1A3ZA

Reduced rusticyanin at 1.9 angstroms
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
TWKEATLPQVKAMLEKDDGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGHAATGMFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUSTICYANIN
publication title Rusticyanin: Extremes in acid stability and redox potential explained by the crystal structure.
pubmed rcsb
molecule tags Electron transport
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 1998-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1a3zA00
3FSVA 1BQ5A 1GY1A 1L9RA 3NJNA 5AZUA 2H5UA 2TSBA 1ZPUA 4KO6A 2VM4A 3UAEA 1ZIBA 3PAUA 3QJTB 4N4YB 2YAEA 2UX7A 5EHFA 3TBBA 2PPAA 1IBZA 2J57A 3PLYA 3SBRA 2HX8A 4E9YA 1PZBA 2YQBA 1ET8A 4P5RA 2VN3A 2ZWNA 4KNSA 3PAVA 2CUAA 4YSEA 5I28A 4A2EA 4P5SA 1JXDA 4YSDA 1WA0X 2XX1A 2VM3A 5B7MA 1KCBA 5D4HA 3X1FA 2IWEA 2Q5BA 3JTBA 1NIBA 4G7RB 3QJUB 2AANA 4YVNA 2IDUA 3FQ1A 2IWFA 1NIDA 4K9JA 4AI7A 5B7FA 1NZRA 1OF0A 2HX7A 3D12B 3S3DB 1NPNA 1A65A 4AX3A 2XVBA 3CZUB 3ABKB 5TK4A 2YAOA 2WO2B 4DP9X 1YLBB 4E9QA 1MG3C 3MX0B 1N70A 4GYBA 3SQRA 4E9TA 1FA4A 2HRGA 1PZAA 3CG8A 5ANHA 4W9ZA 3C75A 1RZPA 4L0PB 3CVCA 5I6PA 4YSAA 4F2FA 2W88A 5B1AB 3NYKA 1F56A 4YL4A 1PMYA 1KBVA 1GY2A 4WKXA 3PCYA 5I5JA 1NWOA 1WA2X 1AZCA 2XXGA 2J55A 5A7EA 3ASOB 1L9PA 4F2EA 2PPEA 5TK2A 2X87A 1KYAA 4F7KA 1IKOP 3FPYA 4A2GA 2DYSB 1KCWA 1WAEA 2BWDA 4HHWA 1GS7A 2MRYA 3NJMA 4YSQA 1L9OA 1OCZB 3H56A 1XB6A 2VW4A 1BYOA 2XUWA 2YAHA 3S8FB 3ERXA 2CALA 5B1KA 3V9CA 3NJHA 1KBWA 4RH4A 2IAAC 1JXGA 2FNWA 1OCRB 1ET5A 5I6NA 1DYZA 1HAWA 1E67A 1PF3A 4Q8BA 5B1BB 4UANA 3KW8A 1NIAA 2BP8B 2PCYA 1EZLA 1FWXA 2P80D 3CDZA 2AFNA 1KV7A 4EF3A 4BDVA 3X1EA 1GW0A 2IDTA 1QNIA 2PP8A 3NJJA 1SJMA 5B1JC 1BYPA 1E5YA 3CVBA 3AY2A 4BXVA 5E9NA 1BXVA 2HX9A 3NSFA 2FQGA 1BXAA 4HIPA 4JKNA 4A68A 3MBWB 4PCYA 2VMJA 4TXVB 1SFHA 1SNRA 1M56B 3AG4B 2DY2A 1AS6A 6PAZA 2FT7A 3HB3B 3TBCA 1OCCB 2YAQA 3FU9A 2ZOOA 3ZBMA 1AAJA 2VW6A 1B3IA 5B7EA 1HFUA 2BW5A 4YSTA 2LLNA 1AZNA 2HXAA 1PLBA 1ILUA 1CURA 4A2DA 3ABMB 3NP3A 2XWZA 3OMIB 1OV8A 2AVFA 2EIMB 2FTAA 4DP4X 4E9SA 3UGEA 1JZIA 2OJ1A 2E86A 4YSRA 4BWUA 2JKWA 2FT6A 2UXVA 5I5MA 4YSUA 1W6LA 1XB3A 3NSYA 1E65A 1M57B 4JHVA 1IC0A 3OMNB 3X1GA 2Q9OA 1A4AA 3ZDWA 3T71A 3X1NA 9PCYA 4YSSA 1AOZA 3QJSB 1UATA 3FU8A 4HHGA 2CCWA 4YSOA 1CUOA 3BVDB 2IDQA 1OOWA 1TEGA 1DZ0A 4BWTA 1SHWA 4DP5X 1HAUA 2BZ7A 2YAMA 2PPDA 4CSZA 4AKPA 1OE2A 3IBOA 4YVUA 1JXFA 3T6ZA 2PP7A 4NAJA 1CC3A 4UF7C 1KDIA 3QJRB 4QLWA 1AIZA 1GS6X 4G72B 4G71B 4CSPA 3GXUB 2VSMB 5B1JA 2JFCA 4G7SB 3PAZA 1I53A 1PCSA 1A4BA 1ZIAA 2BZCA 1V10A 2EILB 2VSKB 2RACA 4GP4B 2FQFA 4M3HA 5B3SB 3QJVB 4Q89A 4W1TA 4QKTA 1L9SA 2HRHA 2GSMB 1BXUA 4DP6X 3QPKA 3EHBB 3FSWA 1BEXA 2FQEA 3PPSA 4DPBX 2YARA 4A67A 4PAZA 3ZX1A 1L9TA 3WNIA 1WS8A 2HZHA 1SDDA 1TU2A 1ZDSA 4UAHA 2R7EA 2FT8A 2OV0A 3EH5B 3FPXA 3N2JA 3IEAA 7PAZA 4X4KA 1AZBA 3FQYA 1QHQA 1JVLA 1PNDA 4HALA 3DIVA 2XV3A 2H47C 2YAFA 5I6OA 1ETJA 5AFAA 1JZEA 3NSCA 1MZZA 1OE1A 3WI9A 1ASPA 2PPFA 3TA4D 1ET7A 3FU7A 3H4FA 3IN2A 4YSPA 2ZXWB 2IWKA 2MTAA 2N0MA 2XLLA 1IBYA 3FQ2A 4HAKA 1SFDA 1VLXA 4FAAB 3JT2A 1ASOA 1R1CA 2P80A 2BO0A 1AS8A 5F7AA 4N8UA 1OCOB 2XV2A 1NIEA 3NSDA 2PPCA 1BQRA 1WS7A 3HEIB 4BWWA 1NIFA 2QDVA 4ZK8A 3OMAB 2HLEB 2BP0A 2CBPA 4HZ1A 4A2HA 2GIMA 4E9WA 3FYIB 3ZIYA 1ADWA 3CDZB 3FT0A 4G70B 4BDVB 1JZJA 4HCGA 2NRDA 4DP8X 5I6LA 5LDUA 1AG6A 5FC9A 2XXFA 4M4RB 1M9WA 4KO7A 1E30A 1ASQA 2DWSA 1ILSA 1J9SA 2BW4A 1ZDQA 2FQDA 2X88A 1SF5A 1ID2A 3EH3B 1X9UA 4BXSV 1GSKA 1IUZA 3CVDA 5D4IA 2YXVA 4AZUA 1W6WA 2WSDA 3UAAA 5I6KA 5AKRA 5PAZA 1X9RA 1JZGA 3WKPA 2A3TA 1PLAA 2PCFA 4YSCA 1KDJA 2DWTA 4DP1X 1J5DA 1AACA 2B08A 4MFHA 3SBQA 3U25A 4NB7A 1W8EA 1BQKA 2OCCB 1V54B 2AZAA 2H3XC 2CJ3A 1NTDA 3FYEB 3GYRA 3IN0A 3RYMA 3ASNB 2GB2A 4AKQA 3S3BB 1CYXA 3ABLB 3OM3B 6PCYA 2PLTA 5I6MA 4KOBA 1JERA 1A4CA 1AZUA 3X2QB 4AKOA 1J9QA 1SHXA 4KO5A 2PP9A 3OD3A 1J9TA 1AANA 2J5WA 4HCFA 2QDWA 1QLEB 2B3IA 3AG3B 1OE3A 2EIJB 1TEFA 2TSAA 3NT0A 3T9WA 3TU6A 2EIKB 3NJGA 1A3ZA 4E9XA 2UXTA 4NERA 1J5CA 4A2FA 1TKWA 4ENZA 4JHUA 4GY4A 4FA7B 2GC7C 2DYRB 3WG7B 4E9VA 1NICA 2GBAA 2Y1AA 2I85A 1JZFA 3DKHA 3N55A 5D4JA 4E9RA 3KW7A 1JOIA 1JVOA 1NPJA 3S3CB 2GC4C 3H4HA 3FSZA 7PCYA 1XMEB 1AS7A 2J56A 2VW7A 3WIAA 3TASA 2XYBA 1PY0A 3BQVA 3ABGA 3UABA 1RCYA 2Y69B 4KO9A 2AZUA 2QPDB 3S8GB 1GYCA 1CYWA 2FWLB 4DP7X 1SF3A 1SDDB 2BWIA 1T5KA 2XX0A 3WNJA 2JXMA 2R7EB 1URIA 4DP0X 1AR1B 1MG2C 3NP4A 3PXLA 2I7OA 3FS9A 1AZRA 1PNCA 2GHZA 3NJFA 3DTUB 1RKRA 2UXGA 3QJQB 5F7BA 3UACA 1NINA 1NWPA 3SBPA 1NDTA 1PLCA 2CAKA 3AW5A 2IDFA 3AZUA 4A66A 1FFTB 1AG0A 2GI0A 2EINB 4BK5C 1MZYA 1A8ZA 4GXFA 3FU7B 4KNTA 2BP8A 2IH9A 2BHFA 3T6WA 1BAWA 4HCIA 1J9RA 3NJKA 2IH8A 2YXWA 3IE9A 3NJLA 1GR7A 1PAZA 1XB8A 1JZHA 1V55B 4WTQA 5IY5B 1N68A 2XU9A 2UXFA 4DPCX 2UX6A 8PAZA 1RZQA 3GDCA 5PCYA 4DPAX 1E5ZA 3UADA 4KOCA 3V9EA 3NJIA 3QQXA 1WA1X 1KGYE 2BP0B 2ZONA 3WKQA 3EF4A 3AG2B 3FSAA 1GS8A 1EHKB 3EH4B 1MDAA 4GP8B 2DV6A 2IDSA 2W8CA 4G7QB 3T6XA 3T6VA 4DP2X 2I7SA 1AQ8A 4GP5B 1L9QA 3G5WA 2YAPA 5I26A 1ZV2A 2QT6A 3AG1B 3OQRA 1PZCA 2QPEB 2XV0A 2WO3B 4KNUA 5I5IA 3L45A 3X1BA 2FJSA
chains in the Genus database with same CATH superfamily
3FTXA 3ISRA 4HIIA 1PSKH 1OAKL 3VXRD 2NOYA 3VXQA 2XVKA 4FYTA 1I8MA 2VIRB 3BKJH 2JCCE 5EO0B 4PCKA 3QHTC 2E47A 3QHFH 3WSQH 4KGLA 1TJIL 4LSUL 5DO8A 2NNRA 12E8L 2ZWNA 3LIZL 4NHUA 3BVTA 4N90D 5EOCJ 1JCKA 3QEUA 3KL5A 4TOYL 4PJ7E 1MI5A 2VM3A 2FWOA 1WCBB 3FONA 4OQTL 4RAVB 2ALWA 3UBXA 4G42A 2BOLA 5AAWA 2E76C 2X2IA 1ZT4A 4X9FA 4BK8A 3CVHH 4FYQA 5FCUL 4U0RC 3O2VL 4FLHA 4QO1B 3APDA 3PWVA 3U6XS 4Z9KB 5HSFA 2ICCA 3A6BL 1IFRA 4CSTA 3C6SA 3ZTNL 4XI5C 2HVKB 2ZX9A 1IM3B 4WUUA 3VVVA 1WHOA 2ZOTA 3QPQD 1I1YB 3Q8CA 2WIIB 3VXOA 3QNZB 4P23D 5GRWA 1EEYA 2XFXA 3TH2T 4IJ3B 3PGFL 1VFBA 2BNQD 4O2EA 2LR4A 4H25B 4N3UA 4P5TC 4QRPD 1RZPA 3HVDA 2WJ5A 2XTSA 3IJEA 4QRAA 4J3OF 3EBHA 4AQ8C 5DA0B 2QVTA 5CS7A 3V0WH 3KWWA 1GYAA 3RTQC 2R2HA 3ROOB 4WI0A 4MMZA 4S0HA 3ZVVA 4UINH 2UYLA 4X8GA 5EO1B 3PCYA 4WKZA 5I5JA 5K9OB 2Q20A 4JQIL 3AVEA 2F68X 2VLRE 1O5PA 1MFMA 3D2UB 3PWUA 1S9XB 5TDNB 5A16A 4P04A 2J55A 4M7ZC 1D5ZB 3QZWG 5TK2A 1IBDA 1U4EA 4P9MH 1KYAA 3KPSD 4U1GB 2NY5L 2CO6A 4TSAH 1VF5C 5K9JL 1T6VN 2B4CC 3UTQA 3C09C 3VGFA 4JO8A 1EANA 3M8OL 4N9OB 4W4NA 4WI9A 4G8GE 1P0SE 4MHHG 3B7TA 2VDKL 4IRSA 4PRHD 3S8FB 5D7JC 4EVNA 4K8RH 1M4KA 1QYGL 5GRJH 1K8DB 2F7OA 3FHQA 3ZQWA 3N43F 5LWYL 4KKCD 1MCBA 5E51A 3NCWA 4FQIH 3ZYIA 1P5VA 5DD3H 4K9EL 3ZL4L 2ZXCA 4Z7OE 3FT3A 4Y9EA 2OKMA 1E67A 5B8CA 4XPGL 4Q6IC 3CCHB 2OBGA 4MWFB 4ICXA 3FRPB 4PG9A 4Q0XL 1OQOA 2PABA 4R5XA 1PFCA 1R47A 1AI1L 2CJUH 4BDVA 4RGNC 1UTDA 5MEQB 3UGXA 2IGLA 4QRSA 3INUH 1X4ZA 2P8PA 3KVQA 5B1JC 2YUVA 1E5YA 4JN2A 4OD2A 1ZXKA 1R3HB 3TO4B 5CBAB 4A68A 4JO3H 4JKMA 2OR9H 4PCYA 5DJ8A 1OAJA 4X2UA 1YMHA 5GRVK 1EERB 2VMJA 3P3YA 4U1MB 3FOLA 3VX1A 1BIHA 1JWUA 1MRDL 4WAFA 4UCFA 1U8MB 1PKQA 1TYRA 3LRKA 1U92A 2A6KB 3HB3B 4N87A 4O2FB 2F58L 1PDKB 4QDGA 3Q9PA 3OZKA 4ZUVB 1KGIA 2BHYA 2WWKO 1LDPH 3DX8A 4I4WB 4IRZA 1VJSA 3QS3A 4YSTA 5LGHL 3UTOA 5FGCB 2IV9A 3NP3A 4A2DA 1NFDF 1XXFC 3IYLW 3H85A 3PL6B 1VPOH 2CLZA 3FOMA 4L4TB 4CU8A 5D2NA 4XOEA 1Y18A 3FT4B 5T33H 2EDOA 3CUPA 4QHUA 1WC7A 3WS3B 1L9NA 4E2OA 3U0PA 1L3NA 3I9AA 1CMOA 2GITB 1MHEA 1N6UA 1AYRA 2DMHA 2Q9OA 2ILLA 1XZ0A 5HJGA 5LHDA 1RJLB 2DL2A 4O02H 1BLIA 3LJ3A 1U3HC 2QR0A 3VXMA 5JOFA 1JI2A 5FLVA 2ZWYA 5GZOA 5JPNA 5FO7A 4HJJL 5F9AC 1QNZH 3IMUA 5HDQH 2BZ7A 4JHBA 4IU2B 5J3HD 2ITDB 3N43B 3MV01 4S1RL 1BMZA 2HUHA 4OCXH 4M00A 5EULV 1GZHC 2EQDA 2CXKA 3GZQA 1GCFA 3KD4A 3LZLA 5I0WA 5JHLL 3HNSH 4W9FC 4K7FA 3LPPA 3PAZA 1YC8A 4H26A 4D7BA 1F4HA 1L0QA 1NC4A 2GFBA 1IE5A 4XC1L 1CF8H 4FXKC 4Z8FH 4GP4B 1T1XB 1CXHA 1AGEB 5AALA 4N5EC 5ADOL 5CD3B 4TNWK 2N7AA 2XA8L 3F00A 4L3AA 1WVZA 4IMKC 2FQEA 3MV8E 5M94B 5CJQH 4I87A 4MJ6B 4NJ9H 2J25A 4RRPG 3AADB 4UDUA 3O41B 2GT9B 4CKVX 2KL6A 5GHWL 2LAAA 1DN0B 5GS2H 1O7DC 5IROD 2FT8A 3T5WA 1XF4A 3BJLA 2VISA 3FPXA 3N2JA 4ORGA 4QRRE 1ANUA 1LDSA 5DZLA 5E4IA 5ANME 2FO4A 5K39A 2WBKA 5IG7B 3L4ZA 3FTYA 4LCWD 4IKLA 3VFMA 2ZSWA 4V1DA 1G7PA 3MGTA 4OGYL 5TDOB 1NFDB 2P5EB 4LHUA 5BRZA 4GW4A 5HYQB 2H47C 4NP4H 3S36X 3CPUA 1U2CA 1T22B 5AFAA 4FKEA 3ZR6A 1JGEB 1YNTF 1AO7B 3TJEH 4BKTC 2EDLA 5E9DA 5GS0D 2NQ3A 5AVRB 2YD0A 3MA7A 3QE5A 3ARWA 4GMSL 1RK1A 4JPWH 4K3EL 4DVBB 2QQKL 4HKJA 1YY8A 3A4AA 4RNRA 4NOBA 1INDH 3FQWA 3Q8EA 4PIBA 1JNJA 1LP9E 2X5PA 2JF1A 4HP5A 5L2KD 4WWPA 1JPGA 1Q9LA 4NQCD 3HEIB 3WO3B 1NBVL 1NIFA 1SEQH 3NPZB 4HBCL 4ZK8A 3VI3A 4B7LA 4NZJA 3U9PH 3A4EA 3MV9B 4IJ3C 3PPEA 4AYFA 3DARA 2G75A 3HRZA 2E74C 3FT0A 4AEIH 4IK6A 3LS5H 3L2NA 5CZKA 2G5BA 5C6WH 3JUZA 5IM7A 3GMLA 4NKMA 4G83A 4U3HA 2E5EA 4MXQC 1A9EB 1IARB 1LK2A 3FQNB 5DRZB 4HFWB 4F27A 1B0RB 3BH4A 2AW2A 5FGSA 1YA5A 2QELA 3MRPB 4JY5L 3BLBA 4Q2ZA 5E6IB 1I8LC 1QBML 1QOKA 4L1LA 3TBTB 3WFHA 2YXVA 2YA0A 3LH9A 4JPVL 5ETUB 4B0MB 1E3ZA 5CFHA 1GKEA 1XIWA 1MWAB 4KJWD 3CN2A 5DMKA 3NCJL 1T20B 4Y5XB 2QQQA 4FQ1L 3BYYA 3OKMA 1UT9A 1JMXA 4LLMA 3DV4B 4YBHA 1B9ZA 1YEEH 3VXRB 1FFOA 2V5TA 2BVQB 2CIIB 1IEBB 1Q1PA 3OGCA 5EZIH 1GGUA 2LQRA 3GGWB 3DUSA 1XCQA 2ZXDA 3EYSL 4Z95L 5FYLL 1J1PH 1NTDA 1XCXA 4GQ9L 1H19A 5JA9A 1Y1DA 4IOFD 3KPPB 4LLUA 3UZQB 3T77A 5I76A 4LKCB 3CFJA 1R19A 3HE6D 1G84A 1W8OA 2GB2A 3B83A 1AHWB 1VB9A 4PJAE 1F8TH 4PJIF 4XPTL 3LNFA 2OSWA 3IDXH 2EDWA 3K8KA 4X9YA 1JF5A 2J8HA 1AZUA 4ZUUB 5BVJB 4PJFE 4PI0A 3F7VB 5AUMA 1DL7H 4HYTB 1YNTB 4OM0L 4BZ2H 5IQ9B 3A5VA 3ZDXB 4O5LL 1OE3A 2CIKB 4FABL 1Z5LB 2CDFA 3IU4H 2P4AB 5C0DB 3MUHL 3TO4C 1GC1H 1F4XL 2FO1A 4QHNA 5AVVB 1KCRL 2EDDA 3O3EA 1L7IL 4R96B 4PR5B 4M6MH 3CU1A 1IGIH 1NBCA 4P23B 1OAXL 3QYNA 1JAEA 4E5XB 2EVGA 1VADA 5I24A 4M61A 2BNQB 4QRPB 3VVWA 5TE7H 3MRDA 4Z6AT 3P73A 1EO5A 5FDYA 3A4DA 2IWGA 4BGLA 5JO5B 3V8CA 4E9RA 2BC4B 3SE8L 4J3OC 2Y9RT 4P4RB 4H7VA 5AEAA 3UH8A 2IANB 1A7NL 1QASA 1X9LA 4XPFH 1KFGA 3PL6C 1MREH 2AK1H 2G5UA 3CH1A 3FTVA 1EO8L 2HJFA 3MV11 4RGOL 4Y4HD 4YHPB 4ONOA 3H9SA 1XMEB 3ZZQA 1HH9B 1IC4H 4FYRA 2H3NA 1TTCA 2VYRE 1FL3A 5E1AB 4U3SA 4HPOL 4KO9A 2AABH 4YMPA 4KGJA 3DROB 2VUKA 5EU5A 4B41A 3KPSB 3ZZSA 1GTFA 2JXMA 4HU2A 3IB4A 4Z5RB 1T66D 4NCC2 1YECL 2ADGA 2IQAA 2WB1A 4DUVA 3K2MC 1U8KA 1AZRA 1FC1A 1U42A 2NW2A 2P45B 2VRKA 4LF3B 4M62H 2UXGA 2J44A 3LKRB 4XNDA 4AV0A 1OP5H 3C8DA 1V7NH 3TN0A 3NEOA 2DQGL 1DBBH 4E0RA 1IKNA 3M17B 5E2WL 4PREB 5EC1B 4P2RA 2F5BL 1DBJL 3CD4A 5SV3A 2F8OA 3DA0A 1J9RA 1CBJA 4N2IA 4NUMA 3TYGH 1S7QB 3IGLA 3IMWA 4K2UL 3F7RA 3F04A 4Z1PA 4PJIB 1KC5H 1KFAL 3FQRA 2UXFA 5LUMA 1GZPB 1I3GL 3NMEA 1S9VA 3KM2A 2E9WA 4JFFD 1J11A 3V9EA 1X5YA 1VHPA 1N12A 4LLAA 3QXDA 5G5DA 1SYSB 1F1GA 1R5VA 4U6HA 4HWEH 1DQQA 5J6SA 5CCKH 3MV7D 3QI9B 4NO0A 4N6RB 1RURL 1KT2B 1URLA 3O8XA 3FB5B 5EU7E 3MRRA 3THML 4Y2OB 3DTDA 2JJTC 3EO0B 1UWYA 1P4BH 1WFTA 2ZICA 3V0IA 1CQKA 2O5XL 1S7TB 2ENQA 2P48B 4OF5A 4WUUE 5DI8B 2MOVA 2DBLH 2YUZA 3ESVF 3OKDA 4GG8B 2J1WA 3QR1A 1ZKAA 4Z7QE 3KVPA 3TEXA 1DVTA 1FYTE 1LMKA 2H7WA 3GSXB 1JPST 3NZSA 1ZJBA 3VRLF 3UROR 5ISZE 2WXKA 1T1YA 5MEPB 3BZEA 4KO6A 4JFPB 4H0IA 2CLRA 3EYFB 4HKXA 4TSBL 4G8EB 4KWUA 1YEJL 4L18A 1QKZL 5CWSA 2D7QA 5C6TH 3GSUB 2UUDH 3UP1A 4UOZA 1FZMA 1NCAL 1ET8A 1QW8A 3IXTA 1HZKA 3T0WA 4L3CB 2AJUH 5I1AB 3BRFA 3C6LD 4HEPG 1FORL 4JG9A 4YDKH 3AS3A 5MENE 5IJDC 1BBJB 4BFOA 2EE3A 2ZCLL 4PS8A 5CZRA 1S5HA 4FNSA 4HK3J 4MNHB 4PGCA 5E03A 3MA9H 4PRDB 2NYYC 1FZJB 1NIBA 2P24A 1J8HD 1MRFL 3MCLH 1OSPL 4IBZA 4QD2E 3U6RB 1J0ZA 1DEEB 1RIUL 4D9LL 1NIDA 5KSAA 2WNXA 1S7VB 5TFSH 3S3DB 1HHHA 1HL8A 3C6EA 1MY7A 1UACL 2AQ3A 4MVBC 3F12B 4N9GB 5HJBA 5FB8B 3D1MC 4WJ5B 5F1NA 1JGUL 2XWJB 3W0WA 1YEIH 4WHYG 1MG3C 2X4OA 2VZ3A 5D2LE 3QUXA 2ZF9A 2K9FB 3LQAL 4GW5A 4UTCA 4M4PA 1P7QD 3B3IA 4FL4B 1TKWB 4H0GA 1R5WB 4PJBF 3FFCA 4GQQA 3CVCA 1KSRA 4WHDA 3RU8H 3N41B 4C8XA 1F56A 3O2DA 1WFJA 1MELA 4R3SB 5C07A 1II4E 4Y5XC 5FM8A 5CN3A 4ELKA 4KKQA 3KXFA 1U93B 4EIUA 2Z6FA 2R0WH 1O6SA 1XF5B 2XXGA 3Q9QA 2BDNL 1LO2L 3ASOB 3RTLA 2FBRA 1CU4L 2V37A 3CZGA 3D3VD 5KVGL 1MCPH 1GSMA 1N5AA 2OZNA 3TJHD 5IHUH 4Y2DB 1HHIB 5EA0H 1GS7A 4GRMB 2BP3A 4LCWB 2FWSA 3LKQB 5ESVB 2WLJA 1MJJB 2OJZL 5D5MB 1OW0C 1AHWC 3E2HB 1FFPA 4S0TD 4MB3A 1T0NA 2X70B 3V6ZA 1T21B 2YRPA 1NMAH 3VJ6B 1P7BA 3KPOA 3EYOA 2IAAC 1HQ4B 3ARED 2VJXA 3P4LA 4OZHA 1WK0A 1UOKA 2K6WA 3P9MA 5JMRA 4NWTH 4NRXB 3EUUA 4JFOA 5EUOA 3QDMD 5B1BB 3RL1B 1EZSA 1C5DB 1EGJH 2WN3A 43C9A 1ZT7B 3QPQC 5E00A 1XX9C 2GABA 5L2KB 4JJ5B 4ZO7A 3D09A 4P23C 3JQOB 1HHKA 4DNLA 5F3BB 5B3NA 3FQTB 5LGJB 3LEYH 2ODHA 4OCSL 1SXNA 2IFGA 2J6EH 4JFDA 1I7RA 3ECQA 3V2AR 3DHUA 4JRLA 4JY4B 1CB4A 2K78A 4KVNH 1BQSA 4OUUB 5F96L 1B3JA 2CMRH 3NABH 1FNHA 1G7IB 4X4YB 2B4CL 4Z7IA 2I32A 4KC3B 2DY2A 2C3VB 4F1SA 5KZCB 1OGTA 4MA3B 3C2AL 4P99A 1RHHB 2NT0A 4OV5B 1FI8C 4D0BB 5ABDE 3QNXB 4MAUH 1YEFL 1TZAA 4I9WE 2K7PA 1AJ7H 1RZJH 4LSSH 2FJFA 4I5BB 1X5LA 4KK8D 3VXUA 5T3XD 2ZKMX 1NGWB 1WUZA 2FX7H 2HRPL 5DD6A 1MQKH 4WFFE 1EMTH 4OI7A 1T03L 2FJHB 4KXDA 4XO5A 4L9DA 3SOBL 1EPFA 2FLRT 5LDSA 1HHJB 1A7PH 1S7UA 4G43B 1M57B 5E9AA 2B1HH 4DVRH 3ARFA 4KKCC 3PHOB 2N1KA 3WJMB 1KB9K 2BSSA 3ZIMA 1I7UB 4D8PA 4RSVA 1IFHL 5KW9H 3US1A 2BOBA 2OMUA 3HE6B 1UATA 3U1SL 3WD5L 2F18A 1FO0A 2NR6A 3LH2H 3SYPA 4WSJA 1OCWH 1E4KA 4R9HA 1T4WA 2KLSA 4CJ1A 1QD0A 3BQUC 4NOFA 3G5YA 4OB5H 4YE4L 3OKLB 4TV3A 2E8YA 3T6ZA 1CC3A 3FFOA 3OR6A 2G9HB 1HHGA 3MRFB 3BPCB 5E24E 1DQDH 1HZLA 3QI9C 4G72B 1PCXA 1MFVA 5E9DE 3UG5A 1YSOA 3WN5B 5IQ7L 5I73B 4BKSC 3T0BA 3V4VB 4JRFA 4LEOA 1QWHA 1CFMA 2YQGA 3VFWB 2YD2A 3DX9B 5KYNA 2DQIH 2AQNA 1W72H 2C26A 2VDMB 2W0PA 2DIJA 3QH3B 2YQ3A 3Q3GA 4W1TA 1R3IH 2XG4A 4OJEH 4X83A 2F54D 2GSMB 4M43L 1NAML 3VI3E 4HOMA 4GEIA 3PPSA 4PPTA 4R83A 3RWDA 4I88A 4C59B 1OAUH 4XP5H 5JIMA 2H0JA 2OS7A 2P8MA 2NNAB 3LXUX 4JPQA 4YHOH 1BEYH 3MGOA 5E95B 4GUQA 1LE9A 3S4SB 1SJEA 1CZ8H 2R2BB 1F02I 3KYKH 5ITFB 2HFFA 3I50H 4D3CH 1LYQA 2K4AA 4KJYB 1OWRM 2Y7LA 4QNPF 5SWQB 1HT6A 3RIAF 4Q74A 4X4KA 4Y1AD 1QRNA 3EBGA 1XGUA 3W1ZA 1HXMA 4EI5D 3V8OA 3V95A 2XV3A 5HHVH 5K93A 1EEUA 5HYSA 5F89B 4DGUA 3H3PL 4PBXA 1UVQB 4L8SA 1MHCB 3GNMH 3WI9A 1C12A 2AJ3A 3HZVB 3FHAA 4F2MA 3R1GL 2ZWZA 3TPKA 1U58B 5I1CH 5ENWB 4H1LB 5DFWH 2EC9U 5J3HC 3OAZH 2XKNB 1IM9D 1OF2A 1DQKA 1A6WL 2XXCB 2WINA 2EEBA 1A1OA 4NNYB 3FKUS 3U2IA 2EXYC 3H42L 4PEEA 4RAUA 5DUJA 5LN8A 1S9WA 2VN7A 1H5BB 2PPCA 1BQRA 1BOGA 1H6TA 1WS7A 1CG9A 4FZEL 1CLOH 2ZOKB 4GRWB 4JFYA 1ZSDB 4X6CB 3SDDA 2GIYA 5ECJE 3T4YA 1F1DA 1MHHB 2J1ZA 5K9QG 3QO1A 4E9WA 2OL3A 1JZ5A 1YNLH 3L3KA 3QDJA 4XNYH 2VDPB 2CKBB 2NRDA 35C8H 1BZ9A 2DKUA 5FC9A 4UDTA 3ZKMC 1BVZA 1OD7A 4XNXL 3MV7B 4Q9RL 3RWEB 3DV6A 1NCIA 2CRIA 4JFHD 3DSFH 2VQ1A 3F8UB 5JW5A 1LO5A 3GHBH 5CGMA 3Q2VA 1ZDQA 2FQDA 2Y7NA 4LSVH 4W9EC 1MAML 1IT9H 2WLIB 2UZYA 3E1ZA 5GS1A 2XC8A 3WV0A 5BQDA 1W6WA 2ZG3A 3VFUB 2VDQH 4Z7NF 5I6KA 3IPFA 5CEXA 4EUPB 4TVPL 3G5XB 5DYOA 3VFTA 3GQFA 4XNMB 3NCFB 4MCZB 4Y2DC 1NCJA 4JFVA 4P3CL 3TCLA 1OB1B 4G5ZL 1AACA 5DHVB 3UAFA 2PTTA 3E2HC 4XX5A 1H3GA 2VLKE 4IRJD 1UGKA 1Z9OA 2NY0D 5KYUA 5E2UL 1YYLL 3TV8A 1B2WL 3DTXA 3FYEB 1UXSA 5CILH 4P9HC 4YXKH 2XPGB 1ORSA 3H9SE 3KWXA 4LAQH 4N2EA 1QI5A 2JIXB 3C6LB 1HILB 3N9GL 3SBWA 2F1AA 5KANI 3GMPB 1UOLA 3CSYB 1RZFH 2B7DT 5T3ZE 4DOHB 1ZA3B 4MX7A 5CF3A 5IFJA 1LL1A 3IMVA 3ABLB 1I85A 1I1AA 2VXTL 2BIMA 3G6JF 4KRLB 1JBJA 1JWMB 1J8HB 4LVNB 5J13B 3W9DA 2BIOA 4XB3A 2QJDA 1WZLA 5EU4B 4A6YL 5T5FL 4CVWA 4UILH 2A73B 4OGZA 4YWGL 1B6UA 4TUUA 2FECL 4OZFA 2GHWB 4YBLB 1IAOB 3M45A 2BOCA 5DEGB 5IV2A 1WQVT 1U3JA 1V7ML 5EC2B 5C09A 2EIKB 4Z0XB 1OO2A 1T0MB 2APXA 5TGBB 2WKGA 2RQEA 2IAMB 3P4MA 4JE4B 4MKMA 4A2FA 3PXJA 3DIDA 1CO1A 5J11B 1RUPH 4P2RE 4YIQA 4E9VA 4PUBL 2D0GA 3MNWB 1OGAB 4UQIM 3PJSB 3T0DA 4RGMB 2F5AL 4N2CA 3UG3A 5J1AB 1JZFA 4W9JC 3NIFB 4B7IA 1E9OA 3UPAA 2H0EA 1H0DA 3MR9A 2OPCA 4UTAA 5I2IA 1E8ZA 1AQDA 3CMGA 3EHBD 3NOIA 1U3NA 1ZTMA 4IRZH 1QAWA 3LZQA 4HC1L 4OZIB 2BIIA 3T8VA 5HJDA 3NZ8B 2WOYA 2FR4B 1EEZA 3FQ4A 1E28A 5B3JF 5C9JA 2V6HA 4UUJA 4J12A 3K6OA 1IL1B 2X28A 3HZMA 4O4YH 1CIDA 1HS6A 2VL4A 1SZNA 4AIEA 1N7MH 3D3VB 2DJMA 4QR7A 3OLGA 1TU2B 4OZGF 3C08L 3PQYB 5BJTB 1IEAA 1BX2A 3ULVF 1WGOA 4DKEH 3KG5A 4P46D 2KZBA 4Z3HA 1ZE3C 1E6JL 1RULL 1LQSR 3Q6FB 4MB5A 1NGZB 1NDTA 5JA8B 1TG8A 3O45B 1FFTB 3RG1C 2GI0A 1VACB 1MH5B 2YS4A 5KBMA 3RY6A 43CAA 3FU7B 3VACA 3B9KD 3UC0L 2I07A 1I1FA 3VRIB 1IVLA 1D5BB 2VQ4A 3QDMB 3WN5C 5I73C 4X9BA 4PRIA 1ROWA 1SMOA 1SVBA 2X41A 2IPKB 1QO3A 3DX1A 1G1OA 4K5MA 2R0LL 2UX6A 1RJYB 3JTTA 4WEBL 3TF7C 3P4OB 4AQZA 3OC8A 1G7MA 3EH2A 1RJCA 2QEJA 3JWDC 2DDQL 3KL0A 3GRBA 1ZHKB 5CIPB 1ZEAL 1TDQA 2Y5EA 1J0KA 4OM1H 4FMVA 4HH8A 1S5IH 3ZE0B 3ZQXA 2VB5A 3ESUF 2C9XA 2ZUYA 3BSZL 1G6RA 3X11B 4TQIA 4KHXH 1XEUA 1ZD6A 4UIKH 4LCCA 3TXAA 3ZJAA 1I4FB 5E8PA 2PYED 4C56A 3QQNA 3LIUA 3AG1B 4GKLA 2QPEB 5GRYA 3K6SB 5BO1L 4BH8A 3DO7A 2ADJB 1OTTD 3N1MC 3OJDA 3ZT6A 4ETYA 5D1ZI 3CFBA 3KR3H 5CJXA 1R3KA 3EJTA 3LXBA 4XVSH 2AXGA 3EOBA 5KBPA 1OD9A 4LKXB 1T66C 4WUKL 4NO3B 32C2A 5EZPA 2UX7A 2PTUA 3U48A 4M7LL 1P1ZB 1PZBA 1JXDA 1ITBB 3L4VA 3FT1A 3HUJB 3SJVB 1GAFL 5D4HA 1ZV9A 2R1XB 4XCNB 3BN9C 1HYSD 3FRPG 1R3LA 1F58H 1OP3K 3ECBB 2CHDA 3MRIA 4YVNA 4BK5A 5ILTH 3QIBD 1H5BC 2D7TH 1AY1L 1NZRA 5A40E 5C2BL 2EYTB 5IMMB 1I3RA 1NPNA 4MA7L 4P2OD 4R7NB 4F9LA 2OTWA 3MZTA 4P2QA 3HFFA 3LIZA 1E5UI 4JRXA 1BG9A 1Z7JA 3H9HA 5IHZA 1B0GB 2XWRA 3IJYA 1ZT1B 3KE0A 3A67H 1D5MB 4NFCA 5DUBB 3MRCA 1MN4A 2VLLA 4XTRD 4OQTA 5KOVC 5CMAB 4KKAD 2PXYC 3MLSL 4J3VA 4NQTA 5F7DB 5IKCA 2NZIA 1LO3L 4UYPA 3STZA 4DEWA 1MCHA 3ISWA 4J3OG 3B7RL 1QPXA 2F54B 1JHLH 2OXGB 3FQXA 1BZ7A 1UKQA 2UUDK 2BVYA 4ZAKD 4OCWL 3MTXA 3DMMD 3JWOH 3RWGA 3QC5X 4JFZL 2F9BT 2VR3A 2ZP8A 2ZSVB 2R59A 3I9IA 2KQNA 3T2LA 3RNQB 3MLVL 4I3RH 4P4KD 2YMTA 4DCQB 1AD9B 1RSFA 3QHZL 4N5UA 4OLWL 1S8DB 3NVQA 4Y1AB 2MTPA 1INQB 2DPKA 4Y4KD 4JHZA 3L5WA 2MQGA 3EOAA 1UUNA 4EI5B 5D1XD 1YQ2A 5C08B 4S11A 5FYKE 3K81A 2NX5A 1BQHB 4GAAA 5D9SA 2Y7OA 4LVNC 5J13C 3TNMA 4GI8A 5AKTA 4JQIA 3HHRB 4QTIL 5B1KA 5C0ND 3V9CA 4NKIH 2VERN 5TJWK 3QIUA 1E50A 4POUB 3L3OB 1AGCA 2X4QA 2GPZA 4EIBA 4YBLC 5I0DA 1IM9B 3T0EA 4MZ2A 1MAJA 4HISA 3K4AA 1MWAL 4ZW6A 3V5KA 2IAMC 2VXSH 1LEKA 4PLOB 1FWXA 4DH2A 2DQHH 5J11C 1L0PA 3CDZA 4HJTA 3D85D 3MOAL 4BKLA 3EJUA 3PIQB 2WVVA 3QAQA 1H6FA 4M4RA 4EEEA 4RGMC 2DLHA 3AY2A 5E5MA 3WLWD 4J2QA 2ZUWA 5IB1B 4R4FL 1N59A 2CLVA 1MHPH 2HKHH 5EZJB 3OLEA 4TQ8A 2W92A 3I02B 1RMFH 1AS6A 3CQPA 3ZPDA 4PJXE 4OSUL 4WI4A 5CR8A 2HKFH 1FNEA 2XPZA 1EFXD 3CSGA 2APVA 3EAKA 1ILUA 3MNDA 3NTCL 4M8UA 5D70L 4CMMB 4H4NA 1L7TL 2HFEB 1NEZB 2G2NA 1LJMA 2FEEL 2A6DA 3SDXA 3KBEA 2COVD 4R26H 4WO4A 5AVZB 3V7AE 2NW3B 2PYFB 5BUAA 2FSEB 1KTLA 5F97E 2WZPD 2VDNL 3EZJB 4K15A 3AT0A 3WXWL 1FH2A 2R23A 1VFMA 2EDBA 4IRJB 4XNUL 3AACA 2AI0L 1LVEA 1ESOA 4KJPC 1TNNA 5ADPL 1DBMH 1HVXA 4U1NB 4NC0B 1TVDA 3AM8C 1FAIL 2XCMC 2D31A 2F74B 3IJ9A 3WJJA 4ZPVB 1UFGA 4KI1A 3ARVA 1K6QL 4K3DH 2O6CA 3D4YA 4WFGD 4M93B 2NZ9D 4YHZL 3SPCA 1QRNE 3CDFA 2J8UF 1IGTA 4CSZA 1ZANL 1BM3L 4NO5B 3G9AB 1NFAA 3CN4A 2VABB 2NDFA 2JB5L 3VFOB 5EBWB 5ICYA 2IOMA 2PETA 2EH8H 3DVNA 2IGTA 5HI4D 1D6EB 4W9DC 3B2PA 1A3QA 5KJ4A 4F2ME 1FFNB 3QUZD 4TUJB 4DN3H 4NQDA 4XAKE 1MEXH 4YPGA 2VUOA 2JFCA 1JHKL 1ZIAA 3LN4A 4X7TB 1KCSH 3OZLA 3IMBA 1U8QA 3K2IA 1SVZA 3QRBA 1RUQL 5CSBA 2CNZA 2Z4QB 4NQEE 3SDAD 1FNSL 5DTFA 2A9MH 5ELIA 3EHBB 5H2BB 5F9JA 2CZNA 2Y7QB 3FSWA 3GD1C 1U8LA 2ZP9A 3NAAL 4RMUA 3AB0B 1GOFA 2R1YA 3QDJE 3AT9A 4ZW8A 5EZLA 4TLTA 4K7PH 2GQHA 4F7CB 4KI5F 3AS2A 4JGJA 4ECNA 4Y8AA 2WYZA 3QO0A 1KXTA 4AW4A 2R7EA 1F13A 2BHZA 1E43A 3DC0A 3HPLA 1XH0A 2YEVB 2AS5M 4FEMA 3ZK0A 3VMNA 1MW0A 2FEJA 5IHBA 3BESR 1KEMH 3PWJB 1MNNA 1Y0LA 2ENSA 3VXNB 1EAQA 2GBTA 1U8JB 3I75A 3RWFA 3TIDB 5DT1H 4ZSOE 2VJ8A 1G9EA 3BMWA 3IGFA 3SKOA 3HE7A 2H1XA 4MJHA 2AV1A 1J9CT 3WNKA 4FAAB 2H3KA 1ASOA 2BXZA 3QQ4A 2P80A 3B9KB 4PSRA 4OLZH 2Y6SD 4OTXL 3VU2A 4JFEB 1BYNA 5AWNH 4OGQC 3RUGF 4BWWA 3LKOA 1QZNA 4GAFB 4ODSL 1HOCA 3UAJA 4E5XG 1DLFH 2BP0A 3EGXB 2R9HD 4JY6A 2XQYK 2X6UA 4FG4A 3BOVA 2BFVH 4ENED 2J8UB 4U4IA 3X3FH 5HGBA 2JCWA 3S2CA 2M8XA 1AC0A 3KYOA 4G6KL 5D96B 4Y7OC 3O2DH 3L2MA 2LV4A 3L3HA 4HK0B 1TTRA 2YUWA 5T1MB 4LCUA 4JDVA 1QPKA 5EOQL 3CXHJ 5FIEA 2BLFA 4IW4C 2MH4A 4R0LB 4RMSA 4MKTA 4FQQA 4TPRL 3H53A 5PAZA 3WNLA 4IOIA 2PCFA 3TH4T 4J4PC 4EBQH 4ZUSA 1T04A 3UJJL 1G9HA 2Z31D 3GBNL 3GMOA 3O2WL 4EI5C 3MMEB 3TONA 1EIBA 2AJSL 4AGMA 4NB7A 1FVEB 3OAZK 4WY7L 4YLCA 4ONHA 1R5IB 5DFTA 5F6IB 3FFDB 5FGBC 2OTUA 1IGYA 4F7EB 4PJ9A 4AXWA 4LK4A 3L3OC 4WTXA 4NZRH 2I5YH 4LSRH 2C4FT 2NZ1A 5GGRA 4ANWA 3WLBA 2FD6L 3SKJH 1ADQL 4WW2F 5I6MA 3Q2NA 3BVXA 5D1QD 3T65A 3VQ1C 3FCUB 3FCTA 3TVMA 3U2SA 1J9QA 1SHXA 2WKLA 1UH4A 3QIBB 4WI6A 1CDBA 4XGZA 4U6XA 4F20A 2D7OA 3QG6B 3MO1B 4I18B 4OIFA 3G9VA 5ERWA 4EI6A 2TSAA 4I3SL 1YO4A 2OP4L 3ARDD 3LNIA 4EN3C 4ZFFA 1Q72L 1XEDA 2XRAL 2Y24A 4IGBA 4NWUL 5DU7A 1R34A 1PQZA 5D4QA 3CDCA 1A4JA 5I66A 3SO5A 4NYLA 3WNNA 5DURD 4YO0B 4EKXA 4FA7B 3GUTA 5IMKA 1UB5B 4NUPA 1JNNL 5LAXA 4U05A 4P49A 1GC1C 5F9OL 5TH2A 7CGTA 2I85A 3ARZA 3NN8B 3REWB 2VCOA 1DQTA 4JO4L 3VQMA 4IKNA 3F58H 4NPYB 2CCVA 4IDLA 2IEPA 2X4SA 2JI2A 3GM0A 4BCZA 4HKZB 4P9HL 1ACYL 5FYKH 1YEGH 1LD9B 5H35B 5G4NA 1CGXA 4OV6F 4ZAKB 3H8NA 1PY0A 3BQVA 5D1ZD 3TWCH 1MJ8H 3RA7H 2WBJD 1QTSA 4P4KB 4IRJC 1OPOA 1IAIL 1SDDB 3KNBB 4ZX4A 1M05A 4XN7A 4L29B 2XX0A 2Y25A 2Y0SA 4NSKA 1F4YH 1MSPA 1HH6A 1QWUA 4HDIA 2F61A 4PJ8B 4C56E 4Y4KB 4BELD 4FXGA 3N3EA 4GIPD 1TQUA 2RCSL 5D1XB 4ZG1A 3ATBA 2IMNA 4M93C 1FO0H 4HEPA 4OAWB 2MKWA 2IDFA 3BVVA 4A66A 2BFGA 5ITBH 2EINB 5FF6B 1GZQB 4C54A 1HINH 4HF5H 2NPLX 4JKLA 4YDNA 4ONGH 1R17A 2BHFA 5E5UB 5EN2B 1FDLL 1HEZA 1F45A 4NO2B 1E27A 2QMKA 4H13C 4MQTB 1UCTA 4XZ4A 4BUGA 5FUCE 5J6HA 5KVMC 4ACPA 2CWRA 1JRHH 1S7RB 2VC2B 3SPVA 1YMMD 3MLRL 4WW2B 1GGTA 1LTXA 2XU9A 3KPMB 1TXKA 1A6TA 1ULVA 3UBGA 1WG3A 4D0DB 3HJ0A 1FG2B 1NCWL 4TULH 2IFFL 1JF1A 2DLEA 2JKJA 3HRPA 5F2FA 3WKMH 5KS9A 1BVKB 1UM5H 4LPXA 2XZQH 2R39A 3IAPA 1MCLA 1EJOL 3EHBC 2P49B 4YE0A 5EIIB 2EUXA 2YN5A 3ILQD 2VO5A 3AB0C 4GP5B 4HS8L 2W9EH 1QUNA 2FSDA 1KLUA 2WYTA 4GBXA 1WWCA 3QEQA 2X1WL 1W0YT 4IHBA 2ZNXA 1FVCA 1WSST 5CO1A 2PO6D 1M2VB 2PW1A 1QFHA 3DO4A 3DJTA 1EFXB 3LQMA 1K4DB 3F01A 4IKIA 3PABA 4UM9A 2JKNA 1A0QL 1UZGA 4C4UA 2M1KA 4HS3A 4X5QA 1BLNB 4XMKH 3HLKA 1XT5A 4YAQA 1VZGA 1I3VA 2X09A 1AXSA 5EORL 3TBBA 4NZFA 1JPTH 4PD4J 4BFIA 3V4VL 4GG6A 4Q4IA 2BIQA 3LZPA 4KNSA 1K5WA 3OKNB 3SYCA 2ZKYA 4Q9QH 2CG9X 1PZ5B 4N8CH 2APSA 3CXHK 5B38B 3JWDL 1CCZA 2VDML 3BEWA 2ZCKL 4ZT1A 3KCPB 3GLAA 4EAEA 2BNRA 2Q5BA 3B9KC 5L4MA 1HOEA 3IRZA 3B2VL 2IH1B 1CICA 3Q1SH 2J20A 2CO2A 1UD5A 4PWFA 5B39B 3WO4B 3V4LA 5EO9B 1TJHL 1Z3GL 3HFML 3DIFB 4KDWA 4WSGA 2VN5A 2OL3H 2NX5E 4DP9X 2BK8A 1C08A 5C6PB 5IVXB 1RK0A 3GHEH 5CJOL 4B9KC 4FQHA 1OY3B 3S36L 1P4IH 3RWCB 4DN4L 4GKNB 4AM0B 4ODXA 4BSJA 3BRDA 3PAYA 2GTQA 1YN6B 2X4PB 4PB0H 4FLSA 2XZCH 3SEPA 2WTPA 5I8KH 1OT1A 4AYMC 4TLKA 4R0LC 2XN9A 3EO1B 3MRJB 3SDAB 1L3WA 2A7BA 2VLJD 4JO2H 1JFQL 1SHSA 1JZ3A 3TBVB 3TLRA 1YZZA 2J88L 4Q4EA 5T1DL 1HNGA 4JDZA 3TL5A 4A7QA 1IAKA 2GJ6E 1M53A 4W6WB 2WGNB 3CZKA 4LBEB 2FHBA 5DDHA 5I16B 1QA9B 3OHXB 4L9LB 4ODWA 1I9JH 4NNPL 4ZYKA 1AP2A 1ED3A 2WP3T 1HI6B 4XXDB 3CZSA 3P0GB 3MREB 4M9PA 5F6IC 1FL5B 4OLYH 3UYPB 2CRYA 1FZOB 3A6CH 1ZA6A 5F7LB 5FHBH 1GGIL 5BMFH 5L8KB 4ZW3A 2Y5TA 3ETTA 4YSQA 3TESA 3IWUA 5HHXL 1QSFD 1U8OA 2Z65C 3B9AA 4O51A 2B2XH 3TYFA 1HYSC 5J0BA 2HT3C 2CO6B 1D6VH 4P5KA 1O7VA 3WTSA 1P6FA 3EOYG 2OMNA 1FV1B 5GGVH 4KK6C 2ZPKL 2FIKA 3IF1A 1UWXH 4I18C 2VR8A 4JPIA 2BCMA 1LEIA 1NJ9B 2BXYA 4IRSB 4OZFH 4R2GD 4YHKL 3VTAA 1HAWA 2JV6A 3N85H 4HUXA 3L3GB 4JZJB 4FTVE 2ETWA 5L9DL 2PCYA 2X4NA 3W5NA 2YZ1A 5DZ9A 2YKLH 3QORD 6TAAA 5HHQB 2NY6D 4K3JL 2IQ9L 4U6YA 1C1EL 3F83A 5CKGA 1BYPA 1MLCB 5IREA 1BXVA 1W9XA 3ATEA 2VDRH 1WD8A 4JKNA 4YX2L 4FFYL 5C0AA 2X1OA 2CPCA 3VB9A 3B43A 4P5TA 1MF2L 4UTAH 2ORBH 3UPRA 2PWHA 4KUCD 1I9IH 5IB3A 4AQ8A 1CLYH 1MIEL 4OIIL 3EGDA 3RTQA 4HUVB 4LMQE 4WQOA 2I69A 1WD9A 2G5RA 1ZLUH 2AAVA 3VMPA 4N24A 3VH8A 5IEHB 4P4KC 1FVDA 3SQBA 2XWZA 5GGSB 3QUKB 1NMBH 3DJZA 5CFAA 4WGWB 1HQRB 4PJ8C 3L54A 1SLUA 3IFPB 2EEAA 4XC3H 1FPTH 4Y4KC 4LPWA 4JUSA 1L6PA 1CD1A 1T1ZB 2Z31B 3BKML 4ZD3H 2BSBA 5D1XC 1CFQB 5F6HI 3AUWB 1A22B 3S5LA 1FBIL 1E65A 5B22A 3CLFL 4RMVA 3J7HA 2WTOA 4FLQA 4H1LG 3HI6H 1KJ2A 5C0NC 5BO0D 5IHWA 4QAMB 1DTUA 1PIFA 2ICWI 1Y18B 2LU3A 2VUYA 4Z18A 5D7JA 4XO9A 1J86A 3T2OA 3VTMA 1WFNA 3U0PB 1XH3A 5H37A 3G6AA 1C5CL 4ZODA 2BS71 4NI6A 5D1QB 4HIJB 4GMTL 3EJYD 4L8BA 2V5YA 4QOKD 3QAZB 1UZ8A 2RR3A 2HJKA 1YEHL 3QJFA 4TF4A 1RL1A 4UIMA 4ZFZB 3IBOA 4PV8B 2WQVA 4PD4K 3ARDB 3ULUH 3QJRB 4QLWA 5E99L 3IK2A 1GS6X 2WXLA 3DOSA 2QHLA 1WPCA 2DLFL 2XOTA 5I1KL 3FZUD 3G5ZB 4L4VD 3GXUB 5IHHA 2R2EA 5B1JA 2CKNA 1G6RH 5FFLA 2YKKA 1MCWW 4M5YL 5DJ0B 3EJZC 4WU5B 3DBSA 3TO2A 3V0AC 1ZLDA 3RZWA 3WFDH 6CGTA 3BN3B 1I7ZB 1Q0XL 2BVPB 2X6CA 4YHYB 4ZZFA 4EUPG 5G2NA 4R4BA 4M7JH 2IH3B 1CR9L 3D52A 1ONQA 3O3DB 3QGVA 4QF1B 5J5EA 2R83A 3S98A 4PAZA 1WT5C 1GW6A 5HD8D 1YN7B 3OTTA 4IKJA 3GTTA 2O5NA 1V05A 3S5YA 2L8AA 3CBJB 2WBJB 4EZLA 3C5JA 3GSWB 1X7TA 5GSRB 5JW4R 3FB6B 3NFPB 1C7SA 5EU6D 5I23A 2QVFB 4HQQL 4N0YH 5DJ6B 3SD2A 5D7EA 1SJXA 2HKAA 4HWBL 5CHNB 2VMFA 3POHA 5FEBA 4K7PY 4B9YA 3KLSA 3BP5B 2FYVA 5CSGA 5FYJD 4H8HA 1OAZH 1XR8A 1DLHA 2NZ9C 1KTCA 2OMYB 5CU9A 1OAKH 2MTAA 2XLLA 4V1DB 3R8BB 3WO4C 4KRPD 3O0RH 3BIKB 2CDEA 1U3HA 3I2CL 3WY4A 5TDPB 1JK9B 3N1FC 3LRSA 1TJIH 3VO0A 1UZ6E 4N8UA 2AJVH 3LIZH 3U0WL 4WJKB 1UA7A 1OAYL 4DO5A 5HVHB 1GZHA 2D3JA 4OQTH 5T3XL 1WFMA 5ICZA 3GSNB 4N2BA 5IZ7A 3P30L 2HG5A 4G70B 3STLB 3D6GA 3H1ZA 2IBGA 4LPCA 2H8PA 3KPRA 5F7NC 1ASQA 3SDAC 5HTSA 1MFCL 4FXKA 2QGCA 4HT1L 2QKSA 4LLWA 3ZTNH 2JNZA 1QUPA 1HE8A 1UA3A 3MCYA 3LEXA 4GKSB 4IMKA 3OHXC 4L9LC 2PO6B 4UT6L 4F8NA 5D7LD 5FUOL 3ULVL 4OCYH 2VIRA 2EE6A 3PGFH 5IWLC 5EO0A 5AVTB 4AEHH 1E8YA 1J5DA 3ZGHA 3CZJA 3C12A 4OLVH 2LHAA 3ARBB 4PJGF 4XBEL 1ROCA 3GJEB 5IW3A 2OCFD 4YHLH 1N18A 1M1SA 3LMJL 4IBYA 2VDOB 5CLWA 1WCBA 2VJ0A 4JHWL 5E6YA 4RAVA 4JQIH 3SY6A 3UO8B 4EXPX 4PRBB 4RISH 4QYOB 3VXTB 1T7WA 3WENA 4K8RD 4IRSC 4QO1A 3HBPA 4NBZB 2OSLB 4JZJC 1J0JA 1JYNA 3FAWA 2NY5H 5JNYA 2NUTB 4PY7B 5FM4A 1AANA 3NZHH 2HVKA 3O81A 4MXVE 1IM3A 3R7RA 3WFCL 3ZLQC 2J5WA 4HJEA 2R9HC 3AG3B 4HG4J 4F9PA 2VDKH 1I1YA 3MJ7B 2WIIA 4EJ1C 3W11C 3QFDB 1QYGH 3QNZA 3D30A 4NERA 1QWNA 1U8CB 2XJKA 4H25A 4X5RA 3VXSD 4DK6A 2WQXA 4PN6A 4K9EH 5L2JB 1CFVL 2BX5A 4PH8A 4XX1G 2JJVA 2QBWA 4KK5D 4OZ4B 2UY6B 3ROOA 1UADC 2AXWA 5C0BD 1PKOA 3VD0A 1AI1H 4NC1C 5K9OA 1TITA 2V2WB 1I8LA 4KJQC 2VLJB 3D2UA 1WLHA 1KPRB 1S9XA 1IQWL 5TDNA 2FGZA 3S34L 4XP4L 2MWCA 2NY2D 2B20A 1D5ZA 4NUGL 2D03L 4PGEB 4AMWA 1CT8B 1SUJA 5I19L 4E41D 3QJZA 5G4OA 5SX4I 5IT2H 3TV3H 4UAOB 1QFUH 3D06A 3D0VB 1TFPA 3V0VB 1MRDH 4YQXH 4QXUH 3MLUH 5BRPA 1B4JL 2F58H 4U1SB 3U82B 3CE1A 1NKGA 4PLKD 3NH7L 4DP0X 2WXQA 3SGJA 2WNWA 1R0AL 2GSGB 1K8DA 1MG2C 3NP4A 4BFFA 1RKRA 2QSTA 3GSQB 3OKKB 5G4MA 3DX7B 3UX9B 5D1QC 3OBAA 4R7DB 3P02A 4NM4L 3QAZC 3CSTA 2A6JB 2FGWH 1NEPA 4AEFA 1A8ZA 3CCHA 4MWFA 4AW7A 3FRPA 2I27N 5KVFH 1CDUA 1D5IL 3ARDC 4FADA 4R2GB 3B2UC 1NC2B 2A6IB 4FMKA 4JMNA 5MEQA 1CXLA 1XB8A 4M6OL 2IPTH 3TN0B 4K73A 3ULAB 1O9WA 1A9BB 3QORB 1QSEE 4JJHA 2B59B 1Y7VA 3IDYB 1Z9LA 4V2BA 1R3HA 1Z5YD 4FQCL 4JGMA 4DPAX 5CBAA 5DD1H 2BNRE 4Y4FD 4AL8C 1T6BX 4U1MA 4YHYC 1N4XL 5DFAA 2Z93B 1XGTB 3GPEA 1FLRL 2PN5A 2VR7A 1U8MA 1MDAA 4ELMF 2A6KA 4O2FA 2KYIA 3T3MF 1PDKA 2FBJL 2DQJL 2I7SA 3KLAA 4JR9L 4MJID 4S1RH 4ZUVA 3VWKD 3ULVE 3P0YL 5JHDB 4LDOB 1DO5A 1NFIB 4I4WA 5F1KC 1VKXB 4DO4A 1UA6H 1GIGH 4KK9D 4N3TA 4U6HB 4URTB 4XMPL 5MERB 3WY2A 2XV0A 4ONFL 3PL6A 4LSQL 4KNUA 4OD3L 4DUXA 4L4TA 5DWUH 3SY0B 2F8XC 5EBGA 2WBJC 2WCPA 1SEBB 1GGBL 3RIFK 1BQ5A 3MLTB 2ZQKA 5HDRA 5C0IB 2VR4A 5GS2D 3WS3A 3AAZB 3FB7B 3N5AA 3QJTB 3BSZA 5HI3D 2YAEA 2GITA 4PBDA 1BQHG 2XA8H 2J57A 4E9YA 5L6YL 5F7KC 4OLXH 4HLEA 1HK6A 4JHAH 5F88B 3US9A 3QRFM 4NKDB 4FFVD 1JD9A 1RJLA 4A2EA 3HC3H 3ZE2B 1IC7L 2EH7H 3IWVA 4JNXA 2Q86B 3QJOA 1EBPA 4NPKA 5GHWH 5AAPA 5IVNA 2O6PA 1PAMA 2EDEA 2DMCA 3BGAA 4AG4H 4BFNA 4Z7WE 3KEDA 4S1SL 3C5XA 4KU1A 2TAAA 4IU2A 4ZUTB 2ITDA 4KUZL 1G7JB 2W1NA 4EDWL 4XCEB 1MIMH 2UWEF 3F05A 3WTYA 1E2ZA 5HVHC 1DCEA 3ALWA 5AOZA 3OV6A 4PJ6A 5D93C 1J5OH 5AVSB 3SGEH 3IJ7A 1YLBB 4MNGB 4CJ0A 1P5UA 3ZDZF 5L88H 1Z9MA 1IQDB 4AZ8B 3FXIC 2HRGA 5DZAA 3T4AB 3QEGL 4YGVB 1AGEA 1CGSH 1SXBA 3ILQC 3QR2A 4K3EH 3HRZC 1A14L 2VRQA 4H5SB 5ANHA 5CD3A 3IT8D 5C1MB 1TYJA 5JR1L 2WSKA 2XWEA 2PO6C 4MJ6A 5ESQB 2GK2A 4LDCA 1PMYA 2XG5B 5DJCB 4HIXL 4JGUA 3ASWA 3O41A 4PJHF 1NEZG 2GT9A 1KBVA 4KRNA 1GRWA 3OXRB 3IFNL 5D55A 5FA4B 2OQJA 1DN0A 1EK3A 4UQBA 3AMKA 3EJPA 3T3MB 2OFQA 2F53E 2ROXA 3T8XB 3ARBC 1J10A 1PZ3A 5DZNA 2KS0A 5FKPB 3S8WA 1L9PA 5AKSA 4XOBA 5C07B 5IG7A 5ACLA 1X5ZA 2H45A 4QXTB 1TJGH 1T5XB 5KN5B 5TDOA 1NFDA 2P5EA 4A2GA 5JLZB 4Y19B 4H88H 2OX5B 1T0OA 3GBDA 3CNKA 1QBMH 2BWDA 3MRHB 4JY5H 3IETB 3ZDYE 1HXYB 1T22A 5EU6B 4KQ4L 5IJVB 4JPVH 4AC4A 3RDJA 1JGEA 3GT6A 1AO7A 3MJGX 5DGRA 1E5BA 4N2OA 3GO1L 1NM9A 3NCJH 4GRLD 4PCSA 2JKXA 1NBZB 5CCGE 2EO7A 4KVCH 2AEPH 3WU1A 2GG1A 4DVBA 3WE1A 1FF5A 1RZIB 3HCVA 5KZCD 4KRPB 1RZ8B 1BG1A 2ADIB 2ARWA 1HWGB 4UOW1 2Y36L 3U9UB 1FL6B 1UQSB 3H6AA 3L1OH 2RD0A 4Z95H 5CLXA 1ZTXE 5CINH 3M7FB 2VMCA 3MV9A 3HVNA 4NAMA 2XWBB 3JWNC 1L5GB 3DX0A 5FFOA 1PBYA 1DVSA 4LCYB 5FFGA 2IDTA 2QLVB 2VLRD 3RBGA 4E9LA 2ZUQB 4XPTH 2HX9A 1YPZF 5GGVY 1A9EA 3VD1A 5DRZA 3FQNA 2HB0A 4HFWA 4NQSB 1B0RA 1OVZA 4WO0A 4X5PA 3N40F 4L1BA 3MRPA 3OQ3B 5E6IA 3TBTA 2P7TB 1WZKA 4M7KL 1Z0MA 2XYCA 4OM0H 4O5LH 5ETUA 1PFOA 1RI8A 3J27A 2EICA 1MWAA 3CC5B 2ZOOA 4PJEB 2VW6A 4G8GD 1T20A 4MA1B 4RGNE 4Y5XA 1XXDC 4LRNH 4QHPA 4Y5VB 3DV4A 3TEUA 4GQRA 1AZNA 1MXGA 4JS7A 5IF0B 2X9XA 3CHXA 4UAOC 1L7IH 5D7LB 3QPXL 3VXRA 1NGQH 1OAXH 4FLOA 4YLQT 2BVQA 2CIIA 2R29L 1IEBA 3HBZA 3GJFB 1J0HA 1IBBA 3GGWA 4DP4X 3CTTA 2X3CA 4FXLA 2MQ0A 1RLWA 2FX8L 2F7PA 2UZIH 3UZQA 3KPPA 3SE8H 3AY4C 4H2CA 4RWHA 3V0GA 5DF0A 1W6LA 4QRQB 3IMSA 4LKCA 5C0EB 1A2YB 5I8OH 2YBRB 4DQOL 3WEMA 1OL0A 1AHWA 1A4AA 1VDGA 3T71A 1IC5L 4GQPH 5LLIC 5DHYB 3QFJE 4ZUUA 3QULB 5BVJA 4R2GC 2WXHA 2MOGA 2XTLA 3QXVA 3F7VA 1SMAA 4FHJA 5SWSB 2DMGA 3L2LA 1YNTA 1OOWA 5IQ9A 4B3EA 3TN0C 2CIKA 2FATL 1Z5LA 4PP2B 1IKNC 3QORC 5C0DA 2R0ZL 3IDYC 1YECH 4YFLI 1IC1A 3IMTA 4NAJA 5AW8B 4DZ8B 1FNGB 2C9UA 8FABB 5JW3H 1J05B 4PR5A 4WHYH 4P23A 3WTWA 4E5XA 1ZVSB 3GS7A 2BNQA 4QRPA 2DQGH 2VL5B 1CTMA 1OM3L 3VXSB 1AGBB 1ZLUK 2BZCA 5JO5A 2EDFA 2BC4A 2O26U 4BRVA 3GWJA 3CFIC 3QJVB 4P4RA 3X3GL 2IANA 4K2UH 5C0BB 5DEZA 1K5NB 4N2MA 4YC2B 5BS0E 1KIQB 4UTBA 1KFAH 1X5GA 1YPZB 2ATKB 2MJWA 3CLWA 1I3GH 1I8KB 1HH9A 3F62A 4X6DE 3HAEB 2X7LB 2NY2B 3NFSH 5E1AA 1AOHA 1OGSA 1Q8MA 1MCKA 3BO8B 3DROA 5A2IH 5HVGB 2XG4B 4E41B 3KPSA 1SN2A 3P9LB 5D72L 1ZK9A 3THMH 4JM4L 4WW1B 4Z5RA 3AQXA 1EBAA 4G82A 3T0AA 4DTGL 3C5ZD 3WUWG 4Q9CA 4LF3A 1COBA 4L4JA 4Y1SA 7TAAA 1QHQA 1JVLA 2JKRM 3ARQA 4QXWA 3LKRA 1M9SA 2Z64C 3IKCB 3H7LA 2YOCA 4L1SA 2YAFA 4OGAD 1PS3A 1RERA 4PWJA 4NHCL 1B4TA 4YHIB 3M17A 3QCTL 4PREA 5EC1A 3D51A 4XODA 1KBBA 3OZ9L 3EJYC 1O7DE 4TSBH 4OFPA 2O6EA 1S7QA 3GKWL 3RVWD 4PJIA 1X5XA 2Q6WB 1MFDH 3ZY7A 3CHPA 1NCAH 3QUMB 3QZNA 2WTRB 1GZPA 4W6XB 2D0FA 2HTKD 1K72A 4KHTL 3T4AC 1FORH 5FO8B 3MV8D 3MUJA 4KI5E 3CWGA 2EABA 2JCCF 1SYSA 5HGDB 5E8DL 4N6RA 1G7QB 4NQQA 1KT2A 4Y4FB 1ITCA 3FB5A 1OSPH 4Y2OA 3II3A 2VAAB 3EO0A 1E30A 4D9LH 1CG9B 1PPIA 1S7TA 2DWSA 4X9HA 1RZKL 2RALA 3KBFA 4PLJD 4QRRD 4GG8A 5DI8A 2FLMA 3NJVA 4LXFA 1MCCA 5TQ0L 4MJIB 2DEWX 2E6JA 3CFCL 1X9UA 3FCGA 1IGFL 1JGUH 3GSXA 3WEBA 3BT0A 3VD9A 4PU2A 5I74B 5CCHE 2X2HA 2HWZH 4XWOD 5JW5B 5MEPA 1BAFH 4KXZH 1FAKT 4JFPA 2B1OA 3EYFA 4G8EA 1NSNL 1UM4L 1ACCA 3GSUA 4G8IB 3EXLA 2NY7H 4L3CA 3FBQA 3WFBL 5I1AA 3CDGB 5GGUA 1QMUA 3MJ8B 1V54B 1XGYL 5IHLB 1RHFA 4JMXA 3QXAB 1Q4NX 4JDTL 4MNHA 1U4FA 4PRDA 4KRPC 1CL7I 1FZJA 4ZDHB 3RYMA 1IBGH 1BXXA 1NLBH 3U6RA 1OK0A 5J89A 1CYXA 1DEEA 2YC1B 1CU4H 2ZCZA 4PVBA 2DTML 2LAGB 1S7VA 1KXHA 2W07B 3LRHA 3X2QB 2D73A 4UT7L 4FI7A 4DK5A 5I30L 3FULA 3F12A 4N9GA 4XPBL 5FB8A 2DWDB 3B7SA 4WJ5A 4BE5A 2OJZH 4XP1L 5IOKA 3GFUA 2XWJA 4EMZA 3NT0A 3T3PF 3TU6A 1KNOB 2ZUQC 4XP9L 7FABL 2BSTB 5GJSL 3UJTH 1XMWA 3G6DH 4KTYA 1TKWA 5EIIG 3UDWC 1R5WA 5EEWA 2HMID 4AQ1B 4B50A 2DYRB 4NT6B 3P11L 2K6ZA 3CK0H 3ECUA 5C09B 4HLZG 4O00A 2DI7A 1C8PA 4R3SA 4MA1C 3OX8A 1BBDL 3KH4A 5L0QB 5KSUB 3KW7A 2AITA 5JIHA 1U93A 3CGTA 5KSBB 4Z7OF 3UZEC 1XF5A 4WWKD 3QG7H 2DMBA 2J6WA 2VDRB 4PJ7B 3I3BA 4B9IA 5CAYB 1DUYB 1FUNA 2WKOF 3ABGA 3MR9B 1KXQA 2HFGL 3U6XA 4Y2DA 1HHIA 2FYYB 4G8FB 5ESAB 3S97C 3H2QA 4GRMA 3ZYZA 1AE6L 1OARL 2B4CH 4LCWA 2QZQA 3LKQA 1EHLL 1GPOH 2BWIA 5ESVA 2VDLL 1MJJA 5D5MA 1ZTXH 5B38G 4ZMPA 4IOSD 3Q8BA 5JORB 1KJ2H 4YDMA 5LNDA 5HJ3B 3L4XA 4OF8A 2X70A 3MXWH 3PXLA 4WNJA 3V6OE 1JZ8A 1T21A 2JKIS 2ZD0A 2VWEE 3VJ6A 4FNLL 4JN1L 1JTOA 4M5ZL 2ICWB 4G6FB 1HQ4A 5H37H 1XGQB 1WV7T 3QQ9D 3T6QC 3V4UL 3T2QA 4NRXA 2HRPH 1MZYA 2O72A 1ZGLM 1IIIA 1T03H 3RL1A 1TQWA 1C5DA 1ZT7A 5L2KA 2KZWA 4GAJL 5DUML 3B8YA 4JJ5A 2YPLE 2NR6C 4NZUL 3I3EA 1E4KC 3K1KC 3NGBC 4A7TA 1DFXA 3NA4A 1MCIA 2DM3A 2DRUA 3FQTA 5DHMC 1E2WA 2H6OA 5F3BA 5LGJA 4PV1C 1AKJB 3L3DB 1U8PB 1TR7A 2H2SD 4JY4A 4N2KA 2PUQT 1DBKL 5F0JB 4OUUA 3WXVL 2Y7MA 2VLRB 4KK5C 3QWNA 3EF4A 1G7IA 4X4YA 1A1NB 4X50A 4YC2C 4NUJB 2DJSA 3L6FB 2PCXA 4PY8I 2C3VA 2B0SH 4YE4H 3W9EB 2IDSA 2XWCA 4G7QB 1Y6NR 2XXMB 3JTTB 3O3UN 4MA3A 3T6XA 3VTTA 5JHAA 5CLYA 2XTJE 1DDTA 3I74A 1RHHA 4U7SA 2NY2C 4OV5A 2OZ4A 4D0BA 5K9QI 5HPMB 5CSZB 2IO5A 4BA0A 4HEMA 4ZNEE 4G8GB 4I5BA 5IQ7H 2WO3B 1HIML 5I1HL 4N0FB 4E42B 1NGWA 3BAEH 2ZG1A 4OFDA 2FJHA 3ZQ9A 1BM7A 1L9RA 3TBSB 5IFHL 2JB6B 2R8SH 1HHJA 3QDHA 5TTRA 4MNQE 4HZLB 4N4YB 4G43A 4M43H 3EDEA 5HPOA 3RNKB 4DGYL 4HETA 3PHOA 4X80L 3WJMA 2J43A 2D4FA 1I7UA 2YQBA 1NCDL 2NT1A 2VLME 1CK0L 4PTTB 2VE6B 3HE6A 2YGNA 2GYSA 5AENA 2A77H 2D7NA 3QZWB 2R69L 2G60L 4AL8L 4QRFA 2XN0A 4JB9L 4LIQL 1QEWB 4G6ML 3JTBA 4QUOA 3SZKC 3B1UA 2P5EE 2NY4B 2ISDA 2UVEA 3OKLA 5IUCA 4JQXC 2C1OB 1IGML 4Z7VE 2FB4L 4OCRH 1Q0YL 2G9HA 3HMXL 3MRFA 2AK4B 5AW0B 4R5VA 3HOGA 3BPCA 1MWOA 1AO7E 4ADIA 3MLXH 4WUUD 3RURA 3WN5A 4M48L 4Y4FC 2PKDA 2WO2B 3V4VA 1J8RA 1DFBL 2XSKA 4MMYB 3VFWA 2EIZB 2RB8A 3DX9A 3IBEA 3TBWB 1FYTD 3GRWL 5EDXA 3QH3A 1XL6A 1ML0A 5C92A 1F4AA 1A6WH 4CN6A 5ISZD 1XDTT 1TOXA 1KJ3L 2XFGB 1IB5A 3DXAE 4IKKA 3H42H 1MW2A 3H9HB 5L8LB 3PJNA 3NYKA 4NS0A 5I74C 1W2KT 3SKNB 1JYWA 4FZEH 1TSHA 2G3MA 2NNAA 3P2DA 4BQCA 1BZDA 4BA8A 2YZ8A 3DHJA 1C5BH 3MNVB 3S4SA 5CJ5A 2R2BA 4ZTPL 5ITFA 5MEND 5IKCB 3V6FB 4YEFA 4R5TA 1LP9F 5D7IE 4LOVA 4KJYA 2AJYL 5SWQA 1AQKL 2KPNA 2BY0A 4Q9RH 1JWSB 3K3QA 3MACL 4FYSA 4FFWD 5C0CB 4KBPA 4B3VA 3RWGB 5F89A 2MRYA 2ZIDA 1UVQA 3GSNL 1MHCA 1OCZB 2MNUA 4ZMZA 4RLDA 2YMXH 5DMYA 3HZVA 4P5MB 4NZTH 5DMGD 3HBQA 4QYAA 4TM9A 1U58A 5ENWA 4H1LA 2E7CA 3U0TB 1JPSL 3WGVB 3GTNA 2XKNA 3CSBA 4APQB 4P3CH 1KBWA 3GS4A 4HJ0D 4LSTH 1TTBA 4RWYH 4NNYA 5C8JB 4OF3A 3DNKA 4NQUA 1I1AC 5I6NA 1H5BA 4N90E 1T7ZA 1PF3A 4X6CA 2ZOKA 4UZSA 4UT9L 1ZSDA 4ZQTA 3PWLB 1MHHA 1UGNA 5GGRY 3LXAA 4AQ1C 5KOMC 3N9GH 3TA3D 4MRBA 2CKBA 3X1EA 1BFVL 3MRKB 4XE0A 1QNIA 4YHML 1AQMA 3G08B 2TRYA 3MV7A 1LO0L 4JG1L 3RWEA 3GK8L 3Q2CA 3U4AA 3N91A 1M71B 2EDYA 1VA9A 3ZDXE 5L0QC 3RX5A 2WLIA 4QRRB 1EFQA 2VDKB 4JFQB 4BHUI 1V7MH 4PJAF 2FT7A 4JPKL 2EECA 5F21B 3KCWA 5T5NF 4EUPA 3G5XA 4XNMA 4MCZA 4PJFF 1YVLA 4BV1A 1OB1A 4LGPB 5DHVA 3CN1A 4PUBH 3T0XA 2YD9A 3UTSE 4FFYA 3X14B 1E6OL 4ZMQA 2IANE 3UTZB 2R4SL 2WV3A 2OMVB 4I1NB 1M3IA 3BC9A 4LEBA 3HS9A 2DD8H 2WXIA 2Z92B 2R4RL 1LP9B 3DRQB 3C6LA 1HILA 1DQLL 1JPFB 1ZHBB 3CSYA 3GMPA 5C7XH 2X40A 4OGXL 4RZCB 1ZA3A 3M1BB 2R2CA 3W56A 3X1GA 1OEZW 2FE0A 4TTGA 1JWMA 5DEFB 3NCYS 4YSSA 1J8HA 3MGAA 5HHME 1UD8A 4Z7AA 1KBGH 1RP9A 5EU4A 2DQ6A 2OYPA 4LARL 4YSOA 5LO7A 1KGUA 2A73A 2H32B 1SM3H 4LASL 4MBRA 4WIQA 1K2DB 2BRRL 1IAOA 5D6CB 1WYJA 5DEGA 5I18L 1NANI 5EC2A 2B9BA 4Z0XA 2YAMA 4OKVB 4YN3A 1T0MA 5TGBA 2P5WE 2PP7A 2IAMA 2Y07L 1KLGB 4OI9A 3JT0A 1E6JH 1LEGB 2XWTB 1T4KB 1MPAL 5KG9B 4MD5A 3MNWA 2VSMB 3Q5YA 3PJSA 2JQMA 5CEZE 4XCCL 1UT1A 5J1AA 1I53A 5KTEL 2PW2B 1A4BA 4R6UA 1I9EA 1V10A 2MOQA 3UC0H 3AS0A 2B9AA 2FQFA 4WFFD 1RZGB 1ETZB 1QQDB 2HVBA 4Q89A 5B3SB 3GMMB 2AC0A 4E68A 4J3OH 5GZNC 2QSCL 4OZIA 3QPKA 2DKSA 2BCKB 2FIRT 4Y16B 2R0LH 1B0WA 3NZ8A 1D2PA 5E0FA 4I7ZC 5BQ7B 2FR4A 2I24N 2DDQH 4WWKB 4HUKB 1IL1A 1XFPA 1EAPB 3D3VA 4FOMA 4QHKJ 1SDYA 1TU2A 2K1MA 3BSZH 3VI4E 4U7KA 3PQYA 3UBFA 4YBQD 2BS8A 3O6KL 4XPAL 5BJTA 3P4NB 3E8UL 4PCTA 4PJFB 3N42F 5MHSE 4ZFGL 5LJYH 4MMXB 1RUKH 1YEDB 5MP6H 1A8JH 3Q6FA 3WFEH 1NGZA 3LZNA 3HG4A 2C5DC 5DC0A 3O45A 5I6OA 1TZGH 1MH5A 3RL2B 2NY4C 3AM8A 1RIVH 2YD7A 3FU7A 5A2KH 4IU3B 1QFWH 3EFFB 1PEZA 4G5AA 3V0FA 4GOSA 5FWRA 4XZUB 2BSED 4HWNA 3VRIA 1D5BA 1FE8L 3BUYB 3MODL 3QDMA 2UZXB 4M7LH 1MCDA 3IS0X 3QXTA 1EZVY 3I75B 1T0PB 2IPKA 4FNUA 3JWNG 3U7WH 1RJYA 1IGCL 3P4OA 5JQIB 1B4RA 5CIPA 1A7RL 3CFTA 1NCCL 1ZHKA 3LD8B 3PWPE 4XHQA 2AQQA 2ID5A 5D7KE 3WE6B 4AH2B 4DAGL 4H40A 1C16B 3O6ML 2V4LA 1G9MC 3X11A 4Y88A 3ATDA 1MJ7L 2XXFA 3LSOB 3UTTB 1OZUA 1AY1H 4WTZG 5C2BH 3GXPA 2LU5A 1XBRA 3D25B 3FU6A 1I4FA 4MA7H 4IBWA 1ID2A 2ZXEB 3CV5A 4RMTA 3MSPA 3LX9A 1KIPB 1TO5A 3K6SA 1XGRB 4AWJC 1XIWD 2ADJA 5BOJA 2WYHA 3HHMA 4LKXA 1A7BA 4NO3A 3MLSH 1JHTB 2C3WA 1BF8A 1P1ZA 2C9VA 2B08A 3BDXA 4LEXL 5BXFB 1ZCRA 1X7SA 4QHLB 1YHPA 5D2LF 2BVOB 2RHEA 4K7PX 4I0PD 4FA6A 1FIGL 4U0QB 5AQ0A 3HZKB 3HUJA 3SJVA 5AZEL 4H8QA 2WP3O 3SGDH 2M26A 4OCWH 4APQC 3KLHD 2R1XA 4JX0A 2OMWB 4JFZH 1DE4B 4XCNA 4DKFL 1CFSB 4G7YH 4PLNC 4UT6A 4CC4C 1IE4A 3ECBA 3LKNB 4YFLF 2FBOJ 3N42B 4OBSA 1KXQE 3COOA 3DGGB 4KTDL 4Q6KA 4XOAA 5I0ZA 3TT1L 3WDHA 1UJ3B 4LCWE 4C83B 2EYTA 2OTUB 3GEFA 4G6AD 5IMMA 1OLLA 1QR4A 3QHZH 4OLWH 5D5ME 4R7NA 1H3UA 1J7VR 5ID0B 4UU9B 3O4OB 3S5ZA 4HIHB 1QLEB 2HH0L 1B0GA 1ZT1A 1UOVA 4HPYH 1JGVL 4J8QA 1D5MA 3BD5A 5DUBA 1C8QA 3N1PC 1B0IA 2CSPA 5CMAA 4Z7QB 5GGQL 2QQNH 4KKZA 2VXQL 1FYTB 1IJNA 5F7DA 4R7XA 5IR1B 4PLJC 3NK3A 2OULB 3VW3L 4KQ3L 3QDGB 4QHMB 4B53A 5ISZB 1HKFA 1BJ8A 3CU7A 3QHFL 4V11A 1QBAA 2F54A 4DWHA 1MUJB 3PF2A 1U2HA 4R8WH 1MWAH 1KCUH 1A4JB 1SUHA 2OXGA 2KLRA 2VLKD 3AGWA 4K9EC 1GMEA 3B2DC 4DPRA 4GPVA 3P2BA 4GS7B 2BY2A 3I9GL 5FYJL 5HYJE 1U33A 5DHEA 2ZSVA 4PRAB 5IBTH 3H9SD 1NPJA 3RNQA 5C0RH 4TN9A 1LWJA 3KDMB 3UJIH 5MENB 5T3ZD 3CVHL 3KPQB 4QMEA 3WHXB 3TASA 4DCQA 1AD9A 3U7YH 4R4FH 4HAGA 1KGJA 4F24A 1S8DA 4Y1AA 4ZS7H 3ZU8A 1GYCA 4XNQA 3RAJL 1INQA 3DYPA 4EI5A 4ATWA 4DF9A 4AYID 3C60B 4OSUH 2GBUA 5C08A 3WEOA 1M7UA 1BQHA 1D3CA 4CC0A 1KEGH 5FGBA 4JKPL 3WOVA 5E6ZA 1I7TB 1EHAA 3FMGH 4ZZKA 3NTCH 4M6NL 5A3ID 3UYRL 3L3OA 1P1VA 4HK3N 5D2LB 1IM9A 4OFKA 2K70A 4P2RD 1VERA 3UG4A 2D7MA 2DIAA 3BSHA 2BSDA 1JXJA 3QUHA 4GXFA 1XWVA 5F0MB 3V0WL 3VA6A 3B9VA 4HCIA 3CDYA 1KWKA 4L8CA 3DRTB 1L6XA 4U33A 3PIQA 2E7LC 2O6FA 4ZW7A 1R3JB 4Z3JA 1FAIH 3TA3B 4DPCX 2C9SA 3BP4B 1E5ZA 5IB1A 3NJIA 5B4MD 2WQWA 3BD3A 2M83A 1K6QH 5EZJA 5LQBH 4P9ML 4MD0B 3NBNA 2VMEA 3E8VA 2WGXA 3I02A 3H2WA 5F44A 2MCPH 2X38A 4Y16C 3OSKA 5EPMB 3ENEA 1TTAA 4ZOBA 4UTBH 3ZTJG 1I8AA 1BM3H 2AMGA 2ATPB 4HS6B 4WWKC 1PJ9A 1IBFA 3SPHA 4AIZB 3FUHA 1AZZC 3PHQB 4K8RL 4KRMB 5HDBB 4CMMA 3ET9F 4B9GA 4DESA 4ZRGA 2HFEA 1NEZA 4FQIL 4KFZC 2XETA 3BAKA 5DVKA 3DPDA 5JXEC 3FSVA 3OHMB 2PYFA 2NW3A 2FSEA 4KY2A 2KC0A 1E3XA 1WBXB 4BFJA 3MRBB 1ZV5A 5LG1A 4IRJA 4AGNA 4J5VA 1FNSH 3PLYA 4JM0A 5E56A 4U1NA 4P5RA 4NRYB 1FGVL 5FUZH 1XVSA 2F74A 3INUL 2WBWB 4YSEA 2WVUA 4ZPVA 2ZOLB 3QQ9C 3UMNA 3QA3B 1BD2E 4LRIC 3VI3F 4HSQA 5IJKC 4AYEC 4ELME 1KCKA 3CFEB 3IGAB 1J0IA 2AHIA 1SPDA 3CPLA 3T2NL 2V0AA 4AENB 4NO5A 4FZ8L 1AR2A 4FQ2H 3LD8C 2VABA 5EIQA 1XV8A 3VFOA 3U4BH 4Z3IA 5EBWA 2CM5A 3DO3A 4Z78B 1D6EA 4TVPD 1FFNA 4TUJA 4PMEA 3AROA 3ORJA 5DLLA 2PR9A 2BVUA 5EB9A 5JHBA 1QR1B 2BERA 4X7TA 1PZDA 4GIOA 3TC9A 3L4TA 4PHZA 2NTFB 5T33L 1WEJH 1VFUA 2WUBH 2Z4QA 3T2PA 2HVJB 2YD6A 4H20H 4GRWE 4X6CE 3FCSB 2Y7QA 4LAJH 4OTXH 5J4MA 2W88A 2ZX7A 4EIZC 2ESVE 2Q7AA 4F7CA 3SE9H 2D3LA 2EYRB 2R27A 1CTOA 4O02L 3V52H 1JTPA 3WHE0 3HI1A 4PRPE 2PWDA 3QUML 4G6KH 3BPLB 3IDJB 1QNZL 4APXB 2V8LA 1KZYA 1WIUA 3QC6X 2IADB 5DQDL 3PWJA 2DICA 3LVEA 3VXNA 3M7OA 1U8JA 2APWA 3TIDA 3ZDZE 2ZKWA 3J8F7 4BUQA 1UJ3C 3HNSL 5DJZB 3GZKA 1IZJA 3ERXA 3D18B 4C4BA 1CF8L 1A3RH 1AGFB 1WZ1H 2BVTA 3B9KA 5JNYB 3HW7A 3O4OC 4NJAH 3MFGB 4G11A 4N26A 4KKBC 4JFEA 5C3TA 2ZG2A 1P4LB 4PJDB 1JPEA 2V7HB 4WY7H 2AJXH 2H1PH 3EH1A 4TLSA 3EGXA 4DOHE 2ITCB 2WQ8A 1RIHH 2WLNA 3N44B 2WMPB 4FFTA 2J8UA 3MTRA 1UEYA 4OUOA 1J8HE 1GW0A 2FD6H 1U8NB 3MUGB 3OG4B 5DVMA 3B8SA 1URZA 4HUXB 3VWJD 1CLZL 2BINA 1F42A 4NXKA 2Q0ZX 2CR6A 4HK0A 4GS7C 2W0FB 1UWGL 5T1MA 4QIRA 3EDFA 4CRPA 4G9FB 4DFHA 3WN6A 4I3SH 2OP4H 4NP4L 4R0LA 2YAQA 1DSFH 4NWUH 5JIPA 4I2XB 5E08L 3ARXA 4F1ZA 3TJEL 5FYKD 1JZ7A 1OGAE 2HXAA 5H4ZA 5ACMA 4ZX6A 1AXTL 3NIFE 3QDAA 4JPWL 1A7OL 1JNNH 3CFNA 4L3EB 4NN7B 4NUQA 3SCMD 3MMEA 3C60C 3HR5B 3RWIB 3ULSB 3VXPB 1A7QL 1INDL 3LTVA 4U2ZA 4XNZB 1OLZA 1FVEA 1UC6A 3MYZA 3OB8A 3BDBA 4ODUB 1R5IA 4U6VL 3FFDA 4JO4H 3MRQB 4ODTH 4YSRA 4BWUA 4OZIE 4F7EA 4MD4B 2ZKHL 3F5WB 4LP5A 4I0PB 4P9HH 5CNHA 1ACYH 5FDWB 5INCB 3KWVA 5GS0H 3CX2A 5IQNA 3VM7A 3K7UA 5DWPA 3UZVB 3ZE1E 5AB2A 1LM8V 1JNHB 3D3VE 3MRMB 2Z4TA 3ESPA 4WHTB 2QQLL 3QIBA