1UENA

Solution structure of the third fibronectin iii domain of human kiaa0343 protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
125
structure length
125
Chain Sequence
b'GSSGSSGHSGEDLPMVAPGNVRVNVVNSTLAEVHWDPVPLKSIRGHLQGYRIYYWKTQSSSKRNRRHIEKKILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0343 protein
publication title Solution Structure of The Third Fibronectin III Domain of Human KIAA0343 Protein
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 17
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uenA00
4RDQG 5B3NA 1BBDL 3WFZA 1U3HA 1FZOB 2C9AA 5FGCE 3U0WH 4PRHB 5FO8A 4PY8I 1HYSC 3LEXB 4L29A 1YZZA 3C6SB 5MEOB 1ACZA 1T3FA 5HJ3B 5CIPH 4OKVB 1RJYB 5DWUH 3SN6N 3U0WL 4LCUA 4EN3D 5JMOC 2NYYC 3BQUC 3QNZB 1PQZA 1VESA 4QRTB 4C56B 5HGDA 1PZUB 2CH8A 2OI9B 4UOW0 3O3EA 4PJHA 2OR9L 5DWUL 1ACYL 4LQFH 3OKNA 4AEIH 1FN4B 4BSWA 1MCDA 5T1MA 3BZFA 4I4WA 3E1F1 1AGCA 3UTQA 4GRWF 4QOKE 4JO4H 1QFWH 2PO6B 5GGVH 2CGRH 4LQFL 3QHZH 3DGGB 1HWGB 2VISB 4DGVL 2IALA 4XC3H 4XCEB 5F9JA 2C1OA 4JO4L 1QFWL 1U8HB 3UDWC 4M1GH 3MV7E 4GAFB 4U0RC 4HZLA 3BO8A 1PKQB 3QHZL 2OYPA 3ZKQD 2WAHA 4XMPL 4XC3L 3T4AA 4XWOD 1I3VA 2ESVA 2CDGB 2X1PA 2YRZA 4ODTH 4OM0H 4LSSH 1BJMA 1T2JA 4M1GL 1MFBH 3SDDD 2AJ3A 3GRWA 5DRWA 4NOFA 3MRJB 5D71H 3VFPB 3IDYB 4LSUL 4X99A 1NAMH 4OM0L 4L3EE 1DN0B 4ODTL 3ZYOA 1IE5A 3ZE0F 2XZZA 3L5JA 3WNKA 2O5ZH 2VKXA 4OIAA 3SJVD 5E6IA 5IHLB 1F3RB 5I1JH 1AGFB 1EZVX 4KV5E 4JKPH 4U6TA 5D71L 3BKYH 4P2RB 1U58A 1LVEA 3DGCR 4YXKL 2O5ZL 1DEDA 1LP9A 1MQKH 3V0AC 3HG1B 3T0EB 3BKYL 4GUPB 4OBSA 1MHHB 5KTEH 2FSEA 3PDOB 1PYWA 2UY6A 3HB3D 4LVHC 3X12B 1MCLA 1OCWL 4KKBD 4MB3A 3CSYB 2NTFA 4NFCA 4K3GA 2CQVA 2ZOLA 3SO3B 1BBJB 4JO3H 1JHKL 3REVA 4JRXB 1CL7H 2P8LB 3D39A 2IBGA 1KCLA 5TF1H 3SJVB 1G9NH 4R7DB 4D9LL 5MEQA 4PJAE 1YA5A 4YHPB 5DUBB 3RWEA 3WJLC 3ULVD 3MJ6A 2VXQH 5I73B 4JO3L 2VO5A 4POUB 4JFHD 2AAVA 4MNGE 1MIEH 2X5PA 2Z31B 1CL7L 4BFEA 4TVPE 4NP4H 3KPOB 1ERNA 2VL5B 3PUCA 1XR9B 5TF1L 3SDCA 5D2NE 4ODWA 5E24E 3JVGA 1G9NL 3CK0L 1YEDA 1J1PH 4MHHG 2VXQL 3QDGE 5J1TC 1MLBA 2Z8SA 4NP4L 3RA7L 3BD5A 4GQPH 1T4KA 2X44D 5L7XH 5FO9B 3CCHA 4BSVA 3SKMA 4MNQD 5SWZE 1J1PL 3ARBD 4TSCH 5I8EA 3SKOB 3KYNB 1KLUA 4JO1L 4NC1C 2G5BA 4ZS6D 4ZO8A 4R0LC 4YO0B 4OZGE 5CILH 4JO2L 3WLBB 3VD5A 5EA0H 5T3ZE 1U92B 3WS6A 5FB8A 5L7XL 3LQAH 1I7RB 4TSCL 1T22A 2HFEA 2N7AA 3TA3B 3WN5A 3WD5H 2EEAA 2VDLH 4POZD 5CILL 5EA0L 4L4TA 1L0YA 4NN5C 4WWKA 4A6YL 5C70A 3BP4B 3OJVC 3OX8B 1I3GH 1U3JA 5IJKC 1QLRB 3OGOE 3L3DA 1LNUB 4R4ND 5HYQA 1XGRA 2VDLL 1PVHA 5TDNB 4C54A 2PYFA 4CKVX 3QZWG 3V5DA 1UGNA 3WE6A 4ELME 1KTKE 1FV1B 3LS4H 4LMQI 1JNJA 1J87A 2RFXA 1T03H 5HYSB 1OTTD 2DIAA 5I1AA 3RWHB 2R39A 1TCRB 2P1YA 3G6JF 1DLHA 3GJFA 3QH3B 4NZDA 3LS4L 4KK9C 3D69B 4C55A 2IBZX 4YZFE 3U0TA 4F7PB 2WK2A 4RBPH 2VXUH 5GRUH 2ZJSL 2IWGA 2GY5A 4EUPG 5H94B 4NQEE 1AIFB 3KPNA 5KN5B 3TIDB 1EUTA 5AG9A 3GKZA 1WAAF 3DVIA 4IMLA 3OJDA 5EZJA 2VXUL 5GRUL 1KBGH 4ZNCD 1ZT4B 4A2LA 4HK3J 2BMKA 4PRAA 1U95B 1FE8H 5F9AC 1XEDA 2R2EB 3GMRB 1V05A 4OGXH 4X7DC 4AIZA 4O00A 3L3IB 4FQQA 3RI5K 1IKNC 3FRUA 3VXPB 4GG8B 4G6FB 1FE8L 4LCWD 1XCTB 2W1NA 3MJ9H 1TVBB 4FQ2H 2ZSWB 2BC4B 1C08B 1G7JA 4P3DA 1OB1B 3TV3H 3GJEB 5FHAL 5I1CH 3MMEA 5CD3A 1VFAA 1IRAY 4JJ5B 1JGEB 3NVQA 3MJ9L 4FTVD 1P1ZB 4ZNEE 4DVRH 5EO0A 2Q7NA 1G7LB 2GIYA 1BHGA 3QJHA 4FQ2L 5GS2D 4LHUD 4E41A 5I18H 2M26A 5HHVH 5K9KB 2VJXA 1RHHA 3P73B 3K80A 5I1CL 1FVEA 4NWUL 5E8DH 4Z7UF 1L9NA 2WMPA 4U1HB 1RUPH 3DRTA 1R6VA 1SJVA 1AD9B 1T1XA 4NT6A 2VDPH 5HYFA 4PJ8D 3VGFA 1MI5D 5I18L 5HHVL 1U8NB 1P9MC 3MRHB 4P3WA 4AJ0A 5E8DL 1V3MA 1YNLH 2VDPL 4P2QE 4I2XE 4NFBA 1I7TB 5AZ2L 3RVVD 4WW1B 2E6JA 2HFGH 2H26B 4F2MA 1GAFL 2XQBH 1YNLL 3TN0C 4ONGH 1S7VB 4MCZA 2H2SD 4KROB 4PGZA 2B2XH 5TE4L 5IJVB 4FQXB 3KLAB 2XQBL 1R3HB 2MCPH 5D96B 1IC7L 1WBYA 5E1AB 4ONGL 1J7VR 1MCIA 4KXZH 1R3KB 2R1YB 4Y19E 4Z7VE 4YXLH 4NO0D 5BZWA 3C2SA 1M6OB 5BRZD 2MCPL 5DD1H 4BELD 1WC7A 3HPJA 3KLDA 2YD1A 4YXLL 1UC6A 3BYYA 5L2KA 5C07B 4BZ2H 3E6FA 2CLRB 1B6UA 1UH2A 2NY4B 3WIFB 3EUUA 4GRWB 5EU5B 1VEMA 3VD3A 3M45A 2AEPH 1MIMH 3BXNB 3HZVB 4LOUD 4BJLA 1AGDB 2BY0A 2X4PB 1XAUA 4S2SA 4BZ2L 3BP5B 4UIMB 3S96A 2IQAB 1CL7I 4N1HB 1BD2D 5E5RB 5GGVY 3WHXA 1Q9LA 1MIML 1CXKA 4Z7WF 3F6LA 1QRND 5IW6B 4JANA 4W4OA 5DZNA 4NO0B 1PGRB 2Z93B 5LGHH 3DSNA 4KWUA 4P23C 4DGYH 4WY7H 2W65B 1E4KC 4XCNB 5C6TH 1HQ4A 5ID1A 1JPFB 4X5XA 3HLAA 3BKCH 4JFOB 2VABA 1N8ZB 5ESVA 3SY0A 3AAZB 2RR3A 3ZTJG 1RU9H 4WY7L 3IJHA 4Y1AD 4XTRC 3WUZA 2P48B 3EFDH 4N8VA 5C6TL 4APQB 3PGFH 4OI9A 4LIQH 3BKCL 3MFFB 4CJ1A 3C60B 4HWBH 5F6IC 5JPNA 5CIPA 2D31B 4LKXB 1RU9L 5FO7B 4S1DC 1TFHA 5EZOH 2JIXB 3DOSA 4D8PB 4Y4KA 5KSAC 1KCKA 3PGFL 1BZ7B 4ISVA 3LV3A 3PWUB 2AEWA 5JOPD 4MD5B 2ARJB 1OLZA 3BEVB 4HAGA 1N5AA 5EZOL 5D7JD 2VLRA 3MRKA 4JFDE 3T1FB 5C0BD 4MJ2A 5CGYC 4ZAKD 2I24N 4YIQB 1DJSA 5DMGD 4LVEA 2E9IA 4PP2B 5JTWA 4RIRB 3UCRA 4ODSH 4P4KD 1BM3H 3ETBF 1J05A 1BF2A 2Y72A 3PWLA 4C57C 1QSFA 2R1WB 3TZVC 5BS0B 1IGYB 4L4VA 3GB7A 5CGTA 3ZKSD 4ODSL 2Y6SC 3V8OA 3D3VA 3D1MC 3T65B 2G9HB 1G7QA 4WU5A 3RNKA 4LCCB 4LSRL 3QIUA 4YHZH 2EDDA 5T1LA 1GVIA 4JFFB 1S7WA 3VXTB 2FYYB 3FQTB 4OZ4B 4WUUB 5HGAA 4BUGA 1AXTH 1F4XH 2B5IB 4MDJA 5DJ8B 5K59F 4QXTB 5JIIA 4G6KH 3PGCB 4N0UB 4YHZL 1GZPA 1RPQA 2VC2L 3ULVE 1NAMA 1S7RA 1UB5B 4RZCB 1AXTL 3MRGA 4JFHE 1CWVA 2FX8L 1F4XL 4MXWH 2VLMD 2EDXA 4V1DD 4ZDHB 4MAYA 2AJUH 2X2YA 3MLTB 3GSVB 5HY9A 5DRXA 2XA3A 2HTLD 2VQ1A 1GGIH 3CVHH 5ALBH 3KPPA 4NRXB 1A9BB 4MXWL 2P8MA 4XZUB 5T3XH 2BVOB 5DRNA 3RL1B 1NLBL 1XF3B 3KHQA 1MJJA 4GMSL 3U1SH 1CIDA 2FB4H 3W9DB 3FT2B 4DUVA 5IHUL 1T66D 2Y36L 1KXVC 4NHUA 4PUBH 4P3CH 1VPOH 2UYLB 3OJ2C 1KFAL 3G6AA 4LEXH 1G7HB 4K94C 3C6LC 3CVHL 4PG2A 4QGYA 3MRIA 5T3XL 4KJWD 2GJJA 1OQOA 2AJZB 3LQMA 1T7YA 1X5JA 2FB4L 2VAAA 4FZ8H 5IMLA 3N1FC 4U1NB 4P3CL 1VPOL 4LEXL 3O9WD 4NN6C 5GGSY 4P48A 1A6TB 1H5BB 4JPIA 2XI9A 2A0LD 5AEAA 3B9DA 4G8EA 4PJBB 4Z6AT 2Y1VA 4WEMB 4F9LA 4V1DB 4BK4A 2OJEA 4R4BA 3WIIH 3ARVA 1CGYA 3BZEA 3FB8B 1YN7A 3KPSA 4LFHD 2NNAA 1CU4H 4JDZA 4RQQA 2NY3D 4G6AC 2Q8AL 4HW6A 2IPTH 4X6CE 3S36H 2MJWA 4P2YA 4UZGA 3WIIL 2O61B 4NRZA 4HV8A 5GGUB 4CGTA 5JLZA 4OLEA 3DV4B 1CU4L 1JPTL 1DUZA 1BVZA 4I0PB 3HFML 3HE7D 5DFWH 3TH3T 5ICZB 4GSDL 4F7EB 2X42A 2EDNA 1RV6X 4UU9B 4UDUB 2G60H 4EDXB 1H15B 4KXZI 3G5ZB 2UZXB 1UZ6E 5CKGA 3O6FC 2R2HA 4N8CL 5DJXA 4W6YB 1SMAA 3BZ4B 4DGIH 4WI9A 3V6FB 4P57A 1WGOA 5T1KD 1U42A 1FYTA 2Z0BA 1JWMA 3TO4A 5IV2B 2NX5B 1JGUH 1B6DA 3QT2A 1HYRC 1IM9A 4DGIL 4CNIA 3T0AA 1E6JL 4LCWE 1ZVSA 4GXVH 4NQSA 3X14B 3DX8A 4YDVA 4D3CH 2Q3AA 2LU3A 1JGUL 2QSCH 4HS8H 1MFAH 5E2JA 1KPUB 4QO1A 2KL6A 3HCVB 4XT1C 4KZDH 4GXVL 4Z76A 1U8PA 4CL7A 4PGEA 1R3LB 4JFED 1X5FA 3O4OB 4ZOEA 5F6HI 4D3CL 2NY6B 5KANI 3DTXB 4QHLA 4H20H 2GITA 4AK1A 4FNLH 1P84J 2NZ9C 5DJ6A 3DBXA 3L7FA 1T1YB 1AXSB 2NY5H 5CS7A 1T7ZA 1MI5E 1KTLB 4XNQA 1M7DA 4UUJB 1GGUA 4H20L 5GJTH 3ELAT 5DJDA 3OZ9H 3VCLB 5J9PB 1PY9A 1RUAL 2NY5L 4NQCE 4PB0H 5DVKA 1RULL 3PL6D 3ARDA 1DDHA 4KJQC 3RVTC 1E4XH 5GJTL 3RPIB 3W9EA 1S3KH 3FO9B 3ZMRA 1HWHB 1U8JB 1I8IB 3ARFB 4MB5A 3ULSB 3UYOD 2FR4A 1NQBA 3P4NB 4JGUA 5JIHA 2VZ3A 4NQTA 4E5XA 5D7IF 1CD1B 2DQIH 3RZCD 4JFEB 3I6KA 4G8GE 4I77H 4Y5YC 4U4BA 1E4XL 5KOVC 1S3KL 2C4XA 4U1KB 3RDTB 1Z0NA 1IZJA 2E6PA 4LRIA 2CIKB 4QRPD 2MHAA 5CBEA 4XH2B 5INDA 1HXYA 3OKEB 2DQIL 5D72H 1FLRL 3F12B 3RUGF 5C0EA 4CMMA 3FB6A 1A6AA 1S5HA 4FQCH 2JLLA 5BRZE 2QJDA 3IDNB 1BJ1H 4PJXF 3MLXH 1CGTA 1ZVHA 1KJ2A 1F42A 4PJFB 2P4AB 4FQIL 2BSED 3E6HB 2IANA 2PW2A 1HYSD 2AEIT 2AXHA 3RWFA 4RFEA 1TPXB 4L9LB 1BZ9B 1AHWC 1K8IB 1VENA 3L5XH 1KTDB 3MRQA 4NQDB 4X7TA 5JDSA 3UTTE 4FQCL 2PTVA 3VXNB 1RY7B 3QWOA 2HT2C 4HCRA 1B9ZA 4OGYL 4WV1A 2NYYD 3BQUD 3I9GH 2WBJA 1IAOA 2A74A 1JN6A 4LGRB 3ZT7A 5DYOA 1AKJA 4AEFA 1P6AB 4U1GC 1NMCC 1CGSH 3HRZB 2WIIB 1E4JA 3L5XL 4JREC 3QJFB 3RZCB 3BHBA 2CLVB 3FQRB 4QXUL 2X89D 1CFQB 4M8QA 4ZQKA 1RZKH 3KYOA 2PUQT 1MCSA 5GRVK 5E8OA 5DURD 1XGYL 1QRNE 3V5KB 3TC9A 2NPLX 1VFBA 1CGSL 4ZPTA 5LXGH 5FHBL 4AENB 4X83A 1J8HA 1RZKL 1U8OB 3Q3GA 5D2LF 1ITCA 3EGSA 3S7GA 2AK4E 3WJJA 4MJ6B 1ZEAL 1MELA 5EZIH 1YPZB 3KWWB 4BQ6A 4Y1AE 4WTXA 1X5HA 3WL9A 1NGXB 1IT9H 1D5BB 4HF5H 5MEPA 1JF6A 3LN5B 3MGOA 5EZIL 4NNXA 3KNBA 3MROA 2IAMA 5IEHA 1KPRB 2B4CH 3GSQA 1IT9L 4KUCF 3UP1A 4M62L 4WO4B 4HF5L 2J6EL 2V7NA 4HXBL 1T1ZB 4JCMA 5DJCB 2DI7A 4E42A 1XIWC 2GJ6D 3GM8A 3QAZB 3VW3H 2P49B 5JOPE 3K8KA 2V5YA 3PJSB 5ITBH 4UNVA 5BVPH 5ANMB 1G0DA 1KIQA 5I9QC 2H9GA 4JRYA 1LD9A 1Q9OA 3G5VB 1ZLWK 2P7TB 4PREA 5C0BE 4OIBA 2X9YA 3RGVB 3NZ8A 3CFKA 4JE4B 1X5YA 1J9CT 3DURB 3VW3L 3EO9H 3QZWA 4P99A 5ITBL 1YEIH 4YUEH 3UO1H 3RIAF 4JVWA 2YZ8A 3QQ3B 5I71C 5EIIB 3SE9L 5F1IA 4UINH 3ZYZA 3BMWA 2FD6H 1S7UB 3EO9L 4NDMA 4WHTA 4QHUA 1HEZB 3NN8A 1YEIL 4YUEL 1UT9A 3UO1L 1LEKB 2EDWA 3N9GL 3KPQA 4X4YB 3TT3H 3LS5H 4K7PL 4J8RA 3P4MB 3GZKA 4EUPA 2GAZB 2D7QA 2F15A 2ICWB 4HWBA 3DX9A 1KELH 4UINL 5FGBA 4JN2B 3DIFA 1I1YA 1AO7D 5DJ0A 4KTDH 4PR5B 1KCSH 3TT3L 3VWKA 3LS5L 5I74B 1FJ1B 2IGFH 4ZYKA 2DMCA 5KSBF 1LHZA 1CDUA 1B4RA 1KELL 3WNOA 1SMOA 4R7NB 4F33A 4HLZH 3RTQB 4KTDL 4RAVA 2QHRH 1KCSL 1J1XH 4OZFB 3G6JE 2IGFL 2HVKB 4LPCA 2EDRA 3FO0H 4KDTC 3QXAB 1QYGH 3IFOA 1OAYH 1UACH 3RJDA 1T80A 7CGTA 1T83A 3VXOB 4TUJB 4ETQA 2PXYC 3L7EA 4M6AA 1MWAA 5DMJB 3GGWA 1HXMA 2QHRL 1G7IB 3HS0A 5C08D 3FO0L 3BW9A 4WHYH 1EVTC 2OX5A 3MA9H 1QYGL 1QLEH 2V5TA 2Z4QA 3SDAB 1OAYL 1UACL 1XF4A 1YN6A 1DTUA 4HDIB 2ZCHH 4MNHB 5IOPB 1AO7B 5ISZD 3TVMA 6CGTA 4LARL 3PXJA 3MA9L 4XC1H 3VI4E 5BW7C 4HFWB 4WU7B 4XPAH 4OZIA 3VRJB 2JCCA 3CDYA 3MJ7B 2ZCHL 1GOGA 4QEGA 4N9OB 4P46B 4K8RH 3CZFA 5GIRA 5CWSA 4AMKH 5F70A 1JZ6A 3H9YA 4XC1L 3VXUA 4HBCH 4XPAL 1BFOB 5INCB 3CC5B 2D4FA 4KFZC 3VFGH 1BEYH 5LWYH 2EE6A 1CFVH 4K8RL 4RWYH 5E08H 4ZUVB 3CVIH 1I7ZB 1ZHLA 4Z7OF 3M07A 1WFTA 4HBCL 1E4XI 5HYEA 5DFVC 3VFGL 2HJFB 3JWDL 3QUXA 2ICEA 5LWYL 1DVFB 1CFVL 4RWYL 5E08L 4KK9D 4PTTB 3CVIL 1AQKH 5D1ZA 3H9SD 4DZBA 1MFEH 3ME0A 5HVFB 4X8JB 4DJMA 4HWNA 3EOBB 1QBMH 2Y7QB 4OSUH 4TUKH 1MRDH 4KRPD 1CBVL 1FG2A 1FNLA 1MFEL 3CFCH 3MV9A 4JPWL 1MOEA 3V6ZB 3BX7C 1UWEH 1A1OA 3MLYH 3I3BA 3THMH 3U0PA 1WBXB 2EYSB 4PRPA 1QBML 3Q0HA 3T0DA 4YQXH 1MRDL 5M95B 2X10A 4MZ3A 1WFOA 2BNQD 2W0LA 3CFCL 4CW1A 3HNSH 4NKDB 4JM2B 2DM4A 3CLEH 1FL3B 2VIRB 2QSTA 5IM7A 3MLYL 3THML 2BNRB 3DV6B 4PJEB 3VI3F 3ZL4H 1QG3A 2CRIA 4LLVA 1BOGA 4YQXL 3MRLB 2MSPA 3VA6A 1KB5H 3HNSL 3ARGB 1I1FB 3QXDA 5LCVH 1AE6H 1D6EA 1R5IB 2HFFA 3ZL4L 1EHLH 1LDPH 4MB4A 2EECA 2BSTB 4HFUL 2R9HC 1KB5L 2GCYB 4RFNB 5AD0B 3ZDXF 5IROC 5LCVL 4I5BB 1AE6L 4RMTA 5D6DA 1EXUA 1EHLL 1LDPL 3B5HA 4P59L 1DQJB 1JWUB 2Q86B 3ZTNL 4ZUWB 3VFTB 5DA4A 4U6XA 1NC4A 1FC1A 1QO3B 3RP1A 5DJAA 5D7IB 5E99L 1RZJL 2DBLL 1MPAH 2G75A 4CADB 1XCQB 3D85D 4J3TA 5DEGB 3GSXA 5E2VH 1HINH 2F54A 1SBSH 2B0SL 2EC9T 3QDMD 5KZCD 3OAUH 4Z7WE 3TBVB 3U4BL 1ZLSL 1SYSB 3FOMA 3TN0D 1URLA 5GGRB 4GKZA 5SX5H 1MPAL 3OTTA 4Y4FB 1QSVA 3IU3B 3BPCB 5D5MF 5T5FH 3RIAK 3VXSD 3OAUL 3T0XA 3BUYB 4HZAA 2EKSB 1E4WL 1D5XA 5C3TA 5EU6A 1RUMH 4EQ3A 2FECL 5IMMA 4QRPE 2X4TB 1DBBH 4TVPH 5IBTL 2YR3A 4LPTA 2MOVA 1L4IA 3PWNB 5T5FL 3EYQC 1DBMH 3T08A 1F4AA 1RIHH 4YHOH 5JHDE 5GJSL 5F7KC 1ZHNA 1Z5LB 4HUXB 5JW4N 5E00B 4KUCD 4HC1A 3STZB 1DBML 3LMJH 1RIHL 4YHOL 1JGDA 2WQ8A 5B8CA 3SHSA 1ZT7B 2VLJA 2CDFB 1UYWH 4OCLC 5T3ZH 3O45B 4F57H 1K4CB 4QRQA 1ZHKB 3LMJL 4GAYB 4ZFOL 2W0PA 5GS0C 4UV4H 2FEDC 3K1DA 1CF8H 1UYWL 4QT5A 3C09B 5T3ZL 5CP7B 1X4YA 4F57L 3AREC 5I1HH 4YE4H 4YXHL 1U91B 4QHNB 1PEZA 2YN5A 4GBXA 4P23D 3GSUA 4UV4L 5F1NB 3TBYA 4B41A 4FQHB 2NLJA 5IESH 2LTQC 3WO3B 1G6RB 3PP3H 4PV8B 4U6YB 4G8IA 1HCVA 4Z78A 4PGDA 4YE4L 1W72H 1XF2B 3VFOA 5EZLB 5IHBA 4PG9A 5CEYB 2IEPA 1JV5A 4XTRD 1LE5B 5KVEH 2IH1B 3QDHA 3S34L 4XMKH 5IESL 2Y07L 1VACB 2VITB 4QHMA 2W60A 3IXAB 5DMKB 1FLTX 4ONHA 5IHZA 1W72L 3D0VA 1WZKA 2DI9A 1NGWA 3HAEB 4S1DD 5EIQA 5KVEL 3PP4H 4TSBH 5KSAD 2YD2A 3TPUA 1IAIM 1B0RB 4OZHF 3HUJB 3UZEA 2GJ6E 5DC0A 5C6PB 3L5WB 3J8F7 2ZSVB 1J1OL 4GS7C 3PP4L 4ZSOE 3BJLA 4ODXB 1CQYA 1WEJL 1YMMD 4L29B 2IPUG 3DI3B 5CGYD 5TF0A 1I75A 3D5OF 2VDOH 3MV8D 4K7PY 4KY1H 2PYEA 4LCUB 1AFVH 2CUHA 1NCWH 4YFLF 5F1OB 1A02N 2QADB 2GSGA 1UENA 1DN2A 5AZEH 3O3EB 3DVGA 3EOTH 4P9MH 4KY1L 5DQDH 2Y6SD 4H88H 3DHJA 2A9NH 3OKNB 2VSDA 3WKNA 1AFVL 3IGAA 4BSWB 2Y9RT 4KKAC 4XPTL 3BZFB 2CJUH 1Y6KR 3UTQB 3EO0A 5KSAB 3B6SB 2E9WA 5AZEL 1OAZH 4IMKA 3QRGH 3IFPA 3EOTL 4P9ML 5D70H 5EU7C 3WXVH 2A9NL 4Q6YA 3AY4A 3QUYA 2IALB 5HDLA 4O02H 4PFEA 4XRCA 2C26A 1J0ZA 4O2CB 2P5WD 25C8L 3QRGL 1A3LH 4KU1A 3A6CH 3VE0A 5D70L 4HZLB 4S1RL 3BO8B 2NTSP 3WXVL 2GEEA 2X6MA 4I48B 5D7LA 4EXKA 4O02L 3GI9L 3QB7C 4YC2B 1HK6A 2Q1EA 2CXKA 3TZVB 1A3LL 3A6CL 5JHLH 5EUOF 4UQ2A 4OFPA 5DI8A 3X11A 1EO7A 1S7XB 3FONA 1H8NA 5DRWB 1ED3A 4JHAL 2W59A 2EE2A 4OCYL 5C08E 4Y89A 4X99B 5IQ9A 3C6LD 3FB7A 4NC1E 4IIQA 5FA4B 3MR9A 5JHLL 1RJLA 1J11A 5LQBH 5HYSG 4G9DB 4CVXA 1I9JH 1JI2A 5ISZE 2I07A 3C8KA 4G9FD 2ZNWA 4WDIA 3P4LA 2XKNB 5JXEA 4JZJC 2XNAA 4F7CA 1NKRA 5SWSB 3V9FA 2JF1A 2CKBL 5LQBL 3ZYIA 4LLMB 3GI8H 4DW2H 1I9JL 3DJ9A 3Q48A 4OCWL 3ZKNC 2D4DA 3BH8A 5CD5C 3KXFB 1EERB 3UEZA 4GKNA 1P7QA 1CG9A 4P5TC 2FSEB 3SKJH 5CJQH 1WJ3A 3GI8L 4Y5XA 2BERA 4U6HA 1DUYA 4G6AD 5KVGH 2C4FT 4XNZB 2A73B 2NTFB 1MCEA 4UB0H 1K8DB 4ZUTA 5IBUB 3KPMA 3SKJL 3S4SA 1KJVA 5CJQL 2PKDA 3OB8A 3D39B 3JSSA 2XZAH 1HILA 3QXUA 1QTYT 4BKLB 4JPVH 5MEQB 4UB0L 4OCRH 3TNMB 2O5YH 4KI5C 1P4BL 4X6FA 4HBQA 1JBJA 2FZ3B 2AJXH 4WW2A 5IBLC 2K7PA 1OGAD 1J5OH 4LPVA 3SDCB 3FCTA 4IJ3B 1CT8B 3BVNA 4OCRL 2ICCA 2O5YL 3S5LB 2ATPA 3LRSA 1EGJH 4PJCE 1Q94B 1NGPL 2V5RA 3B2VL 1MLBB 3P40A 2AJXL 5ETUB 2AS5M 3H3KA 2NMSA 2Z92B 1NFDA 1JUFA 1P4IL 3B9KA 1INEL 2DMBA 1T4KB 1M7IA 4BSVB 3IRZA 3SKMB 5IIEA 4HGKC 3P9LB 5HHOA 1KLUB 1EGJL 3QIBA 4LVOC 4WI2A 1Z6JT 1DCLA 1A4JB 3HC3H 1QBAA 3L5IA 1UWGH 2CO6B 3GSWB 4YBHA 1HIMH 5FB8B 3KS0J 4FN0A 4KZEH 5GRXG 3HMWH 3V0VA 3S88L 1T22B 2ZUXA 3WN5B 3HC3L 2BVTA 2E7LC 4PJXE 1UWGL 1OWWA 3N1GC 2ZNXA 1HIML 1FCCA 3O6FB 2ERJC 3CUPA 1QR1A 1CDYA 5C09B 5EC2B 2BRRH 2NZ9D 4QOKA 2I60H 3NIFF 3L3DB 1OP9A 4CDGC 5HYQB 1XGRB 4M7JH 4MJIA 5J11B 5F9WC 4LAJH 3WE6B 1GHFH 1Q9WA 1EAPA 4M43L 3O0RH 2YSSB 1A0QL 2FJHA 2RFXB 2BRRL 2X41A 2I60L 1FO0A 5HHMD 4PJIF 5I1AB 1JNNH 2X4SA 1DLHB 1L6XA 3BPLB 1GHFL 5TJWK 3LH2H 1F6FB 4KJQD 5BV7H 4X6BA 3RVTD 1J88A 4YHLH 3ZE2F 1B4JH 1G1YA 2H32H 1JNNL 3VFNB 4Z95L 1CGVA 3PHOB 5TE6L 1A7QH 2F58H 2OJZH 5D2LE 1XZ0B 4IMLB 3OJDB 4QRRA 3CZJA 5BV7L 1SJHB 1OGTB 4YHLL 3ULVH 1B4JL 1HDMA 4PRAB 4ZFFA 3DVNB 3UTSA 4HUWA 5DR5L 1A7RH 1A7QL 4AIZB 2F58L 2NQCA 2OJZL 3H3PH 3UAJC 1MAMH 1GYAA 4FQQB 5L2JA 4XBGB 3FRUB 4O2EA 3ULVL 4R2GB 5DK0A 3NIGE 1MFDL 1W0WB 3QUZC 3ZDYF 3QQ9C 5HHMB 1T04A 1HZHH 2XWJB 3AXLA 3MCG1 5DD6B 5IB5B 1QSEA 1MAML 2JELH 4HUUB 3L1OL 4KRMB 2ORBH 4MSWB 5DJZA 2HT2D 3MMEB 4JQVC 5CD3B 1VFAB 1U93A 5I1LB 3DUSA 3PQYD 4WFED 5EO0B 3TGXA 2JJTC 2ORBL 3BUTA 1I7UB 5IFHH 4R26H 5F8RC 1FVEB 4UMGA 3QCTL 5D1QA 3DRTB 4PLOB 2VMFA 1T1XB 4NT6B 1AP2A 3G08A 2GT9A 5FA3A 1QQDA 1YMHA 1BQHB 4R26L 1MCNA 1JHTA 1KNOB 2Z91B 1IGTB 1HHJA 3FZUC 1KJMB 3EYFA 3NACL 3AM8C 1AHWB 4LNVA 4OZHB 2OQJA 3D2UA 4MCZB 1JWSA 5IVXF 2IADB 3O4LB 3K0WA 3F7QA 2A38A 4OFIA 5J1SC 1U3HC 5KSBE 1NC2A 4DEPC 1RZ7H 3MLVH 1H3PH 5GISL 2Q8BH 3W0WD 2EC8A 4J1UA 1LO3H 4OFYD 1H3TA 1I8MB 2YK1H 1OPGH 5BZWB 5GZNC 5MI0C 4QRUA 1XIWD 3GMQA 3MLVL 5IG7A 1H3PL 5KJRH 4MA8L 1NLDH 1WSST 3HG1E 1LO3L 4PRIA 1WC7B 3HPJB 2DQFA 1YMME 2YK1L 4NRYA 4YNYA 5L2KB 1FVCA 3M1BA 1A4KA 3E6FB 3MV8E 3U36A 5KJRL 5BXFB 1DL7H 2X4NB 1ORQA 1WIOA 2H8PB 2K3TA 6FABH 4HJGA 4NSKA 4XAKD 1RI8A 2BSSA 4QY8B 1A7NH 5I8CA 1PFCA 4PJGB 4ELMA 4S2SB 4HH9A 2DQGH 4JRXE 4ZFZB 2AQ1A 2ZOKB 4HKZA 3S96B 1A1MA 2AJVH 6FABL 2ZUTA 2I5YH 1A3RH 1WTGT 2P5EB 5GS2H 3AU1A 3B8SA 2VERN 1TENA 2DQGL 1HHKA 4OLYH 1UCBH 1RZKC 3QIWB 2AJVL 1AJ7L 5C0CA 3S8WA 2I5YL 1HQ4B 5ID1B 3HE6B 3M8OH 4LLWA 5EUOB 1YEFH 2FX7H 5FYJU 2P5WE 3TT1H 2HWZH 4Z7OE 5ESVB 2ZCKH 4IHOA 1UCBL 4AQ1B 3DYMA 3O3DA 4ZXBB 3O3BA 4QGTA 1U2CA 5I0DA 1AGBB 3M8OL 4BFBD 1EHAA 1YEFL 3O6KH 2FX7L 1P2CA 1CFNA 5DDHA 3TT1L 3BAEH 5ERWA 2ZCKL 5CIPB 5JW3H 2PXYD 4EI5B 4PJ7F 4LRNH 1MHEA 4GW4A 1NAKL 5E8PA 2FIKA 3O6KL 2UY7A 2X4OA 5E4IA 4QTIH 4Q6IC 5BQ7A 5JW3L 1N5AB 3OGCA 4LRNL 4HJJH 2Q7YB 2VLRB 3MRKB 4G9FE 2NY2C 4QTIL 2VLKA 4Q2ZB 4H0GA 4GLRH 1D9KC 4MA3B 2YC1A 4JG0H 4HJJL 4J7RA 4MLSA 3P0YH 4PJ5D 1GGCH 3QI9C 2VDNH 5C9KA 3GB7B 4PTUB 4BA8A 3L3OA 4X6EA 3D3VB 5EC1B 4JFZH 4PRHA 3P0GB 2IG2H 3O6MH 4JG0L 4WU5B 4EIGB 1GCFA 1GGCL 4LFHG 3QIUB 2Q76B 4P2QA 3A6BH 1YEKH 5HJ3A 1DLFH 5T1LB 1S7WB 1I1RA 4OKVA 3MBEA 1UA6H 1RJYA 5DFVD 4C58B 1RK0B 1GGYA 2RB8A 4MDJB 1LDSA 1BIHA 3DXAA 3MUJA 2IG2L 3O6ML 3JVGC 3SPVB 1QFUH 3MNZA 4C56A 4Y88A 5EBWB 3A6BL 3UJJH 1YEKL 1DLFL 4Y5VB 1NAMB 1UA6L 3MRGB 5GGTH 5L8JB 3QPQC 2X1QA 3OXRA 1FN4A 1OGAE 4MAYB 1QFUL 4MQXC 1U8KB 5HY9B 5ITFB 2ADJA 3UJJL 2PO6A 4O5LH 2KQMA 2YEZA 1FNSH 4MDIB 5H8DA 5GGTL 2P8MB 2EE9A 2DM2A 5DRNB 4FRWA 2BHYA 2VDKH 4XCEA 2Z8RA 1E28A 3G6AB 1U8HA 5JQ6L 1FNSL 2DOCA 4OF0A 43C9A 1T0MB 3KVQA 4PLKC 1F2QA 4WWKC 4XMLH 2GFBB 4X9GA 3UJTH 2VAAB 1AI1H 2CDGA 3WDHA 2DIJA 3DSFH 4G8EB 2MTPA 4UT7H 4XGZA 4XMLL 3SCMC 1SEQH 4P9HC 3MRJA 1AI1L 2R9HD 4R4BB 3SQOH 4PJIB 3BZEB 3T2PA 1FDLH 3DSFL 2FIRT 3RHWF 3BPNC 2W0FA 4JB9H 4LKCA 3PWPD 4UT7L 4YHMH 1SEQL 5HHNB 4TNWF 4JDZB 4RQQB 4GG6F 4KI5F 4ZTPH 3V6OC 3SQOL 2OS7A 4WRLA 1FDLL 5HPOA 1EGJA 2R69H 2YBRA 5JLZB 4JB9L 3JWDC 1F6LL 5HDQH 5B39G 3S97C 1CLCA 4PV9A 3X12A 3SDDA 1CIUA 3CSYA 4XPBH 5DJXB 1ZKAA 2VN4A 4FZEH 4GAJL 2BZDA 5JXAL 4N90D 4HUKB 1FYTB 2SEBB 2E8ZA 3PWPB 4LCYB 5C92A 5GGSB 1FGNH 3SJVA 5C07E 3EYQD 3SE3C 1JZ5A 3EBAA 5F96H 4AL8H 5DUBA 1IM9B 1F2XK 1KXQE 1I85C 4FZEL 4UT6H 1EIBA 1CCZA 4M93C 4JHZA 3TEUA 3KPOA 1UB6B 5GGQH 3DX8B 1FGNL 4JDTH 4YDVB 5FECB 2G2RB 1TQBC 4AL8L 4UT6L 3GMMB 1DBAH 4JFQA 1S9WA 1N26A 2VOTA 3QEHA 3VWJC 2XQYK 5GGQL 5F3HA 4JDTL 3K2MC 5FO9A 2K1MA 4QHLB 2CIIA 1ZOXA 2GITB 3KYNA 3FFCD 5GS0D 1FL5B 4YPJA 2FEDD 1DBAL 3VRLF 2OLDA 2QL1A 1IM3B 3DBXB 3L7FB 4YDJA 4S1SH 3GMLB 3UPRA 2YZ1A 2VDRH 3ARED 2XN9B 4XNQB 4ZOCA 4R6UA 1I7RA 2R0WL 3QDJD 4K3DL 3VRIA 1RZJC 4S1SL 1T0NB 5T1DL 1M1SA 3SDXB 4KHTL 4DVBA 3BP4A 3OX8A 2UWEE 4I0KA 3ARDB 3W9EB 4LDOB 1LNUA 1RIUH 1FYHB 1NGZB 1L7TH 1A6UH 4P4RB 3OR7A 15C8L 3LAFA 4X6DF 2AXGB 2R4RH 1FV1A 1F8TH 2C5DC 3LY6A 1Q72H 1WWCA 1HNFA 3CXHJ 3IKCA 1EEZA 3I6KB 5C2UB 5JOFB 5HYSA 1VGKB 3P0VH 4ZMAT 1CLOH 3QQNA 3ARBA 4MNQA 3W0WE 1RIUL 3R8QA 3RWHA 1L7TL 2YD9A 1A6UL 4V2CB 5CBEB 2R4RL 4NO3B 4WJ5A 1F8TL 5INDB 4WHDA 3S98A 2B8OT 4CN1A 12E8H 4X4XB 5C0EB 1A6AB 1S5HB 4GLRI 2AK1H 3P0VL 1WITA 1CLOL 5F88B 1AIFA 5DRZB 3TIDA 1I3RB 3VG0H 3BH9B 3RWFB 5JOEA 4RFEB 2LTQB 2AKRA 1JYVA 3MRQB 4X7TB 4YEFA 4I9WE 2AK1L 3TBWA 4MMXC 2FNBA 1QFWM 1U95A 3EO1B 4WV1B 4PJDF 2R2EA 1IAOB 2A74B 3L3IA 4RMSA 1V3LA 1G9MC 2RJMA 5DYOB 1AKJB 3MYJA 4OZFG 4YJZL 4LSDA 4X6CA 4NBYB 2FCBA 4IDLA 4M8QB 3KYOB 2ZPKH 1MCJA 4KKAD 4N0UE 8FABB 5J13C 1TVBA 1VFBB 1OB1A 4F8QA 3GMPB 2ED9A 3FT3B 4JJ5A 3MZTA 3Q3GB 1P1ZA 1G7LA 3EGSB 2YUZA 1A7PH 5K9KA 5L9DH 3P73A 2YHGA 3B9VA 4U1HA 5FCUH 1GC1H 1X3DA 4XCCH 4XBPB 3MRPB 3QSKB 1A7PL 1GZQB 1U8NA 4M7ZB 3MRHA 4X4ME 2NXYC 3MGOB 4XXCC 4H8WH 1XGPA 1JCKA 1IGMH 3MROB 5FCUL 1GC1L 3TM6A 4XCCL 5IEHB 4BUHA 4LCWA 1OARH 2V7NB 4R96B 3FQWB 1I7TA 4WW1A 1SVZA 3WNPA 3HZMB 4J4PC 4E42B 2H26A 4TNWK 4GW5A 4QNPF 4PJBE 1T7VA 1J86A 4JRYB 4U2ZA 1Q9OB 1OARL 2J88L 4PREB 4FTVA 3OF6D 5IR1B 3NZ8B 3CFKB 4Y2DC 3EJJX 4FQXA 5DD5L 1EK3A 5KVDH 1R3HA 1SYVB 2E7BA 4GRLC 5E1AA 1CXHA 4I1NB 1FSKC 3L3HB 3ZKND 5CD5D 4PJ5E 2NY1C 2OL3H 1BQLH 4NO5B 4PJ8A 4YDKL 1MI5A 4RGMC 2HRPL 4MA1B 3FN3A 4P5TD 4PPTA 4WHTB 5KVDL 1XF5A 3NN8B 2DYPB 1INDH 3G5YB 2XTJB 5E2WH 4LAQH 3HA0A 4MGXA 2R8SH 4YEEA 1OQXA 4XPHH 4R97B 4DFIA 3T3MF 3DX9B 2VZOA 1QNZH 1GOHA 1HKLH 3I3DA 1ZLUK 2X9WA 1EX0A 5DJ0B 4MJ4A 3CFBB 3D0LB 3NIFE 3QUML 5E2WL 1OOAA 4LAQL 2LV4A 2R8SL 3HZVA 4RWHA 1AGDA 4XPHL 5FK9B 4K07A 4B5EA 4U6VL 4KI5D 1BWWA 1QNZL 5E7FA 3SE4C 2X05A 5IBLD 1IC4H 1LO4H 3IJYA 1H0DB 4NO0A 1LP9F 2RCSH 2Z93A 3V0WH 1XFPA 3WFHB 4ETQB 3L7EB 5KSVB 1LO0H 1JPFA 3DROB 1IC4L 1LO4L 1WBZA 3JTSB 2V7HA 1ND0B 1L6ZA 2NY7H 1UM6H 2Z4QB 2RCSL 2B1HH 3NPSC 3V0WL 3SGKA 4OT1L 1LO0L 5SWQA 3H8NA 4LLDB 4APQA 2A77H 3TVMB 1IQWL 3QEGH 5AWNH 5K9QI 3MRRB 1UM6L 1NBYA 4OB5H 4WTZA 2B1HL 1BFSA 3V52H 4GG6B 4MD4A 2D31A 3IVKA 4K23L 5CGMA 2JIXA 2R2CA 4DQOL 4D8PA 1BD2A 2ITDB 3ZDYE 1AR1C 2A77L 3N50A 5CWSB 3QEGL 5AWNL 1Y6NR 3L6FA 3VXUB 4OB5L 3PWUA 5CJBA 3A67H 2EICA 4MD5A 3TBTB 2ARJA 4HEPG 2V5SA 3LN4A 3T1FA 3DUUB 1ZHLB 3QUKA 1I1AC 3FKUS 4YIQA 5MENB 5J1AA 1KOAA 4RIRA 3CVHB 3A67L 1DQMH 1IAIH 3IYLW 1RQ5A 2ICEB 4Y1AA 1YEJH 4RFOH 1RZ8A 3OV6A 3MXWH 2R1WA 5BS0A 1W0VB 3UPAA 5EOCJ 1IGYA 4M7LH 3U48A 1DQML 1IAIL 1N0LA 3X13B 3NFSH 2OM5A 3N06B 3R8BB 3C8HA 3MXWL 1FG2B 4KKCC 5DEFA 4RGOL 1J0JA 2FYYA 2R23B 3FQTA 4WUUA 4LP4A 1A1OB 2XV6B 2DLTA 3BEWA 5DJ8A 1N6QL 3NFSL 4IRSB 3UAJD 1KJ3H 5F9WB 3PGCA 2KBGA 4CW1B 2FL5A 1UB5A 3QUZD 5IM7B 2DN7A 3QQ9D 4ZDHA 4LLVB 1GL4B 1BOGB 4P4KA 3MLTA 1KLFA 1N64L 4L5FH 1KJ3L 3F5WB 3EAKA 4UTBH 3BYTA 5CJ5A 3QXDB 2VR9A 3DRQA 1A9BA 1T89C 4XZUA 4X5WA 2HFFB 2WLYA 1XF3A 2EO9A 3W9DA 3TNNB 3FT2A 4JHWH 4L5FL 1YECH 1C7TA 4KK6C 4DWHA 1N5YH 3MACH 1G7HA 3X17A 3NGBC 4ENEC 3FFCE 4UTBL 4M6MH 3Q5OA 1FAKT 2AJZA 2R0LL 4NO2B 3HAEG 1PBYA 4JHWL 1A7OL 1EJOL 4U1NA 1YECL 4U6XB 1NC4B 4J3VA 1N5YL 3MACL 3LD8B 3S36X 3BPOC 1A6TA 3ARQA 4M6ML 4IS6A 5DJAB 3QDJE 2YOCA 2C3XA 1TLKA 4WWID 4N0YL 3FZUD 1MLCA 4V1DA 4AEHL 4NM4L 2R2BA 3FB8A 1F11A 1VEPA 1TTFA 4LRIC 1F4HA 1JZ7A 4GKZB 3O6LH 4LLAA 1PG7H 1X4ZA 1JZ8A 2PTTB 4JR9L 1UXSB 4M48H 2A1WL 1FVDB 1T6WA 1U3HD 5GGUA 4UDTA 1D5XB 4U3XA 4F37F 5EU6B 1WAAA 32C2A 3CSPA 4U7SA 5IMMB 3O6LL 1PG7L 3DV4A 1EEQA 1ZT1B 3RKDC 2GTZB 4OD2A 4M48L 2HN7B 5GZND 1WZ1L 5ICZA 3L3GB 1NGYA 4F7EA 1WFNA 1FAIH 1OW0C 4UU9A 2WBJC 4EDXA 1ZHNB 5A16B 1E6OH 3G5ZA 4PJ7E 2N7BA 1BZQK 3I6LD 2YWYA 3BZ4A 5D7SH 5HD8C 4YGVB 1JK8B 1JTTA 1JGDB 5B8CB 1FAIL 4KV5F 4UOJA 1GOFA 2ZWLT 5IV2A 2NX5A 5BJTA 5D7SL 3JWOL 1FFOA 4R4FL 1TDQA 2EH7H 2X7LA 4QT5B 1QOKA 2J8UB 3VXRD 3X14A 5IB4B 4Z7UA 1T7XA 3H0TA 3WKMH 3E0GA 3RX5A 3EDDA 5I75B 3B8YA 5EU7E 3HE7A 4GBXB 3GSUB 3WFEH 3HCVA 3TBYB 2EH7L 3AMKA 4PGJA 1R3LA 3HPLA 5KS9E 5GRJH 4Z78B 4LSQL 4PGDB 3WKML 3SKNA 3CLFH 3U46A 3VFOB 1D5MA 2IAMC 4XCFH 1JV5B 4R4NC 1PLGH 1AXSA 1P4LB 1T1YA 4LP5A 4U33A 4PJAF 4YR6B 4ONFH 5GRJL 3JUYA 3TWCH 4ONHB 3D0VB 3CLFL 5GHWH 2BOCB 4NNPL 1JGVH 1NGWB 4XP1H 5J9PA 4OLVH 1MF2H 1PLGL 4QTHB 3SGEH 3GKWH 4I3SH 5DF0A 3TPUB 2ZUVA 1DP0A 3IDMB 1I1CA 4ONFL 5DHXB 4KMLB 2GUOB 3TWCL 3UZVB 3RPIA 3C2AH 2GW5A 2QSVA 3FO9A 2V17L 4KKNA 1DQLL 1JGVL 5K9JH 5IBUG 1MF2L 5K9OB 1CDCA 3ARFA 2VTFA 3GKWL 4I3SL 2XICA 4JFEA 3RKPA 3BIKB 2F53D 2NY2D 3ZYJA 3RDTA 5I30H 4WGVB 1D9KD 5K9JL 2PYEB 1DQDH 3QI9D 2V9QA 5EBLA 3EYVB 3DVGB 5CMAB 4K3EH 1IAII 1CTOA 5I30L 2F9BT 3S5LG 4PJFA 3VWKC 3DMMC 4QWWC 4L9LA 3EO0B 4FOMA 5B39A 1K8IA 1IEAB 3TF7C 3W2DH 3GNMH 4OCSH 2A6JA 4NQDA 4QHKI 7FABH 4M00A 2GJZA 5L88H 4Q6IB 5C0GA 4JLRA 2VQUA 5DLMH 1I9RL 2WIIA 3HRZA 4YDIH 3GNML 4OCSL 3W2DL 3RZCA 1T83C 3LEVH 3PV6B 3FO2A 7FABL 5L88L 3FQRA 1CFQA 3QPQD 2X1XR 2D9QB 3GJFK 3AB0C 1ADQA 2I9LB 5D7LB 5DLML 4MQXD 1CFSA 3V5KA 4NUJB 3FFDB 4QRPA 4YDIL 4DUWA 3LEVL 2BNRE 3CNKA 4AENA 5F8QC 5L6YL 1DEEA 1TXKA 4UQ2B 1U8OA 1V8HA 3Q5TA 3X11B 3TFKC 3FONB 2DLGA 4XCYB 1G84A 3OR6A 5I66A 1NCAH 3LDBC 2BXZA 5CZXC 2H2PC 2OL3A 4MJ6A 5IQ9B 4HHAB 4I18B 3T8XB 4IIQB 5E9DD 1YPZA 1VFUA 1YC7A 5EBMA 4PLKD 4L4TD 4WWKD 3HHRB 5D1XC 5EH1A 2QR0B 2C4FU 3JTTB 1NGXA 1D5BA 3BQUA 3C8KB 4OFDA 1NCAL 4WDIB 3W5MA 3IDIB 4XX1G 3FQXB 2X89A 4HULB 4WO4A 1T1ZA 5DJCA 1FQ9C 1DQTA 3PJSA 4X8XA 2XZCL 5ANMA 4Y5XB 1IFHH 4U6HB 4JKKA 5D1ZC 3GEWB 2P7TA 5DC4B 4F37K 4XP4H 2HJKB 3RGVA 4KK8C 2ZUQB 3MBXH 3DURA 1A6ZA 3UDWA 3S4SB 3CX2A 3OJMB 3UBXI 1IFHL 3LSOA 3QQ3A 1TQCC 3J7HA 3IFLH 4XP4L 3JV5A 5EIIA 1KULA 1QPXA 5CEZE 5E2TH 4HEME 1LK3H 5DUMH 4R90H 1S7UA 5LAXB 5CCKL 1NCTA 5J89A 1KGCE 1PZ5A 3D25B 1FZKA 4WW2B 3MQIA 3SCMB 3P4MA 3FCTB 2GAZA 3BVNB 3KYMA 2ICWA 5E2TL 1LK3L 5DUML 2ATPB 4X98B 4I3GA 2GJ6A 4EOWH 2ZZUT 3FHQA 2DJSA 4JQXC 5F9OH 4PR5A 5FGCB 1JUFB 1X6NA 2GK0B 1KIPB 4ZSOA 1M7IB 2WUBL 2DTMH 5IIEB 3K74B 2J3SA 2LQRA 2QV2A 1NJ9A 3MV7D 4EOWL 1BQHG 1T2QH 4Z7VF 5TPWL 1H3WM 5F9OL 4YBLB 3DPBA 4OZFA 2HVKA 1BPVA 3QXAA 1CK0H 3NABH 4K94H 4M4PA 3V0VB 5EUKA 5D6DC 1K3IA 4TUJA 5KOMC 3WNLA 4AIXA 1T2QL 4JFXB 3WHE1 3FL7A 1RJCA 3VWJD 3BD3A 1G7IA 2AABH 4L3ED 3NABL 4RDQF 4QOKB 1VDGA 1KN4H 4MJIB 5IOPA 2IBBA 3FRPG 1AO7A 3O3AB 1EAPB 4PJDE 4CBPA 3DUHA 4WU7A 2AABL 4BFGA 2IFFH 2VZ1A 3MJ7A 2MKLC 4FABH 1W8NA 3VG9B 4TVSa 3F7VA 4P46A 5JUEL 3LN9A 4CMHC 2IFFL 2GYSA 4WI6A 3SGEI 1KIUA 4ZUVA 3BJ91 3SGJA 1ULVA 4P2OB 1KACB 3TCXA 5F7HA 1PG7W 4DN3H 2E27L 1KB5B 1G7MA 2BP3A 4ZFFB 3LPGA 3LCYA 3RWGB 4KUZL 4PTTA 1EH9A 2VUOA 4YFDB 5DT1H 1MJ8H 4UTAH 5DJ2B 2QHLA 1U8IB 4DN3L 1TCMA 4X8JA 3H42H 1HH9B 2ADIA 5DK0B 4U1JB 4EVNA 1LO2H 3BGAA 2Y7QA 3AXLB 5DT1L 3I6LE 4PJHE 5FKPB 4YHYB 3H42L 5IJKA 1OD7A 1U93B 4QNPE 4BZ1H 2EYSA 5FM4A 3WV0A 2BOBA 2X09A 4ZS7L 4FFWC 3E8UH 4NM8H 5SWZD 4NKDA 1QZ1A 1ODAA 4JM2A 3LQZB 2EE3A 2VIRA 4HKBB 3QEQD 3DV6A 1QVOA 3NCCB 4BZ1L 1N59B 1XMWA 3VXRE 3E8UL 1AP2B 1ZGLP 3G08B 2OMBA 4D2NA 3H9SA 3ARGA 1I1FA 4PJAB 1QSZA 3BDYH 1ZXQA 4FFZH 1IGIL 4M61B 1HHJB 2ESVE 4MNGB 1YQVL 3MRFB 2BVYA 3IAPA 5D2NB 3RRQA 1MREH 4NGHH 1FPTH 1J18A 3T3ME 1U2HA 3BDYL 4I5BA 2WV3A 2NXZB 3QDGB 3VMPA 4HG4J 2AGJH 4AT6A 2Q86A 4ZUWA 2NY0C 3HI1A 4Q9CA 1GGTA 1QO3A 5CUSH 2BNQA 2NXYD 1MREL 4NGHL 1IKNA 1NC2B 3ULUD 1FPTL 4ZFOB 5D7IA 3F7PC 4L3CA 5FXCH 4H25B 3BKJL 5JZ7C 4P2CG 4OZGB 1DFBH 5DEGA 1W8OA 4QRUB 4J4PD 3TBVA 3RVWC 1AGEB 1NCDH 1LP9E 1BP3B 4NQED 4Y16B 4PRIB 3RUGA 1VEOA 2DQFB 2A83B 1TNMA 3B43A 4Y4FA 3IU3A 3BPCA 1DQQB 3OKDB 4L4VD 4NRYB 1A9EB 1BFVL 3CFEB 4Y2DD 4YNYB 5E03A 3M1BB 1A4KB 1ZGLM 3BUYA 1NCDL 3U36B 1JYNA 4GRLD 2APWA 3MCKA 4HJGB 2X4TA 2UVEA 1WISA 4HSQA 2NY1D 5I8CB 3UTZB 3PWNA 4HPYH 4ELMB 1DE4A 3ALWA 4HH9B 3TYGH 1W72B 1C16A 1P9MA 4XP9H 4HKZB 2NXYB 4G6JH 5J6GB 1OAUH 3WO4B 2F74A 4HUXA 4NC2B 5GZOC 5CZVH 1U3YA 2BVQA 3HNTL 3D85A 5E00A 2DQJH 3AU1B 3STZA 3TYGL 3QDMA 4XP9L 4G6JL 4HIEB 3RL2B 4LU5H 1OAUL 2CDFA 3N85H 3TN0A 5EOQH 3EDJA 4K71B 5HPMA 3Q6FB 2HYMA 1CE6B 4XWGH 4CRPA 2VWEC 2IF7A 1LEGB 5EIVA 1ZHKA 3VXSA 3G5XA 4GAYA 1U3ZA 3U6RA 2HVJA 4IHOB 4PY7A 5AYUH 2F5BH 3N85L 5JA9A 3O3BB 2EZ0C 5C0AD 1U8MB 4C59B 3VGAB 4QHNA 2V2XB 4L4JA 3FB5A 1KLGB 2MNUA 5F1NA 1GC1C 5HVHC 5AYUL 4FQHA 5CSZA 1QPPA 2F5BL 2N1KA 1A2YB 5E8PB 2FIKB 1EFXD 2X4OB 5K33A 2R29H 3IF1B 3PL6C 4F7MB 3IDXH 4UAOB 5BQ7B 5LGJA 3GM0A 1C8PA 1LE5A 4L4TE 2IH1A 3OGCB 2C3GA 1IC1A 5DUPH 2VITA 2WANA 1NH6A 2R29L 1JPSL 2OZ4H 5DMKA 1D5ZA 4M7LT 3IDXL 3KPSD 5EO9B 5CFHA 3HAEA 4NUGH 2WW8A 2DQUH 4PGCB 3PE9A 2YC1B 2BRQA 5DUPL 1AR1D 1OP3H 2FO1A 4FMFA 5FGSA 5E5UB 2OZ4L 4BYHA 3L5WA 3L3OB 4X6EB 2ZSVA 4NUGL 2CR6A 1P7KB 2DQUL 4P23A 4ODXA 3P4OA 3V6OE 1I1AD 3ARTA 1L9MA 1ZHBA 3MJ8A 2YXMA 4P2QB 3KPRD 4I2XB 4XB7A 4TTDC 2OR9H 3MBEB 4Y4HC 1ACYH 4OTXL 4MS8C 3NPSB 1ZLVK 1MCPH 3DXAB 3IS1X 3W81A 3MNZB 1ZWIA 4F9PC 2FATH 5FUZH 3RWDA 1S7QB 5CJXA 1SBBA 5KSBA 1MCPL 3OXRB 3RI5F 1WT5C 3TO4D 4DGVH 1CFBA 2Y06L 4OZIF 1JTOA 4NZTL 4KKCD 5KSAA 3B6SA 4Y19B 2ADJB 2FATL 2YEZB 5FUZL 4ELKB 5C0NC 5DVMA 5IT2L 4XMPH 1YJDC 1C12A 2CPCA 3B2UC 1E28B 1Q0XL 2A6DB 1YMMA 4O2CA 3MLRH 3CXHK 3SQBA 5T33H 5F1SA 43C9B 2P44B 3MV8A 4I48A 4E41E 3T1WA 4EN3B 2D7TL 1XGTA 4PB9H 2VN7A 2XA8H 4LSUH 3MLRL 1RZIA 4G7VL 3TZVA 2IPKA 5T33L 2WZPD 2HJLA 4XGZB 3EIFA 2UVFA 1MEXL 1S7XA 4AG4L 4PB9L 2OTPA 4KK6D 1AQDB 2XA8L 3MCLH 5HYIA 4ENED 4PLJD 3BFOA 5FA4A 4PGBB 3HI6L 1XGQB 2W0FB 1Y0LB 4K3HA 4LKCB 4YXKH 5JR1H 4G9DA 5JW4R 1SM3H 3OB0K 4JFDD 2XYCA 3VFRA 2HLAA 4YH6A 2XKNA 4J3WA 3MCLL 4XXDA 3BWUC 3NCYS 4LLUA 3V7MA 2H6PB 5SWSA 2YBRB 5JR1L 4LLMA 1SM3L 1OCWH 2FDBP 2EDLA 3KXFA 1EV2E 4UQ3B 4ZFGL 1JHKH 2FEEI 4X0KA 3QISA 4OUOA 4PV9B 3SDDB 5I6XB 4BFIA 4H1LH 1YC8A 4MAUL 2A73A 2V2WB 4D9LH 1K8DA 4XVTH 1AY1L 1UQSA 2HA1A 3C6LA 2FBOJ 4HWZB 4XI5C 5A40E 2IAND 3RKDD 5H37H 5L2KE 4BKLA 3CK0H 3V7AE 3TNMA 4G9FA 4XVTL 4NKIH 1BAFH 3TO2A 4Z5RB 2WBJD 2FZ3A 3RA7H 4CDHA 4KJYA 1GGBH 1CT8A 4NKIL 3ALXA 5HD8D 3S5LA 1BAFL 3A6OA 4JO1H 2CRZA 4E9LA 1Q94A 5D1QC 4JFQB 1S9WB 2OMNA 4G5ZH 3QEHB 4JO2H 5ETUA 1IAKA 2Z92A 1IBGH 1PX3A 5F3HB 1GGBL 5KVFL 1J8HD 2CIIB 3P9LA 3QG6A 2ADFH 5BV7B 5ID0B 3QEQE 1A4JA 2H32B 4G5ZL 4YDJB 1B2WH 3GO1H 1IBGL 2XPGA 1F4YL 3GSWA 4A6YH 3UPRB 1YY8B 1VSCA 3DX7A 2BHUA 4YFLI 2ADFL 2WWMD 2OXGA 4R9HA 1T1WA 3IDGA 3QEUA 3VRIB 3T0VA 1B2WL 3GO1L 4DVBB 1OGAA 3O6FA 1QA9A 5C09A 5EC2A 2IAMD 4MCYB 3QNYB 5KANG 3FQUB 4KGJA 4HIIA 3OR7B 1F3DH 1FC2D 5JA8B 4MD0A 3CH8A 2YSSA 1EEZB 3IKCB 4U2YA 1G7PB 5IGXH 2ZJSH 1YDPB 3IAGC 5KG9B 2BVEA 3ULUE 1I8LC 4MNQB 3ARBB 3QR2A 5D5MA 5J12C 1SVCP 2EYTA 4RX4A 5HGHA 5HTSA 4WJ5B 5FV2A 5IGXL 4YPGB 2VB5A 4H0IA 3KAAA 2MQ3A 3MODH 3VFNA 3PHOA 4NQXB 3ARUA 1QSFE 4KRPC 5D93B 4L4VE 1XZ0A 2AKRB 1G0XA 1WIPA 2ITCA 3E2HB 1SJHA 4JKLA 5EFIB 3D3VE 1OGTA 8CGTA 3TBWB 4AM0A 3MODL 1RUKH 3DVNA 3ROOA 1FNEA 2YD8A 4HT1H 3VI4F 3ARPA 4Q0XL 4XBGA 3MYJB 3GSRB 4J12A 3JWOC 4X6CB 5FHAH 4Q9RH 1QEWA 1MJ7L 3OQ3B 1MCWM 4RMQA 1W0WA 4U31A 4Z0BL 1RUKL 3VWKD 3DMMD 4QWWD 2HKFH 2XWJA 4HT1L 5DD6A 5IB5A 4HUUA 1EMTL 2APVA 5I1IH 3FN0L 4MSWA 3T09A 4Q9RL 3EFFB 4NWUH 3NCJL 4OQTA 5GS0H 5I1LA 2HKFL 3I75B 1X5IA 4LPXA 2Z9TA 2AV7A 4LSPL 4RGNC 1QFWI 1KT2B 5I1IL 1WUNT 1I7UA 3BRGC 5FM5O 4WNQA 4MX7A 5GS0L 4M6NL 1ZK9A 2APTA 1X44A 5C0AE 4I3RH 3JUZA 5AZ2H 4RA0C 1BQHA 3BI9X 1S8DA 1XGPB 1GAFH 1NMAH 3LVEA 3TFKD 1KNOA 2Z91A 1IGTA 3SBWC 4NQCD 4LCWB 4I3RL 1KJMA 4ODHH 3LB6C 2EO1A 2H2PD 5CZXD 4OLXL 3C08L 1AHWA 4JY5L 5TE4H 4GW5B 5DZLA 1J0KA 4WENB 1NMAL 4OZHA 4ZPVA 1IC7H 5D1XD 1B0WA 1V3KA 2IADA 4UNUA 4ODHL 3O4LA 4FTVB 5M94B 3PQYA 4G8GD 3KPSE 4LHUB 2CK2A 4NN7B 3FRPA 4P5KA 3WFDH 4OV6F 3CDCA 3EOAA 1DZBA 3AB0B 1I8MA 3F62A 1F4WH 4PJ8B 1MI5B 5A2JH 4J6RH 2P42B 1XF5B 3WFDL 1CR9L 5D1ZD 5DHVH 2OI9C 2LVCA 4KMQA 4KK8D 1NGQH 4NQCB 4OM1H 3KPRE 1F4WL 3LDBB 3QHTC 3UTTD 4MQ7B 1H3UA 4J6RL 5I8OH 2YPLD 3RJQB 1WWWX 5BXFA 2X4NA 3VFUB 2V5MA 2H8PA 4G42B 3RFZC 4NBXB 1UM5L 4N0FA 1CTNA 1Y18B 4QY8A 5D1XB 5HI3C 2GI7A 2EDBA 4PJGA 1NGQL 2PO6C 4OM1L 3K4ZA 5FDWB 1MVUB 4ZFZA 5I8OL 2ZOKA 4PRPD 5J7CC 4PBVC 1V3JA 1LEIB 3W0WA 1HSBA 4OFYA 5F7DB 3IJYB 3L9RB 2P5EA 1FFQA 1XIWA 1JNLH 3QIWA 3QFJD 2Y4SA 4HJ0C 5BRZB 4U3CA 4MZ2A 3HE6A 1WBZB 2Y23A 5EUOA 4LK4A 4OV5B 1J0IA 2AK4D 2V7HB 3E3QE 3TH2T 1UKTA 1EEYB 1JNLL 1HHIB 3S3SA 4ZXBA 3MNWA 2Y25A 1WV7T 1ZV5A 5SWQB 1AGBA 3JWNC 5HXMA 3GHBL 3G04A 1NBYB 4MD4B 4EI5A 3IVKB 1BD2B 5H2BA 2XOTA 2WIMA 1A21A 2UV3A 1H8OA 3D18A 3L6FB 1QRNB 3BP7A 3MA7A 4OF5A 2PF6A 4QYOB 4WIQA 1ETZB 5KSUB 3LN4B 4BQ8A 3UXFA 2Q7YA 2F54D 2P43B 5DFTA 3T0EC 3LIZH 3QUKB 2O93L 4Q2ZA 2AK4B 3NZHL 3IDUA 5J1AB 5ESAB 4MQTB 4MA3A 4Y1AB 3MXVL 1I9IL 1OTUC 3LIZL 1RZ8B 2DL2A 3OAZK 4LSRH 3SO3C 3LRGA 4PTUA 4DAGL 5JNYA 1FNHA 4BH8A 5EC1A 2YD6A 5FYLE 5C0IB 2R0KH 1RFDH 4HWUA 5EB9A 1UXWB 5DEFB 1ZA6B 2Q76A 3MSPA 2VC2H 5I73C 5HHXH 1RK0A 2Z31C 2FX8H 2IANE 3BEWB 2BVPA 4LBEB 3SKUD 3REWB 3SPVA 2R0KL 1RFDL 1MCKA 5D7JB 1WWBX 5EBWA 4Y5VA 5C0BB 5HHXL 3RZWA 5CHNB 2FL5B 4ZAKB 3T2OA 2VLJD 2FO4A 1NLBH 4GMSH 2IC2A 1A5FL 4P4KB 5IHUH 2Y36H 1TJIH 1U8KA 1KEML 1KFAH 1MUJB 5ITFA 4MDIA 1KXTB 3DRQB 4CMHB 1OP5K 2RQ8A 2CRYA 4X5WB 3PHQA 3ZZ1A 2PTUA 4FFWD 1JVKA 1TJIL 3GSOA 4KTEL 1J8HE 1UEYA 4QXWA 3TA3C 1JE6A 3CPLB 3LPFA 1ZLUH 5DK2B 1T0MA 3WSQH 1O7SA 2GFBA 4MXVE 4L8SC 2EDHA 1KIRA 3ZKXB 1FIEA 5I1DB 4IS6B 1PJ9A 4ACPA 2ADGA 5FGRA 3WSQL 5C0FA 1MLCB 4NPYA 2Q8AH 1NCCH 5GS1B 5IF0A 4PJIA 3DHMA 3G6JB 2R2BB 2FH6A 2CRMA 1F11B 4DK6A 3RVUC 5HHNA 1JPTH 4M9OA 2NY0D 1NCCL 2UZYB 4O2FA 3HFMH 2QQQA 4FS0A 4GSDH 4OQ1A 5CEZH 4UDTB 4JRYE 32C2B 3ESUF 5JZ7D 2AXJA 4OD2B 4N8CH 1X5XA 3RVWD 3HMXH 3SOBL 3O9WB 1NGYB 1TZIA 3HZKB 5CEZL 2CK0H 2WSKA 5ENWA 3EJYC 3T2QA 4A6YA 5JDJA 1KG0A 35C8L 4Y8AA 4WI3A 3HMXL 2GKIA 1K3ZA 5IROA 2CK0L 1E6JH 1NDGB 1PW3A 2SEBA 3PWPA 4LCYA 5GGSA 4WI5A 2NY3B 4Z7QE 1A6WH 1WZMA 5BJTB 3SGDH 2XWTB 2FJGB 1FFOB 3QUYD 2X7LB 1SY6H 5GZOD 1UB6A 5BCAA 1FL6A 1H8SA 5FECA 4Z7UB 4GMTH 2G2RA 1A6WL 2QTEA 3H0TB 3UROR 3GMMA 3HE7B 2JTDA 1VA9A 4LF3B 1RJZA 1SY6L 3AGVA 4OGZA 3HPLB 2DQCH 4GMTL 1NFIA 3GHEH 2VRAA 3SKNB 3ZSTA 5B38B 3U46B 1D5MB 1FL5A 1N3NB 4UIKH 5LVEA 1IM3A 1RUAH 2EZ0D 4OUUB 5T1KB 5BZDA 3GMLA 1G6RL 1GPOH 3U2SB 2DQCL 1OWRM 4CU6A 2P47B 1RULH 2XN9A 3GHEL 5F7FA 3O2VH 4WFHE 4X5LA 5IVXA 2B1AH 4A2MA 2W91A 4UIKL 4CU7A 1T0NA 3O2WH 4OLWH 2NW2A 2KKQA 1GPOL 3L3KB 2EIEA 3SDXA 4HLZG 5GRWA 2APFA 4KROC 1N2RB 4PJCF 4OZIE 2JCCE 1OTSC 3CDGA 4FQXC 3O2VL 4LASH 4NZJA 2B1AL 5D96C 1NGZA 1F3DJ 1TITA 4P4RA 5DGQA 3O2WL 4OLWL 2V2TB 3S4SG 4Z8FH 2AXGA 3VXUE 3MJ9A 4RMRA 1P7QD 2FH8A 1BX2A 1GJIA 1FLRH 3BKML 2Z8WC 1CYGA 5JOFA 4LASL 1VGKA 4WHYG 2ATKA 4WFFD 3FFCA 5TE7L 1UJ3B 4FQIH 4AH2B 5FYKD 4Z8FL 1S9KC 4NO3A 1YNTA 1VGEH 5C3LD 1IGJA 4X4XA 5EBLB 3AREA 4CJ0A 5D9SA 2NY4C 4WEBH 5F88A 4GQ9H 5JHDD 1HHGB 3D48R 3FT4A 1EFQA 4OGYH 5DRZA 4KTYA 3DLQR 4F3FB 1I3RA 2JJSC 3BH9A 5HYJD 1N7ML 1VGEL 3RWCA 5B39B 2A6JB 4TTDD 3PL6B 3BE1H 2YPLE 2GJZB 4Y4HD 4WEBL 4QXUH 4JY4B 4MS8D 4GQ9L 4TUOA 3RU8L 4Z7WB 1CN4A 5C0GB 4JLRB 3EO1A 3MUHL 4KJPC 2EXYC 4TN9A 1TTUA 3KJ4B 1OAXH 1XGYH 3MV9E 4UBDD 3GMNA 3NA9H 1XGUA 3MGTB 4JN1H 3BE1L 3FO2B 5FHBH 4OLZH 4PRPE 1L0QA 4Y0GA 3B9KD 1MRFL 3QCVH 1CD9B 3QPXH 8FABA 1OAXL 4N9GA 1CFSB 2CDEB 2B39A 4ZG1A 4QRPB 2MQCA 1WZLA 5HHOD 1ZEAH 1CFTA 3NA9L 1JJUA 3QIBD 4JN1L 5C0ND 4Q58C 4OLZL 2OSLB 3GMPA 1DEEB 3QFJE 3FT3A 3GRWH 3HTLX 1M7XA 4TYUA 3QCVL 3QRFM 4APQC 3QPXL 3RBGA 3C60C 3B2UD 3OR6B 5I66B 2W9DH 2OL3B 5EOTB 5BMFL 3OAYK 2E7CA 5LGKA 5F9DC 5EG6C 5EBMB 4HKJB 1WQVT 3GRWL 4XBPA 5DHVA 1NEZA 3MRPA 3BQUB 4M62H 2J6EH 4HXBH 2X4RB 1G1CA 1GZQA 2W9DL 2DL9A 4IRZH 3NIGF 3FQNA 4K2UL 1ZMYA 4FXLA 1VHPA 4H0HB 4LGPB 2ZUYA 4R96A 3FQWA 4CVZB 1QLFA 5DURB 4IRZL 3HZMA 3O8XC 5CJ8A 1FNAA 4X7SL 3STBA 3MV11 4JPKL 4EBQL 3LPWA 2PW1B 3C5ZC 4BQ9A 1F58H 2F54E 2A6KA 5IR1A 4KVNH 3SE9H 1RAMA 1ZTXL 3MLUH 4HD9A 5F7MC 1ES0A 1A6ZB 2H41A 2VUYA 3OKMA 1SYVA 4U0RB 4BH7A 5JW4Q 3LHPH 3LSOB 3N9GH 1F58L 3D9AL 3L3HA 5D8JL 4LCCC 4K7PH 4QRRD 1Z9MA 4KVNL 4NO5A 2HKHL 1DR9A 1CD8A 3MLUL 5EU6E 4LEOA 3ZT5A 2B5IC 1QR4A 1UADC 1F5WA 2DYPA 4ZUSB 1F02I 1J8KA 1PZ5B 3G5YA 3ILPA 3R0MA 3LHPL 3UPCA 1FZKB 3NFPB 3WFCL 2ICWJ 2M8XA 1CGXA 2NZIA 3KYMB 3X3FH 2GJ6B 4XI5D 3P11L 3AMLA 4F58H 3CFBA 3D0LA 2NCMA 4HG4K 2Y5TA 5DMIH 4ZSOB 2WUCH 5E94B 5FK9A 1OT2A 3X3FL 4JZJA 2R56H 1NJ9B 2VLJE 5A1AA 4ORZC 2DKMA 4F58L 4NKOB 5DMIL 2YUVA 1KENH 1H0DA 3BRFA 2WUCL 1HQRB 3SGDI 2MMXA 3KS0H 5EUKB 3P9MB 2R56L 5D1QD 3QNXA 4P5TA 3WFHA 1YYLH 5KSVA 2HTKC 4HMEA 4LVHB 3DROA 2VXTH 3JTSA 4LARH 1KENL 1ND0A 4MXQC 1H5BC 4U49A 4ODVH 4D94A 2BY2A 1YYLL 4TPRL 4FQJH 5FCSH 4P9HH 4LLDA 2VXTL 5TGBA 2CUIA 3MRRA 2AERT 2DAVA 2D3VA 5F7WC 3CXDH 3LKQA 4ODVL 3S3PA 3V4PH 4GG6A 4PJ9C 3D2UD 3PDGA 3GJFH 1KF9B 4FQJL 1FH5H 3F7VB 4P9HL 2ITDA 5GGRY 4XPFH 5LBSL 5C86A 2H3NB 5E8EB 2ENSA 3CXDL 2YRLA 3V4PL 3TBTA 3TESA 3B4NA 4CN4A 3JWDH 5IFJA 1FH5L 5BOPA 4PIRF 1CICC 5CEXB 3ECBA 3MNVA 4I0PC 3DUUA 4XPFL 4NJAH 2FX9H 4XP6L 2D9CA 5C08B 5MENA 1HOCB 4O58H 3MLSL 3CVHA 1G7MB 1NBZB 5DQJA 5ACMA 2HMID 2YXFA 4ERSL 4R0LB 1FZMA 1CBVH 4HMDA 1N6UA 4NJAL 2FX9L 4TSAH 1W0VA 5ISZB 4JPWH 4KHXL 4O58L 4LLQB 2ADIB 2PYEE 3ORJA 4OBRA 4OIIH 4EVNB 3X13A 5DS8B 1PY4A 4HX1B 1YNKH 1TVHB 2DWDA 4MMZC 3O2DH 2E7LA 4NN5B 2IH3A 1CDJA 2CLZB 4TSAL 3STLA 2R23A 1BVLB 1K2DB 2APBA 4OIIL 5B3JF 5BVJA 3B3IB 3CD4A 1YNKL 2BOBB 4NCC1 3O2DL 4IRSA 5IB3B 4O4YL 1NUDA 2QEJA 2FGZA 5C0CD 1F3JB 5HI5C 4EIZC 5T5NG 3CFJA 1JYWA 1QVOB 5IMOA 5EWIL 2NY6C 1Q9KB 2EDFA 3UBXB 1R5WA 4HFUH 4OF6A 3F5WA 3VXMD 3PXHA 4YK4C 3H9SB 3TJHC 3HR5B 4GH7B 5D7LE 5FEBA 5J6HB 4L3AA 2GSIB 1VERA 5DJYA 3TNNA 4FXGB 4P59H 3WLWC 3ZTNH 4RGND 1EA9C 3AS3A 2YPKA 2VWEE 4KRPB 4MVBC 1V7ML 1WCBB 3WXWL 3WIHH 5E99H 2DKSA 1RZJH 2DBLH 4IRJC 4NO2A 4CVUA 1PG7X 4AT6B 1DBKL 1I4FB 4JGMA 1LO5A 2B0SH 3HI1B 2CKNA 1ZAGA 2BNQB 3U4BH 4X6DA 3WIHL 4D0CB 5DQ9B 2K7QA 1ZLSH 3ARFC 4O9HH 3VFWA 2DDQH 4L3CB 4HUVB 3A0OA 3LB6D 3VFSB 2VLKD 4FQPA 1X9QA 3HC0A 1F97A 3RDTC 3VGBA 1IKFH 2A6IA 1E4WH 3MRBA 4JQVA 4O9HL 2PCPA 3RUGB 1JI1A 2DDQL 3K81A 4OD1H 4F15C 2PTTA 5IBTH 1G9EA 3P30L 1UXSA 4JVPA 4PJXB 1FVDA 1DBJH 2OP4L 4WI8A 2JJTA 1QKZH 4EI6B 1IEBB 1IKFL 2QQNH 4DCQA 4PRHD 3U79A 3ZT6A 4WFFE 4JCLA 5GJSH 3MCKB 4OD1L 5FYKE 1ZT1A 3IT8D 3LKOA 2GTZA 1TPXC 4L9LC 1IILE 3WMSA 2EDQA 2HN7A 1DBJL 1DE4B 1N4XL 1QKZL 3L3GA 1C16B 2QQNL 3W39A 1S9YB 43CAB 4C56D 2F74B 5A16A 2KZWA 5KBNC 3MOAH 5HYJE 5I17B 4IOSD 2BVQB 1G9MH 3D85B 5F7YC 3AM8A 4OGAC 4YGVA 1JK8A 3QDMB 5KZCB 3K8MA 5C2BH 1P69B 3TN0B 3MOAL 1EJ6A 4RAUB 4KKLC 5HI3D 4ESKA 5HPMB 1DANU 2PO6D 5C9JB 1G9ML 4G7YH 4H26B 3V2AR 4HK3N 5D2LB 2R15A 4YXHH 5JIPA 3VXSB 3G5XB 3U6RB 3W82A 2HVJB 4PY7B 4FG6D 5C2BL 1NFDE 3UYRL 5HVWA 2J8UA 2ZKHL 5IB4A 1MSPA 5HHOE 1XR8B 4G7YL 4NJ9H 4DOHE 4V2BA 2W0KA 1QUNA 3FB5B 5TFSH 4HJ0D 2X4UB 5TQ0H 5CSZB 3S34H 2Q87A 2Y07H 3CU1A 1LWRA 3DARA 3B9EA 1CXFA 1N6VA 4NJ9L 3CSBA 5LGJB 5EU3B 3OHXB 3TBSA 3ULUH 5TFSL 5TQ0L 2IPUK 5TDOA 1P4LA 2AJYH 4WO4C 5IW1A 2YD4A 4YR6A 3L95A 3QAZC 1D5ZB 4MJIE 2BOCA 3ULUL 1J1OH 2D0HA 4QTHA 2AJYL 2CXGA 4AEIL 3VH8A 4P2RD 1UWXK 1WEJH 3RGVC 3IDMA 3VXRA 2GUOA 4RSVA 5EORH 1BLNB 4MJ5A 5GGVL 2CGRL 1KCVH 4HGMA 4B7LA 1OD9A 3HG1D 4P23B 4WFGE 3LKNA 3S37H 5K9OA 1MHPH 1RZFH 3T0ED 3P4OB 2JKXA 3BIKA 1ZHBB 3MJ8B 5EORL 3PHSA 1E27B 5FDYA 5A2KH 2RBLA 1KCVL 3MRNA 4NBZB 3S37L 3UC0H 1MHPL 1RZFL 1QACA 2YA2A 1XH3B 4XPTH 1F00I 1OTUD 4QRRE 3QFDA 5C0JB 1ZWIB 4J3XA 3MO1B 4LSSL 3EYVA 5CMAA 3UTSE 4JRXD 3RWDB 1MFBL 5F6IB 4HIHA 5KSBB 5I74C 3UC0L 5IFAH 2UWEF 3RGHA 4OFVA 3VGEA 3VDCA 2J6EA 2WBWB 5IVZB 5J57B 1IEAA 2AXFA 1NAML 2EDOA 25C8H 4KDWA 3RWJB 4FHBD 2Z31D 4Q6IA 4S1RH 3JV4A 2ZG3A 1M05B 3RTQC 3CFIC 5AYQA 4UILH 1QSEE 5IFAL 5I1JL 3LRHA 3BP6B 1C12B 5C0DB 4JKPL 3F6IA 3GI9H 3TPKA 1YMMB 4POYA 3PV6A 2F53A 4AY0A 2ED7A 3MV8B 4IM8A 2DBJA 4UILL 2I9LA 1D9KA 1MQKL 4JHAH 1XGTB 4OCYH 4NUJA 3FFDA 3SDAC 4N5EC 4WI7A 1RZIB 3QI9A 1KV3A 1R3JA 3BIAX 2IPKB 2LABA 5KTEL 3FMGH 5ICXA 2E7MA 2HJLB 4PS4H 5HDOA 4Z77B 1CGWA 1NUGA 1HNGA 4M8VA 4XCYA 4YHIA 4B50A 4X7EC 4DKEH 3TA3D 4HHAA 4I18A 3T8XA 2WQRA 2VYRE 3FMGL 4AIOA 1U6AH 2CKBH 5DVOA 4PS4L 4P46C 5IKCB 2QR0A 3JTTA 4OCWH 3LKRA 3VFRB 2HLAB 1ZGLA 1UEMA 1IGFH 5J8OA 1F6AA 4XXDB 4DKEL 3IDIA 4LLUB 2P5WB 3FQXA 1U6AL 1MIEL 5IWLC 3SGJC 3W11C 1IGFL 5IUSA 5CSBA 4HS6A 5HHQA 4X0KB 3RVUD 1DVFC 5I76A 4GRMA 2Z35A 4BFIB 2EXWC 2DJ4A 2HJKA 1EO8H 2Q6WB 1O0VA 1RK1B 1K4DA 1P4BH 1UQSB 3H2WA 3C6LB 4PRIE 5JW5B 5E9DA 2FECI 3BDBA 3WEXA 1EO8L 5I1GH 4G9FB 3LQAL 3BWAA 4RMWA 4L8SB 4NN6B 5LAXA 2JJVA 3OSKA 1NGPH 3TO2B 1QHPA 3WD5L 1B3JA 1BVKB 2DLFH 3B2VH 3BGMB 3D25A 3QYCA 4ORGB 5GRZA 1AD0B 1NANH 5FUCC 3EJYD 3SCMA 1P4IH 4WHCA 1INEH 4J2XA 4KI1A 4KJYB 1UG9A 4PJBF 5I1GL 4I13B 4LDEB 3I6GA 4JM2C 2OTUB 4QRSB 1I3GL 2OTWA 1X7QB 4X98A 4W4NA 4LCIH 4G6FD 1CDBA 2DLFL 3DYOA 1IAKB 4PY8J 3RY6C 4IOIA 3H6JA 3S35H 1OF2A 2GK0A 5D6CA 5IEKB 1KIPA 4JZOB 3N0PB 2G5RA 3ARGC 3V6OA 3ZHLA 3QG6B 4RMUA 1T03L 3S88H 3KYKH 4LCIL 5C0CE 2E6QA 1ZLVH 4AZ8A 2JB5H 3U30C 5B4MC 2XPGB 3S35L 4LDLB 2ZUWA 3VXME 4RFNC 3L5HA 2EIBA 3DX7B 5GPRA 4EKXA 1PKOA 3KYKL 1T1WB 3C5SA 3LKSA 3W5NA 3IDGB 3QEUB 3HRPA 2JB5L 4JFXA 1QBBA 3INUH 2XT1B 1AXIB 1BFTA 2GQHA 4M43H 4RGNE 1OGAB 3KDMA 1A0QH 1KCUH 1QA9B 1KBGL 4U7MA 3VFVB 4AEEA 4LHUG 5H35B 4HIIB 4D0DA 4WGWB 1FNFA 3QA3A 5IQ7H 3INUL 4S0TD 5E56A 4OGXL 4HS3B 3O3AA 4RNRB 3O2DA 5EPMB 4MD0B 5SV4A 4EJ1C 3SE3A 1KCUL 4E0RA 1ZA3B 4NNYA 1I85A 1FFPB 4YAQA 2EH8H 5D5MB 1S5IH 4Z95H 2EYTB 3MV7A 5HGHB 1VADB 3HR6A 5IQ7L 5TE6H 1CXEA 4Y4FC 5FYLH 4ZUUA 3H7BB 2DRUA 2VLKE 4KROD 3UX9B 1MY7A 1OTSD 4FQXD 1CXLA 3TV3L 2L4OA 1KJ2H 2AV1B 2BCKB 2B20A 2EH8L 1S5IL 2MPAH 2LU4A 5DR5H 4G80A 5FYLL 4DVRL 3VWJA 4P2OA 2J7LA 4N1CA 2ITCB 1KB5A 3RWIA 4P49A 1GIGH 4HCRH 4PRHE 4L3EA 4AM0B 1KJ2L 1MFDH 3ROLB 1RUPL 3ROOB 2MPAL 1FNEB 3OB0H 3RWGA 1D5IH 2J12B 5C07D 5DJ2A 3L1OH 1U8IA 2VXVH 4XB8A 2DM7A 3SEPA 1HH9A 3RPKA 2NY4D 3ABZA 1QEWB 3DXAE 3T3PF 1GIGL 1KUMA 4HCRL 3ZKMC 3WIHA 3EOYG 4U1JA 5HGBB 3IFNH 1SJEA 4F8TA 1H9VA 4C56E 2EDKA 1D5IL 2NR6C 2IQ9H 2HFGL 2EDJA 2VXVL 5FKPA 4HMCA 4MQSB 3QCTH 2DLEA 2FLBT 5GSRB 3IFNL 4KJPD 4ETYA 2EXYD 2Z8VC 3QXWA 2CR3A 3C09C 3PIQA 1OT1A 2AV7B 2IQ9L 2LE9A 1FGVH 3B5GA 1S9XB 2UUDK 2B2XL 3NPZB 1QP1A 4Y5YB 3LQZA 4WNQB 3PWJA 4MX7B 4HKBA 4WTZG 5ILTH 4B7IA 2DKUA 3MFGB 1N59A 2COQA 3UZQA 3NACH 1FGVL 5D7KD 1JF5A 1PKQE 1S8DB 2DQDH 2IMNA 4L9DA 4PJAA 5EBGA 3T77B 2AP2A 5C1MB 3L3JB 5ILTL 5DD1L 4APQD 4M61A 4FA8A 4MNGA 5I2IB 3C60D 3MRFA 2VL4A 4PJFF 5ADOH 1NCUA 1C7SA 5D2NA 3V79C 3WUWB 2DQDL 5E0QA 2JIXD 4ZPVB 5GISH 1X5KA 3QDGA 3EJZC 2AEPL 3BDXA 3CJJA 5EU4B 3PQYB 1SEBB 5ADOL 4YFEA 4U1GB 1NMCB 4JREB 4J3UA 4ZFOA 5SWZA 4MA8H 4P5KB 3BGFC 2VH5H 1KB9J 4H25A 3QEQA 1G0YR 4P2RE 2GTWA 3EOAB 1OAKH 4P5MA 3LKPA 4OZGA 5F7EH 3O8XD 1KN2H 2P8PB 1T5XA 1AGEA 3IKKA 2P46B 5LGHL 1HCFX 1HN1A 3B9AA 4Y16A 4DGYL 5EN2A 2VH5L 3C5ZD 3T0EE 2QADC 2A83A 1OAKL 2BNUA 5BS0D 4EUPH 1P6FA 5F7EL 1DQQA 3OKDA 1A9EA 3CFEA 1KN2L 2YRPA 4Q9BA 4I9WD 2UWEB 2AQ2A