEQE 5DD3L 3UTPD 5A2IH 4GUPA 1VDGA 3VXUE 3KYNB 4ZDHB 5IWLC 5CD3A 2H1PL 5ENWA 4HK0B 3RIFF 2XWJA 5FGCB 4HXBL 2PR4L 2CMRL 1QLFB 3LQZA 3O8XB 1JZ6A 4L4VD 3MV01 5DK3A 2DICA 1NCAL 4MA7H 2OI9B 4CMMB 3DBXB 5DI8A 4Z78B 2XXCB 3X3GH 2YK1L 4ZFOB 1ROWA 4EDXA 3UXFA 4K3HA 4M4PA 4YHLL 3GSNB 2ICEA 3K8KA 2VITB 1JPSL 3PXHA 3SCMC 4XBEH 5DSCA 5FYJD 4Q6YA 1KIQB 2F53A 5F88B 3VE0B 1K8DB 3JVGC 3DGGA 2CXKA 3TZVA 1ZHKB 3IGAA 2NR6D 2Z92B 1GZPA 4O2CA 4MD4A 3WXWL 3RY6C 1T66C 1FNEB 1UZ8B 1TVBA 3RDTA 4ZAKB 3MNWA 1KTDB 3C2SA 5FO9B 4P4KC 1IILE 3HCVB 4UINL 4CNIB 3VXPB 5IV2B 2H32H 3QXWA 2DLGA 2YPKA 5KSAD 4OCSH 3SDYH 2VLKA 2FGZA 1I8IA 3FRPA 2QV2A 4YXHH 4R96B 3V5DA 4DKFH 1Q0XL 2VDKL 3PHOA 4P46C 5EBWA 2QQKL 4RAVB 3DIFB 2I25N 2NZ9C 3KPQA 1A7QL 5I19H 4NQCB 5MHSE 2ZG2A 5DXWA 1B2WH 2DQGL 4NT6A 3BE1H 2VRAA 3SJVA 3SKNA 3HFMH 4LLQA 3KYMB 4PD4K 4JPKH 4G8EB 3CFKB 3V4UH 5FCSH 3HUJF 1T5XB 3OR7B 4HAGA 3WDHA 2ESVE 4OV5A 3QUXB 3RNKA 1JK8B 4F15C 3PIQA 5F21B 4MDJA 4M6AA 2GCYA 2GT9B 2VXQH 4PR5B 5C09D 2N4IA 3GMQA 2CR3A 2OL3H 4XI5D 3D0LB 3TH3T 4RDQF 4GRWB 2R1WB 4PJ9A 1IGCL 4APQA 1VADA 3G5XA 3RRQA 2JCCB 1TENA 5SWZD 5KSVB 4LSUH 5DMIH 1UACL 1WTLA 4S1SL 1FGNL 4YPJA 3SE4C 2EDHA 3TF7C 3BRGC 4JM2A 5C70A 1CD1B 4XMLH 1H15B 5LAXA 2I9TA 1G6RL 1DEDA 4PJAB 3UDWC 4X9GA 5D7LD 3WCYA 3MRDB 2WUBH 3NZ8B 3MV9B 4OGYL 1KEGH 1ZLUK 3RZWA 1UCBH 3QFJD 4NIKB 4XGZA 4XP1L 2MTPA 2VLLB 4XX1G 1CGYA 3DJ9A 3ARFC 4YFLF 1JGEA 3B3IA 2BNRD 1LDPH 4UILH 4YDIL 1L0YA 3DXAE 4XNYH 1P7QA 1DQLH 4HXAH 2XQBL 1EV2E 4WDIA 5IWLA 2FECI 2W60A 4KKLD 2ADJA 3ARYA 5IW6A 1ZAGA 5A2JH 1JPTH 4EN3B 3QDGD 5LG1A 3QPXL 3H9HA 5TE4H 4W70A 3OX8B 5D9SB 1WBZA 3GJFB 1VFOA 4ONHB 4BUGA 1HXMA 4XVSH 4WUUD 5I6XC 1ACZA 3D85A 3EYFB 4NQEE 1YEJH 4F7EA 4JKLA 4OUOA 5KVFL 2M26A 2R0KH 5TF1H 3SCMA 3IDJB 3X11B 1ZT7A 1IAMA 4AEHH 4CMHB 4J2XA 1MWAA 3MRPB 3NACH 4XCFH 4BFBD 3BPLC 4WW1A 4F7MB 2UZIH 2OTUB 5F93C 3TVMD 3KPPB 3U9PL 3I6LE 5EZIH 4OCMC 3JVGA 1FORH 5D7JB 5E8EB 3MFGB 1UC6A 4MXVE 1AI1H 3FQRB 3RY6A 1SJHA 1S7QA 3EGSB 4RMSA 4KMLB 5F9AC 2ED8A 3JBG7 2GITA 4KK6C 2AEPL 1KELH 2NNAA 3QAZB 4C83B 5DUMH 3NCFB 4N1CA 5KN5B 2VDOL 1RJCA 3P73A 4P4KA 2VXVL 3FQTB 1LE5B 5J3HD 5AZ2H 1OAXH 4WEUD 1O5DT 4FQQA 2W9EH 3RX7A 4KMTL 3CFBA 1PG7W 2JKXA 4OFPA 3WLBB 1CDGA 1IGIL 3H9ZA 2HLAB 2JJUA 4P4RA 3AS0A 5TFSL 2HA1A 1G1YA 1F02I 1BHGA 4U1KB 2BVEA 3HZMA 1OQXA 4UIMA 1JE6A 5IK3B 1YYLL 1JVKA 4IRSC 5TDOA 1JF5A 1OP9A 1EEZB 5C2BL 5L0QC 6FABH 1JL8A 3VMOA 1YEGL 1P7KB 4N8VG 4O5LL 5F1SA 2AJUH 5D7KD 1MLBA 1XZ0B 3QEHA 3RWDA 1KTRL 2X4SB 1BVZA 5D70L 3P4OB 1K85A 2FB4H 4HD9A 5HD8D 3VXUA 1FG9C 3ARGD 3BKCH 4BQ8A 1AGCA 5I75B 3EYQC 3ROOB 2E8YA 4QHMB 4TNWK 3SDCD 3VRJA 5E95B 3WLWD 1NAMB 3EJYC 4FQCL 4YAQA 3HPJA 3U7YL 3O6FC 3PWPA 1F3RB 1T7ZA 4ODWA 4ALAH 1FO0H 5C09E 2V5RA 3ARDB 4U1LB 3ARBC 1F97A 2R56L 1T22A 5E6YA 1KEMH 5SWZE 1IVLA 3KAAA 4AMKH 4KXZH 5B3JF 4ZUVA 2EYRB 2HJKA 4CVZB 3SE4A 2OP4L 3KYKH 1JV5B 4HCRH 3BP6B 4HIEB 1RFDL 3UDWA 2G60H 1RZGB 5D7SL 3HG1D 3MLTB 1IKFH 4DFIA 2QSCH 3TYGL 3LV3B 3X3FH 2RGSA 3VWKB 3ZTNH 5CP7A 2G9HB 3ARFA 3LQMA 4LPCA 1MEXH 5K9KA 2QJDA 1NKOA 5IFHL 1JGVH 3HS0B 1HILA 3SE9L 3AC0A 2CDEA 3ULVL 4UOJA 5I1DB 2EKJA 4MSWB 4JJHA 3SOBH 2P5WD 4PJCB 3BRFA 2EZ0C 1CFBA 2YKLH 4FABH 4QY8A 1AKJD 2P8LB 5DZLA 1YEFL 1R6VA 3O8XD 4MNGB 4QTHA 2J7LA 4OF3A 2NTSP 1IBGH 1JN6B 15C8L 3U6RA 1HYSD 5E6ID 4UQ3A 1Q9LA 2FEDC 5J9PA 5DRNB 3AU1B 4QRPE 5KJRL 4TSBL 5HYJA 4H1LH 3STLA 1FGVL 4NUGL 1NBZA 4OM1L 3C87A 2DIJA 2HTKD 3TA3A 4J7RA 1C08B 1OTTD 2MCG1 2NXYB 1FYTD 3TPKA 1A6AA 4HUXA 4MZ2A 1NPUA 1WF5A 4Z8FH 1NFIA 4XX1E 4XCNB 3MRHA 3UTTB 1T3FA 4O4YL 1CICB 1PDKA 1D6EB 1P4BL 1RIVH 3L5JA 1U92B 4MCZA 5DMJB 3TJHD 1YC8A 2AGJH 4IEFB 3RY4A 1AFVH 3PWVB 3WDIA 2C1OA 4N8CH 2ADIB 2ZCHH 3RPIB 1KLUA 2GSIA 1RIHL 4DZ8A 4FQXD 1F4WL 4ZUUA 4H25A 5HDBE 3RVUD 3ULUD 1DUZA 4IRSA 4JPWH 5T3XL 1PVHA 1KXVC 3A67L 3I85A 2VDMH 4X4ZA 4D9QD 3IS0X 5J11B 2OYPA 2R0LL 3BZDA 1QA9A 2AV1A 1OL0A 5ERWA 2IMNA 3H3PL 3MACL 3LN4B 4WI5A 4L3CA 4RISL 1LMKA 3GDBA 5B22A 4F2MB 1KT2A 1JYVA 4LKCB 3NABL 3L3GA 2IG2H 3O6FA 1IT9L 4G80A 1XCTB 2X4NA 4PBVC 1AP2B 3GO1L 3EDEA 4JZOB 1SEQH 2GUOA 1PG7H 3ARBA 4HUKB 4A6YH 2V7NB 4NQDE 4DQOH 2ITCA 4B41A 1A1OA 1YJDL 4NQEA 5EFIA 3GIZH 4OUUB 2IALB 5C0FA 1AHWC 4R4NC 2BVPB 4DUWA 3PF2A 4MJ4A 2AXGA 3IU3A 3I2CL 1EPFA 3LRGA 2CJUL 5D2LF 1CFTA 4R8WH 1A5FL 1KJ2H 2X4OB 1S7XA 1VPOH 1C12B 1C5DA 3HAEB 3L5XH 4IOIA 2QR0B 1NCWL 3QA3A 3MV9D 1RZIB 1XEDA 3DVFA 4YWGL 3EJJX 4MMZC 3RX8A 2V17H 1Z9SA 2A73B 3HTLX 1HH9B 3W81A 4MDIB 2M2DA 1CD0A 3LZFL 2J12B 5J1TC 4CKVX 3ZL4H 4JKWA 1AXIB 4AQOA 4X7SH 2NY5C 1DQMH 3E6HB 4I4WA 4QXGL 4L9DA 1R5WA 4HLJA 1INDH 2R2BB 5DC0A 3GRWL 2LVEA 3OF6D 4ERSL 4MJ5A 5TDPA 4LSTH 5D93C 3FQUA 2R2HA 2HWZL 5AZEL 1IGTA 1QPPA 1P2CB 4M48H 1ZVSA 4N0FB 3OKEB 3IXTA 1SY6A 4XVJL 4R4FL 5D1QC 3HUJB 2DS4A 3ILPB 4TUOA 1Q0YH 1E6OL 1TPXB 4LL9A 3VG0L 1WGOA 1WLHA 1CL7I 1NUGA 3TNMB 2ZCKL 2ZUVA 4GXUN 2WK2A 1A7RL 2A6DB 4JM4H 5J1AA 2QQLL 3DTXB 5K9JL 1J10A 2HTLC 2UYLA 3C6LB 5MEPA 3QG6B 4D0CB 3QZWB 1QEWA 2BMKA 3LKRB 3QUYC 4NWUH 1PSKL 3MNVB 2NTFB 1K4DB 2YA0A 3EOTL 4R4BB 3U0WL 5GGRA 1YEIH 1AJ7L 1IEBA 1E6JL 1QKZH 4XPBH 4C57C 4L8SA 2X9YA 4P9HC 1HKLH 3PQYE 1PEWA 5GGVL 3AROA 3LQAL 2GJ6E 3MGTB 4OLWL 3O6LL 2BOBA 1ZLSL 2JB6A 2VDPH 3LEVH 1K3ZA 1EJOL 5L9DL 2WBJC 1QSFD 3UZQA 5IFAH 2VLJE 4LCYA 1KN4H 3HNVL 1YQVH 5A2KH 2YD8A 2IANE 1LK3H 1H5BB 1N5AA 2CKBB 4HUVA 1F5WA 2YEZA 4YXKL 1DR9A 5E0QA 5ITBH 3AREC 3VDBA 2OS7A 1OM3H 3BEVB 5E8PB 1HNGA 3MBXL 3SDDD 2XZCH 1X5XA 3ELAT 3ZDYF 3P77A 2XKNB 4K07A 3OKMA 5HYEA 4P2YA 4FQJL 1CDJA 1G6VK 3EO9H 2QL1A 1IC4H 3BKJH 1E28A 3JV6A 1WIOA 1U3HC 1NL0H 1Y6KR 1ZKAA 2DJUA 4IBLT 5E2UH 3T0ED 3UTZB 1KENH 1VFAB 2ZSVB 4HV8A 1AHWA 1KIUA 1WBYB 4PY7A 5HDLA 1TJGH 4YE4L 1YNTB 2FZ3A 3IFOA 3SEPA 1XF2A 4OCWL 1D5XB 5B8CB 5D72L 3FQNA 4YDKL 3GSOA 3MGOA 4G6KH 4OKVB 1OGAB 4UBDD 4TOYH 4TUJA 3VI4F 3AAZA 4Y4HD 2BVOB 3H3BC 4NNXA 2CDFA 4S2SA 4XMKL 3HHRB 2DQJL 2X2YA 4OGZA 5H94A 3BDXA 3ECBA 5K33A 3VWKD 1NGPL 3EOAA 2H2SD 2OR8A 5TDNB 2XA8L 2IH3A 4M7LH 4OZGE 2ARJB 1CDBA 3MRMA 1SYVA 4LHUG 2NY0B 3OB8A 4YEEA 2YSSA 1ACYH 4Q2ZB 4QRUA 4U6HA 3LKNA 3W0WB 5EN2B 2IJ0C 1GGCL 3U1SL 1K8IB 2HJFA 3BDYH 5GZOD 4NO0A 3GMMB 3RWCB 4D9LH 5IESL 3W5MA 1HHIA 4O2EA 1TVHB 4JFDA 4TRPL 5BVJB 4Y8DC 2CSPA 2JK5B 3S98A 1G7MB 5BV7C 3KYAA 1HOCB 4HS3B 3RVVD 1G0YR 2C3WA 4OZHE 2FL5A 2H9GA 3NZHH 3P0GB 2AXJA 3W39A 1S9WB 4YHMH 3CK0L 3V52L 4UNTA 3T4AB 2IF7A 2AXHA 1CLZH 3WHE1 5E8NB 3VXMB 5D1QA 4HIXH 4JPIA 2XZQH 4ZTOL 1XH3B 3U30B 1H3WM 4J12A 3R06B 4X6DF 4OD1H 1D7FA 2BHYA 4UUJB 3MOAL 2B4CH 3LN5B 4PYGA 2VR4A 1CICD 4AM0B 1MCEA 4ODXA 2BNQB 3HI1A 4WNQB 1TCRB 4X0KA 4JHAH 3WD5H 3IXAA 3QUYA 3S34H 4MHHG 4H0GA 5E2VL 3Q5TA 5ECJE 1JYXA 3WIHA 3BIKB 2VDRL 2UVEA 4E42B 2VKWA 1JWMB 2N1KA 3L1OL 4YLQT 5HHME 2XG5A 3VFVB 3VXSD 1NC4D 1QQDB 1S3KH 2WBJA 4M4RA 4P57A 3S3PA 5J13B 1IAIM 4BH7B 4IMLB 5A16A 4M43H 4RFEB 4G43A 3T09A 4DZBA 3KPOB 3SHSA 3U4AA 4AEEA 3AREA 4DK6A 1EHNA 3KDMA 1DFBH 2IAMD 5GGSA 1QFWL 1LD9A 4UDUA 1MIEL 4ODSL 1T04A 3OPZL 1W0WA 4DKEL 3H7BA 4ZO6A 1U3HA 4PV8A 5F8QC 4M5YH 3KYOA 1EMTL 2DQDL 5IG7A 1X5AA 4XPHL 1VKXB 1UKSA 4M6ML 4G6FB 3TNNB 3LB6C 4GSDH 5D1ZC 5JXEC 4XP6H 4YDJB 1A47A 2B7DT 2NXZB 4JANA 3GHBH 4XBPB 4HGMA 1C1EL 3JTTA 1CU4H 5D6DC 3IJHA 2DQUL 1MRDH 3T2QA 1EFXB 4ZS7H 1EZVX 1WUNT 1V8HA 5C0AA 3HRZA 4K8RH 5DYOB 2W9DH 1QD0A 3G04A 3GMRA 2VIRA 3IDMB 4P23C 4RX4D 2HKFH 1MHCB 3K3QA 4DN3L 1WAAE 3QIBB 5GSVB 5B21A 4BK4A 2PTUA 3HC4L 2ORBL 4PG2C 1PLGH 3VFOA 4ZUTB 5I71B 3GUTA 2YD3A 4H5SA 2X1XR 4JGUA 2FX7H 1JGDA 5BO1L 3WHXB 3P11H 4C4KO 1MRCL 4FQLL 4DN4L 2DBJA 2AJXH 2R15A 2DN7A 5CEYA 4KK5C 5D71L 1MFAL 5K9OB 4LMQE 3LKPA 5EIIB 1MUJA 3QHFL 5C0CE 5HYSG 3CH1B 1UWXK 1MCWM 2CLRB 4KRPB 2OL3B 4UOW1 5C6TL 2Q8AL 1W72A 4JRYE 3KWWB 1C5CH 5FOBA 3AVEA 5FEBA 4PJEE 2V2WB 3KNBB 4K3JL 5FF6A 3BSZL 5DWUL 1RJLB 4JB9H 5DFVD 5GGTA 2ADGB 4KQ3H 4P2OA 2Z31B 4TNVK 1YEKH 3SQOH 3IDIA 1S7TB 1CIUA 1C5BL 2EEDA 5JW3L 1GHFH 4NHUB 4GJTB 1H0DA 1RUMH 4JFPA 4XMPH 1W0VA 3MFFB 3LPWA 2FHFA 4UT7H 2X70B 4LSVH 1TQBC 1AD0A 5ANME 4GKSB 2HG5B 3I75A 3WJLC 5AG9A 1CLCA 3S36L 3PGCB 4OF5A 4OZIE 4ODHH 1GVIA 2SEBB 4D0BA 1HHKB 5HGAB 3GSQA 2ERJC 1BD2D 2HT2C 5B38B 5DR5H 5C08B 5D2LB 5F1IB 1RUAL 2NLJA 1I9IH 5IMOB 4PFEA 4J1UA 3UBXI 4LF3A 1A1MA 4X7TB 4NNYA 8FABB 1EEYA 5M7QA 3PJSB 4MNQE 4MLSA 3CZFB 4RA0C 4G6JL 1HHGA 3BO8A 5T1MA 4RGND 5ENWB 4EI6B 3C60C 1FFPA 1WZKA 2P45B 3EOBB 3QIUD 1XF5A 1UA6L 1FVDB 5DD3H 3NFNB 4K9EC 4NO5A 3IB4A 1UVQA 4TUKL 5IHUL 3TBYA 2W9LA 2H1PH 3DUUA 5JZ7C 4KZDH 4KK8D 4JVUA 5IVNA 2NX5E 4KI5E 4HXBH 1OD9A 3DO3A 3MXVL 4MYWB 4JY5L 4GG6A 3KXFE 3H0TA 1R0AH 1JHKL 1MIML 2YK1H 3QRFM 4MXQD 3WFHB 3GSUB 5D1ZA 5JXEA 4YHLH 5IEKB 2HRPL 2P8PB 1JPSH 3MOBH 2P46B 3UJTL 5JOFB 3U2SA 2D3VA 4O2CB 4MD4B 1IARB 4C58B 1NC2A 2IH1B 2EEBA 1RK0A 5TGBB 3HI5L 3H42L 2X4QA 3HE6D 4K2UL 1SVCP 3P0YH 1TTGA 1PKQA 3BX7C 1BEYL 3N1FC 1BZ9A 1FH5L 3O3BB 4CBPA 4MZ3A 1XCQA 4PJ8D 2WNGA 4L8CB 4HH9A 4ZOBA 2UV3A 4P23A 3BMWA 4V1DD 1KB9J 1CFQA 2VLKB 4HHAA 3WNOA 4AZ8A 2XTJD 1G0XA 3HC0B 5DEGB 2W07A 4PG2A 4X6BA 3UP1A 5EC2A 5EBWB 2EE2A 4UINH 1MI5A 4ELMF 4Y2DB 1JBJA 2IFGA 3FOMA 4AIZA 4K23L 4NO3B 4C56A 1A9BA 1ERNA 4KK9D 1MFDL 4N0UA 3IFNL 3HN3A 1Q0XH 1T83C 5E03A 4E5XA 3WUWG 3FOLB 4N5UA 2FRGP 5F7DA 3SKNB 2VDLL 3MNZA 4WO4C 4PRIB 4S0TD 5DHYA 4MA1C 2X89D 1G9NC 1OWWA 1DQJA 3O3DB 2VXUL 4Y89A 1LK2A 1A7QH 5I73B 3RNKB 2KDGA 3QO1B 3PIQB 3D3VB 4MD5B 1SBBA 3K1DA 3BN9C 1UXSB 5L2KE 1G7PA 3EHBD 1MF2L 1M4KA 3ULSB 5F7EL 3O4LE 5E5MA 4Y1AD 4J3SA 3PWNB 1NCCL 5T33L 1WIUA 2RJMA 5IBTL 4LLYA 5C0ND 3AS3A 5C0DA 1JNHB 4PGEA 4HKJA 3L7FB 1QLRB 2D9CA 3WJLA 1TNNA 2C26A 1IGCH 2NY2C 4YBQC 5DHXB 5LAXB 3S37L 2I9TB 1TZGL 4U0RC 1UACH 4S1SH 1FGNH 5I1LB 4RNRB 3BN3B 3WIHL 5IVZA 1JGEB 4F80A 3EDDA 4LLMA 1TZIB 5A43C 1PW3A 3B9EA 3PL6B 1H9VA 1G6RH 4P9HL 1G7JB 5JUEL 2FR4A 4NUJB 4X5LA 4OGYH 3C60A 2I27N 4L3EB 4I5BB 4XP1H 4GQPH 1YY8A 4X7FC 5E8DL 4QLRA 5ESQB 1FVEB 4LDOB 1EGJH 4YDIH 5D5ME 2MQ3A 4IDLA 2XQBH 3OG4B 4HG4J 2FBOJ 3B6SA 5DUBA 1E4WH 1OPGL 4MB3A 1KCSL 2BZDA 5DTFA 2RAMA 5HDQL 1HXMB 4OAWB 1EH9A 4Z7VF 1FCGA 3S88L 2A0LD 3CJJA 1UH3A 4RFOL 3ZSTA 4HJJL 4I3GA 4EI5C 1CLYH 4U7SA 4FTVE 1ZT7B 2H2PD 4LLWA 1MWAB 4KROB 4JFZL 3ZT6A 4ODTL 4XRCA 2DYPD 1CXHA 4G6FD 5FV2A 2P8MB 4QRSB 3IYLW 3V6FA 5F7LB 5KVFH 4DVBB 2Y9RT 3WEXB 4LVNB 5EUOE 1ZHBB 4HZLB 4QHUA 4XC3L 1L6ZA 3GK8L 5I9QC 1PKOA 1SJHB 2F5BH 2Y7QA 5DMKA 5KSBE 3Q3GA 2EYTB 5DHVH 1JWSA 4U1NA 3P73B 4X6DB 4JZJC 4UNUA 4NBYB 3WBDA 1Y18A 3QISA 4ZXBC 4V1DE 1IMHC 1RU9L 4LHUA 3TCXA 2GTZA 2XTJE 2AEPH 1RULH 1OLZA 2A38A 2EDXA 3EYSL 3QDME 2RFXA 3VRIA 3WNKA 1UWXH 2VXVH 3AGVA 2C1PB 1FN4B 3HZMB 3H9SA 4KAQH 4UIMB 3UO1H 4P49A 1YY9C 4ZSOE 4OF0A 4KJWD 1IGIH 1T83A 1MLBB 4W6XB 4Y4KC 3RWDB 2HRLA 4WO4A 4AT6A 3EBAA 4JDVA 1KFAL 1YYLH 1X5FA 1AGCB 4KC3B 5FUOH 1ZHNB 4H26A 2EDBA 5C2BH 5FIEA 1YEGH 2YC1B 4MQ7B 4O5LH 3VRJB 5BV7L 4A6YB 1ZA3A 3NN8A 1W72L 1SQ2N 3ZE0F 1XMWA 2NX5A 1QYGL 1HNFA 4Y1AE 4EQ2A 4QF1A 1O7VA 2GAZA 1QBAA 1T22B 3U7YH 1TLKA 2X9XA 5GGTL 5J4MA 3BESR 2J88L 4JFYB 4ZUVB 1VERA 3HPLA 1RD6A 3NCEB 2F54A 2GSGB 5C9JB 1NCTA 4TTDD 4OCLC 2PYED 4F37K 3BP5A 5CZXD 4BQBA 1CI5A 3MRLB 4JR9H 5CJXC 1QACA 3QQ3A 5C0BE 4FQPA 4J3XA 1YPZA 3EFFA 4OD3L 1RFDH 5A3ID 2CK0L 1IZJA 4GQ9L 4O02L 3U48A 1CE6A 5ESAB 5D7SH 4PJHE 4C55A 2Y07L 3U4EB 3P4MB 5JIKA 4UV7L 1A6WL 1J8HB 4IRZL 4GXVL 4QHKI 2KKQA 2GY5A 4QY8B 4XPTL 1DQDL 1U93A 1W2KT 3SE9H 2VQUA 5GRJL 3ULVH 2VZSA 3QXAA 4NP4L 3U6RB 3D9AL 4YR6B 2BY0A 3HZVA 1EO8L 5EU6D 3RY5A 3MZTA 5HYJB 4R26L 3STLB 4S1DC 3DYOA 5JXAH 1YEFH 4EI5A 3MLVL 2AP2A 2WIIB 3IVKA 3STZA 3TA3B 3CU1A 2Y36L 5IHLB 3HMXL 15C8H 4O51B 2VABA 3BPLB 1DVFD 1MAKA 1S78C 1HHHB 5KJRH 4TSBH 1A6AB 3JV5A 3DX7B 1FGVH 2HH0L 4NUGH 4PRDA 1W0YT 4OM1H 3BKMH 3L6FA 5IVXE 1CYGA 1A3LL 4R3SA 3UPRA 2EIZB 5JOPD 1G7LA 5BRZD 3MRHB 4X9IA 3AM8C 2D0FA 1T3FB 4PJGA 5T1KA 3AMLA 1T7WA 4JN2A 1A4KB 3RGVD 1IGML 1T1WB 5FO8A 1DLFL 3O3UN 4HKXB 2VKXA 3E8UL 4JZJA 5HHNA 3TBSB 1X5IA 3WL9A 4HG4K 1E0OB 1F3DJ 4ZXBA 5FKAB 2C1OB 1L7TL 4DAGL 5HHOA 5T1DH 1KCUL 1OSPL 4O4YH 4NQXA 2DM4A 2F8XC 1P4BH 4M6NL 4X6CE 5GIRA 4OLXL 2GSIB 1N8ZA 4PJFA 3VG9C 4FZEH 5HGDB 4OI7A 1RK1A 3VXRB 5JDJA 2AK1L 2PCPB 4NDMB 1EBPA 1NGQL 2AV7A 3TM6A 4LRNH 1MY7A 1UM5H 1QHOA 4Y2DD 1I3UA 4E41D 4ZQKA 3FO1A 4LRIC 4MA8L 3WN5C 4OD2B 4Y4KA 3BISA 1F4WH 2IPKA 5JA8B 1X5ZA 3MRJB 5GZNC 4G9DA 4MXWL 3CVHA 3A67H 3HR5B 3QJHA 5CCKH 4PRID 5DJDA 4GBXD 3REVB 2R0LH 5K59E 4PJ7A 1KT2B 5FDYA 3T0BA 3EYOB 4M62L 4GS7B 3MACH 4HWBH 2EC8A 3P9LA 5DMGC 3O6FB 4AL8L 1ZLVK 1OAQL 4G80B 4GG8A 4RISH 2HN7A 1MCNA 5EULV 3D3VD 2J8UE 3FRUA 2GUOB 1CT8A 4PTTB 1A1OB 3OJVC 4QEGA 5EFIB 3NABH 3HKFA 4WRLA 4U49A 2OZ4A 5CWSA 4WWKD 2AXGB 2DL9A 4ZYKA 3GO1H 1B0RA 4ORGB 1T7XA 5IR1B 1KGCD 1HEZA 2UVFA 2YPLA 5DVMA 4B53A 1YJDH 4PJ5A 1MCOL 5F9OL 3EUUA 2R23A 4P2RA 2B39A 4UV4H 5CJXA 4HGWA 2YD6A 3I2CH 3MSPA 4TVPH 3QA3B 2CJUH 1VSCA 5IKCA 4NGHH 1CXKA 4RZCB 1AD9B 2KH2B 1A5FH 3WKMH 1ZT4A 3SDXE 2LTQB 5GS1B 3PL6D 4FXGA 3ZT5A 4LEOA 1ONQA 1EVUA 3O11A 4DUVA 4X7CC 4X8JB 4CN1A 2CLVB 5CUSL 3QDMA 3VJ6A 1IM3A 2I9LA 4TULL 1DEEA 4MNHB 4HSQA 5BQ7A 1NUFA 4K9EL 4ELMB 3LZFH 5TDPB 1I3RB 2R2HB 2BCKA 1NFDF 3OAZK 2ADFL 4Y7MA 4QXGH 1IGTB 2P42B 1UG9A 3RI5F 3UTSA 3GRWH 1ZVSB 1LO2L 1X5HA 2EECA 4JRXB 1D5BA 4ERSH 2ZWLT 5DRZB 3CXHK 1AQDB 4J4PD 4KROD 5C6PB 1QSEE 2ZOLA 3NIFE 2I60L 2HWZH 4GAGH 1VHPA 5AZEH 4CL7A 5E9DD 4NYLB 4P2QE 2Y72A 3BGAA 5BMFH 5FK9A 3RVXD 3AM8A 4RCAA 4Q9RL 2V6HA 1YMHB 1I9RL 5J1AB 4RAUB 4XVJH 1DBKL 4R4FH 4JCLA 1T6WA 3KPMA 4J6RL 2EKSB 2FIKB 1E6OH 2IQ9H 4BSVA 3EZ8A 4JPVL 4O2FA 3O45B 5FYKH 3BP7B 2B5IC 4BFEA 4EVNA 2VAAB 2ICCA 3Q6FA 1HHJA 1R5IA 1A7RH 4R7DA 3F58L 1ODAA 2QQLH 4Y19D 1UXWB 3VFPB 2EXWD 1IEBB 4KKCD 4L8SB 3WFEL 4U6YB 4FG6C 5C7XL 3MV7A 1PSKH 2JB6B 3IDGB 4NQUA 4BSWB 3IKCA 2WAHA 1YEEL 3GBNL 4LRIA 4CVXA 3U0WH 2ATKB 5GGVY 4LCYB 3WN5A 3WUWA 1NDMA 1NEUA 1E6JH 4BFGA 2DM7A 1ZA6B 2YHGA 4HUVB 2YEZB 3FN0L 1QSZA 5GGVH 4OLWH 3LQAH 3O6LH 1T2QL 1EJOH 5L9DH 5IMKB 1RHHA 2VR9A 4WFFD 3VGEA 1FFNA 5HHPA 1K2DB 3MJ7B 1G9NL 3TC9A 1M1SA 1JF1A 2E9JA 3NFSL 4DGYL 2J8HA 3BP4B 2VH5H 4YXKH 5BS0E 2DI7A 3FZUD 4WHYG 3VCLA 5E00B 5CP3A 5GRYA 4QOKB 1LWRA 1Q9OA 3O2DA 1K5NA 4L4VA 5FB8B 1U8KA 4FQJH 4Z7VB 3WFDL 1NBVH 4PY7B 1B90A 3NH7L 5E2WL 3MGOB 3VXQA 1S5HB 3FB5A 1HINL 3FT4A 5HVHC 3ALWA 1EO7A 3PGFL 4YUEH 4I2XA 4J8RA 1MHHB 4HBCL 4YE4H 4OCWH 4NNXB 4PGDB 2VNCA 2CDFB 2FX9L 3AXLB 5D72H 3JWDC 3BHBA 4YDKH 2BSSB 2VLRD 4D0DB 1NUDA 2PXYC 3D2UD 4MJIB 2ICWA 3CGTA 2NY6C 2XQYG 3MLYL 4JVWA 3MRMB 4Y4FC 2VO5A 1SYVB 4PTUA 4XMKH 3O81A 2YSSB 1OT1A 3MRIA 4KKBC 4QRUB 2DQJH 4U6HB 3LKNB 4PJDA 4X6CA 1NGPH 4L4TE 4OFKA 1Q9KB 1HQRA 4Z7QF 5EOCJ 3ZZ1A 2HJFB 5J3HC 3B9VA 4EDWL 5TJWK 1N6QH 5JMRA 4I18B 3SKOB 3H7LA 4XP9L 1GCFA 3NCJL 4HWEH 1GGCH 3QQ4B 3EO1B 1QFWM 4Z76A 3LIZH 4QXTB 3VWJB 1F8TH 3L7EA 2F58L 4TRPH 4BYHA 3D0VB 1VFUA 1UJ3B 2B2XL 5HD8C 3ARGC 3B2VH 4JFQB 1HI6B 3UYOD 2GQHA 3CK0H 3V52H 1BX2A 3SDCC 4L4JA 4B0MM 4D8PB 3F7RA 4OIIL 4GW1A 5EO9A 4ZTOH 4OLVL 4L5FL 4TSCH 4X0KB 1EO5A 1YN6B 1GOGA 4QRRE 3MOAH 2OMBA 1N7ML 1ITCA 1AQKH 3RWEA 4PJXA 1CD9B 3QWRD 1RJYA 3WFZA 1IGJA 1FC2D 4WW2C 12E8H 3RVWD 5ESVB 3A0OA 1BVLA 3VXRD 2OR9L 4FRWA 2AKRA 2M8XA 3ZTJG 1ZGLB 1CIDA 1LP9A 1BJ1H 1ZLVH 3EDKA 4P57B 4KV5F 4OQ1A 1MHPL 1YC7A 4PB9L 4MJ6A 4ZPTA 3G6AA 2R8SL 1OTUD 4HBQA 3ME0A 1JI1A 3L1OH 3T65A 1BQHB 4J23A 5KS9B 1S9VA 1LO4L 4LU5L 4YBLC 4R6UA 4UDUB 2DLFH 4LGPB 1B9ZA 4NQCE 3NAAL 3CVHL 4YO0B 2DF3A 3O6ML 1G1CA 1DUYA 2X4UB 1FL5A 3F62A 3GIVA 4H20L 4E0RA 3C8DA 4I9WD 3LKQA 4U1MA 2R9HD 1UFUA 4KHTH 5AYQA 1XF4A 3O8XC 1KCVL 2D31B 3OPZH 4DKEH 5J6GA 3DRTB 4I0CC 1HYSC 2O61B 2OI9C 2CIIA 1EMTH 3ES6A 3CSYA 3DUHA 4WUUA 4Y2OA 3JTTB 4M6MH 4GRWE 4M5ZL 1QSEA 1U95A 3IJHB 3MJ9H 2JCCE 3RKDC 3GBMH 3F7PC 5DRXB 1OTTC 1V7ML 5C0AB 4FXLA 1A6VL 2PXYA 2X41A 3GMRB 3GZKA 2DQUH 2WSKA 3W5NA 3KPRB 5FYJH 4Y4FA 5DJ8B 3KR3L 4X80L 2AK4B 3MRQB 1MQKL 4Y8AA 3VFOB 3OAZH 4FQIH 1NSNL 2YZ8A 1JGDB 2X1QA 3AUVA 4K3EH 3CAFA 3DGCR 3TJHC 2DLEA 3ZLQC 4ZAKC 3OKNB 2ZUQC 3HC4H 2CLZB 2WP3O 5CEYB 4JFXA 3FB7A 3V7AG 5BO1H 1KJ3L 4ZTPH 1MRCH 2BY3A 1NUNB 4FQLH 3MLXH 5DGRA 4DN4H 3UROR 3V8CA 2XNAA 2ZP0T 5FM4A 3M45A 4KU1A 4MD0A 5D71H 4R0LC 2HFEA 2O5ZL 3TJEH 1MFAH 4P3DB 4XNUL 4JRXD 2YR3A 4XCYA 2BC4A 2DWDA 2MHAA 3QHFH 2Z8RA 4HMDA 3LRSA 3ARGA 2G75B 1MVFA 4P2OB 5C6TH 5ID1A 3QXDA 5F3BA 1MOEA 1F4AA 2YOCA 3L3JA 5IIEA 3SDCA 4CRPA 5MENE 4K3JH 4UTBL 2B1AL 3SPVA 5DWUH 4XHJC 4FOMA 1W0VB 1MCJA 3SGJC 1A9EA 3RVTD 1FPTL 1IEAA 3I75B 5SX4I 4W4OC 2OLDA 3JTSA 4DTGH 1J5OL 3KPSE 1C5BH 3SY0A 1D9KD 3DX8A 4M61B 5JW3H 5CHNB 2IFFL 5ADOL 1RMFH 5CJQL 1T0MA 3BYTA 3G6JA 3RA7H 3W9DB 3UAJD 4U31A 1FQ9C 5SWSB 2GFBA 4XC1H 2DWEB 4LF3B 3JUZA 3ARUA 1M05B 5HTSA 3LHPL 2BSRB 3WIFA 3BH9A 1BIIA 1NEZB 5T1MB 3LKOA 3RWJA 1O7SA 3HG1A 4PJ7F 1QR1B 4UU9B 3KLAA 2FJFB 4YEFA 2HP4A 4NKDB 4YC2B 1XF5B 3HAEG 1EXUB 2NYYD 2CDGA 3VD3A 3TBYB 1MJUL 3DUUB 4JVPA 1DN0A 1IAKA 2EYSA 3BXNB 1T1ZB 3PWUB 4FXKA 5EU5A 3X14B 4DW2L 1L9NA 4ZDHA 2PO6B 2P5WA 4BQ9A 3MODL 5EORL 5F9JA 4HK0A 4Z0XA 1LE9B 1ZANL 2DBLL 4JFFB 5IHUH 1AKJA 2WW8A 3DSNA 1QLFA 3O8XA 4QOKD 5D1ZB 3VRLE 1S7UA 1U58B 2VSDA 1F90L 3BUTA 3O2DL 1HE7A 4CMMA 1OAKH 3DBXA 1NFDB 2AJSL 4Z78A 4LSDA 5K9QG 4NC1E 4ZFOA 3U2SB 4MS8C 5A2FA 2GYSA 1UB6A 4WFHD 4K8RD 1NC2B 1MIMH 2Q20A 2JJWA 1C7SA 3GSNA 3RZCB 5J89A 1CDYA 4U1SB 1FYTA 2HRPH 4ZD3H 1XCQB 5HYFA 4CMHC 1TMCB 3UJTH 5EA0L 3RL1B 1KIQA 3HC3L 2GW5A 5F88A 1N6VA 1CFQB 3VE0A 3HI5H 3H42H 1K8DA 3HLAB 4K2UH 5C07E 1QRND 3A6BL 3QI9B 5D7JC 4JFED 3FHQA 2ZUXA 2NY1B 1VACB 3R1GL 1MI5B 4I0PB 1MCBA 3QFDB 2B0SH 5DK0A 1A7BA 4C56B 4OCNC 4FQ1L 3AS1A 4ZAKA 1A9BB 4LMQI 1BGXL 3T3ME 2IWGA 3ZKND 3HCVA 4N0UB 4CNIA 3QG7L 5EC1B 5IV2A 4RDQG 3MCG1 3QZWG 3CVIH 5F7DB 1LVEA 3GM0A 5EO0A 4PJCE 5DHYB 3DX6B 4K23H 3FO2B 1YNLL 3RIAF 5D96B 4R96A 4JDTH 3HB3D 3VD7A 3K80A 1MFDH 3BFOA 4RAVA 4LCWD 4RMWA 3WS6C 4R0LA 3DIFA 2BDNL 1CGTA 3VU2A 4G8GD 5IB2B 3QWOA 5CGMA 2VDLH 3NA9H 2DD8L 4UT6H 1YN7B 4FP8L 1RZKC 2IGFL 2VXUH 1G7PB 1NDGB 3PNWB 2ENSA 5E5MB 4BSJA 1MJ7L 3KYMA 3SDDC 6CGTA 5DVNA 4G8EA 3CFKA 3RGHA 5C0DB 3Q48A 3QXTA 3SGJA 3OR7A 1C8PA 1BBDL 1TQBB 4K94C 1MF2H 4W4OA 5F7EH 1JK8A 1SYSA 4U1JB 5D2NA 5T33H 5DD5L 3ARDC 3CX5J 3D0LA 3FQWA 3U79A 3FTGA 5IVZB 4ZNEE 3V7AE 5KSVA 2IBZX 3P3YA 3S37H 3ZE2E 4WENB 3LS4L 1TZGH 5F1NA 5E6ZA 2FR4B 3F6IA 4JFHD 1G84A 2Y6SD 3T77B 1FNFA 1FAIL 3IJSA 1JPFB 5GRVL 4G3YL 1CDHA 4YBHA 1H15A 2CRZA 4J3WA 2D7MA 3WIHH 4PJAA 1A6UL 4PRHE 1A4JB 4YQXL 3MRDA 3TBVB 4ODBD 1FFQA 3EAKA 3MV9A 3NZ8A 4X4MA 1MELA 5I30L 2CRYA 5JUEH 1A6PA 3VWKC 2L7UA 3B6SB 4KTEH 5DUBB 4W68A 5E8DH 2X5PA 3PP4L 3D39D 4JHBA 4NM4L 2OTWB 3N1PC 5D7IA 4HKZB 3ZYIA 4KJPD 3F65A 1KCSH 3OKOB 2JIXB 5HDQH 2P5ED 3ALPA 3JZ7A 3FFCB 2DKSA 3S88H 4LVHB 4CVUA 3SKMB 5E5UB 1T03L 3ZT7A 4P59H 3OF6A 4NZTL 1IEHA 3OX8A 4HJJH 5D9SA 3OQ3B 5BZDB 2VZTA 5HY9B 3GJFA 5TE6L 4Y16B 4JO3H 3FKUS 4QHUB 2IADB 1D5ZB 1A3QA 1INQA 1LEGB 4Z95L 2YUVA 2Y7QB 2AEIT 4ODTH 1JCKA 5SWQA 5ID0B 3RVVC 1ULVA 3SGKC 1JWSB 4U1NB 4L1HA 3LKSB 3IDJA 2VL5A 5JQ6L 2Z8VC 2PTTB 5FHAL 2BFVH 1KN2L 2A9NL 4XC3H 4JY6B 3GK8H 4X4YB 4XH2B 5EU3B 5FCUL 1QRNE 5E8EA 4WI7A 2RFXB 4U1IB 3FQRA 4JFEE 3EGSA 4R2GD 2A6KB 2Q87A 4IOFD 3Q5YA 1CICC 4ZFFB 1NJ9B 4POUB 4KH2A 3VXOB 3KPLA 4C83A 1A6TA 5KN5A 1LQSR 1U8NB 3FQTA 4CDHA 1LE5A 5T3ZL 2W65B 3EYSH 3S36X 4WO4B 3GSRA 4JDVB 5KVGL 3WLBA 1ZVHA 5ISZB 3NGBB 1WC7B 2W91A 3B9DA 4KDTC 1YMMD 3WS6A 5JW4Q 2YD5A 4EXPX 4POYA 5IK3A 1QSFA 3GMLB 1ZA3B 3WV0A 1EEZA 4IDJL 3UBXB 5J11C 1X9QA 3ULUH 1P7KA 1ORQB 1XZ0A 3L5WB 4AYFA 4G9FB 2APBA 3P4OA 3SDDA 2ATPB 5CS7A 4HEME 4OFYD 3QDJD 3QUZD 2KQMA 3TT1H 4U0QB 2P7TB 5EZJA 1T80A 2D03L 2XN9D 3ROOA 5I15L 5I1KH 4QHMA 3HPLB 2QHLA 5IB5A 3SDAD 1NAMA 2H26B 1S7RB 4K7PX 1QYGH 3MA7B 1JMZA 3O0RL 4WFGD 3C2AL 5I76B 4HWNA 4U7KA 3MLZL 5AUMB 1HDMB 2P48B 4L9LB 5GGTH 4U1LA 1LP9F 4LOUD 2J88H 4KJYB 4BH8A 1LO5B 4HT1L 1A0QH 2MPAL 4WTZA 3EFFB 1ETZA 1DE4B 4GRMB 1DBAH 5EH1A 2EYRA 2Z4QB 2EDWA 4NWTL 4CVZA 1MAML 2NY3B 4JFHE 1U8QB 3B2UC 1JV5A 4Y4HA 3BP6A 4HIEA 5I1GL 4WHTA 1RZGA 2CK0H 3GNML 2A9ML 1FG2A 4GQ9H 1U93B 4O02H 2V9QA 4AEFA 3VWKA 2G9HA 4ZS6C 1F4XH 2Y07H 4MCYB 1JNJA 1T6VN 4UV7H 1A6WH 2ITDB 5FUCE 2KUTA 3VGAB 4GXVH 5BZWB 5KANI 4XWOD 1EDQA 2XXMB 3BH8B 5I1DA 1DQDH 1MH5B 3I50L 2DQFB 1IE5A 4MSWA 2E9WA 1OAZH 5GRJH 5L8JB 4NP4H 4PJCA 4JFFD 3D9AH 1CZ8H 2P8LA 3Q1SL 2CO7B 4GKZB 3DV4B 3L5IA 4MNGA 2P49B 4R26H 4C54A 1B4JL 1GC1C 5DVLA 3I9GH 1G7LB 2Y36H 5DRNA 3HMXH 2WBKA 1EHXA 5H35A 5DURD 2AJYL 5T5FL 3SGKA 3WMSA 1FZMB 4ZFOL 2HH0H 3I6GA 1C08A 4J3VA 4ZO9A 1RIUL 1A3LH 4G7YH 2JJTC 3LS5H 1OGAE 1RUQL 4NN7B 1T5WB 5DFVC 4NQXB 5GIRB 1IGMH 3GI9L 1DLFH 1AC6A 1VB9A 1N8ZB 1TPXC 2Y23A 5F71A 4N90D 4XCNA 3E8UH 2JJVA 3MV8D 3QI9D 3UTTA 2AV7B 1CICA 3BWUC 1CFVL 3QHTC 1HWHB 4HUUB 4KZEL 1L7TH 4I0PD 4DAGH 4M6NH 4PRPD 4PG9B 3WYRA 1ZK9A 2VN7A 2XACC 3PWVA 2IPKB 2AK1H 4NO2A 3C9NB 1NGQH 3BUYB 2ADIA 3RPIA 3W0WE 3WNNA 3QULB 3QJHB 1FCCA 5DJDB 5B38G 4KDTA 3C8KB 3QEQB 1X3DA 4MA8H 1YMME 5C0GA 3VFGL 3VXSA 1NC4A 4P5TB 5EIQA 3OJMB 2EH8L 1IQWH 4LK4A 4XPAL 4KVNL 5SX4H 4GG8B 1GJIA 4MXWH 4L29B 2XPGB 1JNNL 3MREB 3CMOL 3OZ9L 4GLRI 3FRUB 5ELIA 2EE9A 5DD0L 3IS1X 5FKPB 1H5BC 3LN4A 5IB4B 4HUMB 4WWID 2F5AH 4M62H 3QDJE 1QSVA 5EPMB 4HS6A 4AL8H 5CWSB 4OQTL 3VXME 1CFNB 1B0RB 4KK8C 3G6JF 4DGVL 1HEZB 3UPCA 3TN0D 1ADQL 2XT1B 4F57L 2YPLB 3RHWF 3BPOB 4PJ5B 4P2RB 1LEKB 4RGOH 1KSRA 4GMSL 3T2NL 5JHDE 2V7NA 5B4MD 2BNQE 2PF6A 3QEUB 4OUUA 2IALA 2I5YL 1JIBA 4AG4L 2D7TL 3O3EB 1MCOH 1U9KA 3FB6B 5F9OH 5B8CC 5EU7E 3HE6C 2J6EA 1C12A 3ULVD 3HAEA 1BOGA 1FRGH 2APFA 2QR0A 2R4SH 3PABB 1UM4L 4HQQH 5ICYB 1E4KA 3VFSB 3DYPA 1SM3L 3ZKSD 3MMEB 4RX4A 4LFHD 5BQ7B 1RZIA 1V3LA 3GMOB 3ZDXF 1OY3B 1QFHA 2D0GA 4F9LC 3WKNA 5CUSH 1HH9A 4TULH 3V0VB 4MDIA 1IQDB 4Q9QH 4DEPC 1HZHL 4K9EH 3BZ4A 4KK9C 1CTNA 3E6HA 1PX4A 2JIXD 5HGHB 3IKKA 4OI8A 4GW4B 3D5OF 2R2BA 1WZLA 3MRCA 2BVYA 2GY7B 3RX5A 4Y16D 1JUFB 1FYHB 25C8L 2F53D 4FQ2L 4NFCA 2ESVB 1OF2B 2DQIL 1P2CA 5FM8A 2I60H 4YGAB 2JJTA 2WQ8A 5CJBA 4BSVB 4YHIA 3OKEA 1I85C 1TJHL 3EHBC 4Q9RH 4R7DB 3HUJA 1I9RH 4M1GL 3T1FA 1UWEL 1T20B 1DBKH 4QO1A 4J6RH 2RB8A 5JIIA 2QQQA 3TNMA 5C0NC 4JPVH 1XGYH 2A6DA 4P99A 3NVQA 1X4XA 3MV7B 3IKCB 1DBBL 4CVXB 3F58H 2HJLB 1TCMA 3QG6A 3ULUF 4D0CA 5T3XD 1DDHB 1E27A 3B5GA 1RZJL 3QZWA 2VDQL 4AIOA 3TFKC 3HZYB 1IL1B 1BD2A 3STBA 3MNVA 2NTFA 1K4DA 1TQCB 4R4BA 3B9AA 3KS0J 1YEEH 3GBNH 1QFPA 1RHHB 1OW0C 3DXAB 3VW3L 3O6KH 4NHCL 2VISA 4G42A 5AAWA 5GS0H 2YD1A 1WVZA 3SJVD 1JF1B 4OCXH 1OP3K 4BM7A 5IFJB 5EZLB 4HPYL 4Z7WF 1P84K 1CG9B 1AO7E 1T2QH 2FJHB 3QIUA 4M7JL 3S9DB 1H5BA 4NJ9L 4EIGB 4L4VB 1K5NB 2HFGL 1G9NH 5E8PA 4QHNA 3E6FA 4H1LG 2Z8WC 5I1HL 1D5MA 2XKNA 3TESA 2A0LC 4NNPL 1MVUA 4U3HA 4PJ9D 3FB5B 4BZ2L 4APQD 5F7HA 1F6AB 3HRPA 3FT4B 4JQIL 1NAML 4K94L 5DJYB 3WFDH 3VMNA 4J8RB 3W11C 2DTSA 3E3QE 4WEBL 4YHZL 3UTZA 4LEXL 2ZSVA 3C08H 5E2WH 4BK5A 4JM2D 1YECL 1WBYA 2VC2L 1HINH 1D5XA 3P4LA 5B8CA 2NXZC 3PGFH 1KC5L 2VLME 4ISVA 3MRGB 2FX9H 3HE6A 3ARQA 1OGAA 3IDXL 5C08E 5D2LE 1JNLL 1A2YB 5C0RL 3D1MC 4IM8A 2BVOA 1HQRB 4R9HA 5KSAB 4Y88A 5D7IF 4PY8I 4WJ5A 5TDNA 4NOFA 4EOWH 2RHEA 2ARJA 5MP6H 3WO4B 4F9LA 4CJ1A 3ZYJA 2H8PB 3VFTA 4Z76B 2CH8A 5CD5C 4Q2ZA 4EDWH 2LV4A 4PLOB 3L7EB 5EN2A 1GAFH 4OZHF 1K8IA 4KJWC 3D85D 1B6DA 3GMMA 3NCJH 5FECB 1X5KA 2QQNL 1TVHA 2A83B 1C16B 2VXTL 2X89A 5HHXH 4KMQA 2JK5A 1G7MA 2F58H 3SE8L 4HS3A 2AI0H 4MAUL 1ZGLP 1OLLA 5EO9B 5JO5B 2LFGA 1PJ9A 4Z7UA 3X13B 2B2XH 4DUXA 4ZG1A 1S9WA 2B5IB 2X1WL 4PRBA 5C09B 3T4AA 1ZEAH 1I85A 5JNYA 1T66D 2HFFB 3CLEL 1BLNA 1G9MC 1XH3A 1I7TA 3R06A 5L2JA 5ITFB 4OIIH 5FYLE 4UUJA 5SWZB 4OLVH 4P4KD 1OAUL 1KNOA 1J9CT 3LN5A 1KPRB 2APVA 1DP0A 2VLKE 4AM0A 1N7MH 1BFVL 1RZ7L 1VEPA 1LP9B 4WNQA 1VEMA 3L3HA 3LDBB 4TTDC 5T3XE 2FNBA 5J56B 4P46D 4MJ6B 1FDLL 2Z9TA 5D7LB 3VFUB 3T3PE 1CFSA 3BIKA 3DMMD 3QFJB 2Q76B 3PDGA 2OR9H 5LBSL 1HQ4B 4E42A 2BNRB 1JWMA 4X5XB 1MHPH 5A3IC 5EBLA 4PB9H 2FWOB 1F4YL 1QVOA 2R8SH 2ICES 3SJVE 3VFVA 5J06A 2MQ0A 3VXUD 1RPQA 1GGBL 4IMLA 4X4XB 1FL3A 4RFEA 1LO4H 4E0RB 3QDGB 1TFHA 1R3HB 2CQVA 4NM8L 4PGCB 3O6MH 3J8F7 1FLTX 5J6GB 5DEZA 4G7VL 4AEIL 2C4FT 1MCQA 3PWPD 1DBJL 1FNGA 4Q0XL 4H20H 3ZDYE 3ES6B 4XNZB 4WUUB 3ETBF 4QGTA 3BZEB 4UB0L 5F96L 1U95B 1EUUA 2Y06L 2C3HA 2J4WL 2Q86B 1KCVH 2HAZA 5JW4M 4HLZG 5EDXA 4FFWC 4QT5B 5FGSA 1JWUB 2P4AB 3CUPA 4PJIF 3DROB 3WFCL 3TVMB 4JHWL 3MRBB 3CXDL 2EO9A 1KB5H 4M5ZH 4YDJA 3TT3L 3TWCL 3LH2L 4K3DH 5C1MB 5ACZA 3F7VB 1DSFL 1RZ8B 1V7MH 4YNYB 5E99L 1WAAF 2H32A 3RGVC 1LO3L 3C8HA 5DFWH 4KUZL 4D9RE 5C6WH 3K1KC 3VI4E 1M7DB 1NMCB 5DYOA 2J6EL 4GKOA 3DX9B 4L3EE 3IDMA 4JFXB 1NSNH 1REIA 1MHCA 1P6FA 4ZFGH 2ZKHH 1E4XL 1IAIL 3T08A 1FE8L 3L3OB 4ZUTA 2XNAB 1MCPL 2FH6A 3WHXA 4MD0B 4MMXC 4Y2DC 2BJMH 3UZVB 5KW9L 3L5HA 3T0XA 1IC5L 4KY1H 3IF1B 1WCBB 1PBYA 1JZ7A 2CUMA 3LAFA 3TO2A 3GKWL 2BC4B 5MHSD 4PJEF 3LRSB 3M17B 3V7MA 1CXLA 4JZNB 5F3BB 3V0WH 4HZAA 4GBXC 4JO4H 5IIEB 5EIIA 4DVRH 2DQTL 5HVFB 1QHPA 3CH1A 4DWHA 4XNUH 2CLRA 2OL3A 2ZUUA 2ESVD 4NN5B 2Q8BL 3KWWA 4EBQL 5LGHL 3KLDA 5I73C 1IEAB 3KNBA 1N6UA 5E7BA 4Y5YC 4IJ3B 1RJLA 4YHKL 4KK6D 5GHWL 4NQDB 2A6IB 3MUZ1 4UTBH 2B1AH 1T0MB 3G6JB 4KQ4L 3BWAB 1FZKB 1S7TA 1FPTH 3BJLA 3NCBB 4NOBA 4WWKC 3FO9A 1AGBA 4I8DA 1J5OH 3MFFA 1H3XA 1OP3H 2X70A 3WIFB 1I1FB 3BH9B 2IFFH 1BIIB 4GKSA 5CJQH 2HG5A 3KJ6H 1D5IH 2YUZA 1I9JL 4GLRH 3IDNB 4OGAC 4YPGA 5EOTB 2SEBA 5KAQF 4IRSD 3P4NA 5HGAA 5IT2H 1R3LA 5B38A 3LHPH 1FVCB 2Y4SA 5C08A 1NBYB 5D2LA 4OFDA 5F1IA 4YBLB 4D94A 1Q9WB 1DN0B 4X7TA 8FABA 3DXAD 3PJSA 4FXKB 3PL6C 3R0NA 3ILQD 5EU5B 1JF6A 3CZFA 3ZYOA 2P5WB 3BIBX 4MX7B 3EYQD 4KI5F 5F9JB 3ZYZA 3BPNB 4ONOA 4Z0XB 4EI6A 1TJIL 2V2XA 3GKZA 1AKJB 1MJUH 2E3VA 3EJYD 3EOBA 5HGBB 5FM5M 1FVDA 3NFNA 1S7UB 5E6IB 3PWPE 4DW2H 2CKBL 2R0ZH 5EORH 3C09B 5EU6A 3O2WL 3R0MA 1P4LB 3ARBD 1UB6B 4HUNB 4NQED 4XNXL 1INEL 5LGJA 1F90H 2VOTA 3O2DH 4KUCD 1FYTB 2AJSH 1NCNA 3WFHA 4KROC 3GSUA 4HIIB 5J8OA 3WS3A 3I6LD 5IEKA 2NY4B 2P8PA 3L3IB 5JOFA 4YHOL 4HC1A 3RVXC 4LVNC 1GOHA 3IU4L 1H8OA 2X4TA 3RGVA 2IH1A 1M6OA 5EA0H 5TGBA 3HC3H 1LILA 4F8TA 5DK0B 1BMGA 1ES0A 2XWTA 4TSAL 3MO1B 3O3BA 2ZUQB 2APXA 4L8CA 3K4AA 3A6BH 4N0YL 1CGUA 1OARL 3R1GH 4NZDA 1KYOJ 2EZ0D 5EO0B 5TF0A 3HC0A 2EXWC 4FQXB 5DEGA 2QSQA 4FQ1H 3MXWL 3U83A 2GJ6B 1BGXH 4Z7NF 5EOQL 4Y2DA 3QG7H 4R0LB 2HLFD 4NO3A 3QWOB 2VLJB 1B6UA 5HYJE 1NCUA 5IP4A 2IANB 5LXGL 3GJEB 1YNLH 2MNUA 1LEIB 1ND0A 3FOLA 4PRIA 1WZMA 2BDNH 4GBXA 1T21A 5JMOC 3O3DA 4Z7WB 2DD8H 2XY1A 1VFBB 4G6MH 2IGFH 2YS4A 2YPVH 4U6XB 5KZCD 5EO1A 3CNKA 3QO1A 3MC0A 1SYSB 4Y5YA 5D2NB 3D3VA 4NC0B 4XNMB 1BQSA 4MD5A 1UXSA 3I84A 1U0QA 3M1BB 1HSBA 2YWYA 3S96A 1RZFL 2CPCA 3ULSA 4HF5L 2H3NA 3LPGA 3FQWB 1BBDH 3PWNA 4FQHB 3FTGB 4FNLH 4HCRA 4WWKA 2BVQB 1JNHA 2Q6WB 3QDHA 2X42A 5F1NB 5DD5H 3L7FA 1QLRA 4NKIL 3MX0A 3IJSB 3QUMH 5T1LB 4GO6B 4D3CL 5JR1L 4YDVA 4WI3A 2F9BT 3BKYL 4UTAL 1MFBH 1MFCH 4HFUH 3LS4H 5I74B 5I1LA 4RNRA 3EYUL 1FAIH 4I48A 1JHLH 4OZGB 4G3YH 1TZIA 3I3EA 2AABH 3PL6A 5AYUL 4F58H 1G7JA 1A6UH 5I17B 1UYWH 4OCYL 4YQXH 4NUJA 3CDYA 4L3EA 4I5BA 4TVSa 5D7IB 4LAJH 5DD1H 1WT5C 5ESQA 4CJ0A 5I2IB 4R90L 1FVEA 4MA7L 1OAYL 4H1LA 3X3GL 3PP4H 1XGUB 5CKAA 1UT9A 2DOCA 4WTXA 5FA4A 4OAWA 4QRPD 5IB1A 1INQB 1N0LA 4JY4B 5SWQB 3VFWB 4OZHB 5EUOF 4UDTA 1NGWB 1T03H 1T2XA 2VL5B 3TA3C 1XR9A 2K3TA 1RUKH 3PWLB 5F6HJ 5TE6H 3RUGF 2P24B 3DOSA 4WV1B 2R2EA 2P8MA 3DLQR 4N68A 4QRSA 4Z95H 3REWB 1MPAL 2C5DC 3CFEB 4DVBA 3WEXA 1J11A 1ZHBA 4HZLA 2I26N 3QSKB 5AD0A 1GPOL 3QO0A 5FHAH 1KN2H 1YDPB 2A9NH 2WWMC 2EYTA 1RJZB 2AQ3A 3KPLB 3AMKA 1A6TB 4X6DA 5DS8A 5MEOB 5FCUH 5AAMA 4Y19A 2FYYA 1L7IL 3GSRB 3OKLB 2KQNA 1QP1A 3GJFK 3RVWC 2XFXB 5HVGB 4NO0D 1MFNA 3ALXA 4LGRB 2FBJH 2C1PA 1FN4A 1F42A 3QRGH 3H2WA 1VA9A 1QSFB 3U36B 5DC4B 5EBGA 5IMMB 1MCLA 5KVGH 1V3JA 1J0HA 2BVTA 5E2TH 2VE6A 3NPSB 1OTUC 2XQYK 4Z7UF 1U36A 3SDDB 3V4UL 1I7ZB 1CR9H 5INDB 1ZHNA 5JIPA 1TETL 1A64A 5EZJB 1BQHG 4WU5B 4IDJH 4XAKE 5D1QD 2YC1A 4MQ7A 5IB5B 3GHEH 4A6YA 5BJTB 4GS7C 3AB0B 4HIJA 3OWEA 1OGTB 3BT2L 2OL3L 3T0EB 3MA9L 5E94B 3EJZD 1QPXA 2D03H 5I15H 4NQDD 3VD5A 4BH8B 1G9ML 1GH7A 1KJ2A 3O0RH 4OT1L 3C2AH 1N5YL 1ETZB 3NIDE 3JV0A 5F3HB 2GK0B 5GGUB 3S3JA 4JFYA 4F7CA 1S7WB 4XMLL 2GSGA 4PJIB 4Y4HB 5C9JA 4PJHF 4WHTB 2MPAH 5DZNA 1S7SB 2KPNA 3MRLA 1FG2B 2VLRA 4LSSL 5ICZA 4NWTH 3VFRB 1MAMH 3D2UA 3GMPA 1LDPL 3Q5OA 4LLDA 3ROLB 1KLGA 1WK0A 1DQLL 4GKNA 4KTDL 4W4NA 5BCAA 2A77L 5ESAA 1N4XL 2LTQC 1BZQK 3ZHKA 4R7NA 5GJTH 5GS1C 5C2UB 3GNMH 1AIFA 3U4EA 5DF0A 3P4MA 1J8HA 1JPTL 1WT5A 2YN3A 3BQUB 2BSED 4Z9KB 5L6YL 4U4BA 3VH8G 5I1CL 1U3HD 1LO0L 3I50H 5F9DC 4YR6A 3CX2A 1XGQA 4X7DC 2ZOKA 2R0KL 5H35B 4AY0A 2WUCL 4JG1L 4CUCA 4PGJA 4Z7VE 1OB1B 1EEUA 2WIIA 4P5MB 3I6GB 4ONGL 1B4JH 4PJEB 4XCFL 4NFBA 4O51A 2VERN 4W81A 1VCAA 3TH4T 2YWZA 1HHHA 2DI8A 1IAII 4YIQB 3O9WD 3DX7A 2B4CC 2AJYH 5T5FH 1TDQA 1I1YB 4PP1D 5IMLA 2EIZA 2NY4D 3BAEH 4YDLB 1RIUH 1IAOB 4XCEA 2JJSC 4LARL 1A4KA 1T1WA 4HC1L 2ARJQ 4HKXA 1XR8B 3TBSA 3OR6B 2W9EL 3B8SA 5FKAA 4Q7DA 5FYLL 3OG6B 4NO2B 1U6AL 1CFVH 4LPWA 4AQ1B 3BVNB 5D8JL 3UAJC 5DJAB 3IJYB 4G8FB 3BDBA 4RFNB 5HGDA 2VUOA 2VB5A 3VXRA 2PCPA 4NDMA 4CU8A 4L8SC 5EBMB 3PQYD 4BZ1L 5C0GB 3VXSB 2GJ6D 1NC4B 4JFDE 4XAWH 5K59F 1CCZA 2VLJD 2VQ1B 4OD2A 2FB4L 3MJGX 1NEZG 2IAND 1EK3A 3LEYH 2IAMB 3MRJA 3VFGH 3MRFA 3RWHA 2J8UF 3HR5A