1A3ZA

Reduced rusticyanin at 1.9 angstroms
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
TWKEATLPQVKAMLEKDDGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGHAATGMFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rusticyanin: Extremes in acid stability and redox potential explained by the crystal structure.
pubmed rcsb
molecule tags Electron transport
molecule keywords RUSTICYANIN
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 1998-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1a3zA00
1TEFA 1JXDA 3QJQB 3QJSB 4W9ZA 3UGEA 4A2HA 2UX6A 2TSAA 2HX7A 4HAKA 3NJJA 4YSTA 4DP9X 2GC7C 1NIEA 1SJMA 1I53A 2FT8A 1PNCA 1XMEB 1AZCA 4E9XA 4HHWA 3OMAB 3H4FA 1GY1A 3QJVB 3V9EA 2XWZA 3AZUA 3FSWA 3X1FA 4DP6X 3NJNA 3NSDA 2YAOA 4E9TA 2BHFA 4BWTA 1HFUA 2ZONA 4KO7A 2BP8B 3H56A 2JFCA 3NJKA 5I28A 4HZ1A 1MDAA 1SFHA 1NPJA 1KCWA 1JXFA 4BXVA 1GS8A 2YQBA 3PPSA 1EHKB 4DPAX 2N0MA 4YSUA 1JZFA 3T6ZA 2CALA 3JTBA 3ABGA 1GR7A 2GIMA 3FPYA 2VW6A 1ZDQA 1J9QA 2Y69B 2IDTA 2QPDB 1BXUA 1PMYA 1X9UA 1JZHA 2ZXWB 3EF4A 3OMNB 4KNUA 2XXFA 3WI9A 3GXUB 1BQ5A 3EH4B 3C75A 1L9QA 1AAJA 1AZBA 3S3DB 2ZWNA 2X88A 2XYBA 3ASOB 2YAHA 2YAFA 5AKRA 5IY5B 3GDCA 4NAJA 6PCYA 4N4YB 2PPAA 3X1EA 2H5UA 3NSCA 2BWIA 2XUWA 2IDQA 1PF3A 2DY2A 1AACA 2XXGA 1B3IA 3AY2A 3NJFA 1A8ZA 1NTDA 1SHXA 5D4HA 5EHFA 4JHVA 5D4JA 2IWEA 3HEIB 1PCSA 1PLAA 4A66A 3FSVA 2FWLB 3CZUB 3WNIA 1M9WA 2YAQA 2MRYA 1TKWA 2DWSA 1FFTB 2LLNA 1AIZA 1L9OA 4KOCA 1RZQA 5A7EA 4YSQA 1BEXA 3NJLA 5B1KA 3X2QB 1ASQA 3U25A 1MG2C 1BYOA 4PAZA 5I6KA 2HX9A 4AKQA 2HRGA 1HAWA 1MG3C 2YXVA 2UXGA 2AZUA 3TU6A 3EH5B 3S8GB 2BWDA 1PAZA 4YSRA 2JKWA 3NT0A 3FU7A 1J9RA 1NINA 2J57A 3QJTB 1OCRB 4KNSA 4BWUA 7PCYA 3DKHA 2B08A 4Q8BA 5F7BA 5TK2A 4GP4B 2BZ7A 4DP5X 3SBRA 1RZPA 3UAEA 4BXSV 3NJMA 1W8EA 1PLBA 4KO9A 3CVBA 3FQ2A 4EF3A 4AX3A 1URIA 1NICA 1VLXA 3PCYA 1OOWA 3CVCA 1CC3A 4A2GA 5B7MA 3RYMA 1NDTA 1XB3A 2CJ3A 2GBAA 3FSZA 4HCFA 4GXFA 2DWTA 1SDDA 2JXMA 3L45A 4DP4X 4QLWA 4JHUA 4NB7A 1A3ZA 2FTAA 1WA2X 1KDJA 2CAKA 4KNTA 1JXGA 4ZK8A 1WA1X 1AZRA 2EILB 1WS7A 2IDSA 1QLEB 2HXAA 3PXLA 1AS8A 3ABKB 4YSCA 1GS7A 3NP4A 4HCIA 1N68A 2IAAC 3OM3B 2VSKB 2PP7A 1GY2A 3S3CB 4YVNA 1NIDA 1AS6A 2PPFA 2YAMA 5B1JA 2GC4C 2P80A 2XU9A 9PCYA 4A2FA 1SF3A 2VW7A 5ANHA 5B1JC 3AG2B 3QQXA 1XB6A 1WA0X 3X1GA 1NIFA 2NRDA 1JERA 2R7EB 2IWKA 4WTQA 1ETJA 3CG8A 1ASPA 2XLLA 2ZOOA 5LDUA 1AG6A 4E9SA 1OCZB 2H47C 2IDFA 1BYPA 2VM4A 1ZV2A 4A2DA 4L0PB 1ILSA 1BAWA 4UANA 1W6WA 3UADA 1ZIAA 2HLEB 2Y1AA 5D4IA 1NWOA 2PPEA 4HALA 2FJSA 2H3XC 4Q89A 1A4AA 3WNJA 4HIPA 2BP0A 1F56A 2XVBA 1V10A 4BK5C 1CURA 2A3TA 2I7OA 3GYRA 4RH4A 1IC0A 3AG3B 3TBCA 1FWXA 3NP3A 2BW5A 3OMIB 5I26A 2XV3A 5E9NA 1SDDB 3D12B 2J5WA 1ASOA 1HAUA 1QNIA 1FA4A 5I5JA 2YARA 4G70B 3UABA 4F7KA 1WS8A 2FT6A 2EIJB 2OV0A 1A4BA 3ZBMA 2UXVA 1T5KA 3KW8A 3T6WA 3V9CA 1GW0A 1PZAA 3FQYA 4JKNA 5B1BB 2BO0A 2MTAA 1GSKA 2FQGA 1AZUA 1JVOA 4QKTA 1CYWA 3UAAA 2HRHA 1OCOB 2P80D 3SBPA 2X87A 3WKPA 5B7FA 2CUAA 4HCGA 4YSDA 3ZDWA 3ERXA 2BP0B 3KW7A 4G7RB 3FT0A 1J5DA 1E5ZA 2UX7A 3JT2A 2UXFA 2FQFA 3NSFA 3PLYA 5I6OA 4E9QA 4DPBX 5FC9A 2DYSB 2OCCB 2PP8A 4YVUA 1BXAA 2I7SA 2PCYA 2R7EA 2TSBA 4A67A 4G7QB 1BXVA 4N8UA 2PP9A 4X4KA 2WO2B 4AZUA 1M56B 1JOIA 3QPKA 3X1NA 3NSYA 1KGYE 2BZCA 4G72B 5B7EA 1A4CA 2Q9OA 1M57B 1KV7A 2WSDA 2CCWA 4F2EA 2W8CA 3IN2A 3FU9A 2QDVA 3OQRA 3TASA 2FQDA 1JZJA 1SNRA 1KYAA 4A68A 3CVDA 1R1CA 2J55A 3AG4B 1TEGA 1PNDA 1AS7A 2IH8A 5PAZA 1ET7A 5AFAA 2AZAA 2IWFA 1ET8A 1N70A 3ZX1A 4PCYA 5PCYA 5F7AA 1MZZA 2BP8A 2GI0A 3SBQA 4KOBA 4P5SA 2W88A 4K9JA 5AZUA 3X1BA 1MZYA 3QJUB 1IKOP 1YLBB 1PZCA 3UACA 1SF5A 3S3BB 3NJIA 1AANA 2HZHA 2FNWA 4DPCX 2AANA 4AKOA 4AKPA 1E67A 1E65A 4BDVA 3QJRB 3WKQA 3CDZB 3FYEB 3PAUA 2QPEB 1JZEA 1JZGA 4G71B 2WO3B 1V55B 1W6LA 2PLTA 4UF7C 1OE2A 4M3HA 1V54B 3NJGA 3TBBA 2J56A 2DYRB 3BQVA 4KO5A 4BWWA 5TK4A 2E86A 1NPNA 4F2FA 1NZRA 4E9VA 1NIBA 2DV6A 1L9PA 5I6NA 1SFDA 4GY4A 3EH3B 1ET5A 3N2JA 4UAHA 1BQKA 4M4RB 1AG0A 2I85A 3DTUB 3WG7B 1ZPUA 1A65A 3BVDB 3NJHA 4GP5B 3H4HA 1RCYA 4TXVB 3N55A 3S8FB 4MFHA 2IH9A 2HX8A 3T6XA 4DP2X 4A2EA 5B1AB 1IUZA 1OE3A 3ABLB 3T9WA 2XX0A 5I6PA 1J9SA 1XB8A 2EINB 1KDIA 3T6VA 2EIKB 4WKXA 1L9RA 2RACA 3PAVA 4BDVB 1KCBA 2PPCA 1IBYA 1ZIBA 1JVLA 3ZIYA 4FA7B 2VSMB 1J5CA 6PAZA 2YAEA 1DYZA 4DP1X 2CBPA 3FU7B 1AQ8A 1OV8A 5B3SB 3PAZA 3T71A 3FS9A 2VMJA 3FU8A 1NWPA 1ZDSA 1CYXA 2AVFA 1QHQA 3AG1B 4FAAB 1WAEA 2UXTA 3MX0B 1TU2A 2QDWA 1J9TA 1E30A 2Q5BA 8PAZA 3FYIB 3CDZA 1IBZA 2B3IA 2XV0A 4DP8X 3WIAA 5I5IA 3IN0A 2OJ1A 2GB2A 4NERA 2IDUA 2FQEA 3FQ1A 3MBWB 4CSPA 3FSAA 1NIAA 3ABMB 1OE1A 4E9RA 1RKRA 4YSAA 5I6MA 1KBVA 2PPDA 3EHBB 3NYKA 4CSZA 1L9TA 3FPXA 3IE9A 2VM3A 2YAPA 1KBWA 4E9WA 3TA4D 3ASNB 3DIVA 1PY0A 1GS6X 2QT6A 4YSOA 1CUOA 4KO6A 4GP8B 5I6LA 4GYBA 1AZNA 1ILUA 1PLCA 1ADWA 2PCFA 3HB3B 1AR1B 2FT7A 4AI7A 1OCCB 1DZ0A 2BW4A 3G5WA 3OD3A 1EZLA 2XX1A 2YXWA 1BQRA 4E9YA 2AFNA 2GHZA 4G7SB 1JZIA 2VW4A 3AW5A 1ID2A 1UATA 1X9RA 3IEAA 2VN3A 2XV2A 1GYCA 4YL4A 4W1TA 1L9SA 4HHGA 4ENZA 1AOZA 5I5MA 4DP7X 2EIMB 2GSMB 3SQRA 4YSSA 1E5YA 1PZBA 4YSPA 4DP0X 1SHWA 3IBOA 4P5RA 4YSEA 1OF0A 7PAZA
chains in the Genus database with same CATH superfamily
1RK1A 4PGDB 5D6CB 5HVFB 1D5RA 2Q2LA 4U3CA 1Q94B 4POZD 5F6HJ 4DZ8B 3MRHA 2TSAA 2HX7A 3O6MH 5MI0C 1AQDA 1I8MA 5FB8B 3PQYA 4KVCL 2JJSA 4C8XA 4ZMYA 4OCSH 3BN9D 2K78A 2FJFB 4IKIA 2L8AA 4JFDE 3TO2B 1RFDH 3AZUA 1FZOA 3NIDE 4NQVA 2J3SA 2QFPA 2Z0BA 3L3OA 4QXUH 4XN9A 5ESVA 5DFVD 4XMLH 3G5XA 5C92A 2K9UA 4WKZA 3LH2L 1CL7H 3P0VH 5AAWC 1HFUA 3QUXD 4GW4A 4KO7A 4TNWK 1XH3B 3WJLC 1N7MH 3DRTA 5I28A 3GRBA 5EULV 2P8PB 5MHSD 1RPQA 3F7VB 3FK3A 1F3JB 4QTFA 4X4XB 2DBLH 3FU6A 4HKBA 4IBYA 5CIPH 1OAKL 4RGND 5C6PB 1S7RA 3F01A 4P59H 3UTZB 4EUPG 3VRLE 1KULA 4CVWA 3JTBA 2X4OB 4YDJB 4JO1L 3IFPA 4JFPA 1JNNH 3SY0B 4LSVH 4PS3A 4AC4A 4IW4C 2OMWB 4Z5RB 3MYJB 5D6DA 4YHPA 2AQPA 2A5UA 4J1UB 1GOFA 1S9WB 4G5ZH 1MJJB 2PTTB 3M07A 5MI0B 4UM9D 5CEZD 5D7IE 2HWZH 4PBDA 4RGNE 2MQ0A 5K5YA 3HFFA 4N4YB 5I24A 3KZ8A 1WAPA 2EVIA 1RUMH 1SYVA 3GXDA 4XNZC 5DJDB 5C0RH 1OB0A 3MNZA 3BESR 3HUJB 1E3ZA 4BFIA 2OKMA 3TV3H 3W0WB 5D2NA 4XVJL 4ACTA 1N7ML 3IFLH 3PP4L 1LK3L 2XVLA 3PRZA 5BW7C 1AXIB 3QUKA 3DGGA 3OKMB 5DJ8B 1IQDA 1TIUA 3FONA 1E8XA 2YPLD 1HU8A 1BZOA 2CDFB 1M3JA 4LAQL 4F9LA 5GZOC 4QNPF 1OAKH 1M4KA 2DWSA 2IQAA 2FX9L 1NSNL 1J10A 2DQIH 2E75C 3BJLA 5FO8A 3G9AB 3QISA 3U25A 1F86A 3HA0A 3U4EA 4I13B 1A6PA 2E27L 1FH2A 4ZUUA 2UXGA 5T1MA 2K3TA 4J1UA 5FECB 1K4CB 3SIKA 1F90L 3NT0A 1EEQA 2YD4A 1MJJA 2HLAA 5D70L 2YGOA 3WY1A 3FQTB 2F68X 2E27H 5IWLA 3MQIA 5T1LA 1ACCA 2V5YA 1YMMB 4PRPD 1RD6A 3VRLF 1AHWA 1FSKC 3T4AA 5ITFA 1I8AA 4PRNB 3L5JA 4UWQB 2VR8A 3DSNA 1BFVH 4YPGB 2NCEA 4N1HB 2DQEL 5F3HB 3PPEA 4AX3A 5F93C 2CK2A 1T22A 2GTZB 3EADA 4XX1G 2EDFA 2Q8BL 1T21B 3FB7A 1EJ6A 3X13A 3TEUA 1Z6JT 2OS7A 2X9ZA 5B7MA 1QHPA 5CINL 5MHSE 1XB3A 4IMKA 4QJ5B 4HCFA 4UILL 1SDDA 2PWDA 4NBXB 4TQIA 4K9EC 4QLWA 4TMPA 4NB7A 1RZGA 3MXWH 4HF5L 1KDJA 5F7YC 5ACZB 5JDSA 4RRPG 4WFHE 3ILQC 3QEUA 3WTSA 1EEYA 3VWKB 3IVKA 2YIHA 2H45A 1OTSC 1KACB 3ESOA 1OAZH 3RG1C 4XN2A 2XC8A 4EN3A 5BV7L 3KE0A 1EGJL 3FTVA 2IAAC 2VSKB 4PJIB 1YNKH 1T03L 2EH8H 3B2UC 3JWNC 5IFAH 5EOTB 5TE7H 2CRIA 4WO4B 1F11B 3VGDA 3NIGF 4AIZA 2AGJL 5DS1A 4L3EA 3ZTNH 1RHHA 4R26H 3ZRFC 4AQEB 3L5WA 1JWUA 4CA4A 1NIFA 3PIQA 1TMCB 3SDXF 5JPMB 3OXRB 1UJTA 4PRAB 4AJYV 2J20A 3PL6C 4JG5A 1GVIA 2FWSA 4JK0D 4UDTB 1OLZA 1AG6A 3FU0A 4LHQB 3O45A 4OCYL 4WEBH 3P0GB 2E6PA 3VFPA 3WTUA 4I48A 1OCZB 3NACL 4QHUB 4Y1AE 5J1TC 4N5EC 4PGJA 1WFIA 1MI5A 1U8OA 5JLZB 2OTUB 3HUJF 3MXWL 5J1SC 4ZXBB 2R2HB 1BD2B 4N6RA 3KPPB 4UOW0 4XNUH 3WNNA 1LWJA 4OLYL 4Z76A 2CK0L 1E4JA 1OW0C 2ZKMX 3B6SA 1JZ6A 5JYLA 3QJZA 2BSBA 4Y4FC 1XTMA 2JMRA 3CFCH 2Y6SC 2JCCE 3SOTA 5EO9B 2JVUA 2AJUH 3GJFA 5DVOA 3VFGH 4CILA 1HESA 1PS3A 3AT8A 1AGDB 2OBGA 2X38A 5IHUH 3IJHB 4GBXC 2FT6A 5IG7A 2XQYG 4JFQA 4NP9A 3MJ7A 1KIQB 2HVKA 3PDDA 2VLRA 1UOKA 5B1BB 4GUPA 4B0MM 2D0FA 1KG0A 2ZUUA 1JVOA 2DAVA 3GLAA 4ICXA 3PGCB 3FB8B 3SBPA 2Y7QB 4BCXA 3WKPA 5E6IA 4X8XA 2X5PA 4ZT1A 1KJMA 3GMNA 3FUJA 3ZDZE 2ZOKB 2BP0B 2DLFL 2F7OA 5JOEA 3BMWA 3I6KB 3OAUH 4LQ1A 4LVNB 2A6KB 1YQ2A 5C07D 3WDHA 2HJKB 3BDXA 3LIZA 4RFNC 1I9RL 1M7DB 1VFUA 3PWJB 3IU4H 1HHJA 2DLFH 4GQQA 4DTGL 1MFMA 5DMGD 3DX6B 1AH1A 4AT6A 4Y4FB 4MZ3A 4U1KA 1E3XA 4ENEC 2QPFA 3P3YA 2R2CA 5MERA 1S7VA 3RBGA 3RWJB 1AXTL 4TNWF 4JRFA 4HJ0C 5B7EA 4JKWA 1BD2D 3SBWA 3IJ7A 3O0RL 3Q6FB 2EE2A 4QLRA 2WSDA 3LQAL 1DANT 3FBKA 4F33A 3RFRA 1R3IH 2W9LA 4PRNA 3DXAE 1ZLUH 3LN5A 1WCQA 1HZHL 3T0AA 3TASA 1R75A 4A68A 2D03L 4IIQC 1I3GH 2AK1H 3MVSA 2FB4H 1WEJH 4ATWA 2A99A 3UBXA 2BIIA 3BX7C 4YIQB 2XPYA 3NZSA 4J3VA 1Y1UA 4K3EL 2B59A 2R1YB 3VFUB 5E5LA 4XNBA 1BIIB 2ZNWA 3OKEA 1ODAA 5FK9A 1OTTD 3QO1B 1RJLA 2XKUA 2EH7H 3JZ7A 3SE9H 4DVBA 3S37X 2NTFA 5KVGH 1XF4B 4QHMA 3TIEA 1CDUA 5C0EB 2D7TH 2BDNL 5FFLA 3EOYG 2ZNXA 4TQ8A 3DROB 4MD5B 2IWGA 4ODSL 4U0RB 2E9WA 2QPEB 2Z31B 3ARBD 3KL0A 4G6JH 3SKUD 3VFRA 4KJYA 4J2QA 5EIIA 1DVQA 1VSCA 4D9QE 2YHGA 3SQBB 4I9WE 4JQIL 4DIXA 4HJ0D 1QRNE 1OAXL 3BC9A 2R8SH 5EDXA 3KLHC 1QP1A 3AB0B 4MA7H 3EGSA 1NZRA 2FD6L 1WK0A 4O2EA 3Q2LA 4I3GA 4X4ME 3VD4A 2OK0L 4N2EA 4QWWC 5E6RB 3UTQA 2EABA 5FUOL 3EO0A 3ARGA 3N2JA 4P5MA 3DJSA 4JR9L 2XVGA 4TLTA 3Q6FA 1KENH 4FFYA 1I3GL 3QO0A 4MA7L 3S35L 5GQBA 2IH1A 3WG7B 1ZV5A 2WZAA 1FH5H 4AM0B 3BRGC 4XXCC 1DBML 4OF0A 1DVUA 2X12A 1UEMA 5I6XC 1XHHA 4XNAA 1W9XA 4I9WD 1IUZA 4O2CA 2ZXDA 4IHBA 4XNQB 4APQC 1G7JA 2EDTA 2OYPA 3NIDB 1MHCA 2BSTB 3DMMD 4PRBB 1GAFH 3AQYA 1EXUA 1BMZA 3FU5A 4DQOH 2YC1A 2CBPA 1MFDL 1KXVC 5CZRA 1HX0A 3T71A 4YHZL 3HUJA 1KPUB 1Q4NX 2WWOA 3U6RB 3L7FA 4C83B 3TPUA 4ANWA 4ZO7A 5E8EA 3SYPA 4JQXA 3ZOAA 3ULUF 1PQZA 3MREA 4MQTB 2DTSA 4G3YL 2VLKB 3RPIB 1FO0H 2UUDH 2XWTA 4H26B 5IBLD 3VH8A 3HAEH 4M1GL 1GPOL 2BNRA 5K39B 1F4YL 2GFBA 3MJ8A 5EU7E 1HXYA 2EO1A 4B9PA 3PREA 4X2UA 3C60C 3QORD 5T1KD 4CSPA 3ABMB 2B4CL 5ESAB 1LHZA 3V4VA 4NFDA 3P3UA 1L9TA 2VM3A 3QUXA 2ZXBA 3EHBD 1KBWA 4M1GH 4JFOB 1YEHL 5J7CC 3ZVVA 1OPGH 4P2RD 5CCKL 4U1LB 3DV6A 4I18C 4B9YA 3FO9B 4EUPH 3A4AA 4A2MA 1UUSA 3O9WB 4JG1L 4XMPH 4U3SA 3CH1B 3V0HA 4WF7A 1MCQA 3KGSA 4JFFE 2F58L 3KJ4B 4KRNA 4D8PB 3MNVB 2YXWA 4IU3A 1OD7A 3II2A 3Q2NA 1YUHB 1MIEL 4Y4FA 1M1XB 2R4SL 2P47B 3KBFA 5HPOA 1RJYA 2BXYA 3AW5A 3PHQB 4KK8C 3L3OB 3CXDL 4AMKL 4BFJA 2NY1B 1X4ZA 4WENB 5DWPA 3EUUA 2A83A 5BUPA 1N0LB 1MIEH 4RGMB 3O4LB 2VO8A 1RHHB 2BRRL 4BA8A 1IL1A 4XPFL 1FL3B 1UACH 1T20B 1YEDB 3B5TA 3CE1A 2OA9A 2TAAA 1CDCA 4AV5A 4FEMA 4QHLA 4DP0X 4XX5A 4UV7H 1BPVA 1N64L 2YSSB 3WEOA 3FO0L 2HRLA 1JXDA 4Y2DB 2H8PA 3HG2A 1NDMB 4J3OC 4YZFF 3Q6GL 1Q72L 5KYYB 2ZSWB 2ADGB 2GI7A 5MP6L 3NJJA 5JQ6H 1PSKH 1Z9OA 4PYHA 3LKPB 4U6VH 1NIEA 2QTEA 3TN0A 2FT8A 2OZ4L 2EH8L 3FO2B 4MCZB 2P49B 3QAZC 2IMNA 1Q72H 4UT7H 3ZL1A 4QRUA 1FSKB 1ED3A 3KWTA 1EAQA 4KUCD 4U6VL 3OB8A 1UZ6E 1JPFB 2QGDA 1XR9B 5E6ZA 5EZIL 2J6EL 2YGVA 5FYJU 3TVMD 2J1ZA 1MRFL 1IIKA 4XWGL 1EDQA 4N2DA 5BQDA 5F7DA 4CVZA 1OB1B 2J6WA 3CIQA 4AJVA 3KPRE 3SDAB 2BIPA 2EADA 3KBEA 5HHXL 4ES9A 1KCSL 5AL0A 3T65A 2LV4A 2YUZA 3BPNB 3PPSA 1LO0H 2OL3A 4ZUSA 3ARBA 4RMSA 3CFDA 3JUZA 4F58H 2JE8A 2Y5QA 4OT1H 4XXWA 5AZ2H 4M1DL 2VW6A 4IRJC 4WGKA 2FX7L 2UVEA 1S3KL 1ZHNA 3RY6A 2HTKC 4ZUWB 1JYNA 5CZVL 4V1DB 3SDYL 3UJTL 5KVFL 2IH1B 2Y25A 2VDKH 2DJ4A 4BSWA 2WQ8A 4RMUA 5GRXG 3H9SA 3QXTA 3UCRA 3NFPB 1S3KH 1KPRB 2G30A 3SE4C 4Y16A 1OAYH 2Y36H 2E47A 3B83A 2YAHA 2VDNB 5HYJE 2J5LB 1FLRH 4WFEE 4G8GD 3NSCA 4PJHE 4OZFA 3QNZB 1IC7L 5IG7B 2F5AH 3QNYA 2MPAL 4IS6B 3N1GC 1KCUH 3W11D 4WWKA 4J7RA 1NJ9A 4WUKL 1S9VB 3W39B 3MRFB 1BFSA 2VAAA 1GYAA 1DQTA 2QR0B 3ETBJ 1R3LB 1FLRL 4B60A 4A66A 2W60B 2YN5A 1A66A 4ZS6D 4ZFQA 4L8DB 4CC1A 4AQ1C 2WAHA 3FT3B 3B9EA 2EDWA 4MXQD 4EIBA 4YDKH 1YPZE 3RWCB 3MKGA 4HEME 1OKEA 4P46A 4PJCB 2VXQA 3APFA 2ROYA 1RP9A 4LMQE 3W82A 1SN0A 4HFUL 2KBGA 2C9RA 2JIXB 4I89A 3QUXC 5KN5B 5FYKU 3SDYH 3M6DA 3UJTH 3TNMB 1PYWA 5AVUB 5D1ZC 3GSVB 1NINA 1ZS8A 4K5MA 1QFHA 1EPFA 2VABB 2BZ7A 2VLJE 3KLKA 1IT9H 1DZBA 3JXAA 1ZRUA 1CQYA 1L0XA 1X5KA 1ZANL 2AI0H 3UTSD 4GAGL 4F8QA 2ZKWA 3FQ2A 3X3FH 5D2LF 1NICA 1VLXA 2AMUA 4LVNC 3RWHA 1CXIA 1IAKB 2ILLA 1MCDA 3BD5A 1GYUA 1KZYA 4DSYA 4NC1E 1J88A 2YMTA 3OQ3B 5EWIL 3UDWA 3ZTJG 1TVBA 2FBOJ 2CJ3A 1GOGA 3VWJC 1O9ZA 1XF3B 1ZLSH 3WJMB 5C70A 1QWHA 5F96H 4AYMC 3OB0H 4JY5L 2N4IA 3N85L 5F89A 2A77H 2EXWC 3GBDA 4UTAA 2LAGB 3FL7A 4GKSB 4FI8A 5C07A 2EUVA 4XP4L 4LEBA 2Y06L 4JB9H 5IVOA 1RH8A 3CPLA 3HE6A 4ZK8A 4IGBD 4H20L 3NK4A 4KQ4L 4E41B 3WUWG 1SJHB 2KQNA 5C97A 3LNFA 2W38A 2ZUQC 3TZVC 1FL5B 2XZAL 5IJVB 2RALA 3FQNA 3WJLA 4BFGA 3IXAA 4ZJ9A 2FSEB 5GGVH 1J1XL 1FL6A 5D6CA 3NAAL 5DJZA 2Y7QA 3VXRD 4A37A 2HT3C 5EN2A 5J12C 2EE9A 2ZXQA 3DUHA 4CMMB 1SF3A 2ATKB 1HHHB 4KX8A 4N8CL 5JO5B 1B4RA 1G7JB 2N1KA 3TTSA 1UXLA 2BERA 3QG6A 4N5UA 1PY4A 4NO0A 5EORH 5LGHH 3QJHA 5BZWA 4IBZA 4JFUA 4Z9KB 2DEYX 4AOFA 1CFNA 2N0KA 3HR6A 1ZT7A 3ULUE 4AT6B 2X1QA 4YXLH 4HWEL 5F44A 1FNGA 3VXRE 2VIRA 2EXTA 2IALA 4UANA 3HAEB 3MX0A 4Z7UE 4ZPTB 4H2AA 4NNYA 4XPHL 5DK0B 1F4WL 3HS0B 4QOKE 4GUCA 3SPGA 3V4PH 2BIHA 4ONHB 4NQDE 1BW8A 3R06B 5K1VA 5DS2A 4LCWA 4WI4A 1R24A 1TQTA 4MB3A 3RZCC 4WTZA 1XGZA 4GB9A 3JV6A 1HIML 1JV2B 1WZAA 4KK6D 4BK5C 2F8OA 3L8QA 5IJKA 1DVFB 1F4WH 4Z7WF 1MJ8H 2G4EA 3P0YL 1FL6B 5JQIB 2DWEA 4P5TA 3FOMA 2DTML 1GZHC 4QMEA 4TKWA 4HZLA 1ETZB 1VB9A 5TDNB 3SHSA 4E41A 3CFIC 2AXJA 4XB8A 3U79A 2Q10A 4Z7QF 3ULSB 1CLOL 4RESB 3DDFA 5GRZA 1KC5H 2EIJB 1DE4A 1JF1B 5CLWA 3KW8A 4KBPA 1BM3H 3HB3D 2H2SC 4R5VA 3ULVL 1F4XH 1ESOA 2IAMC 4LL4A 1UKQA 2W9EH 4HJGB 4AW4A 3IAPA 1UGKA 4KMTH 3IDUA 5EZLA 4X7SH 1BM3L 1ZE3H 3DSFH 1XF5B 1FHNA 4LPYA 3SYAA 1FDLH 1N5AA 3U30C 4FD0A 5L8LB 3GI8H 4YXLL 3K74B 1H9DA 1K8DA 1D9KB 3FT0A 4IOIA 3MJ9L 1KCLA 3IGKA 1JHLL 4HS3A 3I9PA 2J44A 3HNSH 3G6JE 4Z7IA 3Q9QA 4QRPA 4YLCA 2BP3A 4YVUA 3ROOA 1H3WM 2J1WA 3DMMB 3EGSB 1EEZB 3H9HA 2PCYA 2R7EA 3Q13A 3VXNB 4Z7UB 2Y1ZA 3B2UD 3ZDYF 3RGVA 1IGFL 5ABAA 4N8UA 2WO2B 4KXDA 2P7TB 1JDAA 2XN2A 4IJ3B 4OFVA 4OIAA 3EYOB 2V6HA 2F5BH 1OD9A 1XR8A 1BZEA 1EAPA 2QQNH 1AMXA 4R3SB 5BW7A 1MW0A 3W3BA 5KJ4A 1A4CA 5B39A 2Q76B 4H13C 2H2PD 4Z0XB 1F58L 3F8UB 4MJ5B 4BSJA 5F0JB 4P05A 4F2EA 5IQ9A 3V7MA 2VDMH 2QQNL 3IRPX 5INCB 5I19H 1WFJA 2VH5H 1R1CA 3HAEG 5FWRA 5IFHL 3K71B 1QLEL 2CCLA 3C6SB 4KXZI 4Y1AD 3CLFL 1R33A 2OCJA 1QR4A 2XWJA 3C60B 3FCSB 3FT4A 3HNVL 4HKXA 3VFNB 1Q94A 5IMLB 4GG8B 3VW3H 15C8L 3HBZA 4HWBL 3ZKNC 2YA2A 4UNVA 1OP5H 5AB2A 3EYFB 1QG3A 1QZNA 3VSTA 2D3LA 2HVKB 1OTSD 4W4OC 4X6DA 1RZKH 3X1BA 2CO2A 1FGVH 2JJTC 3TM6A 4LASL 1EJOL 4P2RA 3DARA 3P2DA 3SDDA 3IJEA 1Z0MA 2O5ZH 1PQZB 1R3KB 5KZCB 1IBBA 1CGTA 4WDIB 4AKPA 2ZXAA 2Y1VA 4L9LB 1DVTA 1GC1H 5DEGA 4PD4J 4W70A 2HPTA 5FO7A 2EDNA 4IJ3C 4NZDA 1FGNH 4HAGA 4QCIA 1MVYA 3ZT6A 4CJ0A 5TK4A 4PJHF 4ZX5A 3H42H 2APSA 4H8QA 4NHCL 3ZU8A 1XQ4A 4R3SA 4TNEA 4PREB 5F7WC 4A6YH 5ES4B 3D2TA 4ATTA 5DUJA 1W80A 5GRWA 1J0ZA 2WZPD 4WHTA 2K7PA 3C08H 1A65A 3EYUH 4A39A 5DDHB 3LMJH 4KHXH 2VITB 2Z8SA 5D7JD 2VDPH 1EGJA 2HX8A 5A3ID 4DO5A 5LWYL 1P7KA 2BFGA 2ZX7A 43CAB 3ZYIA 5B1AB 1OE3A 3SE6A 4Y4FD 3G6DL 1FQ9C 3TFKD 2DQTL 2ZKXA 3UPRA 2WYIA 4IOFD 4UB0L 1T7XA 4OZHE 1NMCC 1MXDA 1FVCB 4ZFGH 3E6FA 2CKBA 3BIKB 3OR6B 4N2CA 3GSNH 1QLFB 3V0VA 2EEDA 2BPBA 3CDGB 3F12A 4G1EA 4PRHB 4AIXA 3F84A 1S7SB 4YFLF 1E2VA 5D7IA 5DD1H 3EJCA 2AVFA 3BKML 3ILPA 4LCYA 1KNOB 3VSUA 4F80A 4AL8L 2R29H 4X4YB 4OJCA 1D7DA 3TVMB 2ED8A 1MPAH 3DO3A 3ZMRA 1NAMH 8PAZA 3F6JA 3CDZA 2NNCA 3KPTA 3O4LE 1YMME 2Z34A 4HX1B 5CP7B 2OJ1A 4AG4H 4F9PA 1QNZL 1I3RB 1M71A 5JQHC 1RUKH 4BQ6A 2GJ6E 2FQEA 2XRAH 2CJUL 2OCFD 2EC9T 2R2BB 1D5ZA 4WW1A 3HPJA 1Y6KR 2OXHA 4C59B 4OAWA 4CSZA 2DIEA 4Z8FH 1J5OH 1ACYL 1HKFA 1FYHB 3KH3A 2YUVA 4OIFA 4MHHG 3H9HB 4EIGB 2ADJB 5CM1A 3S4SA 4UTAL 2PWHA 1CFVH 3AU0A 2X2UA 2X4SB 4KPHL 1H8NA 1DR9A 1ILUA 1TLKA 3DECA 1R5VA 4FMKA 5FLUA 5SWZD 1BFTA 1I3UA 5BO1H 1NC4B 4MLSA 1CFVL 1A7BA 2JKJA 3GSNL 3G9VA 2XX1A 3CBRA 1DUZB 3B2VH 4HG4K 3O3AB 4YX2L 1CT8A 1KCRH 1O6VA 2DMHA 4ZTPH 4L3CB 4LE8A 4FFZA 3HE6C 2HTLD 3PWJA 2QHRL 4U33A 4Q56A 4ZX4A 5C09D 4W9JC 4KKZA 1LQBC 4MGXA 2ATKA 3RL2A 2K7QA 5DUML 1NCOA 3ZE2B 1EMTH 1BZDA 2PYEB 4IBUA 1S7TA 2AXFA 2I5YH 4Q6IB 1UWYA 2W94A 4GKOA 4P2OB 2G2NA 5F72S 2VZVA 1BVZA 2LVEA 3MV9E 3H3PH 1KIRA 3ORJA 4AG4L 1XGRB 3SPCA 5MEPA 4XMZA 1RUQL 4R5TA 2NR6D 1UA3A 3D7PA 4AQAA 5CZKA 1G6RA 5GGSY 5E1GA 1H6FA 4WWKB 3UGEA 3WLBA 3HC2A 4YHOL 2WLLB 3PJSB 5GGUA 4P2RB 3CU1A 4HCRL 3HAEA 4D9LL 3HG4A 3MNZB 1A1NA 3G5ZA 3L3HB 4ONHA 1XMEB 3FXIC 1O6SB 5EDSA 5BRZD 4DP6X 4U1SA 2YAOA 3CHPA 2XFXB 3NFPA 3MGTA 3P3RA 5FS5A 2HRPL 2ZJSH 5IOKA 4F20A 5HYJA 4RAHA 4NEHB 3AACA 5KJRL 4Z76B 1YJDC 3U46A 2HUHA 1QEXA 2KLSA 2MPVA 2J25A 4OM1L 2GITB 1TF4A 3B9DA 4ABUA 3RB5A 2YMXL 5JLZA 3W5NA 5G4OA 4FLHA 4DAGH 4BGLA 3UTTE 2VR7A 2IXQA 4N85A 4NQED 3L7EB 3R19A 4KJYB 4MS8C 4D9QD 1MRCH 3I9IA 3NIGE 2Y69B 1G6RB 1PMYA 3SQBA 5HGHB 2JCCB 3HHMA 4ZFOA 5IVXF 3HG1A 3T3PF 3C75A 5JPMC 5D7IF 3NZ8B 3L95B 4P2OA 5EU3B 5JW4N 4NZTL 3GHBL 3HR5A 4NZUH 2OL3L 1G1CA 3JWOH 1UD4A 3ZL4L 2HMIC 4R7DB 5IZ7A 1BPLB 2WXIA 1M2OA 3AQZA 4I3SL 1UWGL 1RZ8A 1XZ0B 5SWSD 3TONA 3SSGA 4NBYB 2NX5B 4WFFE 4EXPX 4UM8A 4Y4HC 4LRIC 1OSPH 3GUTA 1G7PA 2BP5M 2ARJB 4MD4A 5LBVA 1N0XH 1RK1B 1T1YB 4PGDA 2O5XH 1OF2B 1NDMA 1Z9SA 1X5FA 5F3FA 5L2KE 2YZ1A 3MRKB 4R83A 3MRHB 4JO8A 3LEVL 2NNAB 2RIKA 2APVA 5F88B 3S88L 2W9EL 2AJSH 1I7ZB 4GRMA 3SY0A 4LRNL 1QAWA 3FO1B 4CMHB 3KVPA 3WNIA 4NQCE 4EDXA 4M62L 1W0WB 1T0MA 1KBKA 3BWSA 2AEPL 1U58A 2DLIA 2G4GA 2I9LA 4A7SA 2C9SA 1PPIA 4G9DA 2ETWA 2E9JA 5A7EA 2AJSL 3WFHB 4Y4KC 4AEEA 3SDCB 4XTRD 3TEXA 5IEHA 1MG2C 1UADC 2CBQA 2OXHB 2WBXA 4N0UB 4M62H 1OSEA 4S1RH 4M7KH 3N42B 1KXTA 2E4TA 5EIVA 1JXKA 1U33A 1PAZA 4LK4A 1A1OB 3ATEA 2GG1A 1IMHC 2PETA 1WAAE 2Y7NA 3ARBB 3DWTA 4GI9A 1RZPA 1XCTB 2DYPD 4FL4C 4PJHB 3DV6B 2VQ4A 3LZRA 2FR4B 5FXCH 4H40A 4D0CB 2YPVL 1PKOA 1DQIA 2VB5A 3BWAA 5E0QA 3UZVB 5KVDL 4YAQB 5AYUH 2I9TB 1NDGB 1JPGB 3O8XD 4HSAC 4U6TA 1BYNA 3HVDA 1ZJBA 2NYZA 4UM8B 4NDMA 4GUOA 4M6MH 5FO8B 5D93C 1BREA 1IC4L 2YZ8A 3CZKA 1GZPB 2JXMA 4ZUUB 5T1MB 2EUWA 3KBHE 1MHEA 4OR1A 4JHUA 3RVTC 2H6UA 5JMRA 2ZUVA 25C8L 3ULSA 4ZD3H 4J3OD 3V4VL 4AQAB 2IOIA 2XETA 2FHFA 1E3FA 2BY3A 2NY1C 1JXJA 2HXAA 2I32A 5HHQA 3O2WL 3LY6A 1I1FB 3MLTA 3O6ML 4K71B 1GS7A 1NPUA 4EN3D 2Y7SA 4XR8C 3E8VA 5D8JH 1L3WA 3O6LL 1NFDB 3HZYB 2DICA 2A38A 3BKJL 3TNNA 4BFEA 5I1KL 2GC4C 1UVQA 2OJZL 2ZIDA 5HHNB 2AITA 2JKXA 4Y2DC 5D8JL 1HDMA 4R7NA 4U6YB 4NENB 5DVNA 5C7XL 1MWAL 3DIFA 5IVZA 1U8KA 4M93B 4M43L 5SX4I 2VM9A 4WJ5A 3TBVB 3MN8A 4FI7A 3A6OA 5FGCE 3ZZLA 2F8VA 5GGTL 2CHNA 5D1QA 3HE7D 3OR7B 4X6FB 4JFTA 1AR1D 1MWAH 4Z7NB 1XR9A 1BEYH 1S9KC 2QHLA 5IB3A 4GG6E 1F2XK 4JO1H 4M00A 5IF0B 3GSXB 2RCSH 1CCZA 4N2OA 3SGDI 4FABH 1DO6A 4FL4B 2XCMC 4NPYA 5D4IA 4LSVL 2WIMA 3IDNB 4IYKA 4M48L 2HVJA 4OFKA 3MA7A 1EBAA 1QSEA 3KDMA 2DDQL 3NCBB 3RILA 3WNJA 4H8WC 5EOTA 2VC2L 4FABL 2A3TA 5DRNB 2I7OA 1J0HA 4PJBF 3L6FA 1ICTA 2KZKA 5D7KE 3IJSB 1YO4A 4ZTOH 3TBCA 3BRFA 3IMUA 4QO1B 5E9NA 2EZ0C 2VLJD 3AROA 3LH2H 3P0VL 3Q8BA 2CNYA 3TBWB 4MNHA 4RFEB 3GS7A 5I5JA 5F71A 2R4RL 4X9BA 5FKPA 3LEYH 3V5HA 5J0BA 5CLTA 2OYMA 1U36A 5FK9B 4PP2A 1T5KA 3D4CA 3MRDB 2XOTA 3INOA 5TFSH 3V0DA 3VFUA 3TWCL 2R4RH 4NNXB 1XR8B 4Q6YA 3ULUC 5E1AA 4P48A 4G43A 4IM8A 2C3VA 1L5GA 5KANG 1YEKH 3W81A 1TTUA 2FQGA 3OAWA 3I50H 2ERJB 4W6WB 3VGEA 5I71C 3H7LA 1JNNL 3IDYC 4JY6B 3HOGA 4H1LA 3D2UA 3JV5A 2NLJB 4N0FA 4EBQL 1E5ZA 4JFDB 1Z5LA 3MRLA 1WWBX 2UXFA 3OGOE 4A7QA 5ISZD 4G5ZL 4E9QA 4NO2B 1X4XA 1JZ4A 3PUCA 2I7SA 2W07A 3QIBD 3VE0A 3FTGA 2AQNA 1IKNA 5JIKA 3MOAL 1BXVA 5FYJD 4D0DA 2FIKA 1NUFA 2LU5A 5CCGE 3VI4F 3LRSB 2C1OB 2JIXA 4AQ8A 3EOAB 4IKJA 1MCPH 2E7CA 1JOIA 2ED7A 4XPBH 2BSRA 2CO6B 2VXUL 4FQQB 4HQQH 5TQ0H 5ABZA 4C4KO 1EFXA 2OFQA 3B5GA 5GISH 3SDCD 4I0PB 2MCG1 4TRPH 2JQZA 5AL8A 1JZ5A 2W8CA 5ERWB 5AG9A 2IQAB 3IN2A 2D2OA 3TEWA 2XTJE 3W2DH 5DFTA 2Y24A 5CINH 4HS6B 4O51A 5D96B 1ZLWH 5GS0C 5GZNC 4DCQB 5KSBA 4P23C 1L7IL 4O2FB 2J55A 2V2TB 3RDJA 3PQYD 3WEMA 3UJJL 5DHVA 4LHUD 5CD5C 3A5VA 1VFMA 4LGRB 1A9EB 5ILTL 5PCYA 2YK1L 1NUDA 1L7IH 4FTVE 1EUTA 3DC0A 5T1JA 3APDA 2XY2A 4R84A 4KI5C 5TDOB 4IBTA 1S78C 1TPXB 2FGWL 1MHEB 3GK8L 3QJUB 4XVTL 3FHEA 2F53A 4OD3L 3TBSB 1T7ZA 1NKRA 1EGJH 1S9XA 3NEEA 3QEHB 4LL1A 5HDLA 3U36B 3VQMA 3RJQB 5BOZG 5AKSA 3CGTA 2AANA 3L4VA 1E67A 3LRSA 4TOYL 3VQLA 3AAZA 3IETA 3DLQR 3GK8H 5GSVA 4HC1H 3UBHA 2H7WA 4UIMA 1IJ9A 4EDWL 4HD9A 4UF7C 3D8MA 4HIHA 5B1CA 3U4BL 4BWWA 1VF5C 5JTWA 1RZ7H 2QQLL 5E2WH 4PVBA 1FCCA 2PUQT 3K72B 4MX7A 5T1KB 1E7UA 4M8RA 1ZS2A 3EJRA 2X41A 4X0KA 3TGXA 2QSQA 3QFGA 3A21A 4O02B 5C0BE 3WEXA 2N7SA 3UZEA 5J12B 1CF8H 1MF2H 4L8CA 3WS3B 1CGXA 1AY1H 1G9NL 4Z3EA 5BNXD 3UO8B 1G1KA 2A9CA 4XHQA 3FRPB 4LBAA 5AW5B 1H6UA 1F6AA 1A6ZB 1IRAY 3ZE2F 1TYRA 3S8FB 3WFZA 2MOGA 4BH8B 5I15L 1U3NA 3HZMB 4GMTH 3H1ZA 3RAJL 5DJ6A 5CR1A 3SE8H 4RMTA 3HE7A 2AKRA 2P48B 3D07A 3QEGL 1G9MC 3POCA 3LX9A 1VACA 3CFCL 2AERT 2F1AA 2PPCA 4QO1A 5E4AA 3WMSA 3GGWB 2AGJH 4HKXB 2LOEA 3GF8A 1A9BA 1FN4A 5B3SB 1G7PB 2PYFA 3RUGF 4XMKH 1L6ZA 3ESPA 1OVZA 1P6WA 1ZDSA 1CYXA 1ROWA 3HKZA 1EHLL 2W81C 4G42A 2IADA 1L6PA 3MJ6A 3ULAB 2X6CA 1WLHA 2BSDA 1G9ML 3BJ91 1WVZA 2HKHL 1NAKH 2DQCL 2NQ3A 2P5ED 3BPCB 1SRDA 4HDIB 4RSYA 2CNZA 4UDUB 4AJWA 4G43B 3TF4A 4JUSA 5T1KA 1X7SA 4BK4A 4X6BA 3RWEA 1WHOA 4QKXB 4CGUB 4GI8A 1A6UL 2O72A 4KZDH 2KDYA 2X9YA 2YAPA 3L1FA 3MI6A 3IKCB 4E9WA 1M7UA 2HG5A 5DT1L 3SDAA 35C8H 3OWEA 4IRSA 2F54E 3IDJA 4GYBA 4KZDL 4D0DB 1ADWA 1D3CA 4ENED 5BV7H 5SWSA 1UHVA 1XF5A 4GRLA 2VAJA 3FTGB 5I1DB 3CLEL 4FADA 1NCCH 4X80L 1PBYA 2AQQA 5F1NB 3TESA 1NCBL 4HK3N 5H2BB 1KGIA 4JFFB 4YOKA 4J39A 1D5XB 3NCFB 2X4OA 3QIBA 5AYUL 3CLEH 1P6AB 4TTGA 3WHE1 1X9RA 2WPGA 3HZKB 1P2CA 4YBQC 4DGIL 4R97C 2JIXD 2V2TA 4LCIH 1Y07A 4J28A 4NKMA 3GBEA 4JRWA 1KBBA 2EP6A 4GOSA 2XTSA 3SQRA 1JP5A 5C0CA 1U3HA 2UVFA 1PZBA 1W16A 2EO7A 5C9KA 3L08A 2EDOA 3ZUCA 3IXAB 5GGQH 4PJDB 1OF0A 3NK3A 4XH2B 4LCIL 5JPNC 4JFZH 5D1QC 1EEYB 3VWKA 1IQWL 3TC9A 2CD0A 5AAMA 1JPTH 1RPUA 4XNDA 4MQ7B 2OSWA 3UH8A 3UPCA 3ZXAC 5HXMA 4HHWA 3OMAB 1G6RL 4CBZA 3MLVH 2VERN 3V9EA 3FAWA 3O0RH 3X1FA 1HYRC 1H3GA 2E6JA 2GAZB 3QHTC 4OZFG 1UA7A 3GSQB 4XP1L 2Y7LA 5C09E 3VACA 1ZKAA 3L3IA 3LZFL 1R3IL 5F9WB 5C7XH 1NCCL 1M6OB 2KC0A 5ACLA 3HRPA 3IK2A 5E8NA 4AQEA 4UUJB 3RVWC 5TF0A 5DK2A 3NJKA 3FCUB 5LHDA 1TZGH 1A3RH 2DJSA 3JYCA 2WWNA 5CXPA 3O2DL 1NPJA 3RDTC 2P5WA 1VADB 2RFXB 1GS8A 2D7QA 2F0CA 1P7HL 3LV3B 3UMNA 5D9SA 1FORL 4DPAX 5EO1B 3QDJE 1JZFA 2APXA 2CALA 3BVVA 1KTRL 1FH5L 2GIMA 2ZSWA 2FL5A 1CWVA 3GSVA 3S97C 2R69L 5LAPA 1HEHC 1BXUA 4PJFE 3U83A 3UZVA 2C9QA 3K6SA 4L8BB 1UM6L 3QJFA 5IW3A 3V6FA 2YUWA 2R69H 2XKNB 1NMBH 1XIWA 2F54D 2VGLM 4H25A 4UT6H 2L7EA 5AKRA 3V5KA 4CUCA 1P6FA 2Y5TB 5KOVC 1D5BB 2N59A 2IPTL 3FN0L 4FJ6A 2FO8A 2XA8L 3NOIA 4KVPA 1G7QA 2H5UA 4FLQA 2BM3A 3TO4C 3CFJA 4FNSA 4YXHH 5CJ5A 4HOWA 2CBTA 2BC4B 3SE3A 1P4BH 4M5YH 3NEOA 4M6OH 2VSDA 1KG0B 4NAQA 3U9PL 1JI2A 1FFRA 3B9AA 4GAYA 3P73A 5AW0B 2XN0A 1RZJC 3P40A 3QULB 1S6NA 3FW6A 3DUSA 3J27A 3E8UL 4OLEA 1DSYA 5K9QI 1C5CL 1Z0NA 2B20A 2N3JA 3IDXL 4G8IA 4A2LA 2RQEA 2W0PA 1IJNA 2D03H 1L9OA 2LLNA 5KVMC 5FO9B 4P59L 4PJ5A 5I18H 2NY5C 4E5XG 1BEXA 2CXGA 4OLZH 3T0EB 1EUUA 1I1AB 2GCYA 5MENB 1SMOA 3ESVF 4ZMLA 2CKBL 1U8KB 2WK2A 2R27A 1NKOA 4WSJA 2Y07H 2PXYA 4DKDC 2WV3A 4Z78A 3S8GB 3X11B 1GAFL 2JKWA 3CVHB 1ZY9A 3FU7A 2HG0A 3L3OC 3CX2A 1DQDH 1KN2L 2MOVA 1L9NA 1A3LH 2Y2TA 2VXQH 5F1KC 1YMMD 4PRPB 4NPKA 5EUOA 3QUYB 1NMBL 4RWYL 1QRND 1JNLH 3KHQA 1RURH 5E8EB 2BVOA 5I16A 2CIIB 1E6JL 3T1FA 1Z7JA 2NXZB 4UDTA 1U93B 3PWNA 1IGMH 5C2BH 3O9WD 4X83A 4MD0A 5L2KB 1CC3A 5IB1B 2IPUK 3IJEB 4P4KA 4ODTH 4GO9A 1QSED 1UB5A 2DLTA 3ZKXB 3U9PH 4FQJH 3ZHNA 3ZE0E 3ZHDA 2XQYK 2HFFB 4B41A 1QR1A 4WGWB 2VN4A 1OGAE 5DJ2B 5INDA 3WFEL 4FNLH 2CLVA 4LT7A 2GCYB 4MYWB 3HG3A 4JO3L 2DJUA 1T1YA 1Q0EA 4TLKA 2EVJA 4G8IB 2FJGA 2XG4B 3DOSA 2Y07L 3RIAK 1DL7L 3JSSA 5FWQA 2R83A 5DMYA 3MV11 5IHBA 1N59B 4A7GF 2DEXX 1VPOL 2IBBA 4XPTL 2EAEA 2YAMA 5D70H 2UZIL 3DBXB 5DMIH 4WFFD 5JW4Q 4B7IA 3MA9L 1KGXA 4MQXD 2VW7A 1UCBL 4U49A 5HGBB 1MNUH 5I1GH 1UUNA 1PG7W 1C16A 5EU6A 1GGCH 1WWAX 3STLA 4NUJB 1AXSB 1HXMA 3ATBA 5KEZA 1XB6A 3BYTA 2NXZC 1LO2L 2X6BA 2VR9A 1KXTB 3CC5A 1JERA 2R7EB 1HHGA 4YHZH 4WTQA 2E9BA 1ETJA 2J1KA 4ADJA 4DGWC 5J6HB 1TPXC 4KH9A 3MLUH 3EDFA 2H1PL 2MNWA 3CX5K 1YQVH 4N20A 4MNQA 2FJHB 3DMMA 1N64H 1UOLA 4LGPB 2VJ0A 3X3GL 3QXAB 2P46B 1XEUA 4LSSH 3VAEA 3FC8A 3Q6GH 3GQFA 3GB7B 5C0FA 3LPGA 4JZOA 2VDOB 3K6SB 1GGYA 3SE8L 3BIKA 3OR6A 1RP8A 4GS7B 1AIFA 4KRPB 1F56A 4APQA 1V10A 2BSEA 3Q01A 4LSSL 3ZN6A 3IT8D 3CXHK 3ZKXC 3GYRA 1YN7B 4N24A 1DN2A 3CVHL 5GJSL 2VLKA 3OMIB 1I1AD 1TITA 1WP6A 3BLPX 4JHBA 1OPGL 3R8BB 4CVXB 1NGWA 3S34H 3Q43A 3LN5B 2PWGA 2D3VA 4PJGA 4I5BA 3CVHH 3MREB 4OZHA 2Q87A 1KPUA 3WKNA 3T6WA 4M8QA 2VZSA 5D5MA 1U8MB 2ZCLH 4HKJB 1YUKB 1MRDL 2VLRD 2XG5B 4JO5A 4GRLB 5I8EA 5TF1H 5I0VA 3BUDA 4ZPVB 3IGAB 1WAAF 4HXBH 1M71B 4YBLC 3VGAB 2MH4A 3Q1SL 3KLQA 1HDMB 1XIWD 5CMAA 4FERA 1NAKL 5FKAB 2YPKB 1QTYT 1N4XL 3QXDA 2X2IA 3WMQA 4D0BB 3CJJA 4LVHB 4D7BA 3CXFA 2XWRA 3MRRA 1UM4L 5HJ3A 3WHXB 1AGFA 3RWCA 3QIUB 4JPVH 4H8UA 4U1LA 3MLRL 1R9FA 3NSFA 5I1LB 2WKOF 1QBLL 4XOEA 2VN7A 4JFDD 3RVUC 4DKEL 5ABDE 2OCCB 3QUXB 4FP8L 1LNUA 3QIWD 5C09B 4UMGA 2K45A 4Z78B 4A67A 3EGDB 3EOBA 1NGPL 3PXHA 4IDJL 2YJQA 1CL7I 1L3NA 1U8PA 3BKYH 4ZMZA 4V2BA 3IMSA 4PHZA 1PEWA 3F58L 3RZWA 3PGFL 4URKA 5IUCA 1LM8V 4LLDB 4LLWB 4PGBB 4G72B 4HWZA 4PJ8C 1EANA 4M5TA 3MJ7B 2YEQA 1ZGLB 1EAOA 4JFFA 3NIFE 4J4PC 4YDVA 1UXSA 1X5IA 1XGPA 5I0WA 1VZIA 5KBPA 3AG4B 1N67A 1TEGA 1ZLUK 4Z0BH 2NXYC 3MRDA 4JCLA 3E80A 1DDTA 4RIRB 1GA2A 4FG0A 4LO9A 4GW5B 2YS4A 2L7JA 2Z3FA 2A73A 5C07B 2PCPA 4L1LA 5FOBA 5EG6C 1HK6A 1A1MB 3ZTJH 3BP7A 2OMXA 5C08B 2GI0A 4RGNC 3OAUL 4OCMC 5D1ZD 2VZTA 3EBHA 3OJVC 5GHWL 4LLQA 2WQXA 1MZYA 3QXDB 5A2LH 3UACA 5CSZB 4HBCH 2QLYA 1EAPB 2Y72A 2VE6A 2O6DA 1KTBA 4F8PA 4L0YA 3MYJA 4XGZA 2BXZA 3SGKC 3QXWA 3CFQA 2I24N 2WP3T 4HBCL 4QRUB 5E9AA 4OV5A 2RBLA 3LZNA 1ZHBA 2GBVA 1V54B 2HKFL 2OP4L 4ZS7L 2DYRB 4F3FA 2OMYA 3F7PC 4QRPB 4JR9H 4OLWL 3EUDA 2XN9E 1BJ1J 1J8HB 1IC7H 2FBRA 1GJWA 4I3RH 3L16A 3K0WA 1HJCA 4P2QA 4LDCA 1D5ZB 3EH3B 3NVQA 2FYVA 4RA0C 4E36A 1DBMH 2X6VA 4J3OF 2WO4A 4WJ5B 3L9EA 4M4RB 1SJEA 4MYPA 4HH8A 4H20H 1PW3A 1KIPA 3D85D 5FOBB 3JTSB 1MCOL 5AZEH 4GRLD 3IDMA 4K8RC 4NZRH 3BSHA 3QWRA 4PJGF 4YDKL 2NTFB 3ZY7A 4EOWL 5FLVA 1E6OL 4Z77B 1AI1H 4UOW1 4KK6C 4UZUA 2X44D 4Y5VA 4ZAKB 1ZTXH 4JKPL 5L0QC 3BWUF 2ENQA 5E7FA 1FJ1B 1M1XA 1JZ2A 3QNYB 3MRMA 3FOMB 2AEOA 5D71H 4X9IA 3UAJC 1CLVA 2NY6B 4TUJB 3ZDZF 2DQFB 3W39A 1D5MA 2WM0A 4JDTH 4JDZA 4I4WB 2P3YA 2YAEA 1I8LC 2C26A 4Q14A 2LAAA 2ZAIA 4JFQB 5EOCJ 1Q38A 1T5XB 2APBA 2MOQA 3FU8A 2B77A 3GBMH 5E9DD 2UYLB 1T89A 5IV2B 5L2JB 5DQJA 5C0IB 3S5LA 1NA8A 1ACZA 4F15C 3MX0B 1DBJH 1S78D 4MDRA 5D7KD 1I85A 3D0VB 1HQ4A 1K9TA 2F7RA 5CD5D 5GSVB 2EXYD 1R3JA 3QDGB 3QI9D 2H0FA 4WU7A 2OR9H 2XZQL 1D9KC 1U41A 4UQ3A 2ZYRA 5AOKA 1MLBB 2IDUA 4H88H 3DX0A 1CG9B 1DDHB 3JWNE 4EJ1C 5L9DH 3EHBB 4NLHA 1K85A 1O6SA 4FKHA 3RLSA 1M7DA 4JG1H 1Z32X 3RNKA 3TA4D 5I1HH 1U4EA 2V5MA 4ZSOE 3GXMA 4UYPA 1GCFA 3CWGA 2X3BA 4AH2A 3RFZA 4GQPH 3RVVC 4M8VA 2G2RA 2ZCKH 4PJXF 4OCLC 5F0PB 1BBJA 1OCCB 4Z77A 1IIIA 4QRRB 5IROD 3PF2A 3TJPA 1LK2B 2WLZA 4DQOL 3BQUC 2IQ9H 1V5JA 4CRPA 2HLFC 1TUPA 3TO2A 1IE5A 3CLWA 2WOYA 4N2GA 5E8DL 1ZEAL 4UTBA 4S10A 1K8DB 2NZ9D 1A9BB 3KPRB 3C9NB 1N8ZB 3HCVB 4RMWA 1MFAL 4AIZB 4B0MB 3VXSD 3NA9H 1KFAL 5HY9A 4QHKI 3V52L 3L5HA 4XP9H 1YNLH 4P99A 5GGRY 4IK6A 2WN3A 4LVOB 3VFNA 3VXTB 2BNQB 4NO5B 5EFIB 4YDMA 1WUZA 4PS4L 3CSGA 1GIGH 2X6UA 3FOLB 3NCJL 4P5RA 5F2FA 2OSLB 5E23A 1OM3L 3V52H 4L4JA 3T3MF 2OM5A 1BJ1H 4BFRA 3FMGL 3IFPB 4FHKA 1DL7H 1P7BA 4OVVA 2YXMA 5FF6A 4CMMA 5I6XB 4IQHA 1U8OB 3GKWH 4JO2H 1OM3H 3A47A 3RWEB 5DJZB 1EZVX 1HWGB 4GT7A 5CSZA 3P0YH 2XXMB 2BHFA 4RVBA 2VDPB 5FCUL 5ESQB 2EXSA 1MFCL 1ZSDB 5B38G 4LNRB 2YRLA 4NUJA 2NY0C 4IDLA 4LCWB 3H56A 5H37G 3N6YA 4P4RB 4TVPD 1FYTD 3QWOB 1AVAA 4TV3A 1U58B 2XTLA 1Z3GH 1GGTA 5IBUG 2ZXCA 3C2SA 4WNQB 4PV9B 3HNTH 2YGNA 3CPUA 3PGDA 5E1HB 5AUMB 2WUBL 1MFEH 3MBEB 5JOPD 3LXBA 5KUKA 2B2XH 3B2PA 4P5TD 3SKJH 1HCFX 4AYDC 2JQAA 3EAKA 1QSEB 4BA0A 3O2VH 4XP9L 3I3EA 4N0CD 5D1QE 2A7BA 3OAZK 1XGTB 5LWYH 5EOCH 2WNKA 1T2QH 2WBJB 2GSIA 2WWMD 4Z1PA 2B0SL 3H9SD 2CO1A 4JRLA 4DH2A 4NDMB 2F5AL 1S9YA 2IGFL 3ASOB 3GPSA 4CC0A 3FFCD 5IY5B 5FX3A 1OT2A 4FZ8L 2C3HA 2PPAA 3D4ZA 1UT9A 3H42L 4KAQH 1J0IA 1KJ2L 1LD9A 3EFFA 3UZEC 5F7FA 4BZ2H 2XXGA 4A38A 2JCWA 4FKEA 1S7UA 4ODWB 5SWZE 1A7QH 5JR1H 4DEUA 3REWA 3RIFF 4WUUD 3LKSB 4W9CC 2NW2B 4B9GA 5SWZB 1K5NA 4MQ7A 3VB9A 3QVAA 3T65B 5HYQB 4KY2A 2O61B 4BZ2L 2IANA 2DL2A 3TYGL 1CLZL 1J8SA 1IAOA 2XQBH 1A0QH 3BT2L 4XPAH 2C1OA 4ERSL 1KCSH 5HJDA 1FBIL 1TKWA 5EU5A 4MJ6B 1SZNA 1UM4H 3JQOB 4HMCA 1I8IB 3C2AL 2MSPA 1OB1A 4YSQA 5B8CC 3NJLA 5B1KA 1QEWB 5K59E 3CLFH 4PJIE 5ID1A 3C6LA 2HX9A 4J2XA 1EBPA 1HHKA 1MG3C 1OGPA 1I8KB 2DZEA 1RZIA 3V9FA 3FTXA 5DRXB 4LU5H 5E5MA 3F83A 4AWJC 3QHFH 4N0UE 1JK8A 1IZJA 1OTTC 2J57A 3QJTB 4CL7A 1UQSA 2ORBL 4NKIH 4BQ9A 2X40A 1FV1A 3BUTA 3EFOB 3VD3A 5IMLA 2Z92B 1TMQA 2Z35B 1B4JH 4NN5C 3JWNG 4BXSV 5JNYA 2L0DA 3DXAB 5D1XE 2MCPL 1Q9OA 1QUNA 1PEZA 5GZNA 4O02L 3GSRA 4QXGH 1IC1A 2WXOA 3FF8A 4KHTL 1URIA 4LSQH 5CEZH 3PCYA 5CU9A 4ZTPL 1W15A 5CN3A 1C5DA 3L4UA 4QTIL 4ELME 3QAZB 2IFFL 4AYBA 5DUMH 3SYQA 3ILQD 2KHAA 4ISVA 4MCYA 4QXGL 3S35X 1QO3B 4GXFA 4XVSH 2DWTA 1GJIA 3GWJA 5E6YA 1QMUA 2HJFA 4P2OC 2X89D 1BA9A 2NUTB 5DRNA 2ZOLA 1FI8C 1P7QA 4P2QB 3V8OA 1F02I 2D31A 3NTCH 4MNQE 1I9EA 3QIWA 2V4LA 1WS7A 5J6SA 1MREH 4MX7B 3FUMA 4K5OA 2A9NL 1KYOK 5DEZA 1OHQA 3HZVB 4G9FB 1GGIH 2OSLA 1YHPA 4XT1C 1QATA 3TT1L 1IEBB 3FO2A 3WELA 1W0WA 3BZEB 5E4EC 2EDLA 3D6GA 5AW4B 4L2YA 5BZDB 3ZZQA 4MB5A 4XI5D 4TSAH 2NXYB 1GGIL 5IFJA 1IM9B 3VRIB 4J3UA 1XX9C 1TVDA 4CADB 4PV8A 5IW6B 1WBYA 1G84A 4JM0A 3LEXB 1LTXA 2C4FT 3BDYL 4XBEL 3RP1A 3FHAA 2C3WA 3DURB 5DK3A 4AQ1B 2F1BA 4FHJA 5EEVA 2IFFH 3BKMH 1RJCA 3BVUA 4D3CL 4F2MB 1OANA 2H47C 3PJSA 2BOBA 2KZWA 2ZQKA 4L29B 4XVSL 1F3RB 1NEZG 3F7YA 4PIRF 5EC1A 4IIZA 4YK4C 1C5DB 3VI3A 1OLLA 1ZIAA 2HLEB 3CBJB 2DMGA 4XVUD 3MBED 5TDPB 4OZIA 3PWNB 5GS0L 4XOAA 1PG7X 3OJ2C 1NGQH 4M56A 1JL8A 4ZFOB 2LFEA 4RZKA 4Y5YA 2G75B 3GZQA 5ERWA 1QLFA 1Y18B 2YOAA 5IQLA 2XVBA 4YDVB 5FIEA 1PIFA 5LGKA 2BIQA 2HFGH 2BLFA 5LKNA 3KXFE 3ISWA 3TA3C 4PRBA 5CBAB 1NGQL 3PJLA 3O41B 4OFYA 4AK2A 4ZRGA 4PJAE 1ZLVH 3ML8A 4KPHH 3G5VB 1FIEA 1KCVH 2DMKA 5KJ7E 2PYEE 4FGMA 1LEGA 4FMFA 1S3RA 1N59A 3DX3A 4GKZB 1H5BB 4PJGE 2BIMA 1NUNB 4EEEA 4R4FL 4NP4H 3SJVD 1OK8A 4UT6A 1WQVT 2Z7ZA 3FQYA 4JKNA 3U7AA 4DAGL 1I7TB 1QQDA 2DWDA 4R2GC 5AB0A 4FC3E 4JFEA 2HT2D 4JGNA 4K94L 1GSKA 1AZUA 1CGVA 4NRZB 5AQ0A 4XZUA 3IDJB 1B0GA 1I7UB 2HRHA 5DJ0A 2BVUA 2MWCA 4X5XA 1JDDA 4H5SA 4AK1A 3P4OB 3KW7A 1IU1A 5SWZA 1TZIA 4Y4KB 1PCXA 4GAFB 4A7TA 1A25A 3D5OF 2QQKH 1G7MA 2FQFA 2CDFA 2KDGA 4HMDA 4M6NH 4NZTH 1VRSA 4JQXC 4N0UA 1X5XA 2DYSB 4TF4A 1BXAA 4MS6A 3SJVE 3TCTA 3II1A 1NLBL 5DLLA 3QRFM 2BNQD 4DESA 1KGWA 5TDPA 2PP9A 1BWMA 5DURB 2YPLB 3ARGD 1QUPA 3QPKA 5J9PA 2EE6A 2Q3AA 4JY4B 4LCUB 2ADGA 1YEGH 4KX7A 1RVFH 3X1NA 4DUWA 1B4LA 4LSUL 5FB8A 3HN3A 3N91A 3S37L 3QUMB 1IKFH 4GRWB 3GSRB 4JL1A 5TD4A 1KT2B 3F62A 1UWXH 3UYOD 2CBOA 3EF7A 3C5ZC 3DUUA 2WUCH 4MJIA 3DXAA 4APQB 1TCRB 3EHBC 2A9MH 3CK0L 4PUBL 4JPWL 4YXKL 2EIEA 4IGBB 5TE4L 3ZRCC 1N8ZA 1NEZB 1SNRA 3A67H 3CFBA 4KJWD 5GGTA 5DD5L 2WVTA 3O4LA 1KFAH 1IC4H 1QFOA 4Y5YC 1Z9LA 5DJ6B 4M7LH 4HW6A 4XAWL 1CGSH 2EDKA 1JWSA 1ET8A 3ZX1A 5L6YL 2ZXGA 1G5AA 2O5ZL 3VFSA 1LO4H 3WXVH 3OKLA 4HWBA 4F91B 6CGTA 2OSXA 1IEHA 2CU9A 5TPWL 1JAEA 3PWVA 5HYJD 3HS0C 1GC1L 3P77B 4KROB 1NANH 4KK8D 3MTXA 4PJXB 2VLMD 3S3BB 3T4YA 3ILDA 3WHE0 2E5EA 3KCWA 5E6ID 1J12A 4NKOA 1MVFA 2DI7A 5SV4A 3CVIH 4PYGA 4NRYB 1AKJD 3EDJA 4BM7A 4NQEA 5C0AB 2F5BL 3UYPB 3CQFA 5F3BA 4J3WA 1YNTA 3GJFH 4HIEA 2EICA 4M43H 2EDDA 3KL3A 5EC2B 3EZJB 3VFMB 1ROCA 2YBGA 3QJFB 2BY0A 1MFBH 4WCYH 4UOZA 4M9PA 2RHEA 2OTWA 3HI1A 3QNZA 4GRWF 2A1WL 4KVNL 4URTB 5I82A 4EI5D 5CR8A 1NUGA 4YIQA 3KCPB 1ETA1 1RZ8B 1XZ0A 4WO0A 5KYWA 4K3JL 2DQJL 4NI6A 4YBHA 3NJXA 5G5DA 1JCKA 2TRHA 3K6DA 5D7JA 2XQ0A 1LO4L 2XWXA 4JANB 4ZFGL 2WLKA 3LCYA 1T2QL 1ORSA 1NGXB 5G4MA 1IV8A 2ZG3A 5DZJA 4NSKA 1OP4A 4UTCA 4HS6A 4O51B 1TFHA 3BHBB 4WIQA 3TN0D 4LASH 3QEQB 1XF1A 1QEWA 1R3HB 2ICWI 4G8GB 4HV8B 3F7QA 4OGAC 5IGXH 2OPCA 1IBYA 3TBVA 4K5PA 4N0YL 3MACL 3ZIYA 2G5UA 4X98B 1G7LA 4BRJA 4FE9A 3BIAX 1WUNT 3ME0A 3NN8A 3MNMA 2LHAA 5ETUB 3QFJB 3PFUA 2Q6WB 4I1PA 2P52A 3I9GH 4OFQA 4N9OB 1IBGL 1BD2A 1CT8B 5HI4C 1H8LA 1UWEH 5IK3B 1ZA3B 3CVHA 1O9WA 3GIZL 4HKZB 1BIHA 3P9LA 5TJWK 4R4BB 5E1IA 2O4EA 1YEKL 2WYZA 4PJ5B 5E2UH 3B9KC 4WV1C 3WSQH 4QRSA 4K0OA 3QP3A 2B3IA 2I27N 4Z8FL 3NQKA 3MYZA 3B34A 2AXWA 4PJAB 4YLBA 2GB2A 4O2EB 1KJ3L 4L1HA 2MCAA 3FQ1A 1EIBA 4XBPA 1U9KA 3GNML 3UMTA 3NYKA 4L37B 5EO0A 1MCSA 3NH7L 4L4VB 2WZ0A 4WI3A 4ABVA 5DTFA 5KYUB 1NBZB 3BZFB 5DHYB 4FTVD 1WV7T 3L3IB 2IPKB 2IFGA 4IRSD 3OHXC 1TTGA 4KO6A 1FN4B 1KY7A 3P4NB 3GSOB 1JZ7A 1WWWX 4A7GA 2V8MA 3D30A 2FSDA 1Z9PA 1WFTA 4XPBL 1KXVA 5JHBA 1RIVH 4YHLH 3MRQB 5F9JB 4JY4A 4EN3B 5ACZA 5C6TH 4OKVA 3H3KA 4NLAA 4BH8A 1QBMH 2AXGB 2HJKA 2VZUA 4G7SB 4MJ5A 1CICD 4F37K 1JZIA 1F8TL 3B2XA 1OT4A 3D09A 4Y2DD 1T04A 4ZW8A 3TYFB 2QEJA 1ID2A 2IAND 3M1OA 4XODA 5D5MF 4ZODA 3RWIA 4EE2A 4L9LC 1XSJA 4FLSA 4AVHA 4A04A 3DJRA 2KYIA 1DSFL 1IM3D 1Q1JL 2FEEI 2VDOL 3VCLA 5I5MA 1VDGA 2D3JA 3RJDA 4KC3B 4YPJA 1MCRA 3IXTB 5KVEH 1KJVA 3PV6A 2F9BT 5EUKA 1DP0A 1QSFD 2QKIC 1QWUA 3PL6A 4HWZB 4PSPA 5EBMA 3VM7A 3QWQB 4Z7WE 5DHVH 4E42A 2E76C 3GNMH 3CCHA 1TNMA 1R6VA 1WC7A 4XRCA 3LXCA 1Z5HA 1AE6L 3OKKB 1E40A 4HAKA 4RAVB 4W9EC 4WO4A 1A7OH 4AYFA 2ADIB 2VR4A 1NFDF 4Q9BA 5CNHA 4YSTA 3VFVB 1HOEA 2R69A 4NQQA 4U6HA 5KS9F 1FO0A 1H3XA 4IRSC 4E9XA 4KUCF 4KUZL 2RR3A 4KRMB 3D39A 3BEWA 4EDWH 4C4UA 5K59F 2F08A 4MMYA 2EXYC 2VWEE 4ONFH 4TNFA 3BMVA 4J8QA 1A8JH 3KPPA 1QSFE 3VXSE 3QQ9C 3LEYL 4KRPD 2KPWA 5IQ7H 4HZ1A 1MDAA 2E7HA 3BW9A 2E56A 1JXFA 4OZHF 3RFZB 5GZOD 3O4OC 2EUXA 4D3CH 1NSNH 3HB3C 3W0WA 2V7HB 3MV8E 4Y88A 1YN6A 3KS0H 5GGRB 2WQAA 1YYCA 4JDVA 4X6DF 3WY4A 4I5BB 3ECWA 5HHOD 4PS8A 1TVHA 1KIQA 3GS4A 1DO5A 5F3HA 3KDPB 4CN4A 4JANA 3RKDD 4HVBA 3INUH 3LKQB 4KZEL 1JS4A 2F7QA 3LN9A 5DJXA 5I0ZA 2Y5EA 3IMRA 3OMZA 4EPSA 2X88A 2QSVA 3GMLA 3LIZH 3GGWA 3RTQD 4NAJA 3BEWB 1D9KD 2N7BA 2I9TA 2HFTA 5L4JA 2H0JA 3C8DA 4MZ2A 2V9TA 4AM0A 4PJHA 4OIIL 2E8YA 1HOCA 1B3JA 3B7RL 1IAII 3O6FB 1NTDA 3U1QA 3U82B 2AK4E 4QRRD 1BECA 3UTZA 4RQQB 2X2HA 4JDZB 1BAFL 1ITCA 1D5IH 4JY6A 3WHXA 3M46A 1T2JA 1A6ZA 5JXEA 4G83A 4NKDB 1QASA 2HKHH 2Q86B 4KTDL 5BV7B 5EZJB 4Y8AA 1RULH 3F3HA 2JKNA 1DFBL 2YAQA 3RNQA 3TV3L 5AD0A 4LQFL 1YN6B 1BAFH 1D5IL 1T1WB 1ZVHA 4KOCA 3U9WA 2X4TA 2EYSA 3KR3H 4BD4A 4EI0A 3OAZH 3WYRA 4BFBD 1TJHH 1QKZH 1TQSA 1QO3A 2F74B 3DI3B 3BUIA 5ILTH 2BY1A 4NX0A 5E99H 3KPOA 4NO0D 1YYLL 4PCKA 1QLRA 1YNKL 3EJTA 3QJOA 4WI7A 3US9A 3VFSB 1J9RA 2IV8A 3W38A 4PGEA 4AQ1A 3ALPA 4AYEC 1SEBB 4LPCA 1T89C 3JWOL 1X5MA 4OGYH 3O6FD 4JVUA 3EGXA 2WCGA 3NCMA 3OKEB 1F18A 2BRQA 1WYJA 3OF6D 4P8QA 3LNDA 4M6ML 4PI0A 4JRXE 1IKFL 3QDGD 3QI9B 3BO8B 5K9OA 1YECH 2CO3A 3RGHA 1V27A 1YYML 2DQCH 3PP3K 3TBTA 3TH3T 2IMMA 3QXAA 5D7JC 1O6TA 2H3NA 4MMZA 4NFCA 3Q2CA 1RZ7L 5DD5H 1VEOA 3CUPB 3E9UA 3QUYD 4JCWA 5HDRA 2F53E 4X7CC 1TXKA 4K7PL 1A4JA 4RAUB 3RX8A 1TO5A 1GGBL 4DN3L 4KKCD 3ZK0A 1DFBH 3SKNB 1MF2L 5HDOA 2WWKT 1BQHG 3HMXH 1CBVL 1AZRA 3SYOA 4GIAA 3PWVB 4YEFA 2VJXA 4RFNB 4X5WA 3VX1A 3TJEL 1IILE 4JN2B 4Q7DA 1AS8A 4ZPTA 4FXLA 4PJCA 3ZKSD 3GHEH 3OM3B 2DB8A 1NCAL 4WW2A 2YPKA 3BGAA 2M26A 5CHNA 5DEGB 3NFNB 3CVIL 2R2EA 3IGAA 2D7MA 4OGYL 2XFXA 2YQGA 5BOPA 5I0YA 3MRPA 1R3HA 1ZK5A 4G8GA 4HV8A 2EDXA 1LL1A 2P5EE 4IRZL 3RI5K 1UWFA 1EJFA 2Z92A 2ZCHL 3QDAA 4Z7VF 3K8KA 3W0WE 5EIIG 4JG0H 2XLLA 4TL4A 3PDOA 4OI7A 2CUHA 3ZMEA 4PWHA 3AFLA 4TUJA 5D7SH 4Z3GA 1E0OB 2V7HA 1KF9B 4PLJC 2NUPB 3BVXA 1E9QB 2NY0B 4F57H 3OG4B 5LQBL 2VITA 4JDVB 5I1JH 4J3OH 4ZTOL 4OCYH 4YBQD 4OSUH 4DTGH 2WKLA 3L54A 2P9RA 1BX2A 5T5NF 1LP9A 1D7CA 3PNRB 1ADQL 4X4ZA 5ESVB 4BE5A 3N1QC 4OCRL 3DXAD 2Z31C 1VA9A 5ANMB 2HMID 5F7KC 2EE3A 1AXTH 1IGIL 4ODXB 1G7LB 3UTTD 1V7NH 1WS8A 1BIIA 3CMGA 2J88L 3OX8B 4OCRH 3V7AE 3K6FA 3CZEA 2DQHH 4DEWA 2WBJC 3GSWB 3N9GL 3Q2WA 3D0LB 1CD1A 1WTGT 3ZQWA 3KPSD 1RZJL 2ICWJ 3UTSA 1HCYA 2YKKA 3O45B 4NQCA 4HDIA 2ZKHH 3HBGA 1MEXH 4F8TA 2AK1L 4JGJA 4ES8A 5D93B 4QKTA 1F00I 4GRMB 2G3XA 4K3EH 2P80D 1BBDL 5HD8C 3BZEA 2DWYA 1T0MB 3ERXA 1AIFB 3GZPA 4PIBA 5GRYA 4L05A 4HULB 4MBRA 2VE6B 2WXHA 1YN7A 4G2AA 2ESVE 4DPBX 5ICZB 1KYFA 2XWJB 3C60A 4PLKD 1SXCA 5E2TL 3ULVF 3V6BR 2GTWA 3SDXB 3P3SA 1Z9NA 2DDQH 1UD8A 3MGAA 4QHLB 3VG0H 4E5XB 4UT9L 2XA8H 3A6CH 2DQGH 1SY6H 3J8F7 4YWGH 1KLGA 1XF4A 3FUIA 4JQIA 6FABL 2GJPA 3NESA 3D05A 1WIUA 3QS2A 1ECYA 3DO7A 2A0LC 1J05A 4JRYB 2GVYA 1Q90A 3ARDD 2FCBA 2UZYB 3E38A 1CZ8L 5EU4A 3T0VA 4JFFD 1XH0A 4M4RA 3FB8A 4FCAA 4FFWC 3UJJH 2Z35A 3ZHKA 2OK0H 5JW4M 1QSVA 4AXWA 5D1XC 3MV9B 2CJTA 2WANA 3AS3A 1KV3A 4EIZC 3FFOA 4LKCA 4QY8A 2CLRA 1ZPLA 1FZJA 2VLLA 3H2PA 1PNDA 1AS7A 2L04A 4G6MH 5HYSA 1GZPA 2JXMB 3LQAH 2X4NB 2YXFA 2CKBH 1AGDA 2A6DA 2DMBA 2X1WL 2ROXA 5EPMA 3L17A 5B21A 4YGVB 2BMKA 3GMOA 4JO3H 4NRZA 5D1ZA 3FTZA 4MCMA 4P5SA 3ET9F 5E8NB 3STBA 4A55A 4K9JA 1EXGA 1HQRB 3A24A 3AWEA 4FG6D 1QQDB 2DWDB 4HT1L 4RETB 5DR5H 3QHZH 5LO7A 1P7QB 4MS8D 1JNLL 2AF2A 2JV6A 3KYKH 3OHMB 5L88L 1T5XA 5IV2A 1E6JH 3IFNL 2J4WL 2XXCB 4UT9H 3WKQA 3FYEB 3MLXH 4D0BA 1RHFA 4JN2A 2AEQH 2MHAA 1UVQB 2PLTA 2HFEA 2JI2A 2W65B 5J6GA 1AKPA 1BF2A 4KO5A 4ODTL 3BCFA 1QPKA 4GIPD 4ZFZB 3ARDC 5J4MA 2AAAA 2HT2C 4JW3A 1DJWA 1BZ7A 1ZSHA 5KS9E 4YXHL 2Z1KA 1IE4A 2DL9A 2YC1B 1MWAA 4YQXH 2VXTL 3DO7B 4JRYE 1SM3L 5D55A 4B50A 1P4BL 3KPLA 5BO0D 3I2CL 5ALBH 3S5ZA 3ZZ1A 2GSIB 1W8NA 2W0FB 3WL9A 3L4CA 3H85A 1Q1PA 4W9FC 1SYVB 4L4TA 1ZWIA 1ML0A 2VRQA 4NN7B 2IH9A 3GD1C 3K1DA 1PL3A 1TTAA 3TV8A 4XXDB 1SVZA 3I2CH 5ALBL 1NAMA 3L4TA 5I18L 3ILEA 2KPNA 2I07A 3LEXA 4GG8A 1HILA 3T8XA 2V9RA 5EPMB 2HP4A 4YO0A 5EOQL 3UZQB 5DC9B 4KWUA 4DO6A 1EHNA 4I8DA 3ECBB 1LO5A 2OMYB 1F90H 1S7XA 5FYLE 1WBXA 1JVLA 3DVGB 1DQDL 3KPOB 1QTPA 2VSMB 3C5ZA 4HC1L 1AJ7L 1CFBA 4KQ3H 5E6UB 2NW2A 4OIIH 4MDJA 1ZS8B 2OYKA 1GOHA 2VMJA 3IJYA 4MRBA 4X7TB 1XL4A 4NQCB 4LSRL 1TTCA 3R0NA 1GMIA 1FFOA 1NFDE 2G75A 1KEML 1OT1A 1W0YT 3J7HA 4KY1H 4WEBL 4XP6H 3S5LG 3T4YB 2J2ZB 4O02A 5DHEA 5T3XL 3WEXB 4NC0B 3CSYB 3QUZB 1CLYL 3HMXA 5I5IA 5HHOB 2VXSL 3UIYA 4JKLA 4JGUA 4EI5C 1MOEA 2DM4A 4NERA 3UEQA 4A7VA 4ODVH 2H3NB 3PQYB 1AO7B 2K8MA 3GRGA 4Y4KD 4D8OA 1XD1A 2PPDA 1WSST 2ZWKA 4FNRA 5ICZA 5F89B 4FP8H 4MJ2A 4ONGL 1YYLH 2A74B 3MBXL 4XPGH 4YSOA 4AJ0A 5E6IC 4ODVL 5ECGA 2ODHA 4I0PD 5DO2C 2CXKA 3MO1B 1J87A 3CFEA 5KTEL 2WNGA 2WLNA 1P69B 4KI5F 1EWHA 2W1NA 2ZG2A 4OCXL 3EO9H 1AFVH 1HINH 2EO9A 3OD3A 4AZ8B 5C2UB 2D73A 3NDYE 3BZ5A 5AOMA 1W8OA 4GPVA 3RI5F 1M6OA 2P8LB 5JORB 1HSAA 1XWVA 3EO9L 4NZJA 3HC0B 1B0IA 1WICA 4L1SA 4OJFL 4X8JA 2F58H 1J1PH 4RNRB 3B1TA 3TA3A 1CFQB 3NPZB 3DIFB 4YHYC 5HI5C 4QRBA 1FPTL 4ENZA 2G60H 1HHJB 2EIMB 2I69A 4JHWH 3IBEA 4X7TA 2V33A 3HJ0A 1JRHL 4DP7X 5T3ZD 2LTQB 4LKXA 3ME0B 2EVFA 2HTKD 5E5UB 5E7BA 3BP7B 5KVFH 5HDQL 5GRUL 3KPQB 4P3CL 5D7IB 1G6RH 2FZ3A 2G60L 4IGBC 1I1FA 3LJ3A 2BH0A 5FYKD 2XVKA 5FEBA 2G9KA 2GC7C 2XDHA 4JHAH 5D1ZB 5HDQH 1I53A 4N9GB 1RERA 3MCKB 3KPNA 3FB5B 3H4FA 4HGKC 2CO7B 4HH9B 4H1LG 3PG2A 2BNRB 1IZKA 3FQXA 4IBQA 2ZSVA 1YY9C 2AJUL 3R4DA 4G5AA 1YSOA 3WD5H 2ENSA 1DBAL 1NMAL 3B2MA 2GYSA 3FDWA 3WNKA 1A47A 3I02B 5JHLL 4F9PC 1D2OA 4C47A 4RMQA 4OZIB 1UJ3A 2JKRM 1SEBA 4DEPC 5LCVH 5JHLH 4PTTA 1YEFH 1MKFA 3ABGA 2P4AB 4UOJA 5ICUA 4S1QL 3TIEB 3OGCA 4Q6IC 3WN5B 2X0WA 4Z95L 3F05A 2VDRL 3MRBB 2WGXA 1D6EA 2WLMA 1S2EA 3I3DA 3EF4A 4PCSA 3FT9A 4QOKD 1ZVNA 3E6HB 5LCVL 4XHJD 1S46A 2WZ5A 3RQ3A 4HWNA 3MLRH 1YG9A 4GQZA 2EXWD 1VFOA 2CR3A 5CEZE 1FZKA 4ODUA 1QVOB 43C9B 5I1IH 4HOXA 2R8SL 2X4RB 2R29A 4O5LL 2ED9A 1U3JA 4NXSA 5ENWA 4I0KA 4L1BA 3VE0B 1THCA 3H9YA 4M5ZH 1XZWA 4L3EE 3EO0B 4Q74A 4YPGA 4G1MB 5DFVC 1J5HA 1JZDC 1S7XB 1SHXA 1KB5B 3CCHB 4XRCB 3ROOB 5LN8A 5JHDD 5EHFA 4JHVA 1ZLSL 3QA3B 1EK3A 3LKPA 3RZCB 4TM9A 4IOIB 4ZX3A 1PG7H 1SVCP 1T5WB 3GSNA 4FQXB 4U1KB 2A6JA 4WUKH 2FECL 2A9AA 5IM7B 3JV4A 2PR4L 3Q3GA 1AIZA 3ARED 4DEPB 4DFHA 2NMSA 5KYXB 4OM0L 4TUKH 4NGHH 3QUMA 1D6EB 3QFJA 2Q6WA 4ZG1A 2IBZY 4MJIE 3HS8A 3QEUB 4DOHB 2XN1A 2CLZB 2F19H 2XPGA 1F41A 3NZ8A 2NTSP 3C5XA 4FQCH 4PJBE 3AGVA 1TLMA 3FF7A 4BWUA 3ZDXB 3AVEA 1G1OA 2E6QA 1MXGA 1I1YA 5F7BA 2EQDA 4PJEA 4DP5X 5HYEA 5D2NB 4JEGB 2F8XC 1BJ8A 2Y7MA 1FVEB 4LLYA 3ZHFA 5I5RA 4C55A 1Y6NR 4XO8A 5D5ME 4LZKA 2DIAA 5IHZB 3HBQA 2JI1A 1OOWA 2XI9A 4I18B 2G9HB 4LBEB 3AXLB 5SX4H 3WFEH 3V0GA 1XO8A 3RYMA 3BAJA 4AY0A 3FSZA 4BQ8A 4GAGH 2XBZA 1HH9A 1FYTE 5DFAA 5BRQA 1LQSR 3Q5TA 4AGPA 3OHXA 3QUHA 1ZHKB 3E8UH 2D0HA 3S3JA 4ZNEE 3D4GA 1MCNA 1OSZB 4HIEB 4ILDA 3S7GA 4O4YH 5IQOA 2Y3NA 3O41A 4W6YB 5HDWA 4Z7OE 2A77L 4K7FB 2D8KA 3CFKB 3SDCC 4HJSA 3REWB 4KZ0A 5DR5L 3NP4A 5HYQA 2GUYA 5L88H 3AU1B 1HYSC 1AI1L 4QCIB 3VU2A 1JHKH 1AS6A 1NC2A 1B2YA 2GBTA 3OZ9L 4PJEB 1AQKL 2AEQL 2XU9A 1DJXA 5DA0B 4XC1H<