4QHNA

I2 (unbound) from ch103 lineage
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
222
structure length
222
Chain Sequence
VQLQESGPGVVKSSETLSLTCTVSGGSMGGTYWSWLRLSPGKGLEWIGYIFHTGHTNYNPSLEGRVSISVDTSEDQFSLRLRSVTAADTAVYFCASLPRGQLVNAYFRNWGRGTLVSVTAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords I2 heavy chain
publication title Affinity maturation in an HIV broadly neutralizing B-cell lineage through reorientation of variable domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2014-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhnA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhnA01
1EVTC 2OXHA 3K1DA 5AUMB 1D5XA 4YE4L 4CAGA 3QPQD 1T89A 1LQSR 4YDLB 3QEHA 4K07A 3C8HA 5GISH 1FNFA 2V9TA 1X6NA 4LP5A 4Z0BH 1EMTL 1G7PA 2CPCA 2R29L 1QLEL 3HS0A 1FNLA 2D0HA 4XWGL 3CFEB 4RBPK 4CMHC 2IALB 4WTWA 2VABB 2W9LA 1JWUA 3EYVA 2VDLL 3ZHDA 4PP1C 1F4HA 2R1YB 3PHQB 3LN4B 2HVKB 5TF1H 1K5NA 5CBAB 1G7JA 3MRQB 4NHCH 1TLKA 1MIMH 3DWTA 1MFBL 5FEBA 1V7MH 5IESH 4KMTL 3WO4C 1JF6A 4LSSL 5CS7A 3TBWA 4GBXC 2MMXA 1KOAA 1JPSL 3AREB 4OT1H 2BOCA 2GTWA 1I75A 1X4ZA 2E6JA 3L5JA 3MLWL 4HIEA 1UWGH 1G6RB 1D5BB 1A7PH 1W72B 1CWVA 2DM7A 4MB5A 4NCC2 5HDLA 2OK0L 2BNRE 2EYRA 3S35L 3WHE0 3RJQB 4Y2DA 4QTIL 1CE1H 3EGSA 3HC0B 3L7EA 3MBEA 5HHME 1FP5A 3A67H 3GB7A 5DFWH 1M7XA 4XRCB 4HKZB 2FYYA 2CDFB 3WIHH 5ISZE 2NCMA 4K71C 3P3YA 2DLTA 2DLGA 3OJ2C 3LEVL 1WF5A 2GTZB 2G60L 5E2UL 2N56A 4MA8H 4NQED 3MBXL 3UROR 5J8OA 5IKCA 3MUY1 1I1YA 4F7EA 1A7RH 2AJSL 1LK3H 1KNOB 1HH9A 2O61A 1JFQH 2CIIA 1VFBA 1G7QA 1IGTA 3RGHA 3LVEA 4JFXA 3HZMA 5ERWA 4JEGB 4DVRL 2ZOLA 3OKDB 1T5WB 5KAQF 1JPFB 1H15B 1N5AA 1UZ8B 5FO7A 4FMKA 4P2OB 4PP2B 3PWLA 4TSCH 4NQVA 1JP5A 5JORA 1FYTB 1NGWA 5EU7E 5AYUH 2NY0D 4QRPB 3IFOA 5C6TH 4XAKD 3SO3C 2HJLB 4HS6A 1SJEB 4JO4H 4PYHA 5DJDA 3O2VL 4NZTL 2OJZH 1CICB 4JY4A 2APVA 5C0ND 4YXKH 4P23C 1MWAA 2F9BT 1VKXB 1X5GA 3OAUL 1R5IA 3TN0B 4PBVC 2MKLC 4JKPL 3MLZH 4RNRB 1S7XA 5KS9A 3RPIA 1OHQA 4F2MB 1HILA 1KN4L 3EO9L 5KSBF 5GJTL 5JXED 1C08B 2WM0A 3IAGC 4Y4FC 2C26A 5ICXA 1BFOA 1CFQA 1ADQA 4UDTB 5FM4A 5CD5C 4LRIC 2YA2A 1EZVY 4P9MH 3QXDB 4RMUA 4N0CD 4ELMF 1EFXA 3MUZ1 1F8TL 1EGJA 1GOHA 3RGVA 5ALBH 5EOCH 4DK6A 2AXGB 2J8UA 4S1QH 4JFQB 1XZ0A 3I6GA 4HS8L 1DVFD 3B8YA 2XN9B 3PABA 1A6PA 2WLZA 4OLEA 2ZUSA 5E99L 1I7RB 1U3HA 3ILPA 1EA9C 5KVDL 5I1KL 4LQFH 4EUPB 4XBPB 1SJXA 1TZHA 4EDXA 5J13C 2A38A 1QRKA 3EO1A 4WFED 5DJCB 4YAQB 4ZYKB 2Z4QB 3PV6B 4P5MA 3QG6A 2KKQA 1XGTB 1I7UB 4CNIB 1DQDH 4KQ3L 3QNZB 2WIMA 5F89A 5GHWH 2O5XH 3QRGL 3MO1B 4S1DC 3MV8A 1IBGH 2WLYA 3C5JA 1T04B 4XCCL 1N3NB 3LV3B 1JYNA 1ZANH 4R3SA 3MV7E 4JJ5B 3NBNA 3B3IA 3CPLA 1ORSA 5I1EL 2EDFA 4DN4H 3U0TB 5HVHC 4Y4KA 1JUFB 3UTSA 1GGYA 2H8PB 4M43L 5EC1A 4L4VD 3HNTL 5EG6C 4U4BA 1A6AB 1QYGL 1GAFL 3QDMD 3MV8E 3T4AA 1UH2A 3QO0A 1QZ1A 4UBDD 1MQKH 1U2CA 4KTDL 4R96A 4HXAL 3GHBL 1IGFL 4MQTB 4J8RA 3RVTC 4MDIB 4JFFA 4N9OB 2IAMD 4QHLA 1WK0A 1VA9A 4QTHA 2AJVH 1QRNA 5J89A 5JW3H 1YN6A 4LF3B 5FYJD 3UTSE 1RUKL 2IMMA 4ZDHA 4UNTA 1NAMA 5C2BH 3ZKNC 3PGCA 1AO7E 1TNMA 4R0LB 5F9OL 5M7QA 4PJEA 2R0WL 3T1FB 1F2XK 1QQDB 4OCNC 2YHGA 4CW1A 3EYQC 1QO3A 3P11H 4JFEB 4YHNB 2OR8A 3QQ4B 4LMQI 2VZUA 4HUNB 3DMMB 2BVUA 1DLHB 4DWHA 1R3KA 5GGTL 4JFFE 3VJ6A 3MCLL 4ESKA 5A1AA 5FCUL 3OKKB 3ORJA 4PJ8B 3FMGL 2C5DC 4YHMH 1EEYB 4YHKH 5MENB 1BJMA 5KVFH 2P24B 5HI3C 5JNYA 2GJ6B 2W92A 3ARDA 3H42H 4OV5B 1ACYL 1CK0H 4UQ2A 4P4KB 1KULA 4FFYH 4YPGB 1R3HA 3KHOA 5DUPL 3HMWH 1PEZA 4FQQA 2Z91B 2ED8A 5BRZD 1CLYL 3ZE0E 1YZZA 5JIHA 4AEHL 1T21A 3TJEH 2GHWB 2I9TA 1ES0B 5I1HH 2Y36L 3VWKD 5HDQL 4JKMA 3ARFD 4QLRA 1QLRB 4RMVA 3SCMC 4WTZG 2X4SB 4AEIH 1F11A 3EYFB 1FAIL 3WJLA 5ADPH 3N9GH 4HLJA 3PP4H 3BP7B 4GH7B 3RVUD 1HINH 4ODSH 2XWBA 3VRJB 4X9FA 3GSNB 4LVOC 4MVBD 3MSPA 5JDJA 4YX2H 2Q7YB 3MXVL 1EBAA 4KPHH 1DUZA 1OTTC 4MXVE 1K6QH 2HMIC 4PBWD 3NOIA 4G6ML 4JY6B 1OAZH 3OPZL 4M1GH 1ZHNA 2CRYA 1CIUA 2WWMD 5TFSH 4NYLA 2EDKA 2E7HA 4PGEB 4AENA 4LBEA 4P99A 2A6KA 4UILL 5K9JH 1JZ5A 2BP3A 1KCUH 4F3FB 2D0FA 4KROB 3N50A 5HPMA 1ZVYA 3EOTH 2BY1A 5T33L 4KTEL 4X8JB 3O4LA 5CZVL 4EXPX 3OWEA 3DIFB 1B4JL 4J2XA 3NA4A 4V1DD 3V4VH 1T1ZA 1WLHA 2BCKB 4RMRA 3RNQA 3DHMA 3GSQA 4Y1AE 3IDUA 4JANA 3AS1A 4BZ2L 5F9DC 2Z31D 2GQHA 5T3XL 2DBLL 3O9WB 5EWIH 3MC0A 1ZT1B 4X7TB 1UENA 5ILTH 4NSKB 1X6LA 3FOMA 4KQ4H 3IXTA 1YC7A 3SKJL 4N68A 5CP3H 1NMCB 3FRUB 2DJ4A 4K3GA 1X7QA 2XZAL 3T0XA 1DCLA 3M1BA 1SY6H 1NLDL 1QFWM 3SHSA 2AEQL 3VXSB 4P2QA 3BISA 2I07A 4Y5VA 3QPQC 3CH1B 2YD4A 4Z95L 1CG9A 3HR5B 43CAB 2H32B 4Z7WE 1QA9B 1ZHKA 4M7LH 4PJBA 2CUIA 4FOMA 4PRNB 3MRBA 5DA4A 1PGRB 3WS3A 4ODVL 3BDBA 4K3JL 3SJVD 2JK5A 3WUWG 3MCG1 2AABL 2Z35A 3DOSA 3EFFB 1ZOXA 4R4NC 4N8VA 4RAHA 1CLZL 2HT3C 4M5ZL 5E2WH 3AS2A 4C57C 1WZMA 2WBJB 4P2QE 2I9LA 3MGOB 1I8LA 1P1ZB 1FNHA 1T0NB 2CKBB 4LHUD 1BQHA 1MWAH 1V3LA 4K7PY 2ILLA 5ACZA 3QRFM 1T7YA 5C9KA 3G5VB 3L3GB 5TGBB 4G43A 4Z7VA 1YNTA 5TPWH 3SGDH 4GOSA 4B5EA 5CILH 3PQYB 1V7NL 5GQBA 3LKSB 4NQDD 5D7KE 4U6HA 1DANT 5C09D 5LXGL 7CGTA 4LVHB 5I1IL 2FO4A 3QIWB 1YEEL 1KTDB 3M45A 5I2IB 1KPVA 3U82B 4YEFA 3CVHB 3MLZL 3C2SA 1VPOL 5E5RB 5TDOA 3UPAA 5H35A 2F58H 1MFDL 4PB0L 3FFDA 1EEZB 1CFSB 2YPLA 1KFAH 4IHOA 1YYMH 3SE9L 5KVGL 5J1TC 3PWJA 1A7NH 2EDLA 3WLBA 5C0AA 1RJYA 4KI5D 4AMKL 4Q0XH 1NCCH 3NN8A 1WWCA 2OBGA 5EA0H 3F7YA 5ETUA 4HWEL 1EEUA 1MCFA 1CDBA 5AYQA 4H26A 2QSQA 3GKWL 3ZKXB 4BSVB 1QFOA 4ZXBA 2OJEB 1Z3GH 3CDGA 3JVGA 4KDWA 3U0PA 3NTCH 2F5AL 4WU7B 5E94B 1RK1B 3CFDB 4WUUE 2ORBL 1NBYA 3CLFH 5C0AE 4B7LA 4DGIH 4JO1H 4JZNA 3TZVD 3BMWA 4PJGA 3MYJB 1FGNH 3LQMA 4DKEH 2B1HH 4HK3N 3RA7L 4DZBA 2VDKH 2YMXH 4FNLH 3H2WA 3ZKSD 2VDNL 3PNWA 2R23B 3OGCB 1B0WA 3QDJE 2PYFA 3UJIL 5J3HD 1F3JA 4LSRH 4KZDH 2J1KA 1P6FA 5EC2A 2NY0C 3LQZA 4DGVL 4X6CF 3QQNA 5BW7C 3R4DA 5CCKL 4PB9H 3CSYA 1TCRB 1VGKA 2QSCH 4W81A 32C2B 2X4RB 4L4TD 1JZ2A 1FSKC 5JUEL 1ZLUH 2HYMA 3U4BL 3FAWA 1ZANL 1AGCB 4KHXH 3LEYL 4Z0XB 1AFVL 4L9LC 4GAFB 4ZFFB 4M6AA 1NL0L 3ARBB 1QFWI 1NUDA 5DEFA 4TSBH 5TE6H 5KVEH 3F12B 1T1YA 4XCYA 4LPTA 5IF0B 3ZDZE 4I0PA 3STLB 3PWUB 3VXPA 1A0QL 1RU9H 2ATKB 1BREA 4HJGA 4AH2A 4ZS6C 5IB1B 4QHNB 4KI5F 5HGDB 3ULSB 1VEOA 4UTAL 5L8LB 4BKLA 4WFHE 4N0CC 4YWGH 5GS0L 4XP1H 2X4NA 4Y4FB 1FL6B 4OGAD 4D0CA 2H1PH 3CJJA 3AC0A 5JDSB 1I8KA 2NZIA 2UY6A 4PJ9D 4P49A 4NHUA 4EI5D 3S9DB 1WFNA 1DVFC 3U4EB 2EDJA 2CIKB 2X4TA 4U1GC 1GJIA 3AROA 1MUJB 5D7IA 1YNLH 1WC7A 3DX9A 1KXQE 1A9BB 4LSDA 1D7FA 1I7ZA 4OZ4A 2MQCA 4BFBD 4HW6A 5EBMA 5FUCE 4RA0C 3W5NA 2Y7QA 5A16B 5JO5A 4G8GA 3D39B 1R3LA 5IVOA 3W81A 4HGKC 1QR1A 4XNZB 3NZHH 2IQ9L 4UAOB 1D3CA 5I74C 1JRHI 4WFFE 5I76A 3ZZ1A 4K8RD 1YMMB 2FNBA 5L88H 4M61A 1OL0A 3GNMH 4XPBH 4YHPB 2A77L 3PGFH 1LD9B 4Y16B 3ZO0A 1FO0H 4R7DB 3VXME 3MRHA 1RZKH 4J3OC 2ICWB 4ZUUA 4XMPL 3KLAB 3CD4A 4G8GE 3NZ8B 2QQLH 3U9PL 2VIRA 2X7LB 3T3PE 3T65B 1UM5H 4PJ5A 5D7JD 3WFHA 5E4IA 3BPOB 4ZFZB 2HTKD 3KJ4C 1EK3A 5EBLA 3T0AA 3HE6D 3D2UD 4PIRF 1T0MA 4MA3B 3EYOA 4HHAB 2XI9A 4KK5D 5DRNA 5I8EB 3ALXA 2P49B 4E41B 3C9NB 5GS1A 1C5BL 1HNGA 1DUYB 3P77A 2D7NA 2IAMC 3K2UL 4XNYH 4PJXA 3MMEA 5E6IA 5DDHA 3GUTB 1Q9KA 3FQXA 2I25N 1T1WA 3RU8H 3TWCL 4UT9L 3CZFA 4M6OL 2XZCL 4PJ5E 3TIDB 4X99A 1I1AD 5D70H 2E5EA 1A4JB 3BAEH 3QUMA 1KIQB 1MJ8H 1UQSB 2VLLA 1TJGH 2ITCA 4ZMAT 3FN3A 3QP3A 1ZKAA 1I85C 4IJ3C 5T1MA 2WINB 4OV6F 5TE4H 1MCIA 3VU2A 1E4WL 1T2XA 2V2TA 4G6JL 2PXYA 3QZWB 1YPZB 4PJ7F 5IB3A 3O8XD 4PTTA 4RMSA 5CMAA 2AXJA 4K3DH 3D0VB 2BX5A 3EIFA 4HK3J 3HZYA 4MSWB 3MLUL 1JNNL 5FM5O 1MHPH 2VISB 3HE7C 5FYKU 5D1XD 4J6RL 3PDDA 5IM7A 1GL4B 3GRWA 4WEBL 1E4JA 2EDOA 1ZSDB 1TTGA 5E2TH 5DI8A 3WDHA 3VWKC 3QDGE 3LKNA 3CC5B 2BVOB 1DN2A 1JTOA 4XP9L 1SJVA 5F7DB 4ZAKC 4KWUA 2EIBA 3HNSL 5DJAB 2DMKA 4HX1A 4YBQD 25C8H 1HI6A 4JFHD 4KVNH 1SVZA 1IM9A 4LLAA 4GJTB 4YGVA 5BJTB 2VLKB 4WCYL 5ITFB 5CUSH 1UCBL 4BELD 4XNMB 1MLCB 3I02B 2COQA 1Y6KR 1HQ4B 5ESQA 4OQ1A 3HUJF 1V5JA 3FB8B 5GGTA 2Y72A 5EU6A 3PHOA 4NKQB 3IGAB 5FHBL 2QTEA 4RQQB 4H88H 4JGMA 5E2WL 1E27A 3S88L 3WYRA 1JN6A 2K7QA 3RVWC 2DQDH 1LHZA 2WWMC 2C3GA 3ARGA 2DB8A 5AD0B 1A6TB 1EH9A 3EFDL 2CLVA 3T0WA 2XRAL 1ZWIA 2PO6B 2C7UB 5D5ME 3UJJL 1UM6L 1TQCC 1FAKT 4CDGC 5IVNA 3NFSL 3PF2A 3DO7A 5CBEB 4WDIB 2XTJD 3WXVH 1ZLUK 5DT1H 5D1ZC 1GGCL 5L0QB 3H8NA 3QWRD 1WT5A 5JR1L 2F54B 4QHUA 1U3JA 3VFWB 1WZLA 5FDWB 4JFZH 2XKUA 1A6ZB 4JPKL 5K9OA 3LD8B 4JQXC 3WIFB 4MJ6B 3L5WB 2Z31C 3SDDA 1T2QH 5DK0B 3IKKA 4HK0B 2PF6A 5CZKA 2VUOA 1ZXQA 3GMOA 2ICEB 1N5YL 3BP4B 3KPRA 3RWCA 3BIAX 1I9IL 1MRDH 1QBLL 2D7MA 1M7DB 2P8PA 5FB8B 3QIUD 1VENA 1KLUB 12E8H 2FX7L 1JZ3A 4Z76B 4IM8A 4RISH 2PUQT 5I15L 3O4OC 5I18L 4NJAL 2YWYA 4Q0XL 2F53A 3A0OA 1LGVA 1FNAA 2GYSA 2A83A 3WIIL 3H0TB 3UAJD 3QO1B 2B1AL 5F97E 4XVJL 1LO4H 4JRXE 3KPRE 2BDNH 5H2BA 1CFNB 4BSJA 1JGDB 2HAZA 4PGBB 4K3EL 1TJHH 5SV3A 5LCVL 1XH3B 3V0WL 2O5ZH 3PHQA 3LN4A 2HVKA 1Q38A 2FZ3A 4F8QA 4HJ0D 2DOCA 2N7AA 5HHNB 4HV8B 4M93B 4I8DA 4S2SB 1NUFA 2X09A 1J1PL 5SX5H 4KAQH 3SDYL 1WBYB 4TTGA 4HF5H 1WISA 3MRKB 4WHCA 3QCTH 3WNLA 1PYWA 5DMKB 5T1KB 4POYA 2AV7B 3AREA 3OG4B 3IU3B 1Y18B 2YD3A 2VZSA 1S78D 2QADD 3MRCB 1OQOA 3B4NA 2BJML 5D93C 2LAAA 4JO2L 1RZGB 1KB5B 1A7OL 3QHFH 4TULL 4P5TA 2HVJB 2BOBB 3JBG7 4PRPB 4Z77B 4XRCA 2NTSP 4HKZA 5IVXB 1U8JB 2HKFH 4O51B 5FECB 1MFAH 1YEGL 5F9AC 2CDFA 3T0VA 4OFPA 3ULVE 2WQ8A 1NBVL 3TCXA 1G7IB 3K8MA 5LJYH 5LGKA 1J1XH 4YO0B 3UC0H 2FEDD 5I1JH 4I77L 3BUTA 4KI5C 3HI1B 2OZ4L 4YWGL 4YBHA 5DK2B 2H1PL 1KNOA 3KS0J 3P30L 5DD0H 5GRVK 3IJSB 5DRXB 1RQ5A 4RFNC 4ACPA 2FLBT 2EH7H 5D96C 1L0YA 2YD9A 4P0DA 1QP1A 3SOBL 3OKDA 2NX5B 1T5WA 2H45A 3HI6H 4K55A 4LSUL 5TDNA 1JPFA 3NGBB 3WKNA 1HOCB 5J7CC 1UZ8A 2FWOA 4P2OA 4PP2A 3TZVC 1JIBA 1I1FB 5DVNA 1HEZB 5EIIB 2R56H 3SY0A 1NC2D 2YKLH 1AHWA 5T5FL 3TT3L 1RSFA 1SJEA 1XIWC 3NZHL 4RGOL 2M8XA 1UVQA 1XGYL 1KLFA 1T7ZA 4RMTA 1CU4H 4WIQA 3G6AA 1QBMH 4WI8A 3BZEB 1OW0A 2NY0B 3TN0A 2BVQB 2Z8VC 4GAYA 3RPKA 4U6XA 4JFOB 3TJHD 1WAAF 3L3JB 4WWKC 5H8DA 1UCTA 4F2MA 1FYTE 1WIOA 2EYTA 3VFMA 3WFDH 4BM7A 4QRPE 1FSKB 5CHNB 3R8QA 1VFUA 5FUZH 4PPTA 4UDTA 4JG1L 3UBXB 1LWRA 2X89A 1INDH 4UQ3B 3MJ9H 1VACA 3QXDA 4DJMA 1EO7A 4DQOL 3FFCD 4MQXD 5DJ8A 4IOFC 3VG0H 3C5ZB 4JB9H 2APWA 1Q0XL 3QUMH 2FHFA 3MA9L 3FQRB 4G7YL 4X0KA 1IGIH 5SWSD 2XN9A 4JDTL 4PJ9C 3AMKA 1IC7L 5E8PB 1ZGLB 1I7RA 1PLGL 3HPLB 3HMXA 2JB6B 2RAMA 1T20B 4EUPA 1MJ8L 3O6LH 1TJGL 4WUKL 1UXSA 4FQ2L 5D7SH 3SE4C 3I85A 3IAPA 4HKJA 5DJCA 4YAQA 5ECJE 4U1JA 5IMLA 1XGTA 3GRWH 1NCUA 2E6PA 4CNIA 4O5LH 3MO1A 2BVYA 4GLRH 4X4XB 4MDJB 1P9MA 1PZ5B 4K8RC 3LV3A 3B5HA 5J57B 1U95B 1NAKL 1WJ3A 1MHPL 4JJ5A 1RI8A 2VDOH 4KC3B 1ED3B 4OB5L 4P5KA 3U0TA 2C4FU 4PYGA 2XY1A 2AGJL 2OMBA 1JUFA 1HKLH 1EBPA 2H8PA 1AY1L 3DGGB 1MNUL 1PVHA 3S96B 5CJOH 3DI3B 1A6AA 4MNQD 3LN9A 1W8OA 4HBCL 3B2UD 1CVSC 3VXOA 1RUPH 2PYEB 4NPYA 1IM3A 2FHBA 4LGSB 3CXHJ 1X4XA 4JZJB 4XC1H 2EC9U 1LDPL 3HE6C 4LCYA 4L4VB 3AU1A 4FXKA 4MJ5B 3W0WA 3AXLB 4X6FB 4YDKH 3KJ4B 1BIIA 5E8OB 3QDMB 3EOAB 4JQIH 4UUJB 3O6KH 2UZIL 3VFOB 3W9EB 1QFWL 4OZHA 4KJYB 2PW2B 4R0LA 5CINL 1QQDA 3EOYG 3VDBA 5SX5K 4JFEA 3GI9H 4J3WA 1FNGB 2X4UA 4QCIB 3OV6A 1KJVB 1I1AC 4U1IB 3EYSL 5DJ2B 4OZIF 2ITDB 5IB4B 5LGJB 3G6JB 3FOLA 3ZT7A 4F15C 1J88A 4UB0H 4BUGA 4OCRL 3RVXD 2ERJB 1LNUB 3OKKA 4PJ8A 3RVVD 4JHZA 1CCZA 1CGSH 4I2XB 2JCCB 4U0RC 3FN9A 4KK8D 4O2FB 1EEYA 4X6DF 3SGKA 3RX7A 2VL5A 2P24A 4MNGB 2GJ6A 1CD9B 1DL7L 2YD6A 5C0GB 5JHDA 3RIFK 1KSRA 4XPFH 4GXUN 3PDGA 3BSZH 4P4KA 4FQXA 5HSFA 1MHEA 1U8NB 1U6AH 4CDHA 3O8XC 2R2CA 3U36A 2EXWC 3OGOE 3QXAB 3MV11 4QHKJ 3TNNB 1SM3H 1H3PL 3D3VD 2WQRA 3T4YB 1M71B 3HR6A 4HIHB 1QLRA 1CF8H 3Q1SH 4K94L 2X4SA 3I9GL 2BY2A 3PWNA 5MENE 3V6FB 3PJSB 2L7JA 2GJ6E 3DUHA 3MJGX 1AXSB 4Y8AA 4K9EH 4GMTH 5IT2L 3BP7A 4NZUL 4PJHF 3EYUH 5BRZB 2ZUQC 1V3JA 4GFTB 3GSXA 1JRHL 3QEUB 4YBQC 4ZTPH 2P7TB 4YQXH 3ARFB 3CFKB 3IF1B 4ODWB 2Q7YA 4UZGA 3BQUC 5I75B 4YZFE 4U1LA 3TT1H 4Q9QH 3HFMH 4R9HA 5EPMB 5CEYB 4JY6A 5MHSD 1BQSA 3VCLA 2P45B 1XAUA 5IWLC 3W11C 5BV7B 4KHTL 5L6YL 4PGEA 3ULVH 4P2RD 5T3ZD 5K9KA 3NCMA 4FQIH 1WFOA 2EDRA 3QA3B 4F3FA 4F9PC 3O3AB 5EIVA 1G6RH 1W72H 4WVRA 4PS4H 2W65A 4HCRL 4JR9L 5HGAB 3BP5B 1RULL 2K9UA 4R90H 3DIFA 3TV3L 1X5ZA 1DFBH 2AJYL 4TNWF 2BCKA 1VSCA 1EZVX 3RDTA 4Q9RH 2X9WA 4PG2A 1R5VB 4ZPVB 1GZQA 5DHXB 5D2LB 2VXUH 3QI9A 2GSGB 3QWQB 3NFPB 4TUJB 4V1DB 4KKCD 3KNBB 4JHAH 1YEHL 4Y2DD 5IQ7H 3ULUE 3FQUA 3WE6B 2XFXB 4WHYH 3MBED 1B88A 3VXSA 4M8VA 4MCYB 3QIUC 1F4WL 3OKNB 3CH1A 1G1YA 3HR5A 2VH5H 3RBSA 1SEBB 4KVCH 5GSVB 2D7TH 2QQKH 4MA1C 4PRNA 1JGLH 1KXVC 4RFEA 3UAJC 4ONFH 3ZYOA 1EJOH 4HUKB 1SYSB 1OLZA 3BVNB 3OR7B 5E00A 2Q76B 3MLXH 5INDB 3EFFA 2DJSA 1UJ3B 2XTLA 2GK0B 3AM8A 4ZUVB 4ZFOA 4JJHA 3VXSE 3VW3L 5IMOB 3O6FC 3LPGA 3L1OL 1ZT7A 1T0NA 2CKBA 3HLAB 1S5IH 5EU4B 3SJVB 2C3VB 3TBTA 1F42A 3Q6GH 3RTQC 4EBQL 5E5MB 1M05B 1FG2B 1F90L 1UWXH 3U30B 4LU5L 2VKXA 2P5WA 5KAQG 1BAFL 3LKSA 3T0EA 3O6ML 4BQ9A 2AI0L 1WVZA 1G0YR 4LHUB 1S78C 3QXVA 2BZDA 4Y4HA 1AJ7H 1CU4L 1OPGL 1LMKA 1PKOA 2EKJA 4P48A 4I5BB 5TQ0H 3QIWA 3I6LD 4YJZL 1IEHA 3RWHB 5I2IA 4ZUSB 3CVHA 5I8CB 3QISA 1Q0YH 5D6CA 5D93B 3ARZA 1EEZA 4NQDB 1CFSA 1OF2A 4FQJH 4M3KB 5C09B 3SKOA 5IHBA 4PV8B 4XNUL 1CDJA 5ICYB 1TENA 2EXYD 4LMQE 1LEKB 3PQYE 3VDAA 1W2KT 3TH2T 1GGUA 1P69B 3ARUA 3MJ9L 1SQ2N 3WN5C 1A7BA 2R0LL 1JHLH 4NP4L 5IW6B 3PIQB 2VZOA 3MRPB 3QFJA 1TETH 3FO2B 3INUL 4MNHA 2AJUL 4BSVA 2PKDA 3HMXH 4EUPH 5SWQB 4I4WA 3I3DA 2UZXB 4UI2A 1EFXD 2DQFA 2I27N 4ZQKA 4Z7UB 5EO0A 1XGUA 5GGUA 4F58H 5E94A 4QWWD 4CVZB 1R3IL 4Y5XB 1KF9B 5DZLA 1TPXC 4IOIB 2ZSWA 3SO5A 1NLBL 4NO0A 4E42B 3MYJA 3DX8A 3B9KB 4Z7NE 3MTRA 5D9SA 4QHMB 3KJ6H 2CLZA 2R23A 3OGCA 3EW3B 4NFBA 2YUZA 2ZUYA 5I1GL 1U3HD 3V9FA 1SBSL 5FUOL 2GFBB 3G9VA 5F3HA 1TCRA 4OUOA 1DBAH 32C2A 1T03H 4DGYH 3ARSA 2HN7A 3T2OA 5FA3B 5L8JB 4CN4A 1YJDL 1AGCA 3UTOA 1V3MA 3OXRA 5GGVL 3LZFH 4ZFFA 3RWDB 3ZE2E 3D9AL 5C1MB 3P0YH 3U79A 3F12A 3IS1X 4ZPTA 1MAMH 5IF0A 3D85B 3TJHC 4GS7C 2OZ4A 3STLA 1ZLWH 3ZLQC 1MCHA 3MUGA 4L4TB 1MRFL 4P9HL 4LVNB 3UBXG 2DLFH 5KS9F 5HGDA 2VAAB 3K4DA 4ZUTA 3ULSA 1KCSH 4LASL 5E1AB 1EAPA 3BZDA 3Q6FA 4Y4KD 5GRUL 3I50L 3RKPA 3UTSD 1FPTL 2DI9A 4MQXC 3E3QE 2E8ZA 4Y2OA 1RZFH 1NGXB 4PV9B 3ELAT 4EOWH 5GSRA 1FIGL 5IMKA 5D71L 2KQNA 2P8MB 1T7XA 1PEWA 2F5BH 4X7SH 5MEOA 3OR6B 4N9GB 3P9LA 3CMOL 4ETQB 3VMOA 3QXTA 4JFFD 1HKFA 3RX5A 3QXWA 4HFUL 4MHHG 5DHYA 2CIKA 1QRND 4PGCA 1OY3B 2BHYA 4XNXH 1JGEB 1L7TH 5CJQH 5B8CA 4RDQF 3D39A 4TNVK 4EI5B 2VZVA 5AZEL 1A3RL 5I8KL 5FYLD 3BKCH 5CJBA 4NRYB 4PBXA 4NBZB 1UADC 3P4OB 1T0PB 4JAMB 4YHPA 5BCAA 2L7UA 1R3JA 3X14B 3LIZH 4LLUB 1FLTX 5F70A 2BSSA 4DFIA 3GSNH 5DURD 5JXAH 3KLAA 4NN5B 3D39E 3NZ8A 3ARDD 3FQTB 1CF8L 1PX3A 5CIPB 4I48B 2X7LA 2OQJB 1J5OH 3AFLA 3T65A 4NJ9L 2D31A 4ZFZA 1A7QL 1YMME 4LHQB 4TTDD 1ZHBB 4UOW1 5TJWK 3BKML 5F7LB 3M07A 5D4QA 4YQXL 3C9NA 2LU4A 1VESA 5GS2H 1IKFL 1KIRA 3IJHA 2EECA 4UDUB 2ENSA 5D7JB 3GUTA 3WLWD 2BRRL 1XF2B 4OD1H 4DFHA 2P46B 1KBGH 1DBJL 3D2UB 1RIUH 3QWOA 4NQSB 4PLKD 1A4JA 1DQLH 3MR9B 1GGBH 4ODXB 1AE6H 4LCCC 1KIQA 1UQSA 1UWXK 4XBEL 4E41E 2AERT 5IHZA 4OCYL 3CLEH 1G9NL 3TH3T 4HUVB 3MRFB 1IGCH 5IK3B 2A9MH 3MGTB 3RVVC 5KVMC 3DTXA 2P47B 3Q3GA 5I17B 1KB9K 5HHXL 4F80A 2FBJL 5CWSB 3ZE0F 2RJMA 3LRGA 4KK8C 3QZWA 4F15B 1KC5L 1YPZA 4JQVC 3WDJA 2KPNA 3O4LD 5A2LH 2VR9A 3BO8A 1HHGA 1F5WA 3FONB 2OTUB 2FD6H 4MSWA 4FQLH 2VISA 5F6IB 1R5WB 4D3CL 3DUUB 4UT6L 2H32H 4LARL 5E8DH 4L3ED 5J12C 1H3GA 2Q8AL 1BVZA 4OGXH 5IIEB 4ODHL 1F58H 3VXQB 5F3BB 3WUZA 5DJAA 1YPZE 1DTUA 3GO1L 5D1XB 4MXVF 4M7ZC 2VH5L 5BJTA 2VLKA 4XB7A 5ITFA 1NJ9B 1MLCA 4XNMA 4AIZB 1A6WL 1UB5B 1HQ4A 4F57L 1I4FA 5B38B 3O11B 2CKBH 4G80B 4P2QD 5MEQA 3KR3H 1T89C 3AB0C 1CR9H 1HH6B 3IGAA 3KPOB 4YHZL 5L9DL 4RQQA 3T2NH 5DO2D 6FABH 3HG1B 5DHVB 1U58A 5AD0A 1MJJA 1A6TA 5MI0B 4L1HA 3VFGH 2VLKE 2PO6A 3QULB 1A1OB 2VXSL 3JTSA 3L5XH 3OJVC 43C9A 3HC3H 1NPUA 3MODH 5D7KD 3L95A 4OCWL 2CJUL 5EIQA 1Q1JL 4PLNC 2B4CL 4QRUA 3CVHH 4HPOH 3B2VH 2DWDB 2UV3A 3E6HB 2F54A 3Q5YA 2L0DA 4YNYB 1IAKA 3VFWA 4YXLL 1A6ZA 4GAJH 1DQMH 2YS4A 3L5WA 3DSFH 3DETD 4MJ6A 2GSIB 3FAXA 4UIKH 1G7LB 1O7VA 1ZLWK 3X12B 5K9QI 1NFDB 2H6PB 3CVIL 1U8MB 4OLXH 1G7MB 1XMWA 3FO9A 2XTJB 4XHJC 5DYOB 4G5ZL 4IRZL 3JWDL 5BO1H 4KKCC 1NDMB 3O3BB 5DFTA 1M7DA 4Z7WF 3F5WA 3QEQA 4Y2DC 2F54E 5C86A 3FB7B 4FFZL 1BFVL 5FKPB 3MBEC 5JW4Q 5ANMB 2MOVA 1LDSA 1RJZA 1AR2A 1H5BB 3P40A 5EZJA 1BZQK 2HTLD 2YPLD 4M8QB 1JHKL 1K4DB 2EC9T 5DR5H 3DVGB 3BKYL 1F00I 1IQDB 3ES6B 5C0AD 1Z9SA 2MJWA 1CXLA 2AV1A 4TQEL 4YK4B 4ZOAA 2B39A 4HCRA 1XH3A 3RWEB 1J87A 4MWFB 4ALAH 1E6OH 4I9WE 1MI5E 3BP6B 1T3FA 4JN2B 1F2QA 4MD5B 4ZXBD 5HHNA 2N1KA 3BPCB 4WFGD 1AP2B 5EU7C 3EO0A 3MOBL 4OUUB 4S2SA 1QPPA 4YFLI 4JRYB 2VYRE 4UV7L 1U8KA 5E7BA 2BRQA 4CVXA 5IQ9B 3MRKA 5BXFB 1WBZB 4LK4A 1JGUH 1CQKA 1FZMB 5DD1L 2J8OA 5T1KA 2AV7A 1LE5A 3S4SB 5GZNC 3IU3A 4ODTH 3V6OA 3W2DL 3IDYC 2B0SH 3U46A 4S0SD 4LHUG 1GGIH 1RZGA 4DGYL 1P4LA 4HPYL 3DLQR 4P59L 5T1DL 5GRWA 4PRPA 2OLDA 4H1LB 4DZ8A 4Z77A 3ZL4H 4O51A 1IFHL 3VFSA 5FECA 2QADB 4C58B 1KJ2L 1DP0A 3VA2C 4KMLB 3BIKB 5D1QD 4Y19A 4UOJA 2PCPB 1F6AB 4WFHD 3X3GH 1G7IA 3P0VL 4HT1H 3K80A 4YO0A 3G5ZB 3REWB 2NY6B 5CKAA 2AJXL 3L6FA 2X5PA 4N1CA 4I0PD 1IE5A 1OGTB 1IL1A 5DVOA 3HCVB 2R0KL 3LN5A 5IVXE 4NRXB 4OD3L 1Q72L 4ZFGL 1VERA 1INEL 1L0XA 4OM0L 2XQYG 2NX5A 4PR5B 4FQPA 2VMFA 4QWWC 3RGVC 5DQDL 1P84J 3GMLB 1D9KD 1MCPH 4K7FB 5IW1B 1I1FA 1HEZA 5EIIA 2O26U 1RVFL 5GRJH 5IBTH 2D2OA 1U93B 1RUAH 3PWVB 4MQSB 1PFCA 3MOAH 4D8PB 5CAYB 3DPBA 1FZOB 1NGQL 1U3HC 4AQOA 2NX5E 5D7LB 3ZDZF 4YHLL 3TVMA 1JGVH 5E8NB 4G8GD 2E8YA 1RIHL 3IDGA 4PJDA 3B43A 4X7DC 4HZLB 3OJMB 5CJ8A 2BVQA 4MMXC 4FQ1H 4JFOA 1MVUA 2X42A 3H3PH 5CHNA 3SPVB 2EYSB 4PRIA 4J3UA 3MXWH 2H9GB 4G9DB 3UBXA 2RCSH 4UQ3A 6CGTA 2UVFA 1CD8A 1YDPB 5DJXA 4G8IB 4POZD 2H26B 3C5ZA 5JXEA 3SKMB 4Y4KC 4XAKE 5ID0B 1LO3H 4PJ5D 3U7WL 3RIAK 3RIFF 3B9EA 3OB8A 1RZ7L 2HJFA 1QTYT 3V52H 1NUGA 3WDIA 3HZKA 3V0VB 4WW1B 1OB1B 1ZTXL 4PRHA 5CEZH 4I18B 2UWEA 5D72L 3OX8B 2QKIB 5HHQA 2LAGB 5HPOA 1E28B 4ZS7H 3U2SB 4L8SB 3CFBA 1Y0LB 4JM4L 2DQGH 5ICZB 4L8BB 3ULUL 1AE6L 5DXWA 1T1XB 5I73B 3CDYA 2JB6A 1KCLA 1UT9A 5J11B 5E6ID 3TA3A 1IC5L 4N90D 3MYZA 4JZOA 1F6FB 4EQ2A 4LEXL 5CLTA 4FP8L 5HY9B 4R2GD 1QUNA 3A6CL 5D7IF 5HD8D 3ZSTA 1MF2H 2OYPA 4NNYA 4MAUH 3BDYL 5EFIA 3GBNL 3WS6A 4X4XA 2BNQB 4OZIB 1RIVL 4QRSB 1PZ5A 4D2NA 5EU5B 1C1EH 4RSVA 4YDIH 5KW9H 4JHWL 1U95A 5C0CD 4OI8A 2V9RA 4L9DA 3T3PF 4W4OA 4Z8FL 1F13A 2E7BA 3P2TA 1XR8B 4GKSB 2AKRB 5C7XH 2VZ1A 2PXYD 4NQXB 5E2VL 2YRPA 3DV6B 4QHKI 4W68A 3N85H 3UYRH 3GSRB 5FGCB 2VJXA 5SWZB 3DGGA 5C6PB 1CD1B 3T0BA 4Q2ZA 2MWCA 5EZIH 2NY1D 2DQUL 2J88L 5GIRA 2PYEA 4JZJA 3T04D 4OLUH 4EVNB 2FGWL 2VC2H 1ZE3C 4KRPD 4C83B 3WNKA 4MJ5A 4X6FA 4QXUH 4MNQB 4UUJA 2V6HA 3W9EA 3VFOA 1CR9L 3HAEB 1NANH 1IM9D 4FHBD 2I5YL 1RZKC 4U1MB 1FNSL 4Z7OF 1D6VH 2FLRT 5F1KC 1X5XA 2VZTA 2W9DL 1FNGA 2PYEE 1JTTA 1BJ1H 4QCIA 1FLRL 3KYKH 4PJXF 4U1IA 5DJ2A 3RAJH 1YEDB 5I0DA 2F8XC 5LGJA 3G6JA 5EU6D 4HUXB 4HKBB 4L4VE 4I0KA 4L8DA 1LNUA 1CN4A 4YHOH 5INCA 3QDME 3ARGD 4I2XA 2JCCA 4FQCL 1FE8H 1UKQA 3OKYA 2LVCA 4O2FA 2FL5A 1PG7X 3WKMH 4MAYC 4A6YB 4P57B 4NGHH 5C0GA 2R0ZL 3O81A 1IAIM 2IPTH 3ZTJG 4DAGL 5I1CL 4S1SH 3GSWB 3PDOA 1DEEB 3G6JE 2QHRH 5FYJE 3BRFA 2CDEB 2OSLA 3TNNA 3T4YA 1M71A 5GS3A 3MLVH 3RI5K 3U7YL 5E2JA 2A6IB 2GITA 1U8HA 2JCCE 3SQOH 2R4RL 3K2MC 2VXQH 2W9EH 5ADOH 3DRTA 3V6FA 3PJSA 4MNGE 2EIDA 3H9SA 2AXFB 1AXSA 4XP4L 1HN1A 1CZ8L 1FL5B 1MHHA 4MJIB 5JPMA 3KPRD 3CK0L 5F96H 2BY0A 2P7TA 2NXZC 4U2YA 5H94A 5GGRA 2A6JB 3CFKA 3IF1A 3UP1A 3LMJH 2JJSA 1FFPB 3V4UH 5EPMA 5CEYA 4J3SA 3RWIB 4GRLA 3NAAH 4NIKB 4OCSH 3V4PL 3ZMRA 2F53D 4XPTL 3MFFB 4I3RL 4Y5VC 5EOQL 4HIXL 5DO2C 5BRZE 5EH1A 3MV01 1C16A 5EZLA 3FQNA 2KZWA 2I24N 4L29A 4L3CB 1KB5H 3DO3A 2MCPL 1IVLA 1N7MH 2A9NL 3BP5A 5FF6A 1CXEA 2Y9RT 4ONGL 1G7PB 5AZ2L 3HS0B 4P2RB 1ONQB 2EH8H 1OSZA 3WFEH 1X3DA 4POUB 4K7PL 1R5VA 4NWUL 4ZPVA 1MHCB 2XZZA 4X80H 2GSGA 3HB3D 1G7JB 3BN3B 4PLOB 3NFPA 4OLVL 2DM2A 3WIFA 4J3TA 4QF1A 5GRYA 2NXYB 4P5TD 4PJIA 5EOTA 3WE6A 2XFXA 3MFGB 1WEJH 2V17H 3CGTA 4HGMA 3NABH 4S1RL 4ERSH 5EOCJ 5D2LE 5FO9B 4HMEA 5L2KA 5GSVA 2EDDA 3KYMB 2HTLC 4YUEH 4V1DE 5DJ0A 3I3EA 2AJ3B 1SYSA 2D9CA 4OF5A 1NMAL 2CGRL 3THML 2GK0A 4OSUH 2BERA 5IMOA 3I2CH 1HHJB 4QXGH 5AWNH 3V2AR 3WV0A 4CMMB 4TVSa 3IVKA 1MCPL 4LCWA 4WI3A 3HLAA 4ZXBC 3NCFB 1ULVA 3CNKA 3NCCB 2AS5M 4V2BA 2X9YA 2C3VA 3EDJA 4MA7H 5IHUL 3JVGC 1IAII 1SBBA 5IBTL 5IFJB 5E5MA 1M05A 1EO5A 5IKCB 3GI8H 1I1YB 4F7EB 2VLJB 3S4SG 4NM4L 4P2OD 3MNZB 1HH9B 1GOFA 2O61B 2CIIB 5EBWB 4IRSC 35C8L 4LSTH 1IGTB 4I5BA 1NSNH 5EZOH 3RWHA 4JFXB 3ULVF 5ERWB 4DCQA 2ZOLB 1H8SA 4ZUSA 3LHPH 4RRPA 3SJVE 4L1DA 5FO7B 2WUBL 3SDXB 4PV8A 3MLTA 1D5IH 5JORB 2HLFC 3IFOB 1YNKL 1R0AL 4HS6B 3LS4L 4ZOBA 5B3JE 2FATH 4S11A 4TNVF 2MQ0A 4X7CC 3PIQA 3MRPA 1B0GB 4I0PC 2WBWB 1PG7H 4K2UL 1LO2L 5FYKL 1G0XA 2VB5A 2X89D 3V5KA 3WSQL 4NQDE 1R5IB 4HC1A 4AZ8A 4D0BB 1S7XB 5C09E 3RPIB 4Z7UA 1KGCE 1FGVL 1HILB 2HKHH 2VN7A 4CVZA 4Y5XA 5D2NB 4IOIA 2ZCKL 3R0MA 4DN3L 5FUCC 5I71C 5ICXB 3NCBB 4HWBL 1D6EB 1BFOB 1CFQB 3B9KA 1UXWB 2DQIH 3QPXL 2DD8L 5IFHH 2XN9D 3OKLB 4NC1E 4MGXA 3P9MA 4J3VA 1V05A 5C0JA 5DC9B 1PD6A 2YC1B 4KI5E 2J8UB 1EHXA 4Z7UE 1XZ0B 3I6GB 15C8H 3V6ZA 3S36X 3C60B 1WWBX 4OIAA 4P3DB 1H3WM 3C09B 2A1WH 4P3CL 1VFOA 4ETYA 2V5MA 3RWDA 3PHSA 3U6RB 2OR9L 1QFUH 4JM2D 3ILPB 4PUBL 3VXTA 3D85A 3SQBA 1OAKH 4GW4B 3UYRL 5EORH 5KTEL 4HDIA 3OG6B 4D0DB 1MIEH 1MJ7L 5BVPL 1OSPH 3J8F7 3L7FA 5JZ7D 5ITBL 3OB0H 4P5MB 3QG6B 1A5FL 3T3MF 2NR6C 5F89B 3QQ3A 1BLNB 1FH5L 1MFEH 3JWOH 3C5JB 3MZGB 4PV9A 4FN0A 3N1MC 5FYJH 5LGHH 3B3IB 4N9GA 1C7SA 4ETQA 1KEGL 2Q86A 4L4TE 3WFBH 1C5CH 2DDQL 5EC1B 4OM1H 1IC4L 3DUSB 3W0WD 5GS1C 3CXHK 3QT2A 3R1GL 3QO0B 4HKXA 1HIML 2WNGA 1NMBL 3BD5A 5E6IC 1UJTA 3BYTA 2X1OA 4J8RB 4JFED 1RAMA 1J10A 4R2GC 4QTHB 4URTB 1QRNB 4HD9A 5DD5L 3QG7L 5HD8C 4KXZH 3VD9A 4JAMA 4ZDHB 1NAMB 4G3YH 3PGCB 1Z9OA 4PJ8D 2PTTB 4PJEB 5SX4H 4P2YA 4DKAA 4CW1B 1QO3B 2F19L 1KN2L 1XR9B 3K8KA 3PWPA 3MLVL 5JHDD 1WIUA 4H20L 5CIPA 1XT5A 2PXYC 2WV3A 2I26N 3NACL 4FQXD 2OQJA 4P4KD 3VJ6B 1KG0A 5DZOA 3BH9A 1M1SA 2GIYA 1TVHB 2R2EB 1TJIL 1PZUB 1IGYA 5BV7H 1CFBA 3K81A 5B4MD 3ARDB 5F7EL 4ZD3H 1R3HB 4H8WH 1WZ1L 3T8XB 2M1KA 1MCKA 4FQQB 3DV4B 1XF2A 3HAEG 2UUDH 1MOEA 1U3YA 2OI9C 2FSEB 4LSQH 3ECBA 4OCMC 1RMFH 2V9QA 5KOMC 3MR9A 1YA5A 2DIJA 4ODXA 2BSRB 4NUGL 1MRCL 2LU3A 2XWBB 1EO8L 4NDMA 4LAQH 5LBSL 4HUVA 3H9HA 5E1HB 3CFIC 3MGTA 5GS2D 5I17A 5I19L 1Q9LA 1DUZB 3ARGC 3HTLX 1WGOA 4O2EA 1EIBA 2IJ0C 1JWMB 3E8UH 4TPRH 2XWJA 5DEZA 5J0BA 2CK0L 2R9HD 1FRGH 2D03H 3EJZD 4R7NB 5FM5M 4OLZL 3FONA 1E4XL 2OTUA 3IFNL 1YY8A 2Y5TA 2FX8L 4NYLB 4JPIB 4LBEB 2A6KB 1X5KA 3IFLL 2AK1L 1R5WA 3WFCL 2E9BA 4GRWB 1HSBB 4WI7A 5GGSY 3RDTD 3SDCA 3V5HB 3G5YA 1NBZB 2EDWA 3O4LB 5IIEA 3QI9D 3IU4H 1RPQA 1ZLSH 3GJFA 4M1DH 3SDDC 4YZFF 5C0IA 5E03A 3QUZB 4KK9C 4KTYA 4X4MA 5HI4C 4CBPA 2CK2A 3RNQB 1S5HA 4OZGA 4L3EB 4O58H 2V5RA 1K8IA 2LQRA 4PGJA 5I0ZA 1G84A 4R6UA 4BFEA 3VXSD 2R69H 5B38A 3WXWH 4MX7B 3FOMB 1HH6A 4YDLC 4MXWH 3BUYB 3KPOA 3KDMA 4IEFB 5DA0B 5HYSB 4GBXA 3AUVA 5FGBC 4WY7L 3HG1A 5JA9A 3V0AC 2WW8A 2ZKHH 1X7QB 2NY7L 3M1BB 4JDZA 3CSBA 3QULA 4K9EC 1YEJH 1VEMA 2P43B 1CXHA 3L3HA 1ZHKB 1SMAA 4PJBB 4R26H 2DWDA 3TGXA 3MRBB 3L3KA 4JFHE 3OKEA 4YNYA 3HG1E 4Y8DC 1YYLL 5ALCH 1W0VB 4G6AC 2GSIA 3MNVA 1RZJH 1NFDA 3F7QA 2VDPH 5B21A 1HZHH 3T08A 1UA6H 2P5WD 3GM8A 2I9LB 3ULVC 4CU7A 3AREC 3HB3C 3T0ED 3OB0K 2OTWB 3ZSSA 2ID5A 3CSGA 4Y4HD 4JFDD 4P4RA 3QIWD 3TBSB 2F74B 4JCMA 4V2CB 4WJ5A 2K7PA 5ACZB 2AJZB 4OAWA 4HC1H 3TP4A 4RAVA 4AYFA 4G43B 4Z7VB 3VXUD 1YNTB 2UYLB 2Q6WA 3TF7C 5A2JH 2LTQB 4M8QA 3DVGA 3MRGA 1FZKA 1LP9A 2E6QA 1BGXH 2XTJE 4X9GA 3VG9B 1IQDA 1UC6A 2HLAB 4X83A 4HJJH 1CIDA 2EIEA 1S7WB 1KPVB 1V8HA 4XPHL 5TDOB 5H35B 5TDPA 2YXFA 1A02N 1CT8A 2XNAB 4QXTA 3RWEA 3QFJD 4MWFA 5BMFH 1LEGA 1IQWH 2DMBA 4UU9A 2YPLB 4IHOB 4JN2A 4TYUA 2FHCA 1WCQA 4MD5A 5ANME 3B9DA 2YD8A 2Z8WC 3NPZB 3PWJB 1J0ZA 3LPFA 4RGNB 4JRYA 2AEPH 5IQ9A 2X70B 5BXFA 3NN8B 2IF7A 1FZMA 5ETUB 2WSKA 3QB7C 3VGFA 4DTGL 5LWYL 2B7DT 2IGFL 2YPVH 4IDJH 4NO0D 4H26B 5JHLH 3IDXL 1EHLL 3GM0A 1JV5B 1RUQL 3MJ7A 4NNPL 4P2OC 3CDGB 4AT6B 4DW2L 2JB5H 4LRIA 4M62H 2LV4A 3O3EA 3QCVL 3RL2B 1AHWC 1NBYB 4JRYE 4H1LA 3KGRA 1AC0A 5FHAH 1RUMH 4PJGB 2YK1H 4YDJA 3FO0L 1BBDL 5C0RH 1KELL 2KDGA 2PYFB 4G42B 3G5ZA 4IMKA 3U0WL 1OW0C 4X7EC 1NCBH 3LQZB 2Z8RA 3TN0C 4H0IA 1PY4A 5MP6L 3BE1L 4Y89A 4IDLA 2W0LA 1JZ7A 1VGKB 5IR1B 2DMCA 2UUDK 1INQB 5DUMH 3HCVA 5D1QB 1FBIL 4OBRA 2O5YL 4NRXA 1TZGH 3RWGA 2FR4A 1DSFH 1MY5A 3OF6A 5DEFB 4JKWA 2N4IA 4XMKH 4Z7NF 2RIKA 1I9RH 4I0PB 2BVEA 2NQCA 1AQDB 1T2JA 4PR5A 3VXPB 4TOYH 3OJDB 4UINL 3GMLA 1C5DB 4N8CH 3P4NB 1N6UA 3M8OL 7FABH 3DSNA 4XAWL 3LH2H 3F8UB 1BPVA 1FHGA 1N4XL 5F1IB 4X8XA 2X4NB 4D0CB 3PWVA 1I9JH 1GYAA 4OGYL 4D8PA 4M5YH 1TTFA 2EDQA 3ZE2F 1D9KB 5CIPH 1I8KB 4K8RH 5D7LA 3W39A 3ROOA 5E8NA 1WZKA 1YY9C 3GEWB 4UT7L 3D39D 1REIA 4TRPH 4QRRA 2PR4L 4RDQG 4OQTA 1ROWA 2VDRL 2DQJH 4LCIH 1A6UL 3DX9B 4WRLA 1I7ZB 4OZ4B 5EBMB 4QY8B 4BSWA 2Y7QB 1P9MC 1KJ3H 1IAIL 2OL3L 5JO5B 4O02L 4YR6B 5D7LE 3S8WA 2VE6A 3TM6A 2SEBA 1QR1B 5KANI 4J1UA 1MPAL 4QRQA 5I76B 4Y5YB 5F9WB 3O0RH 2H26A 4KJQD 4M61B 3SKMA 5DSCA 4M6NL 2ESVA 5ID0A 1SYVB 2VLRB 3MRRA 4LLDA 5DWUH 1NGPL 3MX0A 3VFNB 4HWBA 2DQCH 2J4WL 3EHBD 3UTTB 1Z0MA 2NY2D 2BFVL 1MAKA 4ZUUB 3BT2L 4I18A 1IEBA 3STZB 2VZ3A 2QKIA 3U2SA 1U8PA 3A6BL 1FN4A 4FZEH 1T1XA 4QEGA 5HI5D 1T5XA 4BFIA 5AAWA 1I8MB 4HXBL 1RJCA 1ZMYA 2HFGH 1CXIA 3ZTJH 2DYPB 2VDQL 3BJLA 2R8SH 4R0LC 4IRJA 1OM3H 2PTUA 2Z92A 3QUXA 4NZRL 4LIQL 2DQHL 3VD4A 3WHE1 3DMMC 2BNQA 4PJXB 4F37K 3X3FH 5DDHB 1FDLL 1T1WB 5CEZD 3CZFB 3KPSA 4XBGB 1B2WL 4PJ8C 3IETB 4GKSA 3QCUH 2AKRA 3TYGH 3DV6A 3SGKC 1DQJA 1RY7B 4Y88A 3PL6A 1ITCA 4WEUD 5SWZA 4B50A 1AXTL 5BZWA 5C0DA 1HXMA 1CD1A 4HFWB 5AG9A 4P4KC 2DRUA 3PGDA 4TVPL 2XQYK 5C0CB 4L3AA 1MJUH 2BNQE 4N5EC 4OZIE 2CXKA 2XA8L 1MSPA 3TH4T 4XCFL 2PXYB 5HHVL 2XICA 4W6YB 5DHVH 3IXAB 3TO4D 5CMAB 5B4MC 2Q1EA 1BEYL 2DTML 4IMLA 4GKZA 3HZYB 4MNQA 3SGEH 1JMZA 4M7LT 4U1HA 1IILE 3S36L 2NY1B 1OLLA 5FGCE 1S3KL 5SWZE 1A9EB 5IM7B 4NKMA 5E24E 1X9QA 2VLKD 5EBGA 1LEIB 4KRPB 1DBBH 4EN3B 1OAXH 5I16B 3RP1A 5GJSL 2CUMA 4HX1B 4QXWA 1G9MH 4HKBA 5KJRL 1JNHA 5CGYD 2NZ9D 4MD0A 3VGHA 1U8LB 1ZS8B 2YSSA 1MCOH 1OTSC 4O4YH 4MNQE 3MLPA 1CGUA 2HP4A 3BPNB 4ZTOL 3VD7A 3GIZH 4A6YA 4P57A 1NH6A 5ESQB 2PO6D 3F6LA 4KROC 5EU6B 3PHOB 1A3QA 1CI5A 4JPWH 2R9HC 5IGXH 3EJZC 1E27B 2ARJQ 4AQ1B 1JN6B 3GMQB 3V7AE 1CL7L 4KH2A 1YPZF 4NFDA 5L7XL 2F54D 1N64H 2XQBL 4JO3H 4C55A 2IBBA 2CLVB 3LKPB 2A6IA 1QVOA 1ZWIB 4J7RA 1HSAA 5A3ID 5C08A 3CXDH 1GPOH 2ZG2A 2IADB 4XPAH 5JPNB 1I1RA 4PG2C 2AXFA 3QI9C 1FL5A 4MJIA 4O2CB 5JW4R 4JPVH 2RQ8A 4Q6YA 1F4YL 1NMCC 1P53A 1C7TA 4JG0H 5K9OB 2EE2A 2RB8A 4PJFB 3QEQD 3RZCB 3GMMA 2K3TA 3NCYP 4I9WD 3H6JA 4ODUB 1N0XL 3MFFA 1PSKL 2ZWLT 3FHAA 3BGFB 4KDVA 2QSTA 1IAOB 1A14L 2BHZA 1IGJA 1A64A 1G9EA 4MJIE 4WENB 2P8PB 4U6VL 2VOTA 3D3VE 5DEGA 3N1PC 4L3CA 2EEAA 1GOGA 2F53B 1NGYB 2YD7A 2A83B 3FJTA 5HHPA 4ZUWA 1OTUD 3AM8C 4QKXB 3BRDA 2ZCHH 4H1LH 1A3LL 4P2RA 2WBJC 1ONQA 1L7IL 2W91A 3B5GA 5H2BB 4G6KL 5KSBA 4BJLA 4H0HB 3FN0H 1MHCA 4N8VG 1LE9A 4LNVA 5T1KD 2FH8A 2FZ3B 5AEAA 5MHSE 5JQ6H 2HH0H 4GT7A 4HWUA 4FFWD 4S0TD 5IBUB 5EN2B 5FM8A 5DVLA 1AR1C 4Q97A 3T0EC 4M7KL 1BQHG 4P2RE 1PQZB 4LVHC 2WUCL 4Y4HC 1QHPA 5T3ZE 1Z9MA 1CS6A 3QIWC 4PRPD 5C70A 3IDNB 1PYWB 4LRNL 1D5MA 1NCWH 2I60L 4R4FH 2AQ2A 4NQTA 4O9HL 5FO9A 4C59B 5LKNA 4JFPA 5TH2A 2YRLA 3OAZH 4Y19D 3KYMA 2IPUG 4LPXA 2AJ3A 3P0GB 4P5TB 3F62A 3HI5L 4CJ1A 1XEDA 1YEIH 3VGGA 3EJYD 1Z6JT 3QNXA 4UTBL 1L6XA 4OIIH 1BBJA 3BKJL 3S34L 3WJJC 4DEPB 1HHJA 1LO5B 4XC3H 4EDWL 5JOFA 1CGWA 5BW7A 4CMMA 5D8JL 1KCVL 1NCDL 1G7HA 4U6YA 3ZKXC 2X2YA 7FABL 2OS7A 4NWTH 3F58L 4S10A 1WBXB 1GHFH 5DZNA 1CYGA 1JPTH 2NX5D 5DD6B 5C07A 3VD3A 5IFJA 4GXVH 4OQTH 5E6YA 2VLJA 1FNEA 3MNZA 3GK8H 1MFCL 5EBWA 2ZPKL 1VEPA 4WNQB 3SGJA 4EKXA 4XNQB 1P84K 2IG2H 1K8DB 4PGDB 3O41B 4G8FA 5TDNB 4N0RA 2ZG1A 5I1AB 2QQNL 1SVCP 1LILA 2FWOB 3SDXA 3TVMD 1F4AA 2VLJE 3ETBF 3SY0B 4LAJH 3BN9D 1AHWB 4WW2B 1OARH 5IVXF 4NOBA 5KN5A 4OLYL 3E3QC 3ARBC 5CJXA 4FFVD 1UVQB 1QEWA 4PRID 1B0GA 1OCWH 2ZCLH 3AMLA 4NUJB 5I30L 3G6AB 1ZVHA 1X5AA 3JSSA 2GW5A 2B5IB 3SDXE 4RFOL 4GAYB 4NO3A 4D0BA 1BM3H 4U6XB 1TIUA 2N7BA 4ZNEA 2EYTB 1PX4A 1SEQH 3I6LE 4ZODA 3VFMB 3C5ZD 5D2NA 2NY4D 2MCG1 1DBMH 4XMLH 2MSPA 4GSDL 4L4JA 1DLFH 5GRXG 1D6EA 3NCJL 1UM4L 1UXWA 1VACB 3C8KA 1P4BH 4PRHD 3MRJB 3OKLA 4OTXH 1AIFB 5DJ8B 1OM3L 1J1OL 4R97B 2YC1A 3HC4L 5KS9E 2ICES 1MCRA 4ZNEE 2QSVA 2VDML 1XCTB 3TA3D 3JUZA 1FZJA 2AEWA 5D2NE 5DD3H 1FVCB 3C60A 5I66B 3ARQA 3GKZA 4X0KB 4P3DA 2IFFL 1DBKL 4OZFB 4XB8A 1S9VA 1SMOA 4FRWA 3U6RA 3QCUL 3MV9A 4OJFL 1KIUA 4XNZC 4UAOC 4XVUC 2J6EL 2IEPA 4GW4A 1MFNA 4D0DA 2NYYD 1UXSB 2J8UE 1KEMH 1MEXL 3D87B 4HKJB 1J9CT 4KUZL 5EO9B 4Y16C 4U1JB 5IMLB 3HAEH 2BC4A 5F1NB 3O2DL 4HGWB 2B2XL 4XP6L 4JM2B 1BLNA 4LKXB 2FX9L 2ZNWA 1HWGB 3JV5A 4RIRB 1NKRA 3MCKB 5ENWB 3JV4A 1QHOA 3RL1A 3OXSB 3UZVB 1W0WA 2DIAA 4R8WL 2PYED 4GW1B 5HYJB 3IFPA 3BPOC 4DVBB 2GJJA 3EHBC 1O0VA 4P5KB 1P2CA 2NY2C 4ZO7A 5DC0A 4NN7B 1AI1H 1NUNB 2WMPA 1N26A 3BIBX 3DUSA 3Q48A 5LQBH 1DBBL 2PNDA 1NFIA 4D9LH 4TUKL 4X5XB 2E27H 3S37H 5HI5C 1RFDL 3VXOB 4NPYB 1IM3B 4M6ML 3O2WH 1B0RA 1NEUA 3HE7A 4K23H 1J8HA 1TTUA 4XCNA 4LCYB 5CZXD 3AU1B 2AAVA 4FXKB 4X5WB 3W0WB 1BIIB 3CH8A 4OZHB 4OLWH 5FOBA 2PTTA 3BMVA 3CFCH 4NKIH 4UV4H 1YQVL 3SDAB 2DQEH 4MD4B 2YZ8A 2Z93B 3F7VA 5HGGS 1XR9A 2X4UB 3QJFB 4JO3L 4LSPL 3KHQA 3FOLB 2R15A 4KZEL 1XCQA 3GHEH 5E08L 1QRNE 4LHJB 2IH3B 1TVHA 3OAZK 2R2EA 4HULB 1EPFA 2Y06L 1YEKL 2VL5B 2YEZB 4PJEE 5JHDB 4M48L 1N6QL 4KMQA 1QSFB 4FQXB 1S8DB 5FYLE 1MHEB 4PG9A 1S7UA 5C71A 2Y5EA 3RY4A 3T8XA 3H9SD 4CN6A 5I9QB 3U36B 4BZ1H 2DL2A 1NGZA 3DV4A 2J12B 3NA9H 1JPST 2FSEA 4HAFA 3LSOB 5DK3A 1XFPA 4Q6IB 2V2WA 4RWYH 5D1ZA 1KTRL 3PWNB 3AY4C 4W70A 1E6JH 4G8EB 2BSRA 5F7FA 2RHEA 4YH6A 5T3ZH 4GRLD 1ZLVH 1IEAB 5EUOB 3U9UB 5TQ2H 1BP3B 4JY5H 2BHUA 4LGPB 4YGAB 5GISL 4GRMB 3GSXB 3QJHA 1VADB 2NZ9C 3WMSA 2CRMA 5IROA 4Z0BL 1JJUA 3ARVA 1MREH 4U1LB 3G6JF 1JWMA 4KK6C 1QLFA 1KB9J 3VCLB 2PO6C 3GBMH 4R7NA 1NC4B 2JCCF 4LSVH 2HJKB 4JPIA 1TXKA 5FGSA 5TF1L 2FRGP 4NHCL 1J18A 1MIML 1HSBA 2PN5A 5K9KB 4JFYA 1OOAA 3V5HA 4RZCA 1V7ML 5L0QC 1TMCB 3B6SB 5IESL 3EZJB 5K33A 1NBZA 1NCAH 1ZEAH 2W65B 3LD8C 4JE4B 3TYFB 4G7VH 3GMRA 2IMNA 3QUZA 4R4FL 4HQQH 4OT1L 5DMIH 2HRPH 1UWGL 5DMYA 3RDTB 1A7PL 1F4XH 3LKQB 4OCXH 4L3EA 2HFEA 4QNPE 1QNZH 1CE1L 1GZQB 4GRWE 5C0BB 4I3GA 3QI9B 2ZJSH 2G2RA 1YC8A 1EHAA 4M1CD 4MX7A 3A67L 4RX4A 2JF1A 3BUYA 5HYSA 2IBZY 3ABZA 3O4LE 1JYWA 3SE8H 3U1SH 5L2KD 3TIEA 3WIHL 1MCQA 5A2IH 4XC3L 3FQUB 3C08H 4FXLA 4X6CA 4GAGH 4NWTL 4L5FH 4L3EE 4M7JH 4MA8L 3UO1H 4CVWA 1JZ6A 3VWJB 4FABH 3DVNB 1FORH 4RMQA 1X5LA 1A7RL 3VXRA 4RFEB 4B0MM 5LVEA 1OTUC 1LK3L 4A2MA 4LCWD 1H3TA 1JFQL 2EDBA 3QUYA 4M93C 5E00B 1W0VA 3MLYH 2Z0BA 4ZFOB 1KCRH 5ESAB 4XP5H 3KPQB 5CP7B 3UJTH 2D7QA 1QSVA 1ZT7B 1LVEA 4XI5D 4LFHD 2OTWA 3V6OC 4FFWC 4TSCL 1JCKA 5D2LF 4PJBE 3TBSA 3X13B 4RGMB 2HRLA 2F74A 1M7IB 3CDFA 5F1SA 5AYUL 3TBTB 5C6TL 2AJZA 4JO4L 3AVEA 2P5WB 3MROB 2UYLA 4PRBB 3G5XA 1I3GH 1MY7A 3T0EB 2OJZL 1BX2A 4QYOA 1A47A 4IIQB 4YXKL 3VE0A 4Y4HB 1KGCD 2LFGA 4JFDB 4DKDC 1L9MA 1KENH 1B4RA 1BFSA 3KAAA 2HLAA 1ADQH 1S7WA 1BM3L 4N0FB 1UYWH 3VXUB 2XNAA 5D6CB 5DMGD 3EJYC 1XIWA 2FJFB 1EGJH 1OF2B 1CLOH 5IUSA 3SKOB 4Z7VE 1JNLH 4C56A 5HGBA 3HKFA 3V95A 1OVZA 1F3RB 5IW3A 4OIBA 2X05A 4P9ML 4NQCA 3UTQA 4U7MA 1GIGH 2ZP0T 1QSEA 2X6MA 2Y07H 1L0QA 2X70A 4TNWK 2APTA 4Z5RB 2F15A 1WTGT 3QFJB 5ALBL 5EOCL 1IGMH 4WWKA 4MNHB 3SBWA 4W6XB 4S1QL 3PE9A 3NGBC 3VGAB 3S7GA 5FK9B 2DI8A 1JV5A 3B9KD 4WHYG 5J1AB 4AT6A 4I4WB 2YPLE 1PBYA 2DQFB 4ZQKB 5EO0B 1XGUB 5GGUB 4Q7DA 3I6KA 4RGNE 3RL2A 2CUHA 2CRIA 4CADB 2ZSWB 1X5HA 4JVPA 3P4LA 3ZKQD 1DQQA 4NO0B 4LQFL 5B39A 1DE4B 3DX8B 5B3JF 5DLMH 4BQ6A 2VXVH 2VUYA 5D9SB 2CLZB 1S7SA 3OSKA 1KV3A 1L9NA 4G42A 4WFGE 1JTPA 4UIMB 5DRZA 1DQDL 1JI1A 5GHWL 3UTZB 2O5XL 3D85D 3N0PB 1UFUA 4U31A 5F3HB 3S6CA 3ARWA 2XZQH 4U7KA 1FFNA 1IBGL 5I8OH 5IR1A 1INQA 4FFVC 5HYQB 3GSUA 1MCBA 2HN7B 5D1QA 1IT9H 5C0NC 4PJGE 4F37F 3IDMA 3OXRB 1SHMA 1MCSA 3SE4A 2GUOA 4DN4L 4ZPTB 5F71A 1RURH 1H3UA 1GC1H 4CGTA 4PJAB 1TQBC 1AQDA 3OJDA 3C5ZC 3MUGB 3OZ9H 5JIIA 5JXEC 1C5DA 4I3SH 4WI4A 3P4NA 4ZUTB 4Z7UF 3DBXB 3MRIA 1MQKL 1NAMH 4PJ7A 1IAMA 4MS8D 1EAPB 5F1IA 4NT6A 3Q6FB 4F9LA 2DIBA 5IMMA 1GZPB 5FYLH 1KPUA 2AJVL 3K4AA 5JW3L 5GSRB 5IMKB 1D9KA 2FH6A 5C2BL 5MEOB 3P9LB 4NO2A 1CGYA 3VFTB 4NKIL 4JN1H 1QG3A 3UPRB 3P11L 4MQ7A 5DHYB 5IB5A 3NCEB 2O93L 3S97C 4XZUA 3WNPA 4EUPG 2LU7A 2XACC 1KPRB 3L3DA 4PGCB 4QY8A 3WS6C 2CMRH 4B41A 2NY5H 4APQB 5B8CB 1CFVH 1QOKA 4XTRD 4YHML 4YR6A 1BQLH 2YUXA 1H8OA 1RK0A 3LAFA 3HUJA 4YHKL 3PWPD 4ELKB 1S9YB 5KVFL 1ZA3B 4Y5YA 3H42L 1CK0L 4FFYL 2FGZA 1SYVA 2VLRA 1R3JB 2JELH 3VFNA 5D7IE 3HMWL 4JRWA 4HBQA 3D5OF 3UTTA 3TJEL 2BSSB 2OP4H 5I1HL 2G9HB 4Y0GA 4YLQT 4JZJC 3STZA 3LQAH 5DS8A 3MNWB 1R6VA 4AEIL 3UPCA 4RWYL 5SV4A 1I8MA 2D31B 4U3HA 5ADPL 3N9GL 2FB4H 3PP4L 1ZVSB 1HINL 4ODSL 1YECH 2DYPA 2VLRE 2EEDA 2NY2B 2E7LA 5IFAH 4UBDC 1Y6NR 2W59A 4JHBA 4YX2L 4KPHL 3UTTE 3JWOC 4GRWH 1K6QL 1KIRB 3IJHB 1OAZL 4M1GL 3H9YA 2LABA 4N0YH 3UEZA 4XBGA 5TFSL 2ERJC 3QWOB 5IJKC 5K9JL 1OAYH 3IETA 5HHOA 1KCUL 3VI3E 2EICA 2YOCA 4GKOA 5DUBB 2CO7B 3EOTL 3BQUA 5IHZB 4WV1A 4HFWA 4ZOEA 4Z7OE 2DQTH 2LVEA 4J23A 5C0CA 4LDLB 3BEWA 5IEHA 4PJXE 5IWLA 3V4VL 2GEEA 4N90E 3DTXB 1ZHLA 3G6DH 3Q3GB 3SDCD 4AL8H 3IRPX 2HWZH 1YEFH 3C2AH 3WCYA 3IXAA 2J3SA 5EWIL 3BO8B 4QRTA 3MLRH 1HHGB 2BMKA 3UYPA 3HNVH 5ILTL 3QEGH 4PP1D 3HA0A 3HPJB 1A9EA 2FECI 3MACH 4KQ4L 2HFTA 4XT1C 2M26A 1KTLB 5F7MC 3UYOD 2GCYB 5GXBB 5C0CE 2YWZA 1LEIA 3ARFC 3TO4B 4EN3A 1SY6L 5I16A 4OFIA 4GQ9H 2JJSC 1BJ8A 5I75C 1PY9A 1U8LA 4GBXD 4GRLC 1CDHA 4LLWA 1ZS8A 5F7NC 3RVUC 3HG1D 5BV7C 2DKUA 4M7LL 5JMOC 4FZ8H 3WD5H 4MVBC 1F45A 4DKFH 1JK8A 1I4FB 5JOPD 4H8WC 4ZG1A 5MEQB 3CX2A 4XPGH 4WI2A 1U58B 2ADFH 3GMQA 1EUUA 4LPYA 1MJJB 2QV2A 3LKPA 4KDTC 3AAZB 3NPSC 3VH8B 3JTSB 1MWAL 2IADA 43C9B 5JPNA 1NQBA 3L95B 4YE4H 5I1LA 1AGEB 4QRUB 4XHQA 5EU6E 4O2CA 5TPWL 1J0HA 5HBBA 5CILL 2CLRA 3O6FA 2EC8A 2AQ1A 1IAKB 1LO0H 1WIPA 2CO6B 1EMTH 2R29H 1QLEH 4XWGH 4PJFA 4LLYA 4F7PA 1ADQL 4Z6AT 4YDVB 3RZCA 1UWEH 4ODUA 1OGAA 3FO9B 2GI7A 2VDLH 2F58L 4M1CC 4U1SA 3MPCA 1IAOA 3HRZA 4LKCB 4OZGF 3QIBB 2CR6A 1KFAL 4YBLC 1PDKA 1N0LA 1YYML 3F5WB 2ZSVB 5FGRA 1MAJA 1A7NL 3QEQB 1MFBH 4DOHB 4LNRA 4KMTH 1NGYA 1NCCL 4PJFE 3X11B 4LSSH 1RJZB 1UJ3C 5EA0L 1UH4A 5EZJB 2ICWJ 4XXDA 1JPSH 2FIRT 4BQBA 1Z3GL 1J86A 1WAAA 3DX7A 3MLWH 2F8OA 4JRYD 2OK0H 3S35H 2AV1B 1XF4B 3NTCL 4NNXB 4QTIH 1U9KA 1WCBB 1VCAA 1FC2D 2XG5A 3DYOA 4DGIL 3CLFL 4JO1L 1T3FB 2F53E 3U30C 5EN2A 1U8IA 1S9XA 1CLCA 1FGNL 3KPLB 3EO0B 4DKEL 2B1HL 4XI5C 4CVXB 1U8KB 2VDKL 2YMXL 1PQZA 4FNLL 1NFDF 4PRAB 2IPKA 1KYOJ 5J6HA 3U83A 3IDNA 4LSRL 4KZDL 4OD2B 2G60H 5E2UH 1LE5B 3GMPB 3MBXH 4PB9L 3U46B 2QSCL 2JJTA 3ILQD 5DVKA 2AJSH 1P4LB 4QOKA 3C6LB 4KHXL 3IT8D 3QBTB 3FT3A 1RZJC 5A2FA 2NY6D 4Q9BA 2W0KA 4TSBL 5T3XE 4DZ8B 5TE6L 5KVEL 4P2CG 3BYYA 4W4NA 1BFTA 2G5BB 3VFSB 1AGBB 4RBPH 4DVRH 1LP9F 3MRDA 1LO5A 1RU9L 5DMGC 1FVEB 1BD2B 4Y19B 1TNNA 1TVDA 4OKVB 5DJZA 1ETZB 3OF6D 4NC1C 3VXMB 1NAML 1U3ZA 1WBXA 1MCWW 1HCFX 3L6FB 5DD6A 3L5IA 4XP1L 3HZVA 4Y5XC 5C0EA 1IL1B 1J05A 3LN5B 4NFCA 5BS0A 1CFTA 2Q3AA 4NZTH 1FFRA 3G9AB 3B9KC 4WNQA 4A2LA 1S7QA 2MKWA 4XNQA 1XGPA 1K8DA 1XF3B 4PGDA 1HHHA 3OAUH 3IDIA 3O41A 4FS0A 4JKPH 5I1AA 4RMWA 2DL9A 1YNLL 1KN4H 3EO9H 5DF0A 5D7LD 5GJTH 3L9RB 4QRRD 4OF8A 4LL9A 4WW2A 1TZIB 4GG8B 4X4YB 3UTPD 3OHXA 5J3HC 3RVTD 2R1WB 3IAQA 4HH8A 5L88L 1F8TH 3GNML 4XPBL 4LPVA 1EX0A 4EXKA 3PGFL 4NUJA 5FYKD 3TVMB 3EDEA 2EE6A 2GY7B 3IDGB 4PJDB 4E5XA 1FO0L 4LVNC 4AEEA 4NZDA 1RZKL 4HS8H 1MVUB 4U1KB 4MYWB 5J4MA 1BJ1J 4P46B 2QQLL 3U7AA 2ESVD 1S7VA 4PRIB 1P7HL 1MH5A 5E99H 1UM5L 2FBOJ 5I1KH 5KVDH 2YPKA 5E6ZA 3MRJA 3LDBB 1JMXA 4QO1A 3S5LA 1TQBB 1AIFA 5DJXB 3BHBA 5BOPA 2ADGA 2ZNXA 5DMJB 2NY4B 4OGAC 3QRGH 4XNYL 1XCTA 2HJFB 3T3ME 4BQCA 1JL8A 3HZKB 4BFGA 1FVCA 3RU8L 5I66A 4XCCH 2BK8A 2ZG3A 4PRHB 4IRJD 2UWEB 4OZFA 3QUXD 5HHQB 4EI5C 5D70L 5GRVL 5FAAA 3GJEB 3CFBB 2IPUK 5I1EH 4Z78B 3BAEL 1YMHA 4PJHA 1QFHA 2BNQD 1Q8MA 3TA3B 5CKGA 3EOBA 4M43H 5AAMA 4JZOB 3HNTH 3KPSD 4CJ0A 3GDBA 1QYGH 1GAFH 5EO9A 5TE4L 2DTSA 4AIOA 4LVEA 1CDUA 4KTDH 5F1NA 4HGWA 4NNYB 4HXAH 3GHBH 1IGFH 4JM2A 1YEFL 2XN9E 3C2AL 4LKXA 5EFIB 3PL6D 4NN5C 5SWZD 1K4CB 3TESA 1BOGA 4M3JA 3QQ9D 4K3DL 4LCCA 4RIRA 3DHJA 3MCKA 5ENWA 3OXSA 5J9PA 4KKLD 2VTFA 5MEPA 1FIEA 3RUGB 4GW1A 5HYJA 3C87A 3RJDA 1RUKH 4DVBA 3KXFA 4YHYB 5F9OH 1R24B 4FTVB 2R0WH 4FXGB 5E2TL 2P48B 3TNMB 4FA8A 2AVGA 2IQAB 4Q2ZB 3MRLA 4X5XA 3FB5B 25C8L 5GIRB 5GGTH 3MCLH 5D7JC 2HTKC 4KVNL 4I1NB 4JCLA 5FCUH 5A40E 3CU7A 3W5MA 2HG5B 3FMGH 4FZ8L 5CUSL 5HYJE 4KK5C 4X5WA 4EZMA 1H0DA 1ACYH 3C5SB 2V7HA 3QYCA 4H88L 5DUPH 4NO5B 5JLZB 4J4PA 3SDAA 2DQDL 3LB6D 4MD4A 2Z93A 5DGRA 1CLYH 4AEHH 1JYVA 3UZEA 3QJFA 2Y36H 5HDQH 1PKQB 4YFLF 4X6BA 1N8ZA 1Q94B 5EUKA 4L8DB 3W0WE 1FAIH 2IH3A 5E4EB 5INCB 2CXGA 4MLIA 3WXVL 2FL5B 4N5UA 4OZHE 3QDAA 5F6IC 5DT1L 1I1CA 2YEZA 4NQUA 3QZWG 5A2KH 3E2HB 1LO0L 3SDCC 5C08D 4JFEE 4JFZL 1QSFA 1S8DA 2AEIT 3MXVH 4NOFA 3RY5A 1KJMB 1T2QL 3PDOB 1UWEL 4R4ND 4G6MH 4MJID 3OPZH 2OSLB 2HT3D 3WUWB 2H41A 2ARJA 5D1XC 5FYJU 3WNNA 2RBLA 3P4MB 4KKBD 5DRWB 3LSOA 3K1KC 2GITB 4Q6IA 1MRDL 1U8HB 4UILH 3QSKB 2BNRA 4BZYA 4G8EA 3DRTB 12E8L 1RZ8B 4ZO6A 3WEXA 5JHDE 1YQ2A 4RISL 3H9SB 1IEAA 5EUOA 3U9UA 1MHHB 1QSFE 3ET9F 3UDWA 3VMNA 3FRPA 3H7LA 4KTEH 4GRMA 5CZVH 5T33H 3RNKB 3ROLA 5JPMB 1VADA 5ID1B 1TFHA 5H94B 5GGRB 2A74B 5ISZA 1B4JH 2EZ0D 5BZDB 2R1XA 5ACMA 5E7FA 2MFNA 1LO4L 5MI0C 2BDNL 4GRLB 4BZ2H 5T3XH 2DBLH 1TJHL 1NC4A 2O5ZL 2HJKA 3BGAA 5EUOE 5KSUB 1C16B 5EZLB 3FQNB 3SKJH 3NFNB 4YIQB 3VH8G 3B6SA 4L29B 3FKUS 1RJLB 3K74B 4KAQL 1G9MC 5GRZA 1UZ6E 3OMZA 4D9QE 2XZAH 4HF5L 1AC6A 3TYFA 1NLDH 3QCTL 5FF6B 2AEQH 3BZFB 3CZJA 1BVKA 4ONHA 4B53A 3VDCA 3VFRB 1J0JA 3K7UA 3NPSB 4Z95H 4NBYB 1OSZB 5CP3A 2XTJC 3RHWK 1GH7A 3LKQA 1Q9OA 1U8QB 2NXYD 2VITA 4F8TA 3QHFL 1SY6A 5C0BA 4ODVH 4K3JH 1KCKA 2DAVA 2AABH 5T5NF 2HKFL 1CLZH 1MFAL 4M5ZH 4HH9B 1H5BC 4QF1B 4HUMB 3LRSA 4PJIB 5EOTB 1QR4A 2GJZB 5CD3A 4IOSD 1P5VA 1J1XL 3UC0L 1CGVA 3VWJA 5I1JL 4PD4J 3H7BB 3DVNA 5FA4A 5C0BE 2P1YA 1G6VK 4YK4C 4YBLB 4ORGB 5L2KB 1CTOA 1J11A 5DJ0B 1CDGA 3NIDE 1V7NH 5DD0L 3GSVB 3U4AA 3VFVA 2NNAB 2FECL 5LXGH 3H9ZA 5I1IH 2EH7L 3L3IB 5ESAA 5C07D 1YEEH 4GG6B 3HI6L 3KPQA 2VLJD 5CP7A 4OI9A 1VPOH 1P5UA 3IVKB 4HJ0C 1MFDH 1OD9A 2FJHA 1NCNA 4LCWB 4PB0H 4ZS6D 3X13A 2B8OT 2R56L 4L8CA 1M7IA 1MCDA 3SE9H 2YKLL 5KVGH 1I3RB 1BHGA 4AMKH 3MROA 3EJJX 4PRBA 4W6WB 3DX6A 4IIQA 4HWEH 2QADC 1N59A 3QAZC 4JFDA 3ZYIA 5ESVB 1QBML 3GKWH 3K3QA 3ILQC 2JTDA 1IARB 4DCQB 3MOQA 4N0FA 3VXUA 4IMKC 2NY6C 3R06A 3WFDL 4H0GA 2F5AH 2ZUXA 3KPPB 2FJFA 2ORBH 1CE6A 5FUZL 1TITA 2E9JA 3BESR 3MLTB 2P5WE 1INDL 1FQ9C 3T0EE 3MV7A 1JWSB 5C3TA 2BVPB 3DJ9A 4JFDE 3RA7H 3O45B 2VDNH 4OZFH 5KSAB 4NC0B 4HLZG 2FEDC 4Z5RA 2X1WL 3VG0L 4JB9L 3UJIH 2EDXA 1EERB 3BOVA 4DGVH 3VXUE 5FK9A 5CCKH 3V5KB 3QUML 2BSTB 5J1AA 2IWGA 2OTPA 3P9WB 1MCJA 4WO4A 3CFJA 5EO1A 3B5TA 4WU5A 1OP5H 1W0YT 1IGIL 5JUEH 2ZUTA 3U4BH 4NZJA 3D6GA 3LEYH 1AFVH 4CADA 1NL0H 2WBKA 4M02A 1DE4A 4YPJA 3O6LL 3MREA 2H2SD 3QFJE 3C60D 1A0QH 4XVTH 1AO7A 5D7SL 2V5YA 5HVGB 1HDMA 3P9MB 1VDGA 1ZA6A 3TCLB 5C0JB 3MV9D 4UIMA 4XGZB 3GRWL 4GMSH 3UTZA 4O5LL 5F9JA 3SDXF 1N2RA 4UTAH 5GS0H 1KJ2B 3WL9A 3V6ZB 1URLA 5HYQA 1U36A 3SN6N 3G04A 4QT5B 4U05A 1YN7B 2VDOL 2V5SA 4LGRB 1S7TA 3VXTB 1NDGB 2X44D 4PJAA 1HKLL 2NLJB 3K8LA 2GT9A 4HDIB 5CJOL 2AP2A 4JDVB 3L7FB 2YBRB 4OGZA 3DBXA 1RUPL 1I7TB 2XWTB 1NEZB 4XC1L 1EUTA 3QQ3B 1KTKE 3KPNA 1JI2A 1GZPA 4I18C 3DROA 4L8SC 2IQ9H 2X10A 4YDKL 3VFUB 2W38A 4MCZB 5I73C 4PJAE 4JQIL 3O6KL 1P7QA 1PJ9A 5J11C 3LY6A 3TC9A 2Q86B 1WICA 2A77H 3HE7D 3VFTA 1J8HD 2E3VA 2ENYA 3IJYB 3UPRA 2J8UF 4IRJC 3GI9L 3MA7B 3QUXC 3V5DA 4MJ2A 4XMPH 4E0RA 1KPRA 1U41A 4HKXB 4UB0L 2VLMD 3LKOA 3U9PH 2IBZX 4ZAKD 4JVUA 4NRZA 3BPLB 3JWNC 4APQA 1CGSL 1FCGA 1BQUA 1FO0A 2YUVA 1VFAB 4ELKA 1S9YA 5DTFA 3TO2B 5C6WH 1ZA3A 2X4OA 1U0QA 2W60A 5KZCD 4XPFL 5IJVB 5DC4B 3BSZL 3PL6C 1C5BH 1U6AL 4AM0A 3K2UH 3QQ9C 2ARWA 2XPGB 1SM3L 4KKLC 4HAGA 2G9HA 3TWCH 1IKNA 3PWPB 4UT9H 4M6OH 3BDXA 3RVWD 3V8OA 4Y1AA 2XZCH 4CU8A 3Q1SL 2CH8A 3MNWA 3ZT6A 3TFKD 4MAYA 1JZ4A 1KG0B 3BH9B 1GCFA 1ACZA 4KFZC 1CDCA 5FKAA 4K9EL 4GMTL 1ZVSA 3EYUL 3B2UC 1IGYB 4ZTPL 4OFKA 5D6DC 5D1ZD 3K4ZA 3TBYB 1E4WH 2MHAA 4PREB 3TT1L 3KYNA 4G6JH 4Q9QL 3HFML 2A2QT 3O3DA 5CJ5A 5DQJB 5FDYA 4Z7WA 3MLUH 1JNNH 3T2QA 4K3HA 3ECBB 4JLRA 3ULVL 4J6RH 5HGHA 3LB6C 4FQIL 3T77A 2KUTA 4WEBH 5E0QA 3F65A 1QACA 3LEXB 5DUBA 1G6RL 1W72L 4PJEF 4PS4L 2UY7A 4NDMB 4XP9H 2YN3A 4TVPD 4R90L 3HNSH 4XXCC 3RVXC 3H9HB 4DUXA 4DUWA 1DFBL 2J5LC 1Q9LB 3JV6A 4O2EB 3OL2A 1EFQA 3GMNB 2XWJB 5IV2A 4Q9RL 4WCYH 1IC1A 1UCBH 1U91B 5EULV 2VXUL 3IYLW 2WAHA 1YY8B 2Y5TB 2L4OA 1O7SA 3QUZD 3HPJA 1WTLA 1KTLA 5FHBH 2DICA 2GCYA 5CEZE 3SDCB 2AQ3A 3S88H 4KKBC 1OQXA 4JHAL 4LLMA 3G5YB 1JPGA 3TO4A 4CMHB 5IQ7L 3VGEA 3EFDH 2D9QB 1F6LL 3GJFB 5BVJA