4QHNA

I2 (unbound) from ch103 lineage
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
222
structure length
222
Chain Sequence
b'VQLQESGPGVVKSSETLSLTCTVSGGSMGGTYWSWLRLSPGKGLEWIGYIFHTGHTNYNPSLEGRVSISVDTSEDQFSLRLRSVTAADTAVYFCASLPRGQLVNAYFRNWGRGTLVSVTAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords I2 heavy chain
publication title Affinity maturation in an HIV broadly neutralizing B-cell lineage through reorientation of variable domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2014-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhnA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhnA01
3AROA 3STLA 1F00I 4ZNEE 5GRWA 1F90L 1U91B 4QOKD 5DI8B 4ENEC 4MVBC 5DZNA 1CDIA 4UT6L 2HT4D 3FRUA 4MD5B 3IDNB 4CVWA 4F7CB 3ES6A 3T0XA 3BN9C 1GGIL 4GQ9L 3L3IB 3OB8A 1N59B 3I75B 5ID1B 4KROB 5GS1B 5CGTA 4GXUM 4WI3A 2R1WB 2EH8L 3KXFD 4NNPL 4JGUA 5K9QI 2A1WL 3GMNB 3WXVH 3HG1D 5FV1L 2F58L 4CN6A 4PJGA 1ED3A 2EC9U 4I77H 1ADQL 4A6YH 1CVRA 2BY3A 2YD8A 3T77B 3TIEB 4LU5H 4M4PA 3HAEG 1HINL 2BC4B 4LHJB 3OJMB 4M6MH 5EO0A 1FIGH 1A7PL 2D2OA 5IOPA 5C09D 1AR1D 4KPHL 1UH4A 3L95A 4JO3L 1S7SB 2LU3A 2PO6A 3RUGA 3RZCB 3LEYH 1MQ8A 5H35B 2XOTA 3SDAA 3UZVB 4XVSL 4YR6B 2DF3A 3X3GH 2CDFB 4NYLA 1MCEA 1ZHLA 2X4NB 4ZAKB 5I75B 2IBBA 3S97C 1WC7A 3Q5YA 3D85A 2VZUA 5LQBL 1LMKA 1EUTA 1V8HA 3FN3A 2DWEB 2C3HA 3MV7A 5E6IC 3FMGH 3H0TA 1CICD 3VWKB 1X5GA 5C0DA 2J12B 4KI5D 4M9OA 4FQ2H 4AEHH 1ZHKA 3MLTB 1AD0B 2VLJE 5J13B 2XTJB 5BS0A 4OQTH 1XCQA 3CU7A 4KRNA 2BOCB 1EMTH 1OTSD 1RZGB 3BI9X 4M6NL 4NKIL 2OTPA 4LASH 3LQMA 2YPLA 3SQBA 1CD1A 3ZDXF 2CUMA 4X83A 4G7YL 3QRGH 1WT5A 3QHZH 5D6CB 3V0WL 1DR9A 4HS6A 1B3JA 4PJGF 4NJAL 4XI5C 4HS3A 5JDSA 3JV5A 3O2WL 5CJQL 5EO9A 4FABL 4J7RA 3IAPA 5I8CA 4IRJB 1X5LA 3U46B 5I1KH 4KKLC 1IAOA 1KGCE 3OV6A 1K3ZA 1FYTD 2IALB 2VTFA 1E4WH 3ARYA 4TNWK 2FB4L 2HP4A 4TRPH 1U8HB 2GITA 4WNQB 4JY4B 5D1QB 4KXZI 1KPUA 5TFSH 1BEYL 2ZG2A 3RUGF 1U3JA 3SBWC 1UKQA 3SKOB 2HVJB 4LLMA 4CVZB 5IROA 2NCMA 2GY5A 4HCRH 4YC2B 5GJTH 5EDXA 3P2TA 4F7EB 4UILH 1S7XA 2ICCA 3VRLE 4KUCF 1YY9C 5DQDL 1RZKC 2BCKA 4L29B 2A77L 1KTKE 3CMGA 1U8QB 2BSED 1EXUA 5FB8A 2FO1A 5TE7L 2VDKL 1NDGB 1AQDB 2DQIH 2H32A 4WV1C 3RDTB 1UKTA 1TCMA 1VDGA 3Q5TA 4NCC1 2AJ3B 2CO7B 5JOPD 5EULV 1RIVL 3E8UL 2BVOB 3GIVB 4P4RB 1XCTB 2UVEA 2YKLH 1TZGL 4K3HA 4YGVB 3INUH 1EAPA 5HGBB 4O02H 1ZWIB 3IKCB 4JPWL 4EUPB 4U3CA 1WTGT 2DI9A 1NBZB 3M17B 5B8CC 1HNGA 2P46B 4Y2DB 2HWZH 5F1NB 3ESUF 2RCSH 1BPVA 3ZT7A 1FO0H 2B1AL 4JN1H 4PS4H 5FUCE 5EH1A 3WUWB 4HC1L 1NCDH 3IVKB 3GMMA 4DOHB 1NBYA 1NGYB 4UZGA 3MRNB 2ZG1A 1DBKH 4P4KB 3S5LG 2WBJC 4AH2B 1DANT 2R1YB 3O6MH 4NSKB 3O6KH 3FO9A 3NN8A 3WJJC 4QY8A 1R3IH 4CADA 2EE9A 1DFBH 4NUGL 1GH7A 5E6ID 1RK0A 3RY6C 4ALAL 4NWUL 2DQCL 4P9ML 5KZCB 1HWHB 4XPTH 3PWPB 1OF2A 2R2HB 4KTDH 4YDJA 3FAWA 1CZ8L 2JTDA 4DN4L 2PNDA 1OCWH 2P49B 1M71B 3DRTB 1S78D 1GIGL 3IGAB 4FQ1H 3RKDC 5FFLA 3QEUB 4LAQL 4EIZC 4JY5H 4G9FD 1QD0A 4IMLB 1PAMA 3A67L 1F45A 3QWRD 5DLML 3TO4B 2BVYA 5LGJB 1JPTH 3B9KB 3O45A 1XGTA 4JEGB 4PJ9C 3OKMA 3PABB 4L3ED 5ICZA 5HYSG 4ZUUA 1WBXA 3GMOA 2QHRH 4MXVF 2VL5A 3U83A 3BEVB 1DBAL 4KKLD 3U7YL 3L3DA 2CKBL 4XCCH 2QQKL 3EO9H 3EYQC 4OD1H 5GGTH 1HSBB 3QXDB 3S8WA 1F58L 5CHNB 1QR1A 5FYKU 3FONA 5DK0A 3UROR 1J05B 3PHQA 1BZ7B 5KW9H 3H3BC 1S7VB 1LP9A 1IMHC 3SGDI 4BSJA 4HIHA 3LD8C 4Y4FC 1KIRA 3K8KA 5IV2A 4HWEL 1H15B 1J1OL 4PRPD 5MHSE 3GSVB 2VH5L 3V4PL 1WCBB 1IGTB 5DD3L 3UTZA 5IVOA 4YDVA 3HC0A 4M62L 4OM1H 3RU8L 4PJIA 1S3KH 1JZ5A 3GJFK 3DX9B 4LCWB 5HDQH 5DRWB 3MNVB 5C7XH 5E6ZA 4NBXB 4G6MH 3ROOB 3WFEH 3DVIA 5DJDB 1DBBL 4M6AA 3RAJL 5IR1A 1U8PB 3L3OB 2GTWB 4QXWA 4NQXA 1KC5H 1BHGA 4Y0GA 3SDXA 1BWWA 1UB6B 3KPSA 3OKYA 1DQJB 1BX2B 1KPRB 3BPOC 3KYNB 3CPLB 2C1PB 5L2KD 1YC8A 4ZODA 3QCTL 4BFEA 4XMPL 4IBLT 2YUZA 1FZJB 4XNXH 1VENA 3AU1A 2GEEA 4WHTB 4OCYL 1QR4A 5E2JA 4W81A 3SKJH 3MPCA 4JPVL 2EH7H 5KVFL 3T0EC 5T3XE 1DP0A 5KSAC 5T3ZE 4M3KB 5EU3A 3GBLA 3JVGA 3FQRB 5F7EH 1LVEA 3E6FA 3VXSA 1GZQB 2XRAL 3DHJA 4HH8A 4M03A 5JPMA 3VXRE 4OFKA 1D5MB 2HH0L 4Z0BH 5D1XD 3GO1L 1QKZH 4NO5A 1V3MA 2RQ8A 2R69H 1I8IA 1UG9A 4X8JA 1P4BH 3WFBL 1IC7L 1I9RL 3TA3C 4KDTC 4XPHL 5BV7H 1LP9F 4E41A 1RUML 3RKDD 4Y16A 4P5KA 5KSBA 1GJIA 4G6FD 4K3JL 4XP4L 3V6ZA 4P9HH 4R97B 2EXYC 4PJIF 3IJYA 2IC2A 5C9KA 4QOKA 3PDGA 4PJ9D 3ES6B 1ZGLP 4CMMA 2D7MA 5FYLE 1Y6MR 3AREC 2VC2H 1MIEH 3ZL4L 4D3CL 1TXKA 4PGZA 3BUYA 2P1YA 1OD9A 4QT5A 5EZIL 4K07A 1HQRA 3SDXF 2P24B 4FXGA 1Q72H 3G08A 4PJGB 1BBJA 1ED3B 1DE4A 1FLRH 4TPRL 4ZSOA 5F9DC 2CD0A 5CEZH 3KLDA 1CK0H 1MCFA 5HVHC 1SEQL 4Y4FD 5EO0B 1A7QH 1CXIA 4NBZB 3O4LD 3PQYD 5FECA 2PO6B 4KVCH 3RUGB 1DBML 4N68A 1X5AA 5C09A 3S98A 1J88A 1AO7D 1RZKL 2Z93A 1TJGL 2NQCA 1VPOL 3SDAB 3S35L 4WU5A 1JI1A 4NYLB 5C1MB 1WLHA 1ZHLB 1D5IH 3BFOA 3VFWA 1WC7B 5IB5A 3D85B 5C0GB 2HFFA 2VJXA 4O51B 1ZANH 1M7XA 3QUYC 5D93C 1DCLA 3H0TB 4YHMH 3SY0A 2CK0H 3TNMA 4ODSH 5F1IB 1N0XL 5C0DB 1WCQA 1PW3A 3ARDC 3HNVL 4HJGB 5I19L 5KSBF 4M00A 2QBWA 1ZHKB 1CICA 4QCIA 5BS0B 1QBBA 1XCQB 4LLAA 3VI4E 3LMJH 3QA3A 4XVJH 4JFDE 5ADPL 2AK1L 4ZTOL 1SBSL 4KQ4H 3TPKA 1S9VA 1KB9K 3WIHH 3T0ED 2YPLB 3ULUL 5MEQA 5DJ6A 1CD1B 5FGRA 1EJOH 3DARA 4WUUE 3SO3C 5JMRA 1F02I 2F8VA 3MRKA 4IRSC 2IQ9H 3NIGE 1YC7A 4OCXH 1G7MA 4HS6B 3UYRH 1QEWA 3ALPA 1SYVA 2VO5A 4HS3B 5JDSB 3DUHA 2BHYA 5EO9B 5I8KL 2VXTL 3KPRE 1IAOB 3P11L 2BSTA 3DHMA 3TA3D 1X4XA 4Z7UE 3M8OH 4UIMA 1CD8A 3TM6A 3OXRA 4NZTH 3E2HC 2ZG3A 4TUOB 2GITB 2OP4L 5IJVA 2IANA 5ANME 1FYTA 1JP5A 1KPUB 2ID5A 4F7TA 3DYMA 5JTWA 4LLMB 2C26A 1SJHA 3GSUA 1LQSR 3DO3A 3KR3H 1SMAA 3V4VL 2X6MA 4TSAH 2GYSA 5L6YH 4RFNB 3DXAD 1UYWH 1CGWA 5GZNC 1S7XB 2O61A 1IFHH 5IW1B 4JJ5A 1BAFL 2BCKB 3MJ9L 1VFUA 4W68A 2MCG1 1EXUB 2ITCB 5H2BA 4X6DE 3RWJA 5KVGH 4N0UE 5L8LB 5FB8B 4NZUL 2CRYA 1QLEL 3WNOA 2H32B 4JB9H 4YDLC 4MYWB 1RUPL 4GBXC 4Y5YA 3IYLW 4GKNA 4JFYA 1V3KA 1N6VA 9CGTA 5JQ6H 4GG8B 1FPTL 4DKAA 1RZFL 1FG2A 4R96A 1EAPB 1P4IL 5EIIA 3O8XC 4JFOA 4WI9A 1QSZA 3IFPA 5IFAH 1JNNL 3MLXL 3BRDA 3QP3A 4EXKA 4Q74A 1GAFL 2F54E 4WO4C 1LDPH 1ZA6A 4N0RA 3PWJA 2MPAL 1QBLH 2V2WA 3GSNA 4X7CC 3CAFA 4S1RH 4F57L 2R9HC 5ACLA 4QXGH 4ONFL 4D9RE 1Z9MA 2F5BL 5KVDL 3GMMB 1NBYB 2C4XA 4KHTH 2NXYC 3V5KA 1HEZA 1KTLA 3NN8B 3RHWK 1CFVH 4BK4A 4CADB 2YSSA 4APQC 1RK0B 3LDBC 4OF5A 3D9AH 2NXZD 3CFKA 3PGFH 3KPMA 4DGYL 1KBGL 1OF2B 5I1JL 3C2SA 5E6IA 2Q8AH 4LP5A 4YDJB 4GAFB 3QUMH 2P44B 2XACC 3RX5A 3ZHDA 2YHGA 3O3DA 4XP5H 2Z35A 4DKFH 4JO4L 3PP4H 1KGCD 1RMFL 4R3SA 4WTWA 2J2ZA 2VWEE 5F96H 3C08L 3W2DH 3WUZA 3MACH 1HNFA 4NZJA 2QJDA 5D1ZD 1KENH 5IEKA 5JW4R 4PRBA 1FZMA 1IAIH 2H1PH 4G9FA 3O45B 2X9XA 4PJCA 1XGTB 1XGRA 3OKMB 3QWRA 4PJEE 5ICZB 1KB5A 3O2VL 4ZUUB 5BVJA 1CWVA 1WBXB 3GMOB 4X7SL 2VL5B 4HJ0D 2HJKA 3T08A 4K71B 5IEHA 4L3EA 1RIHL 1ZVHA 1EHLL 4R2GD 3NFPA 3L3DB 1W72A 1SBBA 3DRQB 1FIEA 3K4AA 4PLOB 3VFSA 3EOBA 1GRWA 3VGFA 5FCUL 4NJ9L 1T0NA 1QR1B 5C0AD 5IF0A 3FONB 1IM3A 4Y19A 3T8XA 5DK0B 3KYOA 1PSKH 3PWNA 3TT1L 2CMRL 5BO1H 5HGHA 1LP9B 1MCWM 1MJ8H 3HNTH 4HIHB 3SBWA 4G42A 4UMGA 3V0VA 5IV2B 1H3PL 3MLZH 2AEWA 3LQAH 3LH2H 1ZK9A 5A3ID 3K46A 3UTZB 3O3AA 1CTNA 4YDVB 3HC0B 4PJIB 4OM0L 3QEQE 2OBGA 5C0FA 1FNSL 1B4JL 3ZTJG 1FLTX 4WEUD 5IR1B 3O3EA 5IQ7H 3I2CL 3DV4A 3CFDA 4NQXB 5DVKA 1A3QA 1DQTA 3SDXB 1HKFA 2N7BA 3KPSB 4GRMA 4AIOA 4RWYL 1ORQA 1GOFA 2DLGA 2ED8A 5B8CA 2Z0BA 3PE9A 3EHBC 4PJCF 2ESVA 1L7TH 3AU1B 4MDIA 4OCLC 5DQ9A 5L2KA 1EHAA 5EOQL 2OK0H 2Y36H 4U0RB 5CEYA 4FQLL 3JTTA 4RNRA 4MZ2A 1M1SA 2G75A 4NCDA 5EU3B 4K2UH 1YECH 3M1BA 3TYFA 1INDL 5LBSL 3CU1A 2W9DH 3E6FB 3VXSB 4FZ8L 3RPIA 1NLDH 5JPMB 2VZ3A 4YK4C 3WJJA 2HLFD 5D72H 4ZS7H 1UCBL 3K4DA 4JFZH 1MLBA 3GB7A 5HI5D 4NO5B 3RWHB 1VEPA 2HFEA 4M7JH 5GZOD 3CXHJ 5D1XA 1I8IB 4X8JB 4HPYH 1U58A 3OPZL 5E03A 1WFUA 4E41B 1GL4B 3O6FD 4UT9H 2F19L 4TVPE 3B3IA 4Y16B 1FN4A 4JHZA 4P5KB 5SWQA 5KSBB 1D6VH 1IGCL 3Q6FA 4PJHA 4DAGH 5DVNA 3VXUD 1GGCL 1R5IA 3MRFA 2DTSA 4N0CD 4QOKB 4CMMB 4NBYB 3WNPA 4EXPX 1NMCB 3H9SE 1KOAA 1EHXA 5I1EL 1BMGA 4LIQE 1QO3A 4PJ9A 4J2XA 2BY0A 4LSRH 3BUYB 4POYA 5MHSD 1KJ2A 15C8L 4RFEA 4J12A 1HQRB 5I0DA 4FXGB 4EUPG 3D39A 2Y7QA 3G08B 1LHZA 3IS1X 1BBJB 2VLME 1DE4B 4KRPC 2H2SD 4POZC 1BQLL 2MCPL 3WUWG 3EJYD 1CDYA 2IPKB 2VXSH 3WLWC 1NH6A 3WKMH 3U9UA 3KJ6L 4U1MB 3GK8H 4Y4FA 1T66C 3G04A 3B9EA 3ZZ1A 4XNZC 5C09B 4YHOH 1E6OH 2Z93B 3O4LA 4Y1AE 3PQYA 4XZUA 4S11A 1KN4H 1OSPL 4X4ME 4R8WL 2VDOH 3CNKA 4WU5B 1AO7A 1QFWM 3NFSL 4JZNA 3CFCH 2FX7L 5T3XD 3EJJX 3VFWB 5T3ZD 1Q9KA 2FHFA 5IB5B 4OCWH 2HFFB 2X4OA 4LRIC 3MLRL 4OLXH 3EYFA 1ZEAL 4Z7WE 3SY0B 3P9MB 3TNMB 3Q1SH 4LSDA 3BISA 5BZDA 3ETBF 4EQ2A 4MJIB 5BJTA 1ZLVH 4PJHF 1CXEA 1CICB 2DD8L 1GGUA 1H3XA 4QCIB 3RVVD 3VFNA 4PTTA 3QA3B 3DYOA 2NY0D 2PW2A 3WCYA 1UWGL 1S9VB 1Z3GH 1J8HE 2E9WA 43CAA 4OFPA 5MEQB 5DJ6B 2NY5C 1NPUA 2FH8A 1BREA 2VQUA 3VGBA 3MA7A 1GZPA 1MFCH 4X7FC 3T0EA 5D7JC 3MRKB 2APVA 1G7MB 1QEWB 2E7BA 3C2AH 1FBIH 2HYMA 4TYUA 4Z18A 1E6JH 3WXVL 2BSTB 3OF6D 2KKQA 4OLUH 1KB9J 4PJDE 3V0AC 4UIMB 1EGJA 3OXRB 4I77L 5IJVB 3TA3A 4KDTA 2IANB 1FYTB 1G0XA 1J87A 4F7TB 2GJZB 3BIBX 3GSUB 3QO1A 4M6ML 1FIGL 1EVUA 3HZMA 4K7PY 3KLAA 4PBVC 2O61B 3FQTA 4LLQA 1HDMA 3QI9D 2DQTH 5H2BB 3RWJB 3LEYL 3SJVD 3DXAA 2ZCKL 1QSVA 3LEVH 1J7VR 4UINH 3ULVE 2PUQT 3NTCH 4RAVA 4Y5YB 4H8WC 4QRPE 4GKNB 3X3GL 4JFYB 5F7UA 3ULUE 2YEZA 4OGAD 3T2NH 3A6OA 4NQVA 1PJ9A 4PRIA 5ITFA 1FG2B 1I1RA 3FMGL 1XF5A 2Y1VA 4R96B 5CLWA 3DMMC 1T04A 5FKAA 5BV7C 1X5HA 5KAQF 4FQ2L 2F74A 3IFPB 1RAMA 4OQTL 5DR5L 4DEPC 5J7CC 1OSZA 5J06A 4NZDA 5BOZG 2ZPKH 1ZA6B 3PWJB 3Q3GA 4K3DL 1RZJH 5F6IC 3CCHA 4MNGB 2V2WB 1SEBA 3GSNB 4P9HC 1L7IH 4LASL 3LB6D 2Y9RT 4JFDD 3R1GH 1WSST 1BVLA 1QSEE 3QRGL 5DFWH 3V5KB 1HEZB 3B43A 1I85C 4YH6A 5FGBA 3QHZL 1KTLB 4NKOA 4MQXD 3QXAA 2HMIC 2YSSB 4WUUD 2VIRA 1BZ9A 3CFKB 4XP9H 2X4QB 3KPMB 3TBWA 5I1KL 5E6IB 4WTZG 3O3DB 2Z35B 5M7QA 3KPRD 4TRPL 4R3SB 1ZLVK 1CG9A 5TFSL 4L4TD 1M7IA 4MZ3A 2I26N 4NC1E 3TIDA 4HCRL 4PRBB 1FZMB 1T22A 5GJTL 2V7NA 4G9FB 3KYMA 4PJCB 4LHUG 1XGRB 3CX5K 5HD8D 1FFPA 1MCWW 1KB5B 3D69A 5BVJB 1IAKA 1RUKL 5I8EA 4IRSA 5IEHB 3CSPA 4JKPH 4L3EB 2HTLC 2DQIL 4ZOBA 3NFPB 3QFJE 1W72B 4MA7H 4P2RE 5A2FA 2YKLL 3EOBB 3FTGA 1T0NB 3INUL 4XCEA 5EC2A 2D9CA 5IF0B 1CLOH 4LDOB 4O02L 1IM3B 4Y19B 5LXGH 3T8XB 1OP9A 3KYOB 4LVOC 5DMJB 3VMOA 2GHWB 5C0AA 3KYAA 5HGHB 2HWZL 5J57B 4GRWF 2EE2A 1A7OH 1MCLA 4G42B 3V0VB 2RCSL 5BRZE 2W0LA 4EOWL 4Y5VA 1FO0L 4U1JA 4JN1L 2EIDA 3Q2CA 2WW8A 1RJLA 2GJ6D 2F54D 1JGVH 1FGNH 5E1AA 3T0BA 3JWOH 3RBSA 1DBKL 2ADFH 5C0FB 1R3IL 5K9OA 1DFBL 3O3EB 3RI5K 4IOFC 4XPBH 3IDMA 3DV4B 3CFDB 4I3SH 3UTPD 3DMMD 4XPTL 4CGTA 4GRMB 3ZDYF 4KTDL 1ORQB 3QIUC 1JYWA 4IDJH 3AY4A 1OCWL 2WZPD 2XA8H 4R26H 4U6YA 5B8CB 2UY6A 5MENE 2Y72A 4RISH 4I13B 4FQ1L 4GKZB 2ESVB 1ZT1A 4HBCH 4MDIB 5DQ9B 4G43A 4RMTA 5KS9E 5L2KB 4JY5L 3O9WC 5CEYB 4HAFA 4RNRB 2OMNA 2G75B 2RBLA 3JTSA 4OGYH 1JPTL 1NCCH 3M1BB 4JDZA 4RBPH 3TYFB 5H37G 5FGCE 3NMEA 2OR8A 4OJFH 4I0PD 3RPIB 1YNKH 2EKSA 3T0VA 2WBJB 3EYVA 2QHRL 5E5RB 3TBTA 4G6KH 1MLBB 5IB1A 3GB7B 5CSGA 5JHLH 3IETA 4S1SL 4XCCL 2HFEB 1FHGA 2YXFA 5D1XB 2DKSA 1U58B 4OD1L 3W39A 5GGTL 5DD0H 1EUUA 3IT8D 4CJ0A 1NBQA 3B3IB 4G8EA 1FN4B 5SWQB 3QO0A 4LCIH 3HZKA 4HGMA 2RR3A 5SWZD 3O6FA 3Q6FB 3VMNA 2IH3A 5KW9L 4U2YA 2YXMA 3KVQA 1R5IB 3MRFB 3HR6A 2NY5L 1MI5E 3DNKA 2D7QA 4FQJH 3VXUA 4BQ8A 1QUNA 5JO5A 1QO3B 3O3UN 4HK0A 4PJ9B 4U1GC 4OM1L 3RWGA 1S3KL 5ABDE 1KJ2B 4RFEB 5HDQL 2DM2A 5C7XL 1AIFA 3D39B 3F58H 1IGMH 1A02N 2ED9A 3QEQD 3K7UA 2IMMA 4QRTA 1KC5L 4ZUSA 4XWOC 3O4OC 3WHXA 5C6WH 2X09A 1F13A 4ZOEA 4QRSB 1YMME 2L7JA 3CK0H 2VSDA 3V6FA 5CP3A 1Z5LA 3MREA 3LD8B 4XNXL 4Y4FB 3G04B 2PXYD 7CGTA 3U2SA 1A0QH 5E2WH 3SKJL 3ARGD 3DUSA 2BXZA 2EH7L 2ZP0T 3O4LB 2VR4A 4XZUB 1DUYA 2V5YA 3L7FA 4OZ4A 5F7EL 1AH1A 3VD9A 1AO7B 1A8JH 4JZNB 3QUXD 3LS5H 2J6EA 2OJEA 1Q9KB 2VUYA 4H8WL 4XNQA 3VWJD 3P30H 3ZE0F 3ROLA 1H3VA 2X4OB 2VMFA 3K2MC 5JZ7C 2NW3A 2LTQB 1JGLH 4Z0BL 4QF1B 1O0VA 3EYFB 1JI2A 1QKZL 3C8HA 1OQOA 4LGSB 1BJ8A 1VGEH 5BZDB 4ZO7A 4WFGD 4JQIH 2R69L 1P4BL 1QACA 5BV7L 3BPOB 1TFHA 3VFNB 4PTTB 5E5UB 2M2DA 2IBGA 1U9KA 2PW2B 2BOBA 3WYRA 4JQVC 43CAB 1TCRA 2DQJH 1KCSH 3I50L 5HJ3A 3WS6C 3MUGA 4P9HL 4JDVA 4WFFE 3QPQD 1WIUA 3MA7B 4PP2B 3TVMD 1GZPB 2JJSA 3LQAC 2BVTA 1T03H 1OLZA 3T0EB 1W0YT 3GJFA 4U1KA 5KSAB 2VC2L 5DD5H 4ZFFA 4ZUTA 1CDUA 5EZLB 3OQ3B 4M93C 3H9SD 5L7XH 1C08A 5CBAA 4G8IA 1FRGH 1Q72L 4RGOH 2Y06H 3QUKB 4JM2D 1FLRL 4MB5A 4W6XB 3O2DL 4QHNA 3TA3B 2D3VA 3OF6A 3VA2C 5CEZL 2H3NA 1CK0L 4M9PA 1JNLH 1JRHH 1FH5L 2QSQA 3QO1B 3U0WH 3HZMB 5MI0C 5JIHA 1A7QL 1IKFH 2ZKHH 3KLAB 3EOYG 3FQTB 4K3EH 4LLQB 1HDMB 1PG7L 4YPGA 2EE3A 3DXAB 2W0FA 1SVCP 2J8HA 5BQ7A 2O26U 1JMZA 3UPRA 4RAVB 3SJVA 5I9QC 2EDXA 3ALWA 4Y1AD 4PJ8D 1D5IL 4M5ZH 1FJ1A 4NQVB 2BJML 4OZIA 1U2CA 4PRIB 5ITFB 1MEXH 1P9MC 4LDEB 4XWOD 5B3JE 2CK0L 2YN3A 3DVNB 1REIA 4ODSL 1T04B 5FKAB 1OY3B 2AI0H 2F74B 4KHXH 5C3LD 5FV2A 5DTFA 3MUJA 1OSZB 3LMJL 1TNNA 2XN9D 4MQTB 3UJTH 1HHGA 3ECBA 3Q3GB 4KQ4L 3RVTC 3CCHB 3WIHL 1SEBB 5FKPA 3CLFH 2OX5A 4RMWA 2Z4QA 3UCRA 3I02A 3EDEA 5HTSA 1DBJL 1E4XH 4GRWB 5E9DD 1UVQA 1BD2D 1EJOL 5J1SC 4MQ7A 1J8HD 4Z7NE 1BVLB 1Q0XH 1NSNH 4KJWD 2IQ9L 4NKOB 3UYRL 2EXWD 4MNQD 2OL3A 3STBA 1IEAA 1II4E 3QXAB 4XB7A 1NGWA 5C0CD 2E6QA 1D5BA 5IMKB 2VIRB 5A43C 3F62A 1BZ9B 4PLKC 4LRIA 3TBWB 5D93B 3HZVA 2Q8BL 1NAML 1A3LH 3ARDB 1OGAE 3M8OL 1WWWX 2J3SA 5GGTA 4NZTL 1N64H 1A22B 3SGKC 3HE6C 1S7QB 5GRZA 1CG9B 1XF4A 1CFSA 5FHAL 1M7IB 3NA4A 2AXJA 3KR3L 3ZO0A 3TIDB 5JW3H 5IMLA 4TSAL 1C1EH 1T22B 2FGZA 2V7NB 4IIQC 4L4TA 5L6YL 3KYMB 1IFHL 1FFPB 1SJXA 5A2LH 5ANMA 4J3VA 5KVGL 1KULA 2MKWA 1IAKB 3ZKMC 5FM4A 4OZIF 4IRSB 3G5VB 5IJKC 2E7CA 2HAZA 5TQ0L 4JB9L 1G7JA 5K9QG 1CL7H 3RTQD 3RWIA 3GUTA 3U79A 3ULVD 1AI1L 3BQUC 5JQ6L 4QRPD 3SDDD 4XCEB 1EEZA 4GXUN 5CKAA 4AY0A 5EC2B 1S5HA 2E6PA 4BKLA 3FZUC 3E2HB 5DHVA 2EDKA 5GRUL 1QHOA 5IFAL 1B0RA 5C0AB 3MGAA 3GMLA 1T1WB 2EIBA 4JFFE 4Q9QH 1DQDH 3LAFA 4Y5VB 4ZUWB 3VI4F 1LDPL 3F7RA 3QZWA 4U1JB 1QBLL 1ZT4B 1HYRC 4S1RL 1RJLB 3IDJA 1AKJD 2DM3A 4QXGL 5T1MA 3JV0A 3X13A 4LPXA 5E1AB 1S9KC 1GPOH 2AJVH 3HMXH 4KHTL 4FFVD 3I3EA 5E4EC 2DKMA 2GJ6A 2F54A 1D6EA 3VCLA 4PJXE 4X5WA 5K9OB 1NC2A 4UIKH 1CFVL 2HLAA 4I9WD 2V5SA 3MV9D 4EUPH 1QSED 3BKJH 3IDMB 1A64A 1AXTL 4CNIB 3D9AL 4BQBA 4RQQA 4WGVB 3BESR 1SY6A 3PGFL 1BZQK 5CGMA 2Q8AL 4PIRF 1CFBA 1A1OA 3QUML 5IGXH 3DMMA 5TQ2H 5IIEA 3S4SA 4XP5L 3TV3H 5EO1A 2M1KA 4DKFL 4TSBH 3PP4L 4XX1E 4U6YB 1ZHBA 4ONOA 3HKFA 4EVNB 5F96L 1ZT1B 3W2DL 3MACL 4G43B 5SX4H 3DLQR 4WO4B 1KENL 2AJSL 3MRBA 1A21A 3JTSB 5C6TH 2Z8RA 2XQYG 4JDZB 4PLNC 1U95A 4DTGH 2W65A 5D7SH 5I1DA 5IWLA 2NXYB 1IGYA 1I9IH 3EYVB 4Z95H 3TBTB 2X9YA 25C8L 3RQ3A 5IB1B 2AW2A 1VFOA 4I0PA 4I4WA 4V2BA 3LDBB 4NHCH 1XAUA 3IETB 1GGBH 3PXHA 3QFDA 2YC1A 3AB0C 4U6XA 4XBPB 3DWTA 3W39B 5L2JA 3EDFA 5F6HJ 2GY7B 4G8EB 3VH8A 3O2DA 3QO0B 2IAMC 3P9WB 1OL0A 1XR8A 1SHMA 1PSKL 5JIIA 1NJ9B 1MRDH 2VZTA 2IH3B 5DWUH 5BO1L 3MRGA 3HS0B 1LE9A 3HNTL 3MJ6A 1KLUA 1RZJC 3OX8A 4KQ3H 5C0NC 3MLZL 4PG9B 5SWZA 1JZ3A 1JHKL 5HHQB 3AAZA 3LQAL 3VXUB 5JO5B 5C8JA 3LH2L 5BRZD 4HK0B 5HDLA 4AEEA 3L3GB 4U1LA 3RWGB 5LAXB 3M07A 4UOJA 1AIFB 3ZT6A 1MCHA 1DTUA 1FNFA 5IQ7L 3BP6A 3QIWD 2BNQE 1MJJA 4QRTB 5E2UH 2ZCHH 2B5IC 3WHXB 4Z7OE 4H88H 1K5NA 3K80A 1XIWC 5DD6A 3SPVA 2B8OT 4YXKH 3L3HB 3D48R 4R4ND 3V6FB 4I2XA 1Z5LB 3MREB 4LCUA 4XP1H 3CDGA 2Z91A 4HWZA 3W0WE 3U2SB 2OK0L 4NHUA 1RZ8A 4IOSD 2X40A 3DUSB 4O00A 5MEND 1MJUL 5J12C 3FN9A 2PXYA 1DUYB 4K2UL 1LGVA 1ZLUH 5F3BA 5K9JL 2XKUA 1IL1A 3L7FB 4OZ4B 5E8NA 2W9DL 4OCNC 5I6XC 3UTQA 1NLDL 4G7VH 5LWYH 2V2TB 4XNQB 3ROLB 4MB3A 2NW3B 5D72L 4ZS7L 4JFZL 4EQ3A 2O5YH 1UJ3A 3H9HA 5E00A 2CK2A 2VDMH 4XWGH 3QUXA 4FTVE 4M7JL 4X4YA 4XAWH 3ARXA 7FABH 1U3ZA 2WWKO 5A2JH 4HPYL 1NAMA 2DLTA 1RFDL 5HY9A 5ETUA 4IHOA 3QIUA 1CIUA 1TETH 4JRYD 4UT9L 2Q20A 4BJLA 1D6VL 2BOBB 3T1FA 4KJQC 1DN2A 1LO5A 4GMSL 1A4JA 3QQ9C 4KK6D 3T3MF 2EDOA 1TCRB 4KZDH 4DAGL 3MUGB 3RHWF 4JDVB 3HA0A 1V05A 5CAYB 3BJ91 5HHVH 3GJFB 4U1KB 3GI8H 3MJGX 4OF8A 4ZFFB 4ZUTB 3RIAK 5CFHA 3BMVA 3V6OC 3NA9H 3ILQD 1AGFA 4LSRL 3RIFK 4GO6B 4NM8H 5GHWH 1C08B 4YK4B 5CBAB 4G8IB 2GI7A 4Z5RA 1NUGA 3K74B 3H9SA 4F7PA 4PJFE 4F8TA 3N1GC 3KPNA 5F6HI 5EZOH 1U93B 4Y2OA 5FO9A 3EKCA 2H3NB 2WSKA 4JM2A 4MXWL 2OJZH 4KH2A 4OZGE 4LLDA 2VXSL 5C0ND 1PX4A 3X14A 3WKML 4OCRH 2FD6H 1QPPA 1YMMD 3GK8L 1WFOA 4I18C 4YHNA 1PYWA 3ZDZE 4YHOL 4O5LL 4OUUA 3X17A 2W0FB 1S7RA 2VISA 5BQ7B 1KN4L 3DSNA 2EICA 3S37X 3UPRB 2VDOL 3SJVB 4CN4A 2AJZA 4OFYD 3CFCL 4OCWL 2XZZA 2UZXB 4OZIB 1S9WA 5CJOH 4WWKC 4S1QH 4Y1AA 4PJ8A 3Q1SL 1M6OA 1FORH 4KRPB 5FYJH 4MCZB 5J11B 2V5RA 5DTFB 5DFVC 3CMOL 2YOCA 2NPLX 2NR6D 3NPZB 1HHGB 5DJXA 3RWDA 1Z3GL 4QNPE 5FKPB 5I1LA 2VL4A 4NQSA 2Z4QB 1VGKA 1DDHA 1KXTB 3I02B 2XN9A 3MV11 4XNZB 1UVQB 3PV6A 2ZNWA 5HI3C 3T0AA 4MQ7B 1MFCL 1WAAA 3GNMH 4GRLC 4NP4H 2F15A 3P0YH 5E9DA 2OL3B 1BD2A 1IEAB 3SOBH 1NGWB 2DOCA 1J8HA 3MLPA 1ZLUK 4DZ8A 4JPKH 2MWCA 4MNQA 1FBIL 1V3JA 2FDBP 4QRQA 5C0CA 1E6JL 3HZVB 3U0TA 1YY8A 3UTTE 4JM2F 1KN2H 3EJZC 4HUKB 4HGWA 4OLUL 4FRWA 3ARFD 2FL5A 1PEZA 3O6LH 3V95A 5EA0H 3OKOA 4JFHE 4KJQD 4OLVH 4R7DA 4RRPG 4LRNH 1CFSB 3QQ9D 4HIEA 4NQCD 3TBSA 5FM5M 5IMLB 5CD3B 2N1KA 4DK6A 4JQVA 4AEIH 1T7XA 1K9TA 4Z6AT 3FFCE 2P47B 4L4TB 4PJDA 3SGEI 3TWCH 2DQUH 1I1YA 5HYEA 1NQBA 3IAGC 2VXVH 4HFUH 4KK5C 4X80L 5ANMB 2FECI 3FO0H 4M1GH 3RJQB 8CGTA 5D7JB 3NH7H 3HFML 4UINL 5CZXC 3OZ9L 1G7JB 3C5ZC 1EDQA 4LEOA 3MRDA 3RWIB 3T2NL 3BJLA 4PJ7E 1JYNA 3GUTB 3VGDA 4L4VE 4ODHH 3N0PB 1G84A 2GT9B 1DVFC 3RTQA 1EEZB 1JPGA 2FEDD 3U4AA 1S5HB 1RVFH 5ESAA 1LE5A 4UBDC 5DHVB 1BQHA 4QRPA 4RGNC 3BXNA 5DHXB 1ZOXA 1B0RB 3IU3A 4LAJH 3VFPA 2DM7A 2DQHH 1SJEA 4PTUA 3L5HA 3GMLB 5HGDA 2ZPKL 5CBEA 3QZWB 2BDNL 4JHWH 1RZJL 1LEKA 1WAAF 4ERSH 2H32H 1KUMA 3CZFA 1L7IL 5D70H 5IVXA 3IDJB 3MFFA 1TPXC 4PJAE 4NPYA 2RHEA 3X13B 3R1GL 3BPLB 4KV5F 4MA1B 4OTXH 4MGXA 1AKJA 5DMIH 2GJ6B 2WP3T 5CS7A 2F54B 1D6EB 1EHNA 3DYPA 4X5WB 1NC2B 1YEIH 4PGEA 2HLAB 2DI7A 4OIIH 1P5VA 2XFXA 3BO8A 4RQQB 2HKHH 4XP9L 5JW4M 1P9MA 3OWEA 4XH2A 3MV9A 4OD3H 1QSEA 2R29H 1A1OB 5KAQG 4KTEL 4D9QE 3DMMB 4K23H 1NCWH 5IIEB 5DFVD 3S4SB 5CSBA 4GMTL 1QHPA 4PJDF 3WLBA 5M94B 1N0LA 1G7PA 1MIMH 4DEPB 1YEEH 3B2UC 4OF3A 4TTDD 3MRBB 5HI3D 5F6IB 4P3WA 4KROC 1IQWH 4X6CA 3KLSA 3LV3A 1ETZA 1U95B 1J86A 2W65B 3X11A 2NY6D 3K8LA 1F6LL 5I1DB 3ARUA 1AHWC 2GSIA 4DFIA 5CILH 3BRGC 4LP4A 1IGYB 5GS2D 1FG9C 5GGQH 4LNRB 4JKPL 4OBSA 4I0PB 4I4WB 4UNTA 1MFDL 3ET9F 3QFDB 3ULVF 2YC1B 4U6XB 5EC1A 4FQIH 3P9LA 4MA7L 3VXME 3MUZ1 4M3JA 5GSVA 2C7UA 2VDLH 3IDYC 5L2JB 1U8IA 2VE6A 2DS4A 3VH8B 4WGWB 5LXGL 3P73B 1XR8B 2D0FA 3F7VA 2VKWA 3SGKA 3HE6A 5IVXF 2IH1B 3MRGB 3GBNL 2WK2A 1LE9B 1KLUB 2A6IA 1MCBA 4UUJA 1A7OL 3OX8B 1H0DA 4OUOA 4OFVA 4L5FH 5SWZB 2B39A 3TH3T 1RY7B 3AAZB 4X7EC 5C8JB 2VDQH 2EH8H 4JFFD 1TENA 3LCYA 4U1LB 5CZXD 4HEPG 1JGVL 1X5YA 1F5WA 5BRZA 4G3YH 2OZ4A 2ADFL 2FECL 3ARBC 5IJKA 1G9MC 1NKRA 1J10A 1LWRA 3BP6B 5B21A 4XPBL 4PR5A 1MJJB 5E8EA 4I3SL 3BOVA 3G5XB 1MCRA 4RGND 4O4YL 1K5NB 3TEUA 5DD6B 5E8OB 2BNUA 3SPVB 5EZJA 1YQVH 3GI9H 4IDJL 2HG5B 4LF3A 4UV7H 5F7KC 4LVOB 4X6CF 4I2XB 4LCUB 4RISL 1N6QL 3CDGB 3QWQB 2Z91B 4M7LH 4HWZB 4HBCL 5LG1A 2YPKB 5D7LE 4NHUB 1RZ8B 2E8YA 5CGYD 3C60D 2R1XA 3BH8B 3WBDA 2AEQH 4OGYL 2PXYB 1XT5A 4NQDA 1NCCL 5LQBH 2VB5A 1IL1B 5E8NB 4IRJC 5JXED 2MQ3A 4OJFL 3UTQB 3MC0A 1YNKL 1QLFA 1JGUL 1XGYH 3BW9A 2BFVL 4G6KL 1UJ3B 3H9HB 4HW6A 5E00B 5F7LB 4C4KO 5JHLL 4Z7QE 4HX1A 1K3IA 4X4YB 1VFMA 1NAMB 3OMZA 4M6NH 5ETUB 4YC2C 4AIZA 3QIUB 5HSFA 3K81A 4H0IA 3TBYA 3T1FB 1CFTA 4FFZH 3UJJH 1LO5B 3HI6H 5HYIA 4JRYA 3P3YA 2I5YH 3WNKA 1FNLA 2PF6A 3O9WB 4J8RA 2ZSWA 1MUJA 2IJ0C 4NOFA 4FQJL 3W9EA 3O2WH 2HT3D 5CJQH 4I0KA 2D7NA 3LPGA 3UO1H 1AGFB 4DKEH 2AV1A 3H9ZA 1IJ9A 4WDIA 4N1HB 1F6AB 3HRZA 4Z5RB 3P4OA 4MS8C 1PKOA 3H9SB 4F7PB 5JMOC 2R0ZL 1IGML 2D7OA 4Y2DC 1JFQH 1XFPA 3FHQA 3KPNB 5FO9B 5F70A 4ZFOL 5CUSH 4AL8H 1ZLSH 3OKKA 1TZIA 4NQEA 4JM2B 4P48A 4WW2C 4LLDB 5I66A 1INQA 3CFJA 3X14B 4L8BA 2WLZA 4YHNB 4AQ1B 1PYWB 2I9TA 1A0QL 3FL7A 2DKUA 4NUJA 1IILE 1YMMA 3TGXA 1S7RB 2VISB 3ARRA 2PTVA 1JPFA 2DMCA 4U1GB 5MP6L 3W0WD 4ZFZA 4JR9H 4FFYH 2AJZB 3C9NA 2IPUG 3VFUA 4CRPA 3P30L 1EBAA 1S9WB 1XF1A 3G6DH 4FQHA 1JZ4A 4L1DA 4PJ8B 4OZFA 2Y07H 1M6OB 1GC1H 1D3CA 1VGEL 5KG9A 4ACPA 5HHOD 5CD5C 4JQIL 1U8KA 3PF2A 2B1AH 3O4OB 2YUVA 4U05A 4P46D 3TO4C 2ZUUA 4XVUD 3REVA 3B9KC 5CMAA 5DJXB 3RWDB 3S3PA 3ARWA 5I1LB 3BRFA 3QXVA 4NQSB 1VGKB 1DDHB 3HE7C 2DQJL 1KCSL 2XN9B 5EFIA 4BK5A 3RI5F 3SE4C 1T03L 4ALAH 1RZ7H 3LRSB 4P9MH 5E9DB 2COQA 1BD2B 2P43B 1YNLL 1HYSD 2P8MA 4CAGA 4KKBD 3CX2A 4DZ8B 4ODBD 2H8PA 1B90A 4MNQB 4Z9KB 4DGIH 4QRQB 5C0CB 3SCMD 1FRGL 3U0TB 1YY8B 2BRRH 3EZJB 4RGOL 4HGWB 2Y06L 2FL5B 5GGVH 1MCSA 3OKOB 1X5IA 5DLMH 4HMDA 4HIEB 3ARFA 4FXKA 3TBSB 5F89A 4UQ2A 5AYUH 2V9TA 3DGGA 1M7DA 5FYKL 3KPQB 4PJDB 1IKFL 2ZKHL 3BE1H 4NQCA 1I1YB 1UXWA 1F3DH 4K3EL 3ZKSD 1NCTA 3QDMD 5LGHH 2EYRA 5IMMA 4XTRC 1T4KA 1J12A 4QXTB 4FN0A 2KH2B 4YXHL 1MFEH 3U4EB 3V6OA 4NO2A 3D18A 3SKMB 4MS8D 1IKNA 4M93B 4LEOB 3MRDB 4ONGL 4K9EH 4M5ZL 5AWNH 1MEXL 4L9LC 4MXQD 4OKDA 3FB8A 3S9DB 3RTQB 1JPGB 2VZSA 4LLYA 1WZ1H 2NNAB 1X9QA 5ESAB 4WI7A 1LE5B 4KXZH 3G6AA 4K3GA 1BQHB 4QRPB 5E56A 2AI0L 3BXNB 5SX4I 4KHXL 1Z0NA 3IU3B 3VFPB 3VU2A 4FQQB 5K59E 2C4FT 1SJEB 4PTUB 1QA9A 4HDIA 3L7EA 1GHFH 5HGDB 4YBLC 5CBEB 3NIDF 4M62H 1LEKB 3CZFB 3PWVA 2EO9A 4GT7A 4ELME 3CLFL 3BD4A 5IVXB 1OP3K 3IF1B 3MFFB 4I48A 1CBVH 3T4YB 5JDJA 1UM5H 3OTTA 4I18A 1E4XL 2A6DA 3S37H 1MSPA 1AKJB 4N1CA 4PJBE 3EOAA 3QIBD 3Q6GH 1Q0XL 1NSNL 4MJ4A 4GG6A 4GW5B 1LNUB 4PGEB 3RA7L 3NGBC 4XP6H 3F8UB 1G9ML 2BX5A 2XFXB 3BO8B 3ZKXC 4X8XA 4ODTH 3CLEH 3QCTH 2JJVA 4XH2B 3MV9B 3ARVA 3RVXC 4XMPH 5F9OH 1A3LL 3L1OH 1MJ7H 3GSNH 2NY3D 4J1UA 1N64L 2HKFL 4KKCC 3WLBB 1BP3B 3QWOA 3UTTD 1G7PB 2NW2A 3HE7D 4BZYA 3TFKC 4UOW1 1B4RA 1D5ZA 4PRHE 5JHDE 4JFHD 1C1EL 4X6CB 3LV3B 3LY6A 4NM4H 3OBAA 4LK4A 3X11B 2HH0H 3MZTA 4HPOH 1I7ZA 3WO3B 3MR9A 3DGCR 2Q7YB 5J1AA 4Q9CA 1XGPB 5AAWA 3U6RA 3KJ4C 1JYXA 3NIFE 3WFBH 3ZE1F 4WVRA 1I9RH 1LO0H 4GUPA 1CL7L 4N0FB 1PBYA 1RUMH 5EC1B 5GSVB 2C7UB 2D03H 1U8IB 2EDEA 2VE6B 4K3JH 2YA1A 1EERB 1PVHA 1A6TA 5KSUA 2VLRD 4ZFOA 4LOUC 2PO6C 3QEGH 3F7VB 1CD0A 3HE6B 3W5NA 2HRPH 1ZA3A 4CVXA 5A16B 4EI5C 2A6IB 1KB5H 4UUJB 1IZKA 4WU7A 3SDAC 1H0DB 3ZYJA 4Q9QL 1DQDL 4NFCA 4MD4A 3VMPA 1HHHA 2K9UA 4IIQB 5E0QA 5EZIH 4GG6F 2VDRH 5B38B 1W72H 4MLSA 5K9KA 1QBMH 2AJVL 2XQYK 2A38A 5BRZB 4JFFA 1RZIA 4Z7NF 4HWNA 1FL5B 4WFEE 3BKMH 35C8L 3BKJL 4PR5B 5E8EB 4HD9A 4U1HA 5TF1L 5T1KA 1Z9LA 5FUZH 3TZVC 3BQUB 4YEFA 1VESA 5K33A 4ZMAT 1HKLH 4PB0H 5KOMC 1WBYA 2O93L 2P5WA 5IGXL 5I8OL 5EZJB 3FOMA 5F9JA 3HTLX 4NZRH 5TQ2L 4LF3B 3TV3L 2VLKD 4G8FA 1DBMH 3SGDH 2CSPA 1QQDA 1TJGH 4D9QD 1VPOH 4KC3B 1TITA 1R6VA 1T83C 3OKEA 3V5DA 1A6AA 5C08D 2SEBA 1IM9D 2R1XB 1YEJH 3B4NA 3IXAA 5HDBE 4NQDB 4DTGL 5D7SL 2XYCA 5D2LA 3C60A 4PYHA 3UP1A 1IGJA 1QLFB 5E4EB 1I9IL 1N0XH 4Z95L 3HNVH 3BW9B 5JW5A 5F44A 2IG2H 5JXEA 1G0YR 5EU7E 1MAML 2N7AA 1GGBL 2BK8A 5GGUA 3T0WA 3V4UL 3L5JA 1CIDA 3MRLA 3MV8D 2JLLA 1HCVA 2CLZA 4AIZB 4P0DA 3K2UH 3TBYB 4D94A 1BFTA 3I3DA 3VXMD 4CJ1A 1CFTB 1QRNE 3SDCD 3QBTB 4UQ3A 5JLZA 1MRDL 1CR9H 4JRYB 5LCVH 2P7TA 5IVZB 4J8RB 4KQ3L 2FEEI 2ZSWB 1G7IA 1HZHL 1MUJB 5TH2A 4LPYA 3W9EB 4AM0A 1U8LB 4GSDH 2AV1B 3BMWA 4QHKI 3QDGB 4WDIB 4JQXC 1AGDB 3HRZB 3AGVA 1K2DA 3P4OB 3PJSA 2OP4H 4PLJD 2YRPA 3HMWH 4GW1A 1ZGLA 3D3VE 3AB0B 5I1AA 5E2UL 2ZCHL 3V4VH 1EV2E 4QWWD 3QZWG 2ATKA 3OKKB 4H88L 1TZIB 4NQEB 4EI5D 2FZ3A 3OG4B 2QADD 1WEJH 3EFFA 3CZJA 4YXKL 5I66B 1BAFH 5E2VH 4IM8A 1INQB 3CFJB 2JJWA 2V2TA 3SN6N 1IAIM 4XP1L 4BH8A 4LPWA 2MOVA 5D2LF 1KJ2H 1IGIH 2I9TB 4BFBD 4NUJB 2BHZA 1YMMB 4U4BA 1JPFB 2EDJA 4ZFZB 1EPFA 5D7IE 2DTMH 4OQ1A 3C9NB 3F6IA 5D2NC 4G7VL 5LWYL 1P4IH 1NGPH 1OARH 3ARBA 3W0WA 3S4SG 3BP5B 4OFIA 2O5YL 3T2PA 4FQHB 3TZVD 2FBOJ 2GK0A 4XWGL 4OZFB 2NY4D 2ADJA 3OB0H 4PP1D 3IRZA 3MRJB 5HI4C 1GAFH 4P57A 4YFEA 7FABL 1U8KB 3FQWA 4LHQB 1NANI 5SV3A 2MPAH 1C16A 1TETL 5DURB 5HHOA 3REVB 5C3TA 1CS6A 2F5BH 4NN7C 5FDWB 4P46A 3ALXA 1J0ZA 1NEUA 4KZDL 1I8KA 3QDJE 3BZDA 4K71C 5EFIB 2BSSA 2WLYA 5J12B 5HHVL 3GIZH 3GI8L 2Q6WA 1T7WA 1XEDA 1G7LA 3MLVH 2BZDA 4LMQI 1KBGH 3QH3A 1WITA 3NA9L 5I1JH 2P8MB 1KTRL 5I6XB 1K6QH 1LEIA 2XPGA 3GKZA 2BRQA 2H8PB 3HB3C 4M02A 4NM8L 5GHWL 3VH8G 4K7FA 2YMXL 5EN2A 4NO0D 1R24A 4CBPA 3C08H 3VI3E 4Z7VE 4KGLA 4OKVA 5EZOL 4TUKL 1JHTA 3ARTA 4PG2A 3H7BA 3ARFB 4LLWA 2OJZL 5F89B 5GS3A 4UQ2B 3DGGB 5J3HD 4PJFA 4W70A 2I25N 4OCRL 4NQCB 2FD6L 5GRVK 1UXWB 3L9RA 4YNYA 2EYRB 5IBLD 1T4KB 2B4CH 1AY1H 2X4TA 4RWHA 2FEEL 3MV01 3QDMA 3ABZA 2BNRD 4NO2B 1R3JA 3D18B 1JK8A 4XAKE 4LEXH 1EGJH 4X7DC 1VA9A 1S8DA 2DYPD 3QQ4A 5EUOE 5CJOL 1J0IA 4WY7L 4HWBL 3FB8B 1R0AH 4S1QL 4KZEL 4LLYB 1MAJA 4YFDB 3G6AB 1FORL 2EDBA 5DEGB 5FYJL 1KCKA 3GM0A 2CRZA 3MCKA 5CLTA 4YBHA 1CGTA 1X5XA 2A6JA 2QQLH 2X42A 4H5SA 3L7EB 4HDIB 4WW2A 2AS5M 3REWA 5MEOA 4IDLA 1VACA 3MLYL 2R8SH 2Q3ZA 1HHIA 3PWVB 3BP4A 5F7HA 4I48B 4K8RD 4I18B 2A6DB 3OAUL 1B4JH 5ISZB 4WJ5A 4LARL 1NFKA 4KK8C 5I30H 1ZS8A 3EOAB 4FQXC 3GNML 3U4BL 6FABH 4NP4L 5DF0A 4GG6B 3P0YL 2XQBH 3HR5A 3SOBL 5F7NC 2DI8A 3PGCA 1Q1JH 1JHLH 1H3TA 4AT6B 5HI4D 3GJEA 2XXMB 3JWDH 4WWKB 4JKMA 1KN2L 3RNKA 1HSAA 4GLRH 3ZYIA 5IM7A 3O6LL 2KPNA 4PJFF 2WNGA 3OB0K 4FQLH 2A0LD 5EA0L 3QWOB 1JCKA 5C92A 4OLVL 2NW2B 4LRNL 4YDKH 1C5BH 1INDH 2HT4C 5JIKA 1D5ZB 3PNWA 3UTTA 2GKIA 4AEIL 4C83A 3TWCL 3HE7A 2DQUL 2PCPA 2QQNH 2ZOKA 1I7ZB 2VXVL 4HFUL 1NFIA 3MR9B 3FO0L 3SE4A 4M61A 5J1AB 5DVMA 2XKSA 4GRLB 4X9GA 3U6RB 2NLJB 5CINL 2NY6B 3TN0D 5B4MD 1EEUA 1HOCA 1LDSA 4GUPB 4JVWA 3ESVF 1TNMA 3E3QE 4U3XA 1GC1C 2JCCA 1A9EB 3MLWH 5I16A 2ZZUT 4WW2F 1A6TB 4ZFOB 1W0VA 1RVFL 5DJCB 2MQ0A 4MDJA 5TDNA 2P42B 3TNNA 1T7YA 1ZA3B 4CVXB 4W4OA 3TO2A 4DJMA 2DQHL 2VLRA 4PJ7A 4S1DD 4WU7B 2XTJE 3RIAF 1JJUA 4NWTH 5AUMA 1GCFA 3RIFF 3MTRA 4JHWL 4MD4B 1DQLH 4ERSL 1HHHB 4OT1H 15C8H 1MQKL 4EN3D 4QNPF 2AJYH 3WIFA 3TJEH 3T4AA 5K9KB 2DIBA 4OTXL 5DMIL 1ZTXH 4NQTA 1KLGA 1KEGH 5DZOA 2F53D 2W9EH 5DXWA 4XC3H 1CICC 4OIIL 1CQKA 2MCPH 1D9KD 1JNJA 4H25A 4L8CA 4U1HB 4KI5C 5T1KB 2HKHL 1MWAA 4L9LA 4OD3L 2AQ3A 2R29L 4XBGA 1JGDB 1WBYB 2P5WB 3DTXA 3KJ6H 4K23L 5GGVY 3QUZD 1NCWL 5F9JB 5IHLB 3GSWA 1OTSC 1YN7A 5IBUG 4RGNB 4G8FB 1A2YA 4AZ8A 5KSVA 4O58H 4WUKL 2UWEA 1QQDB 1LO2H 2DDQL 5A1AA 1F3JA 1MIML 1F3DJ 2VLKA 3V5DB 1A6AB 3OAZH 2SEBB 1IQWL 3IXAB 1TPXB 3EGSA 2J8UB 2VZOA 4C56D 1MOEA 5C08A 5AYQA 5D2LB 1IM9A 4P2OD 3C60B 4PRHD 5EU6A 5JHDD 5CILL 5C07D 1IGJB 1KSRA 1CCZA 3MNWA 4A2MA 1NAKL 2BMKA 5JW5B 2JCCF 1T6WA 4MX7A 4K9EC 4BSVA 2ICWJ 5GGUB 1UZ6E 3GRWL 3MRLB 4FQIL 2C3GA 3MCLH 1UWGH 2VDLL 2CLZB 4PJ7F 2BSRA 4R7NB 4DVBA 5GS0D 4OIBA 5DQJA 3MV8A 3FQUB 4Y4KD 5ICXA 4B0MM 3UTSE 5CJXC 5JLZB 3M45A 1UENA 2P7TB 4ORGA 3V6BR 2E7MA 3SDCA 4L5FL 1U3HD 1G7IB 4Y5YC 5TH2B 4CKVX 2YD1A 1CXLA 2VDQL 4AM0B 4HUNB 4KRLB 4XCYA 3FJTA 1AHWB 3R06A 4JE4B 4G3YL 4PUBH 4R6UA 1K2DB 3PJSB 3U36A 4WHCA 4GW1B 5DC0A 1ZGLB 3F7PC 1IBGL 4LPUA 5FA3A 3ZE2E 5I1AB 4HWBA 1KIUA 1JGEA 5AG8A 1XR9A 2UWEF 3IDYB 4WFED 2ATKB 3PWPE 2FZ3B 3EFFB 1YQVL 2AEIT 3GI9L 4UV7L 4EI5A 2OXGA 4GKOA 4M7LL 2ZCKH 4BH8B 2FH6A 4OF6A 5F9WB 3QQNA 2V9QA 3RY5A 2AEQL 4G9DA 5JPNA 3CGTA 1YYLH 1B88A 3MO1A 1RQ5A 1JN6A 1XGYL 3ARBB 5INCB 1TVBB 2GK0B 1B6UA 1T80A 2ADJB 4GOSA 5DR5H 2NY7H 5CP3H 4P57B 3TZVA 5EU4A 1NFDA 1S78C 3FQWB 4K3DH 1C16B 1IC5L 4ODXB 1A14H 2BY2A 5HHOB 2BVEA 1HXYA 3BAEL 4MSWA 4FFZL 4Z77A 3UJJL 4Z8FH 3HI6L 5GRXG 2I5YL 1T83A 2J6EH 4YHLL 1QRND 2BSSB 3I9GH 2ARJA 2AXGA 3OAZK 2Q6WB 5T3XH 1BGXH 5T3ZH 3D25A 4OZHA 2IBZX 3UO1L 3QH3B 1AXSA 4BFIA 4DKEL 2CIIA 1LEIB 2XPGB 3O41A 4FQPA 3EOTH 4K7FB 2ICWI 5EN2B 1R24B 1BJ1H 1PEWA 2IPUK 3HAEA 1OW0A 1JFQL 3FT3A 1I3RA 1MCQA 1T2QH 4JHBA 1F3RB 4OKVB 4NO0A 4WFHE 4U2ZA 1JHTB 5CUSL 4AL8L 2ATPA 1ZLSL 3H7BB 3D3VD 4LLWB 5B38G 5GJSH 3GJFH 1UJTA 3JV4A 2C4FU 1KXQE 4PJFB 3FOLA 4IMKA 1KEMH 1RUKH 5H8DA 3AMLA 1Q8MA 2X4RA 3L9RB 4YNYB 4NN6C 4B53A 4MB4A 2X4TB 3IDUA 4Y89A 4YHYB 1VFAA 3QDMB 2BP3A 1R3JB 5BVPH 1JK8B 3MRRA 4JR9L 2EKJA 4FFYL 4ODWA 1KFAH 5JIPA 4HF5H 3LKOA 1S8DB 4JQXA 2GUOA 1NFDF 4GJTB 5HHMD 1RJYA 2WIMA 2BNRA 3QQ4B 5ILTH 3G6DL 3MRHB 3WV0A 3QEHA 3BGFC 1A9BA 2ZUVA 2Y07L 3QG6A 1GC1L 3RX7A 2DYPA 1ORSA 3LRGA 2OTWA 4S0SD 4EOWH 5DGQA 3MCKB 1I9JH 2DAVA 3HHRB 2CXKA 2A6JB 3BGMA 4I5BA 5TE6H 3HUJB 1UEYA 1MF2L 2XY1A 4H5SB 4WW2B 2NMSA 3REWB 5EBWA 5MEOB 4HUVA 1VACB 4X9FA 1HHIB 3BP4B 2I07A 4OZHF 4N90D 4QHMA 2VZVA 4WJ5B 1TZHA 3B5GA 3LKNA 1ZS8B 3QDJD 3DIFA 1RZ7L 1QG3A 4MJ6A 5D1XC 3HR5B 4URTB 2EEBA 2GSGA 5D2NA 3GEWB 4DZBA 5I18H 1CXKA 4DGIL 3GJEB 2IWGA 3GRWA 2BRRL 2BVQA 3K4ZA 4PBWD 3TC9A 1HSAB 2UV3A 3ZSTA 5IM7B 4PJGE 2J4WL 5GGVL 2DQEL 1KCUH 3NCYS 1RU9H 1UT9A 5DZLA 2M8XA 3PNWB 2IPTH 2DQDH 5I2IA 5AYUL 2OL3H 1EAJA 4C83B 1YA5A 3HE7B 3BE1L 5HYJD 1PKQA 3TYGH 2PCPB 2ZOKB 5LGHL 1H8SA 1MCDA 4M61B 4S1SH 2AK4A 1YQ2A 3MUY1 4N1EA 1MFEL 3VDAA 1HOCB 3TCXA 3MLUH 2DICA 4RAHA 2YD4A 5HPMA 2FATH 2XWBB 4K9EL 2CH8A 5AWNL 1NUDA 4X6BA 2JCCB 2VR9A 5I16B 4DUVA 3CC5A 3O81A 2JIXD 4PD4J 1WZ1L 1W0VB 1OPGH 4LLVA 4R4FH 5TDNB 4MDJB 5GRJH 2NY5H 3TNNB 3TO2B 2VLRB 1RHHA 4PJ7B 3ARZA 3EYOA 1NDMA 5JA9A 5AUMB 1GHFL 1F4HA 5KANG 4KKAD 4WCYH 3PL6D 3DX8B 3S5LA 2YWZA 1CBVL 1UM5L 5LGKA 2YPLE 3T4AB 4ZNCD 2LTQC 4RIRA 2E9BA 2L4OA 3S37L 3OAYH 2X9WA 4QRRD 3BN3B 1VADA 3NABH 4OZFG 4EN3A 1KLGB 3Q6GL 1MCNA 1KJ3H 3PWUA 4Y88A 4ELMA 4XP6L 5I1GH 1NUNB 5DHVH 4H25B 1QSFA 2F53A 3PHSA 4ODTL 4BM7A 3CLEL 1HHKA 3CD4A 4L9LB 3FO2A 2APXA 2ADGA 4XBGB 5F9OL 1C8PA 3CXHK 4YZFF 3L1OL 1R3LA 1MJ7L 4K7PH 5F21B 3GSWB 3GSNL 1YN7B 1JE6A 2PYED 3EYUH 3QQ3A 2QL1A 2UWEB 4LBEA 1F3JB 5HBBA 3QUZA 4HT1H 1CGUA 1D5XA 2VLKB 4YBLB 1KJMA 4H8WH 2PYFB 4NM4L 3EGSB 3IDGA 4OI8A 5F7DB 5C08B 3RWEA 1SJVA 1IM9B 2B4CC 5EU6B 4HPOL 3BT2H 1SY6H 4HKZA 1BF2A 4FQXA 3AXLA 1ZGLM 3MNWB 4C56A 4D9LL 2BMKB 4P2OA 5JHDA 3HCVA 4MX7B 3NGBB 2BY1A 1LO0L 5C07A 4GH7B 4BSVB 4P23D 3STLB 3MGTA 3F7YA 3ZKXB 1X5ZA 1G7HA 1FFQA 2D03L 4P99A 5TE4H 5ECJE 1UWEH 3WS3A 1FAKT 1H3GA 2BSRB 4DVBB 1FZOA 5DQJB 3I50H 3MV8B 5ICXB 3FRUB 5HGAA 5KTEH 3QEGL 1RI8A 1QLRA 2HRPL 2B7DT 1KB5L 4Y4KA 4ORGB 3VWKD 2DMBA 5K59F 3SDCB 2VSCA 4F33A 3FHAA 1ES0A 1FGVH 2XTJD 2VDRL 4ELMF 3CVIH 1W72L 4XCYB 1U3HA 3R06B 2DIJA 1QBML 4BZ1H 5ENWA 4JRXE 1NL0H 2R0WH 5HVGB 4HKJA 3SKNA 3KXFA 3KJ4B 3MYZA 5I1HH 5INDA 3U36B 3HG1A 4EIGB 3O2DH 1GSMA 1QFUH 5DJAA 3BKML 3HPLA 5FA3B 3JWDC 4U7MA 1FH5H 5FUZL 1HIMH 1XR9B 4ELKA 5IOPB 1YEGH 3CFBA 1HKLL 3PV7A 3HRPA 4PB0L 1P2CA 1T1ZA 1G9NH 4RDQG 3L95B 4KUZH 4NZRL 1PG7H 2WV3A 4EI5B 3X12A 1FC1A 4R0LC 5FGBC 2Z8VC 2GTZA 3MMEA 4HKBA 4LDLB 1YEJL 5D1QD 4LNVA 4G9DB 2BJMH 5JPNB 2Q3AA 3LRHA 3QAZB 4Y7MA 4U1IA 3MV7B 2XZQH 1M05A 1JN6B 2NXZC 4JFXA 4YBQD 4FXLA 5EBLA 3OAYK 2IG2L 1NCBH 1KLFA 1G1CA 4HXAH 2UZIH 2CLRA 2E27H 4F37F 4U1NA 3TZVB 5EU4B 1NFDB 5GSRA 3HI5H 4NDMA 3RDTD 3K2UL 1BOYA 1HXYB 1QP1A 2UVFA 1DBJH 5D1ZC 5DGRA 4MSWB 5JW4N 4Z77B 5GRVL 1CR9L 4KGJA 4L8DA 5LCVL 1LP9E 1VB9A 2NZIA 5TDOA 3UTSD 4FS0A 2ARJB 3UZEA 1JPSL 2AXGB 4HJ0C 3VGEA 3HLAA 1VHPA 1Y0LA 4OZHB 5I8CB 1QRNA 4R2GC 1B2WL 5ERWA 1INEH 4GSDL 4BFIB 4HV8A 1OOAA 2CIIB 3O41B 2Q8BH 1NAMH 3FT4A 2EIZA 1F42A 1EIBA 4HFWA 3EO0A 3IDIA 3LHPH 1CF8L 3HAEB 3HMWL 4DK3A 5FHAH 3FT3B 1I3RB 4P4KD 1T21A 4WIQA 3WNNA 2QSCH 4NO0B 4NKQB 4Y5VC 2ICWA 5B39A 2ATPB 3KPSE 2V17H 4P2YA 1WEJL 3KYKH 3VD4A 2AERT 3JV4B 5E2VL 5KZCD 5CJXA 3DX7A 3PWPD 3FOLB 1U0QA 1XGQA 3NZ8A 5ADOL 4Q97A 4EJ1C 5A3IC 4DKDC 2X4RB 1KJ2L 4M48H 5TQ0H 1IGIL 5FUCC 5TGBA 1CTOA 5DRXA 1FC2D 1VFAB 2YBRA 3ZYOA 1AI1H 3MRRB 2WANA 5D7KE 2DTML 4N5UA 4ODWB 4B7LA 4KI5F 3LKOB 5GISH 1MY5A 2DJ4A 1NGPL 1RJYB 1OARL 2BNRB 4CN1A 3AY4C 4N9GA 1OAZH 4V1DE 5GRUH 3QEHB 4GLRI 4TQEH 1A9BB 3QG6B 3W11C 2VERN 2DYPB 1ORSB 5D7IA 2VLJD 1FFOA 1TQBC 3VGGA 4I5BB 4LVNC 3RFZC 4AENA 3WE6A 4E41E 2FIKA 2PW1A 5EBWB 5DJ8A 4HUVB 5FGSA 3L5WA 5KSBE 3CJJA 3GM8A 1T89A 1URLA 2I07B 4QHMB 5T5NF 5IBTH 2CLVA 3FO9B 4QY8B 4AK1A 1TZHB 4QOKE 1AXTH 3GIZL 3DIFB 1MFAH 2HLFC 2Y25A 4MJ6B 4RX4D 5E7FA 3OXSA 3MLVL 5HI5C 2DJUA 2GSGB 5I17A 4W4NA 1RPQA 3PUCA 1K6QL 5D2NB 3QDJA 4BQCA 2VITA 3QCVL 4DZBB 3N50A 5GZOC 4EBQL 4DFHA 4YWGH 3EIFA 3GMRA 2BVQB 3O6FC 1RSFA 1CLCA 2DIAA 1IAMA 1J9CT 1J0YA 2AJSH 4GAJH 4X4XA 2R2BA 2XWTA 1IEHA 3IKKA 4N0CC 1Q9WA 4NN7B 5E08H 5I2IB 4PGDA 4WFHD 2CDGA 3BEWA 3IFLH 4EDWH 4L1HA 1PKQB 25C8H 4WW1A 1CLYL 1GGTA 3THML 5MEPA 2Z31C 5C09E 2B4CL 1AY1L 2AK4B 5HYJA 4L9DA 4M7ZC 1ZSDA 5DUPL 3MBXH 4LEXL 1EGJL 5HPMB 4LSSH 4MQSB 4KY1H 5D7IF 2HFGH 3OHXA 4EI6A 4GXVH 2H2SC 4X6BB 1L0XA 1R0AL 3PHQB 3CC5B 3EJYC 3KLHC 5C2BH 1P7QD 1KIRB 3C6LC 4LLVB 1DLHA 4TULH 4MJIE 5DUBA 1JHKH 2JIXA 3QRFM 3BKCL 1RHHB 3EYOB 3T09A 2QQLL 1NDMB 4K94H 1EK3A 1I7RA 4PRPA 2R8SL 3UEZA 3LKPA 3S5LB 3MGOA 4CUCA 4OSUH 5EORL 2QSVA 2VDNL 5HYQA 5IUSA 1LO4H 4RIRB 2RB8A 2XV6B 5F97E 5I1IH 3QHTC 1CE1H 3G9VA 3U9PH 4EN3B 5I30L 6FABL 1F11A 4U7SA 2XQBL 3PWUB 1BJ1J 4ELMB 3ULVH 4DW2H 4QRRA 5JQHC 1Q1JL 1JHLL 1QSFB 3W11D 2F53B 1HHKB 3JWDL 4MD5A 3RVVC 1CDCA 4F7CA 5IB3A 2ADGB 2Y5TA 1R3LB 2NY0C 4R90H 5ESVA 1DQQA 4ZO8A 1XMWA 4LHUD 3L3IA 1S9XA 3QQ3B 3RP1A 3U1SL 2JJSC 4F15B 3W81A 4LBEB 1MJUH 2IANE 1FYTE 1OWWA 2PYEA 4YDKL 1C5BL 1D5XB 1PY4A 1AE6H 5K9JH 4EZMA 1WZMA 1F8TH 2VRAA 3IDGB 3HC3L 3ZKND 3RWEB 2QQNL 2FCBA 3T77A 2VQ1A 5D5MA 4HKZB 3PDOA 4YAQA 1GYAA 1KCVL 4FQXB 3AXLB 4UU9A 1YNTA 4C56B 5JHDB 1UQSA 1RFDH 5C07B 4U6HA 3FB7A 3MGTB 1VEMA 3F7YB 3LQZA 3NACH 1G7HB 4OFDA 1TTUA 2P5EE 4HUMB 4EDXA 2G2RA 2JELH 4GMSH 4P23A 4NT6A 3MLWL 1FZOB 3MCG1 3V6ZB 2JB6A 3DO7A 3IJYB 5HGAB 3MXWH 5F7MC 1QLRB 3HZYA 4OCSH 4Y4KB 4UTAH 3QI9C 4NWTL 1J8KA 1FVCA 1FP5A 3BD3A 4ONHA 4F33B 4YQXH 5FUOH 1ES0B 1DQLL 4IJ3B 4OT1L 2Z31D 4QT5B 4MNGE 3SQOH 3VWKA 2CUHA 1A1NA 1MRFL 2AJYL 3JZ7A 1Q0YH 4J4PC 3TJEL 1CYGA 5ENWB 3QNXA 3DURA 1HN1A 4OGAC 4ZYKA 4HKJB 3SKNB 3KXFB 1ZTXL 2BVPA 1KEGL 2YPLD 2W9EL 5INDB 1F4XH 3HG1B 5J11C 4ZSOB 2APBA 5DJAB 4XC3L 3HPLB 2OR9H 4MXWH 3KLHD 4HIXL 3C6LD 4ELKB 1WV7T 3GHEH 3F6LA 3CFBB 1YEDA 1T1ZB 2XXCB 3PHOA 5FECB 2EDWA 4O58L 4HIJA 4O5LH 4TNVF 3X12B 1LO2L 3P4MA 3VXPA 3LB6C 1BLNA 5D5MF 2GTZB 3MMEB 4HKBB 2OZ4H 2AV7A 3U46A 4YXLH 4Z76A 4U0QB 3RL2A 4MQXC 3D5OF 4G9FE 3TT3H 4U1IB 4PJCE 1MREH 4HZAA 2ZUWA 3LKSA 4MAUH 4JFXB 3VXRD 5EBLB 3SKOA 2H6PA 1C5DA 3MXVH 4L3EE 3BDXA 3QPXL 4NN5C 4OV6F 1FNHA 2CLRB 1NCNA 4J3OC 5FA4A 4U1NB 3CMOH 3NPSC 4YPJA 4RMQA 4O9HL 1KYOK 1QYGL 5GSRB 3MCLL 4W6WB 3RWFA 4NDMB 5I76A 4Q6IA 3MUHL 2YWYA 1CQYA 3ORJA 1ZAGA 2G5BA 5E24E 1NDGA 1AQDA 4Y19E 4LLUA 32C2A 4L8DB 4P5MA 5HD8C 1H5BC 5TDOB 4ZNEA 3EFDH 5KBNC 1SYVB 3V7AG 2Y4SA 5FYLD 2R56H 1Y0LB 4MLIA 3UBXI 1QRNB 3UTSA 4FMFA 2PR4H 5ERWB 4HV8B 3VFTA 3FT4B 5EPMA 1ODAA 1X5JA 5IFHH 4DQOL 2EIZB 3VFOA 4PUBL 5E8DH 4HFWB 2WBWB 3IDIB 1ZE3C 4JRXD 4G6AD 5DYOA 1T21B 1SJHB 4E5XA 3IVKA 2ICWB 5EB9A 5B39B 1I1CA 4YUEH 3LN5A 2OYPA 1KIPA 1BVKA 4JJ5B 2D31A 4X80H 2R2CA 3BPLC 1A7NL 3DX7B 4P59H 1XGQB 3NZ8B 4MA1C 2CRIA 3QHFL 2ESVE 3HFMH 5L2KE 4J4PD 3OZ9H 5TGBB 1DANU 5DRXB 3KS0H 2YBRB 1FQ9C 1A6UH 2NY2D 1YYLL 1CLZH 4DVRL 4UT7L 3TLRA 3ZKQD 1HCFX 4LVHC 2ORBH 4N9GB 5EIIB 4OLWH 3S88H 4JFOB 4IMLA 3ZHLA 2J1KA 5HHMB 1UC6A 2NY7L 4M7KH 1IC1A 2DRUA 1MCKA 5D7IB 1UZ6F 2BDNH 3AM8C 3VG0H 1A14L 1SVZA 4AENB 3WE6B 3N1PC 1ITBB 2FIKB 2PW1B 5DJ8B 2VLJA 1RD6A 4Z8FL 2VWEC 4OLZL 5CIPA 5IWLC 3MRIA 5L0QC 2OMBA 3MRQA 4R0LA 2W92A 2CLVB 2GAZA 2HJLA 5ACZA 1TJIH 1CU4H 2J6EL 1NCAL 4I0PC 3I9GL 3QXDA 3CH1A 3LKRA 3NAAH 5CHNA 3RRQA 5T3XL 1BGXL 3OXSB 1DSFH 4OZFH 4X9BA 5T3ZL 3PGDA 5D96B 5I17B 3SE8H 1DL7H 4WEBH 2YD7A 4KTEH 2VITB 3F7QA 2Z9TA 4RX4A 3N1MC 5AZ2H 3EOTL 4PJ5E 3GMRB 2QQQA 4GMTH 4Q9BA 2XI9A 1H15A 3D39E 1T0PB 3SE3C 3RVWD 1T2QL 4MWFA 2XY2A 1G9NC 4N9OB 3ZE2F 1DQMH 5IEKB 1JF1A 4X4XB 3DETD 2XWTB 5DRWA 3MNVA 2W60A 5D1ZA 1Q9WB 1PZ5A 3CDYA 4G6JH 5GJSL 4HWUA 2LAGB 4PGDB 2V2XA 5DO2C 2CDGB 2APFA 5E5MA 2GW5A 1KEML 2HJKB 4WW1B 4BQ9A 5HHPA 5FEBA 2MHAA 3NOIA 1Z2KA 1KG0A 3RVUC 1MFDH 1KCRH 3MRMA 5HYJB 5J56B 2FYYA 2LU7A 3AS3A 5FYLL 1ZSDB 5BVPL 3VFSB 1HHJA 4NIKB 1KFAL 4HF5L 2N56A 1AO7E 1J1XH 1JTTA 1YEHH 3OHXB 4EI6B 5ILTL 3PWNB 5D7KD 2H9GA 1NMAL 4I8DA 3GBNH 2FJFA 2K3TA 2CUIA 5EWIL 1OT2A 4LVEA 4V1DD 5F7WC 1DLHB 1I9JL 4MJ2A 2JIXB 1XF3A 1AXIB 1TLKA 5DJZA 1GZQA 5FF6A 5TE6L 2JJUA 1P7QA 3K0WA 1UZ8A 2PXYC 3CH8A 5DMYA 1CDJA 3ME0A 3O3AB 1LK3H 1L9MA 3SGEH 4PRPB 3ARGC 1L0YA 4OD2A 2RAMA 5LJYH 3LKPB 4YIQA 3MGOB 1UACL 4NRZA 4Q9RL 4M8QA 1O5DT 5HYQB 4D9RD 5LKNA 4NN6B 1UJ3C 3MOAH 3TP4A 4W6YB 4JO2H 3WL9A 3QUXC 1CE6A 3VWJC 4X4ZA 1G0DA 3T0EE 2ARJQ 4XCFH 1F11B 5GGRY 4LSVL 4QRRB 4O4YH 4DGVH 3LIZL 5I18L 4WTZA 3KGRA 1UGNA 3H8NA 1I1FA 4YJZL 1MHHA 1K4CA 5IB3B 4TUJA 1PGRB 2Y5TB 3BGFB 1N6QH 4K55A 5ESVB 1DQQB 4XNMA 3EYSL 4CU8A 4LFHG 1S9XB 1EVTC 4CMHC 3JTTB 1KCUL 1OD7A 4CVUA 1E27A 1TIUA 4G8GE 3QPQC 2PYEB 1RU9L 4LHUA 5I15H 2YR3A 3TVMC 2P24A 2IPTL 2DQDL 4OI7A 2OL3L 3VRLF 4FHBD 4H20H 1JGUH 3IDXH 3B2VH 2BFVH 3TYGL 4QTHA 2VQ1B 5D5MB 3PDOB 2GCYA 4YAQB 2HRLA 1T0MA 3BSZH 4LGRB 4UU9B 1YNTB 3DXAE 1U8OA 1E4KC 2W9LA 3DUUA 1UQSB 3S36X 4U6HB 3FB7B 3MLUL 4MA8L 2FATL 5DHYA 4JM2C 3LQZB 4NOBA 4EDXB 1G9EA 2G2RB 5EBMA 4PRIE 5JXAH 4P23B 4NT6B 4M1DL 4PJHB 2JB6B 3DO7B 5DMKA 1OPGL 4HG4J 4R4FL 3OR7A 4G6FB 4XMKL 5GRJL 3G6JE 3HZYB 5DO2D 2O5ZH 1TJHH 1JF5A 3RGVD 4N5EC 5C0GA 4OF7A 1FVCB 4O51A 4ONHB 4MJID 2NY1C 4WCYL 3RVUD 3S34H 1AFVH 5F1IA 1RULH 3OKLA 5GS2H 4HJGA 1A1NB 4JZOA 2V5TA 2Y7QB 4P2QE 4GRWE 3EDKA 1I7TA 2Z31A 3DURB 2R0ZH 3NVQA 3QNXB 4PJ8C 3JBG7 4ZYKB 4BELD 3NABL 2BVPB 1WWCA 3UMTA 1VSCA 5M95B 1KJ3L 1A6PA 2E9IA 4MHHG 2MTPA 3JV6A 3ZLQC 5I1GL 2KL6A 2J5LC 5DFTA 2ILLA 3KHQA 1YEDB 5L9DH 1F6FB 3U9UB 3PHOB 3CVHH 4K7PL 3C6LA 4IEFB 5GPRA 3EYUL 1G1YA 4HIJB 3PQYB 3P4MB 3VXPB 3MZGB 1BLNB 4HT1L 3ZDYE 5MP6H 2AV7B 1U36A 1UM4H 4Z76B 2IAND 4HBQA 4KJWC 3MQIA 3LPWA 3RL2B 2EXWC 2IBZY 1MELA 4TUOA 4HK3N 2E9JA 3BT2L 1SY6L 3LKSB 2A9MH 4ENED 1F4WH 5T1LD 5BJTB 1BJMA 4MVBD 2H6PB 1BM3H 1C5DB 3V9FA 5F72S 3FQNA 1NGZA 4RMRA 3VXRA 3BN9D 1P7KA 2PN5A 5FA4B 3WN5C 3L6FA 2A2QT 5IW1A 3RWFB 5TE4L 1L6XA 3TESA 1AC6A 1UWEL 5I76B 2ITCA 4Q6IB 5E70A 4DUWA 4TVPD 2G5BB 2KZ1B 2P5ED 3UC0H 2FLBT 5KTEL 4LLUB 32C2B 2AEPH 2WUCH 4K94C 3KHOA 2KDGA 5C0AE 4P5MB 1YNLH 4GG8A 4YLQT 1FGVL 2Q76A 3OL2A 1JWMA 3UTSB 3CVIL 4OV5A 2AP2A 5JORA 4BZ1L 1KYOJ 3RTQC 3VFTB 1V7MH 1NL0L 2R0WL 5EPMB 3VFOB 2D7TH 5I1HL 3ULVC 4KI1A 5D71H 1FVEA 4GW4A 3UBXA 3SDDC 3KPLA 3ULUC 1QFUL 3NCCB 2VLMD 5DYOB 4E5XB 1HIML 1YEGL 4JRXA 4Z0XA 5FYKH 3LN5B 1G9NL 4RMVA 1T1XA 1KIPB 1BVKB 3JXAA 4KUZL 4WI6A 4N5ED 1H8NA 2D31B 3WO4C 2NY1D 2O5XH 3FB5A 3BWUC 4YXHH 3QI9A 4YHIA 5DC4B 2DB8A 4FFVC 1P69B 4M7LT 2YEZB 4J6RH 4ONGH 2XWJA 4KU1A 4RGMB 1C5CL 4J4PA 2YS4A 1EEYA 2XKNA 4KJPC 1XF5B 2XZQL 3NCEB 1NLBL 1ACYH 2M26A 5CZVH 4HKXA 1NCBL 2FBJH 4KJYA 4HXAL 5C0EA 1R3HA 3X3FL 4NFBA 5B22A 2UZIL 4ZPTA 3KWWA 4AG4L 2E27L 4EEEA 4N8PA 2GFBA 4J3UA 4JRWA 3HI5L 3ZE0E 3LS4H 3AS2A 4XI5D 3MLSH 3GKWL 3IXTA 2VLJB 2AJXH 5CIPB 3MRIB 3MRPA 3MA9L 3MRQB 4R0LB 3DRQA 2GAZB 2HJLB 1RK1A 5ACZB 4JFDA 2HFTA 4FFWC 4NC1C 2EDNA 4Y19D 3RA7H 2EDRA 1G9MH 3CH1B 3LKRB 3Q0HA 5EU5A 1ADQA 2CJUH 3VXUE 3PGDB 4WUUA 3BVNA 1INEL 2WQRA 1V7NH 4KWUA 2W38A 2RFXA 2NXZB 2IF7A 1OAQH 4RCAA 2Z92A 2HKFH 1YY9D 2OSLA 3LHPL 1JWUA 2ZUYA 1QBAA 5E2TH 4OGXH 3KPRA 4MWFB 2QSCL 2UUDH 1JF1B 3GBMH 4Z7UA 3LOWA 2V17L 2ENSA 3UYOD 2R4SH 3KYKL 2W60B 5D1ZB 4YHZL 1PZ5B 1T2JA 4TVPL 2V2XB 2HJFA 3D69B 3O0RL 5E5MB 1V3LA 5I8EB 5HHPB 3U82B 1H5BA 2MHAB 5T1DL 1KG0B 1WIPA 4M48L 3B8SA 1QFPA 1L6ZA 2B20A 3UX9B 3MRMB 2YD3A 2FYYB 3NFNA 2AABH 2ESVD 4R2GB 2X4UA 4C55A 4LIQL 3J8F7 1HHJB 4X6DA 3FTGB 4N0UA 3QCUL 5BMFH 3QIWC 4NFDA 3ULUD 5GISL 2N4IA 1RUAH 3TH2T 1OAZL 1MH5A 2H9GB 4TQEL 2FJFB 3WD5H 3FAXA 2WBJD 3R8BB 2VZ1A 4ZPVA 4R4NC 4F9PC 2AAVA 1XF3B 2YK1H 5DJZB 5FF6B 3FN0L 1P7QB 1UZ8B 2FHCA 4V1DA 1FE8H 3SGJA 2F9BT 4OD2B 4Q0XL 2LAAA 2EDDA 4YIQB 3BPNC 3RWHA 1BFVH 2F5AL 3F5WA 4JFPA 3MOBH 4NRZB 5IBTL 3WFCH 2ZJSH 4M8QB 3AS1A 3H2WA 1LD9A 4LSTH 1DJSA 3WL9B 5E8PA 3NIGF 1CE6B 35C8H 4KJPD 1PZUB 1EA9C 3NCYP 1MFAL 3VXOA 5TF1H 4HGKC 4XHJC 5C0RL 1T5XA 1S7TA 3WDJA 5I8OH 3KNBA 1I1FB 1JWSA 2NX5E 4YWGL 1MHHB 3N1FC 4WHDA 1K4CB 4Z7UF 4FQCH 4Y8AA 4TUJB 5ACMA 4P5TC 5A40E 3I84A 4HS8H 2EZ0C 4XNMB 4AIXA 1P84K 4GS7B 4PJ5D 1PY9A 4OF0A 1TQBB 3D39D 4GAJL 4KK6C 1E27B 3AM8A 4G80A 4KRMB 4LVNB 1LEGA 4HZLA 2WIIA 1EO8L 4LHUB 5T5NG 3EYQD 4FFWD 5E08L 3IFLL 4O2CA 2EKSB 4EDWL 3KS0J 3VXTA 4JHAH 4X6DF 4QTHB 1WF5A 3ILQC 2XIDA 4F2MA 2GCYB 1MAMH 1T0MB 3G5YA 3V4UH 5SX5H 5C0BE 5T33L 1U8OB 1U6AH 2IPKA 1EO5A 3DUUB 3QNYA 4PJEA 3MBXL 3QFJD 5B39G 2BXYA 4HSQA 3SJVE 4LSSL 3WSQH 3DECA 1U2HA 5DHYB 4P2RD 4KY1L 1JNHA 3KPPA 3IJHA 2HFGL 3HC4H 4U1MA 3HZKB 4GXVL 1WISA 4ZUVA 4OZIE 5EBMB 3O6FB 4HC1A 3SE3A 4XGZA 4OCMC 4RZCA 5C2BL 4TOYL 5DMKB 1Q94A 3OR7B 2XICA 4TULL 2GJJA 1HZHH 3P0VH 1J5OH 1VFBA 4BZ2L 3ISWA 2UUDK 4K94L 1UM6H 4JG1H 2V5MA 3BZ4A 3RGVA 4F7MA 3BWAA 3P9MA 5I73B 3OKLB 4OSUL 5ID0A 4I0CC 4MJIA 1LO4L 4JZOB 5I1IL 1MNUH 5EBGA 1CE1L 1I7TB 2Z31B 1TVHA 2LQRA 3U9PL 4M7ZB 2G60H 4ZUSB 2QLVB 3JV6B 4DW2L 3ULVL 3QEQA 4L8SC 1EJ6A 5KSAD 8FABA 4KMTL 2FX8H 1OVZA 1P1ZA 5JOEA 2J7LA 4QEGA 2NR6C 3C6LB 4R90L 1UB5A 1N26A 2YRZA 1G6RL 43C9A 3VA6A 4N8CH 1T3FA 1AE6L