1A3ZA

Reduced rusticyanin at 1.9 angstroms
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
b'TWKEATLPQVKAMLEKDDGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGHAATGMFGKIVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUSTICYANIN
publication title Rusticyanin: Extremes in acid stability and redox potential explained by the crystal structure.
pubmed rcsb
molecule tags Electron transport
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 1998-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1a3zA00
2E86A 3JT2A 1XB8A 2YAOA 1JZFA 2VSMB 4KO9A 3SBPA 1ZV2A 4HIPA 4N8UA 1N68A 4UF7C 1NZRA 3FPXA 3S3CB 3QPKA 1AS6A 2FQFA 5D4IA 1AS8A 1PAZA 3FQ1A 3ZIYA 1BEXA 2YAMA 1BYOA 1J9TA 2HRGA 3CVDA 2DV6A 1NWPA 4PAZA 1AG0A 2DWTA 1W6WA 2CAKA 2VM3A 1J9RA 2GC7C 4RH4A 1SJMA 3PAZA 3ABLB 1ZIBA 2EIJB 3BVDB 4E9VA 2HLEB 1NIDA 5B7MA 3CVBA 6PCYA 4WKXA 3FT0A 7PCYA 4JHVA 4W9ZA 5I6PA 1KCWA 1MG3C 2HRHA 3ERXA 3NT0A 2XXGA 4DP7X 3AG3B 3AW5A 3QJTB 4K9JA 5AFAA 4GP5B 2UXVA 1L9SA 1OV8A 5I6LA 4KOCA 2RACA 2AZAA 4A66A 2PCFA 4E9QA 1B3IA 2H5UA 1J9SA 3AG2B 3X1BA 4F2FA 2XLLA 1OCOB 1W6LA 1RKRA 7PAZA 1SFDA 4A2FA 2XV0A 3RYMA 1NPNA 3EH5B 2PPFA 1GS6X 1AG6A 5B1JA 3T71A 4G72B 2XU9A 4FAAB 1ZPUA 2CALA 3NJKA 6PAZA 4G7QB 1PNDA 1TKWA 4HHWA 4KO7A 3ABGA 4YSSA 3KW8A 4YSPA 3S3BB 3TBBA 4YL4A 5I6MA 1ZDQA 4DPCX 5B3SB 1ASPA 2I7OA 4Q8BA 1IC0A 2UXFA 4GP8B 2YAQA 2GIMA 1A4CA 5ANHA 2J57A 3NJFA 1MZZA 3DKHA 1AACA 1X9UA 4P5RA 3GDCA 4G7SB 3CZUB 5I5MA 2I7SA 1TEFA 2VMJA 1AR1B 1OE2A 3NJJA 1JXDA 1I53A 3NJIA 3GYRA 3SQRA 3PXLA 2J55A 1NICA 1L9OA 3QJSB 1CYXA 1DZ0A 1PF3A 3CDZB 2DY2A 1BXVA 4YVNA 1KYAA 5I5IA 3UGEA 2N0MA 2IWEA 2B3IA 1HFUA 1AZCA 2JFCA 1OCRB 2PLTA 4KO5A 2IWKA 2BW4A 3EHBB 3H4FA 3X1NA 3FQYA 4M4RB 1WS8A 3PCYA 3TBCA 1QNIA 1JVOA 1MG2C 2WO2B 1KV7A 5B7FA 4DP6X 2HZHA 3OMAB 1IUZA 1ASQA 2GB2A 5B1JC 2PP7A 4NB7A 3AG1B 3N55A 3NSYA 3NJMA 2UX7A 3H56A 3X1FA 4A2GA 4BDVB 1L9TA 1GW0A 5E9NA 1NIAA 2BZ7A 1IBYA 2FQDA 4CSZA 5B7EA 3ZX1A 3TA4D 1WA1X 2VW6A 4G7RB 3CVCA 1JZIA 2LLNA 2YXVA 3JTBA 3QJRB 1PLCA 2BWIA 4CSPA 1AQ8A 3FSZA 1A8ZA 4NERA 2BZCA 3FU8A 1GYCA 5D4JA 4DP4X 3QJVB 3T6VA 1NIFA 1ZIAA 3L45A 1NWOA 3FU7A 2DWSA 3X1GA 3WIAA 4E9WA 1A3ZA 1OE3A 2VW4A 1NIEA 4L0PB 4HZ1A 2R7EA 3FPYA 3TASA 2IWFA 5B1AB 1KBVA 2OJ1A 2AZUA 1ILSA 2W8CA 1RZQA 3GXUB 3OQRA 1JERA 2YAFA 1J5DA 3OMIB 2Q9OA 2YAEA 3S3DB 2CUAA 2ZWNA 1CYWA 3BQVA 1JZJA 4YSDA 4YVUA 3ZDWA 2YAPA 2AVFA 4E9TA 1RZPA 2BWDA 1ETJA 1BAWA 4N4YB 4KOBA 5IY5B 2IDFA 3WG7B 4NAJA 2FNWA 3CG8A 1NTDA 4BXVA 3U25A 3UAEA 4DP2X 3NSFA 2FJSA 3HB3B 1W8EA 1XB6A 2QDWA 1BXUA 1PZBA 4BWTA 1VLXA 1TU2A 2BHFA 1PMYA 4HCFA 3IN0A 4E9RA 4BWWA 2PPAA 2IDSA 1UATA 3EF4A 3NP4A 1ET5A 1QLEB 2FQGA 3G5WA 3FQ2A 1OE1A 1BQKA 4YSCA 4BK5C 1JXGA 2J5WA 1JXFA 4DP1X 2X87A 2HX9A 2OCCB 3S8FB 1R1CA 1AZNA 1PY0A 3ASNB 4AX3A 1IKOP 5AZUA 4DP0X 1AOZA 2IAAC 5EHFA 5I6NA 2FT7A 4BWUA 5A7EA 4KO6A 1HAWA 4YSTA 3FYIB 9PCYA 3D12B 1J9QA 4HHGA 1SNRA 1KDJA 4M3HA 2FWLB 1M9WA 2IDTA 1ET8A 5F7BA 2GSMB 1PLBA 1DYZA 1PNCA 4AZUA 2PPEA 4A68A 1PZAA 2YARA 3FSVA 1JZHA 3WKPA 3MBWB 1XB3A 4KNSA 3T6WA 1BYPA 3NJGA 1BXAA 2XYBA 1L9PA 1OCCB 4AKQA 2HXAA 1BQRA 2FQEA 1SF5A 2ZXWB 4A2HA 4KNUA 3NYKA 1SHWA 1WA0X 2NRDA 1M57B 2FT6A 1WA2X 1AZBA 4YSOA 3FSWA 1MZYA 5B1BB 2WSDA 3UADA 1KDIA 3WNIA 4TXVB 2XUWA 2XVBA 1N70A 3QJQB 3WNJA 1JVLA 2H47C 3MX0B 3V9EA 2XWZA 2BP0A 3UABA 4GYBA 4PCYA 2TSAA 4X4KA 5TK4A 2BO0A 2EILB 1AAJA 1NIBA 3AY2A 5AKRA 4YSEA 3WKQA 4A2DA 3PPSA 5LDUA 1SDDA 1ILUA 5PCYA 1FWXA 2BP8A 3IE9A 3NSDA 4W1TA 2EIKB 1L9QA 1JOIA 4DP8X 5D4HA 3FU7B 2OV0A 1F56A 3ABMB 5B1KA 2MTAA 3IN2A 4QKTA 2GHZA 2EIMB 1X9RA 1WS7A 2R7EB 3T6XA 3N2JA 1URIA 3ABKB 3ZBMA 3IEAA 5I26A 1KGYE 1BQ5A 3TU6A 4F2EA 4GY4A 2CCWA 3UACA 1JZGA 1KCBA 2AFNA 2DYRB 2UXGA 2CJ3A 3H4HA 3UAAA 4ENZA 1NPJA 2WO3B 2YAHA 5I6KA 3NJHA 2QT6A 3AG4B 3V9CA 3KW7A 2HX7A 1JZEA 3FS9A 2IH9A 5PAZA 4DPBX 1GY1A 3SBQA 3QJUB 1CURA 3X2QB 4BXSV 2IDQA 1EHKB 2QPDB 4GXFA 4AKOA 1YLBB 4DP9X 1NINA 2YXWA 2PP8A 1GS8A 2I85A 2IH8A 3DIVA 3OMNB 1KBWA 1E67A 2PP9A 1ASOA 3EH4B 4G71B 4JKNA 2AANA 4E9SA 1CC3A 2JXMA 4EF3A 4A2EA 3OM3B 4HALA 2VW7A 5I28A 1TEGA 1AIZA 5F7AA 3DTUB 1GS7A 4YSQA 3IBOA 1GY2A 2B08A 2QPEB 4E9XA 2VN3A 5I6OA 1XMEB 2FT8A 1E30A 2TSBA 4G70B 4Q89A 1RCYA 2PPDA 3T6ZA 4AKPA 4HAKA 2YQBA 2ZOOA 4YSRA 1OOWA 2P80D 3ASOB 3X1EA 1J5CA 2EINB 4E9YA 2DYSB 1ADWA 1L9RA 4UAHA 2XV2A 2GI0A 4HCGA 2VM4A 2XX1A 3FSAA 1E5ZA 1V54B 1OCZB 1ZDSA 2MRYA 1T5KA 1AZRA 4DPAX 4FA7B 1V10A 5TK2A 3QQXA 4KNTA 2PPCA 4HCIA 4A67A 3NJNA 3AZUA 1PCSA 3WI9A 1SF3A 4F7KA 2IDUA 2P80A 4JHUA 3EH3B 1HAUA 2XXFA 1QHQA 1A65A 1FFTB 3FYEB 5FC9A 1E5YA 1AZUA 2CBPA 2Y1AA 3CDZA 2XX0A 2XV3A 2BP0B 2Y69B 4UANA 4ZK8A 2VSKB 3NSCA 1PLAA 3S8GB 2J56A 1A4BA 2UX6A 4P5SA 1AANA 1NDTA 2PCYA 2UXTA 1GR7A 1SDDB 3PAUA 4YSAA 3T9WA 3C75A 1MDAA 2BP8B 4WTQA 1AS7A 1CUOA 1EZLA 2A3TA 2GBAA 2JKWA 2H3XC 1A4AA 4DP5X 2X88A 5I5JA 1PZCA 2FTAA 2QDVA 2Q5BA 1V55B 1M56B 1SHXA 3SBRA 4GP4B 4MFHA 3NJLA 1ID2A 8PAZA 4BDVA 2GC4C 1OF0A 4QLWA 3NP3A 2W88A 3PAVA 3PLYA 1SFHA 3HEIB 4YSUA 1ET7A 3OD3A 1IBZA 1FA4A 2HX8A 2ZONA 1WAEA 4AI7A 2BW5A 3FU9A 1E65A 1GSKA
chains in the Genus database with same CATH superfamily
4N2CA 3F7YB 1ESOA 1JZFA 4JRYD 3U48A 5T5FH 4N8UA 3P2BA 1UZGA 2NW3A 3GPEA 3KHQA 3NJXA 2RR3A 4XMPH 3L17A 1AS8A 1TVBA 2WLNA 4B9PA 4R7VA 2Y7QA 4BKLA 4YGVA 3DVNB 4WKZA 3P69A 4P5MB 5JW5A 3KLDA 3TBYA 4OSUH 5BZWB 4R7NA 2I9LB 4Q6IC 5F9WC 1IAKB 1JDDA 2JB6B 3TVMD 1DQMH 3KVDD 2OK0H 3WJMB 4U31A 2R59A 4X80L 1UM4H 3OKOA 1U41A 4Q74A 5A6IA 1Z66A 4AUJA 5I6PA 2X05A 4OLXL 4YC2B 5CKAA 4JM2B 1JPST 2G3NA 4JG0H 4A6YA 4NIYE 3QQ9C 3MV7A 3ZRCC 1X4ZA 4Z7OF 2D8KA 3MZTA 2ITDB 1QR4A 3DBXA 1FG2A 2VDNL 1EZUA 3G08A 1WFUA 5E5RB 4UQBA 1KEGL 2BIMA 5E6IB 4X5LA 3R4DA 3A4EA 1RKRA 4HOZA 4A39A 5DQDL 2B2XH 2FL5A 3TBSA 1NCGA 2EXYD 5C0IA 2HFEA 2P8MA 3ZPDA 4YPJA 2ADYA 5AOLA 4L9LA 3GI8H 2ZF9A 1R3KA 1PX3A 4JPVH 1N5YL 2NY1D 2XY2A 3AXIA 4TVPL 3QUMB 1KG0B 5B3JF 4FE9A 4NJ9H 4KWUA 2R15A 2OMWA 5ANHA 1P5UB 1OCWH 5JNYB 3DKHA 3BQUA 4LOUC 4G7SB 1MHPH 2R4SL 1KENL 4FYSA 3TT3H 3KD4A 1B90A 1AR1B 5EFIA 5I0XA 4JAMB 5ITBL 3NJIA 3HLAB 1FAKT 4HPHA 1TIUA 2AXJA 3DX6A 4BH7A 2QGCA 4RMWA 1WE5A 1L9OA 3B3IB 1TTGA 2VUOA 4R4ND 3CDZB 1AY1H 3M6DA 4G8AC 4TNEA 1JTOA 4F5CA 1U6AH 5DDHB 1U8HA 5I1GH 3CUPA 2Q3ZA 4LB8A 5EZLA 3IKKA 2Y1YA 3U4BH 5L0QC 4BQ9A 2XOTA 1IM3B 5KG9B 5D1XC 1BFTA 4KI5E 5DYOB 1O0VA 4OJEH 5I30L 3D2TA 3IDIA 4FFTA 4HX1A 3TZVC 3BZ4B 3H53A 4F7CB 3BGFB 5HDBF 1UB6A 2F61A 3ARBA 5KS9E 1KB5B 1R0AL 1MF2L 2EACA 5AWNH 4Z7WF 4X6EB 3BJLA 3OJ2C 5D1QB 4QNPF 1WGOA 2B5IC 3L4WA 3LZPA 3QDMA 4LVNB 4KXAA 5FS5A 4JN2B 3IJ8A 3NJMA 3VWKB 2A5UA 3DC0A 3W1ZA 4AYFA 4H25B 3NCJL 3S5LB 5DQ9B 4JCWA 3C5SA 2ARJB 3T3PF 4LPXA 3BLBA 4CSZA 3U2JA 3WN5C 3Q8AA 4AV5A 2QTVA 4NOBA 3WENA 1RU9L 4OI9A 1AHWC 2G5BA 4FG6C 4RBPH 5EU6A 4JRWA 4NQCB 2OCFD 1NH6A 4WWKD 3HCVB 5HYQB 1HIMH 3NIGB 4F8NA 2ED9A 4Z7QE 4PIBA 3D69B 4L5FH 2FBOJ 3RVUD 5D7JC 5E5MA 4MNHA 3FTSA 1IEBB 5T5NF 3LNHA 4P49A 4PJCA 5AOJA 5AW4B 1ED3A 5IEHB 4ODSH 4YLQT 3WMPA 3B34A 3L4XA 4FXKC 5ABDE 3QQ3B 1DVTA 4FTVD 4WJ5A 1AKPA 2R0WH 3LKOA 3RY6A 1QKZH 4M5YL 4K3DL 4LLUA 5T3ZD 3KWTA 25C8L 4GAJH 1PFCA 1S9VB 2O5XL 2EDKA 3D0LB 4YL9A 2PW2B 2WWMC 1ZVYA 3MCLL 4H5SA 3P73A 3TEUA 3FFCA 3MRGA 4E41A 1FO0H 1MIML 1CZ8L 5I16A 3V0GA 3P3SA 5GZOD 5KSUB 1GPOH 1PEWA 1RZPA 5AKSA 2J8UA 3NQIA 4L8CB 2MQ0A 4P4KD 1AFVH 1RI8A 5A2KH 4WFGE 4JRXA 1RHFA 3U36A 2EUVA 4OIIH 4EI5A 3U25A 3QJHA 2GK0B 3KPQB 5EG6C 4BHUA 2BFVL 3U6RA 2YGOA 1SHSA 3WFDH 3LH9A 1ODUA 5EUKB 1TU2A 3ZRFC 5LBVA 1M3IA 3L95B 4MTMA 3MMEB 3BJ91 3PAYA 3MJ7A 4KAQH 1MNNA 1MJUH 5KSAD 4GUCA 1Q90A 2AJVL 4CMHB 1DQIA 4UBDC 2Q7AA 2XWXA 4MD4A 4Y1AA 5DJAB 4D0DA 1CI3M 1I1FB 1B9KA 2BSTB 3N0PB 4IEFA 8CGTA 4Z3GA 5I76B 4M7LH 4PJ7F 2AEQH 3HG3A 1IL1A 3GSQB 1SUHA 4C4BA 3GBML 2X41A 5DEFA 1I8KB 5AZUA 2Y07H 2IAAC 43CAB 3IDNA 3T4AC 4JO2L 1JDCA 1CF8L 4LHQB 2FHCA 4KUZH 3T4YB 1DUZA 3EF7A 4NUGL 2EVIA 1LP9F 1QHOA 2CLRA 2H0EA 3GFUA 1JFQL 5K9OA 5TDPA 2FWLB 2IDTA 2CGRH 5I6XB 2QSQA 1PLBA 3CAFA 4JFED 4YS4A 1VZHA 3P4OB 3KBFA 3D5OF 4B3EA 1HZKA 1MW2A 2J4WH 1R3IH 4RFNB 4U4IA 2FDBP 1XF5A 1ZLDA 2AQ1A 4UV7H 3NFSL 4FYTA 1M7UA 4IMKA 4U7KA 2DW5A 4IBZA 4DKDC 3FTXA 3O2WL 4G43A 4OGAD 5G2NA 3O8XC 1CFSB 2MOVA 3HB3C 1DLHA 1FFNB 3O81A 1RUQL 3BKCL 5GRVK 3N9GL 4XCCH 5HHXH 1AO7D 2CBQA 1GJWA 4M62L 1BBJB 1SHWA 1RZGB 4M93C 1U3NA 3S88H 5DR5L 2ZUQC 1VCBC 4FNLL 4KJPD 3CC5B 2WSDA 4DGYH 1FE8L 4TXVB 5F7DA 4F58H 1N70A 2NLJA 2KZKA 4JB9H 1G1CA 4KQ3L 1H3VA 2FBRA 5J3HC 2YPVA 4IK6A 4JFPB 1TJIH 2PXYA 4FKHA 4C56D 2HFGH 4NN6B 1A4KA 5KYWB 1DVFB 1JWSA 3BEVA 2WXJA 1E40A 3DRTA 1WK0A 3KPOB 1J5HA 5HHMB 4ONGL 1NCUA 5FO7B 2CHDA 5GGSY 1IB5A 4FNSA 3IS1X 5F7MC 4DF9A 2NY6C 2WXFA 5BMFH 2NNAA 3A4FA 1A3LH 4E2OA 2DN7A 5CLXA 4YDLB 1T1WB 4KFMA 1MFBL 5LQBL 2Y23A 3GSOB 2BSED 2W0LA 3GJFK 4HT1H 3QYCA 3IT8D 4AL8H 4NO5B 4LLDB 2VN7A 3FONB 4G82A 1ADQA 1BD2A 3CXDH 2L4OA 4OCMC 3ULAB 3L6FB 4KHXL 1MDTA 3IEAA 4O4YH 1FN4B 4FFWD 4HKJB 3DX2A 4MVBD 3ZDXF 4ZYKA 1A9VA 1QG3A 1HSBB 3GKWH 5DZAA 3TU6A 1QSFA 4LASH 2AJXH 2Z31D 5DD6B 3SYPA 4QKXB 1J7VR 2NNXA 3IJSA 1BFVH 1R19A 2E3VA 5E2JA 3H3PL 2HMID 4GQPH 4WTZA 3QZLA 3TYFB 4LLAA 3F7YA 4HBCL 1K72A 4FI7A 2H7WA 1S2EA 4NC2B 3M45A 4IDLA 4ENED 2H2PD 3LRMA 5DD3H 3VSUA 2C8NA 5F3FA 5DC9B 2IQ9L 5K1NA 4N2DA 1I1AA 1EIBA 1BFOA 3ETSA 3K0WA 3DVNA 4XPGH 1FHNA 2K7PA 4P5MA 2DQHH 5JHDE 3X2QB 2ZYRA 4LRIC 4Y4KB 1RD6A 4L1TA 5I0DA 1QRNB 5BZWA 3NBNA 3OC8A 1D3CA 2I9LA 4GAGH 3SO3B 2JB6A 4AL8C 1MFNA 3WJMA 5HYSB 5F0LB 2CR6A 1F11B 3OMNB 2EDQA 4AQ1B 1X3DA 1E67A 3BAEH 5FYLL 4ATWA 4Z7UA 3VG9B 5C0GB 4U1HB 3P11H 3NH7L 3U9PL 1JS4A 2V3FA 4KMLB 3Q2WA 1E50A 1PJWA 4AIEA 2ITDA 2QQKL 1DL7H 2J1ZA 3EFOB 1QACA 3SBWC 1BLNB 2VQ4A 3V79C 3QXAB 4Y9CA 5E6IA 1GY2A 2DQDL 2XICA 4FXGB 3SGJA 5IR1B 3EYVB 3EO0B 1F4YH 4EZJA 3IDYB 3N5AA 4NFDA 3BWZA 1JZ6A 2LE9A 1RCYA 3BSZL 2D03L 3EDDA 4ODVH 5IV2B 1F4XL 3ALWA 1FNAA 2ODHA 2Z93B 4YSRA 1A7OH 4NRZB 1MUJA 3IF1B 4LVOB 4OCXH 2EKSB 4KXZH 2GTZB 4M3KB 5BVPH 4Y2DD 3CDGB 1KG0A 1T4WA 1ZDSA 4KI5D 3ARFD 2ZOUA 2NNCA 2R69H 3SPIA 5CM1A 5JNYA 4XWOC 4ZFZB 5HHVL 2VMFA 4N25A 3FAXA 5IESH 3POHA 3C5ZD 2OBGA 2RBLA 1OP3K 2HN7B 1GYWA 4HCIA 4K8RH 3HR5B 3Q5YA 4V1DB 3MI6A 4JAMA 2IDUA 1NLDL 2YA0A 3WUWG 2VH5H 5DFWH 4Y88A 5C71A 3VI4F 1L3WA 2Q87A 5FC9A 1JPSH 3BUPA 1DVUA 4M1DL 3B3IA 1QRKA 4LOEA 3CDZA 1NBYB 4GG6B 3EDKA 4UANA 5DDHA 4AQOA 3C8KB 3AY4C 1LILA 3W81A 5BS0E 1IM3A 1XAUA 2VWEC 5KG9A 5DYOA 3VFVB 5J89A 4WI8A 5CILL 5G5DB 1WBXB 3BZ4A 4L3EB 4F7CA 2YS4A 1SEQL 3K5SA 4YSAA 1KB5A 1MRFH 1JGEA 4N1CA 1A1NB 3T2PA 3MV9E 1R5VB 2EEBA 4WEEA 4X6EA 2CCLA 2R29H 5D1QA 4EEEA 5IFJB 2Y1VA 2EABA 5K59E 2JKWA 3D6GA 4KTDH 5C0ND 5AD0B 5DFAA 2J72A 4XP4H 5ILTH 1XCTB 4GP4B 3VWKA 3IAQA 1HSAB 4H25A 4K8RC 3S5LA 5DQ9A 2VDPB 2YPLE 3ZKNC 2ARJA 1T5WB 1JYWA 5T33H 5TPWL 3ARVA 2RIKA 3PLYA 1URLA 1JYXA 1ET7A 3JWNE 4M43L 3SY6A 2OL3H 4NQCA 3WDIA 1O7DC 4FFZH 2WXLA 5LCVL 1IAMA 3HCVA 2QPSA 5HYQA 1YEWA 2N4IA 3WTYA 3X14B 3L5XL 1SDAB 1N68A 3LRKA 2EDXA 3CIQA 3D69A 1BZEA 3LH2H 3GHEL 3BZ5A 3R7QA 4OCSH 1IEBA 4M7KL 2E0PA 3SGEH 5IEHA 1PAZA 3QEGL 1FYTE 3VM5A 1JG9A 3QQ3A 4JFVA 1H6TA 5FGBA 3MNMA 4OD3L 1NWPA 5JIKA 1H3WM 5D7IE 2F54B 3D05A 3V7AE 3P30H 3UTZA 1S9VA 3L3HB 2GC7C 1RUMH 3D0LA 4DN3H 2VO8A 2PW2A 2IFGA 3KBEA 3BGAA 5JHLH 4NWTL 3CZLA 2BY0A 4PGJA 5KSUA 1MG3C 5FFOA 1UJ3C 4XC1H 4L8CA 1YEKH 5AFAA 4JGNA 4Y16D 4OJAA 4MXWL 2VLKD 5E9DE 1LJMA 2C4XA 2GEQA 1RUPL 2GK0A 3KPQA 1SOQA 1BWWA 1UADC 5K39B 2G3ZA 5IJCC 2Z1PA 1EHAA 3L95A 3K2IA 3MMEA 4FFVD 4FJYA 1XR8B 4KROD 3TT1L 2LABA 3B2MA 3QDJE 2D4DA 3TA3B 2OSYA 1ZJAA 3CQQA 2XTLA 1GS6X 5F93C 5B1JA 5DJAA 3HC3L 5DRZB 1AI1L 2VQ1B 4FAAB 1I1FA 4YXHL 5DFVD 2BSTA 3EUDA 5JIHA 3GZQA 3QG7L 3ARDD 4QF1B 5I76A 1XF1A 1CLZL 2N7AA 3GSQA 4K5PA 1MSPA 3C60C 4RISL 4X8JB 3VXOB 1I8KA 1AACA 4F9LC 43CAA 4E36A 3V6BR 5B4MC 4IW4C 5T3ZL 4I1NB 3T0XA 5FO9B 4UV4H 4PRPB 3T4YA 4QXVA 1P6WA 3VYNA 3UX9B 3SYOA 1T04B 3LKQB 3VFGH 5D2NC 2OTUB 4TSBL 4GB9A 2X38A 4UINH 3LQAL 5C0AA 2W80C 3G5ZB 3VWJD 2DQIL 3D2UB 3P4OA 5HYFA 3EZ8A 5J1AB 5JQIB 3GBLA 3BP4B 2RH0A 3C2SA 3QUZB 4KJQC 4V33A 2JFCA 4BZ2L 3N1FC 3FQYA 4A7TA 3PCYA 4EDXB 1MFUA 1CFSA 5IMKB 4OV5B 1FFNA 3L1OL 4P46C 3DGCR 2HZHA 1T2XA 3K6NA 4HWBH 1BBJA 4EZLA 4BINA 1RZGA 2H9GB 4N2AA 1XDTT 1U3JA 2MCPL 2ZOLB 1H9VA 2UZIH 3CC5A 3IYLW 5CZRA 2VDML 3SD5A 2W91A 1M1SA 3WBDA 1JNJA 4H26B 4JFPA 1NBCA 4M4PA 1HWGB 35C8H 4P2OD 5KYWA 5FK9B 1DVFA 1ZLVH 1BAFL 1KTKE 1NC4D 1VENA 2YXVA 4WCYH 3KPOA 3TYGH 5A2IH 4K07A 5C7XL 4H88L 2BWIA 3KPPB 1AQ8A 5FO7A 2BZCA 3HG0A 2GUOB 1FORH 1T2JA 3EOAB 3RIAK 4JJHA 3PIQB 1T1WA 4R7XA 2R1WB 1TQWA 3LTVA 3GSOA 3D4ZA 4MGXA 2BNQE 4U1LB 1NGXB 3UCRA 1OVZA 2FWOB 3LPOA 3X1GA 3WIAA 2EDHA 4U33A 5DD1L 3WFBL 1NUDA 3OAYK 1QX1A 4LLDA 4NO5A 4ZAKC 4W4NA 4EZMA 3ESPA 1QBAA 3FONA 3ZE2B 2P46B 4GMTH 5JHDD 5HVWA 3L6FA 2Y3NA 3GXUB 4NBZB 1FN4A 4HKJA 4OLEA 4ESKA 4LQFH 3W0WB 2O5NA 2YBGA 2Y7NA 1EXUB 5DD6A 2PYED 5DWUL 4GKSB 2JSFA 4ANWA 3TYFA 3IGUA 2AQ2A 4ZI8A 3PQYB 2IAND 2JH2A 4FNRA 4JR9L 4HJUA 3E3QC 2XTJC 4WI2A 3VXNB 4LGPB 3QO0B 3NSFA 2PCFB 5EEUA 2IBZX 1SXZA 2QHRL 3SGKA 1BYNA 2Y2YA 3G6JB 3W5NA 3L2MA 2G0KA 2X1OA 4Y4KA 3SKNB 1GGBH 1QRNA 4IRSD 2G0LA 5LG1A 3RJOA 3A6CH 2AEWA 1QLEB 4R7DB 5FYKE 5KOMC 3Q6FB 4GSDL 3EBAA 4OLYL 2NY2D 5I8KL 4BEIA 5C0CD 1IJ9A 4AQ1A 2AJYL 3RL2B 4J39A 3UJTH 4ZX4A 3N42F 5ADOH 2AQRA 1XIWC 2OCCB 5C0GA 4U1HA 3GS4A 1E7UA 3N85H 4TTDC 3DGDA 2XNAB 1GOFA 2KDGA 5ENWB 3EFOA 2ZPKL 4QRRD 1HU8A 3FBKA 3UDWC 4CNIB 1BLNA 1OAZH 4S0TD 5CFHA 3QXAA 4KO6A 4YSTA 4FXGA 2WUBL 5IR1A 4TNGA 3EYVA 1IBDA 4X99B 1SNRA 3MRRB 3LHAA 3MLUH 5DHDA 4OT1L 2MKWA 3FC8A 5IV2A 2KZBA 4NZ8A 1GGTA 2Z93A 4O9HL 1UFUA 1DEDA 4NRZA 4TM9A 3IF1A 2PPEA 2EKSA 3L3IB 2GTZA 4A68A 4EI0A 3IVKB 5BRZE 1JI1A 1NFDF 2F7PA 5BS0D 3CDGA 4KNSA 5JXAL 2MOGA 5DRWB 5J6GA 3KGRA 2BVYA 4ZFZA 1MH5B 1PY9A 2HN7A 3APCA 4ZODA 2C9XA 2ZCHL 4F92B 2VZTA 3HR5A 1IIIA 4HIIB 2GBTA 5D70L 4V1DA 3WDHA 4FABL 3K2UL 1AZBA 3MXWL 1DJSA 4NI6A 2K78A 3SCMC 1EV2E 1D6VL 1WAPA 2YPLD 3ARGB 3KHOA 3I6SA 1NBYA 4GG6A 1YNTB 4KXDA 3C8KA 4ERSH 3B37A 3H2WA 3NCYP 4XB8A 2A9DA 5SWZB 4WLCA 3HRZB 2AABH 3AY2A 4YBLC 1F8TH 4M8QB 3VFVA 1AQDB 3M1OA 4K2UL 2WVTA 5G5DA 2NY4C 4FG4A 3BWAB 4L3EA 4LIQE 1FSKC 1ZHBB 3CLWA 1CBVH 2JCCF 3BDYL 1A1NA 2BSRB 5DUMH 5KYUB 1KCSL 5IFJA 1HT6A 4YFDB 1D9KB 2OV0A 5TF0A 1WAAA 2JCWA 3TS8A 4TVUA 1FYTD 5AD0A 1X9RA 1Z0NA 4YDVB 3W5MA 1XCTA 1HSAA 5DZ9A 1MFMA 1LEIB 5MEQB 3H7BB 1KGYE 4FMVA 2EVFA 1OW0C 2XY1A 4F2EA 1FIGH 3W9EB 5LN4A 2DYRB 4P4RB 2F8XC 4M1CD 3ULUD 4O58H 4PRNB 3Q3GB 4FG2A 4JM4L 3W11C 4ZUUB 3ZK0A 3VGAC 3X14A 1TSRA 5DVOA 5SWSE 1DFBH 3C6SB 3WKNA 2GQHA 4F8QA 1MNUL 1N8OE 3EYQC 1CDYA 5CN2A 5TE4H 3C87A 1P7HL 5E9DD 5EF3A 5PAZA 4DPBX 4JFDB 1YUHB 2VKWA 1DQDH 2ZSVB 3K4DA 4MQSB 2NY0D 3HN5A 3K1KC 4X7CC 4CMMB 5D7SH 2F54A 4Z3HA 2IDQA 4PJHE 5E7FA 3MCKB 5KVEL 3QDJD 5JOPD 1J8RA 3NACH 3L3HA 3GWJA 5FUOL 1U92B 5BZZA 1BCIA 2PABA 4UDUB 1GS8A 1KCLA 1UD8A 4YLCA 3HLKA 4ZOAA 2J2ZB 2PP9A 3TWCH 4Y19E 1JZ8A 1P4LB 4EF3A 5CD3B 2EJ1A 1IAII 2X2JA 5I1JH 3FUMA 4X4YB 4OTXH 1JNHB 3A6BH 1DSYA 43C9B 4N2BA 5K39A 4X4ZA 1UD5A 5FHBL 1XR8A 2BLFA 3WY1A 1YYLL 2CO3A 1FLRH 1X7TA 2L7QA 3GLDA 2DYPB 3J27A 3HG2A 4GNKB 1KBPA 3TA3A 3E7JA 3WMSA 5CSGA 3ZE1B 5DRZA 2VQ1A 1OOWA 3AC0A 3UAJA 1P0SE 2XWTB 4N85A 3HC0B 1L9RA 2LTQC 4QF1A 2HTLC 1YQVH 2J6EL 4HP5A 1PEZA 2Y5EA 4G6KL 2K70A 1CXEA 3B5GA 4NQSB 4X8JA 3VXOA 2G4GA 2EKJA 3LN4B 3MCYA 3H0TB 3MLSH 5FO9A 1IGML 4PRPA 5FLVA 4DEPC 1XH0A 1QNZL 1T04A 3LKQA 2CUHA 2VISB 2OTUA 2D0GA 3NSXA 5TFSH 4GO8A 2ZOWA 5I15L 5MENE 2ENPA 3G5ZA 1AZUA 3HN3A 1KB3A 1ZLWH 1YEIH 3D2UA 2VR3A 4AIZB 2J5LB 4JM0A 4PWEA 1OWRM 1QD0A 2XG4B 3BP4A 3KWXA 3QUZA 1IFHL 5BRQA 2H26B 1NDTA 2UXTA 4PP2B 1R3HB 3ZT7A 4EDXA 5IMKA 3RWDB 3CSYB 4OV5A 3T9WA 1T7ZA 2C3GA 2C4FT 4FQIH 5J11C 5LXVA 3VI3F 1TJHL 3GMRB 2E9IA 5FECB 3MLVL 3MXVH 2H9GA 1YPZE 2VDNB 3BUDA 4IBYA 2YMTA 5D9SB 4HMEA 5GGVL 3EH1A 2BNQD 2FHBA 4YO0B 4KZDL 4MZ3A 2ZOLA 3IFLH 4U6VH 1ZPLA 4UT7H 4F33B 5M94B 4WJKB 1QO3B 4H26A 4FMKA 3HPLB 4TSCL 3S35H 3MLTB 3NPSB 4I9WD 1W72H 4RLDA 5FK9A 3DUSB 2A9NL 1G5GA 3BRDA 3G04B 3KPPA 4QHKJ 1A6AB 3NFNB 3CLFL 3EO9L 2GUOA 2JJWA 3DIFB 3WTWA 3I2CH 3EOAA 2B9BA 1USQA 2CRIA 6TAAA 2R1WA 1LO2L 4WEMB 1NGXA 4N1EA 2FWOA 4JCMA 5EU7C 1QSVA 3KBHE 1BYOA 3QHFH 3MRCB 1Q0YL 4JK0D 4ZXBB 4F7EB 4FZEL 3D85B 4JKPH 3SQOH 1N4XH 3NEOA 3BKJH 1L7TL 4RH4A 4MCYB 5F6IC 1E4WH 3PAZA 1AMXA 3W0WA 5FYKD 1JYVA 1EXUA 4GKSA 6PCYA 1II4E 3AU1B 5H94B 4TV3A 5FW6A 4NQDB 4J1UB 3ERXA 3HHRB 2JELH 2DQEH 4QRBA 3IAGC 3WKMH 3VXNA 2H6OA 2XQYG 2D2CC 3QO0A 3CFDB 2PCFA 4AITA 4NKIH 1SVZA 1ITCA 1LXMA 5L2KE 3X1BA 3S98A 3QYMA 3G6JA 3R1GH 5L8KB 7PAZA 3IGAB 3SKNA 3U0PB 4A2FA 4Z7IA 5EOCL 2BFGA 4YEEA 3KWUA 1AG6A 4XVJL 3ULSA 2V6HA 1AQKH 4R7DA 5DJYB 4XMZA 3Q6FA 4ZT1A 3GD1C 4L1DA 3RDTB 4KO7A 3HZMB 4AE1A 5LHDA 3QHTC 4YSPA 2KMWA 3RL2A 5BRZD 4OLZL 3V0DA 3Q2NA 4DGVH 3KPLB 2YRPA 3Q6GL 2H1PL 2GIMA 4PREB 5CUSL 5JDSB 1J10A 4RA3A 5C7ZA 1V8HA 4D8PB 2P7TA 4W68A 4CU6A 4NHUB 2XNAA 1X9UA 4XNYL 2Z3FA 4PJ9C 5ENWA 5JQHC 4HS8H 3N1MC 3BOVA 5F0PB 1DN2A 3ZKXB 5F7YC 1MCFA 3K3QA 3MLYL 4IJ3C 2WLJA 3LIZA 4HF5H 1EJFA 1IM9D 4L4JA 4X99A 4J3SA 3RP1A 3WFEH 4E0RA 1VEPA 3GM0A 2Q3XA 3MRRA 4KKCC 4HQQL 4XVUD 4XMTA 4OH2A 2GIYA 2JF1A 4XZUA 2I07B 3WNNA 4AVIA 3WFCL 3VH8A 1EWHA 3QI9C 3V6FB 4N5UA 3GSNB 3NIFE 3L3IA 4PJIE 4S1SL 3IVKA 3TONA 1IQDB 4PG2A 3A67L 1AZCA 2OZ4A 1LHZA 2J1XA 3OKNB 1R75A 2PLTA 2XVGA 2NDGA 4X4MA 5DRWA 5GZNC 1T7VA 3FO2B 1OAQL 4PS7A 2X0UA 1U3YA 4Z3JA 1MH5A 3NA9H 3DMMB 3QUYB 3SDXE 2WP3T 2XWJB 1OAJA 5DRXB 4XMXA 3N91A 4X9GA 1HC1A 5C0BB 4HIIA 3BE1H 5AVRB 1TLKA 4X6CE 4AM0Q 3LRLA 3T0EC 2BRRL 4WW2C 3E38A 1NAKL 1AP2B 5CBEA 3VG0L 1IT9L 3ARGA 4AW7A 4QHNB 4Z6AT 1YNTA 4BIKA 1E8ZA 2LOEA 3C12A 1SJVA 3MV9A 3SD2A 1DBKL 4RWYL 3KYMA 5SWZA 3HRZA 4AYDC 3BN9C 4M8QA 1J87A 1AQDA 3FSZA 3QWNA 4OV6F 3E1ZA 5BRPA 1YSOA 3BWAA 4ZMNA 1LMIA 2CLVB 1ZHBA 5FW8A 4GKOA 5L7XL 1G7HB 3ZDYF 5MP6L 5SWSD 2DQCH 3DJRA 1YEHL 2A9BA 4KKZA 2ZD0A 2YKLH 1B2WL 5KYUA 2ZP0T 1ZIAA 3TO4B 3P02A 1QQDB 3TNMB 4E9WA 4G6JL 4MA3B 3UMNA 2XPGB 1XAKA 3DX7B 4YDVA 3L9YA 3RJDA 5B1AB 3ET9F 2AZUA 3IBEA 4FL4C 1UM6H 4ZMAT 4TLTA 1QUNB 3BYYA 3PWNB 1LEIA 4TMPA 1CTNA 1CI5A 2IPTH 3H7BA 4KVNL 4WW2F 3BMWA 3D39D 4C4KT 2Q9OA 3WEBA 3W9EA 3QAZB 2YOAA 4P4RA 1Y6NR 4MA8L 4PRNA 3Q3GA 2Y7SA 2ZUXA 2DM3A 4ZUUA 2K7QA 2JJUA 1SOXA 4EDWH 3C6SA 1ORSB 2ZYSA 4JREC 5GGQL 5F6HJ 2XG5B 4N3UA 1ULVA 4OJFL 2NZ1A 4LSRL 3CSTA 3X3GL 2QDWA 4JFDA 1YUHA 1AQMA 2ZSVA 3LD8C 1LEGB 4TTGA 2BSBA 4JFZL 1HWHB 4CMMA 3D4CA 4KQ4H 2MH4A 1IEHA 3MCKA 5D5MB 5B8CB 1VCAA 1KYOK 3IDMA 4OQ1A 3AB0B 1KEMH 4G2AA 1QBLH 3NP4A 1U92A 4UDUA 1D5ZB 1EPFA 5CZVL 1TCMA 1UWGL 1Q9WB 1KJ3L 2J2ZA 4NM8H 3UJIL 2CBTA 1O6SB 1P4LA 4FYQA 2A9CA 5CD3A 4GRLC 4B0MB 2E7HA 2DIAA 3EBHA 3BAWA 3QIWD 4X4YA 1HHJB 5DZJA 3RX7A 1JNHA 3V10A 1RZFH 43C9A 2TRHA 3ECWA 5I24A 1GGIH 4KKBC 4JFFE 2APBA 4JMXA 4PJ8D 4UNUA 4HHGA 1J11A 4M3HA 3ZQXA 3ULUL 2DYPA 2W65B 4ZFGL 1EDQA 3FOMB 4FQ1L 5MEND 3AROA 4WFEE 2X09A 1ZEAL 2OYPA 3TPUB 2XWTA 3HI5H 4QHPA 3HC0A 2DF3A 5DMIL 4P57B 3C6LB 4AMKH 2J12B 1BVZA 1XD1A 3BKMH 2VT0A 4NQSA 4BFFA 4A7GF 1J0ZA 3LN4A 4FNPA 3SO5A 4K55A 5J13C 4Z7VF 3L3OB 5I1KL 4JHZA 1OK0A 2ZJSH 2GAZB 3BD5A 3KLAB 2WTRB 2EDBA 3VW3L 3QIUB 5ALCH 3C08L 4CJ1A 1RY7B 2VISA 2CUIA 3ROOB 2APFA 1C5DB 1IZKA 3WO4B 1DBML 3WUWB 3D34A 5CLTA 3MX0B 4KY1H 1RZ7H 4AIZA 1PS3A 4GYBA 4P04A 2ZAGA 4L3CB 4POYA 2L7UA 1BIIB 4PWGA 3M8OH 2XG4A 3N6YA 4X4KA 1KN4L 4YFEA 3EJZC 2EILB 5F7UA 3VXUE 1I7ZB 4PD4J 5D72H 3ZR5A 1G9NH 4F15C 3WHXB 2H26A 5I8CB 5G55A 4PP2A 1CLOL 1R3HA 5E99H 4IBSA 1DDHB 2IBGA 4IM8A 3RWDA 3T2LA 3CSYA 4PW9A 4HPYL 4R8WL 1OGAE 1PLGH 3GMRA 1D5BB 1ZWIA 1JOIA 5FECA 5DHVB 3RTQB 3LH8A 3ZUNC 2CNYA 5D9SA 3CVHL 1H5BB 1HQRB 2EH8H 5CR8A 2C5DC 4YO0A 2E47A 1TETL 2WQXA 4F33A 1KFAL 1MRCL 1QO3A 3GTVA 3HPLA 4K3JL 5FUZL 3O3UN 1QLRB 3Q06A 1Y1UA 4XOEA 4DVRL 5AAMC 1CDCA 1RXLA 3MLTA 4GY4A 4UQ9A 3DUSA 2DQMA 2HT2C 5TE6H 3G04A 1MCDA 3CFIC 2FX8H 3ML8A 1N64L 5DD5H 3RU8L 1A6AA 3NFNA 3ME0A 3DIFA 4F8PA 2QSCL 2WTPA 3MLRL 3S96B 2W9EH 3VXPB 1HESA 2HX7A 1G9NC 1KY6A 5F3BB 2IH9A 4NUPA 1J86A 3KE0A 1UT1A 3MRCA 3B9KC 3FB6B 4JVWA 3MV11 4IRZA 5D1XD 5TGBB 4F7EA 4ZXBA 1A7NL 3TVMB 4M8RA 1CGWA 1RPKA 3MRKB 3D85A 4XNXL 3TZVD 3V4PL 4FHKA 1BSIA 1NINA 4MCYA 5AEAA 2GCYB 3IDGB 3M1CA 3K6IA 4PW4A 1WYJA 5IHUH 3TM6A 1DLFL 3CIAA 4OFVA 4PSRA 5D2LE 4FFYL 3AU1A 4LPYA 4RETB 5H94A 2WSPA 4NQDA 1IARB 3O3AB 2YEQA 5L2KB 2WIMA 3FMGH 4J1UA 1B88A 2K8MA 4LSPH 1TOXA 3SPGA 3KGSA 3WIIL 2ZX9A 5C3TA 4AWJC 3RVXC 1J5OH 2EDNA 4J6RL 3LEVL 3ESNA 4AOFA 5C2UB 3CFDA 1OWWA 4DEWA 3UTSD 2EVJA 2ICWJ 2NXYB 1WZLA 4E9XA 1OSEA 1UWXH 1F58H 2R2HB 5CS7A 2HAZA 3UTTB 5I75C 3IGAA 3U0PA 1AXTL 4M6NL 1AXIB 32C2B 1LL1A 1ROWA 5EMYA 2CRZA 5DJYA 2P80D 4IGBC 3D08A 3US0A 4G59C 4GO6B 3HZMA 4S1QL 3BCDA 4XO4A 4FQXD 3MUY1 1INQB 3RFZB 4HCGA 4M5SA 4QLRA 1A9BB 1WSST 3U6XA 1RUAH 2V5SA 3KPLA 1RUKH 5H35B 3MRLA 4PREA 5JDSA 1I9IH 4DPAX 1OTTC 1V10A 4D8PA 4PQXA 2NOYA 2G75B 1UOWA 3MJ9L 1KN2H 3P0YL 3RGHA 4ELME 4XOAA 1H15B 3O41B 3O6MH 1AR2A 1W91A 3ZTNL 4F7KA 1OAXL 3RWFB 3G7TA 2CHZA 3HPJB 3BVTA 4JDVB 1HAUA 1WFIA 1W9XA 2DI9A 4FADA 1QHQA 2DQUH 5MEOB 3AREC 3FYEB 3IWUA 1CICC 3W2DL 5BQ7B 4AC4A 2BP0B 2X4NB 3V6FA 3DDFA 3GSNA 4PJGF 3VD5A 5CCJA 4YDZA 4HLEA 1IQDA 5JXEC 1TLMA 4DZBB 4QRQB 2DKMA 3OQ3B 1F45A 3OKNA 4OJDH 4YUEL 3QWOB 1E4KA 3V6ZB 4ECNA 5A2CA 1AANA 5I1AB 3FO2A 4NCDA 5DHMC 2PTTB 2LLLA 5J1SC 1FUNA 1HI6B 4NGHH 4UT6L 3C75A 3DMMA 2MIZA 3NDZE 3QUYA 2XWJA 2BY1A 3SDCC 3DDGA 5DRXA 1EZLA 5C0BA 2R51A 3ZYOA 2J88L 4YBQC 3O4OB 3HNVL 4KK8C 1CDHA 2VOTA 3PJLA 3V95A 1BVOA 5FOJA 3V0VB 1K5WA 1AP2A 4GEJA 4MCNA 1Z9SB 2BX5A 2JB5L 3QDGB 4LLQB 4QHNA 4P5TB 4YSUA 2ZUVA 3FQWB 3FO0L 3DSNB 4FF9A 1E9OB 1LDSA 3CK0H 1DBAL 3EOYG 3CXHK 1IC5H 2CLVA 1G7HA 5D1ZB 2J6WA 2VM9A 1VRSA 1OAYH 3LNGA 3OTTA 4JFYA 4OF8A 3SKMB 3THML 3KLHC 2N7BA 1FVCB 3TO4A 4FJ6A 1U3HB 1QQDA 1CR9H 4LPVA 2RQEA 4DAGH 4MA3A 2XPGA 3DX7A 2ZCKH 1CK0H 2AEOA 3O8XD 1QUNA 3PWNA 3HB3D 2I69A 1TTFA 1OARH 4NXSA 4G6MH 4L48A 3EHBC 3VX1A 3EYFB 1V7NL 3ABLB 3VDCA 3I74A 2HLEB 1NIDA 1PZSA 5ICZB 4PU2A 3UIZA 5KVFH 3ASWA 4W9HC 4I18C 3D48R 4JHVA 1KCWA 3ATEA 1ORSA 1AYOA 5J3HD 1YJDH 1DQTA 2UXVA 1L9SA 3LDBC 4KOCA 2XG5A 2F5BL 2WZ6A 1MJJB 4QD2E 4WGWB 1K8IB 1LDPL 2B7DT 2FGWH 1H3TA 1LEGA 4NHCH 3OAYH 4JFFD 3TH3T 1BECA 5G4OA 1GIGH 1Q94B 5D5MA 5B8CA 3WGVB 4LF3B 2VDMB 4ZMXA 3MRJB 3Q8FA 2PPFA 2D31B 3UROR 5CLWA 3HI1B 2BS71 1RZJH 4MMZB 3HS8A 4WFHE 1D5ZA 2FJUB 4WFFE 4WFED 1FVDB 3NCEB 2IGLA 3LV3B 1Q9WA 4DQOH 3N41B 1CMOA 1ASPA 2R2EB 2J3SA 5JA9A 4DN4L 1O6SA 2MNUA 3SE4A 2VDOL 3HBPA 3FXIC 3ENEA 1HXMA 1ZHNB 4AMWA 1IX2A 1I8UA 2F2HA 1BPVA 1TQSA 1HHJA 5I5MA 3U4AA 1YECH 5FYJH 4MB1A 1OE2A 4LP4A 3WSQH 2EVGA 1YJDC 2HRPH 1VDGA 3IU4H 1CFTB 5HJ3B 3B43A 4GXVL 5D71L 2W65A 3BAIA 2ZP9A 1N18A 3FOMA 4H8WH 3MKKA 4Z7NB 4KHTH 4N22A 4KX9A 2CSPA 2FX9H 5FHAH 3TPUA 3H7LA 3V0FA 2DLFL 2WNXA 4D9QE 3VMNA 4ILDA 1B0WA 3VQ2C 1HFUA 4P2QB 4OFYA 3EYUH 3C6LA 5ABZA 3POCA 4PJFE 4XVSH 1RZJC 1LVEA 3IB4A 5T1LD 1VFMA 1NCHA 1ZMYA 4LXFA 4ADJA 3L3OA 4R4FH 5CGMA 1OGAD 1RIVH 2YD3A 2GAZA 3BFWA 5DURD 3S4SG 3B2UC 2WTRA 3KLAA 3S97C 4C58B 3UBXB 2DJSA 2L04A 3QIUA 5BJTA 4R2GB 5CO1A 1UH3A 1XBRA 3VFTB 4GIAA 3ROOA 2CDEB 1TYJA 1AHMA 4N2HA 3VXUB 4A2GA 1YNLL 3FN0H 3WUWA 3BO8B 2XTJE 3E3QE 3GGWB 4H0HB 4MJ5B 3WIHL 1IBYA 1C1EH 4TUKL 2ADIB 5CJBA 5I1HL 2Q86B 4AEIH 1JZIA 1NCAL 1IGYB 3VD2A 1YEGL 3QJRB 2WQWA 4H8WC 1YPZA 4L8BB 1BQLH 1T0OA 3EXJA 1K4DB 3WHXA 5I8CA 4KVCH 1KBGH 2O1AA 3FHQA 1DDHA 1JGUL 4TN9A 3H54A 1FH5L 1OPGL 4TOYL 3U4KA 4BK5A 1KPRB 1D5BA 5DHVA 4WI0B 3RTQA 4AVHA 5ADPL 4OLWL 3GI9L 4B5EA 3L08A 1H5BA 1HQRA 2A4ZA 5F9JB 1OE3A 2PWGA 3B6SB 3QUXA 4WV1B 3ZRSA 4AVKA 1FF5A 5C0DB 1BDYA 4I3GA 4LVHB 4XCNA 2ZXCA 1A2YB 4MAYC 3K7UA 3O6FB 3RZCC 5JOEA 1QLRA 3DJSA 2XA8L 5E0QA 4ZZFA 5B21A 2Z92A 3RX9A 4N0UE 2P4AB 5JIDA 4OZIF 5KSBB 1SBSL 5E2UL 3S96A 5D7HA 3HBZA 3VXPA 2FNWA 1YEEL 5JO5B 1N5YH 2BIIA 4KKRA 5CN1A 3PHOB 3QW9A 1UJTA 5F3BA 3NGBB 5KVDE 1SLXA 2GG1A 3P2TA 4UILH 5D8JH 5TGBA 3FB6A 4CVWA 2D7TL 4UTAA 4TYUA 2F19H 2XIBA 1N6VA 3TBTB 2EXSA 3MRKA 2E9BA 5T5FL 4JZJB 1X5AA 3MUGB 2GCYA 3IDGA 3IDJB 4XE5B 4XMPL 1IGIH 2V8MA 5DJZB 1BQKA 2YLKA 3LEXB 3MYZA 4YSCA 5GRYA 5GSVB 4TLSA 3O3AA 3HE6C 1ONQB 4GIPD 5L2KA 5IBTH 4OSUL 1IFRA 3UG4A 3ZKND 1E27B 1CN4A 1DQML 4Q2ZB 3GZKA 5EHFA 2OK0L 1KIQB 3OZLA 4NOFA 3EJPA 1PKQB 1UM4L 4WI3A 4GJTB 3D12B 2R2HA 3UTTA 1I9EA 4JG0L 2YD2A 3ARWA 3HNSH 1CJYA 4PVMA 32C2A 3KLKA 2R27A 4JKWA 2WBKA 4Y2DB 2FB4H 4YE4H 1DYZA 3IJHB 2DKSA 1PU0A 1ZCRA 1TQCC 3BIKB 1AE6H 1BJ1J 1WZMA 3L9RB 2DB8A 3NMEA 1JZHA 1INQA 3RFZA 2Q76B 1U95B 3F7VB 1A9BA 3NJVA 4QJ4B 4G6FB 5H35A 2FYVA 1BXAA 1S7XB 5LCVA 2A9AA 2VGLM 2I26N 1TTUA 4BFGA 1DJGA 2ZYIA 2B2XL 2NYYC 1NDMB 2G75A 1H15A 3O41A 2N3JA 4YPGB 5D1ZI 4PJEF 2CR0A 3TCTA 3GI8L 3WV0A 5EEWA 2OYKA 4JPVL 3RWFA 4PJIA 3HPJA 3K5RA 4JDVA 4X6DE 5B1BB 2H32H 3WNIA 4F8TA 1HYSC 4G7YH 5SV4A 1HHHB 3QJQB 5MEOA 4L9LC 1OCWL 2DDQH 4A7SA 5BQ7A 1MHPL 1XWVA 2BP0A 2NT1A 2X4NA 3TT3L 3BT2H 4L1HA 4ZG1A 2CR3A 3TJHC 4DZBA 4ZMOA 4QRQA 3V6ZA 3BQUC 3KS0H 3QWOA 4A2DA 5IB1B 1A6VH 4CGTA 4TSAH 3PJNA 2O5XH 2PTTA 1F3DJ 3Q13A 4X0KB 1HI6A 3US1A 3IGLA 1VESA 2P8LB 3E80A 3OZ9H 3TEZA 1NEUA 1AY1L 5CXPA 1U6AL 4LBEB 5I1GL 3U4BL 4YFLI 5I9QB 3JVFC 5T3XE 1FRGH 5DO2C 3V0VA 4ZO9A 1ACYH 1R3LB 4Q4EA 3FH5A 1J0YA 2FK9A 3C60D 4D2NA 3T77A 5IQOA 3QDGA 2O61B 5FA4B 5AWNL 3LPGA 3WTSA 4P5TA 2YC1B 3KG5A 3UACA 3FQWA 2ERJB 4G8GB 4ORGB 4HK0B 3DSNA 4MASA 5A40E 3ARBC 3NIDE 3KBPA 1E9OA 3ZHDA 4ZQTA 2UWEF 2F68X 3QORD 5K33A 4ONOA 5D1ZA 1ZTXE 5T5NG 3SKMA 3VSQA 1TR7A 1FVCA 4WNSA 4QT5B 3J2PA 1U3HA 2X3CA 7TAAA 2BVUA 3BPLC 1JNNH 5EOTB 5EDSA 1GY1A 3MBXL 5CP3A 3QJUB 4HJ1A 4KJQD 3U9UB 4FI6A 5ACMA 4TNWK 5JZ7C 3SIKA 1HIML 3B7RL 5HHOD 3QEQE 3WJLA 5DQJA 4L5FL 3OF6A 1MCNA 4P46D 2MHAB 2UVEA 1CGXA 3EYFA 3QJZA 5E2VH 4IQHA 5ICZA 1MI5B 3PWUB 1ZXQA 4RGNB 1LE9B 4WFFD 2V2WB 4ODSL 2DEYX 3KCPB 4Z76B 1A0QH 5TQ0H 2R0WL 4WU5B 1QKZL 2PW1B 5DVPA 3FHEA 2Y6TE 4BZ2A 4GAJL 2VW7A 2DEXX 3QT2A 4BFJA 1MJJA 3BFQG 3OKMB 3CFMA 3OKYA 2VXQH 1K8IA 3RY6C 4YSQA 1W0WB 2K9UA 5BW7A 1VA9A 1FO0L 4M48H 4U1GC 3MRBB 1P4UA 3UBXI 4DFHA 1GPOL 1UWYA 1Q94A 3SN6N 3U1PA 4LF3A 1FL6B 3MRJA 1AFVL 2V2XB 2D31A 3QFJD 2WXOA 2CO6B 3HI1A 4OIIL 4MMZA 1ZA3A 3AUWB 4TUOB 1Q9KB 1FVDA 5ELIA 3WFDL 3LV3A 2QKIB 3KJ6H 1P53A 2YMXH 4WU7B 2GJZA 4EUPH 4ZAKD 1EUUA 2PCXA 4KAQL 4X9BA 3WL9B 1ECYA 1MJUL 2VR8A 3LN5B 4FEMA 3VXMB 1N0XH 1MHEB 4GUPB 5EO9B 5L8LB 1ZHNA 4HMDA 3RIFF 5AB0A 1Q1JH 3OB8A 4KNTA 5EU4B 1CB4A 2NY5H 3RGVB 1P9MC 4M7LL 2D0HA 1YYCA 2AEQL 4ZS7H 4AZ8B 1CFTA 4HJSA 5HJ3A 3VACA 5ID0B 2WKGA 1OGTB 1COBA 2EYRB 2Y07L 4LGRB 4U4BA 2XTJD 4WUUE 1GZQB 3FRPG 1AC6A 3F8UB 4LRNH 2QADD 3BPOC 4KUZL 4OB5H 5ANME 4P2QA 2NY3B 5HHNB 4KV5E 5I1EH 2CGRL 2E9GA 2RHEA 1HHKB 2LHAA 4YHPB 4GUQA 1NAMA 2DH2A 2CKBB 2X3AA 2WYZA 2EUZA 5IVXF 5MEPB 3UBXA 2BZDA 2J4WL 1CFVH 1R3IL 2NNRA 4UV7L 5L2JB 2E56A 2H6PB 3VFTA 2CDEA 3NJLA 1XIWD 2OSWA 3VXUA 1IRAY 2WBWB 2X2IA 3BO8A 3GGWA 4TTDD 1LK2B 4MJ5A 2NY5C 3O4LB 1I7TB 2ADIA 4J3TA 4XCCL 1PD6A 5HHXL 2Q86A 2FATH 4IMKC 3MJWA 3ULVH 1WG3A 3S88L 4N90E 4L8BA 2ESVD 4PJDF 3PWLA 3PNWB 1K4DA 4DGYL 4UTBA 1UWEH 1CDIA 1NJ9B 1ADQH 4F58L 2D3LA 4JB9L 2F53B 2NNFA 4CN1A 4PWKA 3CPLB 1KPRA 1TJIL 1W80A 3PP4H 3QPKA 2HFGL 4WI0A 3O2DA 2F8VA 4RA0C 4B5ZA 2EIBA 3NCCB 1X5GA 4KMTH 5F9JA 3ZIYA 1NMCC 3B6SA 4WV1A 2HRGA 2E8ZA 2DV6A 5C0DA 2PXYC 2BC4B 1A2YA 2PYEB 5BMFL 3O6FA 4XMLH 1A3LL 5CBAB 1GGUA 4L37B 2FNBA 3QS2A 3P0VH 2B0SH 4O51B 4AIXA 2WQRA 4GSQA 4DOHB 5DZVA 5I8OH 1QP1A 1EHNA 4HT1L 1FGNH 4KK9C 4AL8L 2GKIA 1UKQA 3D4GA 3CWGA 5KSBA 2IV8A 2DIBA 3CXDL 5D7LB 1CVSC 1P7KB 3MR9B 1URZA 3ULVC 4O4YL 1OV8A 1BQUA 1KCVH 5IGXL 5JO5A 3GKWL 4BA0A 2EE6A 4LASL 4U3XA 1BVKB 2AJXL 3UAFA 4OBRA 3ZDZB 3BESR 4JY4B 3RWGB 1T7WA 4QRSA 3F01A 5LB1A 4C47A 1BFVL 5IW1B 4OGXH 4Z77B 1EEQA 3PWVB 3TBTA 2NY4D 4HG4K 4JZJA 2OW6A 5C0CB 3EH5B 3ZO9A 4AVJA 2G30A 3MUGA 4PJXB 3IDJA 3R06B 5DD3L 2AW2A 5IJKA 4ZNEA 5DJZA 1PNDA 3LEXA 3TBBA 15C8H 2AXFB 4QOKD 4XPGL 5GSVA 2I7OA 3T0EE 5GGTH 2WLLB 4CVXB 3SDYH 3OAZK 1NANI 2GJ6E 1XGYH 4LU5H 2C3VB 1E27A 1I1AC 2X6MA 4GAGL 3GDCA 5I1LB 3CZUB 1VFOA 1TO5A 4Q2ZA 1XX9C 5GS2H 3WIFB 1KIQA 2RA1A 1EGJA 2WBJB 1PKQA 3ZSSA 4MKMA 3CD4A 3G5VB 4QGYA 4PS8A 3SPHA 1I53A 3BAEL 4NQVB 2WVUA 3W11D 2XPYA 3IS0X 3P11L 1UT9A 2BCKB 5EN2B 4ZTOH 1DL7L 4ZW5A 3IJHA 1Z32X 4G9DB 3EYQD 3BIKA 4YC2C 2N0MA 3NN8B 3L9RA 1YYMH 3QR0A 4R84A 2Q6WB 3UTQB 4U0RB 5CMAA 2Q76A 1U95A 4YK4C 2JJTA 3F7VA 3N04A 3U7YH 4EN3B 1D2PA 1F4YL 4KK5C 4PS4H 4PJBF 1S7XA 1CIUA 3HUJE 4TQHA 4D3CH 2X4PB 4F9PA 5J56B 4ODVL 2WYHA 1NDMA 4IOSA 1G7PB 3SGJC 4YPGA 1A7OL 1IUZA 3N44B 1ASQA 3ILPB 4OCXL 4MJ2A 1CD1B 5BVPL 2CHXA 3WY2A 3JV5A 1EEUA 4LCVA 3AG1B 1UACH 3L5XH 3DETC 2DBLH 4HJJH 1WV7T 2R69L 2HA1A 3BX7C 4XPBL 3I9IA 4QYAA 4NM4H 3KEHA 1PSKH 4EQ3A 5IESL 4K4KA 3TA4D 4ANVA 3P9MB 4K8RL 3H8NA 1T20B 3AS3A 1AOHA 3T0AA 1JZ3A 5EULV 3FFDA 3N50A 3H2PA 4Z7UF 2LU7A 2VH5L 2IVFC 4LT7A 1QSEB 2XTSA 4V2BA 1JPSL 3T3MB 4JKLA 1AR1C 2P8LA 3VQLA 3KPSE 3SDAA 3AABA 2NY1C 3P2DA 1J05A 4LBEA 3JBG7 4TQEH 5JW4R 1GW6A 3FU3A 2CPCA 1F5WA 2HTLD 4FQ2L 4RX4D 1BIHA 5AB1A 2DQFA 1R3LA 3NIDB 2XN9E 4YHNB 3QEHB 2MWCA 1MRFL 1A22B 3QEQD 4CILA 5AVTB 2HLFD 2PTUA 2WHVA 2IADB 5FA4A 2O61A 2YC1A 3FT3B 2DIEA 2R29L 4ORGA 3S3DB 2CUAA 3LX9A 1SLVA 4G8GA 4HK0A 2VDRH 5K5YA 1A6ZB 4KTDL 2WNKA 2B1HL 4XP4L 4ZX5A 1HKLH 5ILTL 1OF2B 3IJYB 4RGMC 4R4NC 4MJJA 1OSPL 3WG7B 1UTDA 2Z6FA 4LVNC 4R97B 5T33L 3CG8A 4BXVA 3QG7H 4QT5A 2C34A 2H45A 4QDGA 5EOTA 3VWKC 3LXCA 5IHLB 1FL3B 2OL3L 5HI4D 4FFZL 4XXCA 1MCEA 5BO0D 2DMKA 5FV2A 3O0LA 5T3ZH 1EXHA 4JHAH 3UBHA 4BUHA 4ZMQA 4OCSL 2MHAA 4Q4IA 1KGCE 1MI5A 3PWUA 1T03H 2V2WA 3ZT5A 2X42A 4HUCA 4J7RA 1RPQA 4Z76A 5GGSB 3ZZQA 4C4UA 4WU5A 3QNZB 3TXAA 2Y1ZA 2PW1A 4NBXB 5E95B 4M9PA 2FBJH 5A6MA 2CLZB 4U7SA 3P30L 3VDBA 4I1RA 4G8EB 1RUML 4MLSA 3OKMA 5FGBC 2PWFA 4DN3L 2NXZB 2FT7A 3UPAA 4BWUA 4ZD3H 1RULH 1OLLA 1W0WA 5JHLL 4XRCA 4R5TA 2XQYA 4NYLB 3CVHB 3MRBA 4MD5B 2HH0H 2X1WL 3S9DB 4B3VA 3WE1A 4UOQA 2AK1H 1FL6A 1YEKL 2KZ1B 4GRWB 1F4WH 3CU7A 2CO6A 1U2YA 4TUOA 1Q9KA 3IU3B 4KGJA 3HAEB 5KW9H 2QKIA 3FH8A 5BNXD 1OGPA 2X0WA 3MBWB 4NNYB 1EZVX 2Q7NA 4WU7A 1MREH 4OCWH 3WL9A 1EMTH 3LN5A 2DM4A 3VXMA 1FPTH 1MCBA 1MHEA 4GUPA 5EO9A 5EUOE 3II1A 4J12A 1XF2B 2VJXA 4XNZB 5EO0B 4JUTA 3N06B 2ZXWB 4A2HA 1OXYA 4E9LA 5EU4A 1XTLA 4QEGA 4WUUB 5D93B 2J1KA 4GI6A 3P4NB 3R18A 3RGVA 2R8SH 4LSTL 2A0LC 2YD4A 4CMHC 4AZ8A 3RGBA 3BXNB 5ID0A 3H85A 4LARL 5AAWA 3QWRD 1OGTA 2M83A 2EYRA 2CO1A 3V4PB 1GZQA 5LBGA 2DWDB 4UV4L 3DK2A 3DHMA 1PAMA 5F9OH 5KVGE 1UZ8B 3FCGA 2Z8SA 3DA0A 2ENJA 2LU5A 3A4DA 3K4AA 5KSAC 3WHE0 5H2BB 4N90D 5KOVC 3VFGL 1XTMA 1OOAA 1G7JB 3U82B 4ADIA 2D7QA 1XBDA 3D18B 4UINL 5HHNA 1HHKA 1PX8A 4YHPA 4CW1B 3MBED 3LZQA 4D0CB 3IE9A 5BV7H 2CKBA 2P1YA 2ITEA 5I66A 5J5EA 3OHMB 4DP8X 5D4HA 2GPZA 3BUIA 4NN5C 2DMHA 5MEPA 3DO7B 4MDRA 2J20A 3FU5A 2FLRT 3SPCA 3FB8B 5I6XC 5L2JA 2H6PA 4WK4B 3ZE0B 1JGVH 2JMRA 3CX2A 1GTNA 1Z3RA 2DBJA 5HDBE 3ZBMA 1LK2A 2VDLH 3HC2A 4PG9B 3O4LA 1I7TA 4RFNC 2CXGA 4PJ9D 3PL6B 4HWBL 4M03A 1C7SA 1NMBH 2CCWA 4QNPE 3WUZA 4CSTA 1KZQA 2CDGB 2CJ3A 2C4FU 1CL7I 2IV9A 4ICWA 4OM1H 2WVVA 2UZIL 1YY9D 3PNWA 4FEIA 3OJDB 3A6OA 4KKCD 2F53A 3MRDB 3CPLA 3T3PE 1JGDB 1PDKB 1KGWA 1FNHA 1S9KC 35C8L 2QFPA 3QI9D 1S78C 2EDEA 4WCYL 3TYGL 3V5KB 4ZMPA 3WNOA 1R47A 4YXKH 5BV7C 1J8HB 1WFJA 2OR9H 2WXIA 5GZND 4Y5XB 2V37A 1FORL 5F7EH 1I8LA 4MHHG 3UJJH 4L37A 4JRLA 4O51A 4F91B 2P5WB 2AV1B 3RUGF 4DW2H 5CJXA 3O9WD 4H7VA 2MOQA 1ASOA 3DYMA 1G4MA 1F6LL 1J1XH 1L0PA 2AANA 2EDOA 3GDBA 3T0ED 5D7LA 2PCPB 5HTSA 3TLRA 3MR9A 2GJ6D 4A7VA 3VRIB 2I27N 4LQFL 3QNFA 1UASA 2QQNH 1ECZA 1RVFH 3DOHA 4G7VH 4G5ZH 5CLYA 4JY4A 3RWGA 5C3LD 3W39B 3FUHA 5IW1A 2UVFA 2WCPA 3BN9D 4NN7B 3PWVA 4ZSOB 4Z77A 5KBLA 5GGRY 3HIZA 3WGUB 5C0CA 3IFPB 4M8VA 4PJXA 3JT0A 3F5WB 1T1YB 2LV4A 3HC4H 3R06A 4LSDA 4NEHB 3X1EA 3CHQA 2IBBA 2AXFA 1Z5LB 2GI0A 4JJ5B 4Q9CA 1BF8A 2GITB 2WLLA 4N2KA 2D4FA 1LLAA 2FCBA 4WI9A 4CVXA 1P7QD 3MTRA 3IDUA 1GGBL 5B39G 2C3VA 3CN3A 1QOKA 4C57C 3QQXA 3A6CL 2MCMA 5I1LA 3SGKC 3REVB 3ZW3A 3D9AH 1N3NB 3KZ8A 3WIFA 2KPWA 1R4XA 2VLJB 2HMIC 2WBJA 3G5VA 3E8UH 3PHAA 1TQBB 2BH0A 3UJTL 4LHUD 1TJGH 1JYNA 3AT0A 4NQVA 5ADOL 4ENEC 3WJJA 4URKA 4BELD 3N85L 1FFTB 4M7ZC 4OCNC 5C8JB 2BCKA 1PFOA 5EN2A 4K94H 5F1IB 4G9DA 3CZNA 2Q10A 1OAZL 4MA1B 1OSYA 3D25B 3CFCH 5CZXC 3NN8A 4XX1G 3T0BA 3UTQA 3ZR6A 2Q6WA 5E2TH 3SPVB 3NSCA 3NRFA 4RIRB 2XN0A 5DT1L 4EN3A 4HUUB 2F15A 4JANB 4L4TE 1R33A 5CN3A 4OM0H 1SDDB 2X4PA 4B9YA 1H0DB 3MLUL 2KDYA 4HU8A 3DJ9A 5AZEH 4UDTB 1RZKH 3V52H 1SXBA 4C56E 4WTQA 3KPSD 2XCMC 3ILPA 3VXSE 1CD1A 1BQHG 4EAEA 3MOQA 5BOPA 4AQAA 3S4SB 1L6ZA 3EDFA 4LCIH 2F08A 4MFHA 3TO2B 1RZ8B 1O6TA 4S0SD 4ZUTB 3K72B 2XN9D 3K6FA 3OX8B 3V7MA 4PJAE 3PAVA 5CEXB 4RRPA 1ICTA 3P9MA 3KDMB 4JY5H 5HGDB 2J1YA 1H8SA 4KKBD 4AEFA 1LO4H 4CAGA 1RERA 2AXHA 4K94C 4X42A 1QSEA 4H44C 1OIOA 1OTUD 2VDOB 4LDEB 4QY8B 5EB9A 2COQA 5H8DA 5I1CH 3OB0K 2NX5E 4KKLC 1IAOB 4F7TB 4ERSL 4KI5C 3ARFC 4OI8A 4XMUA 2DS4A 2AABL 3OXRB 5E4OA 4XTRD 1F8TL 1RZKC 7CGTA 3FCUB 4LPWA 3S3PA 1W6WA 2CAKA 2VM3A 4YHNA 1CBVL 3QEHA 5KVFE 1U8NB 5DUML 4F2MB 2IADA 2GY5A 5BUGA 2HP4A 3FT3A 3MC0A 2EE2A 1KGCD 5DJ2B 4B27A 1A6ZA 3FT0A 4ZX3A 2BINA 4W9ZA 3T0VA 1WVZA 4HD9A 1OF2A 2F7QA 3EDEA 3I9PA 4UMGA 2HTKC 3L13A 1ZSHA 3PUUA 2BJMH 1KGXA 3MV8D 1V27A 1Z5YD 1KV3A 5LN8A 1X5ZA 1NUGA 4UU9B 4HGKC 4QTIH 1E43A 1FIGL 4L8DB 1FL3A 1LWRA 4B60A 4O58L 4UYQA 3SE3A 1AKJD 1UG9A 4P9HH 1WF5A 4KI5F 1DFBL 1NPNA 2HT4C 5C08B 2VR7A 4G72B 2H3NA 5KS9F 2DZEA 5TE4L 3NCYS 3DOSB 3A23A 3KCWA 1HINH 4YSSA 3GC3A 3U83A 3K4ZA 1DQDL 3H3BC 4YHLH 5GGSA 3QNZA 3DECA 3BLPX 1IGJB 4UM9D 5D7SL 2YAQA 2AK4B 4JCLA 3REWB 2P52A 2PN5A 4BFRA 2CLZA 3NACL 4P48A 4G8EA 4Z9KB 4BFIA 1CU4H 4P5RA 4AUUA 3GNMH 3LJ3A 4IK7A 1PX4A 2HG0A 2A74B 2EDDA 1A02N 1N12A 1GAFH 4EQ2A 4Z7OB 4BGDA 4IU3B 3CVHA 4MD5A 3TWCL 1FFRA 2HKHH 2QBWA 3IFOB 4Q14A 2VLRB 5I1JL 1PG7W 4Z7QF 4FN0A 1WHPA 2DY2A 4OTXL 5EN3A 3IU3A 3A6BL 4P9HC 3HAEA 4KDTA 4OZHE 5CIPB 2WQVA 3FQXB 3MBWA 2IBZY 4N2GA 4NNYA 1SXSA 3B9KD 4MYPA 5HP5A 4Q6IB 5I18H 2YSTA 4X7TB 4LK4A 4ODTH 5F9WB 4TSAL 1FLRL 3NCXA 2DWYA 3VD3A 5IQMA 1XF2A 5EO0A 5IT2L 4WUUA 2PYFB 2R23B 3P4NA 1N0LB 1U93B 3TA3C 1YQVL 4QYOB 4JDEA 3AM8A 4Z95L 1XZ0B 4ZOBA 3D52A 3SYCA 4O02H 1IAIH 3BXNA 5ANMA 3B2DC 4Y16C 4OF5A 3UAJC 1F18A 4DK3A 1GHFH 4OZGE 3V4PA 5DJ6A 3MLSL 4NP4H 4XR8C 2DWDA 4UIMB 3FCTB 2VC2B 5HHPB 1UZ8A 4KROC 2XKUA 2ZZUT 2BHUA 5H2BA 4CSPA 3QQ4B 1G7JA 4GAYB 4ZFOL 1RP8A 3RPBA 5TFSL 2OI9C 3HZYB 5GRWA 4D0CA 4UQ3B 1YEIL 2WNGA 3P3YA 3T6VA 3ARDC 5HDBB 1D2OA 4MCZB 4Z7WB 4W9JC 1GJIA 3L9BA 3RKPA 2KHAA 3D07A 3FB8A 5T1KD 1QI4A 4U1SB 4BUGA 4OCRH 5JR1H 1E4XI 4PIRF 1OTTD 1RZQA 3OLGA 4FQIL 4PG9A 2ZE0A 1JZ5A 3PL6A 3T3PB 1FI8C 1Y18B 3CBJB 3MXVL 5HYIA 3CQPA 2EIDA 2CDGA 2VDQH 4APQB 2YAPA 4U6VL 3IFLL 2UZPA 4QRAA 5FGRA 2F0CA 1WTGT 4UT7L 3OJDA 2IPKA 3P77B 2BY3A 3MRDA 3ARED 5B3NA 1FC1A 4I88A 4RAUB 4H1LH 1PDKA 1CIDA 1NTDA 5IQNA 3UO8B 5I71C 3S35L 3OAWA 1W72L 2L7EA 4HXAH 2MQGA 3MV7E 1VLXA 3V5KA 4U1JB 5JXED 2AF2A 3II2A 1ZLSH 1DZBA 2ROXA 1J8HA 4FDWA 4ODXB 1E8XA 1PZUB 4PFEA 2BIOA 3I2CL 2B5IB 3EF4A 3ZJAA 3EUUA 3L3JB 3SDCD 5C6PB 4MNQD 2P5WA 2DLGA 5DVMA 2AV1A 3SKJH 3GTTA 4OUOA 1JRHI 3UCQA 1FJ1B 3K6DA 3QHFL 1BZ9B 1WP6A 3K8KA 2PCPA 2YR3A 3R0NA 4I5BB 5AKVA 4QRPB 1AZNA 3CHXA 4JKPL 3UTSB 3SQOL 1N4XL 4P2OC 2RCSH 3BKJL 5I0ZA 5KBMA 4HIQA 3VRIA 5IFAH 3CHRA 1E4WL 3Q2LA 3MOAH 4U0QB 1LQSR 1UCBH 1XCQB 3KYAA 1S6NA 3FYIB 4Q9RH 4M29A 5D7JB 4ZSOA 3BIAX 1ANUA 1X44A 5FWRA 5LGKA 4MRBA 4QHKI 4QMEA 3IFPA 2DQEL 2IQAB 4FXKB 1CFQB 1T1YA 3F5WA 3WKML 1PNCA 3MFGB 4U2YA 3KLHD 2IGTA 4TL4A 2XKNB 2OMZB 1DJXA 3VXRB 4WSJA 4CU8A 1Z5LA 4JJ5A 4BV1A 2CO4A 4WF7A 5KYXB 2GITA 2EEXA 3T6WA 3JV0A 3HZKB 4F5CE 5JUEH 4PJ7B 3VD0A 2JIXD 4L4TD 4AKQA 4Q9QH 3PFQA 4X6FB 1AQKL 3REVA 4OKDA 3EHBD 1GYAA 4OKVB 1E3ZA 2EDTA 3VVVA 3T08A 2VLJA 4YHKL 3B83A 4M8UA 4YWGH 3CFQA 3L4TA 3FSWA 2Z0BA 3M07A 2OZ4H 5LKNA 4DGVL 5AVSB 5MP6H 2Y24A 4G6AD 5C8JA 1LP9B 3WNJA 3QDME 2H47C 2V3DA 4JFHE 5CJQH 5F1IA 4HS8L 1EO8H 3G5YB 3D25A 4GFTB 1X4XA 4C56B 4ZRGA 3RILA 4YBHA 3FRPB 3SPVA 2I60L 3VXSB 1NIBA 4HF5L 1YEFH 3EFDH 2RMNA 4HUUA 3WFEL 1LO3H 4JANA 1REIA 4NCC1 5EBWA 1SDDA 2B20A 3TFBA 1H0DA 5LJYH 5DJDB 5EU6E 1ILUA 4UDTA 2XZQH 1L9QA 2NX5D 3D87B 3LEYH 1WTLA 3IM1A 1F2QA 2FE0A 3TF7C 3ZGHA 5B1KA 4PRHD 3ZHLA 3S4SA 2GHZA 4FCAA 4IJTA 4RMVA 5ABAA 4A38A 4GT0A 1KTDB 1KUMA 4PJCE 3T4AB 3TO2A 3U9WA 3LS4H 1RZ8A 2DL2A 4ABUA 4ZUTA 3K72A 4EKJA 3OX8A 1UM5H 3NA9L 3GSRB 3QJOA 4HBQA 2G5RA 4PG2C 3L1EA 5CEXA 3KDMA 5HGDA 2QV2A 2AFNA 2YD5A 4H2AA 3BE1L 1X5FA 2HVBA 3NVQA 3JWNH 4NPYA 1T80A 1NCWH 2QSTA 5CGYC 1XGRB 3GEFA 1OLZA 5E2WH 4QY8A 1DANU 3FFCE 1B9ZA 1JUFB 3F05A 1E9PB 3FUJA 3RX5A 3APFA 1IAOA 1KJ3H 4U7MA 4ANKA 4F7TA 2J8UE 4ICXA 4IRJD 3VJ6B 4NQEE 5KANG 3OXRA 4JRXE 1VERA 4L0ZA 5FGCE 3VFNB 1UKTA 5FX3A 1MFAH 5LAXB 4Z3IA 1U8NA 4M93B 4MB4A 2DQCL 4F2MA 3GRBA 5GS0H 3LXAA 1Q72L 1UA7A 2YKLL 2ZUQB 3J7HA 3DHUA 4XMWA 3ZDXB 3B2UD 4GAFB 2ICWB 2HJKB 5DJ2A 1OB1A 1SBBA 3NDYE 4Y1AE 4YNYB 4K9EC 4J23A 4WDIB 4A63A 1IE4A 1UM6L 2D7OA 3PF2A 3CN4A 5FYJD 2YUVA 2IPTL 3JWNC 4UU9A 2CKNA 5AOIA 2EDYA 1A7BA 4L8DA 4N68A 4Y9GA 2NY6B 3CMOH 4B7IA 3MJ6A 2IOIA 4P3CH 3RAJH 1E30A 5IROD 3NZUA 5KZCD 2EC9U 1PYWB 4EDWL 5HYJB 1BBDH 5C08A 3T6ZA 1SQMA 3VE0B 4LCYB 1HN1A 3DOSA 4FS0A 2QZQA 1ADWA 2IEPA 3OJMB 2VM4A 3ZUCA 4AM0B 5GS0C 5K59F 1IGJA 3NABH 1OALA 4KQ4L 2AK4A 3QARA 4JVPA 3REWA 4MAYD 3T2NH 4QAMB 1KEML 1X7QB 1ZS2A 1C8QA 1QBLL 4LL1A 4OY9A 2PR4H 3TNNB 3U30B 3RZCD 1GTFA 4FA8A 2A74A 1KELH 2P44B 5LGYA 4UT9A 3UZEA 1KJ2H 4XH2B 1UHVA 3TIDB 4IU3A 3M1BB 4NM8L 3VGHA 2XZZA 3HZ3A 3IE4A 5DU7A 4PCSA 4OCYH 4JBSA 4JNXA 1OQOA 1BW8A 4HPYH 2OMYB 2VAAB 2G2RB 3IFOA 1K6QH 4LNRB 1Z7JA 2Z8RA 1E5YA 2VLRA 5TF1H 5EUOA 2Y69B 2VDKH 1F4HA 2NY0C 5F6HI 1RZFL 2O6DA 4N5EC 5CIPA 4ZK8A 3SE9H 1GGIL 3FQXA 4Q7DA 4YHZH 5JW3H 5F88B 4K3EH 4Q6IA 1QFOA 4X7TA 2QFRA 1EFXD 2O93L 4AEHH 4BQ8A 3U46B 5D7IF 3O6KH 4DVRH 4HW6A 1OT2A 3DV6B 4Q56A 1DQJB 4FMFA 1NCDH 3I3DA 3HI5L 1M71B 2A3TA 4AGLA 2PYFA 2R23A 4K5OA 1N0LA 1U93A 2CO7B 4K3GA 4U1NB 5CZKA 4KX8A 3ULUF 1XZ0A 3PGCB 2QZ5A 4JFWA 4AMKL 4MJIB 2LGNA 3Q5OA 3BKML 3L7FB 4RWHA 5FCUH 5GRJH 3Q05A 4MJHA 5FM4A 2P48B 5T5FA 3VI4B 2ED6A 1M2VB 5I19H 3ZL4H 4UIMA 2ZJSL 4FHBD 3GUTB 3FCTA 1BD2E 1KTRL 3NEXA 4HLZH 4DEUA 1TITA 5HHPA 3FCBA 5KJ7E 4CSSA 3IMRA 2EUWA 4PBWD 1PY4A 2AJUH 5ALCL 3FU9A 1E65A 5IBUB 3QQ4A 4GAYA 3JT2A 4G8FB 3VMPA 1ZANH 2YAOA 1QSFE 1RSFA 3SBPA 4X5WB 3FKUS 4X5RA 4UM8B 4I0PB 2ZKMX 3HZYA 2JTYA 4UQ3A 2CJTA 1IQWH 4KY1L 1RZ7L 3S3CB 2ZXBA 3F6IA 4KKAC 3L1GA 3FQRB 3MRHB 4RAHA 4MCZA 5F7WC 4Z7WA 1TMQA 4K71B 3FJTA 3KXFB 3M8OL 1HKFA 4CVZB 4UUJB 3BUYB 4GI8A 4PJ5B 1RIHH 1GRWA 5D72L 4YEFA 4OGYH 4U1SA 1G9NL 2R0LH 3GIZH 4J3BA 4S10A 5E99L 5KVGL 4OU3A 1KT2B 2NYYD 1BREA 5K9QI 2YEVB 1PLGL 1I8IB 2X4TB 3MUHL 1Y18A 2JKSA 4PPTA 1Y6KR 1UWFA 1ITBB 1R6VA 2XQYK 2EH8L 3G9AB 4UMSA 4APQA 1S7VB 2BVPB 1KLFB 2QGBA 2M8XA 1DO6A 2APTA 3Q1SH 4IRZH 4U49A 3E6HB 3SDDB 1HYSD 2JXMB 3P77A 1FZMB 2XZCH 3AG3B 1LGVA 2OSXA 4NIKB 4KTEH 4RAUA 4ZS6D 2BS8A 4OGZA 4N2LA 4TS6A 4TQPA 4RCAA 2VE6B 1B3IA 5TE6L 4MMXC 4U1JA 2FX8L 3TJHD 5DD5L 1WZ1H 3BQUD 2OMNA 4XBMA 3VFWB 4AT6B 2CNZA 5F70A 4BFKA 4HKZB 4AV0A 4LSQH 2ICCA 1TCRB 3QB7C 2WN2A 5E1GA 5I82A 4ZW6A 2W9EL 3L3JA 4XB7A 4KDVA 2XU9A 4KRPB 4RQQA 1UUSA 1N6QH 1HE8A 5FYKH 1KXVA 2WSKA 1FJ1A 4PV9B 1U8QB 3BSHA 1BZ9A 1KJMB 5AG9A 1IC0A 2IH3B 3MNVB 5DO2D 2K4AA 2KUTA 4MBRA 4RZKA 1AJ7H 1FDLH 3S34H 4I5BA 3ESUF 4QRPA 3FF8A 3UTSA 2J57A 1MFDH 2A99A 4HUXB 4B7LA 3JYCA 3C5XA 5IHUL 4JHWH 5FO8B 3DO4A 2YRZA 1XCQA 1IAIM 4BBWA 3NJJA 3EYOB 2Z4QB 3ARBD 5D7JA 1DBJH 4FULA 4R7LA 3FMGL 1M7DB 2AQTA 3OKKB 2J55A 3HJ0A 3NZ8B 1J5OL 3DHPA 2VRQA 2IQAA 4FXKA 1CFQA 3QDMD 1EJ6A 4MNGE 4NJAH 5TQ2H 5LGHH 4YDJB 2XKNA 2OMZA 3V5DB 3VXRA 3RI5F 1I3GH 5KYXA 1EDHA 4HEMA 3ROLB 1F58L 1WD8A 3T04D 5CEZE 5JZ7D 3ABZA 3HZKA 2XT1B 3H4FA 2XDHA 2JB5H 4PJ7A 3F3HA 1H8LA 1JVOA 1KV7A 1RJCA 3DRQA 1GOGA 4X6FA 4APXB 3BAKA 2WP3O 2WZAA 4OKVA 1Y0LB 2Y06H 3GSNH 4QJ5B 1FH2A 1C9SA 2ZWKA 4BFNA 1HH9A 3RE0A 2ZG2A 5EIIG 1RUAL 4MRCA 1RUKL 4W93A 5D1QE 1YCSA 1LP9A 1I9IL 2EEDA 2DTSA 3ATBA 1KJVB 1KWGA 4BCZA 1KN2L 3S35X 3G5YA 3O6ML 3PHQB 5CFAA 5E08H 4C56A 3RQ3A 1N59B 3FRPA 1J0KA 1BM3H 3AQXA 5F7KC 3VXSA 5BZDB 5I2IB 3RKDC 5C0RH 2QVFB 2ICWI 4NERA 1D7FA 5E03A 2DQUL 4WQOA 2OW7A 3SKUD 3UZVB 1Q9OB 5DJDA 3SHSA 5IKCB 3FFCD 4UQ2B 4E41D 1UD3A 4LIQH 2V5TA 3GHBH 3NIGE 4WJG3 1I1CA 2DWSA 1JTTA 4HUKB 3CE1A 2OTPA 3NPZB 4KY2A 1BG1A 1JD7A 2ICEB 2R0KH 4JRXD 1THCA 1KTDA 2WLMA 3T4AA 5J0BA 3DX9B 3WFZA 2X3BA 4EI5D 3ILEA 4NGHL 5JW4M 3GSRA 4KXBA 5DCCA 2A6DB 3VI3E 3WTVA 3V0JA 1E4KC 2OLDA 1OL0A 5A2AA 4HFUH 3BQVA 3WOVA 2YWYA 3IJ9A 5BZXA 4QAWA 1JF6A 2AJZB 1NLBH 5CSZB 2ATAA 4NQEB 1XGRA 4Y1AD 1BAWA 4KOBA 4XHQA 5IMOB 1JUFA 2BVOB 1E9PA 2PTVA 3WXWH 2XI9A 2CO2A 2P26A 1XB6A 2X1PA 3VJ6A 3CZGA 4NLAA 1KC5H 1HE7A 1RH8A 2V5MA 3CK0L 3VFNA 3WD5H 1D5MB 5LAXA 5KYNA 3R4RA 1IC5L 2CJUH 5IHBA 1KFGA 2D7NA