4QHNA

I2 (unbound) from ch103 lineage
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
222
structure length
222
Chain Sequence
VQLQESGPGVVKSSETLSLTCTVSGGSMGGTYWSWLRLSPGKGLEWIGYIFHTGHTNYNPSLEGRVSISVDTSEDQFSLRLRSVTAADTAVYFCASLPRGQLVNAYFRNWGRGTLVSVTAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords I2 heavy chain
publication title Affinity maturation in an HIV broadly neutralizing B-cell lineage through reorientation of variable domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2014-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhnA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhnA01
1I85A 1EV2E 2VDOL 3BH9B 4DQOH 1DBKL 3G5XB 2JELH 3UTSD 3HZKA 4QRQB 1N59B 1WC7A 2IPKA 1JYXA 2B0SL 4MNGA 5F1KC 1I3RA 3AS0A 3DX6B 3B2UD 3PXHA 3KS0H 4HS6A 3DRTA 4AIZB 3BZ4A 1NMAL 3PQYA 4ZOBA 4YC2B 4GMTL 5MHSD 4YHNA 5K9QG 4LHUG 3WFZA 2BJMH 2XY1A 4OLXH 4M5ZH 4NGHL 1A14H 1NL0H 5DQDL 1NUFA 1NGYA 4OD3L 1EZVX 5KAQF 1JTPA 5KN5A 1I9JH 2X4OA 5F7UA 1P1ZA 3SE8H 2GCYB 5F7MC 5IGXL 4Q9QL 4AY0A 4HUVA 1YYMH 3EGSA 4PGCB 4AEHL 4Q0XL 1CXLA 4KHTL 1MQKH 2YPLE 1R24B 1OTSD 3WIIH 5JOPE 4YLQT 4KZEL 1ZGLP 2YKLH 5KSAC 1F00I 4V2CB 2WZPD 5CD5C 4JM2C 5FM8A 5DUPL 1CS6A 1RUPL 3OQ3B 1B2WH 5E8EB 2FHBA 4U6HB 3KXFE 2FECL 2Q76B 2KUTA 4XRCA 2RBLA 3EYFB 1YPZB 5HI4D 3CFJA 2OR9L 5DJXA 4LNVA 4KK8D 3IDMA 3AREC 2EZ0D 15C8L 5GPRA 3RL1B 3L3DA 5C2UB 2AJXH 1JN6B 4U1HA 1CDUA 3MJ9L 1QHOA 3GI8L 4U6VH 4YHYB 1T7WA 3EZJB 4LSRH 4R3SB 1CLZH 2CKBA 4GAYB 5CJXA 1ROWA 3NOIA 4X9GA 3MOQA 4L5FL 3L1OH 3I50L 1YEEH 2QQKH 5E5MB 4ENEC 1U8PB 4Q9CA 1KN4L 4NNPL 5D5MA 3EFDH 4R97C 2P8MB 2R0LH 3OGCB 3QQ3B 5BJTA 1R5VA 4P59H 2FX8L 2YC1A 1KUMA 3S37L 1E4JA 5J1TC 3OJ2C 2F54A 4PG2C 5JIHA 3R06B 3D3VA 3LMJH 5C9KA 5C9JA 1MY5A 1IILE 1FNEA 5J12B 1I7UA 2Q3AA 3NIDE 4UV7H 2DQTL 1I9RL 1UG9A 7CGTA 4OGAC 5IMKB 2NW3A 2RAMA 2QQNH 5KVDL 5GRUH 2P5ED 2E9BA 4I3SL 3GSWB 4PJDA 1BVLB 1NUDA 4WTZG 2E5EA 4UV4L 2AQ3A 3DOSA 1QBLL 2W65A 1AC0A 4H5SB 5F7YC 4D9RE 4QNPF 3DVGB 4N8CL 4LKCA 3UX9B 2BVYA 2PYEE 1Z9SA 4LGPB 5GGVL 3FOMA 4N0UE 2DWEA 1M4KA 2P5WD 2O5XH 3H42L 2IMNA 1UWEL 5ADPH 5IKCA 1EEZA 2RCSL 4YFDB 4I8DA 1ACZA 1IAKB 1ZVYA 4LVHB 4OI8A 4OZHB 2J12B 2H2SD 4Y8AA 1B6UA 4LCCA 3HAEG 4IMKA 1EVUA 3ZHDA 4AQOA 1KCLA 1AGDA 2X4UB 3B2VL 4KI5E 1X3DA 3LD8C 3EDEA 4JCLA 4CMMB 4X4YB 1FZOB 2PO6C 4E41A 1V3MA 2BERA 1AP2A 4JFHD 2HN7B 1LWRA 2NY6B 4IM8A 2QQLH 1WEJH 3G6JB 4JKLA 4N9GB 2R1WA 2JB6A 1YEDB 1IEAA 1UADC 4KTYA 3W0WB 4U3HA 5FM5M 1NEZB 3H3PL 4ONGH 5A16B 4XTRD 1XH3A 4GMSH 5JDSA 5JXED 1D5MB 5HHNA 5A2LH 4LPCA 4Q6IB 3TVMB 5C0BD 1KJ2B 3T09A 3L5IA 4RCAA 5FKAA 2R2HA 3QNZA 5FO9B 1NCTA 3RHWK 1U3YA 1BEYH 1EBAA 4QRTB 3MRLB 4HUWA 1WK0A 4EVNB 1KXQE 2KL6A 1CG9B 2X1QA 1TMCB 4LU5L 3GIVA 1EHLH 1CL7I 3UYOD 2DTSA 5FUZH 2IANB 3X12A 4H26A 4PJXB 3I6GA 3HRZB 3QZWA 2LVCA 4ZYKB 3RKDD 1IGMH 1NAMA 2IBGA 3QHFH 1BM3L 3ES6A 4NHUA 1EDQA 4P2QD 1XR9A 3LIZL 5DJZA 3SKOB 3T2QA 3O2WL 4P2OA 4TYUA 4P3CH 1EVTC 3IU4H 3E3QC 1JGLL 1YPZE 4ZUWA 2WP3T 4MVBD 5GIRB 2RJMA 3VDCA 3LEYL 4HIHB 2Z31A 1X4YA 3ECBB 4NN6B 2GJ6D 1FLRL 1N2RB 5IWLC 4X9BA 2LFGA 3S8WA 1YMHB 2PXYB 4WW2A 4JEGB 5IG7A 1MJUL 5HYSA 3RWHB 2BOBA 3QUMA 3QIBA 5CKGA 2YRZA 3TF7C 3JV4B 3WL9B 4ONFL 1PQZB 4PJ9A 4OLWH 2IGFH 4PJIB 3EBAA 1IGCL 2ZJSL 1P9MC 5DJCA 5K9OB 1GOFA 5D6DC 4MNQB 5E94A 5JW4N 1JK8B 4LLUB 4YBLB 1RPQA 3LKSA 5KZCB 4WHDA 5EFIA 3U0PA 4PJEE 1KSRA 4I0KA 4LPXA 3H9YA 5HJ3A 2XZQH 1UM4L 2DLGA 4BH7A 3NFSL 2IAMB 3WUZA 4C57C 1T4KB 1T2QH 4YHKL 5FYKE 3SDCD 3U4BL 3S3PA 1S9VA 2W0KA 4X7CC 4XP6H 2WANA 2WINB 5C6TL 4HHAA 2NXZB 5GJSH 5EBGA 5LGHL 1MCIA 1ZVSA 3Q6GH 3GKWH 3LKOA 5D1XD 2DI7A 2PN5A 4N0CD 5JW3H 2PR4L 1MVUB 3LAFA 3R4DA 4YE4L 3D0LA 3QAZC 5CKAA 1KPRB 3HE6C 4F15C 1MCNA 1OT2A 3TYFB 3L5HA 4KTDL 3SDDC 3FCTA 2VDRL 3PHQB 1A1OB 4WV1C 1DBAL 5F7DA 4YQXL 2R1XA 1TENA 4JFEA 2P43B 3O9WC 5JO5A 4R4NC 4GJTB 1OL0A 5JIPA 4LF3B 5I1CH 2OYPA 3TEUA 4WFEE 3C8DA 3DI3B 1VENA 5HHOD 4OZHE 5EU6D 4NZJA 3QYCA 5CBAB 4JVWA 4LOUD 3S37X 4CVWA 3LVEA 2ZG3A 3EYVB 3BPLB 3RDTB 3V2AR 2YUZA 2Y4SA 2H2PC 3BPCA 1JRHI 3P9LA 4KUZH 5H35B 2OZ4A 5BMFH 4ODTH 3G6JE 3T8XB 3MCLL 3FO1A 1UQSB 4QRRD 3WNKA 1JHTB 3CPLB 4QHNA 5TDNB 4PY8I 2JJWA 3W0WE 1UCBL 1ZA3A 1B88A 3ZE0E 1S9XA 2HFGH 5E2VH 1IFHL 4L8BB 2HT3C 1GYAA 4FFWC 4NKDB 3J7HA 4O2FB 4BK4A 1TZGL 2XRAL 1FO0B 1BJMA 4ZSOA 1R3LA 4JY4B 3MUZ1 1TNMA 3T0WA 2OSLB 4XP4H 3MRHB 1HIMH 4J1UB 4UDTB 4IRJD 5C71A 1HK6A 1J10A 3X3GH 5J9PA 3T1FA 1AC6A 1UEMA 2EDKA 3DGCR 1U6AL 4GW5B 3W9DA 3A6BH 3O3AB 1IAMA 4M4PA 1NKRA 5CD3B 1HH6B 3UYRL 4S11A 1Q9OB 2IANE 4PJXE 2FGZA 5E2WH 5DMIL 2M26A 5J0BA 5D7IF 3ULVL 2JCCB 2R8SH 3P0GB 2XACC 5KS9E 3DX7A 2PKDA 1BIHA 3M07A 5JOPD 4EBQL 4Y4FA 1RK1A 3VD9A 3JTTA 2F5AL 1T80A 3DI2B 1JHLL 1Y6MR 2ERJB 4KK5C 1CDIA 5F1NB 1G9NL 4UU9A 4RMWA 4UNTA 1PG7W 5IR1B 3U48A 4M1DH 1T1YB 3TN0B 2KZWA 5INCA 1LEKA 1A7QL 5IK3B 1FL6B 1V8HA 3GSNH 4P5TA 1PY4A 2KKQA 4QHUA 3P4MB 2F74A 4XWGL 1LK3H 3NFNB 3TCXA 4OV5B 1FFPB 2OJEB 3HCVA 4JFQB 5IBTL 5ESAB 3G5YA 3MX0A 4P23B 3C6LB 3BP7A 4FOMA 4I0PA 1NBZA 3U9PL 2CPCA 3PWPB 4QTIH 1ZEAL 2Y9RT 3VI3E 4JN1L 4MNQE 2G60H 2WBJB 2IFFH 1T04A 1HQ4B 3EFFB 1CE6A 2RIKA 2IWGA 1BMGA 1XAUA 2AK1H 4PUBH 4ZXBD 5CMAA 2W9EH 5FGCB 1U95B 4EDWH 4EI5D 1U3ZA 4YHIA 3GMPB 4W81A 4I3RL 1MHHB 3BJ91 3KPMA 1BF8A 1T0MB 4ZS7L 2G5RA 4XBGA 5FHBH 3C60C 3LB6C 5L7XH 1I9EA 5CP7B 2Q20A 3W9EA 4PRDB 5I1IH 3TYGH 1QFUL 3O4OC 4K23H 4X5XB 4Q2ZB 5HDBF 4Z7UB 1NLDH 3CK0H 2EDJA 2ZKHH 1QVOA 3VGEA 4G80A 3SKMA 1G7HA 1E4KA 3MRBA 1SJEB 2EDFA 3NCJL 5E6ZA 5DHYA 2LU4A 5DQ9A 4JHWH 3VXQA 3RWEB 4ORZC 5IBUB 2RGSA 1H5BA 3ULUC 3WO3B 1MCBA 3KPNB 1H8OA 5EBWA 3DV4B 4YZFF 4KUCD 1MCEA 2ZP0T 3MRNB 3Q2CA 4LFHG 4OM1L 4PTUB 5FGSA 3TO4B 2APBA 4D3CL 1HDMB 1RJYB 3HE7A 4D9RD 2ICCA 4RWYH 2VDLL 4XAWH 1NGWA 2ZUXA 3WUWA 4UZGA 2PYED 3JWDL 5TE6L 2Z35B 4Z76A 3RTQC 4LGSB 2XZAL 3ZE1E 1MAMH 4XMPL 4N0YL 5GRVL 1A5FH 4KQ3H 3MO1A 5FOBB 4F9PC 2CDFB 3I75B 1XF5A 1P84J 4XC3L 3ZSTA 1CXHA 2VLLA 1KEML 4XNUL 4YPGB 1MPAL 2FLRT 4LPYA 2D9CA 2Y36L 2GSGB 3KYNA 1NAKL 4ZPTA 5I75C 4YHML 3O3EB 4FQ1H 5ACZB 1CGTA 1A22B 1HINH 3V8OA 2AJSL 4F8TA 2AJYH 3QUKA 4P5KA 1U9KA 2AQ2A 2P45B 5KSUA 4X4MA 4MQSB 4GAJL 3HZKB 3U30C 5IESH 3GDBA 1G9MC 1WC7B 1N3NB 3T4AB 2JB5H 5ANMA 4PGJA 3I3EA 4BFIA 2IPKB 3ZYIA 4MNGB 1I3RB 5KSBA 1K5NA 4PLKD 3RFZC 2C3XA 2P47B 3BKYL 4HS6B 3RZCC 3UYPA 4Y4KA 3DRTB 3PQYB 4FFVD 1S5HA 4YHNB 1WBYA 4ODUB 2MCPL 4MD5A 4JFFD 5KVFL 3QNXA 4IOFD 3SDAC 4ZAKB 1NGYB 1RMFL 5GHWL 2W0LA 5KN5B 2JCCE 1P1ZB 5F72S 3EYQD 3KPTA 1BFOA 3GSXA 3VGDA 1MWAH 2I60H 2XZCL 1ZLSH 4HUVB 2AS5M 2Q8BL 3EGSB 5D71H 2BHUA 5KVEL 2R0WL 2NZ9D 4X83A 3M8OH 2XTJD 3PJSB 5BRZE 3FT3A 4X6CA 3H2WA 4KDTA 25C8L 4Y1AA 5CEZH 2ADGA 4RX4D 1OP3K 4J4PC 4EUPA 1IBGL 2HKFL 5DZOA 4RGMC 2CDEA 2VR9A 3VG9C 2VYRE 5E8DL 4XRCB 4OKDA 3IJYA 1OT1A 1MREH 5DJXB 2DLIA 1YEHH 2ZOKA 4PV9B 3RY4A 4DQOL 3IDMB 2JELL 3PWPE 3BRGC 3CCHA 3L3DB 2OMNA 3BIKB 5C1MB 4RFEA 4Q74A 3VFUA 1NJ9A 5CBEA 4UTAH 4IS6A 1R3IH 4U1HB 3QRFM 4PLJC 5K33A 1A02N 3IGAA 4PJ7F 4J6RH 3TH2T 4FS0A 4XCCH 1E6OH 4QTHA 2CKBB 1DDHA 2WP3O 5DMJB 2QQQA 1SYSA 3L7FA 4ZFOL 3Q6FA 5F7FA 2ATPA 1SJHA 4MS8C 2BJML 5D5MB 4OLXL 3TV3H 3JVGC 3MJ6A 4HSQA 4M5ZL 1A14L 1NL0L 1WV7T 3EYOA 1TFHA 4Z7UE 5BJTB 3UTTA 1R5VB 3VXSA 1MIEH 1F4HA 2YC1B 4QXTA 4PJHA 4YBQC 1RD6A 3TBWA 2F54B 3D3VB 2YS4A 5C9JB 5D1QC 4U0RB 1YYML 2ZCKH 1JF6A 1H3PH 1NANH 3ULUH 4PP1D 5F70A 5FUOH 1L4IA 1FNEB 3AMKA 4OCRH 1MQKL 2ATKA 2YZ8A 1D9KA 4NT6A 1I7UB 3WIIL 4NZRH 1NCCH 3ROOA 2YKLL 1IKFH 2CR3A 1CVRA 3QXUA 2NY4B 1PJ9A 1T20B 5CJ5A 2NW3B 1QSZA 5F7WC 1QNZH 3KPLA 1B2WL 3DROA 3PV7A 4OFIA 4PJDB 1XF4A 1ZTXH 4L3EB 2W65B 3WNOA 1D7FA 4LKCB 2XQYG 4QHLB 3FOMB 1T21A 2QBWA 5D1ZC 2DWEB 1AHWA 5IKCB 3IXAA 2FHCA 4NJ9H 3NABH 1EEZB 4QXUH 5I30H 4QO1A 2AJXL 3T1WA 2XN9D 3ARED 4U6VL 1A6AA 3JTSA 4WTZA 1DE4A 5ALCH 4LSRL 1CLZL 5FV1L 3LSOB 4LCCB 3EO1A 2NY6D 4JKMA 3L1OL 4HV8A 4JO4H 1AGDB 1YEEL 2QQKL 1OWWA 1HHGA 4NO0A 4Y5XC 5LGJA 2H8PA 1G9MH 1CICA 1D5ZB 1K4CA 3EFDL 3SO5A 3QXWA 4E41B 3W0WD 4ENED 1AP2B 4Z7WA 2R0LL 3NMEA 1FVEA 4NKMB 1J9CT 3FONA 4P59L 3RWCA 1MH5A 4DJMA 2R1WB 2JB6B 2VKWA 3TVMD 3IAPA 1IEAB 2ZOLA 4MXQC 2LAGB 3PQYE 3LMJL 4HDIA 2B8OT 4XNQA 2CO6B 2B7DT 3NCFB 5JDSB 4LIQH 5HHNB 1A6PA 2F58H 1WWAX 4UV7L 5ETUA 5FKAB 4Z7OE 4MCYA 2R2HB 3QNZB 1KJVA 1CDCA 5EZOH 1A3QA 2QQNL 3IFOA 1IKNA 5GRUL 4F57H 2BDNH 4HUWB 2ID5A 2ZUUA 5I8KH 4OGAD 4PJGE 3V4PH 1PX3A 3GIVB 4FG6C 3IAGC 2QV2A 1CXIA 3X12B 5HHXH 3I6GB 3WMSA 2AAVA 3QZWB 4K71B 4M6OH 2O5XL 1A0QH 1NAMB 1FYTA 5ADPL 4Y7MA 3ES6B 4NHUB 4DZBA 3DARA 1RZIA 3WEXA 1XR9B 3U0TA 1VSCA 5DJZB 2N7BA 4P2OB 4UT7H 2QJDA 5LGKA 4OI9A 4ZUWB 4BELD 4DCQA 2Z8SA 5I1GH 1FL5A 4PRPA 2PXYD 1IC1A 1ITBB 4UB0H 2Z31B 1EGJA 5D6CA 4WIQA 2EE6A 4OCMC 3C5JA 1ZA6A 3WD5H 1PZ5A 1CWVA 5T1LD 3MPCA 2QQLL 5HDLA 1GHFH 3NVQA 1WEJL 2VE6A 5HGBA 4WW2B 2VIRA 2OI9B 5IG7B 5HYSB 4CL7A 2IF7A 2BOBB 3ZYJA 3QUMB 4ONGL 3QIBB 5FA4A 5HD8C 2CXKA 4GMSL 5KZCD 3CMOH 4P46A 2GT9A 3IDUA 3EO0A 4PJ9B 1WWWX 5D5ME 3TBSA 2E6JA 1VFOA 1FNSH 2DM3A 5DJCB 4YDVA 5E94B 4P2CG 1TQBC 5FYLH 2IAMD 1ZWIA 3U0PB 1BEYL 2YN3A 5ACMA 3WS3B 5HJ3B 2F54E 3O8XC 3ORJA 3U36B 3MRQA 1S78D 3D3VE 3SE3A 4BH7B 1EHLL 2QTEA 1RUAH 5I8OH 4M8QA 3OTTA 5EOQH 5FUZL 5JNYB 1S9VB 1S7QA 5D7LA 1IGML 4JANA 3QHFL 3PHOA 3DECA 4JVUA 1QYGH 5SWQA 1ZVSB 1H9VA 3LKOB 4NO3A 3STBA 2NY1C 4I13B 4PJDE 4P3CL 4N5UA 3IU4L 4L3EE 1DANT 3MNVA 3JBG7 3D0LB 1VESA 4Y2DA 4X7EC 3PWLA 3FCTB 3B43A 4BUGA 3VXMA 2Y5TA 1BLNA 1KLGA 2GQHA 3SO3C 4ZTOH 4ZOEA 5F7DB 2R1XB 4JFEB 4QGTA 5HI3C 5JO5B 4POUB 4OFYD 4HS8H 3RDTD 3MNZA 2QEJA 4XBEH 1F5WA 3D85A 3U7AA 1P7KA 3HN3A 3PP4H 1YZZA 1A9EA 3NIDF 5T3ZH 3VD5A 4OLWL 5SWSA 5J1SC 2IGFL 1H15A 3V6FA 4CNIA 5I76A 3NBNA 1KBGH 3BPCB 3P9LB 1R0AH 4KUCF 1A9BB 1ZLWH 3FO1B 4U1LA 1FAIH 3FFDB 5BOZG 3ARBA 2VAJA 2XZQL 1T3FA 3S36H 1ZA3B 3CX5J 1UM5H 1S9XB 2Q7YB 2VQUA 1NUNB 1YEKH 4RFNC 4XP6L 3RWJA 3D1MC 1R3LB 3C09B 4ZSOB 3UZQA 5GJSL 5SX4H 3WHXA 3Q6GL 2L0DA 3GKWL 4OZFH 5CZXC 5J9PB 3T1FB 2ZSVA 5JW3L 2NTSP 3W9DB 1KYOK 4QOKA 4Z7QE 3K2UH 1DEEA 3B3IB 4X98A 1K85A 1EIBA 2JKXA 5AZEH 2AXJA 3HUJA 4OIIH 3O81A 3PIQB 1S7TA 3QFJA 3DX7B 1UENA 5A1AA 5I1CL 5MP6H 2XKUA 3IRZA 4Y4FB 3UC0H 4ZFZB 4R4ND 4EXPX 1RK1B 2YRPA 3D39A 3JTTB 3DVNA 4KI5C 3RVWD 3TN0D 4WY7H 4WDIA 4LP5A 1KLUA 4CVUA 4UU9B 2PF6A 3VH8A 3TBYB 4XVJH 4P23D 3C6LD 4NCC2 4KJYB 4MAYC 5INCB 1JZ3A 4KUZL 1LEKB 5BMFL 4H0HB 4ODTL 8CGTA 4P5TB 4QHUB 5MENA 2F74B 2R29H 3HCVB 3MRFA 4JREC 3G5YB 1HYSC 2WBJD 2EH7H 3BP7B 2NX5D 1HZHH 1NBZB 2HFGL 3TA3C 1MOEA 5E2VL 2X1OA 4HKZA 1KJMA 2VL5A 4JPIB 5HGDA 2HKHH 4OCYH 2C1OA 3SGEI 4XP4L 1T04B 1CE6B 1HIML 3EOBA 3QG6A 3MRDA 3U46A 2IQ9H 4QXGH 5CMAB 5B8CC 3X3GL 3P9MA 5IEHA 4YHIB 1U2HA 2H32A 3EYSH 5F3HA 5DD3H 3KPMB 2V5SA 5E2TH 3A6BL 4MA1B 4XBGB 2B1HH 3W9EB 5E2WL 3ULSA 3IFLH 3DWTA 4MHHI 2A0LD 2R8SL 2APVA 2LE9A 4J3SA 3ARGC 1C08A 4PLNC 3WXWH 4XHJC 1QVOB 5IVNA 4G80B 2DM7A 3SKMB 1G7HB 3MRBB 3TO4D 5CEYA 3OGOE 5J3HC 5DHYB 2Z93A 2KQMA 4I2XA 5AEAA 5DQ9B 4YXHH 3VXQB 5BXFA 2AJZA 1IEHA 3L5JA 5H37H 4DOHB 5EBWB 2OTUA 3RY6A 1UZ8A 1FG2A 3WFCH 3FFCD 4M1DL 1BJ1H 4JFEE 3HE7B 1NGWB 3WUWB 1MCKA 4BSWA 1ZHLA 2VXUH 1LP9A 2F5BH 1IGJA 3GSNL 4Z76B 1L7IH 1KPVA 5IP4A 1LK3L 5C07A 2X7LB 1V3JA 1GH7A 3H7BA 3DO7A 1SY6A 4JO1H 5DZLA 1H3GA 3IJHA 4QTIL 4CUCA 2FJHA 3BUTA 5IB3A 1PGRB 2E7LA 3NCYS 32C2A 4IIQA 5FIEA 2G60L 3EUUA 2VLLB 5I1AA 5M95B 2IFFL 2ARJQ 4LPVA 1PX4A 2EE9A 4PUBL 2CH8A 2AK1L 3KYNB 3MMEA 4ZPTB 3ZDZF 2W9EL 4EDWL 1MFNA 3TBVA 3NCBB 2BSSA 2NY0B 4M6MH 4PGZA 5SV4A 3QUKB 4P5KB 5FHBL 4K7FA 2IPTH 4LL9A 3X13A 3MGTA 5KSUB 4OD1H 5HHVH 5I1IL 4LBEA 3PQYD 3TYGL 4K23L 4JJ5A 4ZSOE 1NLDL 3NTCH 3CK0L 3C60D 4GBXC 5ANMB 2ZKHL 4BFIB 1F02I 4OZHF 1R6VA 1FNAA 5KSBB 1K5NB 1MCCA 1W2KT 1QSEA 1EH9A 1I1AC 5TF1H 4HGWA 2WWKT 4L3AA 1S5HB 1TPXB 4AEFA 5KBNC 5JQHC 1WBYB 1MHEA 4IRSA 2XXCB 4JHWL 3S6CA 2AVGA 2LTQB 4HW6A 4MD5B 2UVEA 4ODSH 4NQEA 5FEBA 1QD0A 3G6JF 2JJSA 3IYLW 4RWYL 3BWAA 4XAWL 1MY7A 1BWWA 4D9QE 1Z9MA 1BFOB 3GSXB 3UBXG 3L7EA 3HMWH 1T6WA 2BY3A 4YUEH 3X11B 3TJHC 4JFOA 3RJDA 3K0WA 1KNOA 5IJKC 3BX7C 1S9YA 1HI6A 1MAML 5IHLB 4Q9BA 5IMMA 1IQWH 5EWIH 1A5FL 4KQ3L 2R69H 3ARWA 3FT3B 2Q8AH 4X6CB 4HUUA 3F5WA 2VZSA 4Y1AB 3UZEA 1U8MA 2BFVH 2ADGB 5DT1H 1R3HA 3JZ7A 5GXBB 3RX5A 4EUPB 1MCOH 1N6VA 4HCRH 2CDEB 2DDQH 4GRWF 4WEUD 3KLAA 4FQ1L 2YHGA 2EIZA 5I2IA 2C7UA 3IJYB 1HINL 4HLZG 5F71A 2NYYC 2AJYL 5I73C 2ZOKB 4QY8A 1X5IA 4KGJA 1KTKE 3CCHB 3CD4A 4KKCD 4XXCC 5IESL 5JOEA 2J6EH 4RFEB 3S9DB 2JB5L 3VWKA 3WO4B 1NJ9B 2J2ZA 5CBEB 3LQAC 4IS6B 4U2ZA 3IGAB 1I8KA 2B4CH 3O2VH 4F8QA 3GB7B 3OB0K 4QTHB 3MCKA 1DDHB 3IDNA 1SYSB 4KJPD 5GGRB 3L7FB 1DQJA 5IHZA 1HH9A 2HVKA 4BJLA 2AGJH 3D3VD 2D7MA 3EYOB 4MYWB 3MFGB 4LRIC 3UTTB 3VXSB 4QXTB 4PJHB 4HXAL 5J13B 1MWAL 4PD4J 3BN9C 1MCFA 1ZLSL 1PYWA 4TTDC 5D71L 2NY4D 2PYFA 2NPLX 1P5VA 1X4XA 4PJIF 3M8OL 1RUKH 4NT6B 1D9KB 3VI3F 4DOHE 1ZGLM 1G6VK 4U1SA 43C9A 3B5TA 2VO5A 3ROOB 4NFDA 2DICA 5CEZL 3N06B 4M7LH 2DD8H 4Y4HC 2UWEA 4HKBA 3KPLB 3UEZA 3CDGA 1XF4B 1HILA 3P2TA 2AJ3A 2R23A 3MZGB 4G6JH 4J4PD 3AC0A 4KV5F 4LLDA 5IVXA 1TQCC 1MREL 1KIUA 1YEHL 2W0PA 1T21B 5C6WH 1CFSA 3IXAB 5ID1A 2UVFA 3BKJH 4Y16C 4UTAL 3KYMA 3CFEB 1R3IL 1A2YA 5TH2A 1OM3H 1N0LA 4WW1A 3ESVF 1A6AB 3FQXA 5L6YH 3ARQA 3JTSB 3FT4A 5FYKH 4J6RL 4GRLC 3UZVB 4PB9H 4XCCL 4E41D 1E6OL 3EO1B 5GS0H 4P49A 5FYJE 3H3KA 4HV8B 4NO0B 1HHGB 5LGJB 4X6FA 4YDJA 2H8PB 2NXZC 1CICB 5M7QA 5EO0A 1K4CB 3TV3L 4F80A 2YPVH 5DHVA 3CU1A 4Z7WB 1FVEB 5ANME 1KG0A 5IBLD 4DWHA 2I5YH 3FONB 5IROC 1MIEL 5KSBE 3RWCB 5DGQA 1L9MA 2GAZB 2ZOLB 3OXSA 2NLJA 3DGGA 2YD2A 5DVMA 2ZCKL 3ULUL 1H3PL 4YBQD 5C0ND 2Q86A 1DBJH 5FUOL 4OCRL 5E4EC 4KTEH 3ABZA 5DVLA 4CMHC 4NZRL 1NCCL 4JAMA 1IAOA 1IKFL 5ETUB 2ICWA 4MCYB 1T1XA 1KJVB 2OQJA 4PJAA 5C0JA 2HFFA 4NZTH 3IFOB 4ZNEA 1DVFB 3O6FA 3RUGF 2DM2A 3QDHA 3RWGA 1ZTXL 4FZ8H 4U1JA 4E0RA 3BPLC 5DJDA 5D8JH 4P2OD 4EN3A 1FYTB 4F7MB 4NJ9L 4DZBB 1FGNH 4HXBH 1RZIB 2BY2A 3NABL 4QXUL 4YHZH 3U0TB 3WEXB 3SN6N 5I30L 1IM3A 1IL1A 2Z31D 5DEGA 5EDXA 5T1DH 4CN6A 4QHMA 5J4MA 3KJ6H 3EOYG 1KJ2H 3B9VA 4DCQB 3DO3A 4YJZL 1FL5B 4PRPB 5LKNA 2ICWJ 4JO4L 3K8MA 1WQVT 2FECI 3VGGA 1G9ML 5CHNA 5GQBA 2JCCF 5D6CB 1XIWA 1VEMA 3C5JB 1ZA6B 1PZ5B 2A1WH 3QIBD 5DURB 4DFHA 5IQ9A 2VE6B 1KB5A 5HGBB 4PJ9D 4HK3N 4UI2A 2VIRB 4M7ZB 1NH6A 2X05A 4U6XA 1IARB 4POZC 3HAEH 1TJHH 5FA4B 3S35L 3DURA 5DMKA 4P46B 2GT9B 1O0VA 2QR0A 4LIQL 3TFKD 2A73A 2AABH 5HTSA 1J1PH 3A67H 5E00A 3TBSB 2F58L 4YDVB 1F3DJ 1ND0A 4GG6A 3O6KH 1CD9B 5EZOL 3UTTE 1ZWIB 2WNGA 3NZ8A 4F57L 4PJHE 1WFOA 2BDNL 4PJCE 5I8KL 2GUOA 5J06A 3L3KA 1OB1A 3OG6B 3V4PL 2EDTA 1CGUA 4Y88A 5H94A 1MFDH 2YD8A 4NJAH 4B0MM 1J18A 3AY4A 3MBEA 4M8QB 5SV3A 4MA7H 1WT5C 2CLRB 3QPQC 4BQBA 5HHXL 4M6OL 5D7LB 3KLHC 2CXGA 1A0QL 3MLUH 4JANB 3PHOB 5SWQB 1DANU 4U1NA 2XI9A 5IJVA 4NO3B 1OSPH 4O58H 3TT3H 4UT7L 2V2WA 4S2SA 4XPBH 3MNVB 1EO5A 5F9DC 4QWWC 1XCQA 4S1RH 3RU8H 3OV6A 5I1GL 4Y2DB 5DC9B 1OTTD 3PWLB 4F37K 4UB0L 4Z7UF 2WMPA 3H9SA 1Q94A 3VXMB 2Y5TB 1BLNB 1KLGB 3EHBC 2UYLA 3E6FB 3VFWA 3WD5L 2M8XA 1GHFL 1IC4H 2IBZY 4YHOH 3V5KA 5F93C 4IOIA 3BFOA 1P7KB 3W11C 1A9EB 4L4VE 4P9MH 1JZ7A 2VDQH 3CMOL 5E99H 3V95A 5SWSB 3QIUA 5MEOA 1H15B 1FNSL 3HZYA 3V6FB 4CNIB 3S34H 4KKLD 4QRPA 4Z7WE 5FYLL 5EZJA 4AMKH 1FVCA 2FWOA 4A6YH 4U1LB 3ARBB 4WENB 2G75A 1T3FB 3RBSA 3JUYA 3U0WH 1RUAL 5I8OL 2X9YA 3ARDA 5EOQL 3F6LA 4KK6D 4WHCA 4KVNH 3AM8A 5GGQH 4BH8A 3RWJB 3OSKA 3WHXB 1E27B 1QYGL 2IQAA 1J7VR 5C0AE 2BC4A 3TZVC 3WJJA 3BUYB 3MLRH 2ZSVB 5MI0B 5F6IB 4QOKB 5IB4A 3CFKA 3MR9A 1DEEB 4X98B 3V6OA 3ILPA 5F7NC 2J5LC 4Y4FD 5J7CC 3HUJB 1FYTE 4RGNB 1J12A 4ZTOL 1FSKB 3MGAA 3QFJB 5TF0A 2IALB 3WNLA 5FCSH 4HS8L 5B3NA 2N1KA 4XBEL 2HLAA 3D39B 2WWKO 3PP4L 4WDIB 4PRPE 1KLUB 1A64A 4WI9A 5T3ZL 3ZMRA 1EZVY 4P5TD 4H1LB 2GITA 3VH8B 3WDJA 2GY7B 1KBGL 1OQOA 2ICEA 3GRWA 1R0AL 4OGXH 1CD1A 1U3JA 1MUJA 4I0PD 4FQPA 4LLVA 4KHXH 3Q5OA 3CUPA 4P4KC 5D7JC 5MENB 1FAIL 3MJ9A 1KTDA 3MSPA 3MRFB 3PWJA 3S36L 2R2EA 3T0EA 1KEGH 3SGDI 3ARFC 1UM5L 4ZAKC 2DLHA 5GZOD 4HKZB 3OR6A 1KJMB 1YEKL 2VL5B 1FFRA 5HGDB 3D2UA 3CIQA 4LVNC 2C1OB 1P4LB 5J1AA 1E6JL 1YEIH 3EOBB 3QG6B 3HNVH 4MXWH 4BUHA 1RU9H 3MRDB 5DC0A 4JZOA 3U46B 4PBWD 3P9MB 3BT2H 2H32B 5F3HB 5F97E 2P46B 3MV9A 3K2UL 4LCUA 2XQYK 1Z3GH 4MA8H 3WHE0 3ULSB 5D7LE 5AZEL 4X5LA 4OIIL 2YUXA 4XCEA 2X4PA 5C6PB 4UILH 1N6QH 1C08B 2Y72A 5MP6L 2CJUH 3S5LB 3UC0L 5JZ7D 2X9WA 3OKYA 5CEYB 2WBWB 4Z6AT 3HE7D 2Z93B 4WY7L 4I2XB 5BXFB 1WZMA 2EEBA 2AJZB 4TNWK 1S7RA 2DQUH 2OTUB 4JO2H 3VXME 1UZ8B 3SBWC 1FG2B 2ADIA 3NH7H 2RQ8A 5ICYA 3S35X 3LY6A 4XVJL 1BZQK 4N5EC 2X89A 5I8CA 4UOJA 1ZHLB 4BK5A 4NBYB 1LP9B 1IGJB 1KPVB 1U8HA 5C07B 4MAYD 2R29L 2EKJA 4NWTH 3DMMA 4MAUH 1LQSR 4LCWA 3GHEH 2EH7L 3H7BB 3DO7B 3BEVA 2YD7A 1HZHL 4PGBA 5CP3H 3IJHB 5SWSE 1YEGH 2FJHB 5IB3B 2NY0D 5FYJD 2HKHL 1A7RH 4O02H 4OCYL 2EEAA 4PJDF 3SGJA 4XVUC 1LO4H 2G5BA 3MMEB 1I8LA 2IQ9L 4QXGL 1J1XH 1F4XH 2VXSH 3PV6A 4PRBA 3ZE2E 3DXAA 4QHKJ 3TBVB 2BSSB 3EYSL 1UWXK 3QCUH 5DD3L 3RGHA 5E2TL 4HZLB 1QQDB 4LKXA 4BSVA 2IJ0C 2B1HL 4K7FB 5JW4M 5KTEH 3X13B 5E24E 3MGTB 4KPHH 3VXTA 4Y4KD 5GS2H 4LBEB 3IFLL 2QLVB 4JJ5B 4AG4H 4WFGE 3WXWL 1VFAA 5C0FA 2NZIA 2FD6H 4TSBH 1OD7A 4HGWB 1C5BH 3ARGD 1ZOXA 1DQLH 1QKZH 4YEEA 4U3CA 3LPGA 4YXHL 1MHEB 4IRSB 4QOKE 3KPPA 1Q9WB 1G9EA 3OJVC 4NQEB 1GC1C 3HUJE 3FB7A 4NFBA 4YH6A 3WFCL 5CAYB 4CADA 2UZYB 1OPGH 3BWAB 3FQUB 3FO0H 2E27H 3QFJE 3ROLA 1F4YH 2XNAA 4B5EA 2VXUL 3L7EB 4LSPH 1ZS8A 2F5BL 1L7IL 4J3XA 4WI8A 5I18H 4OZIA 4Y1AD 3IAQA 2IFGA 3D39E 1FZJA 4ZO9A 4JFOB 4NWUH 3T0DA 1KNOB 1S9YB 1CIUA 1HI6B 4JO1L 4FP8H 5AAWA 3F5WB 1U8MB 3GMMA 2DKUA 4KJWC 1R3HB 4JJHA 4EXKA 3FAWA 2D7OA 3SGKA 3VFSB 2OR7A 3D6GA 4RWHA 4XP9H 1MRFH 2ZNXA 4NUJA 3KLAB 2EIZB 5I2IB 2C7UB 4HPYH 4M6ML 7FABH 3DRQA 4J2XA 2EKSA 2IPTL 4QY8B 4HMDA 4OD1L 5HHVL 2PCPA 1Q38A 4UTBH 1F58H 5KAQG 1EFXB 4ODBD 3NTCL 1BD2D 3VWKB 5I74C 5KG9A 1I8KB 4X99A 4GW4A 5JQ6H 2PUQT 3VGFA 5TF1L 3QUYA 3WDHA 3MCKB 1AD9A 2F9BT 3IDNB 3GGWA 3UTTD 4WWKC 4NUGH 1CXEA 4LLQA 3VXSD 1I1AD 5AUMB 5I1HH 1DQJB 1ZSDA 3N50A 2DBJA 4ODSL 4PP2A 5IHZB 1HH9B 2HVKB 3IVKB 4OQTH 2X1XR 3VI4F 4ESKA 4WW2F 5ITBH 2VSCA 3B8SA 4FQLH 1U42A 3HRPA 2E6QA 1MRCH 1N5YH 3HMWL 4YUEL 3REVA 1PYWB 3AS1A 2PYFB 1B4RA 5GZNC 4I2XE 3IT8D 3TJHD 1IQWL 5EWIL 2CDGA 2R69L 4U1SB 2Q8AL 5EC1A 2GKIA 43C9B 3S36X 4X7TA 1YEJH 4DVRH 2BFVL 2HJKA 2E9JA 2C3GA 2UWEB 5DT1L 4HKBB 3F7VB 1MCOL 3JUZA 4HAFA 4XI5C 4HCRL 4JQXA 2GTZA 4TNVF 2DDQL 4FQHA 1HILB 4W4NA 5C07E 3GMLA 3WHE1 2OL3H 5F7LB 2BY1A 2R23B 4ZS6D 2BOCA 3MV7A 4HK0A 4LLDB 5GGTA 1QTYT 1WIPA 3OG4B 4MB4A 4V1DA 4BZ1H 5CGYD 1CZ8H 1MI5A 1CFSB 2J6EL 5ID1B 4JHZA 3KYMB 1A2YB 3BDXA 1G7PA 3FQXB 3I6LE 4WW1B 1CICD 2NR6C 1JYWA 3FT4B 2B4CL 3O2VL 3VU2A 3DIFA 1XT5A 2V5YA 5C0BA 1Z6JT 4UAOB 4YX2H 1F8TH 3B9EA 3V0VA 4X6FB 4YDJB 5EO0B 2X1WL 2AGJL 5DHVB 1I1YB 2HT2C 4G8FA 1KG0B 3E2HB 2B5IC 4H0GA 1V3LA 3GSUA 3RVUD 5CILH 3L95A 3K80A 3QQ9D 4XMLH 5I0ZA 4XNZC 3OXSB 2EEDA 1NMCC 2KQNA 4M7KH 1S5IH 3VGHA 4FQXC 3OKDA 2Q86B 3BOVA 4R0LA 1RUKL 3ZL4H 1YC7A 4H25A 4XVTH 4JAMB 1IAOB 2A74A 2ICWB 1FV1A 4MMZC 1HNGA 4M7LL 2DD8L 4G8IA 5C0JB 5A3ID 2HFFB 2WIMA 3FTGA 4RMSA 2J4WH 1A4KA 2DQHH 3O6FB 1CDJA 3RWGB 1W72A 4U1JB 1FYTD 4C56D 4E0RB 2EDOA 4G6JL 5DJDB 2GJ6A 2ZUVA 2VMFA 4YO0A 4LPUA 5AAMA 2ICES 3EO9H 1AXTH 3OAYK 3ZDXE 4KK9D 4EN3B 3IKCA 4JPKH 4RIRA 1K8IB 4Z7NF 5GGVY 3BVNA 3CXHJ 3PHSA 3QDGA 3BKJL 4PRPD 1IM3B 5H2BA 1IL1B 4Y5YA 5DEGB 1OM3L 3X14A 3OHXA 5L6YL 5FYKL 4QHMB 4PB9L 1CDBA 1NBYA 4LSDA 5GS0L 4MD0A 5DURD 2UZIH 1QLEH 5ILTH 5CHNB 3BPNB 3RRQA 2XWTA 1XIWB 2DN7A 3K81A 5IW1A 5IQ9B 2I5YL 4HEPG 1KB5B 4P46D 3WS6A 1NBVH 4ZO6A 5GJTH 1RZKH 2VTFA 4U6XB 2NY3B 4HIIA 4CU7A 4NN5C 1NAMH 4PBXA 5DMKB 1DBJL 2QR0B 4C59B 2A73B 3BGFB 4OBRA 5MERA 5E00B 1CGWA 4KTEL 3GMQA 5FYKU 4TUJA 3DYOA 1WBXA 1BQHG 4GG6B 1PLGH 3HG1A 3NZ8B 5B38G 4NZTL 5I1LA 2EDRA 2GUOB 5E9DA 4FZ8L 3L3KB 1OB1B 3DETC 5H94B 4HWEH 5D8JL 3MBEB 2JTDA 4G6AC 5J6GA 4HMCA 3JWNC 3S97C 5HHOA 5HPOA 1FGNL 4HXBL 1S7VA 4YHZL 1T7ZA 3QUMH 4Y2DD 4KRNA 4JFPA 4U1NB 3VXPB 3PL6A 5IJVB 1DQQA 3ZKMD 5T1DL 3VXMD 5DRXA 2V2WB 4S2SB 3KJ6L 1KJ2L 1XCQB 3HHRB 3GIZH 3C6SA 4RISH 3SQBA 5DHXB 5F6HI 1L6XA 1ORQA 2FO1A 1X5ZA 5C0IA 3H9SB 1Q94B 4DAGL 3D85D 4NFCA 1QEWA 4CW1A 4FZEH 5EIVA 2AXHA 2HFEA 4ZQKA 2A1WL 5DMYA 3CXDH 3P9WB 3V5KB 3MRJA 4OLEA 4N90E 4PJFF 5SWSD 1CF8H 4IOIB 3RI5K 1TJHL 3GUTA 4U6TA 4LLMB 2AK4D 2AABL 1J1PL 3PXJA 3A67L 3Q5TA 3QIUB 5MEOB 4MJ4A 1U93A 3ARBD 1BZ7A 5EZLA 3HZYB 1F6LL 3VGAB 4OSUH 3B4NA 4QRPB 5EZJB 3O6KL 3WFHA 1EXUA 2DMCA 3LEXA 1K3IA 2HTKD 2FWOB 5E95B 1PKQB 1EUTA 4BFEA 2G75B 3QEUA 4IHOA 3TH3T 4HUKB 3NA9H 1G1CA 1MFDL 4WFGD 4NJAL 5DS8A 1YY9D 3ARDB 4MA7L 4WO4C 4XPHH 2O93L 2WQRA 3HNSH 1I8IA 1HE7A 5L0QC 3OJDA 4P5MA 4BH8B 4BZ2H 3MLUL 1VFBA 4OUUA 2FBJH 1DLFH 4ZUTA 1I7ZA 3QPQD 4M93C 1CIDA 3EJYD 2IQAB 3MODH 4L9LC 1B90A 2BC4B 1OSPL 4O58L 3TT3L 3QDMA 4XPBL 2ADJB 4RGND 5HI5C 3ZKXB 4S1RL 4OQ1A 3RU8L 3QFJD 5IB4B 1FL3A 3CFKB 3MR9B 4MX7A 2W91A 3ILPB 3O6LL 3MC0A 3ZT6A 2NY2B 1URLA 2APTA 3DBXA 3D39D 3KYKH 3TP4A 4ODVH 2VLRD 4F9LA 1IC4L 3EDFA 1LO0H 4YHOL 5FDYA 2BRQA 5DLMH 5HY9B 1QG3A 3TO2A 3UCRA 5HYJD 3DHMA 3KPOA 4P9ML 3VWJC 3BPOC 3T77A 2VDQL 3SPVA 5E99L 4L29B 5J11C 5BV7B 5MEND 2GITB 3B9KC 4QNPE 1RJZA 3S34L 2ICEB 5E56A 4AMKL 1CD1B 1SQ2N 1MUJB 1Q0YH 4LLVB 3N9GH 4A6YL 3CUPB 3QI9A 3OAZK 3PWJB 4W6YB 2R2EB 3T0EB 1U0QA 1CK0H 4X6CF 1NUGA 2CK2A 3EW3B 5DYOB 2NXYC 3UAJC 3OR6B 4ZFOA 3EAKA 4KVNL 4F58H 5GGQL 1KXVC 3RX7A 3D2UB 4GG6E 4XGZB 5J1AB 1KIRA 3FQTA 4M5YH 5DO2D 5D72H 3SE4A 5IUSA 2EXWC 3GMRA 4JZOB 4MJIA 5C09A 3MLRL 4NM4H 1KTLA 1FYHB 3MV9B 4LCUB 1HXYA 1P4IH 3I85A 3TNMA 5BW7A 4XCEB 5ICXA 2X4PB 3KS0J 3CU7A 1TZIA 1IGYA 1L6ZA 2F15A 4Z77A 4XCNA 3ARUA 4XB8A 5I16B 3MJ8A 1S7RB 3EKCA 3H9SE 4ODHH 2ADIB 1AY1H 2P48B 5C07D 5ICYB 1D5BA 4FQQB 1KT2A 4K8RD 2FR4A 4OGXL 5I8CB 1QBMH 3N0PB 4KHXL 5DK0B 2LV4A 4LMQE 1U8HB 4KROB 3UTSB 1ZT7B 2BSRA 3L6FA 1KEGL 1WJ3A 3GJFK 4LCWB 2BRRH 5D7JD 3I6LD 1E4WH 1XGQA 1F13A 1RZJH 3VGBA 2Z8RA 3ZZ1A 4L1HA 4QRPE 5F6HJ 1WCBA 2O5YH 4S10A 1YEIL 2G5BB 3HNVL 4MXWL 2O61A 1RU9L 4TVPH 1PKQE 4PRBB 4UBDD 3PV6B 4JFFA 1KB9K 3DXAB 1TIUA 2BVUA 3BT2L 2ITDA 4MJ5A 2EDNA 3T2NH 4LKXB 4XCFH 4BSVB 3OAYH 3KLSA 5AYUH 4XAKE 1FRGH 1Z3GL 3VXTB 4MA8L 1QSED 3OXRA 2DB8A 3QWQB 4AENA 3SCMC 4IRSD 4UILL 1N6QL 4RMTA 1WFUA 2Y06H 1VFAB 2CIKA 3RA7H 3SKUD 4NQED 2CJUL 1JRHH 3ZKNC 1PKOA 2AQ1A 3KPPB 4JFXA 4APQC 5EUKA 4Z7WF 2DQUL 4JO2L 1U3HC 1JPGA 3NH7L 1TTFA 3FB7B 4CADB 5HVHB 1BFTA 2R2CA 1EHNA 1C8PA 1R5IA 3ROLB 2ESVA 2XNAB 2PTUA 3IS0X 1ZS8B 2BCKA 1G1YA 4NWTL 3QUZC 1FZJB 4MAUL 3GHEL 1LK2A 5DEFA 5SWZA 3LKNA 1JTTA 1NKOA 2EDEA 2XPGB 1YEGL 3M1BA 4B53A 5DJYA 3GMMB 4JFZH 1A7RL 4O02L 4HUXA 5ICZA 4Z95H 5K9JH 3MACH 1LO4L 4LAQH 1CD8A 1OAXH 5DJ2A 4TSCH 3HZVA 4NUJB 1J1XL 1F4XL 2VXSL 5IMLA 3T0EE 2FZ3A 3S3SA 3QCUL 2EKSB 3VWKD 4L4TA 3VFRA 1M7DB 5KTEL 5IF0A 3T0VA 4KPHL 3RPIA 5EU4A 5C8JA 1H3WM 2PCPB 4WI5A 5GRVK 2AEPH 2DS4A 4Y89A 1DVFC 3ELAT 3N1MC 3ZYZA 4AG4L 1QSVA 5KVGH 5KG9B 4GKSA 5FAAA 4P57A 1OP5K 2FD6L 4TSBL 1LDSA 4GW4B 4X99B 1DFBH 2D31A 3QUYB 3TPUA 1KN2H 4LGRB 1C5BL 1AD9B 1DQLL 1QKZL 3GGWB 3G5VA 4LLQB 3MV9E 1KLFA 1ZSDB 4EUPH 4GLRI 4PRID 4JPVH 4PP2B 2P5EB 4N0RA 4R0LC 5KSAA 1FCCA 4JHBA 3I6KA 4JM2A 1OPGL 5GGSA 3FO0L 2E27L 4X0KA 1F4YL 2DQJH 4LSPL 5I18L 5KANG 3REVB 4U31A 3FB6A 3VJ6A 4NWUL 4ZO8A 3QXTA 4DFIA 2BVPA 4O51A 3SQOH 3V0WH 2CDGB 2XN9A 5EC1B 3AREA 4FP8L 4X7TB 3QXDA 2HJKB 4LCYA 3LS4H 5T5NG 5BOPA 1GGIH 1VACB 2HJFA 2GTZB 5D7IE 4FQHB 4XP9L 1MRFL 3GMLB 4KJWD 3UTSE 4WFHE 2BOCB 3FN3A 4HK0B 4HPYL 7FABL 4YXKH 5CJQH 4LCWE 4AZ8A 4DN3H 1Z0NA 4V1DB 5B3JF 1CQKA 1MI5B 4UTBL 2Z4QB 1XF3B 1RSFA 1F58L 1G7PB 4PG2A 1TJIH 3MYZA 5JQ6L 1AR1C 3DIFB 3DXAE 3QHZH 3FL7A 1UJ3C 5C0BB 5MEPB 4YDLB 4NUGL 3ZLQC 3V0VB 5I1HL 1P4BH 3CC5A 5ECJE 2WBKA 4G9FD 5EU3A 1AJ7H 4OQTL 3BESR 3DPBA 5ITBL 1OTUD 3IFNH 4JO3H 5EC2A 4FQLL 1CTOA 3GSUB 5KVMC 3RVVC 3VE0A 3L95B 1N5YL 1MRCL 2XICA 3FRUA 3TBTA 1LVEA 2RR3A 4PRAA 5FHAH 3S4SG 3OKDB 1O7VA 5D93C 2ILLA 5DD6A 3G6AB 4H25B 2EH8H 3N1FC 3WKMH 3BGMA 1YEJL 2A74B 1EX0A 4DVRL 4EI6A 4G8IB 5D96B 3FTGB 3BP6A 2HT4C 4O9HH 2MFNA 3OAZH 4KRMB 4EN3D 1W72B 2OL3L 2GJ6B 3WLBA 4YO0B 4GOSA 4X6DF 5LCVH 4BZ1L 1CZ8L 3IKCB 1KIPA 2GK0B 2VUOA 2PO6A 4RIRB 1DTUA 4KJQC 3BVNB 1EPFA 3QDGB 4YZFE 1SEBA 1P2CA 5H2BB 4Y5YB 3X14B 3OHXB 3ZT7A 4OZFG 3OF6A 1NBYB 2ARWA 4MD0B 4YX2L 1AXSA 1F8TL 2NR6D 3H6JA 4GFTB 3VXNA 3K8LA 4LVOB 4MXVF 1I7TA 2XWTB 3WLWD 2H41A 5ESQA 1EJOH 5IW1B 2HRPH 1RIHH 1RURH 3QBTB 3INUH 5CILL 1YN6A 4GAFB 4XMLL 1YNLH 3QIWC 4M1GH 4HIIB 4U1KA 4M7KL 4AEEA 1S5IL 1Y18A 1L7TH 5J57B 1NCDH 3ZTJG 2R4SH 5MERB 3ZL4L 1BFVH 3GMQB 4XVTL 3U4EA 2EXYC 2P5EE 4FQXD 1WBXB 3BD4A 4NQDD 4MMXC 4WEMB 2J4WL 5I1LB 2DQHL 3WFEH 4HIEA 2PW2A 5E9DB 1VKXA 1A7PH 1I1FA 2DL9A 3GJFH 4U05A 2ZPKH 4KKBC 4M1CC 5J6GB 3EO9L 1AXTL 2FX7H 4JPKL 1BQHA 5DJ6A 5HHOB 3FQWA 1BFSA 5EU6B 5IWLA 2BY0A 1S7VB 5B38A 4JFPB 3PL6B 1DQQB 3DV6B 2FJGA 4YHLH 4JDVB 5DRXB 4FQCH 3VA6A 3GSNA 3W81A 3NAAH 3QFDA 5SX5K 4PIRF 2UZIL 3RUGA 5KSVA 1QLEL 1ORQB 5ILTL 1GGUA 4V1DE 5C0IB 1MCLA 3UPAA 5BCAA 1U41A 1MI5E 4HJGB 5GGUA 1QEWB 1P9MA 4QRRB 4CW1B 5D6DA 5DRZA 3HB3C 2XG5A 2HFEB 4ZQKB 1G7JA 4FFYH 2WAHA 4L8SC 3MRJB 1QRKA 2UV3A 1NBVL 5GJTL 3QIUD 4ZFGH 1RZKL 3PWUA 5I6XB 2DTMH 5C0BE 3OKLA 1NAML 1HEZA 1CE1H 1FLTX 3GUTB 1KOAA 2R1YA 1K4DA 2EC8A 2QSVA 5INDB 1U93B 1IRAY 1BZ7B 5EZLB 2DLEA 5H37G 1IT9H 4LSSH 1PLGL 1LP9F 4OF0A 3WFHB 1EXUB 3LEXB 3ARDD 5GSVA 2OLDA 3QEUB 4IHOB 3HI1A 1G0YR 1I3UA 3HE6A 4HWEL 5TQ2H 5DS8B 3UXFA 3VFMA 1JZ6A 1OVZA 3SDDA 4P2QE 1BGXH 2MJWA 5EOCJ 4WV1A 1MHCA 1NANI 4P5MB 1JF1A 2Q1EA 1VFBB 4OUUB 4M61A 1IEBA 1CFVH 3O9WA 4ZUTB 1I7ZB 2QL1A 3QUML 2J88H 3VFPA 3HMXH 3ULVE 2KH2B 5GGSY 1D6VH 2ORBH 4XX1E 1AD0A 5DUBA 2NY2D 5DEZA 2P24A 4XWOC 3GIZL 4RISL 3F12A 2GJ6E 1FL3B 4MX7B 4HWBL 5IFJA 4F7TA 1CXFA 2GYSA 2E6PA 3WN5C 4FZEL 3DBXB 1C12A 2R56H 1HNFA 4GKNA 1P7HL 3QDGE 1A1NA 1RIUH 3CXDL 4W70A 2DMKA 5E1HB 5F7HA 1OP5H 1SVZA 1H0DA 3QJHA 1BP3B 4IMLA 4NN7C 1CF8L 1U8OA 2W9LA 4LHJB 3TO2B 4ERSH 1JV5A 2DQDH 3KPOB 3HFMH 3SPVB 1JZ2A 3A0OA 3CVHA 3KVQA 3CZFA 2I9TA 2RHEA 1N8ZA 1A3RH 4ZUUA 1B6DA 3T0ED 4OSUL 5JR1H 4Z8FH 4KRPB 2AI0H 2APWA 5FCUL 3QI9B 4GG8A 3GM8A 4F7EA 3D2UD 3NA9L 5AYQA 1X5LA 4XPHL 1G7QA 3K46A 3HNSL 4ZFOB 2EDLA 4BZ2L 1FBIH 1IJ9A 3BJLA 4KKAD 2FBJL 1DLFL 1AGEB 1R3KA 4OZGF 4K3JH 1KIRB 3FQTB 3MV9D 4GAGH 5I1KH 1CT8A 3EJZD 3GMRB 2ZUYA 1VEPA 9CGTA 4MJIB 2B20A 2VLJA 5E9DE 1LILA 2IEPA 1QPPA 4D9LH 4H1LH 1KTLB 2BMKA 3FFCA 5ACLA 2CLZB 1FNLA 3KJ4C 2MPAH 5HI5D 4CKVX 1HXYB 1OAQH 4MQTB 3TNMB 2XYCA 4BQ8A 3OKNA 5HHOE 3KYKL 5EU6E 5ICXB 4ODVL 1LO0L 1TZIB 2VZ3A 1IGYB 2YR3A 3OAUH 4XCNB 5DLML 1KIQA 3TC9A 4QLRA 3MJ8B 2X89D 4UQ2A 3BSZH 3IF1A 3KGRA 3B5HA 1WFTA 2EIDA 3HC3H 4KROD 1D5BB 4QRRE 4R2GB 3DMMD 4WFHD 1MHPH 1KT2B 4LCWD 4MQXC 2HLFD 4AM0B 2A6JA 5IM7A 1JPFA 3N9GL 5E7FA 4M7JH 2R0KH 4CAGA 5HHMD 1U8KA 2BSRB 3L6FB 1BBJA 1CK0L 3MLZH 1Z2KA 3C60A 5GRJH 4IJ3C 2YWYA 4Y5VC 3WIFA 1QSFA 1XGQB 2UWEF 1W0VB 3DXAD 1MCHA 4F58L 2OM5A 3BQUC 4JRWA 3K4AA 4Z7VF 1WCBB 4M5YL 5D72L 2O61B 5GS1C 2VERN 5IVXF 4JFFB 4LHQB 2EDDA 4MJ5B 2ITDB 1X9QA 2VDPH 4NM4L 5E70A 4WNQA 4ETQA 5FKPA 3K4ZA 3HI6H 3QEHA 3FO9A 4GXVH 2I26N 5CGTA 5AG9A 2C4XA 3MRKB 3OXRB 3DTXA 5DUMH 1P4IL 3ZT5A 2XKNA 1J5OH 4AENB 1DBMH 5EIQA 4JDTH 1AH1A 2HH0H 2PW1A 3MFFA 4I18C 5EULV 4AIOA 2CIKB 4Y8DC 2BK8A 2XTJB 3RTQA 4GSDH 4HJ0C 4QRSA 4AYFA 1YMMD 1C5CH 4JFXB 2WW8A 3N85H 3ARRA 1VERA 3BAEH 4D0DA 1OCWH 5EUKB 4F9PA 4ODHL 5CCKH 1AY1L 2DQIH 4YK4B 4KAQH 5EN2A 1X6LA 1QBML 2ESVB 3PNWA 4HF5H 1RVFH 3GSOB 4K3EH 5JXAH 3BWUC 3CZJA 4UAOC 4ODWA 3ZO0A 2BCKB 4YGAB 2Y07H 3GBMH 1F42A 2BRRL 4URTB 1LK2B 5DEFB 2W0FA 5SWZB 2GIYA 1JPST 4WI4A 1AKJA 1L0XA 4PJAF 1T1ZA 3GBLA 1E4WL 3M1BB 1RZJL 3CDYA 5FA3B 4HUXB 5ICZB 1AGFA 2O5YL 2E9WA 2FL5A 3L5XH 3FRPG 3RZCA 5DJ2B 4TVPL 3HZVB 4FQ2H 1D3CA 2QADC 5IMLB 5JIKA 1T66C 2EC9T 4DGYH 4IOSD 5DFTA 1NGPH 4NQVA 3T2NL 1CLYH 3VFRB 4XCFL 4LP4A 1X44A 5AYUL 5IF0B 1FHGA 2I24N 1FRGL 5EU4B 5C8JB 1YNKH 3SDAA 3QUYD 2H6PA 3RIAF 4M48H 2GTWA 4XVSL 4GKSB 1RK0A 1FN4A 3H7LA 2Y06L 4P57B 1NEZG 3RA7L 4MJIE 4JZJC 1JRHL 2DJ4A 5SX4I 2J7LA 2D31B 2YXMA 3TPUB 1U8LB 5SX5H 3G5VB 1QFHA 3KYOA 1MLBB 3WJLC 2FEDC 3DUSA 1PEZA 5KSAB 4LLWA 2VN7A 3I6KB 4JM2B 5DMGC 5GGSB 4J4PA 1OOAA 4X0KB 2FO4A 1WSST 5DD5H 3IDYB 5EG6C 3FB6B 4X8JA 1DR9A 3U2SA 3VJ6B 2BVPB 4O51B 5L2KD 4GH7B 2P8PA 1JMZA 4H8WH 4GG6F 1K8DA 2XN9B 3AREB 3QXDB 5B4MC 3T0XA 4OM0H 4LCYB 3MV7D 1EO7A 4JFZL 3HR6A 4Z95L 4P3DA 5K9JL 3MACL 2NY3C 1DQMH 4LAQL 4V1DD 1OAXL 2HJFB 1T7VA 4AT6A 4TSCL 5JPMA 1MI5D 2DLTA 3AB0B 2CUMA 1KV3A 5LBSH 3U1SH 5C0CA 5FYJU 2MHAA 5D2NC 2NW2A 1MEXH 3JWOC 2VZUA 1G7LA 3JVGA 4R97B 2FSEA 2AEPL 3BEWA 3WE6A 1WWBX 4P2RD 4HKJA 4G5ZH 1INQA 5KVGL 4NRYA 1H3XA 2VN4A 1H8NA 3B9DA 5A43C 5CZVH 4XPAH 1T89C 4JFFE 1DFBL 5D1QA 1J1OH 1KN2L 1F2QA 2OP4H 1UKSA 4GRWB 3QQ4A 1FNHA 3CC5B 1QFPA 3EIFA 4JPVL 1OW0C 4O2CB 4TPRH 5C86A 5EU3B 5HGAA 4CBPA 5E5RB 5EC2B 3TWCH 4N9OB 2DQJL 2HTLD 5DA4A 4IDLA 3FRUB 5DJ0A 2XTJE 1LEIA 3TBTB 4XXDA 4PRAB 1UT9A 3QO0A 2NTFA 2R39A 3ULVD 1DN0A 3SQOL 5ESVA 3V0WL 5D1ZA 5DD6B 2BNRA 4PY7A 3BGMB 1J0ZA 5AZ2H 1A6WH 3QUXC 4EI6B 1FC1A 3JV6A 4QT5B 3BP6B 1A21A 2MKLC 3VD3A 3AMLA 3VMNA 1GGIL 2J3SA 4UNUA 4CDGC 1CTNA 1O7SA 4KI1A 4YXKL 5CJQL 4GW1A 3QDGD 3WLBB 4Y5XA 4AJ0A 5T1LB 1B4JH 3AFLA 4DN3L 3LD8B 4HLJA 4I4WA 5E6IC 1KIPB 2PO6B 3NGBC 2MMXA 4YWGH 1G0XA 4X6EA 2AXFA 3K1DA 2H3NB 2V7HA 4RNRA 1P2CB 1TNNA 5B39A 1TJIL 3QHZL 1AXSB 2W60A 3FOLB 3VXNB 1PY9A 3I9GH 1P4BL 3KWWA 1I7TB 2K3TA 4EKXA 4M6NH 3EYUH 2X44D 5TPWH 3T65A 1GSMA 2OK0H 1AJ7L 4EQ2A 1HWHB 5ESQB 4D0BA 4JO3L 3IFNL 3G9AB 1YN6B 3UMTA 3ZKXC 1EAPA 5HXMA 2C3VA 4OZFA 3O4LA 5I9QC 4LEXH 4U1KB 5FHAL 5EORH 1Y18B 4MB3A 3HG1D 3ZDZE 3U4EB 3QQNA 2EH8L 2I9LA 5E9DD 3WKML 5BS0A 2HP4A 1F3DH 3OBAA 3MUGA 1T83C 4NZDA 5FM5O 1A6ZA 4O9HL 3IU3B 2AJUH 4HIEB 2PW2B 4NCC1 2ENYA 4HJJH 1VKXB 1QR1A 3P4NA 2HT4D 2CO7B 5TE7H 1RJCA 3PL6D 5IQ7H 1MCPH 1EK3A 1KB5H 5TQ0H 5LCVL 5D7KD 3BKMH 2XN9E 4PLOB 2VXTH 5DJ6B 3FB8A 2CRMA 3FQWB 5DXWA 5JW5B 4PJ8C 5TDOA 1JCKA 2V2XA 3LS5H 2FJGB 1EMTH 4J3OC 4KJQD 4W4OC 1QUNA 3GSNB 3EZ8A 3P77A 3W5MA 4LDLB 3QFDB 3JWOH 5KSVB 3KPRA 3RUGB 5DSCA 3PWVB 2DF3A 4J23A 5GGUB 3LH2H 4OJFH 5DRZB 3O3DA 3T3PE 1EJOL 1G7JB 4DKFH 2HRPL 2YSSA 1RIHL 1RURL 3INUL 3OZ9L 3O8XA 3GSRA 2R0ZH 3PWUB 1YNLL 1INEH 2YPLA 4M1GL 3OKLB 1HEZB 4GRWE 1L7TL 1NCDL 2R1YB 3T04D 2XT1B 3P0YH 1K4DB 4I9WE 1BFVL 1M7IA 3V0AC 3UTZA 1XF2A 1Z9LA 1EHXA 1NFIA 4RSVA 3KXFA 4PJ5A 5GSVB 3SKNA 3WFEL 3L3HA 1DEDA 5EPMA 3F6IA 3HI1B 1A7PL 1LNUA 2Q7NA 2ZPKL 3QAZB 4PYGA 3HE6B 3VFMB 2DLFH 1A3LH 3SDDB 1ZT1A 4HGMA 4U6YA 4CRPA 1OGTA 4WV1B 1MHCB 2FX7L 3WNNA 1JF1B 3QDMD 5K9QI 4KKBD 4M61B 1IEBB 3O9WB 2F53A 3VFPB 3L9RA 1LGVA 1MNUH 2OTPA 4NKIH 4NOBA 4NKOA 4HGKC 4YHLL 5J89A 1AD0B 5DUBB 4KZDH 2VAAA 4FQCL 4FMKA 4FQIH 5IBUG 5DI8A 2P24B 3F12B 1N64H 3NAAL 1BIIA 1G6RH 3B2UC 5E8NA 4NQUA 4M6AA 5IFJB 4NC1C 2AJVH 3Q3GA 4X4XA 4ZG1A 1NFKA 4JZNA 4NO5A 5DJAA 1C12B 4L9DA 4PJIE 1MIML 1WAAF 4GKNB 5K59F 4FFYL 1A1NB 2DMBA 5LVEA 3F65A 1H0DB 3QJHB 2NX5B 3HB3D 4ZFGL 4K7PH 4IMLB 1U8OB 2DTML 1JV5B 1T22A 1CE1L 4FHBD 3IDIB 4KRPD 4JRXA 3CVHB 5CIPH 3CZFB 2I9TB 3TJEH 3QI9D 1N8ZB 4KV5E 5F7EH 1IT9L 3LHPH 4UUJA 4LSSL 4OZIF 1VDGA 3RI5F 3QXVA 2WK2A 4RMUA 4OZ4A 4GG8B 3MV01 4N0UA 2E3VA 1CD0A 3MRPA 4Z5RA 4UIKH 5TQ2L 4PJFA 1G7QB 1BGXL 1AI1H 4MJID 5C09D 2VXVH 5HI4C 1FFNA 3BW9A 3D25A 1CFVL 12E8H 1QZ1A 1R3KB 1SJXA 3KLDA 4OFDA 2J88L 4KK8C 3HMXL 1CT8B 5DQJA 4OFKA 4BYHA 1D6VL 2EZ0C 5FGBC 2ORBL 5BV7H 2VLJB 2EYTA 3E3QE 4H0IA 2BMKB 3FFCB 5DFVD 3GRWH 3JV5A 3BMWA 4U33A 4B50A 3A6CH 4XWOD 1D5XA 5DR5H 5CINH 4W68A 3OKNB 1ETZA 1ZHNA 2R56L 5CGMA 4MAYA 5IW6A 4TQEH 1RIUL 1UH2A 3OB8A 1VGEH 3RGVC 2YA2A 3CLEH 1ADQA 2V9TA 1KIQB 3P0VH 4HCRA 5DK2A 4R2GD 4FABH 4ERSL 4HBQA 3FZUD 1JP5A 2DQDL 2EDYA 3HFML 4UQ2B 3O0RH 3RUGE 3TA3A 4CN4A 1PFCA 3IF1B 2YUWA 3OKKA 1A3RL 1T03H 5C2BH 1GAFH 4ZPVA 2YD9A 4PJBA 5JR1L 3F62A 1ZT4A 2J6EA 2A6JB 3EOAA 3NPSC 4Z8FL 5IM7B 3CSPA 4EQ3A 2AI0L 1JPFB 4PGCA 1RULH 5LXGH 5B8CA 1U8KB 3LDBC 2MWCA 3BZ4B 1BBJB 1CDHA 5F9OH 4GO6B 3TGXA 3C60B 4R96A 2YBRA 2VWEC 4JY6A 3WIFB 2C1PA 2EIBA 1QSFB 3DLQR 3O4OB 1FBIL 3W2DH 4PY8J 4K3JL 3ARGA 2JLLA 4GAGL 5I1KL 1P7QA 5JHLH 1ONQA 2X4OB 3L5WA 5IMOA 2VZ1A 1ZLWK 4D9LL 3O41A 3MNWA 4WNQB 4ETQB 5FKPB 1UFUA 2FDBP 3QEHB 3FO9B 1HHIA 2H2SC 2MPAL 5MEQA 1YC8A 4LHUA 3DTXB 1OAQL 2XKNB 3BKCH 1JZ8A 1NC2A 2PW1B 4CVZA 3MFFB 2XWBA 3OAUL 3RTQB 4FMFA 3ALXA 4WHYH 1H3UA 2YD5A 5C3TA 5IB5A 1A7BA 5F9WC 2ESVD 4D0DB 3CFJB 3BSZL 5FUCC 1PD6A 4X9IA 4O5LH 4QF1A 4PJEA 3HC3L 1WISA 4NIKB 4NQTA 4XTRC 3MROA 1TTGA 1MHPL 5JXEC 4Z0XA 5EN2B 1I3VA 4NKQB 3PNWB 4XMKH 2I25N 4DEPB 4MGXA 4J8RA 5SWZD 4YDIH 4LQ1A 5K9KA 4ODWB 1TCRA 4M7JL 2NX5E 4ELMA 2R0KL 5DTFA 5I75B 3QISA 5E7BA 4JB9H 4M00A 5FGCE 5EU7C 4A2LA 3MLZL 4HT1H 2W0FB 1WZ1H 3V7AE 1BD2A 5GRJL 3TNNA 1QBBA 3U30B 1AKJB 4X80H 4BA8A 3BDBA 1T1ZB 2CUIA 5D70H 3ULVF 4GBXA 1ZV5A 4LPWA 1AGFB 4L4TD 2EC9U 1I9JL 3S7GA 4LLYA 1X6NA 3RKDC 3RZCB 1I1AA 3DVGA 3SE8L 4NQCA 5FGRA 3MLYH 2E7HA 2VDPL 4NQVB 3SJVA 3C08H 3HI6L 4LNRA 1V5JA 1FP5A 4GXVL 3AAZA 3SDAB 1GGBH 3L3IA 5DUML 2H6PB 4MVBC 4J3WA 1J5OL 1DBML 1ZHKA 4JDTL 2GTWB 4MDIA 3FRPA 1RK0B 1KYOJ 3B5GA 1I1CA 4K55A 3NIGF 4U7SA 1MCDA 5KSAD 1JMXA 4QXWA 4NC0B 4GSDL 3STZA 5CD5D 1CFNA 4JM2D 4JN2A 4MQ7A 3U7YH 5IJKA 1C5CL 3FFCE 5DD1H 4OFPA 3BO8A 3KYOB 3N85L 3BAEL 1WZLA 1F4WH 1AQKH 1OCWL 4HJ0D 3GHBH 5CCKL 4LLWB 3SGDH 4U4BA 1CFBA 4NP4H 2DQIL 1A4JA 4N9GA 4KAQL 1YEDA 1ZK9A 4HF5L 1RVFL 2FO4B 4K3EL 4RGMB 5JXAL 3VG9B 1ITCA 2Y07L 1NLBH 3DX8A 3GBML 3U2SB 1A6UH 3QZWG 4PV8A 2ZJSH 5CJ8A 1FVDA 5HYQA 1VADA 5CLWA 5FO9A 1K8DB 4XXCA 5D4QA 1PVHA 2D0GA 1RHFA 4LQFH 4P3DB 1KGCE 3SDCC 1XGRA 3L5XL 2VZVA 4HIXH 4MNGE 4AT6B 5JPMB 4FQ2L 2QSCH 4KXZH 4X7FC 1JWSA 4DGYL 4GS7C 4AIXA 1BJ8A 1NGPL 4PS4H 1CLYL 3HAEA 1D5IH 5F8QC 2MHAB 5D1XC 2QADD 1XH3B 1WLHA 5ITFA 4N0CC 5KS9A 1YNKL 2WM0A 2A77H 1QSFE 1OWRM 4LRIA 3BEWB 3WE6B 2MQ0A 4HKJB 2Z8VC 4M48L 4WI2A 3VFTA 4I9WD 1PW3A 4JGJA 5D1QB 1KC5H 4U1GC 3F7PC 4HIHA 3NA4A 3SDXA 4AEIH 4J3UA 3ET9F 1DBAH 3V6ZA 3QQ4B 1UKQA 5FM4A 3ILQC 5JDJA 2VITA 4J7RA 3HC0A 4H26B 4LOUC 5HGAB 5CSGA 4Y4HA 4C56A 5I1DA 5GGTH 1JF5A 4I3GA 1CXKA 3ARXA 5DJ0B 1FZKA 1LEIB 5DD5L 4XXDB 2A9NH 3ARTA 3QO0B 3I2CH 5K9OA 4MNQA 5ESVB 4OGYH 4H8WL 5D1ZB 1JYNA 2BNRB 2ZUQC 4P9HC 1PZUB 4PY7B 5CLTA 4DZ8A 3MGOA 4P48A 4OM0L 3U7WH 4Y16A 3JV6B 4R90H 3T2PA 4BSJA 1DQML 4GRLA 2PO6D 1CGVA 4JFDD 5LBSL 3U1SL 4GW1B 3KDMA 4M43H 4KMTH 4Y5XB 1MAKA 4IRJC 1BREA 1MEXL 4I4WB 4NBZB 3ALWA 3OF6D 4HS3A 4JFYA 5DRWA 3OPZH 4X6EB 1JGDA 5IROA 2AXFB 4G5ZL 4RNRB 1XGTA 3LKSB 5EFIB 5B39B 5CZVL 4XPTH 4XPAL 4K9EH 3NCMA 4A6YA 1QFOA 1J1OL 2DAVA 3PHQA 4O4YH 2W60B 2OP4L 3U9UA 1UB6A 1XEDA 3K1KC 3KWWB 3C87A 4OFVA 5LAXA 4TPRL 1Q1JH 3T65B 3SKJH 4XP1H 1W72H 5AWNH 4D0BB 3C2AH 4HHAB 3TWCL 1JI2A 3U83A 1EAPB 3LKRA 2C3VB 4OZFB 4K3DH 3O4LB 3EYVA 1G9NH 3IS1X 2XG4A 2A38A 5F3BA 1Q9KA 2BVTA 5BS0B 3MUGB 3V8CA 5JOFA 1DUZA 5AZ2L 1A6WL 3PWNA 1A6ZB 2GSIA 4ONHA 3P4NB 1QR1B 3TESA 3QDJD 1B4JL 4ZXBC 2AEIT 4AL8H 4EI5C 4OUOA 2R9HC 5D7SH 2EO1A 1EFQA 3FB8B 4YWGL 4DTGH 1TETH 4YHPA 4E41E 2VZOA 1TXKA 5E6ID 5TDOB 4NRZA 1RY7B 4ZOAA 4ZS7H 3PGDA 2AK4A 3PDGA 1Q9LA 5CD3A 4QHNB 3P77B 1Q9OA 4OCNC 4HWUA 3KPRB 5I0DA 5DSCB 1X5XA 3G5ZA 3I9GL 4JQVC 2V9RA 1T2QL 4M6NL 2E7CA 3EYUL 4OCSH 1LE9A 5TPWL 1VEOA 2OK0L 1TQBB 3O3DB 1D6EA 3K74B 5GRYA 4X6DA 5C0RH 5I71C 5FYLE 2ED8A 3O8XB 1NFDF 3GSRB 4HC1A 4LEXL 1M05A 5BRZA 5E03A 3MRCA 3QCTH 43CAA 5EORL 1F6AA 3CSGA 1WT5A 4N8PA 1M7IB 3UTZB 1XF2B 4L8CA 3K3QA 4S0TD 1NFIB 3B8YA 3KXFB 3GMOA 4PJ5B 3HE6D 2W38A 2OJEA 4G8GA 1IAIH 3RL2A 3SDDD 2AXGA 5I8EA 2NY1B 3SKNB 2AJUL 3L3HB 5EPMB 2FEEL 4HJJL 5DGRA 4XMPH 3C5ZC 1LNUB 3O9WD 3BE1H 1EAJA 1DP0A 4P9HH 3ZTJH 2FNBA 5JORA 5TE7L 5IQ7L 1ZT1B 2VLRA 3HPJA 1MCPL 1KB5L 4UT9H 4U6YB 5TQ0L 2BNRE 3BKML 1OGTB 2BHZA 3SO3B 4NQXA 2VXTL 3EFFA 2ZWLT 1U36A 3AVEA 2F53B 3P40A 4XP5H 3L9RB 3W39A 5HYJA 3RNKA 1I7RA 3LS5L 1EMTL 4NKOB 1FQ9C 1EHAA 4YC2C 3VI4E 2H2PD 2VAAB 5DI8B 3RIFF 3PGFH 4PRDA 4NOFA 1BIIB 1KCUH 1X4ZA 3JWOL 4PLKC 1J8HA 5C3LD 5E8NB 3RPKA 2H26A 1SMOA 3WNPA 2EECA 4I0PB 4X4XB 5T3ZE 4FFVC 3LH2L 4JZNB 4NO5B 3NZHH 4OJFL 5CP3A 3WUWG 5DJAB 1DJSA 1WICA 2Q87A 2DYPA 2IBZX 4DKFL 4G6KH 2HT3D 4FFWD 3V6BR 2Y1VA 1NDMA 4IOFC 2R0ZL 3RWEA 1INEL 1S7SA 2NQCA 4U7KA 1T22B 1OLZA 2YPKA 3EYQC 4OF5A 5T1KD 2B4CC 1GGTA 1WF5A 1XGUA 4JRXB 3P0YL 1MRDH 5KOVC 3VFGH 2AEQH 4RFNB 3IXTA 4UUJB 2NZ9C 1MCWM 2Z35A 2XTJC 3RP1A 1T2JA 3MRGA 3IJSA 3TZVA 4OZ4B 5EIIA 4Y2OA 4LSQH 3O4LE 4L1DA 3UDWC 3MRPB 4Z5RB 3IETA 4PJFB 3K8KA 2DLFL 4OB5H 1A3LL 4KVCH 5HVFB 5GRXG 4GRMA 5EUOA 5HYIA 1H5BB 2OR8A 2VLJD 1FFNB 2UY7A 3BW9B 4DW2H 3D25B 3U82B 4DKEH 5F21B 4OLZH 4KK5D 1MNUL 5DQJB 4YHYC 4NKIL 3PDOA 3L3OA 4RA0C 3DYPA 2EYTB 4KZDL 4FQIL 3MV8D 3DVFA 3R0NA 5TJWK 1N64L 4UINH 5CEZD 1G6RL 3MOBH 3V52H 1N3NA 4X9FA 3T4AA 3KYAA 2A9MH 2AJVL 1D5XB 1GVIA 3MO1B 4NPYA 1ETZB 1ZHNB 3T0AA 4MAYB 3V4UH 1XF5B 5IW6B 2BNQA 4M62H 1J0JA 4YIQA 4P4KA 1BAFH 1W0WA 5D7JA 4ODUA 4K7PL 4JREB 3DJ9A 5DK2B 3ARFA 1G7MA 1NGXA 3FJTA 1KGCD 3KPRE 3TA3B 4JKPH 4ZAKA 5J12C 1GRWA 4RZCA 3KNBA 3OKKB 4JM2F 5GS0C 3TJEL 5L7XL 5F7EL 4EUPG 1QA9A 4PP1C 3ARSA 3IDJA 3LHPL 4RQQA 3WIHA 4ZPVB 1JGEA 4PJGA 4PJBB 1MF2H 1ZT4B 3EOAB 1HN1A 1S9KC 3KPSA 1QFWH 3LB6D 4Z7NE 5B8CB 1XFPA 3MOAH 4G7YH 4TVSa 1QSFD 3PJSA 4Y4KB 1K3ZA 2C3WA 2XWJA 3CFIC 2WQ8A 4UIKL 4R96B 2YBRB 1S3KH 3DYMA 4JY6B 1AI1L 4OGZA 2C1PB 2VXVL 4RAHA 1CGXA 2KDGA 2MSPA 2H9GA 3QNXB 12E8L 4HBCH 4OQTA 3ARGB 4PJ5E 4LVHC 3IDYC 1P7QB 3ULUD 1ONQB 3L5WB 5BV7L 5IMOB 2DJSA 5CEXA 4PV9A 1C16A 3O41B 2P8LA 3MNWB 3QSKB 1V3KA 3GRWL 1HHIB 3BIKA 5MEQB 4LHUB 3SBWA 4PR5A 3L3GA 1LDPH 3T3PF 2MNUA 3A6CL 2L4OA 3RTQD 4QCIA 5DR5L 5CINL 2NY6C 1O5DT 3CGTA 5E1AA 1NC2B 2F53E 4CVZB 4TQEL 2VLKA 2XWBB 3AB0C 5E6YA 1VGEL 3TLRA 4N1HB 4DKAA 3CLEL 3GNMH 3P0VL 4OZGA 3UJJH 4FABL 2NNAA 3VDAA 3RGVD 5IB5B 2OL3A 4Q6IC 5IIEA 3O0RL 3D87B 1N26A 3TVMC 1F45A 3G6DH 4QF1B 4RAUA 4PJEB 1T03L 5C2BL 3MROB 1GAFL 1TVHA 5C7XH 3BN3B 4Z0XB 1F90H 3RAJH 2X41A 3VFUB 4J8RB 5K9KB 2CSPA 1TCRB 1RULL 1SYVA 4ELMB 1AKJD 5DTFB 5LXGL 4XNXH 1TVDA 2MCG1 3EJJX 5F9OL 1BD2B 1U92A 4MD4A 3I3BA 4JRXE 1WZKA 3TNNB 3U4AA 1T20A 3RZCD 5F88A 3Q6FB 2ATPB 1SJHB 3UROR 1LO3H 2YXFA 3W2DL 4GBXB 2YD1A 1JL8A 2CRYA 4L3EA 5JHLL 4LLYB 1I1AB 3PP3K 4NQCB 3SDAD 3TBWB 3QRGH 5FECA 4PRIA 5EU5A 4QHLA 2I60L 4BQCA 3SJVB 1ZLUK 4PJFE 4LNRB 4NN6C 5F8RC 5HPMA 4HWZA 2ATKB 3AAZB 1H8SA 3L3IB 2HAZA 3BKCL 4P99A 2PXYC 4KY1H 1ZHKB 4HQQH 5IT2H 4G42A 4MDIB 5C08A 1NQBA 3IDGA 3LSOA 3LZFH 3DROB 4Z7VA 3STZB 1CFNB 1D5ZA 4JN2B 4MQ7B 3KR3H 4JY5H 4MB5A 3C8KA 3BO8B 4XPGH 2FGWH 4TUKH 4LARH 4NKMA 5E08H 1NCAH 4O5LL 3RBGA 2LQRA 1AHWB 1A4JB 4YBLC 1YECH 1YY8A 2WIIA 1N5AA 4XMKL 1F97A 4HFUH 4YDIL 4S1DC 3ZHKA 4TSAH 1GGYA 2IAMC 3DX8B 1DE4B 4JB9L 5DJ8A 3MXVH 4PV8B 5I73B 4HT1L 5IB2A 1FVDB 4HG4K 1WZ1L 4PLJD 3MCG1 1OAUH 5HYQB 1VADB 1S78C 5E0QA 4X80L 5D70L 4OTXH 4X4ME 1L0QA 3D0VA 2IC2A 4XNMA 3BRDA 5C0CD 4PJBE 1OGAA 3QJFA 1U8JA 4R4FH 3MRMA 1XGRB 4MS8D 3QA3A 2Y6SC 1V05A 1KCKA 3VDBA 1MH5B 1JWSB 3MLYL 3MBXH 4JRYD 4WWKA 4G9FA 3BZDA 4HDIB 3HAEB 5FYLD 3C08L 4XNQB 4GXUN 5ITFB 5L88H 5KS9B 3DHJA 1GGBL 1NSNH 5D1QD 1L0YA 3VRLE 5ENWA 4G6FD 1YQ2A 5E2UH 3VFTB 1QNZL 1T1WA 3C2SA 4D8PA 3QH3A 3SDXB 5BQ7A 2COQA 3U7YL 3LRHA 5DD1L 3RDTC 3V6ZB 1F4WL 1AQKL 4K7PX 2VITB 2X4NA 3HC0B 3QWOA 3GHBL 4K07A 4QGYA 4LDOB 4NP4L 3WBDA 4X6CE 4Y4HB 4C56B 5I1DB 4Y1AE 5D1ZD 2BNRD 1FZKB 1NLBL 3W5NA 3OKEA 4R6UA 1TQCB 4XH2A 5ALCL 5BVJA 3NIFF 1A6UL 2DRUA 2J1KA 4FTVA 2X70A 1W0YT 4DZ8B 4HWBA 1BZ9A 3MGOB 5DC4B 3UJIH 1ULVA 2OJZH 3PG2A 1B0RA 3WS3A 4Y16B 3U36A 4LQFL 3CFCH 1AGCA 3X3FH 4GRWH 4JCMA 5JUEH 4HIXL 4GRLB 4WVRA 2NY7H 5T3ZD 1LE5A 4ELME 2QSCL 2D7NA 2DIJA 5JNYA 3O2DH 2CLVA 4PS4L 3KDMB 1D5IL 1BD2E 5FO7A 1SM3H 1FPTH 4MXQD 3EO0B 1KCSH 2EDQA 2A77L 3P11H 4HS3B 4JFYB 3CVIH 3IB4A 4YXLH 5DRWB 4LEOA 1JGDB 4BFBD 4N1CA 1U8IA 4ZNCD 1T7XA 3TM6A 1XGTB 2K1MA 1M6OA 1KCRH 3VXSE 3MUHL 4KGLA 4A6YB 4NQCE 4RMQA 1KC5L 1RUMH 4AEIL 3MRQB 2ERJC 4FQXA 3V4VH 2FX9H 3U9UB 1IE5A 1UB6B 3T2OA 3SJVE 2BP3A 3LRGA 4NQDA 5E4EB 1T6VN 5LAXB 4CMHB 1S8DA 1X7QA 2IBBA 2GY5A 5ISZA 3TN0C 3RVWC 3O4LD 3RHWF 4FG6D 1S7QB 3MUY1 3ILQD 5GGTL 3LN5A 4LPTA 3LKRB 3F7YA 5BS0D 1WBZA 4P23C 3C6LC 3V7MA 2A9NL 4OKVA 2K9UA 3GJEA 1SEQH 5F3BB 2D0HA 3I2CL 4F7CA 4OGYL 1NCWH 1Q9KB 2FATH 5JOFB 1A9BA 1DUZB 2WBJC 5BZDA 3U7WL 4DUWA 3FFDA 4R90L 5HDOA 4G9DA 5ADOH 2JJTC 4NDMA 3PWNB 1GJIA 2GSIB 3VCLA 2Q7YA 3MNZB 3D85B 2W07A 4ONHB 5HVGB 1BHGA 4M43L 4KMTL 4YNYA 3RNQA 4HZAA 4YHPB 1JIBA 3NCEB 5HD8D 3OPZL 5I76B 1E0OB 3KPRD 1MCWW 3I3DA 4GLRH 4J3VA 4NRZB 1J05A 4MCZA 3OMZA 1YJDC 2G2RA 5FV2A 3PGDB 4XPTL 4K9EL 1FC2D 2AK4B 1Q9LB 2C5DC 1KULA 2A0LC 3B3IA 1VHPA 4O4YL 4WGWB 3BRFA 4H1LG 4QRUA 3VH8G 4OCWH 3G5ZB 3GSQA 4K2UH 4CVXA 1RIVH 3PIQA 3QR2A 3O8XD 3TO4C 3VXUA 1SVCP 4OLYH 1CGSH 2K7PA 1J11A 1LE9B 1Q1JL 2YPLD 3SKJL 1AFVH 1XGYH 1W72L 4XP1L 2M1KA 5AWNL 5I66A 1D6EB 5IHBA 3C2AL 4X6DB 4ZFZA 4ONOA 2A6DA 5L9DH 4PB0H 1ZXQA 3FB5A 3KPQA 4K3DL 1M05B 5BRZB