4QHNA

I2 (unbound) from ch103 lineage
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
222
structure length
222
Chain Sequence
VQLQESGPGVVKSSETLSLTCTVSGGSMGGTYWSWLRLSPGKGLEWIGYIFHTGHTNYNPSLEGRVSISVDTSEDQFSLRLRSVTAADTAVYFCASLPRGQLVNAYFRNWGRGTLVSVTAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Affinity maturation in an HIV broadly neutralizing B-cell lineage through reorientation of variable domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords I2 heavy chain
total genus 31
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2014-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhnA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhnA01
5E7BA 4ZFZB 4WV1A 4JO4H 3MCLL 4G8IB 3DMMC 4X80H 2FNBA 4DK3A 1BJ1J 3O6LL 4M8QB 2ADJB 5IB1B 4D8PB 1MIMH 4QRRB 4PGEB 4XAKD 1GIGL 3EHBC 1I1YA 2YWZA 3WN5A 4EN3B 5ID1A 5E8EA 3RHWF 5GGRB 4WV1B 4Z78A 3OKNB 4XC1H 1ZAGA 3WKNA 4Y2DD 3ZKMD 3LS4H 3P4OA 5TDOA 1SY6A 1U8IB 3L3GA 1DLFH 1KTLA 2BFVH 1AGBB 5TH2B 2X4QA 1BBJB 4NNPL 4G9FE 3MRPB 2HFGL 3IKCA 3GSWA 3FB7A 5IEKA 1W8NA 3EFFA 1QFUH 2YK1L 3QPXL 4OF5A 4OLYL 4TSCH 4GBXB 4PP1C 5JHDA 1DQML 1CE6B 3NPZB 4D0BB 3UP1A 2R2EA 3QEQB 1XF4B 2NY2D 2MFNA 3RP1A 4BSWA 3T2QA 4U2ZA 2ORBL 5E0QA 5SWSB 1ULVA 1AGBA 3LB6C 2UZIL 3HFML 5FYKE 4GXVH 4OJFH 1II4E 3GSWB 5EB9A 1FYTD 4R8WH 2BDNL 3GSNH 4WWKB 4GAJL 1BREA 1HXMA 4XBGB 2F54E 5T1DL 4ZUSB 1A4JB 3SCMA 5FYKH 1HKLH 5I30L 4X98A 4DKFH 2PXYD 3MRFB 4LDEB 5CJOH 1QLEL 4XMKH 4OB5L 4JANA 1BJMA 3AREC 4YXHH 1BPVA 4IRSA 4OZFA 1KPRB 3O3BB 4OD3L 2NY1C 2Y72A 3VXOB 4M7LH 1ACYH 3U7WL 1YEJL 5I18L 4D0DB 1EEQA 1KEML 1Z6JT 2MQ3A 3D39A 1DBAH 4FQQB 5HYFA 1KIUA 1ZS8A 1L7IL 1MOEA 2EIDA 1FL3B 1T7ZA 3MTRA 3PHQB 3MJ9L 4MD4B 5E6IA 5IMLB 4R2GD 3QCVH 1AQKH 2XNAB 1A6ZA 2R4RH 3VFVA 1TETL 4Q2ZB 2GEEA 3FFCA 2X09A 3BXNA 4JQXC 5C0DA 1W72H 4RGMB 3LKQA 4ZODA 1DQDH 2GSGA 1XF2B 1QR1A 4Y5VB 5DK2B 5HDQL 1G6RL 1IGCL 4FQQA 5BZWB 1ZSDB 2NY5C 1MCBA 4G43B 1INEL 2HWZL 3NAAL 3OG6B 1UXSB 5MERB 1F00I 2EICA 4U7MA 1MIEH 3TH3T 1DE4B 3BE1H 2VN7A 2DWDB 3D25B 5D7LD 3LQMA 3GMNB 5D7JA 3H3PH 1SJXA 5I74B 1QVOA 4EXPX 2CKBL 3SN6N 3QDMA 5ADOH 3IB4A 1DUYB 3PWLA 1J1XH 1BAFH 1TITA 4RFOH 1HH6B 3ROLB 4F37F 3RDTD 4N1EA 5HYSA 1SY6H 1H5BC 5DHYB 2FL5B 1OTSC 4Z7NE 1AXTL 2QQKL 3ESUF 1WJ3A 3UTTB 5LKNA 4YNYA 1WAAE 4F15B 5IIEB 2PN5A 3VCLB 5HGDA 1YY9C 2OR9L 3QDMD 5TDNB 1CG9B 3QNZA 4G6MH 1FNLA 1LVEA 5FB8A 3BIKA 2EO1A 3ZT6A 1DQLL 1UJ3A 3N1MC 1KENH 4GG6E 1KCVH 1FORL 2X9YA 3GBNH 1CTNA 4HLZH 5F7EL 4RGOL 1MFDL 3EDEA 3O3EA 4JHBA 1C8PA 4H1LH 3MCG1 5EBLB 1OSZB 4U3CA 4XVTH 2NY0C 1HHHB 5DHVA 2NW2A 3AMLA 4MQTB 3FQRB 4BFGA 2ICWI 5EU3B 3VXUA 1F6AA 1R5WA 4NM4L 1S7SB 2HVKB 3TYFB 3RNQB 4KVNL 2MTPA 1JTPA 2DBLL 4UOJA 3QAZC 3GJFA 4G7VH 4BQ8A 3AAZB 1WIOA 3BJ91 3HUJF 4G9FA 1MH5A 2FX9L 2XT1B 4XPAH 3SY0A 4S1DC 5FM5O 5MP6H 3MUHL 1C5CH 4HMEA 4RMRA 3VXPB 5SX5K 4OLVL 3MQIA 5EU3A 3VXUB 4D3CH 1JN6B 1BD2D 5FHAH 2F53E 4QOKD 3TYFA 1OAQH 1VKXA 4LGSB 4GXUM 2JCCE 3GFUA 3DJ9A 4IOSD 3MV01 1F8TH 1RU9L 2BY0A 4WI2A 2ZUYA 2C4FT 3GBML 5ITFB 3B5GA 3JWOC 3BPOB 1NGXA 4ISVA 3SBWC 5JQHC 3U9PL 2HLFC 1E4JA 3MV9A 4WTWA 2CGRL 1OF2B 1IAIM 3EAKA 2VLKE 2JKXA 3BYTA 1S7RB 1V7ML 1VESA 3CZFA 4ODTL 4BUGA 1NBZA 5GGQH 2V2WA 3FZUC 2Z91B 1AGFA 4OLZL 5I18H 4Q9QL 1UA6H 2QQLH 4G80B 3VFGL 4MD5B 5E9DD 3S7GA 2ESVA 2FR4A 5DRXB 4J3VA 2ZNWA 4F7EA 3LKPA 4PLJD 4EBQH 1U91A 1TJIH 4ETQB 4HWZB 1RURH 4ZFFA 2AKRA 2FHCA 3P11L 3E6FA 4ZO9A 4M1DH 4V1DA 4FQXD 1V3LA 1NCNA 2V2WB 1MREH 2XWJA 1UEYA 2D7TH 2P43B 4G7YL 3LKSA 3F7VA 3KPMA 4DEPB 4NBZB 2XY2A 3BKYL 4L4TA 5DMYA 4Q0XH 1KPUA 1D9KD 4DGIH 1A3QA 4JFFE 5HVWA 4KZDL 5ANMB 5LQBL 4MNGB 2XKNA 4M62L 3IFOA 4HD9A 4FQXA 4LEOB 3RBSA 4BKLB 3HC3H 3RU8H 3ILPB 4OGYL 5BS0E 1W0VA 1IJ9A 1GGBH 5F97E 1RJLA 1S78D 3NCFB 2DLIA 1XGTB 4J3UA 4C83A 3JWOH 3RGVB 4WCYH 3IFNH 1KPUB 4CADA 4L3EE 1YYML 5I0DA 2LAAA 5CIPH 1RJYB 2VMFA 4GJTB 3LDBB 3KXFE 2VITB 3OR6A 5AZEH 5KZCB 4MAYA 2QJDA 4JPWH 1EHLL 4MXQD 3PWJA 5KS9A 1NCBH 1T2JA 3H6JA 1OP9A 5E8NB 5IMOB 3PJSA 4OUUA 4F2MA 1FORH 1F97A 1HSBB 4NJAL 2WP3T 4LLMB 3PABA 5F7EH 2IANA 4U31A 4WHYH 1LE9B 2EDNA 2CLVB 1FVCA 1BECA 1F4WH 5I1JH 4WWKD 4MDJB 4KI5E 1T04B 3U0WL 1DTUA 1E6JH 5TQ2H 4JVWA 4NHCH 3U4BL 1BD2A 1UH3A 4KY1L 5JZ7D 2Q8AH 1JZ7A 5D1QB 1WQVT 3NACH 5C9KA 3MJ7B 2VH5L 4Q6IA 4FFYH 3DETD 1A02N 4JFEA 5GGTH 4YPGA 4M7LL 3P73A 4A2MA 2AK1H 1M7IA 2FEDC 5GRUL 2NY4B 5GRWA 1RI8A 4LARH 5BO1L 3HZVB 5I8OH 1MCQA 2EXWC 4UTAL 2N4IA 4LCIH 3KPLA 3KYAA 4L3CA 5DVLA 3N85H 2Q7YA 3PWPB 1ZANL 4OM1L 5I71C 1TPXC 4LKXA 4RA3A 1FL6B 1HHJB 3C08H 5HYQB 2FB4H 4NRZB 2XTJE 1PYWA 3H7BB 4P46D 5HI5C 1MAMH 3V6OA 3O3UN 5HHXH 2C1OB 2GFBA 4H88H 3S5LB 4JO4L 4TSBH 5ALCH 5HHMB 3DOSA 4FRWA 3PDDA 1AO7D 1WC7A 1CLYL 4Q9QH 2R0ZH 1XAUA 1KPVA 1JGVH 3H9ZA 5IB1A 1T7XA 3MJ8B 5I9QC 3B9KA 4G5ZH 3PL6C 4XP6H 2OI9B 1H5BA 1ZVHA 1P6FA 4XHQA 4Y8DC 3UEZA 4BH8B 4JHWH 4F80A 3VMPA 1UKSA 4RFOL 4OF6A 1IEAB 5EN2A 5IEHA 1Q9LA 3VXTB 3GGWA 3KPRA 4JG0H 2NY6D 3PV7A 4OGAC 2X4NB 3T1FA 4Z7WE 3D1MC 2NZ9D 3K4DA 5DI8A 1KPVB 1U8QB 1N59B 2UVEA 1EBAA 1KJVB 5ALBL 5CD3B 5EORL 1AY1L 2EDWA 3AY4C 1BP3B 3KYMB 3NA9L 4RNRA 1TCRA 3ZL4L 2PTVA 3L3JA 3VRIB 1A1OB 4TULL 4RGOH 1CE6A 2R0WL 2JB5H 4X7EC 3NFPB 1VPOL 1YC8A 1B88A 2ORBH 1VDGA 3GSQB 3RVVC 4BSWB 1S7WA 1Q1JH 3F6IA 5DI8B 4ETYA 3RIAF 1LP9A 4JZJB 2G75A 3Q6GH 5I1EH 3JWOL 4PJ8B 3GNML 4N8CH 3EJZC 2E9IA 4GH7B 4H8WC 3T0EC 4TQEL 5DLML 1WCBA 3Q1SL 2P5EE 3FJTA 2B1HL 4WO4C 3BRDA 1RZ7H 3KYKL 3IETA 4ZUSA 3SE9H 2E7LA 1V7NL 2Y36L 5IB2A 4GW5B 3VFRB 5HVFB 1NMCC 5DJ6A 1R0AL 3TVMD 3W11D 1N4XH 2G75B 5DT1L 3QO0B 4Q9BA 4QTHA 1JFQL 1J87A 4EI6B 4WI3A 4A6YB 2HT4D 4WUUD 1X5GA 3L5WA 3I3DA 2YBRB 4TTDD 3K46A 4O2CB 2IQ9H 4YZFE 4D0DA 2D7QA 3FN0H 2J4WH 2VDPH 3QDJB 3TN0B 1QFWL 2X5PA 2C7UA 1VGEH 4GW5A 3ULVD 3QUXB 4WGWB 3CIQA 1YEKH 2RB8A 3DX7B 3A67L 2ITDB 4X9FA 3L5XH 2B20A 1G7HB 2VXVH 3O4LA 4ORZC 1EEYA 5I6XC 1L0YA 3QWOA 1DQJA 3WIHA 5I1KL 3ZE1E 3BO8B 5C2UB 1YY8B 1LNUB 4X4XA 4ZOEA 5AZ2L 3QUXA 3BPLC 3LD8C 3ZO0A 3LIZL 5F9OH 4XCEA 2YN3A 5LBSH 3VWJC 3LEXA 4YHOH 2E27L 7CGTA 1IE5A 1MCRA 3QEQE 2AGJH 3OKMB 1D5MB 4NRYA 1DZBA 4JN1H 3GMOB 4WW2F 1EEYB 2NXYC 4L8BB 4OI7A 2VLRB 5IFAH 4LPVA 3EDFA 1NDGA 2WWKO 3OHXB 2YN5A 3C8DA 4XRCA 5CIPA 3DRTA 4XNXL 1G7JA 2WSKA 2P45B 2MMXA 1UQSB 3AS1A 2VC2L 1F13A 5I8CB 1NC2B 3LDBC 4DJMA 4H0HB 1TTUA 4NZJA 4JKMA 5T33L 3E3QC 2E7MA 3ISWA 1SYSB 1EUUA 1FPTL 5DEZA 1FH5H 4RBPK 5FB8B 4JPKH 2UWEB 4KK9D 5ABDE 1D5ZB 1ORSB 3O0RH 2H32H 4LKCB 2JJSA 3BWUC 5I8KL 2FX7H 1JV5B 3O3EB 3DRTB 1H3GA 2Y5EA 3DX9A 3ZYZA 3ES6B 3MLUH 3OGOE 3WDJA 4WHDA 2IH3A 1FE8L 2DDQH 1U3YA 1ZA3A 5I30H 4NKIH 1OAUL 5IGXH 1JGEA 4P4KD 4G8GD 5KVGH 2MSPA 4GAYA 5IVXA 1HH9A 2EYTA 4OM0H 1P4BL 2C26A 2PYFB 1FRGH 3U7YL 1QRNB 3WFHA 4HG4J 3MRMB 2PETA 4R4FL 3NIFE 1N6UA 3MOBL 4PBWD 1NGZA 3QUZA 2CLRA 3L5IA 3BQUD 1X5AA 5C09B 3MUY1 1DBBL 2DN7A 3WO3B 3SHSA 2ZWLT 2ZCKL 3V5DA 3U83A 2VIRB 3H9HA 1PSKH 3QCTH 3SJVD 5E56A 2IPUG 4GAYB 2APVA 4PJ9D 5IWLA 5MENA 4P23C 1U93B 1YC7A 2UYLB 5JORB 2VLLA 1ITCA 2GSIB 2RHEA 5IF0A 4YFLF 1N5YL 1I8LC 2CUHA 5IG7A 4HV8A 2F58H 4PJ7B 4GSDL 3K74B 3WE6B 4M7LT 4UBDD 1OARL 2YSSA 5TQ0L 4DOHB 1WWCA 1LDPL 2K9UA 4K3HA 4UBDC 3P77A 2RBLA 1FVEA 3TZVA 1GAFH 5MENB 1T3FA 4GBXC 3WDHA 4NIKB 2VLLB 4Z0BH 3BAEL 2Z91A 3FN0L 1XZ0A 5FYKU 3DBXA 1IRAY 1LK2B 2D7NA 4QXUL 4LRIA 3PQYE 3IDMA 1QHOA 3B2VL 2Q6WB 4PJ9C 2G5RA 1MCSA 4RMWA 3RWJB 1QSEE 4G6KH 1AGCB 1O0VA 2GUOB 3P11H 3ARWA 4LSQL 2N56A 5IVXF 3WXVL 3W11C 4PJDA 3DX6B 4O5LL 1U9KA 2R29L 3HNSL 2E6QA 5JDJA 3PV6B 1JK8B 1CR9L 4PTTB 3H9SD 5B8CC 4L4TB 3MLRL 4Z7WF 1E27B 3CPLB 4ELMB 3MGOA 5BVJB 5D1ZA 1EO5A 2P7TA 5LBSL 5T3XE 4TUKL 3MCKB 5FGBC 3SKOB 1LO2H 2K3TA 3NFSL 1N64H 4OFPA 4NNYA 4M6AA 3V4PL 2HKHH 2QR0A 4HSQA 1P4LB 4K2UH 4M9OA 4S2SB 4HJ0D 3MV7E 5BXFB 3VGEA 2FGZA 1G6VK 1U6AL 2BOCA 2DF3A 1QHPA 2PO6C 4NFDA 4LMQE 4X9BA 3HI5H 4JHZA 3P0VL 3S34L 3QQ4B 5E2UH 4L3AA 2C4XA 3FN9A 4YDJB 3MUJA 2VITA 4RMQA 5TFSL 5SV4A 3LZFH 4PG2C 1R3JA 3T0EA 4J4PC 5LJYH 5EZIH 1L0QA 1MAJA 4PJ5A 4KXZI 4R90L 5MEPB 4X6BB 1AIFA 1TMCB 3TJHD 4PJGB 2A73B 3SKMB 5FUZL 1L9MA 3TESA 1F4WL 1FV1A 4ALAL 4MNQA 4HWNA 5DLMH 2X4OA 3J7HA 1QPPA 3B9DA 3ARFD 3KYKH 2BXYA 3PQYA 3KVQA 4TTDC 4YHPA 2F15A 3F5WA 5IJKA 2W65B 4TUOA 4DZBB 1DSFH 4K3DL 1SM3L 4Y2DB 2V5TA 2Z8RA 3C2AH 4D0BA 3SPVA 2QEJA 2NY5H 3ALPA 4MQXC 4CU6A 2NR6D 4HHAB 3RUGB 5GHWL 1PGRB 1Q0YH 4MNQB 5MEQB 3FMGL 4KK5C 5HHME 5I1CH 3ZE1F 3VFUA 4JFQA 4WUUB 3MODH 3O45B 3SE4A 1BGXH 4R7DB 1FAKT 1BM3L 4X9HA 4I2XB 5JUEH 1HINH 2DI8A 3MLSH 1DCLA 1HXMB 4JEGB 35C8H 3O6ML 5DHXB 1ZWIB 4N5ED 3SPVB 1UWGL 3TA3A 3HHRB 1K8IA 3KLSA 4NCC1 5K33A 5C6TL 1T7WA 4PRPA 3KDMA 3MLVL 2HFFB 4M6OH 5IHZA 3L5XL 1GZQB 5HYJD 4O2EA 4YBQD 2SEBA 3BUTA 3KPRE 1QRNE 3MV8B 1R3HB 4P3DA 1UACH 4JFDA 2XZQL 4LASL 3X13A 2C1OA 2EDJA 1MRCL 4HUXA 2P24A 3L6FB 3KYOB 3QAZB 3OXSB 2JJSC 3I84A 4D9QE 4NUGH 3JTSB 3GB7A 3QRGH 4KROC 2R23B 1GCFA 2KKQA 1KIPA 5IHZB 4DN3H 2H3NA 1NMBH 3LH2H 4MD4A 3JV6B 3QQ3A 2C1PB 2V5YA 5FYJE 2BVQA 1FBIL 5HHMD 4HIJA 4A2LA 1YPZA 1KGCD 2H32A 4NC1E 4Q2ZA 5INDB 2Y6SD 1TNNA 5LGJA 3WXVH 3SKUD 3PNWB 2COQA 1T1ZA 3KPRB 3V9FA 4UILL 4XNXH 4NUJB 2IH1A 3GB7B 4Y4HC 4E0RB 3CFCH 2R23A 3ZT7A 1I85C 4IRJB 3G6JB 4MZ2A 4P5MA 5DUPL 5AZEL 3RZCB 1H15B 4G43A 3X3GL 3EJZD 4PJFA 5I1GH 3MLRH 3BSZH 4HC1H 1D9KC 3UBXB 5IFJA 1X7QB 1G9ML 3WFEL 2X2YA 3KPNA 4X8JB 2MWCA 4ODSL 4UT9L 3S36X 1ZHNA 5EWIL 4ZNEE 4RNRB 5HHOA 2Z92A 4NYLA 4XC1L 5EU5B 4BJLA 3HAEB 5DQDL 4RAVA 5HI4D 5EU7C 1RJZA 4FABL 1T22B 1GGIL 5F89B 1JMXA 3ZZ1A 2X89D 1NBYA 4LLWB 4J3WA 3FB8B 4YHYC 4XWGL 5FA4B 5JXED 1CL7L 2QLVB 4ZXBA 4JCLA 4KPHH 4JN2A 3WKMH 3D69B 3EHBD 4KV5F 1LEGB 3U4BH 5KVDL 1MCPH 5HJ3B 3QG7L 2HLAB 3JBG7 2EDKA 4I3RH 2VH5H 4P5TC 3DNKA 4TSCL 3B9KC 3VCLA 3DX8B 4MAYC 4HZLB 1KNOB 1J8HA 1X5IA 2JK5A 5TDNA 1MCOL 4P99A 5EO1A 2A1WL 4RAVB 3DMMB 1VFAA 1KJMA 4PV9A 25C8H 3DYOA 1URLA 5A2FA 2B4CL 2G9HA 1NEUA 3WIIH 4Z0XA 1OGAD 4MZ3A 1GGUA 1IC1A 1MFBL 2PNDA 3NCJH 4NN6C 3V6FA 3QCTL 1SYVB 3VG9B 1D5BB 4HK3J 4MB3A 1HHHA 4HUKB 3RA7H 2NW2B 3Q5OA 3DX8A 3RPKA 4JM2B 4YC2B 2BNQE 4XTRD 3ARBB 3HG1A 3QFDA 4OLXL 5DGQA 5I75C 5EO1B 1TJGH 4PGBA 3WN5C 4NZUL 1I1AA 4PV9B 1YNKL 3JWDC 3MRCA 2BSED 5JZ7C 4NKDA 1G7MA 1IGMH 3L9RA 4JZOA 1FYTA 4JRXE 4LLQA 3C2AL 4P2RA 3V6FB 1TXKA 5C71A 3K4ZA 3RX7A 4PJ9A 5DRZB 4LAQH 3QFDB 4PJEA 3ARTA 3LN9A 5D7IE 3OXRB 4L8SB 2DMKA 3Q6FB 1B6DA 2X4SB 4N5EC 2J8UF 4NQDB 3L3DB 5TJWK 2R2BB 1FYTB 1BOGA 2EO9A 5FKPA 4XCEB 2P5EA 1QSFD 2WWKT 4YBHA 3P9LA 4XNYL 2WNGA 3PGDA 3ULVL 1RVFL 3MCLH 1Z0MA 2IG2H 4GG6F 4PJAA 2A6DB 5DZNA 3NFNB 1TJHL 5JA9A 3BKJL 4QY8B 2XWTB 4KTDH 4MJIA 1G6RH 4PB9H 3DYPA 4X5XA 1I7UA 3TBVA 2W9EL 4R4NC 3DHMA 5EBWA 4OZHA 2EIEA 1WCQA 2YD8A 1OM3H 2P5EB 4NUGL 4BA8A 1LO5B 2MCG1 2A6JA 3BP7B 4NQDE 5B38B 3O8XD 4JRYE 5C0RH 3GMQA 3O6FB 4LCWA 1NAMA 3WFDH 4K3EL 4KDTC 4EIGB 4HC1A 3ARFC 2X70A 1FYTE 3FO9A 1U91B 2EDHA 1AD0B 4BQ6A 1QBAA 1H3VA 1A3LL 2BSTA 2D0FA 3ARYA 1B4JH 1D7FA 4FS0A 1Q9KA 5F7FA 1QFUL 1QKZH 1RIVH 5I1AA 1ZLWK 2QHLA 3Q1SH 4KTEH 4L9DA 3DX9B 4W4NA 1W2KT 5C9JA 5J12B 2P44B 2M26A 1FE8H 1YMHA 5F93C 3VWKC 1RZ7L 5C8JA 4LCWB 5IFHL 5TFSH 5D6CA 1EK3A 1ROWA 2IH3B 3T3MF 2VDOL 4RMUA 3DVNA 3IFOB 3GKWL 1JPFA 4DKAA 4U49A 1AE6H 2YUWA 3CGTA 3QUMB 5EA0L 4CGTA 3BDXA 3RTQB 4JKKA 3CX2A 4LSUL 4GKNB 3GSNL 2QKIA 3CFBA 1T7YA 2QBWA 1DLHA 1T5XB 1XGTA 4C83B 1P69B 12E8H 4JO3L 4RCAA 2O5YL 1S7TB 4YEFA 4KPHL 3D0LA 2CLRB 4ONHB 2VKXA 4ZTOL 1CGXA 3HRPA 4H0GA 2DICA 4U1LB 4FQ1L 3V5DB 3HMXA 5ISZA 4QT5A 5I8EA 1G1CA 1QEWB 5I1HL 1CD1A 3G6AA 3MRQA 4RDQG 1CXEA 3VH8B 4M5YH 3IAPA 1YEKL 2YZ1A 3KPSE 2BNUB 3NPSC 3RL2B 1MCOH 5ENWB 4XNUH 3ECBB 3BQUB 4G6AD 4N0FA 1BQHG 4YHMH 3P4NB 4NQUA 4QEGA 1DLHB 4RDQF 4MNQD 4BZ2H 2FH8A 4NCC2 3HUJA 3MYZA 5BQ7B 1MFBH 1JPSH 3GSVB 3VXMB 3NGBC 4LU5H 4PJGF 3VD5A 2ITCB 2GT9A 4MWFA 5F9WC 4KKAC 3GHEL 4D0CB 3EIFA 4XGZA 2HFEB 3LMJL 4CVZB 3ECBA 3HE6A 2OL3A 2Y06H 1WAAA 2R4RL 4FXLA 3P4NA 4OFIA 3M8OL 4M6OL 1T1XA 3SQBA 1AI1L 4LCUB 2A2QT 1WFTA 4M93B 4NBYB 2ZUWA 2I07A 4JZJC 4ZNEA 4M48H 3RWEA 3CCHA 3G5ZB 4P9MH 3WEXB 1OY3B 3CUPA 4QXGL 3CXHK 2ITCA 5CEZD 1JNHB 4DN4H 2H1PH 3MRLB 1MRCH 1FVDA 1SBSL 1MFAH 3QRFM 3HNSH 1FLRL 1UEMA 4L9LA 4MJID 3SDAC 2J8HA 3BP4B 4UB0L 4LHUB 4U1KB 3GEWB 1DVFC 3HC0B 1YY9D 4QRPD 5T3ZH 1AHWB 3DO7B 4MJ5B 1CLOL 5D1ZB 3PWPA 2BMKB 5C0JA 2R8SL 1QRKA 1I7RA 1I9EA 2BX5A 1RVFH 1BEYL 2VWEE 1BLNB 3PHSA 3VD7A 2R9HC 1OCWH 5E9DA 4XI5C 5EO0B 4S2SA 4PLOB 5F7DB 3BMVA 2A6IA 5E5MB 2VLJD 5EULV 5IQ7H 1OTTD 3QIUD 2EE2A 3HC0A 4EDWH 1P1ZA 4OLYH 5E1AA 1G9MH 3QEGL 4XNZB 3EBAA 4Z8FH 5K9KA 1NGQL 1I7TB 5HD8D 3B9KB 2W91A 4L4VD 5D7LB 4BUHA 1S8DB 2FATL 3RU8L 4U1GB 1BMGA 1A6WL 2LVCA 4QOKE 1WAAF 5E6IC 5KN5A 2ED8A 1Q9LB 2HN7A 2NR6C 3G6JF 1K9TA 4D9RE 1MHHA 4FQJL 1B3JA 4RQQA 1MFEH 1RV6X 3VG9C 4OCRH 3W5NA 4GRMA 3MLTA 4HT1L 4BFEA 5CINL 4XP1L 5T5NG 3UTSE 3EFDL 1WLHA 4LSVH 4F57L 3R1GL 1S5HA 2ESVE 1YEGH 3WN5B 4F9PC 5EOQH 1A7RH 4XMKL 1OARH 4DEPC 1X3DA 4R97B 3BUYA 5JXEA 2R4SH 5BV7H 2EXYD 4XPTH 4L5FL 2AJVH 5K9OB 5F7WC 4M6MH 4P2QD 1MLBA 3QUZC 5C2BL 2YD3A 1BQHB 2AJUH 3HZMB 4M61A 4U6HA 3QDGD 4LCCA 3EYQC 4W81A 4MAYD 5TH2A 1BIIA 4YX2L 3VI3F 4OBSA 3HLAA 2KQMA 4AIZB 4GKZB 3UTZB 4FNLL 5DFVD 1YEHL 4ELME 2Q3AA 2XA8L 4MXWL 1YMME 4UT7H 1PW3A 2J7LA 4IIQA 4Z18A 5GS1B 1M05B 1NPUA 5TGBA 4V2BA 4YXKH 1SJVA 1UKTA 3MO1A 4JDTL 3VFRA 3DVIA 1N2RB 1FDLH 1QPXA 3MV7B 3C09B 3MXWH 1SQ2N 3BH8B 3WJLC 3SO3B 4JM2F 1ZGLP 2RJMA 1TZGH 3UJTL 4L3EB 4P5TD 3O11B 3V4VH 4NQED 3L3KA 5DJYA 4PS4L 2X4RA 4IIQB 5D2NE 1L9NA 4ODUA 4WY7L 4ZUTB 4XBGA 5F3HA 1CFVL 3N85L 4HIIB 5ICZB 1NLBL 3TN0A 3O3DA 2C7UB 2F53B 1J1PL 5J6HA 4X98B 5DRWB 4S1QH 1C1EL 5JHLL 2XI9A 3QQ3B 3JV6A 2YPLD 3BH8A 3HE7D 4FG6D 3VD3A 1BIHA 2I9TB 1RZGA 1RSFA 1NC4A 2DQUH 4NO2B 5E00B 3WD5L 3E6HA 1QG3A 1RUQH 1MI5A 1IBGL 3LN4B 4QHLB 1OHQA 3JUYA 4TUJA 4OT1L 4ZNCD 1G7HA 2E7BA 5HBBA 4JO2H 1LHZA 1T1ZB 3CDGB 2D31B 5F71A 1NGPL 4PD4K 2BJML 3Q0HA 4JDZA 5BV7C 4M62H 4KXZH 4IRJA 4P5MB 5J12C 1BVLA 4PBXA 5EC2B 4M1GH 2Y5TB 1GPOL 3O6FD 1CT8A 1J05A 3LEXB 3UBXA 2BNRD 3F7QA 4XCNB 4E41D 1MFDH 4E42A 3OKMA 2VZOA 5KSUB 4QRQB 5FA4A 1F6FB 4LP5A 4XRCB 1I9IL 4MB5A 4JVPA 1OD9A 3V7MA 1BZ7B 1UQSA 5C0BD 5A2KH 1O7VA 4JY6B 3CMOH 4XCNA 5DS8A 1NC2A 2ZCLH 4MNHB 1AXIB 2EDBA 1KN2L 3DUHA 4H1LG 2YMXH 4ODXA 1AO7B 2DD8L 3IS0X 3VFMB 3P30L 2D4FA 2BSSA 4M5ZH 4K71B 3KLAA 4MQXD 4ELMF 5IB3A 4J3TA 5CKGA 5DO2D 2VZ3A 3D2UA 5DSCA 4X6DF 4D3CL 3EYFA 3GNMH 4N8CL 5FHAL 4YHLL 4M1CD 4NZRH 5C0AD 2O61B 4FQCH 1QLFA 3T4YB 5D5MA 4M5YL 5CINH 2XXMB 5A1AA 1A22B 5KZCD 4OCWH 2CDFB 1V7NH 1AGEB 3BIKB 1I1AB 3U9UA 3VGAB 1L7TH 4YDIH 3BRFA 1IGTB 4N0CD 2P5WB 1CLCA 3OJDB 4N0CC 3H0TA 3W0WD 3NZHL 1VACB 1R24A 1V7MH 4YDLC 1YDPB 2EKJA 4JFHE 3SKJL 3QO1A 3OAUH 4F3FB 1NGZB 1J1OH 4I3SH 1D6EB 1QBLL 5HHQA 4RGNC 5KJRH 3DXAE 3C6LB 4H20L 4JJHA 3UAJC 2RGSA 5ANME 2C3VA 2P5WA 1DVFB 4EUPB 4QHKJ 1OVZA 4F8TA 2YUZA 1IAMA 4XNYH 5LCVH 4HV8B 2F19H 2VQ1B 3O9WD 1WT5C 3U2SA 1CLYH 2ENSA 6FABH 1M71A 4G5ZL 2DKSA 5TE6L 1S9XB 2R56H 1ZLSL 4HEME 5C6PB 5JMOC 2E7CA 2VDML 4C58B 3HPJB 4WY7H 4KJQC 4P59L 2J5LC 4YHOL 1P7HL 4XNZC 4UV4H 4QNPF 4KU1A 4HJ0C 4NWTL 5IK3B 4GRLC 3OF6D 1KIRB 5FYLL 5IUSA 1A3LH 1AD0A 1M71B 4ZS7L 3U0TB 3L5JA 5KVDH 3MRGB 1HQRB 4PTUA 4UINL 1RUMH 2AXFB 4L8CA 5LG1A 2C3XA 1RUKH 3G9AB 4S1SL 2IAMC 1Q9KB 1A8JH 1T0PB 3HPJA 1RZJH 3IS1X 3QEGH 4Z8FL 3LRHA 3O4LE 1NGPH 1DUZB 4LQFH 2OLDA 1QO3B 5IK3A 4X6CA 1OL0A 2MPAL 5C8JB 1T20B 2HH0L 2DM7A 4PB0L 2P7TB 3LKPB 2D3VA 1FPTH 4XB7A 4Y4FD 2HKFH 4ZUWA 3OJ2C 1D5IL 4F7TA 5JOFB 2J3SA 4CDHA 1HQRA 4PTUB 4NPYA 4N0RA 4V1DB 1A6VL 3TGXA 4NN5B 5GGVH 3F7YA 1JPGA 4KROB 4YK4B 5CS7A 1DUZA 1YQVH 2XQBL 4MD0A 4M43H 1JHKH 4ONHA 4HKXB 2DLFL 1D3CA 4XTRC 5JPMB 2NXYB 1R0AH 1JTOA 5EOQL 5GGSB 1FZJB 4UMGA 1W72B 1BQSA 1M1SA 2ZCLL 2FYYA 1I9RL 4N90E 4BKLA 3U4EB 1KN2H 2VR4A 4EIZC 4M6NL 1S7QB 4YO0A 3ZT5A 4Q9RH 4IMKA 3QJFA 1FHGA 4J1UB 4Q6YA 2VXQL 1M6OB 4WU5B 2EDLA 2VUYA 4BZ2L 4YAQB 4P2QB 1AIFB 1MJJB 3MLZH 4XNQB 5IBLD 4MD0B 5ACZB 2BVOB 4AENB 3T65B 2X42A 3ARVA 1RIHH 5CZVL 1G6RB 4PJBB 1EO8L 1FZJA 2IJ0C 2QQQA 1MHCB 3K4AA 32C2B 4I0PA 4XPFL 2B0SH 5J1TC 4XGZB 3RVTD 1WBZB 4OCWL 2IAND 5CWSA 3QUZD 4DOHE 4YAQA 1G1YA 1B9ZA 5IMOA 3SE8H 2YPKA 3RI5F 2BVOA 3O6LH 2LAGB 3RWEB 3T65A 1WBXA 2B1AL 3VFSB 4LF3B 1EMTH 1FFNB 2XYCA 3AU1B 3V8OA 3EYUL 4L3ED 1HHIB 5E2VL 3WLBB 4LHQB 4P5TB 4HDIB 5HI4C 4HBCL 4IHOB 32C2A 1RIUL 1T04A 1FLRH 4HCRA 1FNGA 4Y4KB 3DECA 1CFSA 3V5KA 3RI5K 2F74B 4ZFOB 4S1QL 4JHWL 1E4WH 4CMMB 5F7HA 5F6IC 2YPLB 3HE7B 4IRZH 3AREA 3KDMB 4NO0D 4LF3A 3MLYH 3VXNB 4LLVB 1FYHB 5LCVL 4P5TA 1JGLL 1YUHB 2LU7A 5HI5D 3FN3A 3OF6A 3OPZH 4QXTA 3WIFB 4OFYD 1QSEA 1FNGB 3F58L 2IFGA 3VD9A 2VSCA 2IPTL 1FFPA 5GS0L 3L3OA 3QIBD 5IFHH 3QPQD 4Z7QE 2P24B 2IMMA 4HUXB 3L6FA 5JLZB 2AQ1A 3KPLB 5F9JA 5E1AB 1B0RB 5GSVA 4S1RL 4E41B 4I48A 1U8NA 2APBA 2UZIH 2W38A 3HFMH 2XY1A 4ENED 2FX7L 3NVQA 3KJ6L 1MJ8H 5DMGC 5CEXB 1RPQA 2HKHL 1GZPA 1YPZB 2BDNH 4JQIL 5INDA 1O7SA 2DQHH 3FT4A 2JELH 4NP4H 2FBJH 3FB5A 2NY2C 3C5SA 4L1DA 4Z7UE 1ZEAL 1HKLL 1CFTB 3MBEA 3TPUB 3G6JA 3NBNA 3DI2B 4U1MA 3G5VB 3EFDH 4LSVL 2H9GB 1L4IA 3SBWA 3V8CA 4PJFB 4XNUL 5JIKA 2UUDK 1MWAA 4PGCB 1KF9B 2D7MA 1HIML 1YEGL 1Z3GL 4PB0H 4KMTL 4R4FH 1A14H 3LRSB 1LO4L 3QQNA 1RMFH 3VRJB 5L6YH 3SDDC 5DJ8B 3TJEH 1XCQA 1YPZE 3TNMB 4EVNB 4KJPC 3MBEB 5EZJA 2XN9B 4YDLB 3STLA 1KJVA 4KKLC 4N9GB 5CD3A 1UH2A 2QADD 1MWAB 3K2MC 4PGCA 5T1DH 1DN2A 3BEVB 1R5IB 1A6TA 4PR5B 5BRZA 3QCVL 3T0ED 1AI1H 1SJHB 1JPTL 2XA8H 3ZKNC 4NKMA 5D7KE 4GSDH 1JHLL 2YC1B 1W72L 3D2UD 3VGBA 4GMSL 2GK0B 4D9LH 1NCDH 4YDVA 5IB5B 4YXHL 4KK6C 1CDBA 5DJ8A 3TVMC 2IWGA 1RZJC 1I7ZB 1HYRC 2HJLA 3GM8A 1S7WB 1B2WH 5C0AA 4OD1L 5BOZG 3UTTD 3MV11 1JF1A 4GRWF 1F6LL 3TT1L 5FO8B 5F8QC 3SDCB 4DQOL 1P84J 1YNLL 5F6HI 2M1KA 3QWQB 2CIKB 3QJHA 4HF5L 4L3EA 4OZ4A 3IXTB 1PJ9A 1WCBB 3L7EA 5T1MB 1CFNA 3DROB 1T0MB 1XH3B 3WNLA 3TO4B 3WDIA 2FLRT 2GK0A 5I1DB 1FAIH 8FABB 2NY6C 2QSCH 2HJLB 1N3NA 1G7MB 2F19L 4QHMB 5CBAB 4HEPG 1OP5H 5IQ9B 3BN9C 4P2RB 4ONOA 2LTQB 4NNXA 1UACL 1RZGB 2EC9U 4OQ1A 1T03H 3IDJB 3WL9B 1K4DB 4EI6A 2C3HA 3AUVA 3C5ZB 4CW1A 3BHBB 5DRZA 3IRZA 2OZ4L 4H25A 4I0CC 4BM7A 1C16B 2DIJA 1KCRH 2X10A 3UTSB 1N6VA 8FABA 2FEEL 3MBXH 4Z77B 3SEPA 3QYCA 5KS9F 3T77B 2O26U 4MDIA 4ZFOL 5H35A 1J1XL 2O93L 5CSBA 5EU7E 1K4DA 1A1NB 4JR9H 2WM0A 3C5ZA 4CW1B 4H25B 3KG5A 3TF7C 3ZDXE 4IMKC 3BO8A 3CFKB 4QCIA 1EZVY 2AK4A 3V4UL 3ARGC 4Z7WA 4QYOA 1JWUB 2XV6B 1KCVL 5C07B 3BP7A 5B38A 5IBUB 3RX8A 3QBTB 2OCFD 4ZDHA 3HZYA 3O9WC 2EDRA 4MQSB 4XXDB 2QTEA 3GMOA 4LRIC 3ZTJG 4OAWA 3OZ9L 4Q97A 5HHOE 2BSSB 3CFKA 3DV4B 1NDGB 1IC4L 4Z7QF 5L2JB 4BFIB 5I73C 4QYOB 4YHLH 1D9KA 2D0GA 5C9JB 4X6DA 3OAYH 2P42B 3MA7B 4RGND 5DFVC 4N8PA 1JYXA 3DRQA 3MPCA 5D5MB 2FJHA 5I1LB 4M6NH 1JYVA 5KVEL 5HY9B 3C9NA 3HMXH 4NSKB 4PLJC 4RRPA 4WI6A 4YDIL 4ZS6D 1GC1H 3BEWB 1D5ZA 3RWFA 3MLZL 5KSBB 5DMGD 3QUMA 3HCVA 1ZA6B 4OLVH 1JBJA 4OD2A 5B39B 1JV5A 5DJZB 4X4ME 1P84K 2DKMA 1R24B 3WXWL 4X6DB 1NEZB 3N9GH 1YJDL 2AERT 4N1CA 4PJHB 4JB9H 2EC8A 5DC9B 3DRQB 1NJ9B 4NFCA 4U1LA 4U1GC 1IC5L 3C9NB 3GMLB 4K8RC 2AABL 5I8EB 5GJSH 3I6GA 4HQQL 3OAYK 1HH9B 1QEWA 4JM2D 4KHTL 2MHAB 5EUKB 1JGDB 2DQUL 1QRNA 3VJ6A 2VL5B 3BQUA 2XZQH 4N0FB 3GM0A 5E99L 1KYOK 4J12A 3MRMA 5HI3D 3GO1L 2OX5A 4D9LL 1EMTL 5FCSH 1E4KC 4IEFB 5D8JH 1B90A 2VQ1A 2E9WA 4UIMB 4KZDH 3VXMA 2VIRA 2DQGH 3H9HB 4DQOH 2VJXA 4ZYKB 3I6GB 3TCLA 4G9FD 4MWFB 4KUZL 1H8NA 3BDBA 5AWNH 2VDMH 4PJ7F 2ARJB 4KJYA 4LOUD 3UZQA 3VJ6B 3DHJA 2A0LD 2J8UA 5IF0B 4K55A 3LV3B 5LAXB 3TV3L 1INQA 3NTCH 3ARBD 5HYJB 5C7XH 3U0PB 3E2HC 1CDJA 3ZHKA 3HAEH 3NZ8A 1XF3B 3CUPB 1R6VA 4PB9L 3AXLA 3VXRA 3QDHA 4PJXB 5J13C 4FFZL 1ONQA 1FVDB 3GDBA 3QFJB 3EOAA 2Q86A 5J4MA 3SJVE 4XPGH 5E2UL 2ARJA 1JNLL 5AEAA 1SEBB 1XZ0B 3HN3A 5DYOA 5DUBA 4OBRA 4KH2A 5DTFA 4U1NA 3FOMB 1QBBA 5DQDH 4I4WB 4A6YH 1W0YT 3VXRD 4RZCB 1LO0L 1WFNA 1VADA 3ZYOA 5TE7H 3QIBC 4PJXA 3FQUA 4ZUWB 3KLHD 3SDYH 4KI5D 1CDCA 3EJJX 1MRDL 4PJDB 2PW2A 4M7ZC 3RIAK 1MELA 4FZEH 3G5XA 4IIQC 4KI5C 2VLMD 5EO0A 3SDDB 2Q8AL 1PX4A 2ZSWB 4OTXL 5BMFL 3D5OF 1MVUB 5BS0B 1CYGA 2XQBH 4Y89A 5HGHA 1UJTA 4PRBB 3UTPD 4YIQB 3CPLA 3VGDA 3MUGB 1I7TA 1A7QH 5KTEH 4OI9A 3WJJC 4WRLA 1Q0YL 3BWAB 5DVMA 5JDSB 3CZJA 3DUUB 4PRHA 1RZIA 3JZ7A 2G2RB 4J1UA 4WUKL 4U1SA 1A2YA 1FGNH 1M6OA 2HN7B 5DEFA 4X7FC 5J9PA 4PJHF 1JGUL 1S5IH 2CO7B 3QIWB 1MHHB 5CGYD 2QADB 4YIQA 1N8ZB 5EBMA 3LPWA 4JQVC 5A2JH 4QHUA 5IOPA 1EO8H 3SKNA 3NCYP 4FXGB 1MNUL 2BRQA 3LRGA 5DJ2A 4RIRA 1FLTX 1MHCA 3SGEH 4KDTA 4JJ5A 1P2CA 4XP4H 4I0PB 3DMMD 5GGTL 2QL1A 4H26A 1WBZA 2BHUA 3ZKSD 2X9WA 1U3HC 4LVOC 4WU7B 3SE8L 5AG8A 2APXA 5JHDE 3TFKC 1FO0H 4HWBA 1G7IA 1OAKH 3LPGA 3VXSD 3CH1A 2P47B 4NZDA 3VFSA 1CWVA 2HRPH 1Z5LB 1FFRA 2CRYA 4Y1AE 4G42B 4IHOA 4MB4A 3X3FH 4NO5B 4WJ5A 5CJQL 1IGYB 4UV4L 4Y4KA 4DTGL 2XTJC 4Y5XC 4F8QA 5GS2D 4XPBH 1E4WL 2DYPD 3AC0A 2I24N 3UJJL 4IRZL 1NMAH 1OSPH 4U1JB 1Z2KA 5GRVK 4H88L 3P0GB 3EOBB 1N2RA 4JGJA 2O5XL 4UILH 5DZOA 4DCQB 5KOMC 3CDFA 4JRXB 5A2LH 4I0KA 2MQ0A 4B7IA 4KRMB 4P2CG 2FIKB 4HWEH 4CJ0A 5EOCH 4Y5YB 1FFPB 1KC5H 1LK3H 2UY6A 3WFDL 4PJFE 3CJJA 2JB5L 2WBJC 4HIIA 1K8IB 2QV2A 4KK6D 4XBEH 2ICES 5ID0B 1HEZA 4DKEH 3GSRB 5GSVB 3QQ9D 3S9DB 5EU6A 1PZ5A 2DQDL 3QEUA 2EDFA 3QP3A 5F9WB 1DQTA 2YRPA 1RZ8B 2BVPB 4O2EB 4IRSD 4QRRE 4DW2L 4JFHD 3OJVC 3RFZC 3IF1A 3NABH 4O58H 3SGEI 1NANH 1KTDB 3E6HB 3D39D 4DAGL 2VERN 4J8RA 1ZT7A 1AO7E 2Y07H 3BI9X 4HS6B 2F53D 3WFBL 1EV2E 5DJAA 4U2YA 1JNLH 5DQ9B 4TULH 3QIUB 1KJ2B 4OZFG 2H9GA 3IF1B 4U1IA 4FQPA 2WUBL 3SDAB 4E42B 3LRSA 4JCMA 3ARZA 3Q6GL 3IJSB 3SOBH 3PNWA 4PY7B 5D1ZD 3QNXB 4YE4L 1F45A 4AT6B 4GRLA 4E0RA 4L4VA 3ULVE 4WWID 5D1ZC 3NH7L 4XBPB 3HR5B 2YEZA 2B1HH 4ODVL 3VFPA 3X17A 4YHNB 1AJ7L 1YEDB 3ILQD 3S36L 2MCPH 5E9DE 4ZPVA 3KPQA 4HXBH 5J8OA 1TTGA 3UYRH 1JPST 4JY6A 1QNZH 1ZK9A 1SJHA 3RWDB 3EGSB 4HH9B 2R0LH 4UU9A 5DT1H 5KTEL 3VFMA 2G60L 2A6KA 3BZ4A 1TLKA 5LGHL 5ICYB 2IAMB 3BDYH 4KRLB 1WWWX 3PF2A 2NY7H 3LIZH 4ONFH 2Z8VC 3PGFH 3D69A 3MRJA 1JGUH 1S5IL 2J4WL 3MJ9A 2HVJA 1QFWH 3W9EA 1BZ9B 4R6UA 1YEHH 4RFNC 4RA0C 2VDRL 1QLFB 4N9OB 4M7KH 3DIFB 4M48L 5HGAA 1CFNB 2A6KB 4XP4L 4QXGH 4QHNB 2CDFA 1DQDL 3VWKA 1PD6A 4PJCB 1S3KL 3SDCD 4Y4HD 3LSOA 4Z7VB 5HHPB 1UH4A 1IARB 3PDGA 4RGMC 4POZD 1TFHA 3MRNB 3O2DL 4HGMA 3TWCL 3QHZL 2YHGA 1P7KB 1XF5B 4XCCL 1X5JA 2J12B 1IEBA 1OW0C 1U8OB 4JM2A 3RQ3A 5TE4L 1Y18A 4CU7A 1CLOH 3SGKA 4F9PA 5IR1A 5HHVL 1G9EA 4UZGA 3MYJA 5C7XL 1YMMA 3MGAA 2Z93B 1S7XB 5F7YC 3MRHB 5H35B 4AL8H 1HWHB 4KK9C 5L2KB 3GMPB 4HIEB 5IMKB 4HFWA 1VFUA 2DQCL 1ED3B 1I1FB 5CEYA 5DD6A 5GS1C 3BGMA 4KQ3L 5DJCA 1YEEH 5FKAA 5IBLC 3JUZA 1KC5L 1LK3L 3NCYS 4JFPB 4Y1AA 2AV7B 4OQTH 4QRPB 1YMMB 2V5MA 5EU4A 1TVHA 1TPXB 2AI0L 2CDGB 4PRAA 3FO0H 3CK0L 1P6AB 4ZDHB 5DD0H 2D9QB 4PJDF 3RY5A 2YXFA 1QP1A 1HYSC 4E5XB 3TO2B 4C56D 4YBQC 5JQ6H 5GGSY 5FEBA 5IP4A 4O58L 4AG4H 5J56B 4F57H 3LKOB 5KAQG 3QUYB 4YWGH 1QA9B 5FAAA 5SWQB 2JB6A 5KG9B 4H0IA 3LPFA 1A7QL 3PL6B 1I8IA 3VMNA 2ZKHH 2VDLH 4I5BA 4JGMA 2AJYH 3WFZA 1KJ2L 1P9MA 4KZEL 4TVPH 4NSKA 5K93A 4FQHA 3SCMC 5C2BH 1TZHB 4F7TB 5IJVB 2ADJA 4PRID 5TPWH 4YQXL 1DBBH 1GOFA 1ZHBA 3E1F1 3HCVB 4HF5H 1QA9A 1BJ8A 4P49A 3CFDB 3HA0A 4HJGA 4L4TD 5ETUB 3WXWH 2DM3A 4MSWB 1KLUA 4LRNL 4ODVH 5EO9B 1KB5A 5IB4B 4P2OD 4HIXH 4RMSA 5EZOL 2KH2B 4X0KA 1NKRA 3MXWL 4U6XB 1FO0L 1S7QA 4YO0B 4PJ5D 1H8OA 1RZKH 2A9MH 2NY2B 2VL5A 4MA7H 2ZUTA 4EDXA 4WHTA 4EUPH 1IGFL 1U3JA 1ADQA 5SWSD 2XRAL 3SJVB 3LKNA 3ZE0F 1AH1A 3UTOA 1FZKB 2BCKB 4AK1A 5IB4A 4NFBA 3I9GH 1XGPA 2EDTA 4PLKC 4QXUH 1C7TA 4IM8A 3MRQB 2OQJB 3VXME 1J5OH 2VYRE 8CGTA 4PGDB 2BNUA 3KNBB 5CZXC 3PWNA 4PRNB 4UV7H 4YFEA 5MENE 2FJFB 1U92B 5CWSB 3BH9A 4WHTB 1CDHA 3H7LA 1B6UA 5ECJE 1PG7W 3JSSA 4ZXBC 3U30C 1F4XH 1KXQE 5DDHA 2YK1H 3D18A 5A2IH 3T0XA 3K1KC 4OZIE 3UROR 1RHFA 3AU1A 5IM7B 5LQBH 2VAAA 3VXRB 2EDQA 5C0CD 1UB5B 2IALB 2BRRH 3R0NA 5I16A 4FXKB 2ZUSA 3WNPA 4HUMB 3TN0C 4KC3B 2FJFA 4S10A 1CL7I 5FGBA 3EOYG 4PJ8C 5IT2H 2X4PB 3GSNB 1KPRA 3O3BA 5HPOA 4LCUA 3RWHA 4KJPD 3HZKA 2J88H 3C6LD 2I07B 4R2GB 4I4WA 2UZXB 5K59F 5TE7L 4G3YH 4RZCA 3C6LC 3SDCC 5CP3H 5T3XL 3L3IA 4AIOA 3H42H 1NSNL 5C08E 1YUHA 1ZLUK 2KBGA 4QXTB 4FZEL 5FUOH 5I16B 3HI6H 2VR9A 2I9LA 1JI2A 4OCRL 1U8HA 4PJXF 3RL1A 4Q58C 3L3OB 3N1FC 4OZIB 5ACLA 1QSZA 4M02A 2DBLH 4LQFL 2QQNL 4G7VL 1HHGA 2W59A 3MOAH 4R26L 2X1OA 5C0DB 5SV3A 4MJ5A 5GHWH 3A6BL 2ENYA 2D0HA 2FECI 1X5KA 4R90H 3SDDD 5SX4H 5FCUH 3FO0L 3SDAD 2IEPA 1HSAB 1Q9OA 4OI8A 3H9SA 3U0WH 2I9LB 1F3DH 2VKWA 1MCJA 1RZIB 1X44A 2UVFA 4GW1B 4JFDE 4OZIA 3MLSL 2J5LB 4CN4A 1DE4A 1ZLUH 1I8KB 3FT4B 2AJZB 5J9PB 4YJZL 4M43L 3WSQL 4F33A 4N1HB 3P0YH 1F8TL 1RU9H 1ZGLA 1NUNB 1QVOB 4KROD 2ATKB 4JQXA 4OCMC 1DUYA 1N0XL 4JLRA 1K4CB 4HGWA 1HH6A 4UAOC 4JO1H 2J6EA 4JDTH 1P2CB 4UOW1 4X83A 4P2OA 1K85A 3OKLA 4LVNB 5D96B 5FDWA 1DBKH 4GRLD 3KPSA 3ELAT 1I8KA 3I02A 4ONFL 2CKBA 2PW1B 2OTWB 4F33B 2VLJE 5T1LA 3PP3K 2ED9A 3WS6A 4NBXB 1CLZL 1P4IH 3C60A 1OGTB 4HGWB 3BEVA 3U48A 3UDWC 3HPLB 4LRNH 1S5HB 2ZOLA 3MLVH 4WJ5B 4OSUL 3OKLB 2WLZA 4NKMB 5EBLA 1KV3A 3GIVB 2BC4A 4CVXB 2YC1A 1SY6L 1ZLVH 1UZ6F 2PW1A 2VLRE 3WHE0 1ZTXH 5K9OA 4ZPTA 1CD9B 3VG0L 5K9JL 5HI3C 3BKYH 5KSAC 3HTLX 1KBGH 4LEXH 5DR5H 2W1NA 4LSPL 5KSBF 3MREA 3HG1D 1YN7B 4GKZA 4DKDC 2VXSH 2LV4A 2NY3B 2X4TB 3L7EB 2ZUQB 5T1MA 1I8MB 1MCHA 1RULL 3KHQA 2OI9C 1M05A 4MHHG 1WBYA 2EDYA 3EYQD 5GJTL 3MRPA 3O81A 4HS8H 4TNVF 4LSRH 3RJQB 1HKFA 3O2WH 3MRDA 4Y8AA 2B2XH 1QYGH 4XWGH 1HEZB 5ADPH 2VABB 3I6KB 1RUKL 4G8FB 3WKML 1ZLVK 2DQCH 1NCTA 2QSVA 4EQ3A 4W6WB 1HDMB 3ULSB 5F8RC 3L3KB 5DJYB 1S7VA 3IU3A 3ZL4H 1T89A 4ZUTA 3RVUC 5ICZA 5IESH 2OTUB 5GRJH 4WIQA 5T3ZD 3WIIL 4L29A 2DTSA 2VDNH 4UNUA 4JPVH 2FHBA 4L8DA 1RHHA 5JIIA 3HNTH 4Y4FC 3MRIB 1ES0A 2ICWB 1E4XH 2IQAA 5I1JL 1W8OA 1U8LA 1NCWL 1S9VA 2FWOB 3GKZA 4GLRI 3CDGA 4NZUH 1X5LA 4AT6A 1IGIL 1AKJA 5D7IB 1SJEB 5DJXB 3S36H 2CRZA 5CJXC 3UYRL 1QNZL 2VZVA 4ZAKA 1QFOA 2N7BA 1A14L 2DQTH 4NO3A 1Q38A 2HTKD 4OLZH 4V1DD 2GTWB 1KJ3L 1A64A 1ADQH 2OTPA 2WK2A 2HRPL 1N0LA 4NRXB 2H6PA 1I3RB 3VFVB 1DEEB 5C0GA 4FQXB 4QGYA 3OAZK 4XC3L 4PYGA 3H9SE 4R96B 1WIUA 4OF8A 2CJUH 2D03H 1KEGL 3S37L 4PJCF 4C57C 3KXFD 4W6YB 4ZO6A 2XTJD 4DUXA 1CGUA 3MC0A 4E41E 2GTWA 3I2CL 4ZOCA 5AUMA 4PJBF 3FRUB 4TRPL 1EHNA 4NRXA 2XWBB 3MROA 3BEWA 2HG5B 4Q0XL 1KG0A 4HBCH 3D2UB 5DSCB 1OTUC 4DGYL 3J8F7 3ULVF 1K8DB 3QZWA 2R2HB 5TE6H 4TOYL 2O61A 4CL7A 4R7NB 1IAKB 4WDIB 5ESAB 3RGVD 4HGKC 3VDBA 5L2KD 4XBEL 1OT2A 4XPHH 1E4XI 4UV7L 1EA9C 1XT5A 4CNIA 4HW6A 3VWJB 4OV5B 3GIZH 2BSRA 3FCTB 3KPPB 4FN0A 2HG5A 1S7UA 3UTTA 3N1QC 4AQ1B 2Q8BL 5JNYA 4ENEC 1TIUA 2EZ0C 4HUUB 2P48B 4IOFC 1U8MB 2R2HA 1BD2B 2VC2H 3MR9B 4U6TA 4C59B 2BRRL 2ADIA 2CMRL 5FM5M 2HJFB 3I85A 4Q6IB 5DD6B 4CNIB 1AP2A 1QBMH 5AYQA 3NA9H 3IDIB 2W60B 3MBXL 5C0RL 3KPPA 2KDGA 4YR6A 4JFPA 4Y1AB 2GITA 3C5JA 4HKZA 1IM9A 1T1WA 4JFED 2WIIB 3LS4L 1U8MA 4UTBL 2DQEL 1DL7L 3RNQA 1J7VR 4F7MA 3QQ9C 3NOIA 3U0PA 5EIQA 4ZTOH 4JRYB 1VHPA 1H0DB 3SY0B 3QPXH 3V0WH 1J10A 4XXCC 2P5ED 4LHUG 2BVTA 1BOYA 1YEIH 1MCIA 4HPYL 5C07E 1EHXA 1HIMH 1Z9OA 4X7CC 4ORGA 5D9SB 3WO4B 5L7XH 2XKUA 2GY5A 3VXPA 1GJIA 1T1WB 4JPIB 1P7QA 1KN4L 2LTQC 2AK1L 2VDLL 5DTFB 1AE6L 1MI5D 2DTML 2GFBB 2I60L 2BY2A 4Q9RL 1CIUA 3C5ZC 2LQRA 4TYUA 3TIDA 3UDWA 3OKOA 3DTXB 2ZCKH 3D3VE 3INUH 4AH2B 1JUFA 4O51B 3MV9E 4LSDA 1E4XL 3T2OA 2DLEA 2DM4A 5IV2B 2BNRA 2GIYA 3RJDA 2WBJB 5F3BA 2BERA 3ARGD 3P9MA 5CD5C 3UJIL 1IKFH 2AS5M 4E9LA 5EN2B 3T04D 1IL1B 1AGFB 3KYNB 3OX8B 4NJ9L 2WINA 4LPWA 4FP8H 4MD5A 5DJ0B 3O2DH 1P5UA 2PO6A 1KGCE 3P4LA 4PGEA 4PRHB 3S3SA 3CD4A 5E2VH 5I1KH 4EEEA 1A2YB 3BKML 3SDXF 2XRAH 3WUWB 3F7YB 3M07A 4EN3A 3U79A 2H8PB 1SVCP 3L3JB 3VRIA 3QIUC 1FSKC 2Y06L 4XC3H 1IM3A 1JNNH 3AB0C 2E27H 4FXGA 2Y6SC 1LGVA 2NY3C 1CZ8L 1J5OL 4OF3A 4WTZA 1U8IA 2IPKB 1BQUA 3ZDYE 3RZCC 3QSKB 4PGDA 5F1NA 3VXQB 1I4FB 1CR9H 4GQPH 4MNGA 1I9JL 3BH9B 3WUWA 3OPZL 1ITBB 2HTKC 2A77L 2AXGA 3M17A 4U6VL 4F7PA 2XXCB 3RIFF 4O00A 4XMPL 1PZUB 4GBXA 5B4MC 1IM3B 3MMEA 3L1OH 5FHBL 5F21B 4Z6AT 3BW9A 1I1RA 4YC2C 1KLFA 5AWNL 5KVFH 3T0DA 1PG7H 1UM4H 4CADB 3O2WL 2DS4A 2XZCL 3LQAH 1BEYH 1OTSD 3VXSB 5FXCH 4F7PB 4C54A 3HZKB 4U1JA 5K9QI 2YPKB 1BHGA 3NCBB 3O4OB 3RVVD 2VDKH 1MCNA 3TBYA 3SE3A 5FUOL 5SWZA 4YEEA 4QF1A 2XQYK 2HYMA 3V6OE 1OAZH 4B0MM 2A9NH 4FFVC 3U6RB 3DV6A 2AJYL 2ZUVA 3DX7A 3MOAL 3VU2A 4NWUH 3VXOA 3AMKA 4MDJA 2PXYB 4Y19E 4HLJA 3OGCA 1J11A 3MLXL 1HOCA 4JRXD 2GAZA 3LN5B 4CKVX 5D1QA 1BF2A 3FFCE 3NN8B 4ZTPH 4I9WE 4LPYA 4PY8J 3ULUF 5C86A 2HAZA 1RK0B 1WWBX 3RVTC 4XP1H 1UADC 4HKJA 4D2NA 1QOKA 1ACZA 4OV6F 4HX1A 4JREB 4JAMA 4KAQH 3ARQA 1QLEH 4HIXL 1M7IB 5EZOH 5SWZE 1CXIA 3QHFH 3QXWA 2NY5L 4HMCA 1G7LA 1FN4B 3QXDA 3DVFA 3LKQB 1FG2B 2HMIC 1JHLH 2DLGA 4X5WB 1QQDB 5DWUL 4WFGE 4FFVD 4XXCA 2JJTC 5D93C 1OW0A 5J1AB 4NZTL 1DBKL 3K7UA 1D6VH 5JW4R 1UXSA 3RZWA 1BX2B 3F62A 4LKXB 4GAGL 1A4KB 4M3JA 5F9AC 4BZYA 2F5AH 35C8L 2CKBB 2M2DA 3GMNA 3QXDB 5E03A 3OKEA 4X5WA 1C1EH 1MQ8A 1UWXK 4P9HH 3BZDA 4J7RA 4EJ1C 1IKFL 2FZ3B 3GZKA 3MX0A 2AV1A 3EUUA 3V6ZB 5JW5A 1TTFA 4MJ2A 5F96H 3JVGC 5BS0D 3EGSA 5GGVY 3G5YB 5DA4A 4HAGA 1A4KA 2DQJH 1H5BB 1BZQK 1ZA3B 3AS0A 4TOYH 3EYVB 1EEZA 1MSPA 4N0YL 5J89A 4LSPH 2FZ3A 3X3FL 1WZ1L 5IT2L 3MXVH 2C5DC 3OMZA 1EUTA 1YN7A 4NC2B 3CSYA 3UTQA 1UWXH 1N59A 5CJ8A 3ARPA 4AEEA 2E6PA 3I6LE 2F54A 3TBTB 4MVBC 3MV7D 4K2UL 4PRIE 2QADC 1EAJA 1I1YB 3LEVH 2OR9H 3GSUA 4X6EB 4NKIL 5IGXL 3MRNA 4Z78B 5HTSA 1G0DA 4I0PC 3E3QE 4HWEL 2YPVL 3HB3C 4G9DB 4G9FB 3DSNA 3L1OL 5FHBH 4ODSH 4LVOB 5IG7B 5EWIH 4LPTA 1WFOA 3SCMD 3L3GB 1R3KB 1I1AD 3IJYA 1RUAH 4PJ8A 3U1SH 4OGYH 2P5WD 4XVTL 1K5NA 1BFOA 5DMIH 3PGCA 3W0WB 1MJUH 1QFWM 5D7JC 3ZYIA 5JHDB 1YYMH 5BMFH 2XFXA 5DC4B 3WL9A 5IB2B 3B5HA 2V17L 3BQUC 3MFFB 2XPGA 2DQIH 3QFJD 5ACMA 5IMMA 5DUMH 2Z31D 1MCWW 3DVGA 1AGCA 2YMXL 1MPAH 5D7IA 1NC4D 1E28A 4K3DH 3HNVL 3GHBL 3P30H 4PJ7E 2OJEA 2CDGA 3CLEH 4PRAB 2NCMA 4ZAKD 1FJ1B 1A1NA 4G8EA 1T2QL 5F7KC 3UYOD 4KUCD 1MF2H 3CVIH 5EDXA 5H37H 3TH4T 1DANT 4B50A 1HZHL 3UJIH 4KQ4L 4BK5A 4HWZA 1M7XA 1DEEA 4TSAH 2OR8A 5C0GB 4GUPA 2MCPL 1BF8A 4Y2OA 1UWGH 4K23H 4OCXL 4D94A 1KLGA 3S37H 3G6JE 3T3ME 2XWJB 1I8IB 5C07A 1YY8A 2XICA 5C0EB 3MZTA 1ZS8B 1FL3A 3EO1B 4C56B 4XXDA 5DVOA 4PJEF 4UQ3B 4KVCH 4XNMB 5E6IB 4FQHB 5I2IA 1NL0H 5BO1H 3RZCD 3V7AG 1EAPB 2Y9RT 4S0TD 3RY6C 2NY7L 4LFHD 5DK3A 3FFCB 1MIEL 3GI9H 4P59H 3ARDC 4K9EC 3QZWB 4LLDA 1UWEL 5CP7A 5E6YA 5BZWA 3UJJH 5JPNA 1NMAL 1OSPL 4OIIL 1ND0B 4HS8L 3EO1A 1PX3A 4X6BA 2B2XL 4JDVB 4PJGA 1FC2D 1JYWA 2NW3B 3HC4H 3ARRA 1MUJB 3N1PC 4YGAB 2R0KL 3HI5L 4AJ0A 4LSTH 2W9EH 4OZHF 5BRZD 3S34H 5E4EC 2JIXA 15C8H 1OM3L 3RVWC 5L8KB 3V6OC 3FQTA 5GIRA 1LEKB 4XPGL 2UWEA 1MCWM 2X1QA 4KRPC 1ORSA 3VA2C 1HNGA 3FT3A 1ND0A 2HT2D 2ADIB 4XP6L 5E8NA 4Y2DA 3ROLA 5CZKA 1JRHH 1GGBL 4Y4HA 1KSRA 4HHAA 3GBNL 3MJ6A 1CE1L 5AD0B 2V6HA 2FBOJ 5IIEA 3PWNB 3ARFB 5HGDB 4Z5RB 4R7DA 3EDJA 1LEIB 1MCEA 4I18B 4M9PA 5FO9A 5IVXB 1LEKA 1CXLA 3STZA 3SO3C 1VGKA 5J57B 2PYFA 3IDGA 1MCCA 5IJKC 1JHKL 1AY1H 4NM4H 1WWAX 1ZWIA 4LGRB 3ZSTA 1FNSL 4R97C 2FCBA 1K6QH 2J1KA 3QDME 4JFEB 1OD7A 2GJJA 2H2SD 3B6SB 4XVUD 1GZQA 4F58L 4HH8A 1GSMA 4OD3H 1GHFL 4OGZA 1C5BL 5KS9E 3U1SL 4N0UA 3GK8L 1LEIA 5E2WH 5KAQF 5C0NC 5E8PB 1F6AB 4JFDB 4DVRH 3GSNA 4JG1L 3KAAA 3UCRA 3MACH 1LE5B 4MCZA 5HYJA 1A0QL 1VGKB 4MJ4A 5HPMB 1KB5L 1XF3A 3FTGA 4MXQC 5C0CB 3NIGE 5EG6C 3AXLB 1MH5B 1A21A 1JUFB 1F90L 4YGVB 2BNQD 1SEQH 2ZUQC 4UDUA 2Q86B 1FO0A 1XIWC 4OZGB 3WNNA 3SGKC 4R0LC 1U42A 2KZ1B 1PYWB 3H7BA 3GSXA 4KMQA 3TYGL 3P77B 1I9RH 1BFSA 1A7NH 3GMRB 4K3JH 4QTIL 4NJ9H 4LASH 4FP8L 2NNAB 2NTFB 5JW3L 2YPLE 2F8VA 3EYUH 4X4ZA 4X6DE 3NAAH 2Q7NA 1JRHI 1H15A 2OR7A 1UA6L 4QRTB 4QGTA 2UWEE 2MKWA 1JVKA 2VDRH 3CVHB 1J0ZA 3NIDE 5JO5A 4HPOH 1WSST 4XVJH 2AJZA 1PLGL 2CKBH 4P2YA 5CJQH 2B0SL 4LNRA 4XVSH 3GMRA 4Q74A 1NLDL 5H2BB 2CQVA 4EBQL 4XAKE 3S5LG 5F6HJ 3BX7C 3NCMA 1P9MC 1EXUA 3THML 3UAJD 5KSVA 3NIGF 4PTTA 2HP4A 5E2TL 3DGCR 1EGJA 2YD1A 4G7YH 3QUYC 2VXVL 4N8VB 4LVEA 5DQJB 1I4FA 3MCKA 4JFXB 4P46B 3I02B 5AZ2H 3UC0L 3G08B 2B8OT 1DQLH 1J8HB 2JK5B 3MGTA 1CK0H 2QR0B 3DMMA 4U3XA 2H2PC 4RWYL 4WFFD 5L88L 3RKPA 5DJ2B 4XAWH 3NFPA 3KPMB 2Q87A 4MLSA 3GSQA 4NC1C 2AGJL 4FZ8L 4FQIL 4H5SA 4NGHH 4MA3B 4N5UA 3B2UC 2C3GA 4H26B 3Q5YA 1XCTA 2WQ8A 5D2NA 5ALBH 1B4JL 4GS7C 2PF6A 1NGYB 3ILPA 1A6UH 2HT2C 4K7FB 5BOPA 1V3KA 5FV2A 1W0VB 3FFDA 4PREA 3WFBH 1BWMA 4NKDB 5SWZB 2VLKB 3QWRA 5E4IA 5C0AE 1EHLH 4WO4B 4MA3A 4U7SA 4NO5A 25C8L 2F54D 3IXAA 1IGYA 4LLQB 4ACPA 4PV8A 5LVEA 1K2DB 4GKSA 1AGDA 1XCTB 1NMCB 5FIEA 1IT9H 2R1WA 5L6YL 4ODBD 2E5EA 4PJDE 3QDJE 4OZHE 2AW2A 4OCLC 5CJXA 4NQSB 5JHDD 3MLXH 3PQYB 3I50L 4O2CA 4K9EH 3OKYA 3FFDB 2P8MB 5HVHC 3VGFA 5TQ2L 2B5IB 1YECL 3B8YA 3CAFA 1REIA 4NQTA 5LWYL 1HSBA 1JJUA 3PABB 4PV8B 5D5MF 4BZ1H 5L2KE 1LE9A 4ZO8A 3ULUH 2PKDA 2QQNH 2BNQA 3S6CA 1KCUL 3QHFL 2X41A 4UUJB 4OLUH 4KMTH 4L5FH 4NQSA 2R0LL 3U46B 3GSRA 4HMDA 3WHXB 3IDNB 2VISB 3F65A 4PUBL 1HILA 3W39A 1LNUA 3ZDZF 4X5XB 5FOJA 4YFLI 4OZHB 1I3VA 1J0HA 3BT2H 2JF1A 4LHUD 2IQAB 2A6JB 2R69L 1U2CA 1U8LB 3BVNB 5B38G 3WSQH 1QFPA 1MLCB 4NC0B 1FNFA 3R8QA 2CLZA 3ARSA 2IGFL 3QDJD 43C9A 3TYGH 4JFEE 4LCWD 3TC9A 5D7JD 1NCDL 1A7NL 3OXSA 3RWCA 3W82A 2R1XB 1BQLH 5E6ID 4L3CB 3ALWA 4HFUL 4TSBL 4X4YA 3O8XB 1G0XA 5CEZL 2H3NB 3BVNA 5CFHA 3S37X 3C09C 2X1PA 4NRZA 2X9XA 2DQFA 4P48A 4GRLB 2Y23A 5IW1B 1CU4H 4N0YH 1F11B 3M1BA 2CLZB 3EYVA 5H8DA 4XCFH 1EERB 1YEDA 1FFQA 3D85D 4G6FD 4FOMA 4OFDA 4XVSL 3L3HA 4OLWL 4AMKL 4JKPL 2EZ0D 1OTTC 2QKIB 2L4OA 3CFBB 4LSQH 4NOFA 4X80L 3MJ8A 5T1LD 3CSGA 4PYHA 1XIWA 3RY4A 2XWBA 3MROB 5FECB 3VFTB 4X8JA 3D85A 2Z92B 4NYLB 1IEAA 3VH8A 5IEHB 1T21A 2DL9A 5I1IL 2D7PA 2HVJB 1RJZB 3RNKA 1T22A 1C08B 5F89A 1I3GH 1CK0L 5D96C 2VXTL 4OQTL 4YHKH 4JN2B 1R3KA 3IJYB 3HUJB 4G3YL 1EJ6A 3EYOA 3VWJA 4LSRL 4OV5A 2DIAA 2HLAA 2NY3D 5FYLD 3EZJB 2DMCA 2PTTB 3GSVA 1BFOB 3W0WA 3ESVF 4HZLA 1TCRB 5C0FA 3VE0A 3GJEB 1T21B 1OAXL 1WGOA 2HFEA 2X6MA 2XFXB 3UTSD 3SGDI 1IEBB 2XPGB 5B4MD 4GW4B 2WBKA 3QUKB 1EFXD 1U8KB 4KK5D 4PJ7A 1AQDB 1G9NH 1NUDA 2WV3A 4PJAF 5FCUL 1B0WA 1A5FL 2FD6H 3DVGB 3MOBH 2NX5A 3JWNC 4MAUL 4QRSB 5HYIA 3GHBH 1IQDB 5DD1L 3HE7C 3CFJA 3QHTC 2V7HB 2NXZC 4QRUA 4OCSH 4R0LA 3GUTA 1KB5H 1Z0NA 5HGGS 4NO0A 2FO4B 4PGBB 4WFHD 4L9LB 3IETB 4ALAH 3GHEH 4F7MB 2Z31B 5EU6E 1AC6A 1ZE3C 3BP4A 1FJ1A 3HE6C 4G8EB 5DJ6B 1LK2A 3MNWB 4R4BA 4JZOB 1IAII 1YZZA 4KGLA 5FYKL 2UY7A 1H0DA 4JFYA 3D9AL 5D7SL 5GJSL 3DO7A 4BZ1L 1I7RB 5TF0A 3HRZA 1ETZA 3CFJB 3GMMB 3UYPA 3ZHDA 3L5WB 5D4QA 4PRHE 3DX6A 3QDJA 1XF5A 4RFEA 5GRZA 4J4PD 3V7AE 3IDXH 3ABZA 3OKOB 2E8ZA 1CQYA 1A7PH 1DJSA 4UB0H 2JCCA 4E5XA 4QHKI 2ICWJ 4HPOL 3BYYA 5SX4I 1EAPA 1WEJH 4D8PA 5BJTA 3MRKB 4JFOA 5IV2A 4PJAB 4RGNB 2H45A 4CUCA 4G6KL 2WBJA 3V5HA 1M7DB 1NLBH 3FB6A 2PXYC 1NAML 1ZOXA 2K1MA 4QY8A 5KG9A 2FGWH 1JZ8A 1P4LA 4U33A 5BXFA 1EIBA 3JWDH 5CP7B 3SE3C 2ZNXA 5JPNB 2EEAA 2VAJA 5E99H 2ESVD 2A0LC 3EOTL 3CLFL 3B9KD 4LIQE 5IJVA 1KBGL 4LSTL 5IQ7L 4EDWL 2UUDH 4GS7B 1NAMB 2YPVH 1XIWD 4MA8H 5L9DL 4POZC 3X14B 3IKCB 1A9EB 1J0YA 1CICD 5D2NC 3REWA 3G04A 3T2NL 1J0IA 5GIRB 1A6WH 3GRWL 4G6JH 5GJTH 4JY5L 2OSLA 3DLQR 3EO9H 3ETBF 5D93B 1DLFL 2BFVL 3QXUA 2EIBA 4N0UE 1KELH 1XF4A 2GW5A 2GJ6B 1BQHA 4M61B 3LB6D 4U6HB 5SWSA 2X4OB 5CUSL 3VWJD 4MVBD 4Z5RA 3X14A 4O4YL 2C3WA 3Q5TA 3O41A 2ZJSL 4RAUB 4X6CE 4OZGE 3P2TA 4WI9A 1IILE 4WO4D 1MPAL 1QBML 3T08A 4PP2A 2W0FA 3HNVH 1I3GL 3KLDA 1EPFA 1FRGL 4GXVL 4X6FB 1N7ML 4NM8H 5MEQA 5I19L 3A6BH 4F37K 1BFTA 3O45A 4PBVC 4FABH 4N0UB 4K8RL 1E6OL 4QT5B 2DQEH 3PQYD 1JGEB 4OIBA 4CMHB 3O11A 3W81A 3O41B 1LE5A 1SMOA 2DLTA 3ZDYF 2LABA 4ODHL 5DDHB 1YECH 1IC7L 3D18B 4ODUB 3ZKXC 4ESKA 3QG7H 1OP3K 3TA3B 1DBJL 3TCXA 5B22A 4JY4A 1SM3H 4HG4K 4QF1B 5M7QA 2AJXH 4Y16D 2GHWB 2W0LA 3FQNB 1FO0B 2DJSA 1N0XH 3L7FA 2RAMA 3DV6B 3LCYA 3IYLW 2DBJA 4NQEB 3CVHH 2I60H 4CRPA 3MODL 5F1KC 3NIFF 2Y7QB 3IFLL 3PWVB 4P4KC 5AAMA 5EOCJ 2OL3B 5IVZA 4ZD3H 3MV8D 4Y1AD 3BPNB 3NN8A 4JY4B 4PJIB 5DGRA 5CGTA 1JP5A 4KKAD 3FQNA 2WMPA 5GS2H 2YSSB 5MERA 1I85A 4HIJB 3NIDF 2X05A 1JNHA 1IGML 1A7OH 2UWEF 5GISH 1VEOA 2CSPA 5LGJB 5D7JB 2WBJD 4NQVA 2DB8A 1KTKE 5MI0B 3THMH 5GRVL 2WWMC 1F5WA 3V52H 3PWLB 2L7JA 1LD9A 4P57B 3GSOA 1LMKA 5IW6B 1NEZG 4U6YA 4X7DC 4LSSL 3ARGA 6FABL 1BZ7A 2FL5A 4P46A 4XCFL 3QULB 4GG8A 2EDXA 4B7LA 4NQVB 1CIDA 3MGTB 3I75B 1JNNL 3HAEA 2KUTA 5FYJU 5C09E 2Q8BH 2AJ3B 3ULVH 1JI1A 4FQIH 4NGHL 4K94L 4DW2H 3O6KL 3IVKB 1MREL 1DEDA 1G9NC 1EGJH 3ARGB 1UXWB 3BKJH 1U6AH 4CN1A 3QA3B 4EN3D 4UINH 3KPSB 4FQ2H 2VNCA 5DD3H 1PQZB 4AEIL 3C60D 4EN3C 5CLWA 5HHOD 5I1IH 4GQ9L 4APQA 1N6QL 2DKUA 4K7FA 3LEYH 3RVWD 3RVXD 1C5BH 5KVFL 5GRXG 4K3EH 1V3JA 1X9QA 2CRIA 4WO4A 4JG1H 5F7UA 2WUBH 2HT3D 5HYSG 3JTTB 1VACA 4JQIH 2OJZH 4H1LB 5J11C 1XGRA 3ARDA 1ERNA 2R1WB 4WCYL 2BC4B 1MCPL 2NXZB 1RUPH 4NZRL 1RIVL 3OQ3B 3QEHB 4I3RL 4APQB 3NH7H 1MEXH 1Q9WB 1JN6A 3QI9C 4NHUA 3STBA 4X6EA 2Y07L 1WZMA 4RMTA 4M8VA 4XH2A 5CP3A 5EZLB 2R2EB 3QEQA 4M4PA 3ULUL 4JVUA 4WW2B 5CJOL 4QTIH 2VB5A 2X4TA 1GGCL 4ISVB 4LCCB 2E9BA 3R06A 1N7MH 3U2SB 1CXFA 2W0KA 1F4HA 3X12A 3OAUL 4PRDA 5IBTH 1J1OL 3Q6FA 3E2HB 3F5WB 3REVA 3WHXA 4KJWD 1BM3H 1X4YA 1DVFD 1S7RA 4MNQE 3ULVC 2AEQL 4ODHH 4NHCL 4XH2B 1X5XA 1RIHL 4KJQD 2EDOA 1YYLL 1JPTH 1IQWH 3PWUA 4KAQL 4IS6A 2VZTA 2NY1B 2AJXL 3QI9D 4M4RA 4JFQB 4WUUA 5F44A 5C6TH 2R9HD 3BN9D 4P4RB 2L0DA 1KIRA 3NFNA 4O5LH 2XWTA 2ADFL 4ZFFB 4OF0A 5HDQH 4MLIA 5T1KB 3WFCL 2EEBA 3QIBB 2P8LA 1ZKAA 1CDIA 1RHHB 1YNLH 2RFXB 2VE6B 4PRPB 5FFLA 2HFFA 2AJSL 3QZWG 4RWYH 3S4SA 5L88H 4HZAA 1CZ8H 5ERWB 4NWTH 1UENA 2XKNB 1SJEA 1NCCH 4J4PA 3BXNB 4LEOA 1J86A 4P23A 4ZS7H 3TO4C 3EOTH 3V0VA 4ZAKB 2GSGB 3MLYL 1XF2A 3R0MA 1QR1B 3KPRD 5D1QC 5GZNC 3RDTA 4UQ3A 3BOVA 3CFCL 4PJXE 2C1PA 3CSPA 5D6CB 1CT8B 3UMTA 1XIWB 1ZT1A 5JPMA 1CICB 5TDPA 1PG7L 1UM4L 5B3JF 1OGAE 2HH0H 2GY7B 1WZ1H 1MFCL 5HHVH 3V0VB 4BH7B 3SDXB 4P4KA 2OMNA 1MFNA 5KSUA 1WFUA 4S1RH 4YHKL 2LU4A 2W9LA 1OPGL 3PJSB 4OUUB 4UTBH 1S7TA 4X7SL 2FJGB 2IANB 2NXYD 3F7RA 3FL7A 4U05A 2PTTA 2AQ2A 3B9EA 5IROA 2ZJSH 4LP4A 2X7LA 4X5LA 4J6RL 3ZDZE 4FTVA 4UT6L 5C0FB 1VENA 2QSTA 3GJEA 1ZEAH 4ZFGL 1HQ4A 2Z4QB 1DSFL 3TA3C 4C55A 4L1HA 4NJAH 4LLWA 5EA0H 1X5FA 1UCBH 3RUGF 2EE9A 2VXUL 3EYFB 1YEJH 2FJGA 1A5FH 1OTUD 4PUBH 5BQ7A 1C5CL 3FCTA 5TPWL 2NTSP 1FFNA 1DBAL 2OJZL 3D6GA 5I17B 1NFDF 1HHIA 5DHVB 1UZ8B 3O9WB 3LQZA 1IC7H 1KNOA 3TIEA 3CX5K 3VI4E 4FQJH 3HB3D 5DURD 1HQ4B 2Z4QA 4AG4L 3NGBB 1UM6H 3HZVA 2OL3H 4NQEE 4XPFH 4YWGL 3IDGB 3EO0B 2HJFA 4R4BB 4DWHA 4Z0XB 3SE9L 3OJDA 1JWSB 4QWWC 2DMBA 1PDKA 3VXNA 4I77L 1QSFA 5I17A 1CGSH 3QI9A 5DRNA 4LARL 2GITB 3C5JB 3TIEB 3WIFA 1JFQH 3ARBA 1FL5A 2JJWA 3MRCB 4MCZB 4OD1H 2P8PB 4JZNB 3BPOC 2C3VB 3LMJH 3VFGH 1JHTB 1CU4L 4YX2H 2JJVA 1IEHA 2JCCB 4R4ND 1AHWA 2BHZA 3B2UD 2I5YH 1QSFB 4MXWH 5FM4A 4I48B 2DRUA 4BSJA 1RURL 3MRKA 4P9ML 3MV9B 2QSQA 1FGVH 1P7QB 1M7DA 4BH8A 4WHCA 4IJ3B 5ALCL 2LU3A 5F1SA 2HTLD 2ZG1A 4N8VG 1FDLL 1G7PB 4M7JL 5LXGH 3L3DA 2R0ZL 5HVHB 3GGWB 2XKSA 2R2BA 3DTXA 2NNAA 1IMHC 1F3JB 2YRZA 2FR4B 3I9GL 2AJSH 4RSVA 4HUVB 5INCB 2VXTH 2IMNA 3VGGA 2R8SH 5JO5B 4KKBC 2XN9D 3KYMA 1Y6KR 3GRWH 4LNRB 2AXHA 3WJJA 5ID1B 5IWLC 2J88L 5H94A 1MCKA 1EXUB 1AXSB 4OCNC 4EVNA 3HC4L 1IAIL 4RQQB 1LO5A 4YHIB 5IKCA 5DJ0A 4CVUA 1GH7A 4WFEE 1KXVC 1QO3A 1KTLB 2VDKL 4GQ9H 3TT3H 2Q76A 1OAYL 5DD5H 2BOBA 1J9CT 2BJMH 4J23A 2BZDA 4U1HA 5J13B 2FATH 2EE3A 4NPYB 2H8PA 3TZVC 3JV0A 4OGAD 2EDEA 4G8GA 1AXSA 3RGVC 1NUGA 1FH5L 4MAUH 5J6GA 3SQOL 5I1AB 1TQBB 4ZXBD 4P2RE 3KWWB 2NLJA 4ZO7A 3QH3A 3N1GC 5EUOF 1OB1A 3BPLB 4XMLH 3OV6A 2IBZX 3QO0A 5F1NB 3SDCA 3VA6A 2OMBA 1EJOL 2UZYB 3GBMH 1RJYA 4AIZA 1L0XA 4A6YA 2AXGB 3HI6L 4HWUA 3OR6B 4KY1H 4WWKA 1KUMA 2Y36H 2YBRA 5CILH 1DBJH 5TGBB 5C0ND 3ZSSA 3PWJB 5KS9B 4X7TA 2JCCF 2NLJB 1A4JA 3QXTA 3O2VH 3MO1B 1MJJA 3ARDD 1JZ5A 5KVEH 1XFPA 5B3NA 4KTYA 5E4EB 4MJIE 4GKSB 3BP6A 5ILTH 5GRUH 1FVCB 4PJBA 3MACL 1A7PL 2AAVA 2IFFL 3BHBA 4OZFH 1JPSL 1CD1B 3G6AB 1KB9K 3RIFK 1UVQA 3MRRB 2YD7A 4FNLH 4PY8I 4RX4D 1KCSL 3QEQD 4FQCL 3TBYB 3O3DB 4LCIL 4WGVB 4Z77A 1R3LA 5J6HB 1Q0XL 4M1DL 1FZMA 3P4MA 1K3IA 1KIQB 5GGTA 3S35H 2NPLX 3ZHLA 2HT3C 3BP6B 3W9DB 5D7IF 1A6ZB 1F3RB 1Z9MA 4PJCE 4I3GA 4RX4A 4HWBL 1OAKL 5B21A 1UVQB 2P1YA 1VSCA 3H2WA 4DGIL 3VG0H 5FOBA 4L8BA 2YUXA 5K9JH 4L4VE 3K2UH 4MQ7A 1T1XB 4PRPD 4P57A 3GI9L 5DVNA 1RZFL 1ORQB 3OHXA 2YZ8A 2X4UB 5EC2A 1JGVL 1JF6A 2X1XR 2Y5TA 4HXAL 2YPLA 3HE7A 1KIQA 4FTVE 3T3PE 3WEXA 3EYSL 2GTZB 3C60C 4PJIE 4LLVA 1FL6A 2OM5A 1AKJD 4ODWA 1DR9A 4OSUH 1YJDC 5MEOA 1MLCA 2V5SA 4FMKA 4GMTL 4QRQA 4P3WA 4KTEL 1PKQA 1UKQA 1ZTXL 4U1KA 5I9QB 4BFIA 2N7AA 2WW8A 3AFLA 1B4RA 5ISZE 5C0JB 2D4DA 3MA7A 4C56E 1EO7A 1BJ1H 4IMLB 4MNHA 5D1XC 1JIBA 4NQCB 5CMAB 3K3QA 1F11A 1UG9A 2ERJB 3M1BB 4FFWD 2R0WH 3OKEB 1F4AA 4JGUA 4XAWL 3KLAB 5IB3B 2ZOKA 5F7DA 1UJ3B 1J8HD 3KXFA 5E5MA 1XGYH 2DWEB 1UYWH 3VXTA 3PUCA 5JOPE 1Q1JL 3FB5B 1IKNA 4GO6B 4X7SH 2DM2A 1QLRA 1CGWA 5ADPL 4LDOB 3FT2B 4H1LA 1MRDH 1RUML 4B5EA 3QG6A 1NJ9A 4NQCA 4ZFGH 4CAGA 5I1HH 2DQIL 5DD5L 4S1DD 3U7YH 1Q9WA 1R5WB 1H8SA 2ZSVA 5DUML 2ZOKB 5E8EB 5GGRA 3RNKB 3OKNA 3TO4D 1MQKL 1JE6A 1ZT4B 5I76A 3P9WB 3STLB 1T4KB 3MLTB 3T8XA 3DPBA 1VEMA 4YHZL 2F54B 4KHXL 3R06B 1G9MC 1R5IA 1BBJA 1D6EA 5ISZD 5HHQB 4UIMA 1YJDH 3BP5B 1BBDH 4EI5D 2IQ9L 3NA4A 1VKXB