1UENA

Solution structure of the third fibronectin iii domain of human kiaa0343 protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
125
structure length
125
Chain Sequence
GSSGSSGHSGEDLPMVAPGNVRVNVVNSTLAEVHWDPVPLKSIRGHLQGYRIYYWKTQSSSKRNRRHIEKKILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0343 protein
publication title Solution Structure of The Third Fibronectin III Domain of Human KIAA0343 Protein
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 17
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uenA00
3WXVH 3MJ6A 4ELMB 3VFPB 4O02H 1Z0MA 5FYJU 1LDSA 5DJ2B 3GJFH 3V79C 4X83A 1ZT7A 2UYLA 3WO4B 3STZA 2JJSC 2XYCA 2WLZA 4CVUA 4O51A 3QAZC 2F8XC 3AREC 2W91A 4XI5C 5T1LD 2XA8H 1QKZH 2ITCB 4JPWL 3GSQA 4CNIB 3DVGB 3SCMD 2NCMA 4PJCF 3Q5OA 5EUKA 5BCAA 4LOUC 4U2ZA 4LEOA 4J7RA 3C6LA 2A1WH 4KTDH 4XC1H 2BSSB 2FEDD 4UINL 2AABL 2DL9A 4HUVB 2Y5TB 4UT6L 5FOBB 2YD4A 2VKXA 2LVEA 4HIJB 1MEXH 2AJXH 2A2QT 3A6BH 4Z0XA 3R06B 4OGAD 3UAJD 5MI0B 3UX9B 5D72L 1S9VA 1D6EB 2E7CA 4JQVA 4WO4B 3ALXA 1HZHH 2Z35B 4APQD 3DUUB 4GAJL 1DANU 2EH8L 2X4TA 4LP5A 1CICB 4XMPL 1EO8L 3MXWL 3VRJA 3L3KB 3CXHJ 1XH3A 1WFTA 5EUOA 2CDGA 2BXYA 1A02N 1B6DA 4MHHI 5CCKH 3ARUA 3PWJB 2F74B 4U1JB 1J0KA 1FJ1A 3HI5L 3LQMA 1N7ML 3QCTH 1AE6H 4L4TE 5C0AA 2YSSA 2OZ4A 1KJVB 3U36B 1J05A 2W9DL 3M07A 5FO9B 4H26A 5GJTH 1DBBL 1N59A 1NCDH 3D69A 2J8UF 1OAXH 1KN4L 5KVEH 1QFWH 1JL8A 3FQUA 1YPZF 5C71A 2P8PA 4LCWA 5JZ7C 3MNZB 1OP9A 2A9NL 1AO7B 4OZIB 5E9DB 3MV9A 4NKMA 3RL1B 3VWJD 4OIIL 3VD5A 1IEAB 4N0UA 3N1QC 2DM2A 4N0CC 3WO4C 1ZLVK 1WK0A 3PIQB 5C70A 3SGDH 5EO1B 5GRUL 2VABA 3SO5A 4LKXA 2EE2A 1UM6L 4H8WL 3BZ4A 3R1GH 3PWUA 4YAQB 1NBZB 3L1OH 1VB9A 2AP2A 3S88L 1QSFE 3L3HA 4KXZH 4MQ7B 2YEZA 3MRGA 3W0WE 1HHKA 2OS7A 4QRQA 1D3CA 4GG6B 3RVUD 3MRIB 5BRZD 1N5AB 4ONHB 4ELKA 5H35A 1M1SA 1IAKB 2YC1A 3FZUD 4XBEH 1RJLA 4R4BA 3GMPA 2Z31A 4G5ZH 4JZOA 4OLYL 5TF1H 1RVFL 2R8SH 5JQHC 1V3MA 4P3DB 1VPOH 5MI0C 2DQGH 4WO4C 1BZQK 1DE4A 4JR9L 1EERB 1B88A 2R4RH 1CICC 4Q6IB 2EXYC 1U2CA 1K8IA 3DX9A 4S1RH 4WUUA 4HZLB 4PBXA 4OZHB 1CCZA 4WCYH 4Q9QH 1UXSB 1KSRA 4YPGB 1JN6B 1BMGA 1QLRB 4P2OD 1A47A 2KBGA 4OCSH 4QYOA 2ZSVB 4Q7DA 4UOJA 4HUWA 3GJEA 1I4FB 2ZJSL 4PJBF 4XMLL 1UQSB 1T66C 2HJLA 1KG0B 4M43L 1H15B 3L5XH 4BKLB 4EOWH 2OXHA 3HAEA 1RIUL 3OXSB 2EKSB 2IANE 2KDGA 3BT2H 2BNQB 1I1RA 3RGVA 4HV8A 4MMXC 5D2LB 4KRPB 4F15B 4DCQB 1CXKA 3P2TA 3IKCB 2GCYB 2DQCL 1CFNA 1JGDB 2ESVE 3BHBA 3WUWA 4G7YL 2D4FA 1RJZB 3IB4A 2IBBA 3M45A 3V7AG 2H26A 5HYJA 3S5LA 4EDXA 3GMRB 2BHUA 1IEBB 2AJ3A 2L0DA 3RVWD 3H3PL 3MZTA 1BM3H 1KFAH 5IJVB 4OGYH 3O2VL 1YA5A 5I1GL 4PYGA 3S3PA 1XCQA 4NRXB 4WUKH 1MHEA 3UTPE 4JVWA 1UWGL 1LK3H 1M7DB 5GRZA 3V5DA 2LU7A 1BIIA 1PQZA 4J4PC 3WSQL 1KB5B 2NZIA 3O6FD 4QCIB 1SMAA 4Y8DC 1HSBA 5J12B 4Q6IC 1TCRB 4HBQA 5CD5C 3TO4A 3V6BR 3WFCH 1H3TA 4HWNA 3GSOB 1JV5A 1GGIL 1XIWB 1QPPA 5I1LB 3QUYD 4WW2F 4RIRB 1B3JA 3ARGD 4E42B 1ZT1A 2OL3A 3KG5A 2EC9U 4TRPL 3EZJB 2VLJB 2YD5A 3C8KB 1QP1A 3MLYL 4UQ3A 1GPOL 1JTPA 2ZUWA 3QWOA 2A83B 3TWCL 5DMKA 4M1GH 4J12A 4MLIA 2YA0A 2G60H 3QDJE 1QSVA 2QJDA 4NWUH 4JY5L 5I18L 1K4CA 5JOPD 1YNLH 2R0KH 4PJ5E 4Y16D 4PJCE 4AH2B 5C9JB 1OTSD 2G5BB 4KRPC 4F15C 3KPRB 1SBSH 5D6CB 1WITA 5EBLA 5IMLA 1IQWH 5HVFB 1BQSA 1U58A 5I1KH 1QLFA 1FRGH 4M1CC 1HINH 2C1OA 2DIJA 3FO1B 3EFDH 4DKEH 4JRXE 1QLEH 3MXVH 4MWFB 3VDAA 5LBSH 1INEL 5JORA 1NL0H 2CKBL 4JJ5A 1YEFH 3O4LE 1P9MA 4HKBA 2APVA 2BNRE 3CVHH 4PRIB 2F58H 2H9GB 5ELIA 1ZGLB 1DZBA 5D1ZB 2ZCLH 1NSNH 1RIVL 3HG1E 1HH9B 3O6KH 5ISZD 3VFGL 3HZYB 32C2A 3UMTA 3HNVH 3CFIC 3K7UA 3VJ6B 4HPOL 4JKPH 1B0GA 3T4AB 1F3DJ 4LCCA 3ZHLA 3GRWL 4PREA 5J12C 3OWEA 4YBQC 4R97B 2JELH 4Y1AD 5D1QD 4ODXA 2FSEB 4K23H 3WJLC 1WIPA 3VXPA 3ZYZA 4LL9A 3OB8A 2XZCL 5SX4I 1WEJH 1D6VH 3M17A 2OSLB 1XIWC 2VDOH 1CLOH 1YPZE 1ZLSH 3RJQB 1EXUA 3TN0B 3MLWL 4L8SA 4Z77A 1C8PA 3PGFL 3UBXB 5CLWA 4POZC 3QDGA 1A0QH 1NGPL 1JPTL 1TVHA 3OAYH 4RFEA 1H0DA 2YD9A 3MBED 1N6UA 1MCRA 1J11A 4PJXB 4JRYA 5HXMA 1J7VR 1T21B 2P42B 3BYTA 4IOFC 2Q8BH 4HDIB 2E5EA 4QOKD 4G80B 3HE7A 1MCOH 2WINB 1BAFL 3OKMB 3TF7C 3B2UC 4IHOB 4NQCE 4IJ3B 1KPVA 5JHLH 1FL6A 3WLBB 1LEIA 1FO0L 3AGVA 4YQXH 3SDDD 3OF6D 3GGWA 2PYEB 3AM8C 3X3FL 1GOGA 4ONGH 5D7SL 3D39B 2HG5B 4XH2B 5FYKL 4D9LH 3QI9A 4HXBH 2Z93A 4R4FH 5JXAH 2YZ1A 4JM4H 1MRCL 1U8QA 3U7WL 2GK2A 4P0DA 1T2QH 1F45A 2C9AA 5D1ZC 1FVCB 3S34H 5CBAA 4OM0H 3QCVH 1F42A 3MRRB 4L1DA 1IGFH 3BVNB 5E2UL 1WZKA 1N64L 5IMMA 2VZ3A 3GSWB 2B4CH 4PRBB 2NTSP 4IDJL 1GSMA 1WT5C 4R97C 4ZSOA 3ESUF 4N68A 4CADA 4PJBE 15C8L 2FB4H 4GOSA 4MA7L 1A1MB 4OLEA 3RWDB 1C16B 1MCCA 1B0RB 1WIUA 5IROA 2BCKB 2GT9B 2W9EL 5IHUL 1OY3B 1YMMA 1OPGH 3MLSL 4ZODA 1IKFL 1DQMH 4JFXB 3TN0C 2DJSA 2E27H 1UENA 2PW1A 3D9AL 1HQ4B 2GJ6D 3E8UL 4G9DB 4V1DB 5L8JB 3N06B 1S7VA 3RWFA 4DOHE 1FVEB 2DTMH 2R1YA 1UXWA 2IFFH 1QR1B 4UILH 3LPGA 2IH1B 3ULUH 4DZBB 2NLJA 1P7QD 3RGHA 4N8VG 5I17B 2J6EA 3WNOA 2VL5A 3FO0L 5KJRH 4G43A 2EIBA 4G6FB 5IT2L 2NYYC 3GMQB 3MJGX 3LKOA 2P5ED 3TNNA 5TPWL 3VI3F 3P4MB 3LOWA 3TBYB 4IJ3C 1I85C 3C2AL 1A3QA 1T22A 4HUUA 3PNWB 3NPSB 1MHHB 5L2KA 1T0NA 5C09A 2HRPH 1I1AB 3VFOA 2VDKH 1IGMH 1QBLL 3SO3B 1HH6A 4RQQB 1YEGH 5ITFA 1FVDB 1F5WA 4N0FA 5EPMA 4HD9A 5GIRA 1FNSH 4YUEL 3SHSA 1LNUA 4HGKC 4MX7A 4FNLL 4NM4H 4OCWL 4PLJC 4KROB 4NC1E 3OR7B 3SDAB 1UA6L 2BRRL 1Z5LB 5CILL 3CFCL 2ERJB 3RZCA 3QIBA 4GRLD 5F9AC 1GXEA 1JP5A 3GSNH 3LKQA 5IBUG 1C7TA 3HAEG 2NR6C 1JTTA 1WZ1H 1BQLL 1JNHB 1FGNH 4R90H 4BQ6A 3GSVA 1FFNA 1L9NA 1WC7A 5BRZE 3SDCA 5J4MA 2ZG3A 3ZHDA 2EDDA 5H2BA 1HK6A 5ACZA 1NLBL 4KFZC 5GSVA 4AEIH 4HJGB 2P48B 5T5NF 4X6EB 1QHOA 1AHWA 2QEJA 4U1LB 3RWGB 5D8JH 3ARSA 4ODVL 4DVRL 4TOYH 3X3GH 3MV7A 3GHEL 3UJJL 4NYLA 5HY9A 5JW4M 1L7TH 3I9GL 1F13A 2FEEL 4TUJA 5DUML 1BF2A 2PNDA 4Y19A 1FZKB 1MFDH 2CLRB 3OPZH 2JJWA 2H41A 3IU4H 1MSPA 5ESAB 2ICWA 2ADIA 5HDBF 4H1LB 1F90L 1WUNT 5I1CL 3IAGC 3IDNB 1EEUA 1IBGH 5DHXB 5C07E 3BZFA 5KSAD 5C9KA 4U1NA 3MBXL 1EUUA 5BJTA 5IB1B 4K9EH 4Q97A 4EVNA 3NPSC 1LO2H 4OFKA 1J1XL 1G7MA 1I1AC 5JR1L 1P4BH 1R3HB 3MV8A 3PHQA 4OUUB 4PJ9A 2OQJB 4JFDB 3SO3C 5B21A 4H20L 1ADQL 2D0GA 2P7TB 1FGVH 4TQEH 3MRNA 3PE9A 5C0BD 4DN3L 4DVBB 4HK0B 4QO1A 1DFBL 4KROC 2NX5A 4X7DC 4RGND 4OJFL 4P4RA 3SDAC 1A6AA 1KOAA 2MWCA 2ERJC 4WHTA 5MERA 3FT4A 5E2VH 4NKDA 1FL5A 4FFYL 2BVEA 4FQQB 3NA9L 1UEYA 3ZT7A 1MVFA 5IIEA 1I9JH 4PJGF 3U83A 2J1KA 1WCQA 5FM4A 3O3BA 4JHWL 1Y6NR 3K8KA 5DURB 4JM2B 2C3HA 4G6JH 3UTTB 3NBNA 4NNXB 4HJ0C 3UTOA 2WUCL 3FFCD 4WWKB 1GVIA 1X6NA 4EDWL 1MCPL 1OAUH 2W07A 5HTSA 2C3GA 3O8XB 5F8RC 2IF7A 3FB6A 1SJHA 3P77A 1NFIB 4CN4A 5I8KH 4Y5XB 2A6KA 4JG1H 4PJFF 3EYUL 1QTYT 3ARZA 3U4BL 5DA0B 1CFVL 1A21A 2OI9B 5LCVH 5ITBH 2GJZB 1F4HA 4U1SA 4NZRH 1AIFB 3QUXD 5TGBA 3SGKC 4GW5B 1UCTA 5DSCB 5T33L 5C08A 4NZUH 3OKOA 5D70L 3QISA 2V2TA 4X7EC 2B1HH 1I1YA 4J6RH 4M7KH 4DUXA 1W72A 1Y18A 4TN9A 1MFAH 4LLVB 1W0VA 2YS4A 1N3NB 4Z0BH 2GK0B 4JHBA 1U93B 2VAAA 2AXGA 4UBDD 1YECH 2FYYA 4QHUB 4KK5D 5HHOD 3MRDA 5EG6C 3QCUL 4CW1B 4K7FB 4AEHL 2C26A 1Y6MR 4ZXBA 2BOBA 5GZND 3HC0B 3KXFA 2Z8WC 3QIUD 1AKJA 3RL2B 1ZSDB 2BVQA 4PYHA 1HOCA 1HXMA 1KJ2B 1NBVL 2VO5A 1HE7A 1A7RL 1Z9SA 1W72L 1FIEA 1JZ4A 1TITA 5C6PB 1A6UL 3EFFB 3RUGA 2Q76B 4WIQA 5CEXA 3I6GB 5C0FA 4KHXH 4DGIL 4JM2C 2DD8L 1FNFA 1A7OL 4ISVB 4RGOL 4WWKC 1LE5B 4AM0A 1KJ3L 4LLWA 2KKQA 4FQXA 3CXDL 4L29A 1UM4H 3O8XC 4Y4HD 1C1EH 4U4BA 5E6IA 3IU3B 5JDSA 5CMAA 1QRNB 1FV1A 1Q9KA 4NNYB 3WV0A 3ULVH 5ISZE 2VLKA 2DQUH 2IBZX 3RWHA 4Y4KA 4M5ZH 1QA9A 4F57H 2ILLA 4Y5XC 3T0WA 4JO1L 4F7TA 3EJYD 3MJ9L 1RHFA 4MZ3A 4Y1AE 2OI9C 1MQKH 1JGVH 1FPTH 5I2IB 2M1KA 3RP1A 2DQHH 1MRDL 3VXMB 4LLMA 5DEZA 2JIXB 5FK9B 1NC2D 4KZDH 1X4ZA 3RWCB 1T04A 4K7PY 3T4YA 5ALBH 1RAMA 5HPMB 1NAKL 1QRKA 4U1MA 4M1DL 2V7NA 3UCRA 3LKNA 4PJEA 3NACL 5F1NA 4X6FA 1A7NH 2B1AL 4BSWA 4JFQB 1NCBL 2ZCHH 3O3UN 4PJDF 4PGDB 3KJ6L 3ARVA 5FKPB 1KC5H 1WBXA 3FJTA 5JIIA 4NSKB 3HUJB 4IRJB 4KJQD 4U1HB 5CBEA 4JFFB 4QOKE 1UB5B 4BH7A 3WIHH 5C0RL 3CAFA 5L2JA 4HIXH 4M6OH 1RULL 2ATPA 2IADB 2WAHA 3GB7B 5HHPA 1AP2A 5IM7A 2EZ0D 1ORQA 1XT5A 4LVHB 4CVXA 4YX2L 3IAPA 3MLVH 3WS6C 1I3RB 3RU8H 2EE9A 3WHE1 3QNXB 5GRJL 4YHML 3BGMB 2XFXA 2ENYA 1A1OB 1LP9E 1S78C 5DO2C 2YN5A 5M94B 2IQ9H 1NBQA 1RZKH 3BX7C 3KPNA 3KYMA 5GGTL 4YHZL 5IEHA 5IWLC 1JYXA 4TTGA 2LFGA 2VXQL 2P47B 5F7HA 5IFAH 1WWWX 4H0GA 4I77H 5HDBE 5DXWA 4I18B 1GGUA 4RAUB 4QNPF 3QDMB 1KGCE 1WIOA 5B38G 1A9BA 3OSKA 1ZVHA 3CFJA 5FEBA 3VD9A 1L6XA 1EEZB 3BEWA 2FR4B 2BHZA 2EDXA 3G6AA 2X5PA 5B39G 1AGDA 4IOSD 3EYVB 3I75B 5E4IA 5J6HA 1JNLL 4Y4FD 5ESQB 4C83B 2YBRA 1QSEA 2GSGA 3FL7A 3FHQA 4PRHA 3H3BC 2Q7YA 4FXGA 4IIQA 5DFVC 5T1MA 1EFXD 3C5SB 8FABB 1PX3A 2JB6B 3RY4A 2FX8L 2GJ6E 3O2WH 4IRZL 3U0PA 1QBML 3I50H 5C3LD 3RIFF 4N0RA 4O2CB 4G9FA 3B43A 2CR3A 4MDJA 5JO5A 4NJ9H 2SEBA 4Y2DA 1I7UB 5IFJB 3U9PL 5IW3A 1GZPA 4IRJC 4XBGA 3MV11 2BNUB 4PJ7F 3CFBB 1U8KA 4PJGE 3TP4A 4TUKL 4U6HB 3T2PA 4H25A 3DWTA 5DF0A 1MI5B 2HYMA 3MOAL 4IDLA 1ULVA 1S9WA 1ZWIB 2X4RB 2P5EE 1C12B 3U2SB 1HNFA 5C7XL 4H0IA 2XY1A 1M05B 4LVHC 3MNWA 1BGXH 1X5HA 3RY6C 4FZ8L 1ZHKA 3R4DA 1M7IA 5JPMA 1E4WL 2DLIA 3FB7A 5ILTH 1F02I 2HVKA 3ROLA 1AC6A 1RZGA 3BP5B 4BQ9A 4GBXD 3MR9A 3V5HB 1RJYB 4BSVB 3OZ9H 3SKMB 3QJHB 2AV7B 1RU9H 1S7TA 3QXTA 3LIZH 1F4WL 4NQXB 3D3VB 4S1SL 2WIIA 5DRZB 3S98A 4LPWA 5L9DL 1CF8L 4I18C 3UZVB 3X13A 2GSIA 4JFED 4NHUA 4BFIA 5EZIH 5GQBA 1MIEL 2ED9A 3BI9X 4RGMB 5IB2B 3BP7B 4GLRH 1QACA 5ICYA 1X44A 1CDCA 3OR6A 3QNZA 3VXSA 4MS8C 1UM5L 4W6XB 5EZOL 4NQEE 4HUKB 1WAAF 3QDAA 4JB9L 1XCTA 4GKZB 3BQUB 4QF1B 5C6TH 3FO9B 4HS6A 1IGCH 4LIQL 5ESVA 4ZFOB 5HYEA 1QFPA 1YEHH 1EBAA 4L3AA 3DXAD 3AS2A 4XVSL 4P23A 3QUKB 3H42H 2VDRH 1EO7A 2HFFB 1O7VA 25C8H 4NN5B 5IVZB 5EIQA 4XCCL 5KG9A 3Q5TA 1UYWL 3QUMB 4NQDA 3SE4C 3AU1A 4KH2A 4RMUA 4I0CC 2CIIA 4F3FA 3TT1H 3ARYA 5J06A 1CE1H 1JFQH 2VL4A 4PJIF 1V3KA 4KVCL 1T6VN 4EN3A 3JTTB 4PP2B 5IHZA 1XGYH 4P4KD 1NJ9A 5E00B 3HRZA 3UTSA 3QO1B 4L4TB 1OSPH 2HT4C 5C0BE 3RIAF 2C4XA 1A3RL 4JAMA 1JE6A 1EJOH 4RGNE 4WI5A 2XG5A 3GBNL 3DTXB 3K1DA 4ZAKB 4YR6A 1XGUA 2VLRE 4QRTA 3I02A 4R4NC 4QRSA 5DUBA 5HHNB 3UTQB 1INDH 1OAKL 5AYUH 1JHLH 3B9KB 1Q9LA 1BQUA 1U41A 3TV3H 4DK6A 3MYJB 1FYTA 3BGAA 3I2CL 5SWSA 4RGMC 3VFNA 4NBXB 1N26A 1WBZA 3C5ZB 4HQQH 2BVYA 4G7VH 5F9DC 1EHAA 1Q9WB 3FFCE 1A5FL 3DURB 3EHBD 4PJDE 1EFQA 4C55A 3GMMB 3RI5K 3O3EA 5CP3A 3QXDB 3MTRA 3BQUC 4NCC1 4OD3H 3TPUB 5EOQH 1CQKA 3RDTD 4NPYB 2H3NB 3BH9B 4OZGF 4LF3A 4XCEB 1QSFB 2HT2D 1CXLA 3W0WB 1J1OL 1UJTA 3HAEH 4W4OC 2AV1B 2X4SB 3TA3A 3SKJL 7CGTA 2P5WA 4I5BA 4AIZA 2OJEB 5FHAH 4BFBD 1SEQL 5ICZB 3WHXA 3CU7A 4F8TA 1T3FB 4U33A 1EX0A 4PFEA 4NN5C 5KOVC 2LV4A 1JK8B 5CEZL 1JNNL 3MYZA 1BHGA 5KVDH 3O2DL 2NXZD 3O45B 2JCCE 5DJDB 1K5NB 4ERSL 1Y0LA 2B8OT 2YUVA 1YEKH 4XPBH 5KVFH 4FQ2L 3NCEB 2FECI 1CFQB 2EXWD 4JVPA 4YXKL 4PV8B 3QNYB 3SOBH 3T1FB 4M3KB 4QT5A 5BO1H 4RA0C 4ZYKB 3UP1A 1SY6H 1NUFA 4RAVB 4LHUD 4HS8L 3BJLA 1P5UA 3VXNA 4QNPE 5C2UB 3S4SB 5E8NB 4NZTH 5E7BA 2YD7A 4NO0D 5J7CC 5DJYB 3WL9B 4LCWD 2HKFL 4ZAKC 4X4YB 1KEGL 3K1KC 4S1DC 1T1ZB 1OM3L 3QQ9C 3MV9D 5TE6L 5DUPH 1UB6B 4R0LB 4ODBD 3B9KC 2C3WA 1ODAA 4G6KH 4M93B 1MCKA 1I3VA 2IANB 1C08A 1NC4D 1BVLA 2R1XB 4XWGL 1JPGA 3C5ZC 5JW3H 4PLNC 1AD9A 3NAAL 1F11B 1YY8A 4MQSB 4OD1H 3MRBA 2ESVB 2X42A 2VQTA 5HJ3A 1OT2A 3WFZA 2CXKA 3VFVA 4OF0A 4PBVC 4KJYB 3ARFD 4UT9H 4K8RC 5MEPB 1OGAE 4NHCH 4MSWA 3TZVA 3C6SA 5HDQL 3QFJD 3QA3B 4OF6A 1RZ7L 1U6AH 2F53D 2NY0D 3N1GC 1BQHA 1UADC 1CN4A 1UH2A 2Y36L 3IDJA 3TBTB 1A7PL 4XPTL 3ABZA 4IM8A 5EN2B 3ME0A 3TT3L 4I2XA 4AIXA 5I1AA 4L8BA 4OZFA 2P4AB 2XKNA 1MCLA 2FHCA 5KS9F 5LKNA 3PGCB 5JOFA 5F93C 4PP1D 2BK8A 2NW2B 1MLBB 4QTHB 1R24A 3L95B 3BFOA 4YGVA 3RWJA 4OZ4B 4ODUB 1PSKL 1KJ2L 1P4IH 2CJUH 5ABDE 1A1NB 3PJSB 4FG6C 1AGCA 4MXWL 2H1PL 1IM9A 2GEEA 2VISA 1VADB 2FWOA 1YEJH 2VZVA 2O5XH 1J8HE 4JVUA 4OM1H 5B8CA 2VIRA 1T83C 4ODSH 4R0LC 3DX6A 4PGBB 3HLAB 3V0VA 4PGEA 3HB3C 1WAAE 4Z7VF 2D03H 4M93C 3QDJB 3ULSA 2I60H 3Q1SH 3IETA 1JGEA 1UCBL 5IMKA 2CRYA 4PJ5B 5EZJA 1SQ2N 3MRFA 3GIVA 4PJCB 3NCFB 5DGQA 3V5KB 4N5UA 5A3ID 4TSAH 3I6KB 3OJDA 5HYJD 4KMLB 1GAFH 1FIGL 1Q0XH 5IEKA 4YHOH 2HWZL 3DROB 3LQAC 4K3JL 2IEPA 3BGFB 2ICEA 2HP4A 3K74B 4LSRL 1OWRM 5EBGA 1KXVC 1U42A 5IK3A 3U9UB 1AGFB 3O3AA 2PTTB 4PB9L 1BFOB 1NGZA 3O4LB 5JW5A 1SEBB 2BNRB 3ESVF 4XPHH 1DLHB 4ZO8A 4LLYB 3AS3A 4UUJA 2V5SA 1MJ7L 3VFMA 4A2LA 1MJUL 1U91A 5AG8A 4JEGB 5JMOC 3HG1B 3QUZD 5IGXL 2ZWLT 4MJ2A 3KNBB 1R3LA 2JJUA 3TH2T 4R7DA 4JPVL 3OG6B 4RWYL 3BRGC 3OKLA 3TO4D 1OF2B 4HK3N 2WK2A 3FQNA 4AMKL 1P6FA 2CRIA 3HKFA 5IB4B 3MODL 3CDFA 1KIQB 4GRWF 2VDQL 3BE1H 2QQNL 4J1UA 3S37L 1IC5L 3NFNB 3CLEL 1YPZB 4AG4H 1JPSL 1OB1B 2IAMA 3KDMA 1T1YB 3OKYA 2YPLA 4RWHA 4AENB 2AEQH 1J18A 3ETBF 4ZDHA 4G6ML 2YKLL 3SJVA 2G2RB 4XB7A 5E6ZA 1CD1A 4QHNB 4XP6L 3A6CH 5E8EB 2OK0H 2ZUQB 2XQYK 1AI1H 3NZ8B 2ZOKA 5FGCE 4OZGE 4X9BA 5D7KD 4TVPL 3GHBL 3HPJA 2Q3AA 5DS8A 1G9MH 4NGHH 3LD8B 1I7ZA 3PABB 1ZOXA 5JLZA 4CN6A 4JKKA 5C0DA 5HD8D 4NQUA 2WBJB 1MCNA 3QIWB 4J8RB 1LD9A 4NQCB 1MREL 1WSST 3IFPB 5DD0L 3FN9A 4A6YB 3IJHA 4WGWB 3BGFC 3NCJL 4JFEE 1BBDL 4FMFA 2DDQH 5EFIA 3I6LE 5CWSA 2HTKC 5GGRA 2O5ZL 3DX7B 5E99L 3T0XA 1S7SB 3L3DA 5F7FA 4E41A 5I1IH 2P24B 2DBLL 3L3JB 1FYHB 4DZ8B 1HDMA 1EAPB 4HCRL 5GGUA 3VXQB 5TQ0L 1DQLL 2WWKT 1BFSA 4P5KB 5T1LB 5K9QG 1T5XA 5CZVH 4EI5D 1B4JH 2LU3A 3NN8B 1IAMA 1L7IL 4DKDC 3P4OB 1UH3A 4LKCA 4PJBB 3GMLB 1E27A 2V5RA 3PDDA 2E9WA 2MCPH 1UG9A 2Q6WA 3QEUA 1U92A 1T0MB 1J10A 2X09A 4X6DA 4GAGH 5KVGL 3VGFA 3TNMB 5C0JA 5BVPH 5EA0H 5LWYH 1GRWA 4H88H 3ROOA 1LK2B 2X7LB 4WI7A 3G9VA 1HSAB 3FB8B 4X7FC 5I76A 4YE4L 3TBVA 4APQB 5T3ZH 4DOHB 3KHOA 5TDOA 2XZAH 2IPTL 5IW6A 4P48A 3MLPA 3QXVA 4UTBL 4WWID 1U8LB 2ZUQC 5DJ6B 2IC2A 1K8DB 5FUOH 5EU4B 3MLRH 5DHYA 3N9GH 3K3QA 1BFTA 5HGDB 3VW3L 4MJID 1BLNA 5GGQL 5GS1B 3LD8C 2H8PA 2PYFA 4UU9B 3RI5F 1ZVYA 5IUSA 3GO1L 1U8OB 3T04D 4LGPB 1CBVH 5DT1H 3FT3B 2R1WB 2WBJC 3QIWC 3KYNA 1MCIA 2AEPH 2W0KA 4Q2ZB 4M6MH 1J1PH 1XF2B 2OTWA 3D85D 2W60A 3JUYA 5HHQA 1I8KA 1A2YA 5KS9E 2V6HA 3OV6A 3WIFB 2NY7H 3FCTB 1ZVSB 2QKIA 4QY8A 3WKML 3GSRA 3CMOH 4EKXA 3PL6A 4K3EL 1GC1H 4WEBL 4ZFOL 3W9DB 4CVWA 1H3PL 1NUNB 5JHDD 4DQOL 4M8QA 4K7PH 4I4WB 4PJHF 1S5IH 1PG7H 4M61A 2GFBA 5K33A 4WW2B 1FN4B 1KLFA 3AAZB 1DEEA 2HT3D 4MDIA 4K3GA 1VGEL 3LSOA 4ORGA 1KCKA 5BRZB 1YMMD 5ERWB 3U7AA 4QGYA 2CPCA 1W2KT 2F54A 4TULL 5FUCE 3MJ7B 1A22B 4G8IA 5F3BA 5J9PB 4J3WA 4ZUVB 1NCTA 5I8OL 5DRXA 5TQ2L 2XN9A 3TJEL 4Z7VE 1GZQA 3KS0H 3TYFB 3WS3B 3WKNA 3MOQA 5E08H 5DI8A 3UAJC 4JPIB 3PHOB 4M6NH 5D7LA 4Q0XL 1S9XA 4APQC 1AFVL 4K94H 4PB0L 5EUOE 1QFHA 3WEXA 1KCRL 4KUCD 2C3VB 5JXEA 2WWKO 5GISH 5F96H 1N8ZA 5GS1C 4OZFG 1WCBB 3G5XB 4HFUL 2D7TL 4QWWD 3PDOA 4P2OB 5C07B 1CDJA 1TZGL 5E24E 2LABA 3L7FA 1BWMA 5C09D 2UZXB 5EWIL 2D7PA 3CFEA 4LCWE 3Q2CA 2X4PB 4HWUA 5BQ7B 5DJZB 4F7MA 3EO1B 3MV9E 2ZUUA 1NUGA 12E8L 1E28A 1ZT4B 4LHUG 1FDLL 4N0UE 5EOTA 1EGJL 1SJEA 2FATL 1FZMB 5E56A 5IFHH 1I7RA 4K8RL 1FNLA 4G8GA 4HFWB 4NC1C 5I6XB 5K9QI 5EORL 4YC2B 3VMNA 3BWAB 3VDBA 4GRWE 1OQOA 1P2CB 4GUPA 4O2FB 1AGBB 1NFKA 1MHCB 1S8DA 1EHNA 4QHMA 2BFVH 4WW2C 2EYTA 2X41A 5GSRB 5JW4Q 4ZD3H 1RUQH 4UB0H 1T66D 3RVUC 1F3RB 2F53E 5CJQH 2AJUH 4PUBL 4YXLH 3T77B 1NEZG 4R7NB 3FB5B 4PY7B 1R3IH 5E9DD 4PGJA 2OP4H 2XI9A 1WFUA 4P9MH 2DN7A 5J89A 2FNBA 4MD5B 5CJOL 3HFMH 5EIIB 1A64A 4FQ1H 4OIAA 4KY1L 4WUUE 3O6FB 4P3CH 3DLQR 4TNWK 2AQ3A 4CNIA 3DVGA 1K2DB 5E0QA 4LK4A 4L1HA 3OQ3B 2GTZB 2BSSA 1GH7A 4NM8H 2BY2A 3QUYB 4QRPA 1JVKA 1T1XB 3ARGB 3MO1B 1KT2B 3H9YA 4P2OC 4M7LL 1E4KC 2Y07H 2COQA 4XCYB 1FAIH 1D5BA 3RAJL 3L3OA 3R06A 2AK1L 3BP6B 4L3ED 3GUTB 1G7LB 1VACB 1MFCH 4M7JH 5AZ2L 4WO4A 2Z35A 4DN4H 4KAQL 1G7PB 5I1DA 1CICA 1NAMB 3WXWH 5LXGH 4LRIC 1ZA3B 2XPGB 3VXUA 1U36A 4U49A 1TZIA 3AMKA 3F7YA 4U6VH 1S7RB 4Y16B 5DMIH 5I6XC 5CD5D 4OCRH 4ACPA 4YC2C 3LQAL 3RX7A 3F6IA 5HYSG 4YHPB 4JZJA 2APXA 5I8CB 5KW9H 1VSCA 5HYJE 4K3DH 4FQJL 4FFWD 1PZ5A 4KUCF 4LCYB 4XP4H 1R6VA 1WWCA 1EHLH 2DI9A 1FBIL 3OKKB 2CQVA 5FO9A 3KPSA 4JY6B 3PG2A 4K71B 1NANI 1CVSC 3IDXH 1IC7L 3BIBX 2Z8RA 3MFFB 2CXGA 5H37G 5A2KH 4KK9C 5FCUH 3PXJA 3RVWC 4Y0GA 2UVFA 3TJHD 4BA8A 3KPPB 4POUB 5CFHA 3MLTB 2BNQD 3PIQA 3ARTA 3IVKB 2FCBA 1G6RB 5ISZB 3C8HA 4X8XA 1A14L 3WFEH 1MWAB 1KULA 3IFLH 1AD0B 1ZHNA 3CUPA 4YAQA 2R56H 3EKCA 1DJSA 3O6FC 2OXGA 1UWEL 4M1CD 2RFXB 4U6YA 4OAWB 4Y1AB 5L88H 5D1QB 3EYSH 1IGJB 1VEOA 3U82B 1A4JB 3LN5A 1N5AA 4ONHA 5EU3B 1GGTA 1IJ9A 4MNQA 3ARGC 1U2HA 3DVNB 3RVVD 3TBWA 1HHIB 4MB3A 3JVGC 3VXRD 2X4QB 4P3DA 4U2YA 2DLFH 1KBGH 1N0XL 1WV7T 4GQ9L 4IMKC 4UT7H 3HR6A 2Q8AL 3ZE0E 3ZMRA 5HGHB 1BPVA 4J4PA 3MBEB 1WTGT 5CIPB 4M8VA 1Z3GH 4PJHE 4Q6IA 3HS0A 3KXFD 5CJ8A 4MJ6B 2ZOLB 2DQEH 5CD3B 1JF1A 5D7KE 1PLGH 5H8DA 3WD5L 3BMVA 4O5LH 4J3UA 4QOKB 1D5MB 3V8OA 2IMMA 2A9MH 4OZHA 1OTSC 1TFHA 4P9HH 1WICA 4XBPB 1PKQB 4KV5F 1QLRA 3GK8L 3D2UD 1JZ8A 4YIQB 1X5GA 1I4FA 3MJ8B 3QPXL 4CU7A 1F3JA 1KG0A 5F7KC 5MP6L 5JPNB 1JMXA 4K71C 5JUEH 3QRGL 4POZD 3L3IA 3SDDB 1B2WH 4J3VA 5SWQB 1RMFH 1LO4H 3E6HA 1F4YH 2E6QA 2FJGA 3OXSA 1LP9B 3LMJH 3UYRH 2EKSA 1CDHA 2C4FT 3BKYH 4FQHB 4DGVL 3ZKNC 1SJVA 5KN5A 3P30H 3QQ3B 4LVOB 4WHCA 4GAFB 2YUWA 1UVQB 3WNKA 1YYML 4XNYH 1KN2L 1F00I 5K9JL 3IJSA 4XCFL 1JGDA 1E4XL 5ICXB 4YPJA 3BZEA 3CFDB 2ZKHH 4WFED 2DI7A 1RFDH 3NH7L 3BPCA 2BXZA 1CDIA 3PP4L 5D1QC 1C5CL 1CLZL 3GMRA 1CFBA 4F7CB 2DKMA 5F44A 3ARDB 4X7CC 1R5WB 4TPRH 3U1SL 2Y9RT 5F6HJ 1RURL 5DRNB 5IB5B 4ZNCD 2GJ6B 3P3YA 2Q3ZA 3O41A 4RZCB 4OB5H 4TNVF 1KB5A 3MBEC 3LDBB 4PG2C 4HHAB 1P7QB 5GHWH 2CDFB 3IXAB 1EJ6A 5FIEA 2WQRA 4PJGB 1BZ9B 2W0FB 1XIWA 5I1LA 1GOHA 4RIRA 3NCCB 3MA9H 3WFBH 1U8IA 4X4XB 2P5EB 2CDEB 2VLJA 1PYWA 3VRIB 4X80L 1DUZB 3EO9L 2Z92B 1ACYH 1YQVL 5BS0A 1H3XA 3Q0HA 2FX7L 4CVZB 2Y5EA 5I75B 4M6AA 2VSDA 4O00A 4OKDA 2ZPKL 3EO0B 3QSKB 5FB8B 2Z0BA 3SQBA 5DVOA 2ZSWB 3FRUB 4WVRA 4O58H 4JCMA 4HW6A 4ETQB 1F4XL 5C9JA 2WUBL 3QULA 1FFOB 2G5BA 4LVOC 5JHDE 3KPRA 5CSBA 4X8JA 4GRLB 3DPBA 3MRCB 4ZSOE 3UO1H 4A2MA 1AR1C 5BV7B 4QXTB 4MA3B 2I9TA 3QFDB 3ZTJG 4FZEH 2CH8A 4MWFA 3FT2B 4UV7L 3QQ4A 1K4DB 5IBLD 1YMME 3ARDC 4JFHD 3UC0H 3ARBA 3RUGF 4CN1A 4GMSH 1HI6A 2AQ1A 1KPUB 2XT1B 4PRAA 3T2QA 1WBYB 1BWWA 2FLRT 1AJ7L 5A1AA 3MZGB 1XFPA 4LCUB 1HH9A 2VXVH 2A73B 5DRWA 3TGXA 5IV2A 4EIZC 2XZQH 2X9WA 3LDBC 1SYSA 3MRKB 1G1YA 4X99B 3O6LH 4E5XA 2VDPH 4JPKL 1I3GL 1CGXA 4UIMA 1YC7A 2CLVB 1MFBH 3WNNA 2KZWA 4YFLF 3TN0A 5HDOA 5C09E 1T7ZA 3BIKB 1T20B 1EEYB 2EDTA 3NZHH 4XNXH 3UBXA 5E2WL 3MRMA 5JIPA 5I1JH 1NMAH 3PWLA 3BKCH 3TC9A 1CR9H 3SGEI 4HPYL 2DQJH 4HJJH 1INQB 4FTVD 2XKUA 4Q9RH 3C60B 5JNYB 5D6DC 5C0BB 1HXYB 4LBEB 2CMRL 4PD4J 4UMGA 1WJ3A 3VFTA 4RGNB 1T03H 1DDHB 4G80A 1DL7L 2BSTB 4QTIL 1WLHA 5AUMA 5K59F 4OLWH 3WMSA 1NH6A 2WINA 3HC3L 4GRLC 5GXBB 5CEYA 1U8HB 3OTTA 1QQDA 3TO2A 5BV7C 3MROA 1NDMB 2I24N 4C56A 3QP3A 2PYEA 4HG4K 1MCWW 2R2BA 3HMXL 1I1AD 3FFDA 4W6WB 3D39A 2QBWA 3WXVL 2HG5A 3FFCB 4LARH 4NWTH 4O02L 4PJDB 4GXVH 2XXMB 4D0BB 1GOFA 1DTUA 4I3RH 4G42B 4KROD 1PG7X 2AJSL 5DK3A 1XF4A 2GQHA 5IR1B 1DR9A 2ID5A 3BVNA 1QEWB 4OFYA 1RZJC 4I3SH 3GSWA 3K2MC 4KV5E 4L4VA 3WHE0 5I8EB 4FHBD 4ZPVB 3FN0H 3DETD 5D72H 1QKZL 4NQDD 3VWKA 1I7TB 1S7UB 4PV9B 2EH8H 3C5JB 1A1MA 3DV6A 4J23A 3QUXB 3PXHA 4P57B 3F58H 5CHNA 5IQ9B 1B0RA 1L6ZA 3WCYA 2HTLC 4KTDL 4XC1L 3B5GA 3HE6D 4HJ0D 3TM6A 2JCCB 1P1ZA 2WLYA 1FG2B 3G5YB 3HI5H 1ZAGA 4I0PA 4Z76B 1N7MH 4L3EE 3N85H 4G9DA 4P59L 4V1DA 3QG7L 4M03A 4KKBC 3CC5B 3V4UL 1ZHLB 4TUOA 5CZKA 4M7ZB 1XF5B 2IH1A 2NX5E 1DBBH 5KSBF 3C60C 1MPAH 3FOLA 1CFSB 3PWPA 4OZFH 4RX4D 3B3IB 4RGNC 3QIUB 2A9NH 3MRJA 3VFWB 1WZLA 4JLRB 1YN7A 3DRTB 5F88A 1ZS8B 1UJ3B 3HCVB 3QCTL 1FYTD 1ZLUK 2D9QB 3P4MA 1FP5A 5FGBA 1V5JA 4U3XA 5SWSD 3TBYA 5GRUH 1QZ1A 4NFBA 1LEKB 3PNWA 2VZOA 1MHHA 1UM6H 3V6FB 4FXLA 2FZ3B 3SE9L 1G9NC 5CEZD 5GJTL 1BZ7B 4PJ8D 2XWTA 4XGZB 1FVDA 5KVEL 3S88H 1QFWL 2R39A 4YO0B 1LE9B 4PRPD 3OR7A 1AXSB 4Y4HB 3B6SA 1Z5LA 1YZZA 4BH8B 1OGAB 2P5WD 2JJVA 2XY2A 3BESR 1NMBH 1VFBB 4OLYH 1RVFH 2BY3A 1UFUA 3WDJA 1JPFA 3BEVA 4GKNB 4PTUA 4XZUA 3L1OL 2IQAA 3NFPA 2F8OA 5ADPH 2XG4A 2AS5M 5TDPB 5C08E 4JR9H 2CIKB 4YHLL 5TE4H 5F97E 1IZJA 3PHSA 3QUXC 1RK0B 4UV4L 1K85A 3G08B 1NC2B 5DC4B 2XNAA 3BXNB 4MCZB 5DQ9A 4HJGA 1NAML 4WWKD 4DUVA 1MUJB 4X6EA 4XBEL 3VXRE 4AZ8A 5E7FA 2PTVA 3RWGA 4G5ZL 2Y7QA 3NCYS 1CXHA 1KCVL 4DJMA 4LCIL 1BVZA 2E8YA 3GKWL 2MQCA 4KUZH 4U6XB 1BBJB 1F4AA 1QBAA 3B2VH 4CKVX 4M7ZC 4MA8L 4UBDC 3KXFE 5J6GB 4KK5C 3MMEA 4M43H 4Y5VB 1JWMB 4JG0H 4LQ1A 4OV6F 5ESAA 4Z95H 3QIUC 5I1HL 3SGKA 3AY4A 3RJDA 1J8HB 2X1PA 5K9OB 2MQ3A 1UJ3C 2YPKA 1DUYB 5F3HA 3RUGE 2DLTA 2CR6A 1B0WA 3FQRB 5E94A 2FEEI 3IS0X 3O3DB 4ZUUA 1ZLWK 4G8EB 2YD1A 3P9WB 1KF9B 3VD3A 4HWEL 5KTEL 5E95B 1G6RL 4WV1B 3L5XL 2OQJA 4JFDA 4WTXA 3MNVA 1F58L 1YNTA 4DVBA 2Y6SD 2AJZB 4Y4HC 3B8YA 4GSDL 3H3PH 2BVOB 3ORJA 1I8IA 1AXIB 3O2VH 5I1GH 3UJIL 3NPZB 5HI4D 5DA4A 4YH6A 3BMWA 4OCLC 4FQQA 3EJYC 1CT8B 2QSQA 3WSQH 5JA8B 2E7LC 4PJIB 4DTGH 3UTTA 1QD0A 4NNXA 2IALB 5DK0A 1FORH 1R0AL 5EU6A 3DV4A 4PTTB 1KFAL 4OGYL 3O8XA 1EFXB 1IVLA 3QHZL 4C58B 3VGDA 1GGIH 4P5TA 1WQVT 1KXTB 4ZG1A 4QHKJ 3KPMB 3LEYL 1T1WA 2HFEA 3AS1A 5K59E 4MD0B 1IM9D 1GPOH 5IG7A 4Y5YB 5IB3B 43CAB 2ATKA 4L5FH 2VE6A 1ZTXL 5D7JA 4Y5VC 5H94B 2A6JB 4ODTH 1AIFA 1ZLWH 1X5XA 1ZK9A 2JB5H 3SPVA 5ACLA 2DWEB 5DSCA 1JGUH 1XR8B 2PO6B 1TLKA 4JY5H 3A67L 5I18H 2QLVB 3KWWA 3RNKB 5J3HD 1E6JH 1MRFL 2EZ0C 3FHAA 1KIRB 4WI6A 5MEQB 3F7VB 3TIEB 1N3NA 2W92A 4FQPA 5FGCB 4OZGB 3ZZ1A 3KPOB 4WV1C 3ZKXB 1RZIB 4GBXB 4QHUA 3TBSB 4JJHA 2FJFB 4M1GL 3S36H 1YJDH 4X0KB 1INEH 3DYMA 2G60L 4YFDB 4ORZC 2XOTA 4IRJD 2ARJB 2CKBH 5IBTL 3RL2A 1YNLL 4JFFD 4FP8L 4BELD 3CVHA 2P43B 2NTFB 1SBSL 3DX8B 1IQWL 4JFEB 2RCSL 1MAJA 5F9JB 1LVEA 1RIVH 1FRGL 3VFGH 3LH2H 1HINL 3IF1B 3I6GA 3NGBC 3WS6A 3EFDL 4HPOH 1A9EB 3GRWH 4EUPB 3MXVL 4GKSA 3V0WL 4ISVA 1LE5A 3W82A 1KTLB 1CG9B 4QHLB 3GIZH 4XVTL 4HGWB 1ORSB 5IWLA 4HUMB 5KSBE 2XZCH 3HZVA 1QRNA 4NNYA 1LEGB 3CVIL 3T2NH 4NFDA 5F7MC 4TVPD 1KEML 1TZHB 3MLWH 4JQXC 4JZNB 3TVMA 2FECL 2CO6B 4Y5YC 3V6ZA 1JWSA 3JWOC 3O6ML 3QWRD 1NDGB 1NGPH 1JPTH 3F62A 2UWEF 4KGJA 1RUKH 5I2IA 1WISA 4IS6B 4YNYB 1SYVA 4K23L 2JIXA 3DNKA 5L8LB 5FK9A 3RWCA 1CU4H 2PO6C 1WEJL 3IDIB 1D6VL 1CLOL 1ZLSL 4PJAF 2VLLA 5D9SA 5HHVL 1BAFH 1KIPA 4MAYA 4X9IA 2RAMA 1A0QL 3FONB 5IOPB 4PGDA 4P4KB 3ZKXC 4GBXC 4FTVE 5C86A 1FO0H 2AK4A 1MCJA 4NSKA 2DMCA 3HUJA 5DVNA 4U1HA 4NNPL 2HN7A 1V3LA 5D7SH 5DD6B 3OAUL 2Q8BL 5FYKH 1AQDB 1TTGA 3MRLA 3NCBB 3QWQB 3P40A 5DK2B 3ZKQD 5J13B 1BX2B 2CUIA 1MCOL 2IADA 3GB7A 2I5YH 2JK5A 5DVKA 5KS9B 5F7EH 2UYLB 5BW7C 3VXSE 3IRZA 1CGSH 5JHLL 1I3RA 4YQXL 3U48A 1HWHB 4IDJH 4C4KT 4UIKL 1A1OA 4YFLI 2ITDB 3UDWC 1RZJL 4ONGL 1XGPB 3GSQB 15C8H 2HT4D 4HXBL 4MA7H 4R4FL 1KACB 3RDTB 5JXAL 2ZUVA 1OSZA 1NGXB 3OGCA 4WHYG 4LSSL 1N4XH 1T2QL 4X5XB 3S34L 3GM8A 3MLSH 1K6QL 5ENWA 1NGWA 4I18A 4R4ND 1ZMYA 3BPOB 2IH3B 3QPQD 1IGFL 1NFDF 4YEEA 1G7HA 3ZTJH 1U3JA 4Z78A 3D9AH 2BRQA 4RRPA 4NBYB 1EEZA 4NQDE 3VE0B 4Z0XB 4Z7VB 2MHAA 4RISL 3EYVA 3I75A 3U6RA 1EMTL 2FB4L 2IMNA 3V4VL 5ESQA 2X4TB 5DEFA 3SKOA 5E5UB 2NXZB 2VQUA 4HKJA 5EU7E 2EO9A 2EH7H 2CRMA 1XH3B 2ADJA 1OPGL 5EUOB 2JB6A 3BQUD 1CTNA 1DQML 2CDGB 3F5WA 3FOMA 3LN4B 1FJ1B 2APBA 5TPWH 4O2CA 3TCLB 1IKNA 1CGVA 1PX4A 4P4KC 4PRDB 3V2AR 5IFJA 2J8OA 3N0PB 4UILL 1DBJL 1TJHL 1N59B 3D69B 3QQNA 1OD9A 4YHKH 4NO0B 3SE4A 3FQUB 4LCWB 4YUEH 5J13C 4FNLH 3MV9B 2X4RA 1FYTE 4NKMB 5SWSE 1UA6H 4N0UB 3CFCH 3BKJL 2VDLH 3GSNA 5CEZE 2VABB 1NC4B 4LKXB 2HRPL 1BJ1H 3BZ4B 4H1LG 3RZWA 4GRWB 1RJYA 2CK0L 3ISWA 5A2LH 2HJKB 3RNQA 4PRPE 3MRGB 1HHKB 1MFEL 4AQ1B 3WE6A 4NM4L 4NQXA 4QRQB 3RDTC 1BOGB 3D3VA 1J8KA 4FFZL 5DRZA 4TVSa 4D94A 2P5WE 2HT2C 4U1KB 2D4DA 2JE8A 1NLBH 1H3UA 4WEMB 3DARA 4ZAKD 5H35B 4NUGL 2Q20A 2F53B 2YC1B 2B7DT 3BSZH 3QQ9D 5IVNA 3BPOC 4OUOA 5JQ6L 1RJLB 3GMPB 2Z31B 4PS4L 3RA7H 2BZDA 1ND0A 2XN9D 3GSNL 3P9MB 4ODVH 3B9KD 4DVRH 4XXDB 3GHEH 4HMDA 4MXVF 5FUCC 3UJJH 4M62L 3I9GH 5JOEA 5CKAA 1C5DA 3HZMA 1WZ1L 5DLMH 5DUMH 3BP7A 4Z6AT 5IB2A 3KPQA 1FGNL 5D7LD 3KPLB 5EOCH 4D2NA 4R90L 1NPUA 1DE4B 2O5YL 3PDGA 4NKOA 2NXZC 3HPLA 1K8IB 4ZO6A 5C0GB 3DX9B 5JXED 3M8OL 4P3WA 3INUL 4NIKB 4WUUB 4C4KO 2W65A 2LE9A 2NNAA 5I9QB 3CH1B 4OFPA 5FM8A 4Z9KB 4ZS7L 5I0ZA 5KANI 3QUKA 3MBXH 3GZKA 3WFDL 3GM0A 4H8WC 4HUWB 1PKOA 2HFFA 2P45B 5JR1H 2HJLB 3FQXA 2EIDA 3QUMA 3T09A 4H20H 1ADQH 3LRSB 4QXUL 4X6DF 4DN3H 3WFHB 2EEBA 1DFBH 1EBPA 4GRMB 4OJFH 2HKHL 2UVEA 4HV8B 1JGLH 3SKNA 1DQQB 4K9EL 3FN3A 1P53A 3GNMH 4PP2A 4U1IA 1LO2L 1S7QB 4FFYH 4FQIH 3NA9H 3IXTA 3WUWB 1GIGL 5CUSL 3AC0A 1ED3B 3QO1A 5IHLB 4HMCA 4JHWH 2WQ8A 4ZTPH 5FECB 2H26B 5HYJB 4TQEL 3S5LB 5C2BL 4WEUD 2UWEE 2OCFD 2AJ3B 1N6QL 4NDMA 5HHNA 3UTQA 2R2CA 5E2VL 2Z31C 4I2XE 1NUDA 4PJAE 5FFLA 1MHEB 4AT6B 3CZFB 2PTUA 1BIIB 3NIFF 3EYUH 3U4BH 5DVMA 4IOIB 1Q9WA 1B4RA 1CFVH 3DURA 3K8MA 2LTQB 3QUZB 4G6JL 1XF1A 3E0GA 1HSBB 2D7OA 3D18A 2X4NB 3TPUA 3MCKA 2ESVD 1ZGLM 4JHAL 3TO4B 5FYJH 4XCEA 1QSFA 3PWNA 5HYIA 1NEUA 1E0OB 4MNHA 2X89D 5D70H 4ZMAT 3IYLW 5I9QC 1MCSA 1CYGA 2DYPA 1ZHBB 4QRPD 4KKCC 5I8KL 4GW4B 5DFTA 2OL3B 5CS7A 1BP3B 3DHMA 4L9LB 1LGVA 4UQ3B 1SM3L 3W9EB 4FXKA 4XAKD 5ALCH 2V7HB 4UDTA 1YEIL 5DMKB 1AGEA 3QCUH 2YR3A 3UTPD 1K5NA 2EE6A 3ECBB 4NZUL 4JN1H 4LVNB 1HILA 4PJHB 1A8JH 1NCNA 1CFQA 2DM3A 2B1HL 4PV8A 3QNYA 2DWDB 1NBVH 4WJ5A 5DHVB 1H8OA 3L7EA 3T1FA 4DKAA 2D3VA 1OARH 3KAAA 1MFAL 3CSGA 5CJBA 4Z0BL 1A6TA 5A3IC 5L6YH 1VFOA 1A6UH 1QLFB 3H7LA 3P4NA 4KPHH 1NFDE 1DEDA 1DBAH 4WU5A 4DGIH 3KPSD 5JORB 2J12B 5DJYA 4RGOH 3ET9F 1KB5H 3UJTL 1KJ3H 1T83A 4JJ5B 4GG8B 3QXWA 3CXDH 2MJWA 4MD4B 4HKBB 4LMQI 5FDWB 3DHJA 2AXJA 4FMKA 4YDKH 2IANA 2X10A 4TTDD 4XTRC 4JO1H 32C2B 2ZUXA 4S0TD 3B83A 3MJ9H 3AROA 4LCCB 2N4IA 3QUZC 4PREB 5EH1A 1MRDH 4U3HA 4ODXB 2Q87A 3UYOD 4EI5B 3TO4C 2R9HD 1II4E 4MHHG 1UM4L 1C1EL 3M17B 1PW3A 3ULVL 4JRXD 3NACH 1D5XB 4F57L 2YPLE 3V7MA 4L8SB 4Z77B 2OX5A 4L9LC 2B1AH 4KMTL 2VRAA 1YNKL 3SJVE 5D7IA 1NCBH 2FJHB 5EN2A 3O4LD 2DICA 1NCCL 2P46B 4OKVB 3KJ6H 1TVHB 5DJ8A 1H0DB 4U7KA 2DQHL 4HX1B 4I1NB 4C57C 3MQIA 3HG1D 4M4PA 5ALBL 3WIHA 4DAGL 4LVNC 1MLBA 1LO3H 5C0RH 4YBHA 3FMGL 5EO0B 4RRPG 5C0IB 1EVTC 3K81A 1RULH 2R23B 2N7AA 4KTYA 5A16A 4JGMA 4AJ0A 3QBTB 4ZQKB 5K9KA 2L4OA 4ODUA 2YD2A 1RIHH 5T1KA 4UTAL 5D71L 3CSYB 2FBOJ 3T0EA 5CINL 5IW1B 1BVKA 2VZUA 1KPVB 1FL6B 3KR3L 1LEIB 4N9GA 5HD8C 4MXVE 3GGWB 4PRNA 1W0YT 1XEDA 4OGXL 3WIHL 4LFHG 2YHGA 5GGTH 4XNQA 4WY7H 4MQTB 5JMRA 3Q3GA 5CP7B 4JY4A 4O4YH 1FLRL 4LP4A 3K2UL 2BX5A 1A7QL 3S36X 5IMMB 3SY0A 5JHDB 1TJGH 4LCCC 3P73B 3I6KA 3H9SA 1I8LA 2DQFA 1AR2A 1XR9A 4ZSOB 3BN9D 4OIBA 2ED8A 4EI5C 2X2YA 4CADB 1OT1A 2IQ9L 5GJSL 2IPUK 1JNLH 2WBJD 3LY6A 3FAXA 2FX9H 5DD5H 5IFAL 1J0YA 3MREA 4X6BB 4X6DE 1YMMB 4I77L 1FE8H 1RUML 3U9UA 2YPVL 1AGFA 4L8SC 2M2DA 2PTTA 4NUJB 2WANA 1I1CA 3LHPH 1OD7A 1KYOJ 1S7VB 3RWFB 4UI2A 1G6VK 3OX8B 2R1YB 4NJAL 5EC1B 2BHYA 3JZ7A 1A3LL 2NLJB 5HGBA 1UZ8B 3OG4B 5KSVA 2VL5B 2HVJA 4DKFL 3IKKA 4LSPH 1CWVA 1D5ZA 5JA9A 1KIQA 4XPAL 2ORBH 5C7XH 3QT2A 1LO0H 2GITB 5DJXA 1S7XA 2J8UA 3TNNB 4IRSD 2I26N 2XIDA 2R2EA 2XICA 3G9AB 5CJXC 1IL1A 3OGOE 1P4LA 1T22B 4MVBC 1OB1A 1P5VA 5BS0D 1XZ0A 4WI4A 5F6HI 3ZO0A 5LGHL 5C09B 3C08H 2RBLA 4CJ1A 1HH6B 1HYRC 4ETYA 3NIFE 4N0FB 4QHNA 2AGJH 3E2HB 1LNUB 4MX7B 2EIEA 3QJFB 1IRAY 4S1SH 5FXCH 1BFVL 3NZ8A 3SQOH 4ZNEE 3QIBB 4XHQA 4N8CL 5B4MC 2B39A 3VRLF 1MIEH 1F6LL 4R3SA 1R5IA 3G5ZA 4XVJL 2VAJA 4NQCA 3O11A 1WC7B 3SDCB 1RU9L 3IFPA 2E9IA 3ARBD 2HT3C 5FA3A 5H2BB 2F54E 4A6YA 5IROC 4CDGC 5D93B 1ONQB 5GSVB 2VQ1A 2XN9E 1Z0NA 4LIQH 1AQKH 3DO3A 3X12A 3DO7A 2YWZA 4JKLA 1IAIL 5HY9B 5D7LE 3GMNB 4TUJB 4XVSH 4Z7OF 3L3JA 4WGVB 1GCFA 1EAPA 4JN2B 2K9UA 2D31A 2OZ4L 1OTUD 1FSKC 2ICCA 4QEGA 4WHYH 4XCCH 5T1LA 1ACZA 2MNUA 5C6TL 3SCMA 4QRRD 3NN8A 4XAWL 3P4OA 4X7TA 4PJBA 3GMLA 1CD9B 4KK6C 1U8MA 1CK0L 3BZFB 1FZOB 4ZOCA 1T0MA 4U1NB 4QWWC 1KXQE 4KVCH 5KAQF 4EVNB 4N8VA 1BD2A 1G7MB 3MOBL 4HUXA 1YEDA 3RTQD 1AXTL 1LK2A 2X7LA 3PHQB 4PJ9B 4W4NA 1KLUB 4L3EB 1HSAA 5T3XD 1EZVX 3FB8A 1JRHH 3E2HC 4RMWA 3UZQA 3GEWB 4WDIB 1L9MA 3TT1L 3HR5B 1Z9LA 1HQRB 4M4RA 2NX5B 4G8GE 2FL5A 1CE1L 4MAUL 4P4RB 1JFQL 1G0XA 1RUPL 3L5WA 4WHTB 4X5WB 5EU4A 1OAKH 4YWGL 5MERB 3DJ9A 3QIBC 3FT4B 5HGDA 5IESL 5GS1A 1DQJA 1FL5B 4LPUA 1XGYL 5GRXG 2L7UA 3I2CH 4Y88A 3MCG1 5CZXD 2DQIH 5IIEB 4BZYA 4AYFA 1ES0B 3WO3B 1MY7A 1OSPL 2LQRA 3FT3A 5TH2A 5C07D 1Q72H 2WBKA 4HC1A 4HF5L 1MIML 3SDCC 5HYFA 4YHIA 4Q2ZA 5D93C 3HNTL 9CGTA 2DJ4A 5AYUL 1AHWC 3FCTA 3FB6B 1J1OH 3VWJA 1R3JA 1NMCB 4FA8A 4H1LH 3S4SG 1MVUB 2FGWL 5D2NA 2CUHA 2OR8A 2YUXA 3BO8B 3DSFH 1AH1A 2A6KB 5C0EB 2W38A 1VEPA 4G7VL 3RFZC 1H5BA 3QZWG 1JNNH 3DMMA 4XXCA 3L5JA 3RPIB 1FN4A 5F89A 1T80A 2EKJA 1CL7I 2VXUH 1EIBA 4LNRB 4ERSH 4FQLH 4YHNA 3P0YL 4QRPE 5C08B 5BRZA 1IAOA 2V2TB 3CPLA 1JWUB 5E1AA 2N56A 3MJ7A 4B41A 5J9PA 1RUAH 4KK9D 4ZFFB 1W72B 1SY6A 4U6TA 4XAKE 3TYFA 3VXRB 4JFYA 4U1GB 4PJ9C 4HS8H 3IJYB 5J1AA 2AXGB 3PHOA 2FYYB 1KYOK 3GI9H 3VXUE 3MRDB 4X4ZA 1HHJA 4P5MA 3PWPD 1U3YA 4ZXBB 2XZZA 3VG9B 2BOBB 1HYSD 3KXFB 1JTOA 1AKJB 1MCBA 5KVFL 1KEGH 3MLUL 1OM3H 5BVJA 5ID1A 1HOCB 1HXMB 3UZEA 3SOBL 4HWBA 5BO1L 3RKPA 1WCBA 1PZUB 3S7GA 4P2OA 1E4KA 3KPSE 3D2UB 3RUGB 2AAVA 4FFWC 5CEXB 2ZCKL 5BZDB 1U8NA 2X4PA 3AXLA 2IWGA 3Q6FA 4XX1E 5DJZA 3EO1A 4I9WD 4AM0B 1ZT4A 4WFHE 4Z7WA 3LV3A 4FQXB 3V52L 2EE3A 5E6IB 5JDSB 5CMAB 3TJHC 2PN5A 1NMCC 1RZ7H 1FFQA 2R0LH 4G6KL 4Y4KB 1QA9B 1D7FA 5A2FA 2EECA 4F7TB 1PDKA 2Y72A 3G6DL 3OAYK 1A7PH 4CMMA 5EC2A 2PW2A 2OL3L 4F33B 3F7RA 3TEUA 2GYSA 1LDPL 1A6WH 4ZTOH 3LS5L 4LLMB 3VG0L 4UT9L 5LGJA 4NHCL 1T04B 2CO7B 4MNQE 5HI3C 3T1WA 2XXCB 4U1MB 4HIHA 3FB5A 4NC2B 5F1NB 4KMQA 3RVVC 1DANT 3EYFA 3ZKND 1S5HB 1KJ2H 5EIIA 4U1GC 3BRFA 4B53A 5J8OA 3D0VB 3GMOB 1QPXA 5MHSD 3O6FA 3VRLE 1CIUA 3AS0A 4ZXBC 3VG9C 3P9LB 4BH7B 4OZHE 3RHWK 4PLOB 1K2DA 4X9GA 2GHWB 4ALAL 5T5FH 3OKNA 3JSSA 5F7NC 2ATPB 2VMFA 5ADOH 5HHPB 2MSPA 2GTZA 5AWNL 1AP2B 3QUYA 5IM7B 1P4IL 2CJUL 3ARGA 4JDVA 1ORQB 4CVXB 4NRYA 1UCBH 4BZ1H 4EZMA 3VD4A 4MYWB 3UTZA 5C3TA 1UKTA 3U0WH 5CSZA 2XFXB 1VACA 1VCAA 2B0SL 4Z7OE 4ODHH 2O5XL 4OGZA 4OLZL 1G7PA 1FIGH 4FQXC 4ODSL 5FUZH 3KYMB 3KPNB 5IEHB 1X5KA 1ZA3A 4OD2A 5E6IC 2I9LA 4K3JH 4LLQA 4PIRF 2D03L 4Y16A 3MUY1 4Y4KC 4LSRH 4XNZB 3REVA 4L4JA 5DQDL 5I8CA 1A9BB 1REIA 4TSAL 3CFJB 4JDZB 1MJ7H 1SJXA 4HH8A 2AEIT 3G6AB 1MJUH 3C9NB 3DOSA 1ZKAA 1AGDB 1GAFL 5LJYH 4JY6A 4QRUB 5EBWA 3GFUA 4GFTB 2YBRB 4I3GA 2JJTA 5EU6D 2W0LA 2Q7YB 4FXGB 2PUQT 5IVXA 3WN5A 4AMKH 3KPPA 4P5TD 3MODH 4CDHA 4WW1A 2VDQH 5KAQG 5KSBB 5T1DH 4HS3A 3P0VL 2QQNH 3S37H 3IVKA 5TFSH 3DRQA 5ISZA 3CLEH 2X4UB 1MWAA 2SEBB 4Y2DB 3LQZA 4WTZG 3J8F7 5D7JD 4XBGB 2CLZA 4G6MH 2YKLH 2QTEA 1AR1D 1X5YA 2RFXA 1U8KB 1KGCD 1AC0A 5D1QA 3WNLA 4H25B 4OQTA 5SWZA 1S9WB 4OSUH 1NCAH 1PAMA 3BDBA 4HEME 2VYRE 1HHGA 1HHHA 3ARDD 3NFSH 1V7NH 2NY5C 3EYOB 5BS0E 4TVPH 1U9KA 4HKXA 1MNUL 1IC1A 2X4QA 4CAGA 1M7IB 5MENA 2AEQL 2HVKB 3ROLB 1RZGB 2R2HA 1U8JA 2NY6D 3MBEA 2BC4A 5FYLH 4NO3A 2QQLH 4FTVB 1U3HD 3PQYA 2OK0L 1G7JA 5CD3A 2R69L 1D5MA 2V17L 4XNZC 2UUDK 1BBDH 5KSUA 5F72S 2E9JA 1PKQA 3NIGF 4HIEA 1BEYL 4BFIB 3E6FA 5E8OA 2O5ZH 5ANMB 5E99H 5EU5B 4LEXL 5BMFH 3GBML 3OR6B 4HCRH 1X6LA 5GRVK 3VXSB 5TQ0H 3SDDA 2X4OB 4XCNB 5IBLC 3R0MA 3HI6L 1BF8A 1L7IH 5B38A 2X1QA 1IM3B 2J6EL 5ESVB 2DDQL 3IDMB 2HLAA 3QQ3A 5B39A 1QG3A 3L5HA 3K46A 1UVQA 5HDLA 3TVMD 4XB8A 5ICXA 4Y2DC 1JHTA 5KVGH 2V2XA 3CFDA 3GSUA 4EI6A 5KG9B 2EDOA 3W5MA 4QRRE 4NQDB 1B4JL 4YE4H 4F7CA 1RZFH 2EC9T 3OKDA 4F3FB 2IPTH 3Q48A 3MUZ1 1UACL 1R3KA 1I1FA 3BW9A 5DC0A 5ID0B 1IARB 3R0NA 3HE6B 2UZIH 1QO3B 2YD3A 3VW3H 4NQED 2VN4A 1E4XI 4EN3B 5DRNA 3I3BA 1MJJA 5IHZB 2NY2D 2GJ6A 1NJ9B 5T3XE 4YZFF 4OBSA 4RZCA 1MY5A 3GO1H 4I0KA 2UUDH 3HRZB 1DVFA 5J11B 1LP9F 4Q9CA 5T3ZL 4HHAA 4NQTA 2DLHA 3MA7B 4YR6B 4QRTB 1RK1A 1X7QB 4QRSB 5DUBB 3V6OE 2QR0A 2H2PD 2ICES 5D1XD 2HTLD 1FYTB 4K3EH 5SWSB 4C56E 4KRLB 3VFNB 1DQDH 1N2RA 2YD6A 1KUMA 3MACL 1KJMB 5DT1L 1WBZB 2Z92A 4LLUA 4CVZA 2X1WL 3SDYL 2AEPL 4PJ8B 4B0MM 1T2JA 3O3EB 4KKBD 4KJWD 4XT1C 1X4XA 2ZSWA 4NCDA 3FRUA 4LF3B 4PJFA 3U4EB 3QUMH 1VGEH 3C60D 3HMWH 4PRPB 4ONFH 4PGCB 3CMOL 3ZDYF 4TULH 2P5WB 2NY3B 4AIZB 4L4VE 3SBWA 3TIDA 3WHXB 5I8OH 2VLRD 1CXIA 1A6ZA 1S5IL 1PG7L 1J0JA 4JANA 2A6IB 5C0CD 3DETC 4QXTA 1I9RL 2AI0L 3FT2A 4HZAA 4PB0H 2IG2H 3FTGA 3LKSB 1Y0LB 2B2XH 1S9YA 2NZ9D 2IBZY 4WU7A 3HE6C 5DEGB 5FV1L 5D5MA 5EU7C 1WBYA 1ZEAL 4AL8L 2KUTA 1ITCA 5DJ0A 4QT5B 2Y23A 4EN3C 4LCUA 4HFUH 2D7TH 2BVPB 1AY1L 2C1PA 1TZGH 5E08L 5J11C 5EWIH 4M6NL 3VXNB 3PWPE 4K94L 3MRKA 4ZFGH 4IBLT 12E8H 4W6YB 1FDLH 4MQXC 4KRMB 5GISL 1EGJH 1KENH 4I48B 2CLVA 5F96L 2FATH 1CLCA 2LAGB 1XGQB 4K8RH 5KSAA 4OI9A 1ERNA 1BVLB 3NABL 1EEYA 4UNVA 1HIML 3RVXD 2V5TA 3BUYA 3X11B 4D3CL 1JF6A 4PJ8C 4I9WE 2ADFH 4M48H 2MPAL 1G7IA 3FQTA 5HJ3B 1DN0A 4HH9B 4AK1A 3EOBA 1VKXB 4RBPK 4MSWB 4JCLA 3C6SB 4PUBH 3TZVB 1CZ8L 2AKRB 5E2TL 5IFHL 3CK0H 2N7BA 2UWEB 5I0DA 5F7DA 4EEEA 4H5SA 3RWEA 1PY4A 1BQHB 2NY3C 4NP4L 4HK3J 5SX4H 1CGWA 5CJOH 5BXFB 4R96A 4I2XB 3R8QA 4D8PB 4PJAB 4L8BB 4NT6A 5MEOA 2XKNB 4KY1H 5JOFB 1GYAA 4ZD3L 4UB0L 2K3TA 5CJQL 3FFCA 2DQTL 1S7WA 1R24B 4OCYH 4QKXB 2HA1A 4D0BA 5BZWA 1R3IL 5I30L 3O9WD 4YGVB 5EO9A 3RWJB 1YC8A 5DMGD 3ZTNL 2D9CA 2NMSA 4HLZG 2GI7A 4YDLB 1QEWA 1OGAD 4M7LH 5MHSE 4FQ1L 1O5DT 3NIGE 1ETZB 5I8EA 3RAJH 1IM9B 2VISB 1EAJA 1UWXK 1WVZA 2AK1H 1MQ8A 2HFTA 2VXSL 2APTA 2FWOB 4ZUTB 1KTKE 2WWMD 1OW0C 5HGAA 3VGGA 4E0RA 1JYNA 3QRFM 5B8CB 2VIRB 3QUXA 4P57A 4LPVA 5IQ9A 5DR5H 4PR5B 5FKAB 3MUGA 3FRPA 4PGEB 4V2CB 4I8DA 4F37K 3BPNB 5KBNC 3ULSB 4G8FB 4LQFH 4LSTL 5FA4A 1ZGLP 3IETB 3LQAH 1JGEB 5FHBH 4RBPH 2GTWA 5EZJB 3MRFB 3GIVB 3VFSA 1FLTX 4Z8FH 1RHHA 3EOAA 4HXAL 2O26U 3OJDB 4M7JL 4NZDA 7FABL 1XF5A 1FBIH 2DB8A 5HHOA 3WXWL 1Q1JL 5LXGL 1NFDB 2Y6SC 3B3IA 3JV4A 3TZVC 2DAVA 3D1MC 3Q6GL 5F7UA 3RWIA 5HHMD 4ZUSB 4U6VL 1G9EA 2ICEB 5DMIL 3VFWA 4OCRL 4U0RB 1D9KA 5F1KC 5IK3B 3BD5A 1J8HD 2Z4QB 4XMKL 4F7PB 5HI4C 4BYHA 1H3WM 5KW9L 4NOBA 1DBKH 4K3DL 4MMZC 1LEKA 3WYRA 3OHXA 3V4PH 2FO4A 3M1BA 2FZ3A 4S11A 4N5ED 2F5AH 1QNZL 5INCA 5EU6E 1DLFH 4YZFE 4XGZA 3S96B 1R3LB 1UWEH 4XNUL 4R7DB 3IDXL 3G6JA 1YYLH 2QSVA 2APWA 4JGUA 2JCCF 3OKLB 2GKIA 2RJMA 5FCUL 1LE9A 3FQNB 5EBMB 1PEWA 1F8TL 1UWXH 4Y4HA 3NTCH 2A0LD 2DYPD 5T5NG 5J0BA 1T5WA 4PJ7A 3ZSTA 4YDLC 4LASL 3WFEL 1M71B 1ZE3C 3IFLL 2NY5L 2E7MA 4GKNA 3KDMB 1W0WB 2YPLB 5DTFA 4GW1A 4ZDHB 4ZOAA 3IDYB 4MJ4A 1QFWI 5BOPA 3SJVB 3FQWB 4CUCA 5B8CC 1OTTC 5ECJE 3UPRA 1FNEB 3QB7C 4MNGA 1LILA 2YK1L 2FLBT 2VZSA 2ZOKB 3BPNC 3SGDI 3MRHB 5J3HC 2YWYA 5DS8B 2DLFL 4RFOH 4U6XA 1I7ZB 3GK8H 5EULV 1CLYL 3BDYL 3ZDYE 5JLZB 4M5YL 5C0DB 3QPXH 5J6GA 5MP6H 1Z3GL 1LD9B 3EOTH 2QSCH 3QRGH 4OTXL 1JWMA 1NGYA 1YEEL 2BJMH 3B9VA 2FBJH 3DGGB 2DQEL 3H7BA 1PLGL 4KQ3L 5F7WC 2VNCA 4U0RC 3ULVD 2A9ML 5K9OA 1DUYA 3MPCA 2PO6D 2ZNXA 5DJAB 5CWSB 3U0TA 2DKUA 2AXHA 3LPFA 3FQRA 5GGRB 4B7LA 2HFGL 4E9LA 1WAAA 1YYMH 4AY0A 1KN2H 2VKWA 4G8EA 4UOW0 1E4XH 2A77L 5GS0C 1DBML 1EA9C 4B5EA 3REWA 1QYGH 5GGUB 1EEQA 3O0RH 4WV1A 3N1PC 3L9RA 1F6AB 1B2WL 4G3YL 1T5XB 4D0CA 1F4YL 1CLZH 5E5MB 3LMJL 2H32B 3MGOA 3UYRL 3IDGA 3T65B 1R5VA 2V2WB 2LU4A 4LKCB 2F19L 4KQ4L 3X14A 3SKUD 4XWOC 3ZDXE 1MCHA 1U92B 5I66B 1WFOA 3JV0A 4ZFZA 3IAQA 1RURH 4X6DB 4F9LC 3P0GB 2ZKHL 5C0ND 1CT8A 2OR9L 2X70A 3ROOB 1RFDL 5C8JA 3IDYC 2UZYB 1M6OA 4Q6YA 1BOYA 1UEMA 3I6LD 4PJIA 5I76B 5FF6B 2YZ8A 5TDOB 2AQ2A 5FO8A 4Y4FA 2CRZA 5IW6B 5GGSY 4TPRL 1YN6B 4O2EB 1EFXA 3H0TA 5DHYB 4CMHB 4A6YH 1MLCA 3D25A 3EDJA 5GRWA 2PYFB 3KYOA 5LQBL 2AK4E 1G7QB 3KLAB 1JYVA 3HUJE 1MCWM 3TFKD 2WNGA 4OB5L 5JW4N 3EO9H 1YQVH 2FX7H 3KYNB 4KGLA 2A6JA 5GHWL 4P2QD 2FRGP 3V95A 2OTWB 1U8PB 2W60B 1QHPA 3JUZA 5HHQB 1I8KB 1A2YB 1XR8A 3F12B 4LPTA 1DQTA 4Q9BA 4U0QB 2QKIB 3BP4B 4L9DA 4QY8B 2WUBH 3GSRB 4MB5A 3WFBL 4J2XA 3PL6B 5IJKA 3W2DH 5MEQA 3F7VA 3TIEA 4M8QB 3K4DA 2H6PA 3KPOA 3H9SD 3ZKSD 4L8DB 4GBXA 4JKWA 4M61B 2GFBB 1KNOA 1DEEB 2FJFA 4BK5A 2MFNA 2XWJA 4X0KA 1TXKA 5FV2A 4UV7H 3T3PF 1HWGB 3SDXF 4MDIB 2P8MA 4Z5RA 1CS6A 4O58L 2ARJA 1S3KL 3LSOB 3HZKA 3EDKA 4DGYL 2NY1B 1UGNA 1WZMA 2F54B 3W11D 5C1MB 4G8IB 1NBYA 2XA3A 3DX8A 3QPQC 2F5BL 5DRXB 2XN9B 5C0CE 1GZQB 1U0QA 3CSBA 3KJ4B 5FO7B 5IF0B 4KC3B 3ULUE 2VDML 2Y4SA 4ZUWA 3ULVF 4KTEL 1V7ML 3LS4L 5D7LB 2PCPA 4P2YA 1S9XB 3ZSSA 2BOCB 3UDWA 4X9FA 2CGRL 1CG9A 3CLFL 4HC1H 4GMSL 4KWUA 3SE3A 3W39A 5EZLA 4NFCA 4JPKH 1I3GH 3ZL4H 1XGTA 4CMHC 1IQDB 4D9RD 3VDCA 3WDHA 3C6LD 1QFWM 3DXAA 2VWEE 1TZHA 4LLDB 3PDOB 4MXQD 2CD0A 2VZTA 3L7FB 4OF5A 5E2WH 2XZQL 1NDGA 5AAWA 3QR2A 1CD8A 4F7MB 1TQBB 3HI1B 2VDPL 4ZPTA 5D7IF 5EOTB 5FGRA 2CMRH 2C7UB 1SJEB 1DL7H 3CJJA 3OKEA 4JDTL 3CGTA 3PL6C 4G8GB 4X6CA 5I1EH 2OYPA 5I1JL 3FONA 5IOPA 3ES6A 1NMAL 4GUPB 4P4KA 1MELA 3BKCL 5C0AD 1CR9L 1S8DB 4P46A 1X3DA 2DQJL 1IT9H 3FRPG 2GJJA 1MH5A 2PKDA 3V9FA 4Q9RL 6FABH 3HMXH 3MGTB 5I16A 2F8VA 5DD6A 3VFUA 1AQDA 2NY1C 1T03L 4K2UH 5DK2A 1BX2A 4OLWL 2ARWA 4N90E 3QH3A 5KS9A 3QZWB 4H0HB 2AJSH 1OLZA 3KJ4C 1OAQH 3R8BB 4HWBH 1FNHA 1JI1A 3WJJA 4Z7UA 2ICWJ 2ITDA 5I19H 1KPRB 3MLZL 1XGPA 4F37F 4LARL 4NWTL 5JXEC 3RDTA 4GXVL 1FZJB 1XF3B 1NGXA 1E6OL 4I3RL 4X5XA 3OXRA 3HC4H 4JFZL 2G9HA 4QRPB 2NY4B 5HHXH 2IH3A 3Q5YA 1U95A 5KVMC 4FOMA 2R4SL 4I3SL 43C9B 1BD2D 4P59H 2Z31D 3ILPA 1D5BB 3VE0A 2VXTL 2VDNH 3ILQD 3FN0L 3L3OB 3QG7H 5E8DL 3V4UH 4XP5H 4Z7VA 1TQBC 5I1DB 2BVUA 3UROR 3VXOB 3F58L 3VXUB 4R9HA 3KS0J 1TZIB 5IKCA 4S1QL 3F7YB 4WUUD 3LN4A 4BUHA 2A6DB 3HRPA 3N85L 4JZJB 3TCLA 4Q58C 5BOZG 4Y8AA 4PRDA 8CGTA 1PZ5B 3N1MC 4LHUA 4KKCD 2XTJD 3SE9H 3DI3B 3KPSB 4KDTC 2OMNA 1MPAL 2DQDH 1TETL 5I15L 1YMHA 2EEAA 4NO0A 5HHME 4PBWD 4BUGA 2X1XR 4M7LT 1TTUA 2M8XA 4Z7QF 4HBCH 5F9WB 4OV5A 1QVOA 3CCHA 3ZT5A 5TE7L 3F7PC 1I8MA 4Z18A 3RGVD 3LCYA 1T2XA 4XP1H 1JYWA 1NC4A 4JREB 2QQKH 1ZHNB 2A74A 3CUPB 4HKZB 3DMMD 1NEZA 2HJKA 4U6YB 4MLSA 5EUOF 4YHLH 3QHFL 4NQSA 4OCXL 1BOGA 2FIRT 4UV4H 3ARFA 3LN5B 4U1KA 5FDYA 3QFJA 1NAMH 1TVBB 2F53A 4JRXB 4MNQB 4UQ2B 2NY4C 1NMBL 3LKRA 3NA4A 5GRYA 4LNVA 3TBWB 3MRPA 4YDVB 3P9MA 1KCVH 1KCSH 4OCMC 4XXDA 4LCIH 3GKWH 1G1CA 5AD0B 5DZOA 2R29H 3KPLA 5ADPL 2OTUA 3D0LB 3BKML 4MA8H 4XTRD 5TE4L 35C8L 3HS0B 1GGCH 1URLA 5C0GA 1G0YR 4HLZH 5I1HH 1JF1B 2YRLA 3T3PE 1HN1A 3SDXE 2Q86A 3T8XB 4X7SL 1XGRB 3ARPA 3CH1A 1KCUL 4JZJC 4KUZL 4O9HL 4FABL 3B2VL 2BSRB 3HNSH 4X98A 4HWEH 5KTEH 1F3JB 2J88L 4D0DB 1G6RH 1VA9A 4AEEA 1ZLVH 3L3IB 1F58H 2DS4A 4JG0L 1MWAH 5GS0L 1EHXA 4Z95L 3LRSA 2VC2H 3ULVE 4LAQL 1ZXQA 3E6HB 2DF3A 2FJGB 1A6VL 5HYSA 3WFHA 4HIIB 4GRMA 3V7AE 4P99A 5F9WC 5IMOB 4GSDH 4OQTH 5KN5B 3L5IA 5DJCA 3IFOB 1DQQA 3S35L 4YDJA 1RV6X 5HGGS 4TTDC 5CLTA 3UJIH 4ZOEA 1S7QA 2Y06H 3IJSB 3VCLA 4JREC 3P4LA 3DYOA 3BZEB 2AERT 3MLXH 4JFOA 1ED3A 2WP3T 2OLDA 3BPCB 3L3GA 5FECA 4KZEL 2GAZB 3EDFA 1LWRA 3U46A 1PJ9A 2QQQA 2R9HC 2AXFB 1Q9OA 5CIPH 1R0AH 2KZ1B 2VTFA 5D7IE 3QHZH 1YUHB 4AT6A 1Q38A 3LEYH 4NKIH 3CZFA 1G84A 3CFKA 4ZS6C 3O41B 4X5LA 4IOIA 3QUZA 4DTGL 2R0WL 3BZDA 1ZTXH 2QL1A 2EDYA 2X4NA 3RBGA 1FORL 1VGKA 3BUTA 1FL3A 3EYQC 3A67H 3BDXA 3T0EE 1GGYA 1K3IA 1ZHBA 1TVDA 1RZ8A 4EUPG 1U8IB 4GW4A 3PGDA 4OLVL 1MRFH 4IRSB 2G5RA 5GPRA 4L9LA 1PYWB 1GJIA 5BS0B 3W9EA 4LSUH 4P2QE 4L5FL 2V7HA 3QDGD 4YXHL 3VFRA 1DN2A 4ODTL 1C5BH 5F1IA 1PGRB 3MRQA 2JB5L 1DSFL 3DUSB 4PLKC 2BDNL 3ECBA 4GAYB 4JRYD 1JGUL 1QOKA 4P2RA 2CKBA 4JGJA 4PJHA 4DEPB 5IBTH 2VERN 4FP8H 4NQVB 3QULB 4Y2OA 2DWDA 2XRAH 3CXHK 5DHVA 1E6JL 1LQSR 4XC3L 3H9SE 3HE7D 4X8JB 2YXFA 2RCSH 4ODWB 4YK4B 4NRZA 5AZEH 3GSXA 1TPXB 4NO5A 3GRWA 2I9TB 1IFHL 3BN9C 1YJDL 4MVBD 3S36L 2R0ZH 3QQ4B 3V0WH 3ARBB 3IRPX 4XVTH 4GG8A 5DDHB 1N5YH 2EC8A 4WI2A 1J87A 1HI6B 4MD4A 5FDWA 4PRAB 4F2MA 3QI9D 4F58L 1CL7L 2K7PA 3ALPA 1CQYA 3CVIH 4OF7A 3TPKA 3U79A 1KEMH 4Z7WF 1TTFA 1VFAA 3LH2L 3MUJA 3L6FB 5DRWB 3WDIA 4L3CA 5IV2B 3WIIH 3ZE0F 3KHQA 3O6MH 1SYSB 5B4MD 3LEXB 5DD1L 2UV3A 1CGYA 2PXYA 1T4KA 3GIZL 4EI5A 4DW2L 2H2SD 2X9XA 1TDQA 4XRCB 5SWZD 4E5XB 2WP3O 3LB6D 4QRRB 3EGSA 2DIAA 2J8UE 4D9RE 4UIMB 3OL2A 4BJLA 2P49B 3T2NL 3ZE2F 4XNMA 5F1OB 3B8SA 5GS2D 1D5XA 4IRSC 5HHVH 4Z7QE 5GGVL 1L4IA 5MEND 3MRMB 4OI8A 2FJHA 4LDOB 3PWLB 4OKVA 2NW3A 1RUKL 1FO0A 3RTQB 2JJSA 1CE6B 2EYSB 4HX1A 4XHJC 1J5OL 1OAYL 5BV7H 3OJMB 1CU4L 3JWDC 4NNPH 3PQYD 3T3MF 3AREA 4R26H 4DEPC 5AYQA 3OAUH 5EO0A 3VFTB 1TMCB 5C0IA 1UC6A 1IGIH 3QG6A 2R23A 3BH8A 5AUMB 3GJFB 4ZQKA 1IC4L 2JLLA 4HWZA 4MJIA 5C0AE 5CEYB 4YK4C 3CSYA 5F71A 5IW1A 5CJXA 4KK6D 1TPXC 1QQDB 3TO2B 3MROB 2O61A 2WW8A 4C56B 3NCMA 4UIKH 5L2KD 2R2BB 2OR7A 5E8PB 1RZJH 3FFDB 3FO2A 3ARBC 3H3KA 2EDHA 3H9HA 3D85A 4JO4L 4MCYA 4LLAA 2I5YL 3LEVH 1ZA6A 4LSSH 3QEQA 2J5LB 5F7EL 2F9BT 5CP7A 4FS0A 3EOYG 1NKRA 3TYGL 1XF4B 1K6QH 4P49A 1CGSL 2VOTA 3RZCD 4M9PA 4QGTA 5JHDA 3QIBD 3P73A 3DIFA 5HVWA 4L4VB 1OTUC 4RNRA 2OJZL 4KHTL 3CMGA 5T3ZD 4RISH 3VWKB 1EMTH 2ED7A 3C8DA 3IS1X 4N1CA 3DV6B 3V4VH 1QR4A 1L0YA 5CHNB 1KTDA 1CGUA 2P8LA 3SDCD 1F6FB 2VITB 4L8CB 4X6BA 1N4XL 4MJ5B 4POYA 1P1ZB 4UNTA 5J57B 4OF3A 4ELMA 1KELL 1BD2E 2HH0L 3VFPA 1GGBH 2FIKB 4I0PB 4NUJA 1IGTB 4XP9L 5DJ2A 3MV7D 5IVXF 1DVFD 3RTQC 3OX8A 5EC1A 4TUOB 4Y19D 1DBJH 4D9QD 1TJHH 1UZ8A 2YMXL 3FOLB 5AG9A 2EH7L 3PWPB 1G9NH 1NLDL 2ITCA 3DYPA 4JO3H 3MRJB 2CK2A 1YN7B 4LSVH 5F88B 2GITA 4OFVA 3V6OC 3BKJH 5CZXC 2BVTA 2XTJE