4TVPL

Crystal structure of the hiv-1 bg505 sosip.664 env trimer ectodomain, comprising atomic-level definition of pre-fusion gp120 and gp41, in complex with human antibodies pgt122 and 35o22
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
210
structure length
210
Chain Sequence
APTFVSVAPGQTARITCGEESLGSRSVIWYQQRPGQAPSLIIYNNNDRPSGIPDRFSGSPGSTFGTTATLTITSVEAGDEADYYCHIWDSRRPTNWVFGEGTTLIVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
publication title Structure and immune recognition of trimeric pre-fusion HIV-1 Env.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 37
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2014-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpL01
1QSZA 1DBAH 3SE8L 3FN9A 4JFDD 3T1FA 2ED7A 5E5MB 4GW1A 3BKCL 2BFVH 1S5HA 2HVKB 2VAAA 2NXYD 3U36A 3UC0H 5JXEC 2YXFA 1BBDL 3NH7L 4NO0A 4P4RA 4FNLH 4PP2A 3BOVA 4JRXD 1F3DJ 1EAPA 2A6IB 3PV7A 5C2BL 2EC9U 1RZFL 4R7NA 1CD0A 3WXVH 1P4IH 8FABB 1CD8A 5F3BB 4F8QA 1AXSB 4QRRE 1RULH 1PGRB 1QVOB 1XGPB 3WS3B 2B8OT 4R8WL 4HHAA 5TE7L 3DJ9A 1HINL 2X4TB 3WIFB 2NX5D 4OF7A 3QEGL 3LDBC 1CL7I 4ZDHB 1OT1A 1O0VA 3G9VA 2UWEF 2W60B 3C87A 1X7QB 2ATPA 4QGTA 1L9NA 5DA0B 1FH5H 4P3CL 3H9HA 4JZOB 5FOBA 3W9EB 5SWSB 4UDUA 4NQED 4C56D 5EU4A 1IAIM 4XVJL 5KAQF 1DQQA 4NQXB 1BVKA 2AV1B 3IAPA 4P2RB 1IT9H 5L6YH 3VGHA 1OAKH 3GRWH 3ME0A 1DE4B 4EDXA 1HHHB 2V7NB 1U8IB 5TH2A 3UBXB 1N5YL 1S7QA 4LIQH 4N0FB 4WFHE 4O58H 1NC4D 4N0UE 2VH5L 3BSZL 1DUYB 4K71B 3F8UB 3ZHLA 4YX2H 2DQDH 2Y36L 3H2WA 1T20A 3RAJL 4K3EL 2BX5A 4YDLB 5KS9B 5HHOD 3NIFF 5L2JA 1U3HA 1MWAA 5IB5B 4GS7B 5CJQL 4J3WA 2YPLD 4NKOB 4R97C 4JANB 2X4PB 1F4HA 4EI5C 1G7IB 2H9GA 3MLUH 3QPXH 2BSRA 4N0UA 3VD3A 3TPKA 3MLZH 4Y4HA 1BZ7B 5SX4H 1P7QA 2XWBB 1CBVH 5C0AE 3KS0H 2BVPB 5F8QC 3VWKB 1N6QH 1JVKA 5DRXA 2HRLA 2MPAH 4QRPD 1OTUC 4DWHA 4NKMA 3LIZH 4O51A 1KEGH 5DS8A 2IPKB 2P8MA 3AY4A 2VMFA 1ADQH 3T8XA 4MNQD 5DEZA 2MTPA 2P5EB 5IQ9B 1DDHB 3RZCD 5F6HJ 3EO9H 3MJ9A 3CGTA 4ZSOB 4M6AA 5C0GB 5D1ZD 1MAML 4ZFFB 3CSPA 3V95A 2P4AB 1IM3B 2ZWLT 3MLXH 1NGYA 1F2QA 5CUSH 1RUPL 3D6GA 3H9SE 4JAMA 5KZCB 5CKAA 1T83C 4XBPA 3VXMB 2WUBH 2SEBB 1EHAA 3T0EC 3WFDL 3C6LD 1U8OB 5KVDH 4I18A 1WZLA 2YRPA 4NGHH 2R0LL 3NZ8A 2F5AL 4GXUM 4U6YB 1DBBL 4JPWH 3P11H 4HJJL 4KUZH 3EYUL 4XNXH 5D7JA 3RWFA 3BKMH 4M6MH 1I9RH 1T1ZA 1EJOL 3D9AL 3I2CH 4FZ8H 2NR6D 2NYYD 4PG9A 3IGAB 4Y2DB 4TSBH 1DFBL 4ZAKB 4MB4A 1YUHB 5I8OL 4HKZA 3IDMB 4HXAH 1BFOA 3OPZH 2DJSA 3W39B 4Q9BA 5FHBL 1NCWH 1GHFH 1U95B 3AAZB 3ZDYF 1ND0A 3CH8A 4IDLA 4KK6C 1C08B 3AS1A 1A3QA 1YEGL 1XR8A 2P46B 3RNKA 3QHZL 2XT1B 1A9EA 5IVOA 4JDZB 3ARFC 3O9WB 1H3WM 2ICES 4I77H 5J56B 2XI9A 5BO1L 5FYKL 4F7PB 3DMMA 3GB7A 1ZS8B 3H8NA 4KI5E 1T66D 3WBDA 4NQTA 3FAXA 3MOAH 4I48B 1FE8H 1TJHH 2C9AA 2P24A 3CVIL 2A6JA 1DVFB 3DX9A 3V5HB 4OCRH 1G6RL 3DSFH 2AAVA 2ITCA 4YHLH 3B6SB 1MCKA 2FX7L 2GTWA 1S78D 3MNVB 3QIUB 3U4AA 3OKLA 5FA4B 4G8FB 4Y5YC 2FLRT 1KB5A 4M7ZB 2Y5TA 1E4XH 2CMRL 3QYCA 1NMBL 3PIQB 1A6TA 3P2TA 1RIUL 3V7AG 1SY6H 5GRXG 5D8JH 5GGVH 1QLFB 2PR4L 4M43L 1KLUB 4L1HA 3SOBL 3LEXB 3RBGA 3ZTJG 4Q2ZB 4QTHA 1UJ3C 1X5FA 5E8EB 2CKBL 4JO2H 5CJBA 3TA3B 2HTKC 2ZNWA 4XXDB 1FNAA 4MCZA 5HDQL 4Y1AE 4NC0B 4OLZL 2OI9C 2VIRA 5EORH 4DN4L 2FZ3B 4OGYL 1E6JL 2BP3A 2X09A 2UYLA 3G5XB 1RZ7L 3RU8L 4TNWF 3MRHA 1FL5B 3HZVA 3JWNC 1TQCC 4XPBH 1IC7H 4UBDC 2VITA 4BSVA 1WWAX 4HUKB 5IWLA 3FT3A 1NAKH 4H25A 4Y1AA 3BP4B 4ZTPH 4Z7VF 3K1KC 1B0RA 1OGAB 2VZ3A 1BJ8A 5C71A 3ARGA 4BFIB 4ZNEE 1KN4L 4NN5B 4YQXL 3IDUA 4FXGB 3NABL 1UQSA 4AEFA 2R1XB 2HH0H 5I1IL 4YE4H 2H3NA 2JJSA 4JFEB 1D6EA 3LQZB 3RBSA 1CGTA 5SWSD 1RZIA 5CSZA 3QB7C 3EFDH 3HCVB 2YBRB 3N50A 3TCLA 3QUXB 2XWJB 2QV2A 4ZNEA 4JZNB 4HIIA 4WW2F 5FDWA 1AGEB 1IQWL 1JNNL 1MH5A 4P2RD 3MGAA 3QIBA 1K85A 1U3ZA 1GGTA 2FATL 3QUZC 4YIQA 4UV7L 5IM7B 3KJ6H 4DAGH 4DEPC 1RMFH 4MJ6A 3GBMH 4GRMB 3MR9A 3UYPA 4NO3A 4PJHF 5FAAA 1ZGLP 2ZKHL 1DEDA 1RAMA 2FHCA 4CVXB 4BA8A 5DRWB 3PNWA 5GHWL 2V2XA 1MFNA 3U7WH 1T1YB 1AD9A 2VKWA 2Q20A 4QXGH 2DDQH 1AD0B 3MRIA 1A3RL 2FJHA 4K7PH 4KAQL 5EU3B 3LOWA 2QQNL 3VE0A 4WEBL 2OL3B 4KJQC 4PJ7A 5F93C 4P2QA 3VFUA 3VWKD 2V2TB 1FGVH 4MLIA 1FPTL 5JHLH 1OAYL 3KYKH 4PGEA 4KK8D 2P5ED 4MD0A 4LSPH 5LGHL 4R2GB 1LE5B 5DJXB 4LK4A 5DYOA 4HEPG 5IOPB 2OQJB 3NAAL 4ODWB 4OFVA 3NFPA 1DL7L 1N4XH 5KW9H 5DQDH 4WHTB 5AG9A 4N8VA 4UNTA 3X11B 4XMKL 5HI5C 3LD8C 3DGGA 1T80A 5ALBL 1X5KA 1HWGB 1RVFH 4JE4B 1KLGB 4MD4B 4IRJA 4JFHE 5KZCD 1KJ2H 4HBQA 1SJHB 3SKUD 1JBJA 1T3FB 5TGBB 5JIIA 1JRHI 2YUZA 3OKKA 4FG6C 3VXMD 3W2DH 4CU6A 1G7MB 4X7SH 4YHNA 5T33H 1H5BC 1T7WA 2VL5B 4WUUB 4L1DA 1I9IL 4S1QL 2CR3A 5EWIL 2DRUA 3VGEA 2BRRH 3P30L 2EDEA 3GIZL 1JN6B 5DO2D 5T5NF 2XA3A 4ONFH 1RD6A 5E9DE 1MVFA 5I9QC 1S9XB 2ORBH 3CMOL 2J6EA 1WBXB 4Y2DD 4ZAKD 5A2IH 2NY5L 1SQ2N 5DQJB 2ENYA 4WCYL 2IPUK 3MRCB 4X6EB 3UTTE 1K8DB 4P23C 5M7QA 1JGEB 1RHHB 1MRCL 2EH7H 2J3SA 3FQTA 3MRJA 4KWUA 5B8CC 3ZYOA 2FL5B 4O4YL 1CR9L 5IFJB 3HC3H 3P9LA 3C8KA 4PLOB 1A47A 3OKMA 5DJ2B 3MACL 1F4YH 5ESAA 1QA9B 4M1DL 1B6DA 3O9WD 1AO7B 4DZ8A 1ZVSB 2J1KA 1XZ0B 2H26A 3UTTA 3QDAA 5IMLB 5M95B 5IJKA 1FO0H 2ATKA 3A6BL 4HWBL 2ADGA 4BM7A 3ALXA 2YUWA 1DVFD 4HK3J 3Q5OA 4C58B 1AGFB 2MCPL 1IQDA 4G6FB 2VLJE 4HUUA 4JDVA 4MJIE 2K9UA 3K8MA 4WWKB 4RGNE 3QIUD 5GGQL 1A0QL 1JGLH 1YJDH 4X6CB 5TPWL 1I7TA 5I71C 1WT5A 3QQ4A 5ANME 5ETUA 3KYOA 3O0RL 5I2IB 1ES0B 1REIA 1LO0L 4NCC1 3V8CA 4NNXA 3BI9X 4RMVA 1ZVHA 4MJIA 2XYCA 1OB1B 4HH8A 4HT1H 4ZD3L 2L7JA 2GAZA 1ZT7A 1EJ6A 1BF2A 4JG0H 5FYJL 3ULSA 4LMQE 3VWJC 2M26A 4TSCH 3QCTL 4JREB 5ANMA 2VXUL 3TA3D 3SBWC 3WD5H 1YEHL 5C07A 3T2PA 4XNUH 3WYRA 3E6HB 1MCRA 3HI5H 4XPAL 3BVNA 4Q97A 3BIBX 1SJEB 2ICWJ 5CP3A 4R4FH 1YN6B 3LS4H 3W82A 3BGFB 3I6KB 4K3DH 2JKXA 2VDLH 1BWMA 2FYYA 4H88H 1FNLA 5C0FB 4TUKL 3RVWC 4IRZH 4JM2A 4DJMA 1DBML 4RWYL 5EPMA 5BXFB 1AR2A 1OGAD 5GS2D 2FIKA 3GHEL 2AXJA 1JHLH 4CW1B 4D0CB 2AJSL 1KPVA 5ENWA 4DGIL 3U4BL 2X70B 3QUML 3M8OL 5FGRA 1UZ6F 1LO5A 1OTSC 3VFGH 4WO4A 2XN9E 3WNLA 4JFED 3QRGL 4FZEL 1K4DA 3X13A 3VXRE 3RUGE 3DBXB 2DI8A 4LSSH 4X7FC 1A7OL 2VSCA 3QUXD 2JK5B 1KGCD 2IBBA 1A7NL 4XPGH 5FKPA 1N8ZA 1WGOA 3BWUC 5B4MD 4OZFA 4MVBC 3QZWG 4K23H 3O6KH 2WINA 1R3LA 5C70A 4L5FL 3G6AA 3BDYH 5I0DA 4WHCA 3VD5A 3LRSA 5K9JH 5IK3B 1A1NB 3K2UH 3ZKND 3EOBA 4HLZH 3SPVB 2W92A 4FFYL 1NBVH 2BERA 3GKWL 1CS6A 2Q7YA 2O5ZL 5MI0C 2X4RB 1F58L 4P5MA 1FNSH 4YO0B 5DQ9B 3QIWC 1LP9E 1QKZH 4EJ1C 1EMTL 5LAXB 1FFPB 1NSNH 1IGYA 4LAQL 1N2RB 1NCBH 1HK6A 3LSOA 1EH9A 2P48B 4UOW1 4WI5A 2NW3A 3ZHDA 5JORA 4NHCL 2YC1B 3OKEA 3MJ6A 5DJCB 4LASH 1CDHA 4L3EE 4KHXL 4KJYB 4XPHH 4ZPVA 1JGVH 3O4LB 3TBTB 3HR5B 2DQEL 2CJUH 4ZXBC 3HFMH 3UJIH 1OAUL 4RZCA 5JOFA 1Y0LB 1E27B 3BE1L 1I8MB 5D7LB 3UYOD 4R2GD 2H41A 3HC0B 4RX4D 2X4NB 5C9KA 4ELMB 2BOCB 5CIPH 1MVUB 5DUBA 5F97E 3U0TA 3P0VL 2NY0C 4JG1L 4QCIB 3QDMB 4ZO6A 1R3IL 3LHPL 2PW2A 3MNZB 1DLFH 3OR6A 2B5IC 1R5VA 4HJGA 5TDOA 5FO9B 5EDXA 3T4AB 1U6AL 5IQ7H 2Z9TA 1UVQA 3GMPB 3WUZA 1JI2A 2CXKA 35C8L 3RHWK 1KIUA 4WUUD 3TFKC 1A14L 2HG5B 1NCUA 3MJ9L 3NIGE 4LQFH 1P5UA 1QO3B 2DJUA 2X9YA 3CDGA 1S7VA 1WBZA 4P9MH 4X7TB 1ZLUK 2KZWA 4AEIH 3DXAE 3U2SA 3VRIB 2NY5C 4XP6L 1FFOB 1QBLL 5JNYA 3HA0A 1I3RB 1BM3L 2Y06L 3F5WB 3H3KA 5HPMA 2H6PA 3VFOA 2PTUA 4E5XB 1E4WH 1NBZA 2L7UA 4KV5F 5D9SA 4Y19B 1T5WA 4PGBA 5I8KH 3V79C 5KSAB 3AREC 5SWZE 1VPOL 1RZGB 4KQ4H 4E41B 5A2LH 3C9NA 3DXAA 3KPOB 3O3BB 4Z7WB 5L0QC 2XICA 1AO7D 4K3GA 3QPQC 2AJUH 5GGUA 1OARH 1G7JB 5F9OL 1YPZB 4A6YH 5GJSL 1U2HA 5JW4M 1UYWH 2XZAL 3CFCL 4D3CH 1TZHB 1G7QB 3WCYA 3ZHKA 4NZRL 1Q9OB 2OTWA 2YEZB 4XNYH 2W9EL 1I8IB 4G6FD 4PJXE 4TUOA 2AJ3A 3DROA 3IDXH 3WUWG 4PS4L 3KPMB 4WWKD 3BPOB 2XG4A 1KUMA 3BKYL 5E5RB 3RGHA 4JZJC 2HWZL 3JWOH 5GS0D 5F9DC 3KPLB 4MXQD 5E8NB 3QDJB 2OK0H 4FABH 1A2YB 2IANB 1UWEH 3B8YA 3MRLB 1UA6H 2WBJB 1XGRA 4KK9C 4P0DA 2EZ0D 2C1OA 3QNZB 4PJXA 4G6AC 1EZVX 1EHXA 1NFDF 2Y07H 3RL2A 1V7NH 1H3XA 4Q6IA 4YR6A 4POZD 2IADB 2ZPKH 4IOIB 2QADB 4LPCA 5C0JB 5E99H 2HRPH 2Z4QB 3EYVA 5DI8B 5I74C 3CDFA 4LU5L 1WF5A 3GZKA 3QHFH 4PJBA 2R9HC 3TZVA 5GS1A 1KCKA 5IFAH 1KYOK 3IDIB 3QEUB 4HQQL 3T08A 3WIHA 4RFNB 3ECBB 4MA1B 4OTXH 2CRIA 2P44B 4X4YA 4K3JL 3MRKB 3TVMC 5JW5A 4JO4L 4PJIE 3MV8A 1UCBH 1XGTB 1R3HA 3L7FB 1RIVL 2DQHH 4ONGL 4UINL 43CAB 5C0RL 3BT2H 2YMXH 4OD3L 3O2DH 3KNBB 4U6HB 1UWGH 4YWGH 4F7EA 1FL6A 3RVTC 4HFWB 3I50L 4JFFE 3ARZA 4ZG1A 1EGJL 5B39G 4Z0XB 4PJDB 4CADA 3MV9B 4K9EL 1LILA 4PJIA 3UTQA 1MCLA 2J8OA 3I6GA 3NCYP 3U9PH 4NPYB 1PYWB 3IRPX 1MUJB 1LWRA 4JVPA 1XF2B 1FVCB 4OB5H 4NUGL 2AKRA 1IRAY 4U1GC 4YBHA 5DWUL 3BPCB 3PJSB 1VGKB 5L7XH 4PR5B 4R4BB 3FQRB 3OJ2C 2ICWB 2XQBL 4JFFA 1MCJA 2RHEA 4WHYG 1AGDA 5MEPA 4EOWH 4Z7UB 3LCYA 2CLRB 4AEEA 3QXUA 1MCCA 4MQ7A 4BH7A 2WV3A 3DX8A 1BMGA 1MLBB 5DJ6B 4DZBB 4PJFB 5EBWA 1ZHBA 1CZ8L 1E4XI 2QLVB 4XTRD 1FGNL 3BKJH 4DVRH 2Z31B 4HG4K 3BP7A 2CDGB 3BZDA 3FHAA 4OF8A 5E7BA 4WFFD 3UCRA 3I02A 1AHWC 4O02L 4HKXB 1RJZA 5IMKA 1KBGL 3E6FB 1R3JB 2VZOA 4QXTB 3CJJA 5ICYB 3DSNA 4QHKJ 4UIMA 3KLHC 4DGYH 1OGTB 3LB6D 1NAMA 1ZEAH 5D71H 3WNOA 5D7SH 2YK1L 1PW3A 1MJUH 3O4LD 2ZG2A 4U3CA 4C59B 4FN0A 3TT1L 3BZEB 5IBLC 4J1UA 3DX7B 3ZYZA 4LARH 5J6GB 1U3HC 2X41A 5D7LD 5T1DL 3FO2A 5AWNH 4ETYA 1CGVA 3DVGB 3QWRA 2WLYA 4TVPE 4WFED 1OAZH 1QHOA 4Y4HC 5KSBE 5ITBH 3S4SA 1SEBA 2B1HL 2E9IA 5E94A 3SJVE 3LDBB 2ZOKB 3QDMD 1CLZH 1ZA6B 1R0AH 2RFXB 4U2ZA 2VKXA 5EOCL 5I17B 4IMLA 1S7TB 3AY4C 1Q9KA 3GMMA 1K2DB 5I1GL 3TYFA 2B0SL 5JIHA 2B2XL 5AUMB 4Z7QF 1JUFA 5KSBA 3BEVB 1IAOB 1OAQL 2Y5EA 4DKDC 4FQ1L 4GLRH 5I8EB 5INCB 3SJVA 3UBXI 1RUKL 2KH2B 4DOHB 3MMEB 2JF1A 4IOSD 5I1KL 1HKFA 4QEGA 2O61B 4N5UA 2HKHL 3A67H 1CQKA 3D69B 4CN4A 3EO1B 1MSPA 3CLEH 3DYMA 1RHFA 5GISH 4ZFZB 5EOQH 3QFDA 5K9KB 5C0BA 4YXLL 1GC1L 3B2UD 2J88L 3HAEA 2XKSA 3PQYE 1TTFA 4Y19D 1XF4B 4R97B 5JO5B 5KSAD 1XIWC 1YYLL 4E41D 4FQXB 4G8IA 5D7JC 4CAGA 5IB3A 4P4KB 4N5EC 2J6EL 4IRSC 3X3GH 4YPGA 1J9CT 4JPKH 5J1TC 2HFEB 1CU4H 5BMFL 3S96A 3C5SB 3L3HA 2G9HA 3PQYA 3MRMA 5IGXH 4AL8L 3VI3F 3SKMB 5EC1A 5TQ2L 4PRDA 2HJLA 2CLZA 1RPQA 2VDQH 3Q6FB 5CBAA 1DQMH 3TPUA 3GSXA 2ZOLA 1AGCB 3QJFB 4MD5A 4ZODA 2UZYB 4Y5VA 5TF1H 3DMMC 4PJ9B 4WU7A 1X5LA 1MCDA 1FSKB 3QDJD 4ZFOA 3MROB 3H3PH 5ALCH 2IAND 4OI7A 3O4OC 3B3IB 2WBJD 2CPCA 3Q48A 4OZGF 5IBTH 5I1EH 3DLQR 1KT2A 2K3TA 2QBWA 1GJIA 1P2CB 4ODTH 5CWSA 3IETB 1NGPH 3TO4B 1XAUA 1I85A 3KJ4B 3WLBB 5GZND 3BRDA 2QADD 3WFCH 1RK1B 3FFDA 1TCMA 2I07B 1KV3A 3WNKA 1HYSD 4KI5C 4GSDH 2P5WE 3T0BA 4S1RL 3MO1A 5HGDB 4KTDH 3JUZA 1RURL 2IAMB 2VXQH 1S3KL 1CICB 3V5DB 2I26N 1DR9A 1V7MH 5F6IC 3QQ9D 5HYJB 1B4RA 4LPTA 4JR9H 1L6XA 4HW6A 4JKWA 1IEAB 1BD2D 2P5WA 1A8JH 3BN3B 2X6MA 2IFGA 2VDPL 1GGCH 1NGWB 3IDYB 1Z9LA 4N0CD 1W0WB 4RAUA 3TJHD 4Z7OF 5C0CE 1ED3B 5CMAB 5GIRA 3OB8A 4UQ3A 3VXNB 3VG9C 1TITA 4M7LH 1ZA3A 4CNIA 2VXSL 2NY2C 4X8JA 5J12B 2Q6WA 1PFCA 4K9EC 1R24A 4QXUL 3MV9D 5JW4Q 4TRPL 4UU9B 4LBEB 4HD9A 5FYLH 4R7DA 3RNQA 3BX7C 1WFUA 4FTVB 1IFHH 3T77B 5IWLC 4JLRA 1HHKA 1II4E 4HUWB 2R23A 2AEPH 5C0CA 2VLME 2FJGA 4LDOB 3NPZB 1RJCA 3ARGC 3QCVL 5EBLA 3PDOB 5C7XH 2HFGH 5CJOL 3FB5A 5FYLD 3TLRA 3G5VB 4L8SA 3TIDA 4OV5B 1CFTB 5DVLA 3ILPB 3OXRB 4WNQA 1EAJA 3LY6A 1C5DA 2JJSC 2FR4B 1GGBL 2DTML 3TNNB 2WUCL 4QHMA 3ARSA 4L4TE 1BBJB 1NGZA 1XH3A 3W11C 2Z31D 3OKOA 4HBCL 5EZJA 4ODXA 1WEJL 4CMHB 4W6XB 5CILL 1UJ3B 4V1DE 3ZO0A 2QEJA 3Q6GH 3IFOA 3QIBC 1BZQK 4QT5A 3S34H 3D87B 1F3JA 2I5YH 3VJ6A 4GG8A 4LLUA 1INDL 2P42B 2LU4A 4DVBB 2BHYA 4L4TA 3WXWL 5JXED 1MFCL 2DM2A 1F4WL 4M6OL 5CHNA 1U8KB 4V1DA 3BZFA 5EC2B 3HI1B 3RY6A 1B88A 3B9KA 5L8KB 2YUVA 1ZSDA 3FB6A 5J3HC 1I7RA 4NQDE 5MEOB 3MREA 1PLGL 5T1KA 4Q9CA 1SYVA 4OZIF 2YA1A 4Y4FC 2EDLA 2X89D 4IIQA 4HC1L 5FHAH 5KVGL 3ROOA 4H0GA 1T2XA 2E27H 4LRNL 5F96L 1UH4A 3S35X 2AK1H 2IALB 4APQC 5BS0A 4F8TA 5T3XH 3QWOB 4ZYKB 3ZYJA 1F00I 3NFNA 3HRZB 1G7HB 4PV9B 4QHLA 3OGCA 2X1OA 4YK4B 5BQ7A 4NN7C 5DJZB 1RJYA 4P46B 4GG6F 2IPTH 1JHTA 1UC6A 4QRTA 4UUJB 2CXGA 3VD4A 3KDMB 3HE6B 1Z9SA 1KIPA 1YNLH 3H42L 2D4FA 5T3XD 4IRJC 4K8RL 3O45A 3O11B 5IKCB 4LKXA 1S7UA 1GC1C 4BH8A 2HMIC 4QRUB 2Y7QB 1G7PB 1GPOL 1PEWA 1E28B 4U1SA 4NDMB 4MGXA 1B6UA 1HHJA 3REVB 4FQXD 4Y7MA 5J13C 1N64L 4Z95L 3DRTA 1T0NA 4P4KD 4M93B 1P1ZA 3GDBA 4YBLB 5IVXB 3U48A 3UJTL 2VAJA 2Q86A 32C2A 1OTUD 5GS3A 3VFPB 4Z8FL 2FO1A 1WWBX 1AXTH 3G04B 1QNZL 4PJEB 1CFSA 3EJZC 2DD8L 3IFPA 5DD0H 1GL4B 1DZBA 5L8JB 1W8NA 5C6TH 5BZDB 4OCXL 4UTAH 3WKML 1NJ9B 3LV3B 4XVUD 3BD3A 3U7YH 1B4JL 3ARUA 1FNGA 3V4UH 2IG2H 3MUGA 4OF5A 2QSCH 5D5ME 5HGHB 3VA2C 1DQLH 2YD8A 4OCSH 1P7HL 4PJ9D 5IJKC 4N0YL 4DKEH 2FNBA 4F57L 2HFFA 5H2BA 3SEPA 1GIGL 5IESL 2FCBA 1MRDH 4HUVB 5I1LB 2DIBA 3VDBA 4XMPH 1HQRA 2E9WA 2VNCA 1H5BB 2BMKB 4MDJB 4GRLA 3TO4D 3QH3B 1JNHA 2W9DH 3A6CH 1KJ3H 5D5MA 3BYYA 4JFYB 4D9RE 4LSUL 2EYRA 3MZTA 5I9QB 2E6QA 1WT5C 4UTBH 4AT6B 1XF3B 1VA9A 2IAMD 3BUYA 3KYMA 3HB3C 1CICD 2ARJB 3BH9A 15C8L 5JR1L 2BDNH 4KKAD 4LSQH 5IT2H 2GCYB 5C0DA 4P2CG 3IS1X 5LCVL 5HYJD 4GUPA 4RGNC 4LEXH 5KSUA 5H8DA 4KK6D 1S9VB 1XCQA 4XZUA 1FIGH 3AU1B 4N9GA 2F8VA 4K94L 5D7IB 2NY7H 2R0WH 3DV4B 2ADJA 5DFVD 5C08B 1CVRA 1HXMA 4CVWA 1YY8A 4U4BA 3IJHA 1KELH 3DO7B 1OAXL 3N1PC 4NZTL 3LKPB 3LKSA 2IC2A 3WO3B 5KN5B 2QQKH 4LF3B 4FTVD 3C60A 4OD1L 3EYOB 2KL6A 4JM2C 4WFGD 2XFXA 1EIBA 5ADOH 2VN7A 3CDYA 3FQNA 2N7BA 2W38A 4OGAD 3V6ZA 4X6CF 1NANH 5BVPH 5I71B 1OF2B 3GBNL 1J18A 4P59L 1D3CA 3NGBC 5FGCE 2XQYK 1AQKL 4PBXA 4HKJA 2EDTA 3SE8H 4P2OA 3VH8G 1V3LA 3BKCH 3RWEA 1HNGA 2QL1A 3BP6A 4I0PB 5AD0A 3V5KA 3VWJB 2UWEE 5DFWH 1RJLB 3NH7H 3NOIA 4ORGA 1VFBB 4Z77B 5C2BH 4UT6L 1RZFH 2GJ6B 4G8GB 3U0WH 4LCUA 4YBQC 1CLOL 3V0VB 1MJJA 5EG6C 4R8WH 5TE7H 1CLCA 3D39E 1HINH 2L0DA 3SDAB 5EA0L 3QEGH 5HHNA 2UWEA 4FQCL 4UBDD 2HAZA 3G5ZA 4HPOL 5A3IC 1NCCL 2ITDB 4ZUTB 1YDPB 4PRNA 4PRBA 2YSSA 2APBA 4Y5XA 4MDIB 1Q0YL 4RRPA 4AM0B 1JZ4A 1RFDL 1K9TA 2DQIL 4XVJH 5LVEA 4NOFA 4Y4KB 3D39A 4QOKB 3QNYB 3M1BB 4KDVA 4HCRH 1T1WB 1GZQA 3RI5F 2JB5L 4KRPC 5E95B 1N5YH 5IB1A 4FQHB 3SY0A 2VH5H 2NXZC 3HLAB 4ETQA 1NFIA 4I2XE 4GRWF 4WY7L 2E7HA 2Y36H 4K3EH 2GUOA 2X05A 3MRBA 3LEVL 4P46D 1JWMA 4LVHC 1ZLUH 3CFJA 2I9LB 3K80A 3HE6D 5CJQH 4PV8A 5HHVL 1FORL 4K07A 1PKQE 5FF6A 4K8RC 3LKOA 2VTFA 2AS5M 4JVUA 4I2XA 1PJ9A 4PD4J 2F19L 2AI0L 1G9ML 4TVPL 3P4OA 3PGDA 5DHVA 3HMWL 2AP2A 3QIWB 4XPTH 4PRHB 1RIHL 3D3VE 2AJXL 2DJ4A 5EBGA 4FXLA 4OUUA 1I1RA 4EIZC 1BGXH 5D1QA 1R5WB 3N85L 4HV8A 4U6VL 3QEHA 4FQQB 3JTSA 1J05B 4KJQD 1L4IA 4DK6A 3VFTB 2W0KA 3NA4A 1MAMH 4PJ8B 4I13B 1Y6NR 4BQ8A 3D3VA 3WFEL 3DO3A 2G5BA 3KLAB 1FZKA 3QDGE 4YHZL 3QWQB 5J1AB 1OP5H 4GKZB 4NC1E 1BJ1H 1WWWX 1RU9L 4M5ZL 2NY1C 4PB0L 5D72H 3SDXB 1A4KA 2QR0B 2WW8A 1PZ5A 4U3XA 1U92B 3WFDH 1S8DA 2IH3B 2R0LH 2F5AH 1IVLA 3IJYB 1DBBH 4HJJH 5FO8A 3FT4B 5HSFA 5F7KC 3FCTA 3QDGA 1EJOH 3D9AH 2JJTA 1UB6A 2UZXB 1EO7A 1DFBH 5C6PB 4JDTL 1UM4L 1QQDA 2ZUQC 5DSCA 4ODUB 5I8OH 5I30H 4L8CA 1H3TA 4NO5B 4EXKA 3FO1A 3MRDB 4EVNA 1S7RA 4I5BA 1CYGA 4HS6A 2QJDA 3FO9B 3C5ZB 3MLVL 5FHBH 3BRGC 3O3UN 4EDWL 1HIMH 1U8NB 4ZFOL 4RMSA 3STLA 2FX8L 1PSKL 3CDCA 1YEGH 4MS8D 1KJMB 3OKDB 3QHZH 1W0VA 1IAII 4KROB 4LLYA 4PJAF 2M2DA 1DP0A 3VXTA 5BO1H 5FYKH 5I6XB 4Q6IC 3DETC 3I9GL 5DJYB 3RIAK 3AREB 3VGFA 2G2RB 1DQTA 5F3HB 5EO9A 1FVDA 1ORSA 5TDNA 4Z7WF 5GS1C 3CVIH 2DQJL 1OY3B 1UACH 2APVA 4K94C 2PYFA 3W0WE 1WQVT 2BCKA 3GMNB 3UPRB 1YPZF 1G6RH 1JWUA 5FYKD 1HSAB 5LBSL 5C08D 4KJPC 3EOAA 4QO1A 2FX7H 2XKUA 1T1XB 4HWNA 3V6FB 2AXGA 2V2WB 2CMRH 1NMBH 3PP3K 5IP4A 1RIUH 1TJIL 3I75A 3NIDF 4HUXA 3K8LA 4QYOB 3S5LA 5BV7L 2EKSB 3W0WA 3CU7A 3LVEA 1JGUH 4MNHB 3B5TA 2PR4H 2NLJA 2CK0L 4JZJB 3SOBH 3P9MA 5E6IB 1CLYL 2CKBH 4Z7VE 3TO2B 5GQBA 5C8JA 3QJHA 1OWWA 4OLZH 4IHOA 3SCMB 4DN4H 1FNHA 2X1WL 3V0WL 2AV7A 3VXUB 1E6JH 4LCYB 1FYTB 5CD3A 4I0PD 2PYEA 4OFKA 1HNFA 4CN1A 3DARA 4R96B 5E00A 3VWJD 5DR5H 5GPRA 1N7MH 4XWGL 1RZ7H 4DW2L 4LNVA 1RUML 3C09C 5I16B 2EO9A 4HLZG 4TOYL 4XAWL 3RWDA 2MSPA 1SHMA 4Z7VA 2GJ6D 3BQUA 4LVNC 1BQLL 1QSEB 3MYJA 4G8GD 5FKAA 1S9YA 2DLEA 2FH8A 3BIAX 3ZYIA 3HZMB 3NBNA 2VLRE 4NOBA 3RWCA 4MZ3A 3SDAD 1EX0A 3NABH 1BWWA 1U8MB 1YEDB 1SBSL 3H0TA 3KXFD 4YC2C 5I1IH 2DKSA 4HKBB 3QG6A 5L88L 1ZLWK 5LXGL 2PW1A 2XTLA 1MFDL 1CGYA 3T1FB 4WW2A 4ZUWA 1S5HB 3ZKSD 1G7LB 3ZE0F 3U36B 4Y4KD 4QOKD 1IQWH 1WFOA 1JNNH 1TZIA 2BNQA 2F54D 4ONHA 5A16A 2FATH 1EAPB 3KWWA 4UV7H 4PJHA 3GSRA 3RDTB 1UXSA 3M45A 1Y18A 2HLAA 4HHAB 5LGJB 5F7LB 3EKCA 4MVBD 4ZFGL 1U8JA 5I1CL 2YD4A 2ZKHH 4ENEC 5DEGB 2OTPA 4O2CB 1MAJA 4B7LA 4HIHB 4O9HH 3CMGA 5K33A 1RK0A 5GHWH 5E1AA 2ATPB 1YMHA 4BQ9A 4HIJA 4L8BA 3R06B 1KCUL 1N59B 4UDUB 5HJ3A 1A3RH 3UTPE 2PTVA 2XKNA 4KAQH 1MCSA 1G9MC 2QQNH 3PABA 3TH3T 4WEBH 5DD3L 3O2VL 1BVKB 2EEDA 1EEYB 3K81A 3SQOL 3MX0A 2ADIA 3QIWD 1TENA 5EIIB 4FQPA 4PRHD 2GW5A 1FPTH 1DQJA 4EDXB 1OAYH 5EULV 5TH2B 4ZUVA 5IHUL 1S7QB 4Z76A 5LGHH 4BELD 4X6DF 5CS7A 3ES6A 1NPUA 3NAAH 3JTTA 1SBBA 3BRFA 1DL7H 2E7CA 1J8HA 3VFSB 4PJ8D 4XMKH 2J5LB 5L2JB 4X9GA 3D2UA 5ALBH 1MWAB 5BCAA 1GGIL 1VFAA 2A38A 4OSUL 2ILLA 3VGBA 2ZUXA 5F1KC 4X0KB 1P7QB 1VADA 1QFPA 3QULA 1I9IH 1OSZA 2VISA 5DRXB 4S1QH 1S9WA 5EWIH 4FQIL 2HT2D 3P30H 4H5SA 4WGWB 5ERWA 1F4AA 5DS8B 2P8MB 1A22B 4JKLA 5FUOL 1Q94A 5EH1A 3CMOH 4U33A 1YEFL 4EUPA 5JPNA 3C08L 2NY5H 2G60L 4WCYH 4AJ0A 3SQBA 4M7LT 1F6AB 2AK4E 4DKFL 4Y5VC 1MRCH 2P43B 3MLRL 4UNUA 4GXVL 3R1GL 1AR1C 5EUKA 3C5ZD 3BN9D 3DX6A 3EAKA 1IE5A 4O4YH 1CR9H 1NGYB 2X40A 4JO1H 4PLKC 1P6FA 1ZT4A 1FAIL 3MACH 3SE9L 1ORQA 4M1DH 4BSWB 4KROD 2OCFD 5HD8D 4Y8DC 4ZOCA 4I18B 2YWYA 2KQMA 2AK4A 3MZGB 1J86A 2A0LC 3EDKA 3K46A 3SKOA 5D2NE 3ARED 3NZ8B 3A6BH 4XX1G 5GGVY 4OZ4A 4HWBH 4UI2A 1DBJL 3KR3L 4J8RB 5DJAA 3K2MC 3RWFB 5H94B 4NCC2 4O00A 3QRFM 1IKFL 3TN0B 1CE1L 1I7ZA 2MCPH 3MLSH 5DVNA 1KB9J 3T2OA 1YEJL 5DRNA 2R29H 4PP1C 4MA7L 1A0QH 4WI9A 2R69L 5TPWH 3WDHA 5D2NA 3MRGA 1A9BB 2H32B 3O0RH 3MSPA 1LO0H 1ND0B 4DGVL 1H3UA 1FG2A 5BV7C 4X9HA 1XR8B 4L9LA 4WHDA 3RNKB 5DF0A 3F6IA 4ZD3H 2Z35A 1A9EB 3HUJB 2IGFL 4JFQA 5FYJH 2GI7A 5F89A 4OFIA 2R1YA 5E6ID 3GB7B 4F33A 1ROWA 4ZPTA 2ESVD 4HF5L 2VXUH 2GQHA 4G6AD 3SCMD 5AAWA 2P24B 4N1EA 5SWQA 1YEHH 5DHYB 5TF0A 4TTGA 4JPIB 4LLQA 3VXUD 3X12B 3VXPB 1FYTD 4XPAH 5A2JH 43C9A 2ITCB 2WWMC 4KZEL 2GTWB 3SGEH 3UTOA 3QFJE 1KB5B 4GBXB 3PWVA 5J8OA 2Y5TB 4L8SC 4PUBL 1J0YA 4TUKH 3GI9L 1A6TB 1DBMH 1QSED 4RWYH 3KYNB 4YDJB 5CZXC 3ARVA 3O3AA 3GHEH 2B7DT 4HEME 2E5EA 1FYHB 4JCLA 5GJTL 2ZZUT 2AJSH 4UT7L 4DGIH 1WV7T 3U4BH 1A7BA 2CRZA 3QUMH 3M8OH 1P84K 2EDRA 4QTHB 4LPYA 5IJVA 2FBJL 3C2AL 3QRGH 4FZEH 4HK3N 4MCZB 1LNUB 1QRNB 2VIRB 5I0ZA 1BQHA 3A6OA 2BVQB 4JY4A 3CU1A 1A7OH 2IBZX 2Y6SC 4RBPH 3VCLA 1A7NH 5TE6L 4L8DB 2UYLB 2X7LA 4PRIE 2AEQL 3BP5A 3MRHB 4PGCA 3HZVB 5HHQB 3RY5A 4L5FH 2GYSA 1KF9B 4GXUN 2JIXA 4JFDE 4K7PY 1CL7L 1T2QL 2LAGB 2VITB 2GY7B 4BSVB 4H25B 3RDTD 1HH6B 3UMTA 1A4JA 1B0RB 3RY6C 3B9KC 1CD1A 1BLNB 3EYSL 1SVCP 4JRXE 4DFIA 2CIIA 3CCHA 1RV6X 4OFPA 3RVUC 4PRIA 2VC2H 3GKWH 2O5ZH 3AXLB 4B50A 5J7CC 1F58H 1UQSB 2A9NL 3D18A 1J10A 2AGJL 4JFDA 2H3NB 4LAQH 4NJAL 1D6EB 2DM4A 1NANI 1LK2A 4G42A 2VDKL 1RZIB 5CSZB 7CGTA 2NX5E 1PQZA 1ETZA 4NHCH 3LKQA 1ZE3C 2A83A 5D1XB 1CVSC 3IRZA 4KHXH 3L5IA 4HIIB 3MFFA 5FDWB 3DTXA 1MH5B 2DQEH 4TNVK 4PY8I 3RA7L 1KENL 1OAUH 3ETBF 5I66B 4NQEE 4C56E 3FONA 2X4SA 3KLHD 2Q3AA 1MWAH 4OKVA 4G8EA 4HDIB 4I3SH 4UB0H 4YHOL 3ZTJH 4MJ6B 5F88A 1JK8B 5I73C 2NX5A 5C3LD 5FCUL 1NMAL 4NO3B 1A7PH 1TETL 3P0VH 3L3GA 1UZ8A 4JG1H 5A1AA 1IKNA 4R6UA 3P73A 1R3IH 1NMCC 2EO1A 3IKCA 3LHPH 4OCNC 3PNWB 3UYRL 2VLLA 1FJ1B 1AP2A 4Y4HD 4OD2A 4J23A 4L29A 3RUGF 5HHOE 3C5JA 1P7QD 3MRIB 2FJHB 3W9DA 35C8H 2GSIA 4KV5E 4M62L 3VE0B 2XG5A 1A14H 2NY6C 2YPLE 4PJ7B 1G9NL 4P2QB 5FUZL 3NN8A 1FBIL 3MJ9H 4PREA 2GT9A 3WFBL 5FFLA 4LGPB 1GZPA 4QHKI 2RCSL 3ET9F 3FMGL 1TJGL 3QQ3A 1XGYL 4XP6H 5DYOB 3N0PB 4P3WA 3RTQB 4QRPE 4YDKL 2VRAA 1XCTA 5D6CA 3FOMB 2BNUA 2D7TL 3NFPB 4FRWA 3ZE1F 1MRFL 4NN7B 3RVXC 3I6LE 4MNQE 2YPLA 3BDXA 3BEWA 4XP9L 4C83B 3L9RA 3DGGB 2VDNL 1LP9F 3WN5A 1VPOH 4M7JL 4CN6A 4IRJB 2YD9A 1QR1B 3W5MA 1ZLVK 1JGDA 3OKKB 5FECA 4QRPA 3H7LA 3SGDI 1L6ZA 5F9OH 4P57A 2VR4A 4OF3A 3EW3B 1PY9A 4MNQA 4EI5A 5K59F 3GSQB 3GSUA 1CK0L 2XZAH 3CFCH 4EQ3A 2ED9A 4NZRH 4DCQA 1NFDE 3TN0D 4N5ED 2W9EH 5IVXF 4XCNA 3MCKA 1G6VK 2YD3A 2OR8A 4PS4H 4D9QD 1FFRA 5IHZA 3BKYH 4TPRH 3FQTB 2HWZH 4EI6A 1PG7L 1CG9A 5DDHB 1J1OL 2DMKA 3K4DA 3C8KB 3P9LB 4FXKB 3O6LL 4QHUB 5H37H 3R8BB 1NFDA 3ULUD 2DYPA 2LTQB 5F9JA 1JF1A 3GJEA 2Z91A 4U1LA 4KH2A 2LABA 3L5XH 5B38A 2H26B 4X8XA 5ESVB 3DMMD 4LPUA 2DIAA 4G6ML 3FRPA 1U41A 4S1DC 3U83A 4U0QB 3LMJH 5HI4D 2ADGB 3PWJA 1T83A 4LU5H 4S0TD 3R8QA 3C60C 4HUUB 4HQQH 3PP4L 4NT6B 5HVHC 4KJWC 4GBXD 4K3JH 4JO4H 4G9FA 4WUKL 3QQ4B 2RJMA 2YWZA 1P4LA 4JFZH 4NQCE 1RIVH 4ONGH 4NNXB 2VQ1A 1JFQL 4UINH 2PTTA 5C0RH 1X3DA 4OD3H 2VO5A 3BWAA 3JV6A 4MJIB 2FSEA 3Q3GB 4J3XA 3BHBB 3I50H 3ULSB 1ITCA 2BJML 3MJ8A 2FX9L 1TPXC 4M5YL 1RUQL 1HYRC 3OZ9L 5GGRY 5HYQB 4NQCA 3ARFA 1JYWA 5C07B 4NUGH 4MJ2A 4Z78A 2D9CA 1DN0A 5DWUH 4GAJH 2NY2D 3HMXA 4OCYH 1INQA 2UVEA 4WDIA 3ZDXF 5DT1H 5HGBA 5AAMA 4JM2B 5D93B 2WNGA 5EPMB 4KDTA 3HNTL 3FT2A 3MBXL 4Y5XC 1CZ8H 1PBYA 5FB8A 4AG4L 1YN7A 1FGNH 3ARGD 3VFNA 1WIOA 3UTSE 5ENWB 1HI6A 3ZT5A 3S37L 2FO4A 4O02H 2DQGL 3GHBL 3N1MC 4WO4B 1KBGH 4O2EA 5D2LB 5KANG 5E5MA 1K4DB 3X13B 2YD1A 5DGQA 3CSYA 3W11D 4NRXA 2DBLL 1I4FA 3GI8L 3V6BR 3CFBA 3VFRA 1XMWA 2GTZA 5D1XD 2WIIA 5IHLB 4WW1B 2YK1H 4DTGH 5FKPB 1N8ZB 4CU8A 1I1FA 3UTSA 3UEZA 2IPUG 3FN0L 2R0KL 5IMOA 3TT1H 5HVFB 5SWSE 1R3LB 3G6AB 3CVHA 1ODAA 3TBSA 5IW1B 5T1DH 5I1DA 3LS5H 4Z7QE 3LRSB 5IV2B 3PWUA 3EOBB 4P2RE 3VXQA 5DVKA 2EECA 1EVUA 4TSAL 4ZDHA 3RKDD 2B1HH 4KKBC 1UENA 2EE9A 1X7QA 5FO7A 3PWLA 5F7HA 3QXTA 4JZOA 3CPLB 2HT3D 5B22A 2NY3B 5EOCH 3IF1B 4TYUA 1IGYB 5FV2A 5J3HD 5KS9E 3I84A 5JORB 5D1QC 2B0SH 2B2XH 2W91A 4P2RA 2P8PA 5C9JA 4X98A 1WUNT 5B38G 3NCJL 5JPMA 2QSVA 5IHBA 3OKEB 3OHXA 1G9NC 1H8SA 1DE4A 4P2QD 3CXHJ 4FQ1H 2HJFA 3X3FL 1HCVA 5I1KH 2NXZB 3RFZC 3LPWA 2HKHH 2A1WL 1FCCA 1MI5B 3WE6B 3RTQD 4F7TB 4ORZC 3U0TB 5IB5A 4YXLH 1GC1H 4NKOA 3U82B 4LVHB 2X4PA 2P5EE 1J12A 2J88H 3IT8D 4YFLF 1KACB 2PW2B 3OQ3B 3S9DB 3OR6B 1KC5L 1YYLH 4IRJD 4ZSOE 4G43B 4NRYB 1R5VB 3N9GL 2EDDA 4X6FB 3MUZ1 2FRGP 1YNTA 2JJTC 3VWKA 4NC1C 3O6FB 2HT4C 4WENB 1UVQB 2J6EH 3SO3B 3EHBD 1AFVL 4PTTB 1NKOA 3NACH 3RWHB 3ZKMC 5IQ9A 4PD4K 4ACPA 1FHGA 4UQ2A 5J06A 1A6UL 2IH1A 2VN4A 1I7UA 1FLRH 4YHML 1ONQA 2R4RL 3CDGB 2F74B 2PNDA 1S7VB 1WBZB 5TQ2H 3VXME 3UTZB 3KS0J 5JW3L 3S37X 1PY4A 4JFHD 5E08L 3U2SB 4XAKD 4EIGB 4F80A 4ZFFA 5JNYB 2X44D 1UCTA 1T5XB 4Z0BL 2DWDB 3HI6L 3V4PL 2H6PB 3QXDA 4JO3L 4ZQKA 3VFOB 2ERJB 4LHUA 2C3VA 1NBZB 2RIKA 3RWIA 3EJZD 2GFBA 3AB0B 3PP3H 5D9SB 5CZVL 4HWZB 2C5DC 4OZGA 1C5BL 4PGBB 1F90L 4RNRA 2SEBA 3U1SL 5K9OA 3C9NB 1L0XA 1U8OA 3QP3A 5F9AC 2N7AA 4KI1A 4YXKL 4U6YA 5GGUB 3BJLA 5AYQA 3RPIA 3IGAA 4MQTB 4H0HB 4PJCF 4S1RH 3LQMA 4Z7OE 1YUHA 1RURH 1S3KH 5EB9A 1S7XB 2AJ3B 3DROB 2ZUQB 3W39A 1OSPL 3GNML 4GMSL 4CVZB 3DWTA 3AAZA 1LD9B 2H2SC 3FB7A 2D0HA 4MCYA 3STZA 1C08A 3MFGB 5EUOB 1KCVL 3HB3D 3K8KA 2HVJB 2PXYB 3F7YB 2VDPH 4PB9H 4EBQL 1HOCA 1B0WA 2C1OB 3D48R 4MJID 3HPLA 1LMKA 2EIDA 4OCWL 3RL2B 4Q6IB 1WSST 5T5FL 1JPFA 2VXSH 5CP3H 4MB3A 3T0AA 1DVFA 4GT7A 4MXVF 3V5HA 3FL7A 4TRPH 3L3IB 1ZLWH 3K0WA 4PJBB 3TZVB 2IMMA 5C07D 3MNVA 3QIUA 5JHDA 5FA4A 2FEDC 4XP4L 3WHE0 1MHPL 3QCVH 3PIQA 5DEFA 4KTYA 5J1SC 1LK3H 3N1GC 3QO1A 4LKCB 4V2BA 1T89A 1WZKA 5CJOH 5JW5B 2HLFC 3MV8B 4LCWB 4JM2D 4P5KA 2APTA 1R3HB 4NBZB 2B4CL 1N0LA 3U79A 2DTMH 1KLUA 5JXAL 4OF6A 3F65A 3LEXA 4JKKA 4HBCH 5E8EA 5KVFL 1W72A 3ILQC 4NWTL 4OGZA 3TA3A 1WEJH 4OLWL 5CILH 4WO4D 4OZFH 4CADB 1QZ1A 3UTQB 3I6GB 3H7BA 4AH2A 2G5RA 3R0MA 4MXWL 1FL5A 1INDH 2AKRB 3QQNA 4CJ0A 4Q9QL 2R4SL 1HKLL 1MFCH 3GGWA 5I19H 3IAGC 4M8VA 1BJMA 1F4WH 1X4ZA 4JFEE 4M6OH 4JRYE 5MEPB 2G75A 1AGDB 3PG2A 5CP7B 3RGVB 4MQ7B 2LV4A 4YJZL 4XNQB 3ROLA 3DX8B 1VCAA 3SGEI 1WJ3A 1ZHBB 3WJLA 4FXGA 4OZIA 3T0DA 3LN5A 1KTLA 2R1XA 5JW4R 3BO8B 1PLGH 3BP7B 3Q5YA 4L9DA 2GEEA 4QY8B 3G5YB 3T09A 3LQZA 3I02B 2FBOJ 4JRYA 4JHZA 4HC1H 5DA4A 5IMKB 1KSRA 5KVGH 3KPQA 4LRNH 5F96H 4UIMB 2XWJA 1D5XA 4WI8A 4JZNA 5TFSL 1AGEA 1NAMB 1P6AB 4P48A 3WHXA 2LAAA 3MBEA 2DQTL 4GG6A 3HPJA 1M05A 3PWPE 1Q9LA 4N68A 3WDJA 1T04A 4GRMA 4GKSB 1L7IL 3FQXB 4BK5A 3H42H 3BPNB 2NXZD 1BIIA 3RX7A 4K8RH 5E70A 2EH8L 3MJ7B 1S7WA 4CVXA 1JZ2A 5EZLA 4NQVB 1B90A 5E94B 1Z9MA 1GPOH 3PWPA 3RVVD 2PETA 4G9DA 3FO0L 1AD0A 1CI5A 4K8RD 3WLWC 1N64H 4Z95H 4LEOB 2OL3A 1Q9KB 3GMMB 1JL8A 4BZYA 3FZUC 2BSSA 3O6FD 1IT9L 5DD5L 5KSBB 5HI3C 3QUYB 5CD5D 4ZNCD 4Z8FH 3SJVB 3HS0A 2AERT 4H1LA 1T6VN 1QNZH 2DD8H 1KIRB 5ESQB 4WUUE 4HJ0C 5IB2A 3WKMH 4D9LH 1SMOA 5TQ0L 3HNVL 5CJXA 3SDYL 4FA8A 1B4JH 2IQ9L 2OZ4A 4ZXBA 3QFDB 5C0BB 3WO4B 1SYSB 2HJKB 1KLGA 4WI7A 1OOAA 4CKVX 4F37F 4N0YH 1Y6KR 1OTTC 4F57H 3OBAA 5IW6A 1YMMB 2CDFB 2GITA 3DXAD 3U0PB 5IESH 3OXSA 4R3SA 5IB3B 1N6QL 2MPAL 5IROC 2WMPA 4HGMA 1JN6A 1JHKL 1HHIB 1CFNA 5C0EB 3GJFK 1S9XA 2E9BA 5F7EL 3L3HB 2G9HB 3PQYB 1WBXA 3MRMB 4LSUH 1D9KC 4J7RA 5EC1B 4EKXA 1AO7E 5D2NC 3V8OA 4PRDB 5D96B 3FTGA 3MRCA 1U9KA 3CFEA 3TEUA 1NKRA 4X6EA 2N4IA 4M48L 2CLZB 1K8DA 2EE3A 15C8H 4U1IB 2X1XR 5EU5B 4UAOC 3HKFA 3TPUB 1IC1A 3GSXB 5F7MC 4MD5B 5EU7E 5LCVH 1B0GA 2LU7A 3PXHA 4J6RL 1QBBA 4M7KH 2OJZH 4BZ1L 1QA9A 3PXJA 3BD5A 4ZFOB 2X5PA 3DHJA 1AO7A 2PXYD 1JMXA 1FFNA 1MPAL 3MA7A 4X6CE 4KZDH 4XP5L 2HYMA 4KMTL 4PJ5E 5CWSB 4JPWL 3REWA 3ZDZF 4FFWC 2EYSA 1I9RL 3LKNA 2OSLB 4FZ8L 3FFDB 1AGFA 4NZTH 4KPHL 4TSBL 3MLTA 3TZVD 4QWWC 3MO1B 4E9LA 3F7VA 5C09E 4OFYA 4WWKA 3OGOE 3PL6A 5E4EB 4KJPD 2FLBT 4M61A 4X6CA 5FGBA 4PJ5A 2YN3A 5AEAA 4ZUSB 5I2IA 1ES0A 2JCCB 1C5CL 2XZQL 3GBNH 3MV8D 6FABL 4RGMC 5JIPA 4LCWD 3MV01 1OB1A 2B4CC 3ULUF 1AQKH 4NZJA 4I77L 5C09A 3QUKA 3HUJF 4RQQB 1U8PB 2HA1A 5J11B 3PGFL 5HXMA 5GIRB 4YPJA 3V52H 5EO0A 4CNIB 1I3UA 2D7QA 2Q6WB 4YFEA 3KLDA 3HMXL 4OLXL 1KCRH 4Q0XL 2CRMA 2R2HA 4R7DB 3RNQB 3WFHA 4YHLL 2D9QB 4MAYA 4TUJA 2OM5A 4I4WA 4LVEA 3H9ZA 1MIML 5DUPH 4FQLL 2BHZA 1CLOH 2R23B 3ULVF 5C0CB 2F8XC 5C0FA 1JMZA 4OLVL 4TTDC 4H1LG 4JFFD 4MLSA 5EA0H 3FB5B 4ZS6C 3BMWA 4FQCH 3TIDB 4L8SB 5BXFA 2XNAA 4TNWK 5D8JL 3RGVD 3EOYG 3EOTL 2WWKO 1NCCH 5EZIH 5GZOC 4GRWE 2D7MA 5BJTA 4ZTOL 1C5DB 4TULL 1GAFL 4K2UL 2X70A 2KUTA 4QHMB 4IJ3B 1Q0YH 1NGZB 4QRQA 1RFDH 2DQIH 4ODXB 3LPGA 3L95A 1J1PL 4JN2B 5CGYD 4X7DC 4PTUA 2MQ3A 3V6OE 3IFOB 4QT5B 3U30B 2JB5H 2JK5A 1F3JB 3CVHL 4GG8B 1EHNA 4XWOD 4WFFE 3QUMA 1T03L 1BFSA 1ZOXA 4L4TB 4WY7H 1U42A 1NDGA 2CH8A 5E56A 3JV5A 5CHNB 5BOZG 1IKNC 3LEVH 4WJ5B 1IGJB 4BK4A 5IK3A 2AQ2A 3IVKB 1ZGLA 1NUNB 2BVUA 3BZFB 3HNSL 4OZHF 2ICEB 5HHVH 1M7XA 1VDGA 4NBYB 3U4EA 3QAZC 3AC0A 3O4LE 1QEWA 3B9KB 3QXVA 2XY2A 5C86A 3EJYD 1I7RB 2VZTA 1GXEA 3RJDA 4ENED 2F19H 3MXWL 5F1NA 2UV3A 2YPKA 3GMOA 2AI0H 4JB9L 5LAXA 4ELKA 1G9MH 1X5ZA 4TVPH 1N2RA 5D7LE 2APFA 4IIQB 3HMWH 3UPAA 1KLFA 1DBKL 2A77L 4ELME 1RIHH 3ROOB 2AJXH 1AE6L 3BAEL 4WFEE 1ZLVH 2YC1A 5DJCA 2V9TA 4QRRA 3O4LA 3N85H 3HR5A 4U6VH 5BS0B 3QDME 3CX5J 4TVPD 5EN2A 1CXKA 1AHWA 1J0ZA 2RBLA 3QUYD 4QHLB 1Y0LA 3SJVD 3OGCB 1U36A 3VI4F 1E27A 2V5SA 5BQ7B 1IGCH 3KJ6L 1RJYB 2CLVA 3HC0A 4OV6F 3VFMA 2YD2A 1EHLL 1JHTB 3IU3A 4NNPH 4QRTB 3HAEH 3WFEH 4I3GA 5I73B 3WN5C 3BESR 1RY7B 3PGCB 4PB0H 1RU9H 4M5ZH 4LCCC 2YS4A 5C0BD 1TXKA 3VH8B 3WIIL 1NMCB 4JJHA 3U7WL 3GMLA 3DGCR 2H8PB 3CH1A 1HZHL 3HG1E 5C1MB 3T4AA 4QXGL 2DDQL 1X5GA 1HHJB 1YMMD 1N5AB 2HN7A 1BX2A 1HDMA 5KVEL 5IB4B 3DRTB 1T0NB 4PJAE 3JVGA 2HG5A 3IDJA 5T1MB 1P1ZB 4KY1L 4JKMA 1QO3A 1U3YA 4UMGA 5D1ZC 4JDTH 4Y19E 1OD7A 1UM4H 4PJ7F 3KVQA 2Q86B 2J2ZA 32C2B 5FXCH 3VRIA 3PQYD 4W6WB 1ACYL 4YHYB 4NM4L 1FFOA 1CFSB 4Z7WE 3HG1A 1AH1A 3F7PC 2F8OA 3IFPB 3MLVH 1MCWW 1U8QA 4XVSL 4EDWH 1YPZE 2FX8H 4E5XA 4OCLC 4PJAA 1KXVC 5C0AA 4LPXA 4LOUD 2QQLL 5FA3A 3MUGB 1R5IB 3WMSA 1RZGA 4PYGA 3IFLL 3I9GH 3KPOA 4Z7WA 3NIDE 2NR6C 2NYYC 1D7FA 2HFFB 1MCHA 4G3YL 4NHUB 1YPZA 1K5NA 5CFHA 1T4KA 2DQJH 1HQRB 3B2VL 4GRLB 1KTRL 3VGAC 2OJEA 3BZ4A 3QDJE 1TVHA 1JNHB 4KMQA 1TZHA 1XIWA 2IANE 1KJ2B 1BOYA 2YEZA 5E8OB 4HGKC 5FUCE 2D7OA 1NCAL 3H9SA 1IM9A 3KPMA 3C8HA 1IBGL 1TJIH 2O5XL 3BUYB 9CGTA 4IRSA 5DK2B 5GSVA 5BV7H 1EBPA 4LNRA 4LHQB 4F3FB 4JM4H 3KPLA 3QDJA 1T66C 2CK0H 4RDQF 2UUDK 4GUPB 1A2YA 4YEFA 3MRLA 5KSUB 1CCZA 2MHAB 1U91A 4LP5A 4XBGA 1CLYH 1X5JA 1M7IA 2R1WB 1E4KA 5ACLA 2F53E 2AXFA 4N9GB 1EO5A 3INUL 1F02I 4RFOL 3S7GA 3V0WH 4IOIA 3UJJL 2J4WL 2ADJB 5C0JA 3QI9B 2LVEA 5LGKA 1HXMB 3DIFA 1RZKL 4XWGH 4DW2H 4KQ3L 3MRQB 2C4FU 3M07A 4XNZC 1RUMH 1Z5LA 2XTJB 3B9DA 3JV4A 4XAWH 3QEUA 3LKSB 5ABDE 2DF3A 4J4PA 3GKZA 1BQLH 2F53A 2XIDA 3ZE0E 4KDTC 1FO0B 3MRKA 3ALWA 5C0CD 3MV9E 1TVBA 2MWCA 1KN2L 1XGTA 3IJSB 2R2BB 3L7FA 1W72L 4R0LB 1I75A 1SBSH 1X44A 2NNAA 3DI3B 3UO1L 2VABA 2R8SL 2OXHA 3RX5A 5L88H 3VRLF 3SGJA 1NL0L 3OG4B 3IDNA 4HKJB 3IFNL 5DC4B 5LXGH 5HDBE 4KKCC 1H3GA 4P2OB 5FYLE 3IXTA 5T1LA 1MLCA 5FCSH 3RWEB 3MV9A 3BP6B 1ZLSH 4HZLA 5AD0B 3O3DA 3V5KB 5H35A 1N6UA 1FVCA 4ORGB 4D0DA 1FAKT 3MNWA 2KPNA 3VD9A 2VDOH 1E6OL 3BPCA 5FGCB 3U46A 3T2NH 5F9WC 3PJSA 2PO6A 1TQBC 2BRQA 2AXHA 2ICWA 3KYAA 2Y6SD 2WWKT 4LCUB 4L4TD 1EGJA 1I1YA 3UXFA 3EJJX 2LFGA 4ZFGH 2YUXA 5I1CH 3TWCL 5HHNB 2UWEB 3DRQA 4WEUD 3FJTA 4FOMA 3SDCB 4UT9L 5KOVC 5C92A 1OW0A 1HWHB 4X6DE 2Z31A 2CDGA 4PRNB 3SE3A 2YSSB 3B9KD 3E3QE 3KPNA 4Z6AT 1CDUA 1DQDL 1KCUH 4LRIA 4HKXA 3OKNA 4MWFA 4ERSH 3E6FA 1R3JA 3QNXB 5DD3H 3O2VH 5ICYA 3D39B 2VUOA 3MXVL 4WEMB 5D2LF 3CK0L 1BP3B 1OGTA 4K71C 4X6DA 5IHUH 3L3OB 1T21A 4XI5D 3KLSA 3SY0B 5BS0D 2I27N 3IDGA 4ETQB 4B5EA 1NFIB 3MUJA 4YDLC 1KPUB 4RIRA 2Q8BL 5J6GA 2GUOB 4GS7C 3MRBB 1JWMB 5ID0A 2BZDA 1IC5H 3GEWB 3MOQA 1GGIH 1KNOA 4JFOB 4OSUH 5EU6E 5CEZH 5FF6B 1MFEL 3LKOB 4U1JB 3ARTA 4NN6C 3VWKC 2OL3L 4D0BB 3ARPA 2FD6H 2Q76B 1I1CA 1QKZL 4RMWA 5BZWB 4AQ1B 3V7MA 2ID5A 3P4OB 4NFCA 1S7TA 3PGDB 4KK8C 3LQAL 4FQIH 5A2KH 5CEZD 4GAFB 4GH7B 1FN4A 5AUMA 4UOW0 5EU6A 5FUOH 5GGRB 1YEFH 4HV8B 2IEPA 3QEHB 3C08H 1J7VR 3JTSB 2G60H 4JPVL 3NTCL 4Y4FA 2NY6D 1AI1L 5I1HL 5H37G 2FJFB 1NEZA 4DKFH 2OZ4L 1I3GL 4GXVH 3R1GH 3D69A 5DJDA 3TNMA 4APQA 2G5BB 3DOSA 3EO1A 3EZJB 5K9KA 4XNMB 1FAIH 3PDGA 1ZHNB 3SE9H 4MAUL 3ZSSA 2XQYG 2YD6A 1PZ5B 5JO5A 1MJ7L 3DVNA 5DO2C 3MRNB 4OQTA 1INEH 2XY1A 4F15C 3GO1L 3B4NA 1DBJH 1QSVA 3KR3H 5CIPB 1OHQA 3QDGB 4NRZA 5E5UB 1Q1JH 1TDQA 1IKFH 4LSDA 1CE1H 1UB6B 5ICXA 1KIQA 5HYFA 4LQFL 2P8LA 4GRLD 3GFUA 1QQDB 5LQBL 3KPSB 4L8CB 1YEJH 4AEIL 4MA7H 3FO1B 4N9OB 1S7RB 4I5BB 2R69H 4ODSL 4AK1A 3MA9L 5D4QA 3BPLC 4HIXL 5AZEL 3DNKA 4DGVH 1AY1H 1GRWA 2AEIT 3STLB 1LGVA 3SDDA 4U0RB 5EFIA 2MJWA 5MP6L 1IZJA 5CSGA 1W0VB 4PJ9A 4IOFD 4LLYB 2IGFH 1WBYA 2P1YA 5I8KL 4OF0A 2N1KA 3MROA 4IS6A 3B3IA 4WV1B 5E9DA 3QA3A 1DVFC 1KFAL 4HF5H 4HIEA 1KOAA 1Y6MR 1CDJA 4KUCF 1P2CA 5EO9B 1FVDB 1ORSB 5TDNB 3TO4A 1IC4L 1HILA 5HYJE 2PYFB 1JPGA 5HGAB 2BCKB 1RK1A 3QIUC 1UYWL 3QI9D 1JWUB 4KZEH 1CTOA 4BQBA 3EOAB 1RZKC 3EO0A 3EYQC 3TESA 5GS0L 5HGDA 2HP4A 2EXYC 2XACC 2XTJD 1T89C 5DD6A 2VR9A 4PUBH 4JJ5B 3GI9H 5SV3A 2Z8WC 4HUXB 4A6YB 2ZCKL 2W1NA 4OLUL 3ALPA 1F11A 4UT7H 4FTVE 1A7QL 4RFEA 3TA3C 3P9MB 5EUOF 4WFGE 2DI7A 2Z8RA 1NGWA 1W0WA 5CZKA 2FBJH 3C2AH 2Y07L 5CMAA 3VXNA 5C8JB 1V7NL 2EE2A 4LL9A 4LSTL 2VLJA 4CL7A 4IHOB 4P2OD 3NZHL 2AV7B 2GK0B 3O2WL 4PGZA 2PYEB 2COQA 5TE6H 4LBEA 4X5XA 4ISVA 3ARQA 2AEQH 1BOGA 4MA3B 4FTVA 3B5GA 3RWDB 4U3HA 3SGKA 4CMMB 4Z7VB 1T2QH 3GUTB 4OTXL 3BQUB 5EO1A 3DUSA 3MYJB 4F58L 1BQSA 1S9YB 2E8ZA 3FKUS 3WJLC 2WAHA 4HPYH 4AENB 2Z92A 2OX5A 3EYSH 4HAGA 3GSNA 1U58B 4NZDA 3ILPA 4MNGE 3SKNB 5C6WH 3WS6A 3FQUB 3OXRA 3PV6B 1A6PA 3SDCD 2A9NH 2VERN 3V2AR 2AGJH 3TNNA 5GRWA 1BBJA 2MMXA 1IGTB 2XZCH 3QG6B 4NJAH 3NPSB 4YWGL 5IR1B 2VDKH 2PW1B 2H2PD 4CRPA 1WWCA 4N8VG 4WW2B 2FIRT 4ZUWB 5B4MC 4WGVB 3MBEC 5EOTA 3STBA 4X9IA 2WM0A 3D39D 4MNGA 3U9PL 1TZIB 1X4YA 1KENH 2BNQB 2ZJSH 4ONHB 5HYSA 5A16B 1H8OA 1NLBL 1K4CB 1ZT1A 4DVBA 3O41B 4BKLB 3ZKNC 3QCUL 3KWWB 2EDKA 3GSOA 4CU7A 2FGZA 4PJHB 4YHOH 3GSRB 3TC9A 1UXSB 1VEPA 5FCUH 1NMAH 1QTYT 1Y18B 1LDSA 2HLAB 1TETH 1QFWL 5DRZA 3O3EA 1U8JB 1C7TA 3HI1A 2XN9A 4CDHA 4XGZA 1T7VA 3BDBA 5DHVH 3NVQA 3VXRA 1RK0B 3BKJL 3UYRH 3RUGA 1FNEB 5E1AB 1YMHB 4HIJB 3BYTA 3ZE1E 4S2SA 4O2FB 4X9BA 1M71B 5DTFA 2XKNB 4KKBD 4M62H 2XA8L 4JQIL 3D0VA 4P3DA 2EE6A 1T0MA 1G9NH 5FUZH 1C1EL 1FBIH 2ADIB 1HHGA 3LQAC 4L3AA 5GRVL 5CLWA 3WFBH 2IALA 3ZL4H 1WFNA 4R2GC 2VWEC 3QWOA 1DQJB 4ZYKA 1QYGL 3FMGH 4MSWA 4Z76B 1TJGH 3ARBA 4PV9A 1XGYH 3KGRA 4Y8AA 3ARWA 3ES6B 4HC1A 5CJXC 3JTTB 1G1YA 5K59E 1VFUA 5GRJH 2D7TH 4FMFA 1J8HB 2F58L 3KPTA 4XP9H 5KJRH 1LP9A 2VQTA 3D3VD 5JOEA 5IVXE 3O11A 2IQAA 4M8QA 1VFAB 2VDNH 4M7JH 4XCFL 4QRUA 2E3VA 2Y7QA 1N26A 5I75C 5JDSB 4XHJC 5AZ2L 4QRSA 4PJEE 4L3EA 1VADB 5FYKU 2VISB 1S9WB 5E0QA 1T0PB 1CK0H 1ZHLA 4JN1L 5EZOH 5IVXA 1ZMYA 1I9JL 3QDGD 2HT4D 5MHSD 3ABZA 2Z8SA 3G04A 3HZYA 4JY5L 4GW4B 2AJZA 1QFHA 2ZSWA 3KPSD 1IAIL 4IMKA 5BZDA 1NC2A 5EUKB 1PG7H 3DX6B 3PDDA 1J1OH 2C1PB 3LH2L 1AKJA 3O6LH 3MLWL 1HXYA 4NZUL 3MRPB 1B9ZA 5HGHA 4O5LL 1QBAA 3JUYA 5FM5O 1MHHA 2ZUYA 4XC1L 4LPWA 4YHPB 2ZCLL 4HUVA 2GIYA 5EU7C 5JLZA 4G6MH 1KPRB 4OZ4B 3MRRA 3IS0X 3SE4A 5DJAB 3E1F1 3VXSB 4LSVL 1I7ZB 2XXMB 4WWKC 3PL6C 3PP4H 4JFYA 3OF6A 1VACA 5FGBC 5GS0C 1X6NA 3GMRA 3V9FA 3P4LA 5SX4I 4MXQC 1JZ7A 2ARJA 3MRGB 4HWUA 5SWZA 3CC5A 3S88L 1MFBL 3DYOA 5C08E 4KHTL 1HEZA 1LDPL 3ZLQC 2GCYA 4NSKA 1JFQH 1D5BB 3W0WD 4L9LB 4UAOB 4OZFG 4POZC 2H2SD 4XT1C 3ZDXE 4JREC 3H3PL 5F89B 3FRUA 2R1YB 2BJMH 3AU1A 2O93L 4F33B 4M5YH 1A1MB 4ZPTB 4LLMB 1KXTB 1HSBB 3OZ9H 5C08A 3CFDA 4F7CA 3D25A 2OR9L 5SWQB 4MAYC 4UIKL 1IMHC 3BGFC 4DK3A 4HS8L 43C9B 2PYED 2BVOA 3HZKA 3LKPA 5KN5A 1K8IA 4LF3A 3EYOA 4WU5B 4TQEL 5FK9B 3CFKA 1M6OA 3BQUD 3L6FB 2FEDD 4KRNA 3O3AB 2NCMA 3HNTH 4F9PA 5L9DL 1XF5A 5CEYA 3CFIC 4ZUUA 1OF2A 4Y16B 4AG4H 2R0ZL 5TDPA 1EZVY 1FLTX 2IF7A 4HWEL 4U6TA 4DUXA 1IGML 2JCCF 3DYPA 2HLFD 3S37H 4D8PB 4RGMB 1BD2B 3O8XB 4L3CB 4AQOA 2DQGH 3GHBH 5CBEA 3S36L 5IJVB 1ZHKB 4KK5C 3NCFB 4I0PA 2J7LA 4OI8A 1V8HA 3ZKXB 3AVEA 1URLA 2DBLH 3QXAA 4OLYL 3GI8H 1BQHB 1RJLA 4JY4B 4JY6A 1YA5A 1XGUA 2APXA 5JQ6L 2X7LB 5FYLL 3FN0H 2R0KH 3BP5B 4AMKL 1IAKA 4PY8J 2BNQD 2AQ3A 1S7SA 2MQ0A 2W65B 3V6OC 1MHCA 1XEDA 4XTRC 4YHKL 5C7XL 3SDAA 1A4JB 4QOKE 3WL9A 1A6AB 2CIKA 1CD1B 4TSAH 2CIIB 4YHIA 3CCHB 4PRIB 2ITDA 4ZUTA 1BFVH 3AM8A 4PRPE 3D18B 3PHSA 4ONOA 2X1QA 4AM0A 4JFXB 4R26L 4KRMB 3P3YA 4N8PA 1LK2B 4G42B 1P7KB 4LPVA 4Y4KA 1PQZB 1ETZB 4URTB 1WIPA 3MGOA 3M1BA 3NCJH 1UKSA 3FAWA 1BVLA 4DUVA 1T1WA 3G6JF 3MFFB 1BAFL 5HY9A 5IUSA 1JZ3A 4FQHA 1IILE 4PRPA 3X3FH 5F1IA 3VU2A 1EPFA 2EDJA 2X4SB 4M03A 2VDRL 4G8EB 5BRZE 3WNPA 2A1WH 5F88B 2D4DA 5JDJA 3UTPD 1A21A 1J8HD 1UZ8B 4RA3A 3S3JA 2YZ1A 2C26A 3P73B 4YGVA 3TH4T 1D5IL 2MCG1 4UILL 1KULA 3IKCB 4V2CB 4M00A 1FZOB 4JFPA 1KC5H 4J2XA 4CJ1A 2VLLB 5DJ0A 2V5RA 2WLZA 3N9GH 1AP2B 5BRZA 1CD9B 1LEKB 4L29B 3JVGC 3C5JB 1VFMA 3GSWA 4EUPH 2GSIB 1MCPL 1AFVH 1OD9A 2EDYA 3NN8B 4U1HB 1OCWL 2OS7A 4PREB 4DUWA 5IG7A 1A6UH 1GZPB 4YHMH 2HKFL 5CAYB 5JQHC 2R4RH 2Z93A 5JW3H 5E08H 1J0HA 1FZJA 1JP5A 3QQ3B 3NMEA 4PJ8A 3S36X 1VFOA 3B2UC 4Z0BH 1XCTB 5D6CB 3HI6H 2BNUB 5DMKA 5GGTA 5HHXL 4JO3H 5DVMA 4OT1L 1YNLL 3CX5K 4PJCE 5CZVH 4OQTL 3L9RB 1C5BH 2MQCA 4HJ0D 1F90H 3FFCE 3WN5B 2NZ9C 4YAQB 1FDLL 1DLHA 1YY9D 4YXKH 4BJLA 5KS9F 1VSCA 1E0OB 3QG7L 2UUDH 7FABL 1ZTXH 3IJYA 4P57B 1VENA 4PG2A 4FQJL 3TIEB 1BJ1J 4PJCA 4EI5B 1DTUA 3GSUB 3ARYA 3VXSD 1JZ8A 3FFCA 4DCQB 1Q72L 5I76B 3BPOC 4XCNB 2XWTB 1OSPH 2MKWA 3GNMH 3L5WA 4MXVE 4YLQT 1AJ7L 4QKXB 1CFQB 5DMGD 2X9XA 1CG9B 2WBJC 1AXIB 1KCVH 5FUCC 3TH2T 4JGUA 1E4KC 1NFDB 2LQRA 4EBQH 5F9JB 1JF1B 1QSFB 4U1LB 5GZNC 2QADC 3D1MC 4N90E 1KYOJ 5B38B 2G2RA 3FHQA 5T5FH 4I3RL 1T7YA 2FWOA 4NNYA 4XP1L 3GMNA 3PWJB 1HSAA 4J4PC 4RFNC 3K7UA 3T0EB 4MA1C 5DC0A 3VGAB 4XP4H 3MV7E 1A6VL 4FFWD 3QQ9C 1MHPH 3LN4A 1P5VA 1TVDA 4HXBH 3QR2A 4CUCA 4NP4L 4G9FB 4QWWD 4QYOA 2EKSA 2QHLA 2CGRL 1P4LB 1FYTE 3IYLW 2BDNL 4N0CC 2B4CH 4MNHA 2PTTB 3SGJC 4U31A 5JXAH 3ZKQD 4Y16D 5ICZB 3BWAB 3JV6B 1BF8A 2FSEB 3S8WA 5J57B 3MV7A 3S35L 2NY4C 5KVFH 1JNLH 1ZGLM 4NWTH 5E1HB 3TO2A 4OLWH 3O8XD 3L1OH 4HAFA 3WNNA 1J11A 3SCMA 1AGBA 4NM8L 1QFWM 2J8UB 5IF0A 2NY7L 1EV2E 3JV0A 1FYTA 4NQCB 3S4SG 3ARFB 2PO6C 4DFHA 1J0JA 2BXZA 3PWNA 3UAJC 3P9WB 4KKLC 1DN0B 2ZUSA 4Q9QH 4PY7B 3NCMA 2R4SH 2OP4L 3GSVB 1IEBA 2DLFL 4P9HL 2XPGA 3GSNL 4HG4J 4MQXC 5ADOL 4WDIB 2JIXD 4Z7NF 2HTLC 4WTZA 1GYAA 1F8TL 1J0KA 1OW0C 4E0RA 2Z31C 2ZSVA 3SE3C 3FT2B 2YZ8A 4PFEA 3MCLL 1YN7B 1U8MA 3AS0A 1A64A 4Y5YB 4LRIC 3VFNB 4PRID 4ZS6D 1ITBB 2FO4B 5KG9A 4MX7A 1H3PL 4GQ9L 5GZOD 4O2EB 1G7LA 5INDA 3CSYB 2EDWA 4NRXB 3TBYB 1I4FB 3CZFA 5DVOA 5TFSH 3CFBB 3HAEG 3VFRB 4XH2B 3E3QC 2GTZB 1QLRA 1OVZA 2WIIB 4KRLB 2DQTH 3AGVA 1I1FB 3MLYL 2VYRE 3UTSB 3BXNA 1AC6A 5IMOB 2Z8VC 3U0WL 3RDTA 1YQ2A 2OI9B 4S10A 5F9WB 4BZ2L 3CVHB 1L7IH 1TQBB 3TBSB 5I1DB 4G6JL 2A74A 3RI5K 5LGJA 1UGNA 3PWUB 2EH8H 3VXQB 5DEGA 3BMVA 4O2CA 5CEXB 1TQCB 4HIHA 1HE7A 1LO4L 1UM6L 4R4NC 5FO7B 3BH8A 3PWLB 3RWJA 3R06A 3V7AE 3HE7A 3FO0H 3O6ML 1N59A 3VRJA 4QF1A 4LSRL 1EEYA 1UB5A 3TF7C 5JPMB 3MGTB 2P8PB 1XR9B 4X98B 5DD5H 3TBWA 5C9JB 5EIIA 5E2VL 4NJ9L 4HCRL 3OHXB 4GW5A 2H1PH 2FB4H 2FEEL 1DSFL 2HJFB 1KXQE 1JF6A 1HQ4A 1F45A 5HHMB 3VXOA 4H0IA 1PD6A 2O5YH 2DL9A 3MC0A 5E8PA 3VFSA 5TQ0H 5ISZE 4NQDA 3HNVH 3SDYH 5E2JA 5I1AA 2IQ9H 1Z3GL 1MY7A 3QUZB 1MHEB 4FQXC 3ZTNL 4OJFL 2XOTA 4AEHL 4DEPB 1T7XA 4C55A 5GRVK 1A6ZB 4P4KC 4X0KA 1IGFL 4M4PA 5C0NC 1EXUB 2BNRE 4NFDA 3AROA 1YNTB 4NN6B 5B21A 5ISZA 2FECL 4XPTL 1Q0XL 1JHKH 1X5AA 3I6LD 2W59A 4EI5D 5F7EH 1BGXL 4UQ2B 3V4VL 3D0LB 4MMXC 2IH1B 1I7UB 1AIFB 1ONQB 2JB6A 1HCFX 4PBVC 5CKGA 4DN3L 1JYXA 4M1GL 4XVUC 3DI2B 3D85A 3LKRB 2BNRA 4M48H 1F6AA 4NKDB 3ZDZE 3SDDC 5F7NC 3S98A 4JQXA 3QXDB 4PJ9C 4ZQKB 4Y89A 3OJDA 4LHUB 1FSKC 2C3VB 4W70A 5BVJB 1ACZA 4J6RH 3RWIB 2GFBB 3BISA 4WTZG 2NPLX 4BZ1H 4HX1A 5D72L 4OZGB 5J6HB 2W9LA 4BSWA 4D9QE 4NYLA 2XXCB 4RNRB 4WVRA 2V5MA 3HRPA 2DYPD 5HVWA 1H8NA 5K9OB 3TYGL 4FS0A 1MPAH 1DN2A 3TO4C 3KJ4C 1QSFD 4XP5H 3U7AA 4PPTA 4KMTH 1NBQA 3LD8B 4J8RA 3X14B 3F12B 4U1MA 5H94A 1VB9A 1WTLA 1EK3A 3RPIB 5IIEA 3ULUE 1P9MA 4YDIL 3TN0A 4F15B 2J12B 4GKNA 4XVTL 2IAMC 4KPHH 3HUJE 1I1AA 1CICC 2YPVL 3T0ED 5I30L 3ARDA 3SKJL 4KKAC 5FEBA 2ZCHH 3GK8L 5L2KE 1NCDL 1A9BA 2H32A 1HIML 1UH3A 3FB7B 4MCYB 2D31A 3I3BA 1C5CH 3STZB 1T6WA 2XZQH 4Z5RB 3BPLB 4G9FD 5IFHH 4LFHG 6FABH 3QEQE 4GAYB 4XCEB 3IDYC 5I18L 3HUJA 3T04D 5C0IA 4MHHG 3ULVE 4BFGA 3LPFA 5HTSA 1HOCB 3TT3L 5DFVC 1N3NA 3HPLB 4P23B 3PGFH 2X4UB 3DURB 5J12C 5B8CB 4TVSa 5L2KA 2VXTL 1NCNA 1JPFB 2IMNA 3F7QA 4RAVB 4U6XA 5DHYA 1UACL 4LVOC 3HMXH 4JPIA 4OLXH 4Q0XH 3X12A 3VXPA 5KSVB 3QEQA 2E7MA 4HZAA 3SGKC 4NQCD 3S6CA 4U1KA 3ARFD 4U7MA 1YEKH 3T4YA 1RUAH 5E2TL 1MIMH 4OGAC 4FQLH 5JHDB 3MPCA 4Y88A 4GBXA 3BGMB 2YOCA 1TZGH 2DB8A 1GVIA 4OLVH 5HYEA 4P9HC 5DEFB 1QRNE 4YDJA 3KYNA 3WS6C 3QO1B 4D2NA 1YNKL 3EOTH 4W6YB 1S5IL 1G6RB 4P5KB 1EEUA 1JGUL 4ZTOH 4ZO7A 3U6RA 4TULH 1GAFH 4K2UH 4EN3A 2GJZA 4CMHC 5ACMA 3L3KB 1W72B 4Q58C 4OZHE 1LNUA 1J1PH 1QRNA 4GOSA 4POUB 3P77A 2X4OA 2FH6A 2BVQA 4NQSB 1A7RL 3H7BB 3E0GA 4AH2B 4L8DA 4KKCD 3CVHH 5DR5L 1N7ML 1SM3L 5F72S 1T03H 4POYA 1OQOA 2Y4SA 4FFVC 5JOPD 5HHQA 3K3QA 3GIVA 4K7FA 4ZO9A 1MQ8A 3GGWB 4HK0A 2CKBB 4PRAA 3UTSD 1BBDH 2DN7A 2R15A 2HTKD 2G75B 4OZHA 3MOBL 4LLWA 1HH6A 3HNSH 1JI1A 4Q74A 2WK2A 1BLNA 1JV5A 1WVZA 3CUPA 3ROLB 5LG1A 1QPXA 2MNUA 2AJVL 4OBRA 4OZIB 3AXLA 5F1OB 3LN5B 3QO0B 3VI4E 1KTLB 4XRCA 1VEMA 1JPSL 3MXWH 4I0KA 4JB9H 1CGSL 1ZWIA 3KXFB 12E8L 4JRYB 5ITFA 1CQYA 1OLZA 2EIZA 1DBKH 2A77H 3BAEH 1AE6H 3KPQB 1BFTA 4P3CH 2XRAL 2C7UA 5D1XA 2DWEB 2FHFA 3TBVA 1D5XB 3VW3L 4AIXA 3ARBC 4YK4C 3OWEA 3WHXB 3MBEB 3QSKB 4P46C 3DV6A 5I66A 4GG6B 3HPJB 1M05B 1F13A 2DMBA 1KJVA 1Q9LB 3HE6C 2F54B 3UZQA 4HDIA 2D0GA 5DC9B 2DKUA 1EHLH 3SO5A 3CZJA 1JK8A 1H15B 1NUFA 1T04B 2PCPA 4XPFL 5HHMD 4UZGA 1NCTA 3BSZH 1A6WL 1BIIB 4PJGB 2CD0A 4YDVA 4PJ7E 4P2QE 3U9UA 4FMKA 4HMCA 1MF2L 1S7WB 3P4NA 3RAJH 4I8DA 2A6KB 4KKNA 3HC4L 2UZIL 4O9HL 5EZLB 4S11A 3WIIH 3MCG1 3QUZD 3PWPB 3VFWA 2BY3A 4PGDA 5J0BA 1FJ1A 5DHXB 5GXBB 4G9DB 3PHQA 1HZHH 4S1SL 5HHPB 4YEEA 1U8LA 4M93C 1AQDA 2QSTA 2DQCL 4YBLC 4WI2A 5KVEH 3ELAT 4B41A 4R90L 2BSSB 2VJXA 4KY1H 1FV1B 1CXLA 5MI0B 3THML 4WTXA 3TGXA 1KEML 1YQVL 3PF2A 5I8CB 4X7CC 3HS0B 4H8WL 4IMKC 5GGTL 4H1LB 1ACYH 4NM4H 5JIKA 1BEYL 3ZMRA 1PKQA 5DMIL 3RTQA 3FOMA 4XVSH 4GMTL 2DQFB 3WNMA 1I8KB 5IB2B 5GSRA 1HH9B 1UWXK 4C54A 1KG0A 2P7TB 4C83A 4JQVC 4ZXBB 2QQLH 1DUZA 4LHUD 4XAKE 1EERB 1QR1A 3IFLH 3IXAA 2A73A 1RUPH 1MCOL 1WIUA 2EIBA 4ELMF 1QLEL 5IW6B 3KPPB 2GITB 3GJFA 3KPRB 4KMLB 4UV4L 3SE4C 4G3YH 5I75B 5J4MA 3DUUB 3OXSB 4XCCL 4R3SB 2NY0B 3B2VH 4F2MA 3GSQA 1GCFA 3BJ91 5HI5D 2A9ML 3BIKB 1CFNB 3QZWA 3OL2A 1KTKE 5ACZB 4JHWL 2B5IB 3EYUH 4P5TA 5HYIA 1NFKA 1NCAH 5E6YA 2IWGA 4FG6D 3FTGB 4MS8C 3S3PA 3CFEB 1IBGH 2O5XH 2UY7A 3G08A 3M17A 3WSQL 1U93B 4IDJL 1U8HA 1LE9A 2X10A 1NDMB 1PX3A 3L7EB 5DDHA 3JWDL 2R2EA 4FXKA 4QHUA 4KDWA 2V5YA 4JO1L 1B0GB 3QBTB 5I1JL 1T22A 4GLRI 5T3ZE 2Q8AL 4PBWD 3T65A 3VFVA 1FFNB 5MEQA 3INUH 3MA7B 5ESVA 4QNPF 4RFOH 4P23D 3FOLA 3UJJH 1LEIA 2J4WH 1FCGA 2C3GA 3REWB 1RZKH 2EYSB 4L4VE 3B83A 1SVZA 4KQ3H 2ADFL 3LKNB 3MLPA 1EFXB 3VRLE 3I3DA 2ZUWA 3MLSL 5KAQG 4RRPG 4YXHL 3MLTB 4NT6A 5L0QB 3F7VB 2YKLL 5DK0B 3AS2A 4KU1A 2EYTA 3PL6B 2R29L 5JHDD 4FP8L 4M61B 4F9PC 4PJ5B 3EYQD 1OPGL 5A2FA 1KN2H 3RKPA 2EXYD 3O81A 3G6DL 4L4VA 1W72H