4TVPL

Crystal structure of the hiv-1 bg505 sosip.664 env trimer ectodomain, comprising atomic-level definition of pre-fusion gp120 and gp41, in complex with human antibodies pgt122 and 35o22
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
210
structure length
210
Chain Sequence
APTFVSVAPGQTARITCGEESLGSRSVIWYQQRPGQAPSLIIYNNNDRPSGIPDRFSGSPGSTFGTTATLTITSVEAGDEADYYCHIWDSRRPTNWVFGEGTTLIVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Structure and immune recognition of trimeric pre-fusion HIV-1 Env.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 37
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2014-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpL01
2E9WA 3ALWA 3EIFA 3QIBC 3HS0B 4HZLB 3V5DB 4DFIA 1JF5A 3FCTB 2FX7L 3KDMB 4TVPE 1P5VA 1DDHB 2IPKB 4GQPH 3HLAA 3S97C 2NY4B 4WUUD 3W11D 3T4AA 4D8PA 4PLNC 3TH4T 5JXED 3QO0A 4LEXL 3J8F7 3MLYL 1T5XB 5T1DH 1XCTA 4MSWA 4NWTL 3KHOA 3RIFF 4UV7L 2W60B 2FL5A 3MODH 1A6AA 1ADQH 1B0WA 4L4JA 5HPMB 4OV5A 4NZUH 3KS0H 1CXKA 1FPTL 5KSAD 4UZGA 1HXYA 3QUYA 5B8CB 2IF7A 4QXUH 2FLBT 3Q5TA 4TQEL 4AL8H 1UENA 4WTXA 5MEPB 4P5TA 3NIFF 3BQUA 1FG2B 3IF1B 2JLLA 3C6LB 2AK4D 5L9DL 4KHTH 2FLRT 1F4XH 4HF5H 3TBSB 3EFDL 5CJQH 3UCRA 2CDEA 5D7IE 2LU7A 2IQAB 5DUMH 4XWGL 4WU7B 1HXMB 5D1XD 5BVPH 1A14H 2AABL 2EKSA 2O61B 1G7QA 3TBWB 3TNNA 3O6ML 3VRLE 3L9RA 4WUUB 2AJSH 4I4WA 3D5OF 4XC3H 4ZYKB 3QHFL 4XGZA 3ZTJG 1T20A 4JG1H 5JORB 5CJXA 5C0EB 3TBVB 4DAGH 3MFGB 4Y5XC 2ESVE 1VHPA 5A2JH 3LQAL 3IGAA 1A6PA 3ULUH 4QRRD 1HHJB 2FJFA 4NGHL 3CDFA 4LSSL 5HDBE 4JKKA 2J5LC 3LEVH 4GQ9H 5A40E 4L5FH 4UTAH 4BZ1H 1HK6A 4NSKB 2KQMA 5IJKC 1MPAH 3MUGA 4NM8L 1NFIA 2B2XH 3BDYH 4H1LB 5L7XH 4GFTB 3P4NB 2YSSA 3WIIH 2M26A 3M17A 1H3PL 4MHHG 3VFPA 4EVNA 4JAMA 2Y36H 5F89B 4ODUB 3C5SA 5BQ7B 3MV7D 1A4KB 3Q2CA 1B0GA 4LCYB 4LDOB 2P5WD 4DKDC 4UQ3B 3LZFH 3NFNA 5HDQL 1HYRC 5FV2A 1CI5A 4HK0A 2OYPA 1UB5B 4OI9A 1QFWI 1N5YH 2A0LD 3QIBB 3LHPL 1OL0A 3WXVL 2F5BL 1FQ9C 4Z7WF 1KLGA 1JZ4A 2LV4A 5HHVH 3O45B 1D5MB 1B0RB 2EE2A 1JZ2A 3QDJD 1RULH 1R5VB 3OKEB 4FFVD 4O5LH 5LJYH 3DV4B 3I84A 5FGBC 3T3ME 4ERSL 3KPPB 5FECA 1VEMA 1AHWC 4ZFOA 1U8MA 7FABL 4MJ5A 5IESL 3WIHH 3O6FA 4B0MM 1EK3A 1BBDH 1WWBX 2GFBB 4X5LA 1DL7L 2B1HH 4WU5A 3VE0B 1QRND 3QIWD 5SWZA 4NZRL 4HWBL 3QI9C 3L3IB 4JKPL 1BAFH 4N0CC 1ZT7A 2QSTA 5GGRA 3MLWH 3ZDYE 3ARBA 5LGHL 2FBOJ 3ARSA 3QQ3A 2WBJC 3D9AL 2BNRE 1CGTA 1I1YB 1UKTA 4KMLB 2CIKB 4JRXA 3SDYL 4H8WC 2J4WL 4HZAA 1FAIH 2OCFD 3Q6FA 5C70A 4K3EL 1B4JH 3NH7H 3DO7B 2M1KA 3HB3C 4F7EB 5E8EA 4HS8H 4MCYA 4M5ZH 4PGCA 1E4WH 1TETL 5BOZG 3RZWA 3Q1SL 2DQIH 4R8WL 4JRWA 3ZYJA 3QUXA 5KN5A 3TEUA 3UTZB 4Y5XB 4URTB 1KJ2B 1ONQB 3RIAF 3VXQA 4P2RB 4XNXL 4LSTH 3UJJH 2MOVA 5HYFA 2HRPH 2ARJQ 3JXAA 4LOUC 5I1LA 4GRMB 4NOBA 3HRZA 1Z3GL 5E08L 2J5LB 4PRAB 1FFPA 3ZTNL 2X4TA 4P99A 4WWKA 2XWTA 3G6JB 5DD0H 4WENB 1LP9B 3MNZA 1IKNC 3V5HB 4FFZH 3HUJE 5I8EB 1SEQL 3NBNA 3UPCA 4GMTH 4D3CH 4HGKC 5JHLL 4QCIB 2OLDA 5I1JL 4IMKA 2MMXA 1QLFB 1UM4H 4E5XA 5IHUH 5FM8A 1UH3A 3TYFA 2QSVA 1KBGL 1IQWL 1ETZA 3T2NL 4C57C 1TITA 1RZ8B 2QBWA 3H3PL 4ODWA 4QYOB 1MFDH 1QSFA 2WBJD 2K1MA 5L2KD 4JFOA 4JDVA 2GIYA 2PXYC 4GO6B 4NRXB 4G8GD 5DK0B 1QBMH 3ARPA 4DTGL 4L8BB 3KPRE 4JFHE 2HTLC 4NIKB 5J6GB 5HGDB 4ETQB 1J7VR 2P43B 4EI5A 1KCUL 2EDDA 4EQ2A 2C9AA 2R4RH 3LEYH 4GXUN 3MRKB 1UEMA 4HWZA 3MLSL 1KLUB 1RJZB 1Y0LB 3FO2A 4KHXH 5TE6L 3S3JA 5IF0A 2YN5A 1AHWB 4HUVB 1RHFA 3FN0H 4AIOA 4K3JL 1BPVA 3VGBA 4PJCE 1NCBL 4MQXD 1F8TL 3DVGB 2PYFA 3D39D 3B9KA 4UV4L 4MNQA 1UCTA 2A77H 4YZFE 4QTIL 1N2RA 3QI9B 4HIIB 2DB8A 4QGTA 1KENL 5HHXL 4FQ2L 4XPTH 1U8QA 5KVDL 4XRCA 3O6KH 1QSED 4YHNA 3NA9L 4RWYH 4LPYA 5TGBB 4L1HA 1S7VB 3SCMD 3VW3H 3IVKB 3C6SA 2I25N 1U91B 2A1WL 1KIQA 4JVWA 2WBJB 2FWOB 5MEQB 1VFBA 2XZAH 2BSRB 4PJFE 4NO2A 3QFDB 3K4DA 1F90H 4V2BA 2KZ1B 3D3VD 1UXWB 5K59E 4KK8D 2WLYA 2DD8H 3KPOB 3T0ED 4M7KH 4I3SL 1UWEH 5HGAA 3RQ3A 4G80A 1DVFD 4WTZA 3HN3A 3PWVB 1HNGA 4Z5RB 5C0CA 2VDOH 1U8PB 5FUZL 1R3JB 4I5BB 5D7JD 5J9PA 3BEVA 2AI0L 5CLTA 2DTMH 5MEND 1HYSC 3BXNA 4OGYH 1WIUA 3OGCA 3PV6B 1XZ0A 4B50A 3GMLB 2J7LA 2DLHA 2DQEL 1YEIL 2DQHL 1P2CA 1FNEB 5DMGD 4A6YL 4FNLL 3PL6C 2HTLD 1G7HA 4ZPTA 2XG5A 2YPLD 5LBSH 1TTFA 5J6HB 4KC3B 2C3VA 2X1XR 3DNKA 4JVUA 1OT2A 2MCPL 2MPAL 4YDLC 1QSEB 4JN2B 3RJQB 3VGGA 4AK1A 4BM7A 5DQJA 2XYCA 3HNSH 4JO2L 5EUOB 3UTTB 1A3QA 4DN3L 4CNIB 3CLFH 4KK6D 4D0DA 4K07A 4HIHA 3NCEB 5JA8B 2HKFH 3ARGD 1EAPB 1JGVL 3EJYC 2F54D 3C9NA 1KIUA 1A6TB 3TT3H 2Y1VA 5GJSL 3D85A 3P73B 4MDJA 1P4LA 1UACL 3DYMA 5EA0L 1M6OA 3QCVH 4U33A 3W5MA 1WBYA 4L9LA 3JSSA 3MRQA 1Q1JH 4QOKD 4F2MA 5J57B 4PJGA 1MRDH 3SE8L 2CXGA 2NY3C 2FHCA 1NMBL 1MI5E 5JIHA 4ZUVA 4X9GA 2FIKA 3EO9L 1MFAH 2H45A 4EDWH 4P59H 5HY9B 1DBAH 4Z95L 2PXYB 4M9OA 4OZGF 5SWSB 1P7QD 4YXHH 1LK3L 4P23C 5IVXE 4Y4FA 4PJHB 4EN3C 1QA9B 4WW2C 3GI8H 1KELL 5C2BL 4UAOC 2BRRH 3U46B 1IKFL 4EIGB 4C59B 1BQSA 3D0LB 5FA3A 4UOW1 2IANA 5CILL 3SKMB 4OZIB 5KVGH 4OQTA 2JK5A 3GO1H 3NABL 4DGYL 1BZ7B 4AT6B 3P3YA 4K8RD 2F54B 3RY5A 3N9GH 1FIGL 5I1IL 2R0KL 3JTSA 4RGMC 3RKDC 2B4CC 3GNMH 5AG8A 4K3DH 2YKLH 2XFXB 5EBMA 1CLZH 3HC0A 2P8MB 3BN9D 4FQQB 5HGBB 1RJYB 5F9AC 3RL1B 3MCLH 1CE6A 1NGPH 3LKRA 1RIHL 5D8JL 3VFWA 1S7SA 2NY1D 5TE7H 2Q76B 1CCZA 2XZCH 3JV0A 1M7XA 1NCDH 1QACA 4H20H 2YD3A 3MRJB 2W9DL 3JZ7A 4OZHA 1XT5A 1XMWA 3NFPB 1BVKB 3WUWG 3LPFA 3O41A 3S36L 1DZBA 2LAAA 4ONGL 1WFOA 5C2UB 5FOBA 3PQYA 2Q87A 4OUUA 1JF1B 1U3HA 5C0BA 4D94A 3SDXE 4ZUSA 4XPHH 3RL2B 4TUKL 1BEYH 1T1WB 2W9EH 1MY5A 4DVBB 3BPOC 1I9RH 3DRTB 4PJ8C 3UXFA 4LPVA 1OGAD 4WFFD 4FTVE 5IM7B 3ETBF 2J88L 3WUZA 5TQ0L 4ORGA 5GS3A 2HJKB 4OCWH 1JPFB 3TWCH 2OR9H 3MRCB 4DGIL 1CDCA 3C8KB 3U9PL 3PGFH 3PL6B 1PSKH 4I3GA 5EIIA 4KAQH 2D9CA 4D9LH 2WV3A 5EZOH 5GHWL 4PB9L 4XBEH 1G7MB 4LSQL 4LLYA 4YDLB 1JTOA 1PBYA 2PN5A 3RVTD 4NQCD 3AU1B 5I6XC 5ADPL 4MA7H 1BD2A 3VXOA 2I07B 4UU9B 1EA9C 3LS4H 1AD0A 4JR9L 3ARFD 3MRIB 3DI3B 4GRLA 1EBPA 2QKIB 3CFJA 5HHNB 6FABH 4PJ7A 5EZLA 3UJIL 1UT9A 4JANA 4Y5VA 1CFSA 4AQ1B 5EFIB 1WCBB 4UDUB 3O3EB 2BNUA 1HIMH 5KVMC 4JZOB 4PJBE 1XF1A 4BH8A 1CF8L 2JIXB 5E5RB 4ZXBA 4BK4A 1R3KB 4PJDB 1GPOH 2JCCB 2Z93B 3GSXB 3ROOB 1CS6A 2AJZB 2NY3B 3V0WH 1A8JH 1T7XA 1A9EA 1IT9L 3L5WB 1DE4B 3HE7D 2W1NA 1AO7A 4P23B 3G9VA 4EN3B 3TFKD 1IGTB 4WW2B 4XBGA 5ELIA 1TNMA 3SGKA 3I3DA 1EPFA 4LVEA 1JNNH 4UAOB 1Q8MA 2D31B 4NQCB 4G7VL 2JB6A 3U79A 3HR5A 1S9WA 1MAKA 2ZNWA 3VD5A 1T66D 4D9RE 3V6FB 3PGDB 1EAJA 1QLEL 2ORBL 1SEBB 1JGEB 5HYQA 3MODL 3CVIH 1ADQL 3VFRB 5J1AB 4NZUL 4RGMB 4N5EC 4FXGB 3LMJL 3MRDA 2ERJC 4KY1H 1NEZA 4QXUL 2VAAA 3KXFA 5DVMA 2P8PB 2CLRB 1BP3B 3KPQB 4AL8L 1FNGB 3QUMH 1OF2A 3HZVB 4IRSC 1HHKA 3TJEH 4G9DB 5FA4A 1TTUA 3HI1B 5F7EH 1F4XL 2NNAA 5ICYA 2UZXB 3B5GA 4NFDA 5CJQL 4XVSH 2FDBP 1I8IA 2AXGB 2QADC 1A14L 1Z9LA 1AQKH 2FRGP 1CK0H 5E4EC 2AXHA 5F9JB 2PETA 3MA9H 4Z7UB 1A7PH 4CADB 4MJ6B 3DRQA 4U1IB 5GZNC 2BDNH 5EB9A 3TBTA 2AJSL 3TO2A 1OARL 5EOCJ 2IQ9L 3T0VA 4XC3L 4JY4B 1S7WB 4UILH 5CEZH 4MNGE 5CCKH 4JG1L 3BPOB 2Z35A 4PJ8B 3MJ7B 4DAGL 1JE6A 1OTTD 1UXSB 4EQ3A 4U6VH 4ZO8A 3ULUL 2J6EA 3G5VA 5E95B 1X44A 5SWQB 3MCKA 4JPVL 2EH7H 2HYMA 1UFUA 4XNQB 4N68A 2KH2B 2QQQA 3U7YL 4FFYL 1RUQL 1HNFA 1J1OH 3IDJB 4IS6B 2RBLA 2XKNA 3HAEA 4DJMA 5I6XB 5D7IA 4XP9L 5EC2B 2A73A 2ZPKL 3VXMD 4PJ9C 1TZGH 3BDYL 5L7XL 1M05B 2QQKH 2CDFB 5GQBA 3RAJH 3WIIL 1Q9LA 5D7SL 5I17B 2APTA 1U3YA 4WCYH 2YUWA 1W8NA 5HYSG 1F3DJ 3DVFA 2VKWA 2EE9A 4KDTC 3MRNA 3RUGF 4HEME 4OF8A 4PP2A 5HHPA 3ZDZF 4Y88A 4HWUA 4NNYA 1CZ8H 4ZO9A 4KI1A 3D25A 5IMOB 2W0PA 3B5HA 5JDSA 2OZ4H 3TLRA 4M6OH 1N5YL 1S8DB 2ITCA 2QADD 4LCCC 3SDAD 3W0WB 1II4E 4JHWH 3OL2A 1HKLL 5FO7B 2OXGA 4OIAA 3K4AA 4GSDH 5EU7C 1A9BA 1G7IB 4NDMA 4ODTL 4PTTB 5IWLC 1RULL 2R56L 2B0SH 3MV11 4LAQH 3WNOA 4O5LL 4J4PC 1IEBB 1YN7B 2E6JA 3WNNA 3WIHL 1AGDB 1BWWA 5ACLA 1I3RB 4ONFH 1BBDL 2B1HL 8FABB 1U58A 1MH5A 2BOBB 2Q7NA 3RZCD 2ERJB 4NN5C 1GC1C 3VI3E 3MNWB 2BVEA 3FO0H 1QO3A 2Z4QB 1BAFL 4Y16D 5HHMB 1B2WH 4IRSB 3BEWA 1MHPL 1Q94B 5D96C 5JNYB 3I85A 2X1WL 2VUYA 2EDQA 2GJJA 3A6OA 3NIGF 2DI8A 5DZOA 4NPYB 4ELKB 3DTXA 5C0JA 1QBLH 2QADB 5I2IA 3MC0A 1OP3H 2NY2D 3UX9B 2FGWL 2DAVA 3MV8B 1S5HA 4ODBD 5E4EB 5IEKA 2XKUA 5F7UA 1KV3A 4HS8L 1TIUA 3BW9A 4KI5C 3RWJB 4ODSH 3BRDA 1E4WL 5DJ6B 2GTZB 4OLVL 3ZE1E 4HPYH 3VD9A 3PWNA 5ECJE 5E8DH 2DQIL 1Q9WA 3MRMB 2H2PC 3S5LB 2MHAB 3JV4A 5D6DA 5C0DA 1OD9A 1CGWA 4KJQC 4LSTL 3NZHH 3UJJL 1AGCA 4Z78B 3TIDB 5D2NC 2WUCH 2SEBB 4X5WA 4GAGL 1NLBL 2R23A 2IPUG 3KLHC 1F13A 4MQ7A 4XXDA 3SOBL 3LV3B 2I9TA 5J8OA 2OTUB 2EYSA 5HHQB 5IW6A 1SYVB 2FYYB 2HLFC 3G5YB 4E41B 1KGCE 5HYJD 5DD0L 2JJSA 2BNRA 1BF2A 3OTTA 4P3DA 3QO1B 4PJ9B 4FFZL 1H3GA 1PKQE 1SJEB 1JMZA 1JWUA 4GMTL 5GS2D 1G0DA 4P2RE 4MHHI 3NZ8B 1G6RB 1QHPA 2BFVH 1UM4L 4NJAL 4NNXA 5IHUL 5ESQA 4C83A 5GGVL 4JPIA 3KLAA 4NQDD 1T2JA 4XCNB 5GRXG 2Q1EA 1CLYH 1FL5A 5KJRL 1GOGA 4QT5A 2WSKA 4ZAKC 2ZOLB 2R2HA 5T1LB 3RWDB 5I19H 3LN5B 3QZWB 3IRPX 2XWJB 4N0UE 4LCCB 5J0BA 5H94B 4JQXA 2ZSWA 1QBML 4ODHL 3WIFB 3FO9A 3KYAA 2WIMA 1WIPA 4PG2C 3TO4A 2FR4A 1WBXA 4KROD 3LDBC 1UZ8A 4KI5D 3SJVE 4YHZL 2R4RL 3B83A 1HHIB 2VLLA 1LEIB 2NY6D 3MRFA 5HSFA 1FC2D 1LK2A 1H15B 4HKBA 1UB6B 1BVZA 5IVZB 3SDCD 2NW2A 5I16A 1LDPH 4PJAB 5GS0H 2AEIT 3C8HA 3BAEH 2A77L 3L1OL 2R1YA 3OBAA 4NN5B 5HHOB 5I75C 2A6KA 3WS3B 2VLKD 3KLHD 3V7AG 4F9PA 4ORZC 2V5YA 2ZOKB 5IK3B 3O3DA 1YEEL 4GKSA 6CGTA 4YUEH 2NR6D 4RWYL 3TBYA 3MV9D 5D96B 3DJ9A 4TNWK 1T22A 1WISA 3OV6A 1ULVA 5LQBL 2VE6A 3EOYG 2H6PB 1KFAH 4DN4L 3LKQB 1K2DA 5HVWA 3GMPB 3OKYA 4TUJB 1F90L 5IBLD 3PHQB 1IC4H 2B1AH 3LH2H 3JWDC 4PRPD 4R4ND 3W5NA 3IDMA 3IJHB 5DJCB 1O7SA 2GY7B 3T3PF 2DM2A 2DD8L 4M7KL 5IB4A 1QRKA 5CZVH 4JM2C 1TJIL 4M1DL 2O5XH 4GRWB 1I9JH 4HAGA 3KYMA 1U8LB 3U0WL 5ISZB 3P4OA 4PJCA 4YQXL 3LKSB 4Z0BH 2VDOL 4GW1A 1A64A 1QVOB 5INDB 3EYOB 2DTML 1EJ6A 5DT1L 3QDGD 1CTOA 3RWIA 4OGYL 2IAMA 3BDXA 4EJ1C 3BP7A 5D2NB 3DXAA 4NQEB 1TZIB 5J1TC 3QUZD 4WHYH 3RWGB 4WGVB 2XA8H 3RWEA 5DDHB 5DMIH 5LBSL 1MVUB 5K9KB 5FUOH 2X4SB 3UO1H 5LXGH 1GRWA 3S3SA 5DJDA 5EU4A 5ENWA 1GZQA 3MV9B 5KSVB 3PHOA 3GEWB 4X6EB 3N50A 1FO0B 4Q0XL 4O9HL 3MPCA 3VXRA 4AM0A 4PJFA 1KJ3H 2Z91B 4JE4B 3IDIA 4L4VB 4QLRA 5EIQA 1A6ZA 3H7LA 1FFOB 2HKFL 1B4RA 1JRHL 5LGJB 3TT3L 4HKZB 1WT5C 2D9QB 4GG6B 3DMMA 1FVDB 3FZUC 3QCVL 2ILLA 3VXUA 2F58H 4K2UL 2G2RB 3WEXB 3FFDB 1Q1JL 5GSVB 1T1XA 4M8QA 5IUSA 4IOIB 1MRDL 2ZJSH 3ULUE 1S7UB 4TNVK 5EUOE 3UTTE 4ZAKB 2WQ8A 1MCOH 1F2XK 1MFAL 1SVZA 3F6LA 1KN4H 1KCSH 4EDWL 1MIML 1DBAL 5AUMA 1T7WA 1Q9OA 4YXHL 5DHYB 4KRPC 1Z6JT 3IS1X 1F4WH 3NIDF 5IHBA 1MRCH 3LDBB 4NRYA 5HDOA 1J8KA 3JWOC 2BRRL 3U4BH 1JN6A 1FH5L 4GW5A 4DKAA 1EFXD 4LSDA 3GMOA 4PUBH 2ADGB 5KSUB 2EDJA 3GO1L 3UZQA 1A1NB 2EIZA 4LHQB 4LIQH 4Z7OE 4L4TB 4XNUH 3GNML 1U3JA 5I75B 2EH8H 2V2WA 4PJHE 3VFNB 2R0WH 1G1CA 5D5MB 1CLZL 3MCLL 3O2DH 1XF3B 1H9VA 4RBPH 1NGPL 2CIIA 1WLHA 1NC4A 2XZCL 4JFFE 1NCDL 4HH9B 4H20L 1XGQB 3T0XA 5EWIH 1N0XH 3BT2H 5IVXA 4PTUA 2FZ3A 1NGYA 3W9DA 2OM5A 5FCUH 4BSWB 3A6BH 5DRWA 3JV5A 1I7RA 4NYLA 5HD8C 5CSBA 3VH8B 5F3BA 1I8LC 3TA3D 1WITA 1U9KA 4O00A 4AJ0A 4JM2B 1Z5LB 1ZT1B 1KPVB 4DQOL 2W9EL 5I18H 5FK9A 4ZFZB 3CVHL 1I9RL 3TC9A 1AY1L 2AEQH 4RIRA 2ZUTA 4L3EA 2OL3H 1F00I 3AB0C 3CSYA 3MLTB 4YDVB 4OCWL 1X4XA 2XN9B 3CCHB 1ORQA 2OR9L 3TWCL 2A6JB 1KCKA 1H0DA 4CVZB 3E6HB 3PGFL 1IQDA 1PSKL 1EGJA 3B9AA 4KAQL 4D9LL 5EZOL 4FQLH 4GBXA 4S2SA 4R4BB 1CE1H 3QP3A 1E6JH 3VFSB 3LS5H 4YE4H 3LIZL 3U4EB 3E3QE 3WHE0 3MZTA 3LS4L 5JW5A 3L5HA 4CDHA 1WIOA 3OGOE 5H35B 1PZ5B 2ATKA 2ZP0T 1BQHB 5HJ3B 4DOHB 1ZE3C 1JYWA 1DBKH 3O4LD 4RWHA 1A6WH 3SDXA 1I3GH 3FB6A 4QTHB 2G9HB 3CK0H 1R5IB 2ARJB 1HIML 2P47B 4KXZH 1RK1A 2DMBA 5E5MA 4OF5A 1J88A 4X80H 2DMCA 4YXLH 4RZCB 1HH6B 4G8EA 4NCC1 3EYQC 4PS4L 1IAMA 1S3KL 3HI6H 4U6TA 1AGBB 1MWAH 4YGAB 5DI8A 3CGTA 2R2EA 5JZ7D 4Z6AT 1FE8L 4NC0B 4KRPB 1S7QA 5E94B 5I66B 2GCYB 4MGXA 5C9JB 3NACH 1HSAB 3VCLB 1HQRB 4EUPA 3D0VB 5EO9B 5I1HH 5DJ8B 1V8HA 2EE6A 2YBRB 3P2TA 1I7UA 4AEIH 2VR5A 2NY0D 1MHCB 4LP5A 4M7LT 1F45A 2JCCE 5AEAA 1R3HA 1SHMA 2FBJL 2BERA 4P46A 4BELD 1H8NA 1ACZA 3O3UN 3GGWB 4MB4A 4WY7H 4WVRA 3L3DA 4W68A 4I3RH 1R3LA 3QPQC 3CVIL 1W72A 1VKXB 3FRPA 4KUCF 1BFVH 1LO5A 3QPXL 2GI7A 4GT7A 4KY1L 3MLVL 3O8XC 5FYLH 4OLXH 3MJGX 15C8H 1NGXB 4XCCL 2JJWA 3QUML 5F1IA 3CPLA 3EGSA 5DF0A 5D1QC 1MHHA 2EDHA 3O3AA 5DS8B 2I5YH 3WN5A 5F7EL 2VAJA 1UKSA 2K3TA 4IRJC 4XVSL 3FFCD 4NO5A 2A83A 3PJSB 3GSNA 2YOCA 3T09A 1TQBC 4LMQE 1AQKL 4PP1D 5CJOH 1IILE 1QLRA 1CK0L 4FHBD 3TVMC 1OP9A 2XACC 3MA9L 1A7PL 1E28A 3AFLA 5BRZB 3BKYL 2BDNL 2D7QA 5F7DA 3LKNB 4UILL 1CGSH 5CEZL 1U8KA 4KKCD 5CCKL 2F5AH 4MA3B 4HGWB 5EU6A 4U3XA 5EO0B 5F97E 2PR4H 1DEEA 4U6VL 4LAJH 2YWZA 4YR6B 3HS0A 4JRYB 4HZLA 1FYHB 3V5DA 2EH7L 5TF1H 1N5AB 3FCTA 2WAHA 3KDMA 3BGMB 1DDHA 2IPKA 4JREC 1PEWA 4Z7UE 3RNKB 2ENSA 5KSBB 3OKMB 3JUZA 3OJVC 1J1OL 1A7BA 2LE9A 1T5XA 3MLXH 2JE8A 1NFKA 5T5FH 2W60A 1TZGL 4AG4H 3AVEA 4IRZL 3GMMB 2AJYL 2V5SA 5HPMA 2FD6H 3RAJL 1EUTA 4KRMB 4CL7A 4HKJB 1H3XA 5B8CA 1DUYB 2KUTA 2VUOA 4WCYL 4HWEH 5L8KB 2VDQL 5MEPA 2BC4B 1BX2B 4I9WD 1WAAE 2C3XA 1FG2A 4RNRB 3IF1A 3VDBA 3C6LA 1YEHL 4TNVF 1YUHB 4FN0A 5I8KH 2QSQA 3TBSA 1CQYA 2GK0B 3ARVA 2AXFB 1MJ7L 2IQAA 1Z9MA 4U3CA 4WU7A 1HXMA 4U0QB 3B4NA 2I9LB 3FB8B 3H3BC 4NO3B 4K7PH 1CLCA 3IFLH 2O61A 5C3LD 3TBWA 2DLIA 3C60D 4XWOC 4WUUA 1LGVA 2NX5B 1V05A 3MRHB 3E8UH 2C4XA 2GITB 4TSAL 4GSDL 1MAJA 2PO6D 5E9DE 4DUVA 1MFBH 1ZGLM 5JORA 5EZJB 2JTDA 5MERB 5C0EA 2B0SL 4IJ3C 3TBVA 1UG9A 4LAQL 3CFIC 4K7PY 1P4IL 1L7IL 5CEYB 1HHJA 1VEPA 5ITFB 4APQC 4NKDB 2FJHB 2VN4A 1L0QA 4ONFL 4UIKH 43C9B 4JDZB 4AQOA 3H9ZA 4IBLT 4NWUH 4ZFFB 3D2UD 4MLSA 2VQ1B 4OLWH 2R4SH 3W0WE 1FNFA 5T1KD 3O8XB 3CZFB 5CINH 4NSKA 3FO0L 2ZUSA 4OZFB 1B2WL 1VGKB 5D1QB 1D9KD 2HFEB 4H1LA 4K9EC 3SO3C 3P4NA 1KLFA 4NQVB 4IRJB 4YFEA 3GMNB 2F53D 5KAQG 1DANT 2P8LB 5F89A 1TQBB 4ODUA 5BQ7A 3UPRB 1A4KA 3TVMB 5E70A 3GSVB 4LCYA 5DEFB 4X4ZA 1MCPL 4KH2A 4ODSL 4UQ3A 1KEML 4HPYL 5E8DL 4Q58C 1VFUA 5HVFB 1ZV5A 1UB5A 3WNMA 4N8CH 3QFJB 3S6CA 1I1RA 1MFNA 5J1SC 4OD3H 3QIBA 3VJ6B 1F6LL 2A74B 2DYPD 3O45A 5ITBH 1D5MA 1B0RA 4JREB 4N8PA 4XWOD 3MV8E 1P84K 2W07A 5CSZB 5K9JH 1R5VA 3ULVH 3OKEA 3DV4A 2D7OA 3KPPA 3BP4B 1A7OH 2OL3B 1JGLH 1AIFB 3OJDB 1J1PH 4Y0GA 1JYVA 3BUYB 2WINB 4GKZB 2APFA 2GFBA 1IMHC 3VE0A 4POZD 3SDDC 3QQ9C 5GGRY 2JKXA 3L3HB 3KPLB 2DQTH 3L3IA 3CFKB 2BFVL 3ULUD 1MRFH 2X4PB 2EC8A 1AE6H 4WW1A 1WEJH 4P2OC 2X89D 2VZVA 2XQYG 4ZODA 2VITB 2YUVA 4OLZL 3P4MA 2YD6A 5CJ8A 4E41E 1LMKA 1NMCC 1FGNH 3V6ZA 2CIKA 5I19L 3DO7A 5BVJB 4F7EA 1RZ7H 3FQWB 4G8FB 1JGDB 4FQJL 1A02N 2EDKA 3L6FB 2R69L 2EE3A 4MXVF 1J8HD 3OPZL 3ZT6A 4IJ3B 2IH1B 2VDNH 1YPZE 4YAQB 4Y5XA 3UTZA 1KJ2A 4IM8A 1ONQA 4X9BA 5CZKA 4F15C 4P2RA 5EOCL 5JXAH 5E8NB 4NOFA 5FHAL 2O5ZL 3EO0B 5F9WC 2ZG2A 1F4AA 5KS9E 4PJXB 4APQB 4GRMA 1GVIA 2YWYA 3K8MA 5GS0L 3C5ZC 3VI4F 4FABH 4P5KB 4PRAA 4WJ5B 4TOYH 5IJKA 5IB1B 3G6JA 3QXWA 5C86A 3AGVA 1LP9A 3V5HA 1TENA 4YUEL 5I8EA 3C08H 2YRZA 3SO3B 5KVEL 1KFAL 4OCXH 4PB0H 4RFNC 4QCIA 2YR3A 5AWNH 2HVKB 4RGND 3SDDD 4H5SB 1QLFA 3DETD 3LPGA 1RD6A 3LH2L 4ONOA 2HT3C 1WC7B 3PIQB 5HHOE 2NZ9D 5FF6B 3BWAB 1RZ8A 5CZVL 5GPRA 4MJ4A 4Z7VB 1KB5H 2O5XL 1I9JL 2PW1B 1P53A 2V2TA 4Z0BL 3NCCB 4QYOA 3MLZL 3EOBA 5I15H 4NRXA 5DK0A 3H2WA 1U93A 4L8BA 4NRZB 5J6GA 5HGDA 4ETQA 3ZT5A 3DVNB 2XA8L 5DMIL 3IU4H 1K5NB 3MRKA 4JGMA 5GRVK 5E8OB 4Q74A 5FUOL 3UO1L 4WEMB 1KLUA 3QXVA 4LARH 1RJZA 1Y0LA 4RAHA 4Y19B 5FGBA 5B39G 5TDNB 3UJTL 3ZKQD 4J2XA 3P11L 1AHWA 5FYJD 1P84J 4GRWE 4HUVA 5ISZE 3O9WC 1RI8A 3DVGA 4X6CB 5A43C 1VPOH 4YHKH 3S9DB 1AR1C 3QI9A 3ULVC 1RAMA 4NQEE 4HIIA 1ZLUK 1SY6H 4KQ4L 5JLZB 4Z77B 5CEZE 4A2LA 3GJFK 2Z31D 2F58L 4NKOB 3ZKND 4P2OB 5TGBA 1S7VA 3IVKA 3VXSE 1U91A 1TVHB 2WBJA 2FWOA 5MEQA 3FAXA 3VU2A 1E27B 4FQXC 1T21B 2BSRA 4XP5H 3QFDA 1KN4L 1T5WB 1KCSL 4JHAH 2CGRL 4XNMB 1NC2D 4L4VE 4OZHF 1U6AH 4LHUD 3A0OA 1UXWA 4U1LA 4ZOEA 3KPOA 4LEOB 5GRZA 1F4WL 3VWJD 2VQUA 1MRCL 5DZNA 3PWVA 4F3FB 4X98B 1CGYA 1BWMA 4V1DD 1NAML 4Z5RA 1U8PA 1R3JA 2YS4A 3MJ9A 4I5BA 4JO4H 4XVJH 5B22A 2BY2A 4F15B 3EYVB 3AMLA 4LPWA 4PY8I 3GMLA 1CXIA 1TCMA 2L4OA 1T3FB 4NZJA 3LQZA 1FNEA 3C5ZB 2WUBL 3QWRA 4LIQL 5FFLA 4JQVC 5HGHB 3QISA 5J6HA 2W0KA 4XNUL 3W39B 3D6GA 1QSEA 2R0WL 3RTQC 1INDH 1L7TH 4JN2A 5DFVC 3S35H 3O2DL 3PABB 5EUOA 1CFNB 3UTTA 2DQJH 1IKNA 4CNIA 4RAUB 3MX0A 4JGJA 4O58H 2GTWB 4O2EB 2NZIA 3LAFA 5D71H 1DBMH 1X5IA 2V5MA 5T3ZH 4JM4H 1EAPA 4RFNB 1J05B 1N0XL 2HFGL 3BT2L 4MD4B 5LGKA 1A6TA 3OKDB 4U7KA 3K0WA 1D5IH 3P73A 4PJ7F 5FCUL 1AR1D 3NFNB 1PVHA 2B8OT 4L4TE 1RZJH 4Z7WB 5CIPB 5AYUL 2R2BB 5D5ME 3RDTC 1KT2B 5JMOC 5C09D 4XPFH 4O51B 2VLJE 1WZ1H 3MLUH 3R4DA 4OQTH 2AJUH 2AEQL 4FP8H 5E0QA 4HUMB 5HY9A 3LRGA 4FQXD 5SWSA 1VEOA 3LN4B 4PJHA 5DMYA 5F93C 1QA9A 2DIAA 1XR9B 1K3ZA 3HC3H 1XR8B 5DC0A 1A1OB 3U46A 4Z8FH 1OAUH 3D0LA 1GGUA 3GMRB 1CE1L 4Z7QE 3LS5L 3SKMA 4LHJB 4OZIA 5F21B 4XMLH 2XZQL 3O6LH 3O9WB 3QIUD 1FG9C 4CBPA 1BZ7A 2Y23A 4AT6A 5D2LB 2F54A 2QTEA 4X7FC 1OTUD 5F8QC 2BY0A 5AZ2H 4I0PC 1PDKA 4XHJD 5IHZB 1UGNA 1A6WL 2I60H 2XFXA 3BRGC 1I3GL 2P8MA 4FQQA 2GSIB 1RJYA 5HGBA 3RL1A 5HI4C 3VD3A 2NXZD 5C09B 2OR8A 4IEFB 2Q76A 2VLRE 4YXLL 4PLJD 3GBMH 3K7UA 4QRUB 3NFSL 3MRJA 3HI6L 3V4VH 4FQXB 5E9DD 3NFPA 1BVKA 1MWAL 1NBVL 1N64H 3P9WB 2FSEB 4DOHE 3RJDA 4J3WA 2FEDC 1JF1A 3PP3H 5HI5D 3RGVC 1IM9D 2PF6A 2X1PA 3RL2A 1RZKH 3NACL 3CC5A 1T1WA 1DEDA 4HKXB 5I1HL 1ZANH 4BSVB 2VXUH 2AAVA 5FUCC 4DVBA 3DRTA 1W0WB 5IG7B 3TV3H 4Y1AD 4QHMB 3K46A 4AEIL 2Y9RT 4MCZB 2HJKA 1JPFA 1KXTB 3D87B 3MRCA 1A6UH 4WY7L 3C8KA 1T0NB 3RY6C 3GKWH 3PL6A 1S9YB 1TJGH 1BFVL 2VO5A 1G7MA 1G9NC 2BNQB 3WCYA 1QNZL 2A9MH 3WYRA 1HKFA 5B4MC 3RTQB 4N0FB 4OLXL 4F8QA 4LP4A 1X5YA 4RMQA 43CAB 3AU1A 4XBPB 1EVUA 1CXFA 4ZUUA 3QT2A 3LEXB 5D7IF 2I07A 4UU9A 3MRIA 3RPKA 3K3QA 5CP7B 4F7TB 3QXAB 1OAZH 3S34L 1C1EH 2H8PB 3BESR 4ZOBA 3VRLF 4JFQB 3FQXB 5CJOL 5EFIA 2EXWC 2HKHL 1WCBA 4P4KC 4UDUA 3O3EA 1IVLA 2CRYA 4JZOA 4NZDA 3WNPA 4C58B 2JIXA 1R3KA 4PJDA 3GSXA 2JCCA 2Z93A 3RDTB 3N1QC 4OCMC 3ROOA 1CGSL 2AJZA 4HUWB 5B21A 2F5AL 5JHDD 1QFPA 1JIBA 4JO1H 2XTLA 5C6TH 3L5WA 1DE4A 2PR4L 1DANU 3NCYP 4PJEE 1JBJA 4P23A 1RZJC 2L0DA 3OXSB 4EN3A 3QEHB 4OGXH 1IGTA 4WW2A 5CLWA 4UOJA 5MI0C 1KB5B 2VXQH 4OFYD 2D31A 4NQCA 5E6IC 5D70H 3EHBC 5BS0B 4ZFGH 4U3HA 3S35X 5DD1H 5SX4I 3V6FA 3MLXL 4M00A 2HTKD 3UYRL 1SEBA 1JGEA 1JK8B 2ZCKH 3BOVA 1DQMH 5T5FL 3ULSB 3VRJB 1G0XA 2ENYA 3EJZC 5J1AA 3VFRA 4I0PB 1NH6A 4FXGA 4JRYE 1LNUB 5IR1A 3MRGB 1AQDB 4HWEL 2P8PA 2CLRA 3KPQA 1FNGA 3FTGB 1IJ9A 3ROLB 3HZVA 4X99A 3FOLB 5DRNB 3ZL4L 1YNLH 5A2KH 5KSBE 4G9DA 1Z2KA 4ODXB 2YA1A 2UWEE 3HI1A 5I8KL 4FZ8H 3QDHA 2NY5C 5AG9A 2J6EH 2AXGA 4KQ3L 5CD5D 2ICCA 3LKPB 3IFLL 5F9JA 4Z7UA 4CADA 4MJ6A 3RGVB 2E7BA 4U1IA 2EXWD 4P4KD 4JY4A 1S7WA 4RQQB 3MBED 1MFBL 1WV7T 3T3MF 3HAEH 5F1SA 1IGMH 3S98A 5I1KL 3BH8B 1RUMH 4PJ8A 3MJ7A 3PE9A 3LSOB 1UXSA 2MWCA 3GIVB 1X5KA 4JZJC 5SWQA 1GIGH 2E6PA 3DUSB 3CDYA 3Q5OA 4V2CB 1KIRB 1CDGA 4XNQA 5ALBH 4UIKL 4NZTH 4NWUL 1RZGA 4OLWL 1X5AA 5CINL 4YBQD 3IDJA 3QJFB 4IS6A 5EZIH 4LVNC 1J0JA 2EZ0D 3ZDYF 3QUKB 4HX1B 3IT8D 5H8DA 5EC2A 3FT4B 3INUH 3DROB 3L3KB 1SBBA 3V4PL 4Y4HD 2H1PH 2E27H 1M05A 1X4YA 2EDLA 4LHUG 2UUDH 4UT9H 2CDFA 1LE9B 5J4MA 3C2AH 5C0RH 2H26B 1A2YB 4DK3A 5I17A 2Y06H 1G9MH 5CGTA 4OZGB 4P4KB 1H8OA 3CZJA 1CDJA 3A67H 3HPLB 5DFWH 3SQOH 4OT1H 4WFGD 1HH9B 1NAKH 5H37H 4PRHD 5IMOA 2EXYD 4ZFOL 4W4OC 4AMKL 4C4KO 3HZYB 4BZYA 4NNPL 2Z92B 3GUTB 4LIQE 2NYYD 1RIVH 1S8DA 4OD3L 4OV6F 3W0WA 4U6HB 2YD9A 1TDQA 2DLGA 5BZWB 5FO7A 1A5FL 4OSUL 5DD5H 3WFCH 5MI0B 3TP4A 5ITBL 1LO3H 1MSPA 1G7IA 4PTTA 1MCCA 4LU5L 3EZJB 5E6IB 1KN2H 4KVNL 4D2NA 3FRUB 3HUJF 3QNZB 1DBJH 1IEBA 1YN7A 1T04B 1AGDA 1J1PL 4DKFH 1MCWW 1XCQB 2YZ8A 1YNTB 3WD5H 3NCJL 1I3RA 3SE9H 3QFJE 2QQNH 3ZDXE 5IFHH 8FABA 4M7JH 5A3ID 2BOBA 3EO1B 5E1AB 2OS7A 3MNWA 2VDMH 3F7PC 3VXSD 4L1DA 1MRFL 1L0YA 2Z4QA 3F7VB 1AE6L 4IRSA 1Q94A 5JNYA 4TUOB 3WS6C 4K94H 5JOPD 3G6AB 2R0ZL 1C7TA 3DOSA 4NPYA 1OLLA 4ELKA 1FGNL 5DURB 3KPSE 3MV8A 1I9EA 3PF2A 1BIIB 4CRPA 3RWJA 5DJ6A 2GTZA 1ORSB 4HH8A 3MRMA 4EBQH 1ACYH 2NXYC 3S5LA 1SBSH 4LLAA 2MHAA 3AC0A 2Z8WC 1V7NH 4U1KB 4PJCF 5JXAL 4JZJB 4Z78A 3TIDA 4UBDD 2SEBA 1XGPB 3PP4H 4YZFF 3IETB 2VERN 1PYWB 1OAYH 2GUOB 3C87A 2YPKB 1IL1B 1J9CT 3LV3A 1OQXA 2DL2A 3JUYA 4HBCH 2OTUA 3KNBB 3VMOA 2Y4SA 5HHQA 4C56B 1SYVA 2FYYA 3G5YA 4LVNB 4E41A 3F65A 2DM4A 2Q8BH 3QO1A 5GRJL 3BSZH 4PJ9A 1Q72H 1G6VK 1SJEA 32C2B 3SY0B 4PJFF 4EXKA 4X0KB 4I18C 3NZ8A 1G6RA 1AH1A 2AGJL 4PJXE 4WFEE 3NVQA 4AEHH 2VLJD 4KTDH 2R0LH 4X5XB 4KDTA 4X7TB 4XCNA 4XCFL 3I6GB 2X6MA 4HC1A 1F58H 4OGAC 3CDGB 2ZOLA 5T1LA 3RWDA 4M1CD 3LN5A 3ZT7A 3QZWA 3T77B 2XWJA 4R97C 5D7LD 1ITCA 4LCCA 5H94A 3WIFA 5FYLE 1U8JB 4HD9A 5DXWA 4JFEB 5CBEB 2OXHA 2R29H 4LSPH 2X4UB 4BFBD 2XQYK 4X4YB 4YHYC 5IWLA 4OCSH 3BRFA 1LE5B 3IU4L 4E42B 2PCPB 4LCUB 3GZKA 1HHIA 1J86A 3CAFA 2NW3B 1LEIA 4WI3A 1MCRA 2NXYD 4LCWD 4J4PA 3BVNB 5IEHA 1H15A 2MTPA 1UB6A 5E2UH 5IVZA 4NBXB 3SGDI 4YO0B 4PJAA 5C0IB 4G9FD 5KOMC 1VPOL 1UC6A 1W8OA 4YHMH 4YXKH 5HHOA 3WS3A 2VLRD 1U36A 3ARDD 3HG1D 3O0RL 4LLWB 3DYOA 4NQDA 2ZOKA 5IK3A 4R3SB 3OKKB 5E2TH 1P6AB 3BZDA 1MCQA 1ND0B 4NP4H 3REWB 4KKLC 5C08B 4D0CB 2H6PA 5HXMA 3LKQA 1YQ2A 5B38B 3JWNC 2NTFB 4XP5L 3GMPA 4TUJA 1HZHL 3MFFB 3S37H 5IVXF 1JZ7A 2C3GA 3PHQA 7CGTA 4X6CE 4MZ3A 2X7LB 5BZDB 5C6PB 2V2XB 3WLBB 1KB9K 1IBGH 1X9QA 3IJHA 5DJCA 5BMFL 4F8TA 1UYWH 4GW4B 2D7TH 5D1ZC 1UJ3C 1D7FA 5CGYD 1U8LA 5ISZA 2ZZUT 3LKSA 1CGXA 1NQBA 1YYMH 4IMLB 2QHLA 1RHHB 4JO4L 1QVOA 2DM3A 5INDA 3EYOA 1OB1B 4FFWD 1UH2A 2CKBB 1C16B 3MREB 3Q3GB 2J8UB 4OGZA 5D2NA 4NQEA 1TZIA 4G9FB 5DHVH 4N1HB 5E24E 2YD4A 3RWGA 3TZVD 2VL5B 3HG1B 1ZK9A 5CD3B 5DDHA 5J3HC 1MVUA 1YEFL 2BHZA 4WGWB 5K9KA 1XGYH 2X4SA 5C0AD 1SMAA 5IIEB 4P2QB 5F9DC 3MV9A 4OKDA 3S35L 5KSVA 4TYUA 4X6EA 1W0VB 1FNLA 2DQJL 3RUGB 3UTSD 1FO0A 2QLVB 4MWFB 3PUCA 4G6FD 2N1KA 4O58L 5HI3D 3F7YB 2Z91A 4L4VA 1FFOA 1DBML 2DOCA 4I18B 2WWMD 2X10A 4WEUD 5LGJA 2Y6SC 1D5IL 4HKZA 3MLRL 2X4RB 4GG6A 3SDXF 3BE1H 1FVDA 2G2RA 3WEXA 3FFDA 5GSVA 5GS0D 4X6BB 4IOIA 4GXVH 3ZTJH 4X7CC 5JPNB 1GHFH 1S7UA 4XPFL 4ZAKA 1WZ1L 2Z8VC 4OQTL 5A2FA 4H88H 2VDPH 4R97B 4HIXL 5ID0B 2X9YA 4P9HH 5DHYA 2GSGB 4PG2A 1CFQB 1H3TA 4M7LH 1PX4A 5FCSH 4YHIB 3WV0A 3FMGH 5CUSH 4JG0H 4HFWB 4YHYB 1PZUB 3H9SB 4S1SH 1L0XA 2FB4H 3P0YL 1K4CB 3L5XH 1E4KC 4UTBH 1JNLH 1INEH 1F4YL 2H2SD 2ADGA 5KSUA 3JTTB 1A1NA 5AZ2L 4K55A 3K74B 4L4TA 4KJWC 4DK6A 3VFNA 2I60L 3OAUH 5J3HD 5D5MA 4PJBF 4M5YH 1RU9H 5I8OH 1JL8A 1XF3A 4QXTB 3ECBB 4UIMB 5T33H 1BFOB 3EUUA 4M3JA 4HH9A 3GBML 3D1MC 1XGQA 3EOAB 2I24N 1J5OH 1KXQE 2BRQA 4NCC2 3V4VL 2DRUA 4RFOH 2DKMA 1N64L 4BSWA 3L7EB 1NANI 3VH8A 5FB8B 3ULVE 1TVBB 1NBZB 1F6FB 4DW2H 4P2CG 1A6VH 1RZKL 2D7NA 4JM2A 4ZPVB 1Z5LA 5D1ZB 1ZT1A 1KPVA 3VWKC 1UJ3B 5IQ9B 1ZANL 4ZFZA 2VXUL 1KB9J 5JO5B 4JFDD 3TV3L 1RZFH 1R24B 4XT1C 3SE3C 4JRXE 1F97A 1A7NH 3OR7B 3HA0A 4NO0D 3MLTA 4YDVA 3FQNB 5GRYA 2VZOA 3HR6A 3CCHA 2XN9A 5DJ0B 1A6UL 2A6JA 4U05A 5DVKA 4CVZA 5DGRA 2QR0B 3VG0H 3E6HA 3GKWL 1TJGL 4R4BA 2CLVB 3NGBC 2A9ML 5C92A 4KJPD 3VFSA 4BH7B 2WLZA 2PYED 4YDJB 1CDIA 4NN6C 1QFUL 2PUQT 3U4EA 4C55A 3LKOB 1S9XB 3KJ6L 3B8YA 2AJVH 3DGCR 2VOTA 4GAYB 5H35A 1PZ5A 1BQHA 4JPKH 5HJ3A 3S37X 3TN0D 4I1NB 1FRGH 4Z76B 4W70A 4PLKC 3QBTB 1YYLH 1WT5A 4QTHA 4KJWD 2EDOA 4AYFA 4EUPH 1D5BB 1R5IA 2ARJA 1T83C 2BNQE 3IXTB 4NKIL 3PWPB 4XP1H 4XTRD 1CD9B 2HJLB 1BJ1H 4U6YB 1TVDA 1HH6A 2GJ6D 2L7JA 4RZCA 3ZE0E 1EO8L 4NO0B 1OD7A 2HA1A 1YMMB 4JO1L 5DD3H 3S4SB 1AGBA 4Y4KC 2R8SL 2D0FA 1W72H 5E94A 1OAKL 2GCYA 5I66A 2DLTA 5C9JA 1HSAA 3RHWF 1M7IB 3VCLA 1HQRA 3D0VA 5EO9A 2VXQL 5DJ8A 4BUGA 3GMQB 3SKJL 2QQLH 1WFNA 2YBRA 5D70L 4ZFGL 4Q9CA 1MHCA 1QSFE 4HSQA 4HJ0D 4B5EA 4MJIB 3UTQB 3GGWA 4XPGH 2ZCKL 1DQML 1MF2H 4DWHA 3GSNH 4G6AC 5MHSE 1VKXA 4UT6L 1YJDL 1AXIB 4KUZH 3RX8A 2P5ED 2GK2A 3BKJH 1SJHB 3KYNB 1NGXA 4F57L 3ALXA 1ZAGA 2ZUYA 4IHOB 1CBVH 2CMRL 2V5TA 5DS8A 3ZHKA 1YNLL 4KKBC 3KPSD 1OM3L 3LB6C 4YHOH 4FZ8L 3RVVD 2NLJB 4LSRL 1RPQA 2J6EL 3PJSA 1IZJA 4QHUB 4RMUA 4ZTPH 5FKAB 4X4XB 3UTPE 4MQTB 2DLFH 1PFCA 3LPWA 1I8LA 5BRZA 3KR3L 4KDWA 4UMGA 3VWKB 5SX5H 3LKNA 1UM6H 5D9SB 2AS5M 4MA3A 1JP5A 1KG0B 4HGWA 5EO0A 2D0HA 4XZUB 4CAGA 3R0MA 4WFHE 1QR1B 2X42A 4FG6D 5B3JE 5J89A 4YR6A 4JRYA 2BHYA 3I2CH 4YC2C 4CJ0A 5A16B 5IOPB 1N5AA 2N56A 3VI3F 5ALBL 3BGMA 4NZTL 2ARWA 4FMFA 3RNKA 1OAQH 5KSBA 3OKMA 3NGBB 3PGCB 1NFDB 2ADFH 3BP6B 5KW9H 4JCMA 4LL9A 2DJUA 3RIFK 4X9FA 1XIWD 3M45A 5FUCE 1MFEH 4P5MB 3TT1H 2H1PL 4MMZC 5DHVB 4HUNB 1UADC 2E27L 1ES0B 5EU5B 1J1XH 1Z0MA 3C2AL 4Y8DC 5C0RL 4HKJA 1DUYA 5DMJB 2Y06L 4ZUTB 4MYWB 1G9ML 4OCYH 1G84A 4QWWD 5GRVL 1IFHH 2BC4A 1BX2A 2OP4H 1IZKA 5J13C 3ZE1F 1FYTD 4RNRA 3NTCH 4ZS6C 1RMFH 1JPGB 1YUHA 1FZMB 2GK0A 4OQ1A 4RX4D 3SQOL 4KKBD 2AXFA 1KCLA 1PY9A 3ARED 2I9LA 4PRID 2VZUA 4Y4KB 3FB8A 4L8CB 3GBNH 4NO3A 3ALPA 3WHXB 3U1SH 5EN2B 5A2LH 2IFFH 5DD5L 2NX5A 3WFCL 1YECL 3MRHA 3KS0J 4KK5D 1EJOH 4PJGE 5EZJA 5MERA 4ISVB 2DQUH 3PDDA 3UPAA 4H1LH 3OB0H 5CEYA 2EIZB 5T3ZE 1DBJL 2AEPH 5I1CL 4XI5C 5ITFA 4NKDA 1T2QH 2FJHA 3DSFH 4PJIB 3SE9L 1HEZB 2YXMA 5IVOA 43C9A 5IFHL 4M7JL 5DO2D 4ZFFA 2VQ1A 3BDBA 2HG5B 3O8XA 3CZFA 2VDML 4QHLB 3VFGH 3B3IB 1OSZB 2YC1B 4OZFA 1VGKA 2IANE 3QUYD 5D1QA 4WEBH 2HFEA 2XOTA 2DMKA 4K94L 4NQVA 3RBSA 4P5TD 3DX7B 2IH3B 4UT7H 4J8RB 3BQUD 4IRJA 1A0QH 4PRIB 5DR5H 3GMNA 3AS1A 2P8LA 1YMHB 3MXWL 1CL7L 4ZOCA 3UPRA 3KGRA 2CR6A 3TVMA 3GSVA 1AC0A 5DEFA 4X7SL 5ANMB 4P3CL 5D7KD 1AXSB 4OCRH 3ZO0A 4H26B 5D4QA 1I8MB 1WZLA 1K8IB 1CN4A 4EBQL 1ACYL 1MHEB 1OW0C 1V7NL 3UZVB 4OZHE 1U2CA 3QFJA 4KDVA 3O11B 3VJ6A 4KPHH 1ZSDA 2A74A 3AROA 4YC2B 4BKLB 3QNXB 5C0BE 4DCQB 1CICC 2YMXL 4WHYG 5CSZA 4HBCL 3TH2T 5IW1B 3N85H 4KUCD 1XFPA 1S7RB 3BP4A 4G8IB 2OL3A 3QH3B 4KMQA 1AIFA 3OJDA 1G7PB 2Q8BL 5CSGA 3BSZL 1Q72L 3WKNA 1YNKH 2WINA 4GKZA 4QRPB 4LLMB 5K9QG 1S78C 3RVWD 3L3HA 4B7IA 4YGVB 3KPLA 1XF2B 5GGUB 1EXUB 5C8JB 3CFKA 4NJ9H 4IDJH 2X4PA 4CW1B 3G04B 2APBA 4U1JB 4KTDL 2R0LL 5J13B 5TFSH 5AAMA 4ENED 1A22B 1HSBB 2VITA 1KJ2H 3QAZC 1F58L 1QQDB 2F19L 1JNHB 5HYIA 1E4XH 1EUUA 5C07B 3W11C 3V79C 1C08B 5BVJA 3TIEB 5JXEC 4Y2OA 3EBAA 3FQWA 3CFEB 4G8FA 1G9EA 3BZFB 1JGDA 4MX7B 3L6FA 4JZNB 4LSPL 2XTJE 4X8JB 1RVFH 3RA7H 3RIAK 3QXUA 2IH1A 4YAQA 3VFMB 5KSAC 1HE7A 3ESVF 1KPRB 5E8NA 1W72B 1HDMB 5E2UL 2HT4D 3EO0A 3ORJA 1AO7E 3GDBA 4PJXA 4APQA 2XQBL 4PJ5B 3H3KA 4J6RH 3OKNB 2PTVA 4RDQG 5I71C 5L8JB 4P5KA 4YHML 2BMKB 4WJ5A 4YXKL 1KC5H 1CICD 5DK3A 5HTSA 3GSWB 4JFEE 4NBYB 3FT3B 5I1AB 5IB1A 3QEQB 5E1HB 5E2TL 5SWZD 5D1XC 4FQHB 5I8CB 1P5UA 3O2VH 5EUOF 4NP4L 1KTDB 2OX5A 2VZTA 3BP5B 3RX5A 1QHOA 3THMH 3LD8C 2HVKA 1PLGL 1ZVHA 3ARBD 4H5SA 3S37L 2ICWI 3L95B 4MDIB 4ZDHB 4HJGB 1IBGL 1WC7A 3PIQA 3ARQA 4JRXD 1YQVL 1TLKA 4XXCC 5FF6A 2GJZB 2DBJA 3BWAA 1EEUA 3V0VB 1UYWL 3QG7H 1MCEA 4Z7VA 2BVPB 2PW1A 3MOAL 1YYML 2HLAB 4XB7A 3PHSA 5TH2B 3EYFB 5C08E 3OZ9H 3QUXD 3ARUA 4NRZA 5KOVC 4Z7OF 3I6LD 3BJLA 1CICB 2FHFA 1JHKL 4PJHF 3DVNA 4WHDA 1K5NA 3QWOB 2HJFB 5E8OA 2DDQL 5TDNA 1I1AC 4Y19A 3SBWC 1GOFA 5ID1B 4JFZH 1U95B 1A7QH 3H7BB 1CFVH 1RK0B 4U1NA 3ZE2E 3UBXG 4WWKD 2A9NH 1WGOA 3MBXH 1MLBB 3RWFB 5JW4R 3ARYA 1T7ZA 4H8WH 4X6CA 2D03H 3SDDA 2FCBA 4ODVH 2J8UE 1JRHI 3DIFB 4BK5A 5KZCD 5JLZA 3OAYH 4Z77A 2GY5A 3BE1L 3U30C 4NKOA 4P2OA 2OK0L 2A0LC 3U2SB 3MJ9H 1MQ8A 4P2QE 3QAZB 1DQJB 1TVHA 3RBGA 4HT1H 4XAWH 1E27A 4NHUB 5F9OH 1T21A 1GYAA 4JFPB 1T5WA 1NGWB 4XNMA 2VDPL 1KPUB 3LOWA 1NMAH 4FFVC 4P9HL 3VDCA 1S7TB 1QSFD 1OWRM 1M71B 3V6OC 4LEOA 3GRWH 2VH5H 1UEYA 4M7LL 1X5JA 3FMGL 5CUSL 2WM0A 4F3FA 3TYGL 1K9TA 4X98A 5GJTL 3SKUD 4S1SL 4P3WA 3VD7A 4FQIH 5ETUB 2FB4L 3QIWC 4EI5D 5KSAB 2X2YA 3L5XL 4HG4K 3KAAA 2OTWB 3EYVA 4HMCA 4J3SA 4YNYB 4YBLC 1T3FA 2RB8A 4UINL 3C5ZA 4OLYL 5FO9B 3L7FB 1YEGH 5I71B 2AK4B 5HGHA 1X5LA 4O4YH 5L8LB 3W39A 1TPXC 3V4UL 3OAUL 2ICWJ 3B9KD 4MNQD 1RU9L 3WO3B 4LRIC 2CPCA 3PABA 5D1XB 1CFNA 4XPBH 5I8OL 3H9SE 2YA0A 4YDKH 3V2AR 5L6YH 1I1AD 5T33L 4H0HB 4RAUA 3QNYB 2J1KA 2GTWA 5TDOB 3UTPD 4O2EA 2E9JA 1MNUL 3HZKB 4TULH 3MA7B 3U36B 1J05A 3TCXA 4MD4A 1J5OL 3LD8B 3OKDA 4UB0H 5DZLA 1WSST 1KEGH 3I50H 1EGJL 4Z7WA 5CIPA 2X4NB 2R2BA 1RUPH 4QRRB 4DW2L 2X9XA 4KKAD 1A6VL 5DLML 5I74C 1KT2A 3EYUL 3TF7C 2K7QA 4O51A 4WTWA 2JCCF 4YHLL 3S96B 1ZHBB 1RZFL 1YC8A 5CZXD 2WNGA 3N1FC 2FH8A 4L8SC 1A7NL 1WZKA 5FYKD 2IJ0C 2BSTB 5ADOH 2BY3A 3LN4A 5ILTH 5C0CD 2VSCA 3PXHA 2MSPA 1XR9A 4XPAH 1XR8A 2CQVA 4OI7A 4WW2F 1A1OA 4J3UA 1P69B 3QCUH 3GM8A 3GMRA 1I1AB 4KRLB 2YK1H 4X6DB 1M1SA 1IGCH 3GIZL 3O9WA 3MV7B 4M61B 3R1GL 3IAPA 5D2LA 2AJVL 3VXNA 2P5WB 5KANG 4LK4A 2V9RA 4WW1B 3WXWH 4GKOA 5IHZA 3OKLB 1MQKH 2ZUVA 2GSIA 1OY3B 4RFEB 3U30B 1QPPA 3P4MB 3HMXH 3VFOB 5C09A 4ZTOH 1S5IH 3V6ZB 1BLNB 3D85D 3WFEH 1UZ6E 4GOSA 4QRUA 3KHQA 5GISH 4B53A 4FQXA 3PG2A 3QDJB 4HIJB 3WUWB 3FQRB 3V7MA 3QYCA 5IB5B 1BFSA 2FSEA 1DTUA 1LO4L 5FGCB 2UVEA 4LFHD 4Z7UF 5BV7C 1NGZB 1KXVC 5IT2H 5CAYB 1JWSB 4MQXC 2ZUWA 4JQIH 4HKXA 5H2BB 2JELH 4BSVA 5F8RC 1HINH 4Y4FD 4CKVX 1FIEA 1W0WA 3PWPE 5IG7A 5C71A 1QRNB 3QIWB 4QHMA 3FB5B 4MCZA 2BXZA 3ILQC 3NPSC 4LSVH 4OLEA 1BREA 4YBLB 4ZS7H 4LRNH 4XPGL 2ZKHH 1YMME 3QEGL 2A6IB 3GSNL 2APXA 1T0NA 3H9YA 4M48H 2IAND 4U0RC 4HG4J 3U0PB 1S9YA 4JQVA 2WZPD 3SCMC 2BNQA 4M7ZC 4KUZL 1WAAF 5E2VH 2VXVH 4J12A 1TPXB 5FDWB 4P9ML 3BKJL 4N0FA 3RTQA 4F33B 3WLWD 1MFCH 43CAA 4XBPA 2W91A 1ZLVH 1PKOA 3TNMB 3LEXA 3GSQB 4YHOL 5C9KA 4F7TA 5CP7A 4KK8C 3QXAA 3T0EC 3BMWA 1EH9A 4UNVA 1MCDA 1DVFC 3BI9X 2UYLB 5GRWA 2H8PA 3LCYA 5D72L 2XPGB 3X3FL 4ZTPL 2F74B 1HCVA 4JFQA 3FQXA 4RMWA 5DA4A 5D7JC 1BGXH 2DLFL 2HWZH 4YPGB 2V2TB 1TXKA 2WK2A 1VCAA 3RDTA 3EOBB 4CMMB 5TPWH 3PQYD 1X4ZA 4HUWA 4DUWA 5F96H 4LDEB 5DMGC 1U3HD 3MUJA 5CKGA 1U93B 2P45B 3BIKB 4S11A 4L8SB 3VFUB 3CU1A 4OKVB 3DVIA 1NJ9B 1NGQH 5T3XE 3I2CL 4PGDB 5IGXL 3VGDA 3OXSA 2B4CH 3QEHA 1NL0H 4AENB 5DEGB 1KB5A 4KK6C 5F71A 3ZYIA 1UWXH 2P42B 5BS0A 3RX7A 3ARGC 2Y07H 2ADFL 5KW9L 3MQIA 2ZG3A 1H3WM 1JK8A 3VRJA 3ULSA 1DR9A 4UQ2B 3ILQD 3DXAE 3VG9C 3BKCH 3FONB 2VISB 1RJCA 1NPUA 4I0PA 1BD2D 1LNUA 4N5UA 1JF6A 3DURB 3MRGA 3W9EB 2VWEC 1AQDA 4OCYL 4GRLD 5IQ7H 1IFHL 2OP4L 1R0AL 3FTGA 4O02H 1YEJH 3ROLA 3F58L 1JPST 2DBLH 1G7JB 2VTFA 3FOLA 5DRNA 4BZ2H 5L2KB 2LU3A 3NTCL 1RMFL 4ODXA 3VXRE 4G8GB 1P7KB 2G5BB 1C5DB 2YUZA 1N3NB 4MZ2A 1QEWB 4ZXBD 4U1LB 1SY6A 4TPRL 2XTJD 1FZOB 4CMHC 4J23A 3GBNL 3LKPA 1OLZA 3U1SL 3VXUE 3RGVA 2WMPA 1V3JA 1H5BC 2IFFL 4G6ML 5L2JB 5BV7B 4H0GA 4RQQA 4NM4L 1AO7D 4RMRA 4K8RC 3BH8A 3BZ4B 1J0YA 3D39B 3LSOA 1ZXQA 5HPOA 4G6KH 3BISA 3LQZB 3NPSB 1MIEH 3QDMD 3GIVA 2AEPL 4LCIH 4AIZB 1I4FB 3BN9C 3DUSA 1KIRA 1OP3K 3DSFL 4YEFA 1SJVA 4U0RB 3EOTL 3RY6A 2NY1C 4OM1H 3SCMB 1AXTH 3M8OH 2BJML 4M7ZB 4CN1A 2IG2H 3WKMH 2EDFA 5E7FA 3WL9B 1E6OH 3QJFA 1DLHB 3VFGL 4LLDB 3QUKA 4HX1A 3FT4A 2Q6WB 3DROA 3L3KA 2D4FA 1L9NA 1DQQB 4WEBL 1YY9D 4U6XB 3KXFD 5DC4B 2NMSA 3D3VB 2X1QA 2UVFA 2BSSB 4KK9D 1LE9A 4UT7L 3T0EB 4OD2B 1FZJB 5DR5L 4KJYB 5E2WH 2H26A 1A2YA 1DVFB 3MRPB 2BHUA 4PJIE 1CVSC 5HYSB 4OZGA 4YX2L 4P4KA 4LGRB 5D7JB 1MCWM 4UUJB 5MENB 3HPLA 1GCFA 4TVPD 2A6DB 2MJWA 2ZCHL 1YPZF 3ET9F 1X7QB 5JUEL 1HH9A 4BFEA 2IALB 1UWGL 1TZHB 3QDMB 3T1WA 1BJMA 2YPLB 3G6DH 2AV1B 3HZYA 2M8XA 5KS9F 4ZSOB 2Z92A 2AVGA 3GUTA 1FBIH 2ZUQC 1ED3B 1BF8A 4U6HA 1GGIH 3GI9H 4ZO7A 4XNYL 5BZWA 3RVTC 4MB5A 4JJ5B 1PEZA 2RFXB 3QDAA 5IFAH 3ARFC 3N0PB 3REVB 5E6IA 2D7PA 3N85L 3ARGB 4K3HA 3T4YB 4U1HB 4N0YL 5KG9B 4BSJA 2NQCA 3FRUA 3LVEA 3MR9B 3QNZA 4L3EE 1T04A 4WNQB 4S1RH 2DQDH 3T2QA 1XCQA 2EIBA 5I73C 1YNTA 3VG9B 1YNKL 4JHBA 1DQLH 4LPXA 4QOKB 4G7YH 4PJAF 5FDYA 3HNTH 3EO1A 5E1AA 4LF3B 3IU3B 1MREL 3CSGA 4XVUD 3F7VA 4PY7B 3T8XB 4UDTB 4BQBA 5TFSL 3HE7C 4WTZG 3MUZ1 5TE4H 4RGOH 1T1YB 4TUOA 1P7QB 3G6AA 1V7MH 3TPUB 1KJMB 2D4DA 1KJ2L 3PWJB 3TFKC 4P4RB 4LNRB 3IFNH 1E4XL 2ESVD 4YDIH 4CMHB 2Q8AH 3RFZC 1OPGH 4LQ1A 3CC5B 4WHCA 1BIIA 3M1BB 3IYLW 1T66C 4AIXA 1H5BB 2KDGA 1ORSA 5EPMB 4IOFD 1I7ZB 2FX7H 4I2XB 1RVFL 3RA7L 3EDDA 4GRWF 4U1KA 4NCDA 4YIQB 4F7MA 5MP6L 2F9BT 4LEXH 4NT6B 2BOCB 4JZJA 3ESUF 5SX4H 1XGPA 3IETA 1G6RH 1PYWA 5C07E 2GUOA 4NWTH 2YPKA 1IL1A 2NY1B 4LKCB 3U9UB 3KNBA 4ZUUB 4R7DB 2XNAB 2EEAA 3OB8A 3DX9B 1N26A 4C56A 4U7SA 3GHBL 1KYOK 4HC1H 1N0LA 5F3HB 32C2A 5IB2B 3SY0A 2ESVB 4LFHG 4X0KA 1WFUA 5BJTB 5C0ND 2JB5H 5GGQL 4KGLA 5I1DB 4XWGH 3HZMB 4PJ5E 4Q2ZB 1JZ5A 5JOFB 1OGAB 3DYPA 4X5XA 4Y7MA 1OTTC 1OTSD 4X7TA 1FZKB 3I6GA 4F80A 4JFYB 3QG7L 3QEQE 3CDGA 4TN9A 2AQ2A 3UDWC 4ELMB 1BQLH 4W4OA 1TCRB 5GS2H 1ZLSH 3T77A 1KULA 3CFDB 4RMSA 2ZUQB 1WCQA 4S0SD 3LQAH 5M94B 1MJUH 4NGHH 1U8JA 1GC1H 3T0AA 4CDGC 4JFEA 1F4HA 5CBEA 1RQ5A 2X4UA 4X4YA 1WICA 1LE5A 4S1DD 5T1DL 4E42A 2PCPA 3ARFB 3GJFB 4LCUA 5EU6E 2NW3A 3BVNA 1A7QL 2GT9B 3WFHB 4WO4C 2VLME 5I73B 4YO0A 5IR1B 2A9NL 2WIIB 3MBXL 5K9QI 5C0IA 4H8WL 4JY5H 2D03L 1ZA6B 4R2GD 1RZIB 4F9LC 3V8OA 2BNRD 4KZEH 3ZYZA 4X99B 1PGRB 2FEEL 3X12B 5JQ6H 1H3PH 4LLWA 4RISH 5JR1H 4KHTL 4R3SA 1CIDA 4HF5L 3OKKA 5E7BA 5D5MF 4GRWH 4M4RA 1ND0A 3HE7B 4NKMB 4XC1H 5DUML 4EI6B 3WS6A 3REWA 4XCEB 3SDAC 3MJ9L 5BVPL 1D6EB 5C08A 4D0CA 3LY6A 4HT1L 4XAWL 2EIEA 5B38A 1MELA 2NTFA 3T1FB 3MFFA 3F8UB 5IMKB 1KOAA 2VJXA 2X7LA 5BZDA 2V2XA 3WLBA 1P9MC 3CD4A 3RP1A 2X41A 5E99H 3LHPH 2VH5L 4GW4A 4MXQD 1T03H 4RBPK 4Z7QF 2Q86B 4JM2F 4IMLA 1FO0H 2EDYA 4FQIL 1RHHA 4PBXA 1JVKA 1T1ZB 3TO4D 4W6WB 4OAWB 3RZCC 1OB1A 3E2HC 3VGFA 5FYJU 2CKBA 3LEVL 1C16A 5F1NB 3MREA 3Q3GA 2J8UA 4GQ9L 1RZGB 1TMCB 4M6NH 1OGTB 4Y16C 2Y7QB 4G9FA 4L5FL 5IESH 2E7MA 4WUUE 4UTAL 1G7LB 1U8HB 2J8HA 4GG8B 4MLIA 4BZ1L 2VL5A 1ZLWH 3HG1A 5DTFB 1YEGL 5CD3A 2DN7A 2M2DA 4O4YL 1MPAL 3I02B 2K7PA 2C4FT 2BVTA 2B2XL 4OF3A 5IIEA 4P2QA 4HMEA 2BCKB 4M03A 4JKPH 1W0VA 2RIKA 3RUGA 4YDKL 5L6YL 2EO9A 2NY2C 4MWFA 2Y36L 3F7YA 4WO4D 1ZGLB 1KYOJ 3F7RA 4TULL 4I18A 1LO0H 1SM3H 3D9AH 5EIVA 2R15A 1HI6B 4NQSB 2X4RA 2J4WH 3LZFL 1KEGL 1N8ZA 3KPRD 4JFHD 1Z0NA 3ZZ1A 1FFNB 4X6BA 2AV7B 5E6ZA 5JPNA 5L88H 4P49A 3ARRA 2JF1A 4R8WH 1R3IH 1CFTB 3HUJB 5HHVL 3F6IA 5ID0A 3MJ8B 4XNXH 5ADOL 5ILTL 3RI5K 5CFHA 2GSGA 3GM0A 1U0QA 4OF7A 1CFQA 3BKMH 4XPAL 1NEZG 4YHIA 1I9IH 1TJHH 1Z3GH 3VXMB 2IAMD 4HFWA 3H9SA 1H3UA 3QCUL 1K4CA 4QRRE 3ZTNH 3ELAT 2YK1L 3LQAC 4WO4B 1OP5H 3UBXI 1CGVA 5DGQA 3JTTA 1JYXA 1B88A 4EZMA 3OJ2C 2BVOB 1SEQH 1JI1A 1AGEB 3JWDH 1IGIH 2BZDA 3MLWL 3VXRD 4GKNB 1BMGA 3KPRB 1MQKL 5I1JH 3NOIA 2W38A 4QXTA 3U0TB 3ECBA 5KVFH 4UIMA 4F58H 1U8OB 4KXZI 1BFOA 1S5IL 4JCLA 1IQWH 3SDAB 1CU4H 3GJEB 3X3GH 2JJTC 1FAIL 3DMMD 1B4JL 3EOAA 3NH7L 4LKXB 4X6DE 2ED9A 3MV7E 1P1ZB 4PJEF 4M5ZL 4KROC 3H3PH 2APWA 3W2DH 2P5WE 1CG9B 3L7EA 3KLSA 2NY6C 5FB8A 4DTGH 1TVBA 3U7AA 1NBZA 4ZPVA 5IQ9A 3SDCC 5IT2L 5D1ZA 1UJ3A 1O7VA 1KCUH 2VKXA 2JELL 4WV1C 5JO5A 1HINL 3HAEG 2HRPL 1R24A 3RZCB 3E2HB 3OR7A 4LSVL 3FQNA 5DJ0A 3MYJB 4LRNL 4Y16B 1NCBH 1WF5A 2QR0A 2PW2B 4M48L 2GYSA 2NR6C 1O5DT 3RVUD 4IIQC 3CU7A 3TCLB 5E2VL 2CLVA 4QTIH 4BH7A 5KSBF 4R0LC 1KENH 1F3RB 2UWEF 4YDJA 4D3CL 3S3PA 5IBLC 2NY2B 2Y5TB 3LKOA 1S9XA 1QRNE 4R4NC 3K8LA 1MEXH 4GAYA 1MI5D 4S10A 2A1WH 1F6AB 2FX9H 1XF4B 3CMGA 4Z76A 5CP3A 1NC4D 2DQGH 1ZGLP 4OBSA 1D5BA 3G6JE 3IXTA 1LP9E 3JWOH 3PWPA 5DJAB 1YY8B 1ZOXA 2HJLA 2IPTH 4P0DA 4U6YA 2B20A 1MFDL 2ITDB 4UI2A 3QUZC 4WIQA 4MNHB 5F96L 4NO0A 5H37G 3SGEI 1YMMA 3S4SA 2ADIA 5FUZH 3SKNB 1Q9KB 1CDUA 3FB7B 4CN4A 3LEYL 1VFAB 1KIPB 2F8OA 2IGFH 5HYJB 3H0TB 1ZHNB 4L3ED 2X1OA 1M7IA 4KHXL 5IEHB 4FNLH 3GMQA 1FL3B 3FN0L 4MS8D 4QRSA 1X5HA 2Y07L 1E4KA 4FXLA 1Q38A 3OAZH 3DX6B 4GBXD 3QEUB 5SV4A 4MJIA 3UTQA 2OJZH 4FOMA 4JO2H 1MI5B 3MOBH 5EORH 5KANI 4NQDB 9CGTA 1OCWH 4XPTL 5HGGS 2P24B 3O6KL 1SJHA 3KYNA 3VW3L 5IQ7L 1HHHB 4IHOA 1YEJL 1RJLB 2DBLL 5DRXB 2R1WB 1T6WA 2KBGA 2XZAL 1K6QH 1MLCB 2NLJA 4RDQF 1ZVYA 2YA2A 2EYTB 3SE8H 2YRPA 2X09A 1PJ9A 4QHUA 1X5ZA 4HDIB 4FTVD 4KROB 2Z0BA 4S0TD 3EO9H 1UWEL 4X4XA 5FKAA 4PG9B 2W92A 1EO5A 3ZKXC 2NY6B 5F6IC 5ERWB 2E7LC 3UMTA 1RUAH 3HKFA 4N90E 3VWKA 3SDCB 1URLA 5D9SA 1XEDA 5JW3H 1EEYB 4WV1B 1KG0A 5L2KE 1KELH 2NY4C 4XZUA 3A6CH 4U1SB 4HWNA 1CIUA 1QR1A 3SE3A 4G8GE 4K71C 1MIEL 2AERT 2VLKB 3ZDXF 5DC9B 4LCIL 1XGTB 2IBZY 5A16A 5IOPA 4RCAA 1FDLH 3DPBA 5DWUH 4IIQB 2X70B 4P46D 3TJHD 1EMTH 3HNSL 3M8OL 5I1IH 3MGOA 1D6VH 2CO7B 3RY4A 3UAJD 3CLFL 3PGCA 4EDXB 1NFDA 1NDMB 1E6OL 3BP6A 4R0LB 4J7RA 1NCUA 3HRPA 3PWLB 35C8H 1BVLB 4P5MA 4QRTB 4PRPB 5DHVA 5IBUG 1ES0A 4X9HA 4HMDA 4FRWA 1RIHH 5EU5A 2LTQC 2G60H 5F7FA 4FTVB 3TA3C 1FP5A 3QULB 4ESKA 5E2WL 1T0MB 2AQ3A 1NKOA 4BFIB 4ZUTA 4R96B 1GZPB 1QSEE 3OF6D 1HWHB 3S36H 4HCRA 4OM0H 1T83A 1NANH 5EG6C 3QDGB 1JPGA 1RUKH 1ZA3B 1IRAY 1FZMA 4P59L 3FKUS 1F11B 3QUZB 4TUKH 2VB5A 3IFPB 3CUPB 4Y4KA 3NCYS 4L8CA 5LG1A 5DMKB 3GI8L 3NCBB 3B9DA 3QJHB 1FBIL 5TDPB 3RI5F 3WHXA 4D9RD 1KTRL 3T0EE 3UP1A 4GJTB 5DD6B 5K33A 5EN2A 1GGIL 5EU6D 5C6WH 4CVXB 4AH2B 4ISVA 3LRSB 3QR2A 4OZFH 5KVGL 5MENE 4PB9H 4N9OB 3OX8B 4LSQH 4PJBB 5HDLA 5ACMA 3BO8B 2NY4D 3D18B 3N9GL 5SWSE 5JW4N 2DQDL 2Z9TA 2EDXA 4PJIA 1AJ7H 4K3DL 2YKLL 4CGTA 1HEZA 4PJXF 5GZOD 4L8DB 3HNTL 2HG5A 4QHLA 4ALAH 2WQRA 3UJIH 3B3IA 5TE7L 1OSZA 2YC1A 5JPMB 3P9LB 4RX4A 4OZIE 5TE4L 5JZ7C 4RGOL 5GGSY 4BQ8A 5ESVB 4DEPC 2F54E 4XP4H 3DX7A 2IH3A 4J8RA 4PRIA 2B7DT 3C6LD 3QG6B 2NPLX 3IFNL 1YMHA 4YDIL 2Q8AL 3P77B 5ALCH 4XPHL 5DUBB 1IT9H 1OPGL 2V7NB 1BEYL 4QOKE 1BHGA 1U2HA 1VACB 4N1EA 3ZKXB 5F6IB 2NY0C 2UY6A 1EFXB 5ANMA 4Q9RH 1AXSA 2VWEE 1JWMB 1L6ZA 4H26A 2OBGA 1I8MA 3T0DA 1K8IA 2JJVA 3AMKA 4YLQT 1MHEA 4Z7VF 5I30H 2F15A 2HVJB 4G7VH 4EEEA 3O11A 1FHGA 4HUXB 4K71B 3I6KB 5ABDE 5CHNB 1UH4A 5EULV 1AR2A 2P46B 4O2FB 2MKLC 4XBEL 4BKLA 1F2QA 1QLEH 3QNXA 1G6RL 2FECL 2ORBH 1LDSA 4K7FB 4DCQA 4B41A 4OZ4B 2YRLA 3DLQR 2ICES 3SKOB 4MA7L 5IMMB 5IW1A 3LMJH 4Y89A 2ATPB 3N1MC 1S7RA 3FO1B 1V3LA 3I75B 4G8IA 3QH3A 1GSMA 4HC1L 4MNGB 4I2XE 1G7PA 3IFOB 6FABL 5EBWB 4PP1C 2MFNA 2YN3A 4QRPA 1NUDA 2LTQB 4LLMA 3TA3B 2OTPA 4X6CF 1QFOA 4OJFH 2JB5L 4YGVA 1D5ZB 4KKCC 1XF2A 5GGUA 1EXUA 5C8JA 4ZYKA 3KLDA 4CW1A 1GPOL 3G04A 2FO4B 4U1JA 2C4FU 2IBZX 5MEOB 5F44A 1PQZB 3AY4C 1IE5A 3ES6B 3V0WL 3EJJX 2WBKA 1MUJB 1HSBA 1OARH 2EEDA 1EO7A 2IQ9H 3VA6A 1QQDA 4Q9QH 4OFDA 2W65B 1JNHA 1BQLL 5C07A 1ZLSL 2ED8A 2W0FB 4Z7NE 5JOEA 1C08A 1EHAA 5D93C 3TIEA 1JNNL 4KMTH 5FEBA 3CFEA 1MJUL 3BZFA 4MX7A 1GC1L 4JPVH 4JZNA 4PJDE 4X8JA 3QIBD 4JLRB 1OGAE 4WFFE 4YFDB 3U7YH 4FFYH 3VFMA 1RUQH 4K9EH 4GLRI 4FXKB 3O4LB 1KPRA 1HDMA 5CBAB 3CLEH 4XP9H 4ELME 4LNVA 3GHEH 4PJ5A 2ZPKH 3OKNA 4P2YA 1V3KA 4JY5L 3GSOB 1Q0XH 4A6YB 1IAKB 1DCLA 4KZEL 2BMKA 5FKPB 3RWHB 3ZLQC 2KPNA 4NQCE 5JQ6L 4M02A 5D7SH 5CWSB 4RISL 3TJEL 4G43B 3GSWA 3S36X 3FT3A 5I1AA 1NBYB 3QQNA 4X83A 5JR1L 3QEQA 1HHGB 2VDKH 4FQHA 2EDWA 5I8CA 1M4KA 1QFHA 3X11B 4XC1L 4X4ME 1KTDA 2VN7A 3BP5A 4DEPB 3C60C 2FATH 5D6CB 1FL6B 4M93C 1FCCA 4CVWA 3MLPA 2PO6C 5DSCB 1OSPH 2CDGB 4LVHC 4BJLA 3L95A 4OFKA 4MDIA 3BGFC 4ZDHA 2NY0B 4HJGA 3PDGA 1MCFA 5E99L 3V7AE 2GJZA 3V0VA 1O0VA 1HKLH 3DUUB 4YJZL 1T03L 2BVPA 2P48B 2FX8H 3AB0B 4ODTH 2HLAA 1FO0L 1OW0A 2R56H 3N06B 5TH2A 1KGCD 3EYFA 1VERA 1CVRA 4M6NL 1K4DB 4I8DA 1CICA 1D9KC 3IKCB 2VXTH 4P2RD 5JW4Q 4ACPA 4LGSB 3QWOA 2HJFA 3NA4A 5C7XH 5B39B 3FFCB 5ID1A 1FNAA 1JJUA 2QQKL 1U95A 3H7BA 1Y6KR 1RK0A 3KYKH 3RWFA 1MLBA 1MHPH 1A4JB 3UEZA 1T80A 1I85C 4DGVH 5D2LF 2E5EA 1LO0L 1U3ZA 4MB3A 3SE4C 1SM3L 3DIFA 5LAXB 3ULVF 5IROC 1EEQA 1CZ8L 2FGWH 4EUPG 3K1DA 5FYJH 3U2SA 5GXBB 1DQJA 1INQB 3G5XB 2OZ4L 4Z18A 3SJVD 4OLVH 4M6OL 3MRBB 5L88L 4HXBH 4NHUA 4X7DC 4BUHA 1A1MB 3K80A 4JHWL 1R3IL 1R5WB 4JFPA 2CH8A 2N7AA 1NGWA 1KPUA 5FM4A 1PKQB 3GFUA 5DJ2B 5D93B 1ROWA 3IJYB 5JXEA 1S7TA 3FRPG 1M71A 2UY7A 2DQFB 5IKCB 3BKML 4GAGH 1I9IL 1NLBH 1TJHL 4PGEB 4YPJA 3WJLC 3SOBH 1P6FA 4POZC 5ETUA 4YFLF 2YD2A 4W81A 5KSAA 1I8KA 3WDHA 2OTWA 3BHBB 4PYHA 2IWGA 2EYRB 4OTXH 4YNYA 3ULUC 1IC5H 4BQ9A 3SHSA 5FO9A 3L7FA 2AK4A 3PP3K 4U2ZA 3JWDL 4N0UB 1IGIL 3VGEA 5C0FB 1ZTXH 5CIPH 5E00B 3W81A 2X4OB 3SN6N 5IB3B 3VXME 5D1XA 4NJAH 3MCG1 3PDOB 3QI9D 1MCLA 3ZE0F 1JHTB 5KVFL 3SJVB 1JGUH 4F58L 3QNYA 5GGVH 3S7GA 1QBLL 3R06B 5TDOA 4P48A 5GGSB 1GGCH 1CU4L 4JJHA 3X3GL 4N0CD 3C60B 3HZKA 5KJRH 3MA7A 4M93B 3CIQA 3U36A 4JKWA 1QKZH 2PO6B 4N90D 4LVHB 4OFVA 3W2DL 5JIKA 5HHME 3VFVB 3BGFB 5GGVY 5GGTA 1MCBA 1WWCA 2X4NA 4ODHH 4XXCA 4OUOA 1KNOB 4QRRA 1JUFB 2CLZB 2ZUUA 3C2SA 3HB3D 2UZIH 2AJ3B 3NZHL 3S96A 4YHZH 1ZSDB 1ZHBA 3QCTH 2WUCL 3RPIB 3D2UB 3WJJC 5T1KB 3K2UH 1OOAA 4JN1H 1J11A 3KYOB 2BSTA 1WFTA 3U6RB 1I1FB 1D9KB 2ED7A 4OFPA 4NKQB 4LOUD 5CGMA 4M1GH 4BQCA 3L1OH 3FT2B 5DEZA 5I1GH 1I1AA 3SBWA 1L6XA 1BM3H 2F53B 2DKSA 5HBBA 3QWRD 1VDGA 4RGNC 4X6DA 3EYSH 3DETC 1IAIH 3MV7A 1DLFH 1YEEH 3B8SA 4M61A 2VABB 3BIBX 1FV1B 1J0KA 4TTGA 1ZHKB 2P5WA 1MEXL 3MRLB 4M6AA 3UTTD 2NZ9C 1JPSH 5LQBH 3DX8B 4DN4H 2FX9L 5IHLB 3OKLA 5GS1C 2C7UB 2DQGL 1GGTA 1CLYL 5EUKB 5ICXB 4RFEA 3L3GB 3VFOA 2O26U 1T4KB 3MMEB 3JWOL 2DJSA 2IPTL 1N6QH 1BLNA 3B6SB 2DYPB 4OBRA 1TJIH 4M1DH 4QF1B 1VB9A 5B3JF 5FHBH 5F7KC 3U0WH 3X14B 3QDJA 3E3QC 4HIJA 1U8IB 3FQRA 4KKNA 4YQXH 5IBTH 3EDKA 5E03A 3TPKA 5KBNC 5IB5A 3DO3A 1BOGB 5I1EH 5DT1H 1DN2A 4MD5B 1WWWX 3R8QA 5DK2B 3N1GC 2IGFL 2VR4A 3V6OA 1NGZA 1YN6B 5I0ZA 2PXYD 5SWSD 1JWSA 5H2BA 3CH1B 2WANA 4HLZH 1WZMA 1FVEB 4TSCH 1QRNA 3QIWA 1LDPL 4PV8B 3FB5A 2UV3A 4H1LG 3BAEL 1DSFH 1CDYA 3OMZA 2OJZL 3HNVH 4G6JH 4ONHB 2A6IA 3MOBL 4O9HH 4Q0XH 2Z31C 5EORL 4JFFD 3ZKNC 2A2QT 1DQDH 1OCWL 2Z8SA 5EU7E 3U0PA 1JRHH