2FJGB

Structure of the g6 fab, a phage derived fab fragment, in complex with vegf
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
223
structure length
218
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTISDYWIHWVRQAPGKGLEWVAGITPAGGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARFVFFLPYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor/immune system
molecule keywords Vascular endothelial growth factor A
publication title Structure-function studies of two synthetic anti-vascular endothelial growth factor Fabs and comparison with the Avastin Fab.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 218
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fjgB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fjgB01
4HJJL 3ZE1F 3S5LG 4E0RB 2BVQA 4OUOA 4YJZL 3VXSB 4PV8B 1JPFB 3O8XC 5HGDA 3TIEB 3F7YB 1MAML 4JO3L 4LSUL 1GGCL 1E4KC 2X9YA 3MLSL 4L8BB 4TTDC 4X99A 3VWKA 1C5DB 4RQQB 4MJ4A 4MDJA 1B3JA 5E03A 1N8ZB 2BNRB 1CE6B 2FYYA 3BWAA 2Z93A 2X70B 1MRDL 1OTTC 3GEWB 4YBLB 5E7FA 5CMAA 3ZZ1A 4YXKL 1ROWA 1KT2A 3ZHLA 3FCTB 3PWVA 4F7EA 3DHJA 1E28A 3QWOA 2ICWA 4MJIB 4O4YL 5BMFH 4N5ED 1QQDB 3X14A 3C5JB 3RVUC 4Z6AT 1FIGH 4MAYB 4ODHL 4QGTA 5I1CH 2ADFL 3H9YA 5IVZB 5CINH 4HC1H 3C87A 2Q7YB 4F9PA 2W0KA 4WGVB 2F19L 3AGVA 5L2JA 1J05A 1DQLL 3S88H 1KEGH 2NY0B 4LCCC 3E2HC 43C9B 4MA8H 1DQJA 4LLAA 5DJCB 5IQ7H 3PQYD 1FE8L 1QFUH 3CDGA 3RA7L 2GSIB 5LGKA 1EGJH 3UYRH 5F71A 3IJSB 4OLVL 3F7QA 5F1NA 3TVMA 3VFTB 4G43A 3BXNA 2OMNA 2VNCA 1GGUA 4U1NB 2BHYA 3HI1A 1DZBA 1AFVH 3ME0A 3UPRA 3WXWH 2UZIH 2NY3B 2ZG1A 4F7MA 4KMLB 1JNLL 1I3UA 2QJDA 4X7DC 5FYJE 4PJFB 4MD5B 4EDWH 3BJ91 4ZXBA 3SO3B 1IM9B 5D8JH 1FBIH 5CJBA 4HK0A 1SEQL 3HN3A 4Y19B 1JHTB 2FEEL 5E6IA 4AMKH 3C60A 3I2CL 4WV1A 5IG7B 3WNNA 3FQTA 1LO5A 3O6KL 3P4LA 4N0UB 1S7UB 4QHMB 1QBMH 2AXFB 3GSUA 1IAOB 2EH8H 2XQBH 4QRRE 3ZHDA 4DCQA 1SJHB 3KLDA 3G04A 3DYOA 4XP5L 4X8XA 1X5JA 4E42B 4R97B 5MEQB 1BEYH 1I9RL 1P53A 1Q9KA 1A7RL 3BOVA 1T5WB 3QJHB 4I3RL 2ED8A 5HDBF 2VIRB 2FBOJ 4NFDA 1LEGB 1UB5B 2HVJB 3ARDB 1HH9A 4O2FA 3UTTA 3WLBA 1EJOH 1Q9LA 2Q76B 2ZJSL 5H37H 5EU6E 4C57C 4GXVL 5GRUH 1T6WA 4P2CG 4ETYA 5CGTA 5F9OL 1CG9A 3NVQA 5KJRH 3X3GH 2NPLX 4D0BB 2VXQL 5F7WC 5EUOF 2ZUUA 4OD1H 5ABDE 1LNUA 3LKNA 3ARQA 5EO0A 1U8OB 4CRPA 1DUYB 1VFMA 4MHHI 4YDVB 4GAFB 4X83A 4KRLB 1KIUA 2ZZUT 3QUMH 4PJ9D 3MMEA 3L7EB 5HYSA 5MP6H 5KBNC 1CS6A 2XN9A 2HMIC 3V6FA 3BO8B 1MFCL 4ZFFB 2ZPKH 5C2BH 3QWQB 5IB1B 5EIQA 2CGRH 2J8UE 3KDMA 4XH2B 4IIQC 4DQOH 3R06B 4P2RE 5DQ9B 4GG8A 2R4RL 5CUSL 5E8EB 4Y4KA 4FXLA 3QIUB 2R1WB 5BV7B 1QFWL 3VFSB 2P7TB 4JPVL 4HWEH 5ID1A 5HHPA 4FFVD 4ZUTA 1JZ4A 1ZSDB 4O5LL 5LJYH 1Q38A 1W0WA 1T04B 3KR3L 1Z9SA 5ESQB 3QXVA 5FYJD 5C07A 4PS4L 2PNDA 4LBEA 2MQ0A 3FQWA 4AH2A 5KSBB 2HA1A 5TJWK 4LGRB 3D3VE 4WW1A 3VGFA 4YO0A 4DFHA 3LKOB 2X9XA 1KGCE 4UI2A 4X6EB 4UTAH 3KPNB 3LAFA 5A40E 4PJGF 2QR0A 4OIBA 2N1KA 5JXAH 1ACYH 4LCYA 4K2UH 4QRRD 3QUXC 4LHUG 3CUPB 5C7XL 4U1MB 4HUNB 3EHBC 3L3DB 3WFEL 1PVHA 3S7GA 4H8WH 5FKPB 3N1MC 1P4BH 4JO4L 1FFPB 3IDJB 3U7AA 3SOBL 1NFDF 1WBZA 4M6OL 3HPLB 5F1KC 4ZO7A 2NY2C 2AXHA 4JRXE 4Q6IA 4GKZA 1FORL 5MI0C 5ICYA 4KKNA 5EU6D 2CIIB 1CGVA 5EBMA 5E1AB 4FMKA 5TH2A 5DMIH 5ESAA 4Z0BH 4PJCF 3TPUB 1RZGA 3AREB 4R26L 5JPMA 4JQIH 1Q0YH 2VDOL 4K23H 4HS8L 5LGJB 3SKMA 5MEPB 3E0GA 1CGWA 5IF0A 5JPNA 1OAZL 2E5EA 1WWWX 2KBGA 2VUYA 5M7QA 1AIFA 1RUAL 4LLUB 4MVBD 1FN4B 1G6RB 3RVWC 1UQSB 3IFLH 3LCYA 3O8XB 1J5OL 4O2CA 2DKMA 5C0EA 2M1KA 4Q9QH 2QQKL 3HCVB 3MNVA 3GSVB 2D2OA 5I0ZA 3U36B 4OI7A 2E7MA 4LLMA 3CVHA 2Z91A 5JLZA 1BJ1J 2WBJC 1MNUH 3FO1B 2R4SH 5HD8D 4PJXF 2ITCB 3WS6C 5CD3B 4ZPTB 3DRQA 1WCBB 3S36L 3WFZA 2R9HD 5CJQL 1IC5H 3N1GC 5DJZB 5I66A 1ZT4A 1BFTA 2BVTA 2OK0H 3ZYIA 4G7VH 3AS0A 4BZ2H 4LRNL 1WFUA 5LGHH 3D3VD 2O26U 5IGXL 4JG1L 3T77B 2GJJA 1UWGH 4KI5F 2APFA 4NJ9H 1K85A 4LLDA 1BBDH 2VSCA 3JVGA 2DI7A 2CJUL 5C0CB 5I1IH 1PKQA 3BMWA 3L5WB 1TIUA 3FO9A 2X41A 2VDLL 3MRLB 4XP1L 2BNUA 1ZHBB 1YEHH 3IYLW 3T0XA 4LCCB 4LLVB 1DQQB 3E2HB 5JTWA 5C0BA 4I2XB 1S7XA 1HQ4A 2YWZA 4BUGA 1A9EA 4N5EC 5BV7L 2DQFA 4PJDE 4YWGL 3U7YL 1V3LA 1JV5A 3MXVL 2ZUWA 3WFHA 4KTDL 1JTPA 5FGRA 4FP8L 1FNGB 4WO4A 5FDWA 2ZOLA 2PR4H 3P0YL 4OM1H 3QT2A 1TETH 3UBXA 1J1XH 5T3ZE 2ADIB 1H8OA 2NLJB 4I48A 4OZFG 1KB9J 1FDLH 5D7LE 4DOHE 3U1SL 1M7DB 4J6RH 2FBJL 1G1YA 2JLLA 4CNIB 3S37H 5C9JA 5I1HL 1MFEH 3SKJL 4LF3A 4E0RA 1H3UA 1YEIL 4PUBH 3VXSA 3HB3C 4PV8A 3DROB 3TIEA 5FYJH 4HXBH 1U6AL 3NCCB 5DD5L 5DHYB 4L8BA 5EZOH 3N85L 4RQQA 1H3VA 3U46B 1N8ZA 2UZXB 1X5AA 2BNRA 1U58B 2FZ3B 1I7TB 4PLJD 1CE6A 5MERB 3LSOB 3B4NA 1F4YH 3DSFH 1MCOL 1X5ZA 1GHFL 3ZKMC 3L3OB 3ZLQC 3FCTA 1MFBL 3BD3A 2W0PA 1KC5H 1EFQA 4MJIA 3QNYB 3ULUE 2LVCA 1NQBA 1QQDA 4LPUA 1SBBA 3OAUH 3L9RB 1L0YA 4MAYA 5HGBB 5ANMB 3MV9D 3SO5A 5I30H 4JZOB 1N6VA 2PYFB 1HIML 5IVZA 4QLRA 3MGOB 1JN6B 5DRWB 1B0RB 2BSRB 1G6RL 1HHKB 4Z7VE 4XNUH 2P24A 4DN3L 2J6EL 1U8KB 2DQEH 4QHKI 3PWLB 4H5SA 3F6LA 1S7QB 2GSIA 2XOTA 3B5GA 4G6AD 4IIQB 3IJSA 4G9FA 2Y5TB 3VFTA 2DLFL 1OGAE 4U1NA 4BSVB 4Y5YC 2Q86B 1IM3A 4CJ0A 1J8HB 2AJVH 5T3ZD 3H0TB 4KC3B 5ALBL 4PJFA 4H1LG 4MD5A 4YGAB 1JHKL 3FB5B 4PBXA 1IM9A 2DLTA 5IW6B 2XRAH 1Q1JH 4Y19A 2NY4D 4PB0H 4MQXD 2DQJL 4U7MA 4WI6A 5IG7A 2H2SD 3O9WC 5KVDH 1AQKH 4N0UA 1S7UA 4QHMA 1L6XA 3OXRA 1IAOA 3BKML 4FFVC 1GOFA 3D87B 3QUXB 2G75B 1CLZH 5MEQA 1P9MC 5D1ZD 4G5ZL 4K07A 4JLRB 5I8KL 1T0MA 2CDFA 1T5WA 4GQ9H 4PIRF 3C8KB 2VIRA 4ZSOB 1W72H 4XCYB 1T2JA 3ILQD 4PGJA 3MUGA 4LMQE 3ARGA 3BSZH 1UB5A 2HVJA 2OTUB 1XGTB 5C2UB 4QXUH 2ERJC 2NY2B 5JHDE 2Q76A 1LO4L 5D2LB 4NC2B 5MI0B 5FFLA 1BREA 2VXUH 3R1GH 3ULUD 1E4WH 1Y18A 4TRPL 1MVUB 4D0BA 1I85A 1TVDA 2YK1L 3AM8C 1S78D 1OP5H 4CADB 2AKRA 3OPZH 1U8OA 4ZO9A 2ESVD 3KJ4C 2ZUSA 3JTSB 1EMTL 2BERA 2DYPD 1U3YA 4MSWB 3L7EA 1D3CA 5IFHH 4M7LL 3ARPA 1NBZB 4P57B 5SX5H 3T2QA 3W2DH 1KCSL 1N3NB 3TPKA 3BO8A 2ITDB 4ZFFA 5IB1A 3HUJA 3QXAA 4XH2A 1I9IH 1OAUH 3R06A 1C12B 3IDNB 1XGYH 5DQ9A 3ALXA 1DANU 5E8EA 3MJ7B 1YEKH 4X9HA 1OGAD 2R1WA 3QIUA 3MLWH 4ZUSB 4POYA 3VFSA 2P7TA 2EIEA 2WBJB 5C0AE 4L3EE 4Z76B 3UPAA 1R0AH 1ZSDA 1NCUA 2GIYA 4NQEE 4FA8A 3VRIB 3ZO0A 1MJ8L 1T04A 4XPBL 5I71C 1GXEA 3EYQC 5HVFB 2YA2A 1JPGB 2P46B 5DRXB 8CGTA 3VMOA 4Z7NE 2A77L 1NGWB 2G9HB 5CP7A 4S1QH 5BMFL 1B88A 2IPUK 5K9QG 3KPNA 3WKMH 5F7FA 3X3FH 3SGEI 1FIGL 3HNTH 2KKQA 3WIHA 3BDXA 5ACLA 5I1CL 3QNXA 3L6FB 5HD8C 4I77H 5CINL 3CUPA 4U1MA 2A6KA 1GCFA 3L3DA 4FTVE 3QQNA 3PWNB 2PUQT 2R9HC 3ZTJH 3S88L 4P99A 5BVJB 2YMXL 1QHPA 3FN0H 3IDJA 3NN8B 4M9PA 3B5TA 4MA8L 4TOYH 2HTLD 3MOAH 5IQ7L 5H8DA 1QFUL 4EI5D 4NO0D 2Q3AA 3MO1A 5TE7H 1EGJL 3UYRL 5JHDD 4Y16D 3QUYA 2CIIA 4LSVL 5E1AA 4G6JH 1EA9C 4R4ND 1KJ2H 1AFVL 3TPUA 3AREA 4R3SB 3VG9C 3WXWL 2UZIL 2B1AH 5LGJA 1RUPH 4ZOBA 3V52H 1OTUD 5MEPA 5D1XA 2YBRB 3PQYB 3GK8H 2H3NB 4KDTC 1P84J 5CZVH 3EGSB 4EDWL 3DJ9A 5T3ZH 4LLUA 5D8JL 1FBIL 1FN4A 4OKVA 1G6RA 1J18A 3SDXB 3O8XA 4MMZC 3RWDB 5D9SB 4AMKL 1BVKA 5C09D 3X13A 1AD9B 1A6TB 4NQSB 5DA4A 2VZSA 3HCVA 2ZCHL 3GSVA 3O41B 3U36A 1QBML 4WFHE 2L7UA 4RFNC 2XQBL 2Z31D 4GMSH 3ZE2E 3NA4A 1JI2A 1A3RH 1R24B 3FO1A 1MCQA 3IDGB 4CVXB 2ITCA 5CD3A 1BEYL 3GFUA 4WI4A 1YPZA 1WCBA 1WK0A 4NQED 1XGQB 3MRBB 2LTQC 1YDPB 1UH2A 1MH5B 2CRIA 2D9CA 3BN3B 1N7MH 3H3KA 4YX2H 4Y5VC 1EJOL 3T77A 3D5OF 4XAWH 5J1TC 4HIEB 5GRUL 1XGUB 2I9LB 1BOYA 4PLJC 5C0CA 2ATPB 2BNQE 1RJZB 3OWEA 5KJRL 3X3GL 2VXTH 3L5WA 3ULUH 2WWMD 3FFCE 4OD1L 3G5XB 3MRLA 5EU3B 1ZHBA 3CFBB 1M4KA 1AXTH 4U33A 4LCCA 4KK6C 1DQQA 4LLVA 3E6HB 4NZJA 4FTVD 1K8DB 4O00A 2SEBB 5MP6L 3UZVB 3TFKD 3MUZ1 1EXUB 4MA3A 5F93C 2R29H 2ZPKL 4GKSA 1GGIL 3W82A 5C70A 2CGRL 3BESR 4RMUA 4Y5YB 3CMGA 1FNGA 5DR5L 2X9WA 3LHPH 4PJ8D 3PWPE 2I24N 2ADIA 5D71H 2NLJA 4OCWH 2X4OA 3NABH 4HWEL 4N8VG 4PV9A 1SVZA 1M7DA 1KLGA 1CXKA 4UV4H 1A4JB 4MNGE 1S7VB 4CNIA 4PJAE 3ARBA 4G6AC 4W4OC 3KPLB 3MV11 5ADOH 1R3JB 4K3DH 2EZ0D 2GT9A 3F12B 3DROA 4OSUH 3O9WB 2YHGA 3T0EE 1ZKAA 5DYOA 1ODAA 4X7TA 3TCXA 2VZOA 5B3NA 2X4RB 4NO2B 3VFWB 3VDAA 5IMLA 5JXAL 4OAWA 2KQNA 2JJUA 4EN3D 1IGFH 2FZ3A 4FQXD 1I7TA 4WFHD 1ACYL 4Y5XA 4K2UL 5MERA 3LSOA 2CMRH 1MQKH 1T7VA 2APXA 3U30C 4PJFF 2DOCA 2NY4C 5JA9A 4N0FB 5ETUB 3L3OA 1H9VA 4ZUUB 5D5ME 5IHLB 1MHEB 2H2SC 1L7IH 1P4BL 2ERJB 3TZVD 4AQ1B 2XWTB 3QNYA 4BH7B 1HXMB 3L9RA 4ZUWB 5ANMA 5TQ0H 4HUUB 2PYFA 4QRRB 3UJTH 1QOKA 5KSVA 3MGOA 1JYVA 1JN6A 5D1ZC 1B0RA 2BOBB 4KUCF 5DMIL 3VG0H 3KJ4B 2BSRA 4Z0BL 5C6TH 1HHKA 2BNQD 1Q0YL 3ILQC 3FFCD 4JR9H 4K23L 1EJ6A 1U8KA 4OCLC 5IV2B 4RMQA 3D48R 3STLB 1F00I 3MC0A 6CGTA 3PWLA 1H15B 1TQCC 3R8QA 1S7QA 4HC1A 2MKWA 4CAGA 3ZSSA 5E4EC 3U0WH 3ULUC 4IIQA 1QR1A 5EU6B 1M1SA 1KTKE 1NC2D 2Z35B 2Y5TA 4OCRH 3IFLL 4JQVC 3I3EA 1S9XA 1MHCB 3C8HA 5CBEB 3ARFD 1S78C 4EEEA 2B7DT 4WUUE 2MCG1 3DOSA 1UJTA 4Q9QL 2Q86A 3GMOB 3HAEH 2EDQA 5IEHA 1J8HA 1EGJA 4LCIH 1Z6JT 3VDCA 2WANA 3CFKA 2D31B 5I71B 2R4SL 2R2HB 3FB5A 3CAFA 4DKAA 4RAVB 4PJIA 1J7VR 3O0RH 5IW6A 4MWFB 4HLJA 5CJ5A 1PQZA 3RFZC 3I3DA 1IC5L 5FM5M 2EDXA 4I0PD 2OK0L 1QLFB 3NOIA 4G7VL 4P2RB 4BZ2L 5LGHL 1BWMA 4M93C 3V6BR 4LCWE 1CK0H 1YUHB 5GS2D 3T0ED 4QRQB 2FJHB 3OB0K 3OR6B 1UWGL 3PV7A 4NJ9L 1LP9A 1V7NH 1BBDL 3AS2A 3UMTA 3QUXA 4JREC 1YEGH 3SJVD 2G75A 3IVKB 4K71C 5AAMA 4JLRA 4L29B 5EULV 1KPRB 3C8KA 2VDRH 4ZSOA 3MRFB 1YEHL 4XCYA 2XKNB 3W0WE 1MQ8A 5KW9H 4QHNB 2OTUA 1XGTA 1LE9B 3D3VB 5KSBF 3UTZB 5D2LA 2VLJA 1FG9C 4JVWA 4ELME 4PLKD 2A2QT 1MVUA 1W72B 1YN6B 3VI4F 4CADA 4HS6B 4QRPE 2VDNH 2PR4L 3VG9B 5K9OB 4OM1L 2GITB 1J1XL 4CDGC 3TC9A 2EC9T 2VWEE 4MSWA 1FDLL 2DL2A 1NBZA 4P57A 4NKOB 2C4FT 1J0KA 1N3NA 3S37L 2ITDA 1MFEL 4EI5C 3O6MH 4OTXL 2RB8A 4JRXB 4MD4B 5FUZH 4PUBL 2DQHH 3QUMA 3IDNA 4R4NC 3WFDH 25C8L 5FYJL 3DVIA 1SEBB 2BMKB 1K9TA 2IPUG 4HXBL 1HHGB 4ZUSA 1JHLL 4RFNB 3QEHB 4WUUD 2WBJA 1OTUC 3LN9A 5EZLB 1F6AB 4Z76A 5EZOL 3G6JE 3ISWA 3VRIA 4A2MA 2UUDK 4G9DA 1XF5A 4HV8A 4KKBC 4RGMC 3IT8D 4QTHB 2G2RB 5HXMA 2LTQB 5FHBH 1F4YL 4ZTPH 1IARB 4QRSB 3DSFL 4PY8I 1JPGA 5DRXA 1JRHH 4PRNB 1KC5L 4GAGH 4UOJA 3SDDD 1NGWA 2G9HA 1VB9A 4XMLH 1NKOA 2XI9A 4M7KH 4Y5VB 5H2BB 3T65B 3BHBB 2XNAB 3OAUL 4UINL 4H88H 3RPKA 2Z31C 3P2TA 1K3IA 5EIIA 1OPGL 1OAYH 4GAYA 3VRLF 3OZ9H 5KG9A 3IKCA 3BIKA 3V5HB 2D7TH 3PGFH 3PWNA 1F3JA 5GJTL 2OM5A 3D0LA 2HT3D 4OCNC 4XNUL 1WIPA 2Y36L 2DQUH 5BVJA 4BK5A 3NN8A 2HN7A 2ZUXA 4PGEB 2VITB 5FUCE 4WI7A 3MV9B 2RIKA 2XG4A 4X4YA 1VESA 2WWMC 5GQBA 2A73B 3VGHA 4R3SA 3QUZD 2APWA 2DS4A 1YEEH 5KZCD 3QCTH 5IBTH 2D3VA 2DQTL 3D25B 2Y1VA 4EQ2A 5J1SC 2H3NA 1IEBB 4RMSA 2XICA 3D85B 3EGSA 3GB7A 1M71B 1NPUA 5E8DH 1OAQL 1A02N 4PJDB 3SDXA 4YFEA 2X1QA 2XRAL 1Q1JL 5CSBA 3RWDA 5D9SA 4U3CA 3D2UD 1AD9A 4PJ8C 1A6TA 5KVDL 1ZA6A 3O41A 5SWSE 5KTEH 3FT4A 1FNAA 3FONB 2L4OA 4JKPH 1HHJA 2EO1A 1R24A 4O9HH 4UILH 3IDGA 4YFLI 5D7LB 2BVEA 4CVXA 1CLZL 4DOHB 4KVCH 5HYSG 3U30B 4Q2ZB 1NCAL 1XGQA 2NY4B 3MRBA 3IFNH 4GQ9L 2R1YB 1FLTX 1YDPA 1W72L 1RJCA 1MH5A 1JIBA 1B90A 1MAJA 4WEMB 3ZDYF 3BSZL 5ERWB 4PYHA 1FC1A 5ESVB 4QXUL 1D5MB 1G6VK 3EYUH 3FO2A 4HIEA 1XGUA 2VXUL 3R1GL 4G7YH 4EN3C 3UCRA 4FQXC 2CO7B 3TIDB 4GQPH 1RJZA 5D1ZB 2DQIL 3OPZL 3G5XA 4LU5H 4FQQB 5EU3A 4XXCC 3CFBA 5M95B 2XKUA 3E6HA 4I1NB 4X4MA 3TCLB 1K8DA 1S5HB 3TZVC 1TQCB 2SEBA 2WAHA 5IFHL 4LMQI 1SJEB 1EXUA 2QADD 3W2DL 1GPOH 5E4EB 2LQRA 1U95B 4YHLH 1GVIA 4HFWA 1JZ3A 3U48A 4OLXH 1OAUL 1CXLA 3GMPB 4Y5YA 1XGYL 2ESVB 4KFZC 1C1EL 3G5VB 1YEDB 4UIMB 1UCBH 1IKNC 4O2EB 2MCPL 2DYPB 2VKXA 4LP4A 1QUNA 1C16B 1TVBB 3U6RB 3LRSB 4Z7VB 5L6YH 1ZGLM 2I07B 1R0AL 1P1ZB 2XTJE 1A4JA 3N50A 1S7VA 3V7AG 3T8XB 1U8HB 1R3JA 3NPSC 2BHUA 5EC1B 3VU2A 3OKLB 3F12A 2PO6D 3O9WA 3ARFC 3BVNB 4XCNB 2XZAH 1VEOA 5ACMA 4EZMA 3MOBH 1OGAB 2DD8H 4M93B 4NJAH 4S1QL 3WKML 1U9KA 3X3FL 3UTSE 3UDWC 2X4RA 3HNTL 4NO2A 5E99H 1D7FA 5KAQG 4JREB 5SWSD 4NNYA 1P9MA 3KVQA 4I77L 4K71B 5CEYB 4XI5D 3FRUB 4G6KH 4FQCH 1IFHL 4LHUD 4APQD 4ISVA 1NGPH 5ETUA 4ZUUA 1MHEA 2IMMA 3BDBA 3C2SA 4I0PC 3RX7A 4OCYH 3FN0L 1G7LA 2XWTA 4TOYL 3MOAL 4BH7A 3T0EC 5DMKB 4X5LA 4ZUWA 2DB8A 4RISH 5TE7L 2EDLA 4PJEE 1DBBL 4QRRA 2WBWB 3DWTA 3AM8A 2W9LA 3T3PE 2BOBA 5KSUB 1KYOJ 1KB9K 4YE4H 1AXSB 1A7NH 2B1AL 1RUPL 3V52L 3AMKA 1ZVSB 1LE5B 5JUEH 3STLA 4CW1B 3A6CL 3GK8L 1H15A 5CZVL 1ZHNA 4EI5B 2VQTA 1IC4H 5T3ZL 5FGBC 5JHDB 4PLKC 4NQUA 2Z35A 3LD8C 5D2LF 3BI9X 4HBCH 3QDJE 4NN5C 1GRWA 1G7HA 3QI9D 1MHCA 3QNZB 5CBEA 3ZDXF 1CN4A 1MHHB 3SE9H 3VFNB 4S11A 5C92A 3P4MA 4NN6C 2W65B 4GMSL 3S96A 4S1DD 2D31A 1A3RL 4RGMB 3HZVB 1KNOB 2R2HA 1SQ2N 3VRJA 4RFEB 4YXHH 4RAVA 1U92B 1HCVA 5GJSH 2XTJD 1RAMA 4MWFA 1F4XH 3FZUD 2WSKA 5C09B 2J8UA 3KYAA 1QLFA 4P2RA 5AD0A 1N7ML 1IGMH 3KG5A 2AW2A 2FB4H 1YUHA 3V6ZB 4QRQA 2FJHA 3KPMB 2Z31B 1TJGH 4XAWL 1CDUA 3NACH 5C0AB 2GTWB 1MIMH 1T6VN 3KHOA 3UTSD 2VXTL 4NQEB 3ZDZF 3WKNA 5DDHB 3ULUL 1VACB 3NBNA 4L29A 5DHXB 1IGTB 4M8VA 1KPRA 1MCCA 4HKZB 1EZVY 1NCTA 5CGYD 3JV6B 4HCRA 4XVJH 2V9RA 1LE9A 3D3VA 4PR5B 4HD9A 4XWGH 3K46A 1A7BA 1UEYA 4XMPH 2R29L 3RVVD 5FO9A 1UWXH 1GJIA 1YN6A 1G9MH 5C0ND 4HS6A 4EQ3A 5K9OA 2GITA 2HT3C 4FTVB 4OCWL 5E94B 5JIHA 3NABL 4LEOB 4UV4L 1V3JA 2A0LD 2CR6A 5IOPB 3Q2CA 3HA0A 4HF5H 2Q8BH 1WEJH 2EXWD 4UBDD 5ADOL 4JRXA 1D6VH 4MD4A 3N1QC 1FL6B 4K3DL 1OAKH 1PBYA 4PJ8B 4OSUL 3DX8B 1FAIH 4ZO8A 3GSRB 1FGNH 3QDJD 3QUZC 2VN7A 1KXVC 1NCWH 3QEHA 1Z0MA 2FRGP 2VXSH 4DVRH 4C83B 1CTOA 4XBEH 1IGFL 1KJVB 2VWEC 5E24E 4XPAH 2EC8A 4QTHA 3K2UH 2G2RA 2VE6B 2CMRL 1MQKL 1WZKA 1EO8H 3QCVH 3BT2H 3HI5H 4K7FB 1URLA 3MA7B 4PRNA 1L7IL 3SDXF 1A6UH 3T65A 4Y5VA 5H2BA 1OCWL 3QG6B 5GGVL 3BHBA 4EN3B 4FQXB 1XZ0A 2FECI 3UJTL 4QEGA 3V5HA 5C0JB 3VG0L 4F7CA 3HC4H 2ICEB 4JR9L 1MCSA 4JO1H 3TZVB 3KPSE 4PGEA 2KL6A 3PHOB 4HIIB 2CXGA 2FD6H 2VITA 3B9VA 4U1HB 1SBSH 5HI3D 2NW2B 4R4FH 3TO2B 2HJLB 1EHXA 3RVXD 4OCRL 1JE6A 5D1QD 1QSEE 2BNQB 2A73A 3UTOA 1T0NA 1JZ8A 3FFCB 4DKEH 3G9VA 1FNSH 2NTFB 1ZT7B 1I3RB 2CK2A 5DVLA 1AGBB 2HJFA 3D25A 1RUML 4LCIL 4PB9H 1ZANH 1IEBA 3R4DA 3S4SB 3V6OE 2QADC 3D85A 3DVNB 5C1MB 1M71A 4M61B 5BOZG 3NPSB 1KJ2A 1NC2B 1G9MC 5DFTA 3O0RL 4PJDA 5FUCC 3MNWB 3V5DA 3ARFB 4XT1C 2VL5B 4ZPVB 1U8NA 1NJ9A 3PWPB 1KCUH 1CK0L 1GOGA 5GRJH 3FONA 3GMRB 4N1EA 1V7NL 1F58H 4W6XB 3T2OA 3MRJB 1IAIM 1YEGL 5D7LA 3KPQB 2VLKD 3MRDA 2K3TA 4MNGB 3O3AB 3MJ6A 2R1YA 2VDRL 3B83A 3GBNH 2VDPH 1MFDL 3DVFA 4I0PB 1I1YA 2PO6C 1O7SA 3P0GB 4UQ3B 5KW9L 4Y88A 5ERWA 3SKUD 3T0EB 5ESVA 1ND0A 1D5MA 4L8DA 4WY7H 3DURB 4NKDB 1PLGH 2JCCE 3HTLX 2ATKA 5D1ZA 3HC0B 1P5VA 4XI5C 4UNUA 4NCDA 8FABB 2R0KH 2OTWB 1CFVH 3CCHB 1P84K 1ADQH 4MD0A 3TCLA 1KN2H 1S5HA 5D5MB 1SJEA 1XR8B 3CD4A 3BRGC 1CDJA 1EBAA 1U95A 2B2XH 3MSPA 4OZFH 4ONFH 3KPSD 5A2JH 3O6ML 3LD8B 3O81A 4JQVA 2W9DH 4NN5B 4P23D 3MLRH 5FUZL 3GMPA 2DQHL 4OD3H 3EO1B 4NQDE 3WFDL 3G5VA 1YEDA 4UIMA 1DP0A 4JQXC 2DYPA 2Q7NA 4NN6B 3VGGA 1C16A 1TVBA 3U6RA 1QSED 3QJFA 3LRSA 2V9QA 1T22B 4Z7VA 1OOAA 2IPKA 1P4LB 3AVEA 4YHZH 1P1ZA 5DWUH 4GOSA 3T8XA 3T0VA 5FHBL 4ZTPL 5EC1A 4ZMAT 3S5LB 3OKLA 2LAGB 4M7ZC 3HMXH 3QI9C 5LKNA 4XCNA 1OGAA 2CUIA 2WQRA 4GAGL 1SMOA 4XMLL 4M7KL 4RBPK 4WUUB 5J9PB 4ZD3H 4X9BA 5E2WL 1AE6H 1XAUA 5EBWB 4R9HA 1OAYL 4P3WA 3TLRA 3OZ9L 3BWUC 3FRUA 4KGJA 2BY1A 1PX3A 3K8LA 2XTJC 3PGFL 3KWWB 1ERNA 2QHRH 2VKWA 1KTLA 3W5MA 1L7TH 2QTEA 3QFJE 3SDDB 1FYTE 2DQUL 3AS1A 2VH5L 1VGKB 4C58B 1NUFA 1CICD 5ILTH 1MCEA 3MRGB 2OR8A 1H3XA 5KSUA 3KYOA 4AENB 4P2OD 5MEOB 1AXSA 4UQ2B 1CF8H 5CGYC 1YEEL 5DRZB 3QCTL 5IBTL 1ZVSA 1I8MB 1LE5A 3W0WB 4CW1A 1OLZA 1X3DA 3MUJA 4EI5A 1X4XA 2DI8A 5E8DL 5JHDA 3RZWA 4OI9A 3RVVC 3OF6D 5IMMB 2QQNH 1D9KD 4P4KD 4ELMB 4DUXA 3QNZA 4ZG1A 4MJ2A 5C0NC 1MHHA 3QPXH 3OTTA 3QUZB 3VFNA 3NH7H 1A7OH 4WEBH 2ZCKH 4M6NH 1I4FB 1F6FB 4QRPB 2B1HH 1M7XA 4JKPL 3TWCH 5FV1L 3STZB 4FHBD 3HZVA 3G6AB 5ID0B 1KNOA 4KVCL 1GH7A 1RZ8B 4PPTA 2EXWC 5IJVA 3EDDA 3IFNL 3HAEA 4XP4H 1F97A 2FECL 3QDME 2J8HA 1JTTA 3CFEB 3V6ZA 1VFAA 3KPMA 3EYUL 1KPVB 3PNWB 4R2GD 1CFQB 3GGWB 2GTWA 5C0AA 1EX0A 4L3EA 4GLRI 1BLNB 3G6JB 4NQEA 3KXFE 3OKYA 3P3YA 3QB7C 2AEPH 1VACA 5DDHA 3QO0B 5ELIA 1IGTA 4YHPB 4LU5L 5JZ7D 1CLYH 1JPTH 4HKZA 5IB4B 5KS9E 3PABA 2QSCH 4YHKH 3JV6A 4ODUB 2BFVH 1NANI 1U2HA 1BP3B 2RHEA 3H3BC 4MNQE 2A9NL 3VMPA 1BFVH 1MJUL 3LEYH 3QFJD 4MS8D 3B9KD 1GPOL 4PR5A 3B9EA 5I74C 2H32H 3BAEH 1WC7B 5TPWH 1LK3H 3CSYB 4YHLL 5IB5A 3HI6H 3MR9B 4BFEA 2FDBP 4BFIB 1XF2B 3TP4A 4OLXL 1QFPA 1NUNB 1T7XA 5FM8A 4PGZA 2X89D 4D94A 1ZLSH 5LXGH 3NFSH 5CSZA 4IRSC 4FTVA 4LEOA 4DKFH 5L6YL 5CIPH 1M05B 2DTMH 2QADB 1JVKA 1C5BL 3MV7E 2DJ4A 4KKLD 5IOPA 5HI3C 3GSWB 3B9DA 5T3XE 3RL1B 4IOIB 1FL6A 2C3XA 3RVXC 2X7LB 5E00B 4PJ8A 3VXUE 5D1QC 4Z0XA 5F97E 2XZAL 4XB8A 4HX1B 3GSRA 3MOBL 1PSKH 2DD8L 4HS3B 3OSKA 5DO2C 3V4VH 4WW2C 1KIPB 4MB4A 4CVZB 3SBWC 3HKFA 1UKSA 1ZS8A 5FM5O 4PGDB 2BVUA 2VE6A 3TV3H 4G6KL 4FQCL 4ENEC 3H9SA 4QYOB 2J8OA 2PO6B 5E6YA 4K7FA 3UO1H 1NGPL 3QRGL 4RA3A 3DX9B 4OF6A 4L8CB 4PJDF 4G6MH 5BQ7B 4OCYL 3U83A 3QG6A 5D2NE 3NZHH 1EERB 2X1PA 4K8RD 1OAXH 4ODSH 1CI5A 1GSMA 5SWSB 4EN3A 3GBLA 4FQXA 4RISL 5GRVL 4QHKJ 4XXCA 4YE4L 2AQ3A 3IXAB 1A7NL 4Y89A 3TZVA 1LK2B 4ZODA 5AG9A 1NBVH 3PHOA 1J1OL 4HIIA 5DK2B 2IANA 3J8F7 4U1HA 2XT1B 3OJDB 2NW2A 1IC4L 3TO2A 2HJLA 1B9ZA 3O3UN 4HBCL 1LO0H 5D93C 2B0SH 3O3DB 1AD0B 2BNQA 1IKNA 2C1OB 4DAGL 1ZXQA 3HE7A 2F54D 4TNWK 3SE9L 1D5XB 3FFCA 4M6ML 4D0DB 2NTFA 1U8LA 1YZZA 1ZT7A 5GGUA 1X5FA 4CMMB 1AGBA 1U8MB 4OGAC 2EYRB 4X6BB 3S4SA 4X6DE 2VR5A 4M61A 4JKWA 4YXHL 3P77B 3MV7D 4M7ZB 1ZOXA 3MNWA 3QI9B 1F4XL 4OGZA 4P23C 4Z18A 4AIXA 4YDKH 5C9KA 3ULUF 5GGRB 5T3XD 4FMFA 2HFFB 3GHEL 4L8SC 3IFOB 3L5XH 1KIRA 2GQHA 1IGML 1LDSA 2FB4L 4K3EL 3VXUD 3PWPA 3UDWA 1TJGL 3GMRA 1IL1B 1G0DA 4UB0H 5D7KE 3NACL 3FN3A 3MRJA 1MIML 5A16A 4M3KB 3KPQA 5E9DD 4Z7VF 3LVEA 1CU4L 2XTJB 2E9IA 4MNGA 4XWOD 5D72H 3QDAA 4PJAA 3V6OC 3ZTNH 4I0PA 3NIDE 4QWWD 5T1KA 3MLYH 4P5MB 5T5FL 4XVJL 1QO3B 4WI9A 1AKJA 3T0EA 2RQ8A 3DURA 4NKDA 3IFPB 3T4AA 4NRZB 3CXDH 5J13C 4XWGL 4XX1E 5FA4B 3UTSB 4M4RA 3TYFB 3HC0A 1G9ML 8FABA 5D96C 2OTWA 1UA6L 4E41E 2RJMA 4YFLF 3IAGC 1HH6B 2HKHH 5D5MA 1XR8A 3SDAD 1TLKA 4ODXA 4TSAH 1CICC 4MDIB 1OGTB 2Q8BL 4HF5L 1WEJL 2OTPA 3MV8A 4JDZB 1KJ3H 1D6VL 2FHCA 2EDEA 3ZKND 1OAKL 5IT2H 3ILPB 3QXDB 4PJEB 3EO1A 1FAIL 4LVOC 3EDEA 4P2OC 4JVPA 1G7MB 4FS0A 1NCWL 4UDTB 3VFUB 4OZFB 1T22A 5K9JH 1E6JH 2VXSL 4DVRL 1YMME 4U1IB 5DEGB 4XBEL 4NBYB 4TUOA 3RU8H 3G9AB 3K2UL 2D0FA 4N68A 5DFVC 4JFFE 1RZJH 4FFYH 3S5LA 5DVNA 1EO8L 3QCVL 3BT2L 3HI5L 35C8H 4I3GA 3QDJB 3QBTB 1A6UL 2DWEA 2P4AB 1GC1C 1UC6A 1YMHB 4WUUA 3TVMD 5J9PA 3D18B 1CZ8H 1YY8B 2PYEE 4NNXB 2C3GA 2HYMA 4K8RH 5IKCB 5EBWA 2YS4A 4Q97A 3LKSB 5FEBA 5D7KD 3KWWA 5J6HA 1WZMA 2GSGB 3Q6FB 5TFSH 3HC4L 5F7KC 1JWMB 4ZXBD 1BF8A 3MRRB 1BQLH 4JO1L 4ZDHB 2NYYD 5CSGA 3L95B 5I74B 1E4JA 3WO4C 3MFFB 5B8CC 4L3CB 3NCYS 1SBSL 5E6ID 1T03H 3BYYA 4LCWA 5C86A 2XACC 4HW6A 4R2GC 4R4FL 3MRGA 3MJ9L 2ZSVB 2H2PD 1JNNH 3KNBB 5F6HI 2V5RA 4G3YH 3RHWF 5HVWA 3T2PA 5JZ7C 3NPZB 5MEOA 4IRSB 4UQ2A 4DKEL 4RNRB 4OFYA 1XCQA 1FNSL 5DRZA 1L9NA 4OIIH 1I8MA 4E41D 3W0WA 1O7VA 4PB9L 3UTPE 1ZANL 3B9KC 3QA3B 3P4NB 4XBPB 3S34H 3N0PB 4AIZB 1BBJA 1NDGB 4Z7NF 3RX5A 1MCWW 3UTTD 5IMMA 1EFXD 4JN1H 5DJ8A 5D1QB 2FH6A 1N64H 3QUZA 2P45B 1Q94A 4WW2B 1DL7H 1I4FA 5T3XH 2WM0A 3ZT7A 4QRPA 5CBAB 4LEXL 1KCUL 2HLFC 1JYXA 1HYSD 2WP3O 3BPCB 3LS5H 3CPLB 3VCLB 4QHLA 1F58L 2YPVH 3STZA 4KKLC 1FC2D 2R2BA 3G6AA 2JKXA 3VWJD 1RZ8A 2EDRA 5D7JD 1WGOA 5F6IC 3GBNL 2XN9D 2VDPL 4BQ8A 4JFFD 2X09A 4POUB 3CFEA 5K9QI 1WZLA 1KPVA 4J7RA 4KJWC 1PLGL 3PNWA 1MJ7H 1BECA 1PEWA 5EU5A 1CFQA 5BRZA 5J6GB 1JF5A 1KYOK 2VLKB 2C7UB 3NCMA 1BLNA 1U42A 3QO0A 4YHPA 3VFVA 1EEYA 2R0KL 4ORZC 4X0KB 5IB4A 1CFVL 1EPFA 4F3FB 2P8LB 1T1XB 4K7PH 3RP1A 4ODUA 3T0WA 3K0WA 5F1IB 1ADQL 2QL1A 3Q5OA 1DBKH 1KN2L 5HY9B 4U49A 3RIAF 3UZQA 2EDYA 3LKQB 4K8RC 4HKJA 2DIAA 2EE2A 5DQJA 1DBMH 1WC7A 3H9HB 4TPRH 3CSYA 4NHCH 4ONFL 3MR9A 4BFIA 1Y6MR 5JQ6H 1XF2A 1IAKA 5D93B 3MLRL 1BD2A 4OD3L 3TBYB 1VGEL 3ZE2F 2NZ9D 1A6PA 5SV3A 1PG7W 4JFHE 2H32B 4N90E 2NY1C 2YUVA 4ONHB 1M05A 2LE9A 4Y0GA 3OG4B 5DWUL 4OZIA 4Z7WE 3KPSB 3MLTA 2R0LH 3GSWA 5LBSH 3LDBC 3WNOA 4P23B 3UTPD 4IOIA 3LZFH 2X7LA 5E00A 3KLHD 2Z8SA 4MJ5B 4L8SB 3HMXL 4QKXB 2WWKO 4WRLA 4MYWB 4NN7C 2DAVA 1H8SA 1QSFA 5CIPB 3IU3A 2AVGA 4HS3A 4X6FB 1DFBH 4KZEL 3MACH 1QSEB 2CLRB 2IFFH 1LEIB 1KIPA 1GAFH 1AHWA 3P9LA 4CVZA 2YD8A 4KY1H 1KUMA 3B3IB 3BZEB 5DEFB 4C55A 3BZ4A 2W9EH 2NY5H 5ENWB 1CVSC 2QHRL 2PO6A 5E4IA 3DYPA 1L7TL 3DX9A 4L8CA 1UFUA 3LOWA 3NCBB 5J13B 3K80A 4DK3A 1V8HA 5I18H 1G1CA 3MRHA 5ILTL 5SWSA 3TBSB 1WWBX 3CZFB 2YEZB 1TENA 5KVGH 2F8XC 1RZ7H 3E8UH 1AP2B 5D96B 5FM4A 3IXAA 5M94B 2CIKB 4QWWC 4XP6H 5IW1B 3CX5J 1BFSA 5INCB 5DK2A 1CICB 1YEFH 1K3ZA 3OJDA 3VXTA 2HFGL 5D2NC 3QHFL 2JCCB 2EDBA 2QQNL 2HT4D 3B8SA 4BELD 4LVOB 5GRXG 4JQXA 4P2OB 3HZMA 3QPXL 3STBA 1ZT1B 2YZ8A 3ARYA 3NH7L 4QXTA 4WEBL 3WDHA 1AGDB 4KJPD 2ZCKL 4M6NL 1CDHA 1J88A 1E4XH 3MRQA 3U7WH 1Q9WA 3S3JA 4CMMA 1U8MA 2B1HL 5I16B 2JK5A 4JFHD 3TWCL 3L1OH 3FB8A 2EYRA 2YPKB 3SDAC 4N90D 4XPFH 3ESUF 5HYEA 3P77A 5D5MF 1A3LH 3O2VH 1LHZA 1JMZA 5KVMC 3QI9A 5GGRA 2VZ3A 4QOKA 4G9FE 2HFFA 5CEZE 3IFOA 4WJ5B 1BJ8A 1JGUH 3L7FB 2GY7B 3FRPA 2PCPA 2EDHA 4NQDB 4JY5H 4GH7B 1IL1A 3WFCH 4F9PC 3Q6GH 4XAKD 4IRJD 2D9QB 5L9DH 1O5DT 2AEPL 3ECBB 4R4BB 3ARTA 3GUTB 3TYGH 1CLYL 1JPTL 2JJTC 1K2DA 2QSCL 1HYRC 2BFVL 2ORBL 3JTTB 4P5MA 3GSOB 1QO3A 2YD6A 3CFJB 4JVUA 3WO4B 5B8CB 3UZEA 3VXSD 3MYJB 1BFVL 3IFPA 4NRZA 4R2GB 3BAEL 5TPWL 1LK3L 4KGLA 3HI6L 5FA4A 3UTSA 1QFOA 3TYFA 2NY5C 4OM0L 5KVFL 1JBJA 3KHQA 1IAMA 3MRIB 4A2LA 3L5IA 1ZGLP 1ZLSL 5LXGL 1OB1B 1BOGB 3NFSL 5IBUG 4ZNEE 3VD9A 3QZWA 4W4NA 1IC7L 1HH6A 2DRUA 5I19H 4DKFL 4OFKA 4U05A 2DTML 3QFJB 3B9KB 1JFQL 1FYTB 1N4XH 1RY7B 1TXKA 4JFZH 4HPOH 1G9NL 5E6IC 4M7LT 1OGTA 1UADC 1ED3B 2AABH 4MJID 4F33B 1EUTA 3VA6A 3ILPA 1ADQA 3QXDA 4PJEA 4MAYD 3ZHKA 2CLVB 1PSKL 4YHNB 4FQ2H 3ZL4H 3OKOB 3RL2B 1G7MA 4PY8J 3ARVA 4R96A 5FO7B 4UDTA 3VFUA 4OZFA 2DQDH 4N8VB 3WNKA 4U1IA 1TVHB 3EYFB 5DEGA 1AGFB 3SCMC 1D6EB 4NQXB 3PGCB 4YPJA 5HHXH 2NY0D 2W60A 3HRZA 1DLHA 5F6IB 1IGIH 3INUH 3R0NA 4ZOEA 3HUJE 2K7PA 3HFMH 3QDJA 3RTQA 2WUCH 3WL9B 4CU7A 5FYKU 3EJZD 4ELMF 3ZTJG 4G9FD 3WLWD 3BUYB 3NZHL 1OAXL 4NC1E 4CJ1A 3ESVF 1YY8A 4ODSL 1NCBH 5IKCA 3LN5B 1YNLH 4NIKB 2J7LA 3HMXA 4UOW1 3LKSA 1OLLA 3VWJC 2ED7A 2HAZA 4JFQB 4W68A 5D7JC 1DBJH 3LKRB 5DJ6B 2GSGA 3Q6FA 1R3IH 3CVHH 5DC0A 5B39G 1HNGA 4GMTH 4OF3A 1ACZA 5FAAA 5TDPB 4IRZH 2VLRE 4BA8A 1IM9D 3MRRA 4ZDHA 2P5WE 1NBVL 2C26A 3L95A 3UXFA 4MB5A 3MFFA 4L3CA 1GZPB 1BAFH 4HK3J 2WINB 4ZUVB 3IS1X 3VI3F 1E6OH 2ZSVA 2MMXA 1A6VH 3KNBA 4G8EB 1LO0L 4NRXA 3CU7A 2B0SL 3SGKC 1YA5A 3HE6C 3VW3H 4IRSA 4TUKH 3FHAA 3G6JF 4RNRA 4X5WB 3GMLB 2NY1B 3BEWB 5KS9B 4LPVA 1GC1L 3TJEH 2EECA 3RPIB 3QA3A 4MNQB 3OB0H 4N0RA 3LDBB 4XBPA 2ICWI 1NDGA 3FOMB 1T3FB 1YECH 2OSLB 3ARGD 4L4VE 4WDIA 4KQ4H 4JY4A 4UMGA 4NN7B 1RK0B 3NZ8B 1W0VB 5J06A 1Y0LB 2NZ9C 2R0ZH 3BP5A 3Q5TA 4WW2A 3RWEB 5CEXB 3N1PC 5CBAA 2VLLB 1QLRB 3BPCA 5IJKA 1T2QH 3SBWA 4UB0L 4HT1H 2IH3A 4N0YH 1SYVB 1ZAGA 3MV7B 1KCKA 5D72L 2NCMA 3ZTNL 4ALAH 3OBAA 4MQ7A 3MLYL 1FIEA 2WIIB 1R5IB 2VB5A 3VXUB 5DMJB 2F5AH 1J9CT 2H6PA 2FATL 5E5MB 2OZ4H 3CXDL 5I1EH 3LRHA 2ZP0T 1UM4H 4TQEH 3RBGA 3QIUD 3FQRA 3UJJL 4HPYH 1FL3B 4Z5RB 4HDIB 5HHOE 4X0KA 4BYHA 5IVNA 4F3FA 2P8LA 1T1XA 4OLUH 1EHLH 5F1IA 2PN5A 4HJ0D 4UTBH 3L3GB 2HKHL 5HY9A 4AEHH 3LKQA 2VLRD 5HGDB 4TSAL 2VZ1A 2P5WD 3H9HA 4PP1D 5D2NB 4IDJH 5HYQB 2AGJH 1XR9B 4RSVA 1KJ3L 2LU4A 2UUDH 3REVB 4X99B 5SWQA 5IT2L 3A6BL 3TBYA 3K1DA 4UDUB 4F8TA 2ENSA 4IEFB 2H32A 1XGPB 5K9JL 4ONHA 1E6JL 5CMAB 4L1HA 3SDAB 4Z7OF 3KPSA 3RU8L 4HFUH 4P23A 3VXQB 2GAZB 5DK3A 1QEWB 4FFYL 3LPFA 3T1WA 4EIZC 1E4XI 4MJ5A 4L8SA 4OLWH 35C8L 2B4CH 1FNLA 3JVGC 5CIPA 2Y6SD 3NAAH 1I1AD 4M7JH 1YC7A 1NUGA 1QSEA 3QUYD 2CLRA 2FH8A 1CZ8L 1LEIA 3MFGB 1CYGA 5L2JB 1UZ6E 4K8RL 5CEZH 3DNKA 4DEPC 3B3IA 5HGAB 1I7UB 2UV3A 2BZDA 5DEFA 3V6OA 4D9QE 4X6DB 5D1XD 5ENWA 1C5CH 1YJDL 3CDGB 2C3HA 5TFSL 3ARXA 4B5EA 1CL7H 7FABH 2FR4B 4AL8H 5T5NG 4ZFGH 1B4JH 3X11B 4MXVE 3HRPA 5JW4Q 1T03L 3TBSA 1LDPH 3Q0HA 3CZFA 3NFPA 3VXNB 4S10A 3UPRB 2YEZA 4IRJC 3BDYH 3JV4B 3KS0J 3VXME 1AP2A 4N8CL 1TTFA 1PEZA 4G3YL 2XWBB 1JZ5A 4Z95H 4K3HA 1W8NA 1YNTB 1S7TB 4MB3A 5GRYA 3LEVH 3ZE1E 2E8YA 3RBSA 1LEKB 4HGKC 5HHOD 3V0WH 1OTTD 3EOTH 3HAEG 5INCA 5F9AC 5E6IB 1CICA 4F37K 3VDBA 3KYKH 4XCCH 1LO5B 3KLSA 1H3WM 3S34L 4DGYL 1A9BB 3GSUB 2DWDA 2JCCA 4JN1L 2YZ1A 5JMRA 1P4IH 1U3HA 4UT6L 4GRMB 1N64L 4P2OA 1S9YB 1ZT1A 4OFVA 1AGDA 1DL7L 2UY6A 5T3XL 3BGAA 4GRWE 1FL5B 1MRCH 1Z5LB 3BUTA 3OJVC 4E41B 4HLZG 3ZE0E 2MQCA 3LS5L 2YD7A 5I16A 3SCMB 5CKGA 2YPVL 2CLZA 3GRWH 4PRPE 1HH9B 3OF6A 1EFXB 3AAZA 3WLBB 1R6VA 1T5XA 4JM2A 1CG9B 3L7FA 3CJJA 4FQIH 4PLNC 4NQDA 1WWCA 3EO0B 4X7SL 4H20L 1LNUB 3I02B 3FHQA 3AS3A 2P49B 3MMEB 4NWUH 1ZGLB 3VWJB 1YMMB 2EEDA 4EOWH 5HYSB 4P48A 3ECBA 4R4BA 4UV7H 5D7JB 2B4CC 3GUTA 2WUBL 2P48B 4JFFB 4K7PL 4D9QD 3ARBD 3JTTA 3FB7B 3GSOA 1DBKL 3CFJA 3P11L 1BJ1H 3EJZC 2RAMA 5B8CA 3WLWC 4NM8H 2P43B 1TCRB 3VMNA 1DBML 4TPRL 5JQ6L 4AEIH 1FG2B 1LP9E 1WIUA 3LH2L 1A0QL 5HHPB 3HE6B 2WLYA 4KK9C 5GXBB 3REWA 1MEXH 1BOGA 3VXMD 4M3JA 4KVNH 4Q9BA 1QACA 1MRFH 3AUVA 5IB2A 3QFJA 4NP4H 1FYTA 3B9KA 2QLVB 2JIXD 1MELA 3SHSA 4K9EH 4WW1B 2R0LL 4AK1A 4OZHF 5LBSL 5JDSB 2VLJE 1S9WA 1ED3A 1RULH 3LZFL 5FYJU 3WN5C 4B50A 1A2YB 2NX5E 3I6LE 1UJ3A 2FEEI 4YHNA 3TGXA 4GW1A 4OCSH 4ZNCD 1DFBL 3MACL 1G0XA 3OKOA 3RL2A 3IS0X 4RWHA 5FO7A 4D2NA 5F7UA 3OXSB 4LAJH 1GAFL 1TVHA 3EYFA 1F8TH 4KY1L 1AGFA 4V2CB 4NQXA 3PGCA 1KTDB 3SDCD 3L3IB 3DVGB 3CDCA 3KPOA 3ARGC 2G60H 4FQHA 2NY5L 2HMID 4M6AA 2IAMD 2OX5A 5LQBH 3QQ9D 4NCC2 4MJ6B 3MRNB 5JO5A 3WL9A 1H3TA 3LQZB 3KLAB 4I18C 3BUYA 5HHQA 5TH2B 4X7EC 5TF1H 5EU7E 4LFHG 4WW2F 5JPMB 3DUUB 3LN5A 3RQ3A 3GMQB 5E8PA 1CT8B 3SKMB 1J8HD 1FVEA 1T80A 4GBXA 4JFQA 3S4SG 2AJ3B 5HPMB 5DUPH 2ZNXA 2H1PH 2V6HA 3SKOB 3TJHC 2GKIA 2YC1A 5TDPA 4XP6L 3WCYA 5L8LB 1KSRA 1PX4A 4U7SA 2DTSA 3O6LH 3QDMA 1YEFL 5FDYA 1HSAB 3GO1H 4Q0XH 1Z9LA 2DQCH 2WINA 4ZUVA 2QEJA 1Q72H 3BH8B 4NC1C 2DMCA 1UM6H 3CVHB 1ZMYA 4X4XB 2MPAH 1KCRH 3KXFA 3RI5F 1MCHA 3QUXD 4DGVH 4X5WA 3GMLA 1E4XL 3EHBD 3U7WL 3PDOB 3BEWA 5KS9A 4HJ0C 2EIBA 1QFWI 4G8GE 1CD0A 3RPIA 4MNQA 1C8PA 1Q0XH 4PP1C 4XPFL 3FOMA 1N26A 3O2VL 4KJYB 5BJTA 2GW5A 4U4BA 4JFXA 1ZWIB 1QA9B 2VLJD 1RK0A 3NZ8A 4LLDB 1NCDH 1W0VA 2R0WH 1JGUL 1Y0LA 4BFBD 2FNBA 5CEXA 1SHMA 2VLLA 2VC2H 4JY5L 3I6LD 2C5DC 1H5BC 1QLRA 1JL8A 4K9EC 4WTXA 3WFCL 2BNUB 2XG5A 4DEPB 5IROC 5JNYB 3MBXH 1S9VB 5L9DL 3SPVB 1SYVA 3I75B 1S7XB 1HQ4B 4Z7WB 3ET9F 1X5YA 3TYGL 3PGDA 2HP4A 1U3JA 5DJ0A 1ZTXH 3FOLB 1Q9OB 3DXAA 4KUZH 3WFHB 1BWWA 3VXUA 1JUFA 1T0PB 1I1AC 2Y6SC 2FGWH 3QUYC 5FDWB 1DBAH 5E5MA 4IRJB 1XCTB 4ZFZB 4N0CD 5LWYH 3QO1B 4EUPG 1LILA 4I48B 2R2CA 1CL7I 1FL3A 3HMWH 4Z5RA 1IAII 4HDIA 4KRNA 5D1XC 4LIQE 3VFOB 5C9JB 1DJSA 5IFAL 4ONGH 3L3GA 4LF3B 4W81A 3CFDB 1N4XL 4JFZL 4HPOL 5D2NA 1RUQH 5HYQA 3AROA 5KVEH 1QTYT 2I60H 4JHWH 1XR9A 4OF7A 2AABL 4RX4A 1DEEB 4JZJC 1V5JA 3MLUH 3QQ3B 3HNVH 3REVA 4HUWB 3CXHJ 4AYFA 1Z3GL 4PJXE 1RIHH 1MCNA 4UDUA 4FQ2L 3ZL4L 4TVPE 1S3KL 4IS6B 1XGPA 1LD9B 1RI8A 2J12B 3TNMB 3SDAA 4CMHC 4X4ME 4LSPL 1FNFA 2ZUVA 3LQMA 5HHXL 3ZT5A 4GRWH 4G8GD 4NOBA 3VXQA 2GAZA 2RCSH 4KI5E 2FJGB 1QEWA 1IGIL 3INUL 1CFBA 4LSSH 2DQGH 3HFML 4GAJH 1X5HA 4XVTH 1WQVT 3PJSB 5CJXC 3GIVB 4J3VA 2WUCL 3RAJH 1WF5A 2X4SB 5T1DH 2E6PA 4ZS6C 3EBAA 1NCBL 4M8QA 1XIWD 1A22B 2P24B 4ODBD 1YNLL 5HGAA 3BD5A 3IDYB 4JGJA 1I7UA 3SGDI 2IBBA 4X6DA 1R5VB 1F4AA 3BKYH 4H5SB 1SMAA 2JJTA 1DBJL 2PF6A 4JFOB 1R3IL 3CVHL 4DGIH 4GMTL 4BQ9A 3V4UH 2FR4A 4IRZL 2AEWA 2F5BH 4L9LA 4G9FB 3HB3D 4LKCB 2VL4A 3X11A 4UUJA 1BAFL 3RWJA 3VXNA 4PJBA 1IM3B 2XKSA 4LGSB 2YD5A 3F7PC 3JV4A 1E6OL 1A6VL 5IP4A 3GMMB 2XWBA 5DHVH 2JF1A 1YNTA 3VW3L 1S7TA 4IHOB 2W38A 4TUKL 4BH8A 4J3WA 1LEKA 3ARBC 4GFTB 5I6XC 3WFBH 4KQ3H 2B20A 3ZKMD 3THMH 1A9BA 1YECL 4LPTA 3WN5B 3OXRB 4OKDA 4LQ1A 1H8NA 1TZHB 4GRMA 1RPQA 2WIMA 1S9YA 4FRWA 4OIAA 5F7DB 1FL5A 1Z5LA 4Y5XC 3RGVD 4E41A 2YKLH 3G6DH 1T0MB 2CDFB 5CJ8A 1T2QL 1DDHB 4TYUA 1JF6A 1FFQA 4TVPD 4HT1L 3SCMA 5IHUL 1LO3H 1I8KB 2HG5B 1NCCL 3MUGB 4N0YL 3ARGB 2R8SH 3HZYA 5C3TA 4Q58C 1EFXA 4YHIB 3GBMH 5EZIH 4BZYA 4DUWA 3WJJC 1J0HA 4XRCB 5DT1H 4NZUH 3O11B 3PP3K 4ALAL 1Y18B 2UYLB 3VD3A 1JGLH 4I18B 3NFNB 3SE4C 2F5AL 4DFIA 3EO0A 5HHME 2AKRB 4BJLA 5DZLA 2OZ4L 3I02A 4EJ1C 3BKCL 2WLZA 4RIRB 5I1EL 1UM4L 1MREH 1ZGLA 3VWJA 4GSDL 4LSDA 4EBQH 1YMMA 3SDCC 4HPYL 4OJFH 4HKXB 5D7JA 1B6DA 5KOMC 2F9BT 3CX5K 1UXWB 2IAMC 2D7PA 5GGSY 4JFFA 4OLUL 3QQ9C 2QHLA 3FB7A 1EHLL 3HUJB 3QXAB 3O45B 5CD5D 4UTBL 5I1AA 4AEHL 1QSVA 1BQUA 3VFPB 4D9RE 4KDVA 5EBLA 1TCRA 3O9WD 1FO0H 2F53E 1DN0B 4OF5A 4IDJL 2AGJL 4Q6YA 5DJAA 1FG2A 4JCMA 4YUEL 5DLMH 2PYEA 1X6LA 2OP4H 3S3PA 2FSEA 3QHZH 4B7LA 3SGKA 4QY8B 2IBGA 3HE6A 5IESH 5LG1A 5E08H 2NXZD 3EZJB 2CK0H 5IK3B 1WWAX 1QRNA 2VLRB 4RBPH 2P5WB 4QCIA 12E8H 5JDSA 5CP7B 4U1SB 5EPMB 1EH9A 1JNJA 1CDGA 1X7QB 3NCFB 4XPHH 5E1HB 2AI0H 2A9MH 1A2YA 4OLWL 3ZKXC 1WIOA 2ZKHL 2B4CL 4EXKA 1VPOL 3QNXB 4M7JL 4CUCA 4HUMB 1H5BB 2AJZB 2A6KB 4JM4H 4HGMA 3OXSA 3QFDB 4NBZB 5CEZL 3EOYG 4X98B 4DW2L 5KS9F 1KTDA 4NCC1 3L3IA 3DVGA 2DLHA 1DUZB 2P44B 2FLRT 2JE8A 5F9WC 2OQJB 1C5CL 1F5WA 4O58H 2ADJB 3OMZA 4FFZH 3ULSB 3MO1B 4L4VB 1CL7L 1WICA 3G5YB 3MRNA 4MJ6A 7FABL 1IAIL 1I1AB 2FL5A 1PZ5B 3QUYB 4AL8L 3LQZA 3PHQA 4M48H 1CIUA 4ZFGL 2IBZX 2BY0A 3KLAA 3ZMRA 1B4JL 4P59H 3VD4A 1ZVYA 1A14L 2J4WH 3HG1E 4Y1AE 1BM3L 3DUUA 2YXMA 3GMQA 1CT8A 4X80H 2A6JB 5D1XB 3MZTA 2AJ3A 5HPMA 1FVCB 3M8OH 2Z8WC 3EYQD 4WGWB 3SKOA 4OKVB 3V0WL 5JIKA 5FB8B 3DGGB 3EOTL 2W07A 3H42L 4G8IA 4HAGA 3SY0B 2I9TB 1BVKB 4LIQH 1P7QA 3X13B 1HSAA 3KYKL 4XCCL 1HKFA 3GDBA 3FRPG 1JK8B 4D9RD 4P2RD 4N0CC 4JZJB 4RAHA 3BH8A 2YA0A 2VERN 3G08B 1F2XK 5EOCL 5EU7C 1P4IL 4X4XA 2EEBA 5DD1L 4HG4J 3JV0A 1PZUB 4AM0B 2BC4B 5I1DA 5HHOB 1YPZB 1MRCL 1REIA 3PDOA 4CMHB 3DLQR 2XY1A 3O2WL 3GRWL 4TVPH 4KJYA 4PBVC 1QNZH 3P30L 3MPCA 1ZWIA 1KGCD 1QA9A 1KXQE 3WV0A 1KG0B 2VDMH 3V8OA 3B2VH 4FQIL 4HIJB 1TCMA 1V7MH 1FQ9C 5C6WH 2M8XA 3OX8A 4O02H 2KUTA 2E6QA 2UY7A 5JNYA 2O5YH 3QZWG 1S9VA 2Y5EA 3AU1A 4NWUL 3SPVA 4CN1A 2AK1L 3I75A 5B21A 2IGFH 4EOWL 1SM3H 4ERSH 4UV7L 4Z7WA 4FXGB 5DMYA 3C6LC 2GK0B 4WUKH 4MA3B 1GL4B 5HHNB 5F88B 5IHBA 5C0RH 4P46A 3DX6A 4GKSB 3FQUB 1G7PB 1Q9OA 3FOLA 4JY6A 4LNRB 1KB5H 3FAWA 4JRXD 4YHOH 4NM8L 1HWGB 3GJFK 4H8WC 1FZJA 4XCEB 1NDMA 4IRJA 1J10A 5EA0L 1XCTA 4ZFZA 4AEIL 3VA2C 1XIWC 3PDDA 4WWID 1HI6B 2IADB 3QO1A 4F58H 2X4OB 4ELKB 9CGTA 4PV9B 3QQ4B 1KLGB 4NUGH 5EC2B 2WK2A 3QAZC 2OXGA 2Z8RA 3VFOA 4PREB 2Z92B 1MEXL 3ARBB 4KVNL 5I6XB 4YNYB 3WIHL 4X6DF 2DIJA 1MRFL 3T09A 2OZ4A 2E27H 5GS0D 2GT9B 3CFDA 1GZQA 4K9EL 5DYOB 1SY6H 4X7TB 1QLEH 3IDUA 4LPWA 4F15C 1RULL 2ILLA 1DEEA 3QQ3A 4L5FH 1X4YA 2XXMB 3TH2T 4HUWA 1GGYA 5HBBA 5IMLB 5ITBH 4OAWB 3VXMB 3GIZH 2D03H 1MLCA 5B22A 4OCSL 4Y5XB 2AS5M 2XXCB 4IS6A 1KPUB 1A5FL 1LD9A 3TNMA 1TITA 2JIXB 1F8TL 4CN6A 4KK6D 3A0OA 4EDXB 4U7KA 2YR3A 4L4JA 4JAMB 2G60L 2FJGA 3LV3B 5J0BA 2DBJA 2I27N 5HJ3B 1VFUA 4XMKH 5LQBL 3PJSA 2XIDA 2FGZA 3GIVA 3RY6A 3CK0H 4WU7B 3HHRB 5KSVB 2X4SA 4PRAB 5IQ9B 3RGVC 5TF1L 4M1GH 5IR1B 3D0VB 4GRWB 2QKIB 4MXQD 1BQHB 4J3XA 5BXFB 4E5XB 3SDCB 5GGSB 1BVLB 2YUZA 1R5VA 2IAMB 4PRPB 4JFOA 4KKCC 4UNVA 2H1PL 3D85D 5DJYB 2CUMA 1QR1B 5F6HJ 4KHTH 4KI5C 1ZHKB 4M03A 2GYSA 3F7VB 3JUZA 2IMNA 4LKCA 1S9XB 3O6LL 5L7XL 3AXLB 3GO1L 1F3DJ 4Q0XL 2DQCL 5I73C 1Q72L 5IEHB 1UM6L 4PY7B 3GMMA 1A7PL 3C6SA 1MCPH 1BZQK 2MPAL 1N59B 3CFKB 3MRKA 1KCRL 4WTZG 4IHOA 4HQQH 3QDHA 4DGVL 4M00A 5D7LD 3RIFK 5IVOA 4PJIB 3LB6D 5E5RB 5CD5C 1Z0NA 1PQZB 4M9OA 2AP2A 4ZYKB 2C3WA 3JBG7 2EIDA 3HS0B 5DHVB 3LY6A 3OAZH 4L3AA 5F7MC 3WN5A 3C5SB 5ACZB 1NGZB 3BYTA 1TZHA 2VYRE 3ZKXB 1DQTA 4HCRH 3NCYP 2DI9A 4PRDA 1LP9B 1NCDL 1NSNL 4YEFA 4NQVA 5F7DA 4M5ZH 4UT7H 2VC2L 2NXZC 2BXZA 2XTLA 1DDHA 4ZNEA 1QG3A 3EO9L 4JO2H 1IT9H 1I8KA 3MBXL 2HG5A 2Y4SA 3CC5B 5F9WB 4YHIA 3OKMB 4Y4HC 4MCYA 2VLJB 3KPRE 4XRCA 4KDWA 2DKSA 3MX0A 3O11A 3OGCB 1T1WB 4R90H 3MCLH 1ZTXL 2UYLA 4GRLD 4I18A 3NFNA 5AWNH 3P9WB 1EIBA 4GS7C 1Z9MA 5DFWH 3GRWA 1DBAL 4PJ7E 5BO1H 5CFHA 4RIRA 2LU7A 5LWYL 2ZUYA 5DSCB 3HMWL 5F3BB 4HKXA 3T0DA 1B0WA 2V7NB 4NFCA 5CILL 3T0AA 1UXWA 4HUKB 1S7RB 2F74B 1A1MA 3BW9B 3RRQA 4ONOA 4U31A 4JO3H 5EH1A 3QIWD 4ONGL 1NMAH 3O45A 3VFPA 4XNXH 3QUMB 4LGPB 3ETBF 4OGYH 5GS0H 1DN0A 1RUQL 5ADPH 5KVEL 2I60L 2D4DA 1XGRB 5FXCH 3MLUL 1MRDH 3HNVL 4QY8A 1A1NA 5FOBB 1JP5A 5KAQF 2I25N 4G9DB 1XF5B 4HV8B 2DM4A 3M45A 4JFEE 5IK3A 1FO0B 2VR4A 4WI3A 2VLRA 4ODHH 2P5WA 1BX2B 2YPLA 2ADFH 1MCWM 4U1SA 5EPMA 4RGOH 1X7QA 2RCSL 4KK8D 2BP3A 5GPRA 4LSSL 2DQGL 3E6FB 3RJDA 4GAJL 2F19H 4P49A 4XVTL 2WZPD 1JYWA 5DXWA 1DQLH 5EIIB 1S7SB 5E2TH 3RAJL 2FX7H 4GAYB 4LP5A 1H5BA 4HC1L 3IKCB 5KG9B 5JW4M 2AJZA 5T1DL 3BIKB 1IGCH 4LSRH 3QP3A 3QFDA 5IROA 1F3JB 3D0LB 4WWKA 3LEXB 1KEGL 2K9UA 2FIRT 4X98A 5KSBE 3V4PH 2FIKA 5AZEH 4G8GB 1DUZA 1F90H 3BPNC 2HN7B 3C6LB 5E8OB 3BKYL 2OQJA 3DIFA 4RA0C 2ADJA 3ULSA 4L1DA 3X17A 4L4VA 3G5YA 3V4UL 2BCKA 1I1AA 1PZ5A 2F5BL 2OXHA 2YRLA 4YPGB 3NA9H 3VGAC 4X4YB 1BZ9B 3MRPB 4MX7A 1JNLH 1OQXA 1XIWB 2A6JA 1JMXA 4WFEE 3QAZB 2LU3A 1JPSH 1VDGA 1W2KT 1FVCA 3GB7B 3H9SE 4KKBD 5KOVC 3BIAX 4Z7WF 1NAMH 5FB8A 3DGGA 4KXZH 3RWGA 1OQOA 3WFBL 3M17A 4KQ3L 2I9TA 3SY0A 3THML 3PUCA 1JK8A 4F15B 1ZA6B 4LL9A 4NKMB 4JZJA 3IF1B 1I9RH 3FT4B 1FSKC 3G08A 2EH8L 2NY7H 4I3RH 1HHJB 4GKOA 5C0AD 3L3JB 4AM0A 2BC4A 4JKMA 4L3ED 5HHOA 1IEHA 2YD9A 2YKLL 3MLPA 5GS0C 1UM5H 1LO3L 5J11C 2IANE 2ADGB 4JDVB 1AO7E 5MENA 1WCQA 2R8SL 4JHBA 5EZIL 3V0AC 3FO2B 5AUMA 5DT1L 5CJXA 4NZUL 1MCDA 4V1DA 3NCEB 1KG0A 1JGLL 2BOCA 4HIJA 4PJXB 4X7FC 3RGVB 1FFOB 2VZTA 3UJIH 4HSQA 1N6UA 4LLYA 4I5BB 4YBQD 3QUML 4U6YB 1QR4A 1OP9A 1MREL 4EBQL 4OJFL 3O4LE 5BS0A 4FXGA 2GK0A 5HHNA 5F88A 4JFPB 3T1FB 3FQUA 4OT1H 5C2BL 4KTYA 1G7PA 1CQKA 4HFWB 4LNRA 1KF9B 4CBPA 3EJYC 4DQOL 5FA3B 4XCEA 1HHIB 1FO0L 5I73B 4MXQC 4OD2A 2JB6B 4JHAH 1HI6A 2IADA 5DLML 2OP4L 5AAWA 3QHZL 4ELKA 1EAPB 1INDH 3QQ4A 5EC2A 1KB5B 1VEMA 4PREA 1EDQA 2KH2B 2Z92A 4WFED 4M02A 4S1SH 5IESL 1A47A 1WISA 4YNYA 2CPCA 5E08L 1N5YH 5E0QA 2V9TA 4QTIH 2CK0L 5H35A 3R0MA 3GSNH 3H9SD 1WV7T 4XCFH 1J12A 12E8L 2X4QA 2RBLA 5HI5D 1CCZA 4UTAL 4MGXA 5C7XH 4J3TA 2DLGA 4WHYG 4XPHL 2K7QA 2AI0L 4QRUA 1OF2B 2A9ML 3VXOB 2ICES 3WUWG 1GIGH 4OFPA 3VXMA 4NNYB 2NZIA 4XC1H 2AV7B 2NXZB 1IQDB 1KPUA 4JM4L 3LB6C 4J3SA 4ISVB 2JIXA 3ZDYE 3NIFE 4H8WL 4PRHA 4EDXA 4A6YA 1G7LB 2XA8H 2YN3A 4JAMA 4Y4HB 4HUXB 3V5KB 2Q20A 3WJJA 2PETA 3LV3A 3MRCB 3MV8E 4L9DA 2IAND 4O58L 4X5XB 5HJ3A 1RUKH 3EKCA 3SE4A 1W8OA 4GS7B 4WU7A 4M48L 2AEQH 4PRAA 5IQ9A 4ZQKA 5IR1A 3D0VA 4I8DA 2J4WL 2QKIA 1BQHA 3HE7D 4JQIL 2ARWA 5BXFA 1T7YA 4LFHD 3QIBD 3C8DA 4X80L 3SDCA 1RMFH 4K55A 4E5XA 5GGSA 1BVLA 2PTTB 1DTUA 2IAMA 2D4FA 2JJSA 3I3BA 3DI3B 4PRPA 4PGCB 4K7PX 5I2IB 1JNHB 3M8OL 1ZHNB 1KEMH 5DJYA 1Z9OA 1GGBH 1ZHKA 3MYZA 3PV6B 4GRLC 3F7VA 4P5KB 4YIQA 4HIHB 1G7HB 1J86A 4EXPX 5CP3H 3IJYB 1EK3A 3AXLA 4WVRA 4ZAKD 5DD3H 3CXHK 1P6AB 3P4MB 2R2EB 2BDNH 3PWPD 1P2CA 4PY7A 5CJQH 5FYKE 4YBLC 3S96B 1N59A 1MNUL 5GHWH 2ICWJ 3MA9H 5IM7A 3PDGA 3VRJB 1MI5E 3VFGH 1B4RA 3QIWC 3P4OB 4V2BA 4QXGH 2FLBT 2VMFA 5FUOH 4YDIH 1OHQA 2J8UB 4ZYKA 3HUJF 2CJUH 1IVLA 5T1KD 4HLZH 3HS0A 5DHVA 4TVPL 5AD0B 4J8RA 1E0OB 1AKJD 1QNZL 3C5SA 2F53B 5ACZA 1NGZA 2YD4A 4KPHH 1VKXB 5TF0A 5DC4B 4P2QE 4BK4A 2VDML 4Z77B 3DV6B 4JGUA 5I1IL 3B2VL 1V7ML 1S5IH 4HZLB 4JPIB 2GI7A 3CDFA 2KQMA 4O02L 5F7EH 2O5YL 5DGRA 5AYUH 3MXVH 2N7AA 3CC5A 3BPNB 2IGFL 1SM3L 4ERSL 3F6IA 3OKMA 4FP8H 4KK8C 2HFTA 4WUKL 3OGCA 1T1WA 4LNVA 3VGAB 5JOEA 1KB5L 3MV8D 3MGAA 2NX5A 2EC9U 1I7RB 5FO9B 1FCCA 4YHOL 4YR6B 3E1F1 2FBJH 2C4FU 1TETL 3A67H 5K9KB 5J57B 4GKNB 3IU4H 4F58L 4HKBB 1OD9A 5I17B 2GK2A 5DSCA 5F3BA 1NC4D 2V7NA 5DVMA 4J6RL 4NUGL 5JA8B 1S7RA 2F74A 3BW9A 3SN6N 1OT1A 1U6AH 4JDTH 3PHSA 2GEEA 4X8JB 5D6CB 2E27L 1UACH 3I6GA 2E3VA 1L4IA 3D6GA 1SY6L 4MA1C 1QLEL 4P0DA 2LVEA 1FSKB 1XGRA 3EYVB 5BRZE 4Y1AB 5B38B 4L5FL 1H3GA 5FOBA 3DRTB 2XY2A 2PTUA 5GRZA 1F4WH 3GIZL 2XPGA 3EIFA 2D03L 4DN4H 1MFBH 4HWZA 5FYKD 2GJ6E 5IBUB 1KFAH 1FO0A 1PYWB 2H45A 3F62A 5J11B 1BX2A 1CDYA 2NY6C 1TNMA 2IFGA 3E6FA 5DA0B 4XMKL 1BD2E 2YOCA 4LCWD 4XPGH 5I30L 3VH8A 1S7SA 5IFJA 1XZ0B 3CK0L 1FV1B 2R39A 3DHMA 3K4DA 4HGWA 1FRGH 3CU1A 4F7CB 1DEDA 5K59E 3BIBX 1YPZF 3LEXA 4OFYD 4MXWH 4NO3B 4OZIE 4Y7MA 2EYTB 4G8GA 2DQEL 3C6LA 5E8OA 2XZCH 3W0WD 4J3UA 4TSBH 4ZS7H 4KHTL 2X40A 4XX1G 4YPGA 2ID5A 1BZ9A 2AJYH 3BGFC 3MRPA 1QSFE 4M1DH 1BIIA 4H26B 1T0NB 1XIWA 4JPWH 4YBQC 5B4MD 4U3XA 2FX8H 4R8WH 4QRPD 2HJFB 3WXVH 2AJVL 5I75C 1MCPL 3LS4H 1CBVH 3MBED 4FQJH 4YGVB 4HIXH 3RZCC 1QBAA 5B39B 1KJ2B 4LARH 3WHE0 4LVHC 3OR7B 1R3LA 3CNKA 4ZTOH 3V5DB 3WJLC 3I50H 3BKMH 2IH1A 4PB0L 2IF7A 2E7LC 1U8NB 4PJCA 2MNUA 4NKMA 1NJ9B 1AQKL 3IF1A 1VADB 5I8KH 3O6FD 3EYSH 4XBGB 5EG6C 4HCRL 2V7HB 2PXYD 3WD5H 1NAMB 5BRZD 3L3JA 1UZ6F 1QYGH 3MRDB 4YDLC 2CH8A 4M5ZL 2BJMH 4UT7L 2OBGA 1ZEAH 5T1LD 4YZFE 4JO2L 5I8EB 1IT9L 1DVFD 1I1YB 2X1XR 3LN4A 2ADGA 1IRAY 4JDVA 5EOTA 5HI5C 1ND0B 3W9DB 4L8DB 3EUUA 1X5IA 2BRRH 1ZVHA 3MLXH 4MXVF 1E4WL 3MCLL 3GMNB 1YEJH 2ATKB 4MZ2A 3U4AA 1HQRB 5AWNL 3H7BA 4JFDE 4PJXA 3RGVA 1CD8A 1FFOA 1BD2D 3EDFA 3JWNC 3RY5A 1KCSH 1ZHLB 5BO1L 4UOW0 4I5BA 4U6YA 5GSVB 4JANA 5DQDH 4MD0B 2HT2C 2BK8A 2BVOB 5TE4H 3OGOE 5A2FA 4KROD 4LSTH 3ELAT 1OY3B 4EUPH 4JFPA 3T1FA 4GRLB 1UYWH 4QOKE 1NMAL 1I9IL 3LRGA 1KELH 3QPQC 4XNXL 1P69B 3O2DH 4OGYL 5FA3A 1F13A 1HHIA 5GS0L 1MJ8H 5ADPL 4XPBH 2CRMA 1ZA3B 1YEKL 3HE7C 4M5YH 1QSFD 2JB6A 1VFBA 4HG4K 3DUSB 3MLWL 3QIBC 3QJFB 4XVUD 1KLFA 4GRWF 4P9MH 1EAPA 2IPKB 3DARA 3ZE0F 1KB5A 1UXSB 2A77H 3QIWB 4KHXH 2QV2A 4D3CH 4RFOH 1MCJA 5CJOH 5FYKH 2ARJB 1X6NA 3EFDH 4ZAKC 4OV5A 2D0HA 4F9LC 3I9GH 4RGOL 5E2VH 5ICZB 4UZGA 1OF2A 3VXOA 3TH4T 1LQSR 5FGSA 3CIQA 3GM0A 3HLAB 3GSNB 5E2TL 5AZ2H 2V2TB 2AV7A 2FX7L 5IVXE 2YMXH 1IQDA 1FVDB 1IGCL 1SY6A 4LSRL 1KTLB 3HNSH 4PJIF 5J3HC 1V3KA 3VD7A 3WNPA 4KU1A 5CWSB 3S3SA 3V4PL 5AZEL 1F90L 4LSVH 1B6UA 2D0GA 4HUXA 4Y4HA 3V5KA 1VA9A 1BIHA 3MRCA 4DKDC 2KDGA 4X5XA 4Z78B 4TVSa 3FT3A 3NA9L 3T04D 3EYOA 1LP9F 1OW0C 4G6JL 2QSTA 3KYOB 2DF3A 1KJ2L 5FOJA 1WZ1H 4JFDD 4XXDB 3MTRA 1T20A 5GZOD 4PD4J 5KANG 2PTTA 1JGEB 1JPSL 4LK4A 4PGCA 5I2IA 1JTOA 1JNHA 2D7MA 5EIVA 2ZCHH 1NAML 3KPRB 3PV6A 4P5KA 4HIHA 3QWRD 1CFTB 2ZUTA 4AT6A 4MA1B 4QOKD 5IB3A 1L6ZA 3IJYA 4QHUB 3DYMA 1F3RB 4PJ7B 2R2EA 1N0XH 4CVWA 2LAAA 4BQ6A 2NY7L 4DVBB 2MTPA 3M1BB 1ITCA 3TA3D 3MLVH 4LSQH 5BZWA 5IJVB 3QRFM 5L0QC 3P4OA 3HAEB 1UM5L 4OUUB 2NY6B 1EAJA 3EZ8A 3RI5K 4YX2L 1VFAB 2F53A 4LRIC 1ZLUK 1VKXA 3QDGE 1JF1B 2GUOB 4L3EB 3DV6A 4Z77A 5HSFA 3FO0H 1JRHI 3LPWA 4HZLA 4JPIA 1JGVH 4JFEB 3T08A 3UJIL 5CCKH 3PABB 1AXTL 1GGIH 3T0BA 2L7JA 3E3QE 1KIQB 1HINH 3IB4A 3ZYOA 3CMOH 2PW2B 5DR5H 3HPJB 2OL3H 3BRFA 5IB5B 4OT1L 4UT9H 1EVTC 3BGFB 2AJSH 1I7RA 4U1LA 3J7HA 1DR9A 2GFBB 4YR6A 1F45A 3LHPL 4Y8AA 1W0YT 2WV3A 2CXKA 4JJHA 5T33H 5K9KA 5D71L 4JHAL 5CSZB 4GKNA 1VHPA 2J5LC 2Y23A 5I75B 4HKBA 4AIOA 5I17A 1KACB 1INDL 5C0IB 1PGRB 3RZCB 4YHYC 4S1SL 1NLBH 2DICA 1N5YL 4LVHB 4QTIL 4X8JA 5D6CA 5CLTA 4RDQG 4Q9RH 1I1CA 3GSNL 4OLZH 4XCFL 4Z0XB 4DUVA 1IGJB 3RTQD 2EYSB 2B8OT 1AI1H 3EYVA 5B4MC 3HG1A 4Y1AA 2FCBA 5B38A 4BKLB 5ISZE 1AGEA 2IWGA 1J8KA 3DRTA 1RZKH 5EOCJ 4GW5A 1GIGL 4YDLB 4XC1L 1ZS8B 3MBEC 1G7QB 3S36X 3QCUH 5JXEA 2DIBA 1BHGA 2NQCA 4JRYA 2X4PB 3OKNB 3HZKB 1PYWA 3H9SB 2C4XA 1I8IA 4WFFE 5DUBB 1MLBB 5EUKB 5T1MA 3VD5A 2Y07H 2Q3ZA 5B3JE 1GGTA 2XA8L 2DM3A 2Y25A 2VQ1B 4ZFOB 3UP1A 4NT6B 3O6FC 3MJ8B 5JOFB 5JR1H 2PXYC 1RUKL 5TQ0L 1INEH 3BJLA 2WNGA 3H2WA 5A43C 1FV1A 2AEQL 1II4E 2R1XA 3QDGD 3BE1H 3EOBA 1JI1A 4MCZB 2VSDA 5C6TL 1CD1B 1DVFC 4IRSD 2JJWA 4QT5B 1RMFL 4LQFH 4IMLB 4NO3A 3TT1H 2EYTA 1QZ1A 2E8ZA 2W0FB 4HMEA 1HILB 2IANB 4M62H 1OP3K 1AO7B 4UNTA 1KEML 4NBXB 3U0WL 3H9ZA 1GGBL 2HH0H 1U3ZA 1A8JH 4J1UB 4Y2DD 4H26A 2VRAA 3HE7B 5DD3L 3QIBB 4LKXB 5DO2D 3VXPA 3SGEH 1NGQH 2BDNL 1U8LB 5GGUB 5FIEA 4XGZA 1UVQB 5GHWL 4YGVA 4KROC 3MA9L 3O4LB 3U4BH 3VE0B 5C0DB 1IJ9A 2X05A 5HVGB 5B39A 3VFGL 2NR6D 4OZGE 4ENED 3MV9E 5AYQA 3OR7A 2FWOB 2IEPA 4UAOC 4QXGL 5FUOL 4XTRD 4YDIL 4ZAKB 3VXRA 1U8JA 2EH7H 4G80B 4NDMB 1ORSA 1KIRB 2X10A 3DETD 5CHNB 1VADA 4XVUC 3CFIC 4XBGA 2V7HA 4KPHL 1NAMA 3SDYH 1AHWC 1IZKA 3TM6A 5A16B 4Z9KB 5ISZD 3IDXH 3SGJC 1F6LL 2COQA 1X5GA 4N5UA 1S5IL 4PJAB 1D5IH 5I8EA 2Y72A 15C8H 1KBGH 5F7EL 4R7DB 1B2WH 5AYUL 5T1KB 3K7UA 2W92A 4WFFD 1AKJB 1RZKC 4S2SB 3W9DA 4BSWB 4R6UA 3CH8A 2OI9C 3T4AB 1P5UA 1QVOA 3GMNA 3TT3H 1HQRA 1NFIB 1Z2KA 3S35H 2FHFA 1N2RB 2VDNL 1TDQA 2DM7A 1ZHLA 2K1MA 3A67L 5GSVA 3IU4L 4OTXH 2BVOA 5F9DC 4OF8A 4MLIA 4OGAD 3S9DB 1JPFA 3CFCH 4ODXB 3RWCB 25C8H 3F7YA 1Y6KR 1I1FB 3MCKB 2W59A 2NW3B 4GRLA 3MV8B 4X7CC 4JDTL 1JHLH 2P8PB 1UACL 1C5DA 1UENA 5DI8B 2BY2A 4HJGB 1ZA3A 3M07A 3DUSA 5GZOC 2X70A 1NC4B 2P8MB 4EUPB 5GSRB 4PRBB 1FGVH 5F9JB 1F4WL 2LABA 4WHDA 4DN4L 4ZFOL 1UXSA 2X2YA 4TUOB 4BQCA 3QIWA 5L0QB 1KFAL 3C5JA 4UINH 2ARJA 1CGSH 1JRHL 3V9FA 1DQMH 1CDBA 2ESVE 1OPGH 2DWEB 4Q7DA 1XF3B 3CZJA 5ICZA 3WMSA 2Q7YA 4H88L 5GJTH 1MWAH 4XPGL 5ITFB 3HLAA 2Y36H 2EIZB 3GSNA 2VZUA 2V2TA 1K4CB 2CRYA 43C9A 3C5ZD 1AR2A 4XVSH 1FVDA 3TA3C 3TO4D 4UIKH 5DJCA 2D7TL 1KCVH 1NCNA 4TNWF 5J6HB 4KAQH 1MCLA 1FRGL 1MI5B 4NPYB 3AB0C 2MQ3A 4MXWL 5CWSA 5BVPH 1U8PB 2XZCL 2J8UF 4JG0H 5D7SH 4BUHA 2XA3A 4LCWB 4TSBL 1U36A 3K4AA 4ZS7L 4Z78A 2DLEA 4PJ9C 4YK4C 3U0PB 5JW4R 5GS3A 2AJYL 2DQTH 4OCMC 4P2Q