1UENA

Solution structure of the third fibronectin iii domain of human kiaa0343 protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
125
structure length
125
Chain Sequence
GSSGSSGHSGEDLPMVAPGNVRVNVVNSTLAEVHWDPVPLKSIRGHLQGYRIYYWKTQSSSKRNRRHIEKKILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords KIAA0343 protein
publication title Solution Structure of The Third Fibronectin III Domain of Human KIAA0343 Protein
rcsb
source organism Homo sapiens
total genus 17
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uenA00
4FQ2L 4Z5RA 4BZ2L 4GBXB 3TO4C 4M48L 4HGWA 4P5TB 1I75A 1UENA 3RNQA 3P3YA 1KOAA 4QY8B 2P4AB 1G7MB 5EO0B 1V3JA 1YDPA 1YEJL 3RWDB 5EZJB 5DZNA 2HFFA 1DLFH 5FYLE 5KSBF 3F6LA 3MRNB 1HEZB 5SWZB 1G1YA 2PW2B 3MRQA 2WUBH 1XGPA 2VERN 1C7SA 4K3GA 4KKBC 2FBJH 3X13B 4EUPH 3AY4A 5HGAA 1OW0C 3L5IA 3QCVL 4YAQA 3JV4B 2GW5A 4WUUE 3ARFA 4YZFE 5B39A 2Y06H 3MOAL 4CN4A 3CLFH 2YPKA 5A16A 3OXSA 1DBAH 2MKLC 5DR5H 4HCRH 1PZUB 4WEBL 1AO7D 1RUQL 2ADJB 3HUJA 2P8LA 3G9VA 1R3HA 5L8LB 4HAGA 2DQHH 3L3DA 3WIFB 3VD9A 5FA4B 3VFSB 2B1AH 4EIZC 4OF5A 4JRYA 4PJEE 4YHLH 1P69B 3FQRB 1S7SA 1JGEA 3LEVH 2WANA 4MAYB 1DL7H 4LHUD 4BQ8A 5T33L 4N1EA 4P3CL 4ESKA 5LWYL 3QXWA 1I1CA 3NAAL 4JFPB 2Q3AA 5EZOH 1HYSD 4PBWD 4R26L 1KPRB 4XMKL 3SE3C 5CLWA 3U2SB 1TFHA 1K2DA 1B9ZA 1TQCC 2Q7NA 4R96A 1JHTA 3CU7A 3LKSA 3MRDB 2LU3A 3MV9A 5JPMA 1EEYB 3MLSL 4J8RB 4NRXB 4AIXA 2L7JA 4OUUB 3HKFA 3IDNB 1A2YA 1DUZA 1JGDB 3CXHK 4I48A 4MXQD 5ADPH 2WIIA 3BT2H 1IQDB 1OTSC 3MACL 3WS3B 4WFGE 5BCAA 1KN2H 3O9WD 5GRZA 3BPLB 1OGAA 4XNUL 4OCWH 4HULB 3BDBA 1SVZA 1QHOA 3DUHA 2C3HA 5FDWA 4L4VA 5BJTA 1X7QB 4EXPX 3E2HB 2QL1A 1X3DA 3RPIB 3SBWC 2VXQH 2VLRE 4JFQB 2NPLX 3IETA 3O4LB 4LGPB 2ERJC 1I1AB 1KC5L 3WL9A 3HS0B 3MJ9H 1AY1H 5EA0H 1EO7A 3G5YB 5F1IA 3MV11 4ZMAT 1KJ3H 2CKBH 4WEUD 1TXKA 2DQFA 3MTRA 3VXSA 2GY7B 1T2JA 1KJ2A 1UH4A 5KOMC 2UYLB 5FKAB 1DDHA 2Z9TA 1I7RA 3UDWC 5F7EL 1G6RH 1P7KB 1BZ7A 3HUJE 3CXDL 1MCQA 2VDQH 3VFMB 5GHWH 5I1JL 3FB5B 5IB4A 3S5LG 3H9ZA 2VDKH 1BBDH 1UA6L 4Q0XH 5B4MC 4LSPL 4P23B 1R3IH 2X2YA 2W91A 5E2WH 1QEWA 4TUOB 2AQ3A 1XFPA 3NFNA 4OKVA 5D1XA 2VAJA 1KGCE 4RSVA 4JEGB 1NFIB 1RK1B 2B1HL 4W6YB 1RMFL 3OB0H 4K55A 4PR5B 5AG8A 5GGQH 1MJ7L 5TDNA 4P2CG 2XYCA 3MGTA 5FHAL 1TMCB 2JIXB 3U46B 4XAWH 5C7XL 1RUAL 4GRLB 5AZ2H 3MV9E 1XGTA 3BI9X 2XACC 3LKPA 1FQ9C 1BD2B 1URLA 1TPXC 5JA9A 3MOBH 1FFNA 2E9BA 3KXFE 1YMMA 4QHNB 4YR6B 1EGJL 1MFBH 2X9XA 3PWNA 3BKYH 4DGIL 4XX1E 43CAA 1ETZA 2UZIL 4I13B 4P5MA 1GSMA 3RWFB 1IT9L 1OGAE 1NGZB 3FCTB 2VKXA 5D1ZB 5C0CE 1JNHA 4NP4H 3MNWB 4HWNA 1MCEA 1UWXK 3IJHA 3LKRA 2VYRE 3BP7A 3DV4B 4LPTA 4HXBL 4NQXB 4LLQA 3ALWA 4X9BA 2LV4A 4P2QE 4KAQL 2GITA 1W0WA 3AS0A 4FP8L 3VXSE 3SGKC 1JNLH 2YSSA 4ZDHB 2EDEA 3U1SL 5HHXH 1RY7B 2VMFA 1Q0XL 3H42L 4XCEA 3EDFA 2VE6B 4GMTL 3S34L 4Y1AA 1F3DJ 2NY3C 3GSOB 3P40A 5HBBA 3QWOA 3TIEB 5BS0B 4N5ED 2E7MA 2J88H 4XGZA 5C09B 3KR3L 1FC1A 2DD8H 4MWFA 3MLRL 2ID5A 1K85A 3SCMC 1ONQB 1U93A 4N9GA 4BSJA 4MB4A 3RY6C 1AI1H 3BAEH 1GC1L 4N8VB 4OLWL 3MBEA 3O8XD 5DURD 1D6EB 2X89D 4ONHA 3HR5A 5EU7E 4DJMA 3TBWB 3KAAA 1UWGH 4X6EB 2NQCA 2NR6C 4H0HB 2DM7A 1JZ3A 3BJLA 4UU9A 3CK0H 1EEZA 1T5WB 4M3JA 4F7EB 4XCFL 1HXYA 5D71H 1MELA 3K0WA 2VWEE 2XTJC 1VACB 3RTQC 4UQ3A 2PTTB 2FB4L 5DMIH 1EXUB 4JG0L 2PTUA 4JR9H 3DXAD 3SKOA 5F72S 3S35L 4FA8A 5HYSB 2ICWA 5GJTH 3SDDB 3QG6B 2B20A 1AKJD 3MFFA 4ZOCA 1HH6A 5B3JE 4M6NH 3DV6A 1HINH 5ICZA 3MCKA 4X4YA 2D2OA 1C8PA 4IOFD 1VB9A 4A6YH 3QFDB 4JO1L 4KY1H 2DJ4A 5CD5D 1N8ZA 2XWBB 3NIDE 1JK8B 3HA0A 2R2HB 3DROA 5HHQA 1W72H 2R1YA 4OZHB 1TVDA 4XMPL 5EU6E 1T22B 2EKJA 4PRNB 3X3FL 4CW1A 1A6TB 1JE6A 4HUUA 4Y1AE 1K8IB 3BWAB 3SPVA 3OTTA 1KB5A 4QRPB 2W9LA 5IW1B 3D0LB 1EJOH 1HNGA 3K7UA 4PRHB 3LS5H 4KKNA 1VEMA 1R5IA 2R2EA 4UIMA 5EZIL 1JPFA 4ZFFA 4U49A 1GAFL 2EECA 1M05B 5ALCL 1TQBC 1T20A 5FUCC 1MCLA 1N64H 4HZAA 1KCSH 1N3NB 4NSKB 1EHLH 1A0QH 1LDPL 1UH3A 4HKXA 1A1MA 1VHPA 3Q3GA 2BRRL 2P47B 1FVDB 4RCAA 4WW2B 4LVOB 1UXSA 4EI6A 3AROA 4GLRH 5FYLL 1OGTB 3QO0B 4OD2A 5IB1B 3S9DB 4NNXA 3GSRA 3F5WB 3NCJH 1ZTXL 2J2ZA 4RAVA 1KV3A 2JB5H 2Q20A 3RI5K 4Z7NF 1QZ1A 4X4ZA 2HT4C 4Y5YB 3D85B 4Y2OA 5E9DA 4TPRH 3BFOA 3L3HB 4C83A 4PUBL 2HJLB 3PL6B 5F3BB 1CXHA 5E70A 1AFVL 3I9GL 1GZPA 5C07A 1U8LB 3IKCB 4XNQB 1BLNB 3G6JE 3W39B 4YQXL 2WLZA 3I3EA 5JZ7D 3B2VH 5EOTA 1MIEH 1G6VK 4EDXA 3KLAB 1I4FA 4HK0B 4J3XA 3VWJC 1HSAB 3EYOB 3BKJL 4NCC1 4P9HL 5ID1A 1UM5L 2Q87A 3PWPD 3V4UL 3ESUF 5ANMA 3U7AA 4R4BA 2HRPH 5GXBB 4TUJA 1MH5A 3ARTA 5T3XD 5J6HA 1A6AB 2KQMA 1S78D 3VXNB 2R8SL 1JF1A 3OHXB 3PGCA 1EJ6A 4L1DA 4RQQA 5I8OH 3EFDL 4KRPC 2HJFB 3TN0D 1KYOJ 4XP5L 4PG9A 2WMPA 2BSRA 1V7NH 3T1FB 3S7GA 4IJ3C 3KPRB 3L7FA 2DLFH 1OWWA 4HLZG 3FT4A 1P4IL 1X4YA 2AABL 4OCNC 2Z31C 4LNRA 4LAJH 4OFKA 5A3IC 1UJ3C 2OMBA 3S35X 3MBXL 4WI4A 1T1WA 2B2XH 4XC3L 1IFHH 3F65A 5HGBB 2ZOLA 4OBRA 1EK3A 3ARUA 4Q9RH 4WNQB 3TFKC 3AREA 4LCWD 3QPQD 4PTTB 4KMTL 5DJ0A 2UV3A 2VN7A 3NFSL 4IMKA 1QVOB 4JFZH 3UROR 5CJOH 3MV8D 1H8NA 4LF3A 4JM2C 2VQ1B 3OKMA 1XIWC 2RR3A 2PCPB 5GS0L 4ONFL 4KJQD 3MLWH 5IBTL 3C09B 1OP9A 1YYLL 4MQXC 1X4ZA 1NAKH 3JTSB 3GKWL 4TUKL 4GAGL 1LQSR 1CDIA 2G60L 2DN7A 1HKFA 1NEZG 4C55A 5KSBB 3QUYC 1N5AB 1AIFB 2OQJA 5JXAH 1P6AB 4HDIA 5D7JC 4MDIA 1QFWH 1FC2D 4HS3B 1GGBL 3K4ZA 2GTWB 4RAUB 1D6VH 4DZ8A 2NX5A 4TTDD 3GI9H 4EI5A 4X83A 1FCCA 4M6MH 5ANME 4OZIE 4YWGL 3JVGA 3QEUA 1NBVH 3U0WH 4OZGA 3GZKA 1ZLUK 2G75A 3HNSH 2R69H 2C7UB 2KPNA 3P9WB 4GQPH 1BEYL 1LP9E 5KVDL 2NW3A 4XT1C 1A22B 2QQKL 1T3FB 4JZJC 3FAWA 4OD3L 3LN4B 1KCVL 4GXVH 2GEEA 4HUWA 4X98B 5CEZH 1HQ4A 4DTGH 5IFHH 2ERJB 1B3JA 3P0YH 2DAVA 5EO1B 5EIVA 5EPMB 2BSSA 3QIBA 5CP3A 3QHZL 3D3VA 3RX7A 3DSNA 3PQYA 5D7IF 1K6QL 4OFYD 5IMOA 3WSQH 1M4KA 1JYVA 5C2UB 4XVTH 3D5OF 4Z7QF 1CDGA 4F7MB 4CN6A 5DHVA 2NYYD 1LO4L 5HI5C 2EDXA 2YPLB 4LKXB 3T0XA 4NO0B 3MZGB 5FUZL 1MF2H 5HHPB 1RJZA 3GGWB 2LVEA 3S88L 4NBXB 4RMTA 1DQLH 1HIML 3EUUA 5IJKC 1ZAGA 4GKZB 1CDHA 1SMAA 1ZT4A 4LEOB 4MCZB 4NRZB 1CQYA 3O3EB 4JY4A 1L4IA 1K4CA 2HH0H 2VLLB 2RGSA 3HHRB 5JMOC 5IHUH 4LFHD 3L3IA 4OLVL 3VJ6B 5IFAH 3E1F1 2JK5A 1A7OL 3LKOB 4JRXD 1BWWA 1OSZA 1TPXB 5E7BA 1IC4H 3ZHDA 1TIUA 2DWEB 5C0RL 4U1JA 4N8PA 3CFEA 1FNHA 2F5AH 3ECBA 3QIWC 4P5TD 3T1WA 1ZT1B 3KPLA 3GMPB 3F58L 2DQUH 5IK3A 4TYUA 2W9DH 1FNGB 3GUTB 3DXAE 3ZZ1A 4MB5A 3QUXB 1LEGA 3QDMD 3B9AA 5CMAA 5A2LH 3TT1L 2C4XA 4TNWF 5FECB 5SWZD 4WU5B 3ILPB 5DFVD 5IW3A 1J88A 1LNUB 5BO1H 3BD5A 2W65B 3MODH 4XPFH 1P53A 5F1NA 4N0RA 3SQOL 3L3JA 4NKOB 4UMGA 4UDTB 4YEFA 4HWUA 4X7SH 4ZFOB 2X41A 4XBEH 1U95A 4X5LA 3VH8G 5EIIB 1KULA 2H26A 4NRYB 4JKLA 2MOVA 2C3XA 3MNZA 2GTZB 1H5BC 4LQFL 5FF6B 1AJ7H 2H6PB 4NZUH 4K2UL 3FT3A 2V7HA 3VFOA 1RVFH 3CVIL 1JMXA 3FFCA 1AXSB 5FDYA 5GRJL 1UM6L 1WISA 5FYJH 4MAYD 1FFOA 3UJIL 1KB9J 5JW5B 4OSUL 3RL1A 5DO2D 1NAMB 3C6LD 3KLDA 2NXZD 3ULUE 3TYGH 1DUYB 2C1PB 4BUGA 5GRUH 2DQEH 2P48B 4U1IA 3QQ9C 4PP2B 3GB7B 1ED3A 5C0NC 3KPSA 1NAMH 2GJJA 5T1DH 3ES6B 4XPAH 3ARDB 3U9PL 4DEPC 3BVNB 2ORBH 5D2LB 5TDOB 1D5MA 3LZFH 5I19L 5DJZB 1MCWW 1YECH 3KWWB 4Z95L 2NY1B 4LLUB 2XTJB 4QOKA 4RFOH 4WY7L 1R0AH 5AUMB 4ZSOB 1CWVA 4F3FB 3GI8L 3BHBB 3QPXL 5F44A 5GRVL 2OMNA 1FN4A 1MQKH 2VLKB 1EVTC 4JANB 5H35A 1NCBL 3H9SA 1RZ7H 1X5KA 1F4XH 1OT2A 1RZIA 4DVRH 4P4KC 2P24B 5KSUB 1IGFL 4NKQB 2J6EA 3L5WA 2YR3A 4LSQH 3B9VA 4X7TA 1UB6B 4LLVA 4HV8A 4AEFA 3O4LD 2VXUL 2IG2H 4GAYA 5BV7C 1I1AD 2AEWA 3SGEI 1C5BL 2V9TA 1FYHB 3O3AB 3RVXD 4BSVB 1RZGB 2BVUA 4OZFB 2F8VA 1J1PL 4UT9H 3UYOD 5C8JB 2AGJL 2DQCL 3VE0A 4DQOH 3B9KA 1IAMA 1F4AA 5TE4H 5GS2H 5HYJE 1QRNA 4PJAB 3FFCE 2FYYA 5T1MA 2YBRB 4S0SD 3EYUL 1FZMB 4P23D 4PJXE 3RVTC 1OLZA 4FQJH 4X7FC 2FL5A 2ZOKB 1FFQA 1KEGH 5C08B 3EO9L 2FJFB 4KQ4H 3C60D 3LDBC 4QRUA 4XCCH 3S8WA 3QJHB 3VG9B 1S3KL 1NC4B 1NFDE 1QR1B 3PHQB 3MJ8B 3CSYA 3KHQA 5EIQA 4ZAKB 4BFIA 5K9JL 3VFVB 1X5HA 1B6UA 3MLYH 4KHXL 3B5HA 1MUJA 2VO5A 3GSVA 4M61A 1RZJC 3ZE2F 1BD2D 3I6GB 1DQJB 5H37G 2KZWA 5CHNA 2OZ4A 3SO3C 1MHPH 2D7MA 4X6DF 3MV8E 1MSPA 1YN6A 1V7MH 4GKSA 2IH3A 2EYSA 4F33A 2DBLL 4X9FA 1QSEA 4PJ7F 3P4OA 5DD3L 3RP1A 2AXJA 4MCYA 5D1ZD 3VRIA 2V2TB 1CG9A 1KJMA 5EWIH 4C56D 1MCBA 2BVOB 1PQZA 4BSWA 2AJZB 1IC7H 3VWJB 4HJJL 4G7VL 2BHYA 5IJVB 3MFGB 3L6FB 1SJHB 1HXMB 5IIEA 5LQBL 3KYKL 2YC1B 4WV1A 2D0HA 3N9GH 5DC9B 2HT3D 4P46B 2NCMA 3TC9A 3VMPA 1GPOH 4JZNB 4PJCB 1P7HL 2YEZA 4Y4KB 1QRNE 3ZT6A 1N5YL 1MJJB 3QWQB 5BS0D 4EUPA 1T1XB 1XF2A 3IU4L 1AP2B 1HNFA 1OVZA 5HGHA 2VZOA 4HFWA 1CE1H 1H3TA 1E6OH 1UZ8B 3DBXB 3JXAA 4G6ML 4JFHE 2X4QB 1I1FA 2HWZL 4HCRA 1MCDA 4OLZL 2Z31B 1YQVH 5M7QA 4MQSB 4F7TB 1N4XL 1T03L 1TTUA 1IGJB 2OJEA 3BN9C 1R6VA 1VFMA 2D7TH 3WHXA 1I9RL 1NBYA 4PB0H 1OWRM 1C16A 1MAKA 3CC5B 1U3HC 2MCPL 1G9EA 4XB7A 5JW3H 1WQVT 5C71A 1ZEAL 3CFJA 1F4YH 1LVEA 1CBVH 1XIWB 1G7LB 3QUKB 3ZDXF 4NCC2 4JQXC 2E6QA 3MLZL 4S2SB 2QEJA 1GZQA 3SDDD 5L9DH 2ICEA 2CDFA 3RIFF 3HFML 4HKZA 5IG7B 1L7TH 4YO0A 5F71A 3MRDA 3D6GA 1PKQA 4XPGH 4MNGA 1CLOH 3AAZB 4JRXE 5E8PA 5C70A 3LH2H 5GZOC 1DBKL 1FZKB 3G08A 4HPYH 1IAKA 1FSKC 5JHLL 2A73B 2BNRA 3GMNB 4NQVB 4RX4D 4PP1C 1R24B 2J8UA 4B41A 4M5ZH 1CS6A 3EJJX 1CFBA 4KJPC 3BGMB 4WO4C 4MJ4A 2H8PA 4D9QD 2Z35A 3RUGA 4UB0H 3HZVA 2Y23A 1A4KA 4MNQA 3KYOA 1NCNA 3NPSC 4U1NA 4YC2C 3EFFA 2DIBA 1KLUA 4QRPD 1QPXA 3H3BC 1FV1A 2CK2A 3MJ9A 3O3DA 3IT8D 1MI5A 2AV7A 4BYHA 5KW9H 2CKBA 1J5OL 5KVGH 4M8VA 1BQLH 1JRHL 5F9OL 4DOHB 1FO0B 1NUDA 4PGZA 5DJXA 4J4PD 3TBSA 1HHIA 2R0LH 3HR6A 3HAEB 1G6RA 4KVNH 2IF7A 3HZYA 3QNYB 4UT6H 1YEFH 1KIPA 3EKCA 1FO0H 4BM7A 2D4DA 3A67H 1NDMA 4NO2A 1IGYB 3EOAB 1UM4L 5EUKA 5LAXA 1A14H 2P7TA 3FB7A 5KVMC 1BZ9A 4HIIB 3LSOB 2H3NB 4UNUA 1MRFH 1VDGA 4PJIF 1YNKH 4PJ5A 3SDCC 4PJHA 3D85D 5BW7C 4G6FD 3HC4H 4FQQA 5IMKA 5ERWA 3ALXA 4GKOA 1TCRB 2K7QA 1IGTB 8FABB 4KPHH 3ROOA 4OF0A 4ZUVA 2EDOA 2ZCKH 3M1BB 2UVFA 4M7LH 4NQDA 5EC1A 3S36L 2JIXA 1PKOA 5JW4N 3IS0X 4G8GA 3MREB 1IKFL 5GJSL 2ZNXA 3BIAX 4IMLA 4Z7VB 3N1QC 3VXOA 3OKLB 2BMKA 4NKIL 2ADGB 3R1GH 2DWDA 1VGKB 1GGTA 3T77B 1U3ZA 3FO9A 5ICXB 1T6WA 5DD6B 5E8DH 3DVIA 5EC2A 3DRQB 4KRMB 4I0PC 4ZXBA 4YBHA 3EOTL 2DTML 2ATKB 5IF0A 3BZFA 1NSNH 4MA1C 3MCLH 4MXWL 1MI5E 3A6BL 2R9HC 3D2UA 2ZUWA 1U8NA 3SDXF 3LS4H 1JUFB 3O4LE 4FXKA 5IVXA 3STZB 3VRJA 2EYRB 2Z8RA 5I1CH 5HJ3B 4FFYL 4PRPA 3KPRD 4DKEL 1CL7I 4PJ9C 1NMBH 3JWOC 5ILTH 4AG4H 5JUEL 2MHAB 4ZDHA 3P0VH 1CD1A 3UO1L 3VRLF 2DM2A 5I1AB 4P2RA 1G7QB 4TULL 1H5BB 1VSCA 4FQIL 3O3UN 2UWEA 2H1PL 3L9RB 4JG1L 3W0WA 3PV6B 3PWUB 3IDJB 3BGFC 3RGVA 2XXMB 5E5UB 4PJHE 2NY4D 4R0LC 2X70B 3ZT7A 3QULA 4KTEL 4PRAA 5C0BA 3VXQB 3GBMH 1SJEB 3HZMA 3U0TA 3P77A 4RFNB 5DS8B 1QBBA 2BERA 5JPNB 2GT9A 3P4NB 3A6CH 3L7EB 4MXVE 4XI5C 5I74B 1QFUH 1U41A 2KZ1B 1KLGA 5EORH 4Z77A 3AGVA 5LGHH 3IFOB 2AJYL 3VFGL 1RHHB 4H8WC 1NJ9B 2HTLD 4G8GE 5DDHB 2FIKA 1BD2E 2ZSVA 4LCYB 1MREH 3BESR 4L4TA 4PD4J 4GS7B 4M5YH 4XNZB 5T3ZD 1T80A 5BMFL 3O41B 4IOIA 5FGRA 4K7FA 2VDPH 4KVCH 4XNYH 3ULVC 2BDNL 5F1KC 2EDNA 1YEIL 4A6YA 5C0EB 3DYMA 4WFEE 4P4KB 5K9KB 3RWEB 5CZKA 1JTPA 5MHSD 2GYSA 1W72A 1QQDA 3THMH 4HZLB 5IVXE 5BV7B 3RNKB 4EN3C 2OL3H 4OFDA 1A1OB 3RL2A 3E0GA 1CICC 3O2WH 3DGGA 2PYEA 3BEWA 4NHCH 1BFTA 5F6HI 2VXSL 4CRPA 5BV7H 4PJBF 5ID0A 1HWHB 3W11D 4UBDD 1RUPL 3I50L 1AD9A 1Z5LA 2FX7L 5GISL 3VWKA 1YEKH 5BS0E 2JELH 1U8JB 5KVEH 1RULH 1GCFA 4KRNA 5C09E 5T5FL 1Q38A 4HW6A 4LSVH 1F3DH 3SDYL 2ZG2A 4LNVA 2XKSA 1E6JH 2LE9A 3GSNL 4B50A 5FHBH 4D9RD 2IMMA 2V5TA 3VDAA 4FNLL 3GJFK 2K1MA 3C8KB 4RBPH 5DEGB 3DTXA 4OBSA 2D0GA 3HCVA 3RZCB 4J23A 4P49A 2AJUH 4YHOH 3MX0A 5FGSA 5KS9F 5INCB 3IS1X 4NFCA 3FQXA 4HKJB 3QQ3A 3QIUD 5D5MF 1Q1JL 3T0WA 2Q3ZA 3SO3B 1K4DA 3L5XL 1YN7A 3GBLA 2YWZA 2FX8H 3RJDA 1RZJH 2IH1B 1WT5A 4HF5H 3C6SA 4JKPL 5ESAA 3QHTC 1TZIB 1KPVB 4ZUUB 1Q72L 1UGNA 2FSEA 3IFLL 3QUXD 1LK2B 5H2BA 3OPZH 4KK6C 1A6UL 5T1LA 4PRIB 5DUPH 2V6HA 2XG5A 3GK8L 5C0AB 2IADA 4HMEA 1RJYB 3QCTL 1KNOB 4GQ9H 4OF8A 1AC6A 3WV0A 3DPBA 3BDYH 3ARGC 2W0FA 1PVHA 4JVPA 4OZHE 5DJAA 5SWSA 3TO4A 3G6AB 3NZHL 4I5BB 3LKQA 5DD5H 2R0ZH 4RGNB 4X5XA 4HK3J 3LQZA 1RU9H 4J7RA 4WWKC 1A6AA 2R2BB 4FQHA 4YHKH 4PRHE 3FFDA 4JREC 4DUWA 1WBYA 4WU7A 3VFPA 4CVXB 3ZDYE 2A9ML 2W0LA 5E2TH 4F8TA 1KG0B 3JV6B 3JSSA 5F6IB 2HVJA 5FYKH 1DN2A 3MROA 4Y4HA 1L0XA 1OW0A 1Q9OB 1D5BA 5F88A 2OS7A 1YNTA 4N0CC 5HD8C 4XPTH 3RX5A 4PJ8A 1YPZB 4RISH 4KV5F 2HFTA 5DVKA 5F93C 3ZDZF 1ZGLP 4Y5XC 4W6XB 3MRFB 1WSST 3V6ZA 1MFDH 3C8DA 5EUOA 3FMGH 3PWVB 3ARDD 4IDJL 1FVEA 4WRLA 4ZD3H 2JTDA 1U3HB 3CLFL 4Z0XB 4W70A 2NY1D 1SM3L 2XTJD 4XTRD 3ISWA 2WWMC 2BY2A 4QCIA 4PJDB 4YJZL 2OR7A 3CFDA 3RDTC 5CFHA 1OAZL 4ODWB 3X11B 3C5JB 3SE3A 3HI6L 4Y19D 4GH7B 4JPVL 1T66D 1UACH 2FD6H 3QUMH 1U8HA 5JR1L 1OAYL 2IFFL 2Q6WA 4NQEB 1BAFH 1KSRA 1N0LA 1NPUA 3DX8A 3RWJA 1FJ1B 1WC7A 1YMHB 5DMJB 2Z0BA 3T4AA 2PR4H 4Y16A 4QRRA 1FSKB 3P9MB 1PSKL 1GGCH 4OJFL 5EBMA 4P2YA 4WO4B 4Z78A 5SWSE 2A1WH 4AMKL 3MO1A 4UINH 4YXLH 5F7UA 4CU6A 3RI5F 1NMCC 2NZ9C 3DUSB 1WF5A 3EHBC 1G7IA 3PUCA 3K2MC 3QG7L 3NPSB 1V05A 3MA7B 4PTUA 2GJZB 4AIZB 2E8ZA 5GSVB 3S3PA 4YGAB 3U9UB 2WWKT 1INQB 3KJ4C 2P46B 5ENWA 3BPNC 3BT2L 1M7IB 3FHQA 3QUZB 5F7HA 4WI9A 5J1AB 1FE8H 2FX9L 3DSFL 1NL0L 1EAPA 1IAII 4OCWL 2YA2A 1JPGB 4BQCA 2B4CL 1E27B 1NC4D 4E0RA 4ETYA 5AZEL 5KSAA 4YDKH 1YNLL 4XXDA 1RZ8B 2XZAH 4ZAKD 2AEPH 4OGZA 3ARVA 5DQJB 2XKUA 4ENEC 2Y72A 4KTYA 3QNZB 2Y4SA 4GW4A 1KJ3L 1AO7A 3OG6B 5E5MA 5HDLA 1V3MA 3BEVA 4NWTH 1Z6JT 3QEQA 5D70L 2R1XB 1G7JB 1T21B 3SOBL 2XI9A 4GRMB 4U3XA 4ZPVA 1WWBX 3B43A 2Z8SA 1JZ2A 2NLJB 4ZS7L 1ZVYA 4X7EC 1DBBL 4DGYL 3CCHB 4GO6B 2CLRB 3EYFB 1R3IL 4X7CC 5DHYB 3T0ED 1BX2B 4JFXB 2A0LD 1WBXA 2XXCB 1A21A 2PW1B 1G9NL 3TVMC 3TZVB 3X12B 4W4OA 1A6VH 1QTYT 1M6OA 2W9EH 4JHBA 1VKXA 9CGTA 1X5XA 3HE7C 5I71B 1T2QH 5D8JH 4L8SC 4G8EB 2QQNL 3K8KA 2VXTH 1KN4L 2XZCH 3RRQA 5T3ZE 5HVWA 3GIVA 3L1OH 1QFPA 2NY6B 4P46D 1DP0A 3ARBC 4IIQB 5HYEA 4LLDA 2C4FT 2MQ3A 5ESQA 2DQIL 5CEZE 1CR9L 3S5LB 2EDDA 2F53A 4MA1B 4Y4KD 1AE6H 1MFEH 3F7VB 4MNHB 5E8EB 4B5EA 2BCKB 4R7DA 3DX9A 3IFPA 2D0FA 3SGEH 4MJ6A 1OAUL 4PJIB 2I07B 4FN0A 1IBGH 4YZFF 3K2UL 1NCCL 2BVPA 1VPOH 5SX5H 2V2WB 3LRGA 5MEQB 4PJ9B 1IEHA 3B3IB 2DLGA 2JJVA 2AI0H 3C5SB 3U36B 1I1YA 3CSGA 1OM3H 2CDGA 4LAQH 4J6RL 1WFOA 5JIKA 3QCUH 5JHDD 1I7UA 3BX7C 3P9LA 4PRBB 4PPTA 2EEAA 5JQ6H 3V6OA 3JWOH 4OF6A 4MLIA 1OTTC 1YYML 5FV1L 4TVSa 4PGEA 4PJEF 3ULSB 1N7ML 2ESVB 3QEQE 4M7JH 2YPLE 3PF2A 2RIKA 1B4JL 3PWJA 4R0LB 1BREA 3IRPX 1XR8B 4E5XB 3QDGA 2XN9D 3LB6C 3SCMA 5E8OB 2CPCA 4CADA 4OGYH 5TQ2H 1H0DA 1BFOB 4LLMA 1NAMA 4P57A 1XIWD 2OR8A 4YPJA 2J8HA 5E7FA 5DYOB 4OQTL 3U6RB 5INDA 4RGMC 3D9AL 3KYMA 1ORSB 3PIQA 1SEBB 3BH9A 1BJ8A 1NCAH 4GG8A 3Q6GH 2I9LA 1ZHLA 3OKOA 5D96C 4JVUA 1SJVA 1ZWIB 1E4XL 3BVNA 2FZ3B 3OR7A 1JYWA 5CZXC 2APTA 5EDXA 5GRXG 4ZTPH 3WJJA 4H8WH 2EH7H 2FR4B 3FZUC 3RTQA 3SE8H 2P8PB 3QEHA 3MV01 4JB9H 3ZTNL 3OB0K 1DLHA 4KHTH 43C9A 2X4TB 3IF1A 1NDGA 5D2NA 2O61B 1CVSC 1FP5A 1S9WA 2A74A 3CGTA 3B83A 3G5XB 1BVKB 1AGFB 2X1OA 2NNAA 2WBJC 4HKBB 3PV7A 4YFLF 1MCCA 1A6ZA 1RIVL 3EJYC 3ULVH 2GK0B 1H8OA 4EUPG 1XGYH 5T5NG 3UC0L 4JR9L 4ZO7A 4EN3B 1ZK9A 1GGYA 1T0NA 5L88H 3EZ8A 1CICB 4XP9H 5F97E 5KAQF 4UV7H 4F7CB 3MRHA 5FA3B 3IFNH 3I02B 3HUJF 5DK2A 4GW5A 2DMCA 3ROLA 3X3GH 2ZUUA 5TDPB 2I26N 3PJSA 5FYJE 1PAMA 4XH2B 5E5RB 3TT3L 1KACB 1LILA 4KRLB 2KL6A 1ZANL 3EYVA 3SJVB 5EBWB 3WFHB 2H41A 3CDGB 2ZOKA 4YLQT 2FATH 2CKNA 1A47A 5EU3A 5F3HB 1CGUA 4UAOC 5MERB 4O9HL 4O51B 5TF0A 4PGBB 3GHEH 3V52H 3UXFA 1YEDA 1U0QA 4YE4H 2O5YH 4Z18A 1JWUB 1N59A 4PB9H 5E2VH 5GGVY 4V1DA 4OLYH 1X6NA 4JY6B 5D2LE 3T4YA 4NGHL 3KPNA 4ONOA 2JLLA 5FK9A 2UUDH 4G43B 2XTJE 4ODVH 1M1SA 3ARFC 4NN6B 4ZSOE 2QQQA 5FO9A 4NBYB 4XMLH 4E41A 2VDML 5HHME 2FBOJ 3PDOB 4JFDB 2VLKE 1LO5B 5GGRB 1N6QH 4Z0BH 4NM8L 4R97C 4N0YL 2VXVH 1FLTX 2BJMH 1B6DA 3VFUA 3QH3A 1VGEH 4WCYH 3WMSA 4OI8A 3MGAA 2Q7YB 4LDOB 1CXFA 1NBZB 4P2OC 1F6AB 4QXUH 2IPUG 4FG6C 1UQSA 2HTKD 3MR9A 1NC2A 1GXEA 1QBLH 3RJQB 1I3GH 3CFKB 2DI8A 2EKSB 2OTUB 4GJTB 4ALAH 2B0SH 3W2DH 1R3JB 3KHOA 3VGAC 2DQGH 3VD4A 1CFQA 4XRCB 5I8KH 5FKPB 2YK1L 4PJAE 3OF6A 4JREB 3EO1A 3N0PB 3W9EA 5E2UL 5J56B 4QTHB 4CBPA 2VKWA 1SQ2N 3FN0L 1KUMA 3S96A 5FUCE 5HDQL 4TSAH 1JWMA 5C08E 1B2WL 2EDTA 5ISZB 4UQ2B 3M17B 4NT6B 2NY2C 4LMQI 1HHGB 2UVEA 4HK3N 5I16B 1HHHA 1UJ3A 5EU4B 2IANB 3IDXL 5J89A 1T1YA 2YUWA 3IGAB 2DLFL 1L9MA 2IAMD 5GZND 3CZFB 3QRGH 3MSPA 2M2DA 3TYFA 4N8CH 1KENH 1MVUB 1N0XH 5DK0B 4IRJB 3OKKA 3HNVL 3LMJL 2PYFA 5DJCA 2EZ0C 2DQTH 4NO3A 3OB8A 5FO7B 3VXMA 3VDCA 1QO3A 4JFEA 4JM2A 2WQ8A 3CMGA 5IUSA 2EIEA 2RCSL 4LL9A 5IW6A 1G1CA 3ARZA 5HGGS 5B3JF 3GMMB 5I1IL 2XTLA 4GRWH 4HJGB 1XMWA 1CK0L 3CXHJ 4W81A 5CEYA 1IILE 2FWOB 4N5UA 4K8RD 3QUYA 1CT8B 1RK0B 3NPZB 3G9AB 4JO3H 5IT2H 3MLWL 3BZEB 4H5SA 1MRDH 5D7JA 5HGDA 3I6KA 4KI1A 1PG7H 4M1DL 1T7YA 3OG4B 1DVFB 2HN7A 1FLRH 1BBJA 5GGSA 1NMCB 1F58L 4LDLB 5JXAL 3PWPA 1FNSL 3ESVF 4LOUC 4CMMA 5A1AA 5SV3A 1S9VB 2VN4A 3LRHA 1QFWL 4HIEB 3V4VL 4PJCE 1YEEH 4U31A 4U1MA 4RMSA 3D87B 5GSRA 5D93B 4JZJA 1P7QD 1F11B 1Z9MA 4PLNC 2RBLA 1NANI 2DDQL 3TN0A 5E6ZA 2NW2A 4X6CA 3U0WL 1UT9A 4CDGC 5CBAA 3CVHB 2H32H 5IR1B 3EO0B 1R5VB 5J9PB 5T3ZL 1P4LA 4XP4H 4F9PA 4WHTB 1WZKA 2YN3A 5HHOA 4K9EC 4NQCB 1C1EL 3OAUH 5DGQA 5CEZL 1C12A 4HWEH 3VXUB 2BHZA 1NEZB 3RZCD 4UDUA 3HI5H 5DI8A 4OV6F 1JL8A 4PS4L 1JHLL 4X80H 1P1ZA 1NGWB 3WE6B 4JN2A 3TEUA 2XFXB 4S1SL 3CAFA 3Q1SL 4WFHD 2VQUA 3B2UD 1ORQA 3RA7H 5IJKA 3GO1L 1BIHA 3ZSTA 4JFEE 3X14B 3REVA 1A3RH 2QKIA 2F54B 2WBWB 3H3KA 3G6JF 3U30B 3U0PB 2FEDD 1T7ZA 3R06B 4PRID 2BK8A 5FXCH 4RNRA 1RJCA 5C0AD 5CGTA 1IM3B 1Y6MR 3TF7C 1YY8A 1LGVA 5JMRA 1ZLWH 4OLUL 3HE7B 4H20L 2F15A 3U7YL 3SKUD 1IC1A 3OR6A 4L8SB 1TZGH 3K8LA 5IFAL 3QIWA 2ADFL 4NN7C 1Q94B 1MJ8H 2X4NB 4JN1L 4RGND 4JLRA 1BQHB 5MEOA 5DZOA 4KZDH 5JO5B 3PABB 3RIAK 2VITA 1KPUB 3NGBC 3HC3H 4P3WA 5AWNL 2M26A 5GIRB 2QR0A 5HDBE 5A2FA 3GNML 4HLJA 2E27L 1J8HD 1ACYH 1KJVA 1CU4H 4JO2H 4DVBB 2BNUB 2W9DL 1CFVH 1D3CA 1QSFB 3LKNB 3IVKA 4ZUTA 5IEHB 4LSSH 4YHML 4NUJA 2CIIA 3LIZL 3S37H 3O0RL 1A6WH 4WHDA 2DQJH 5KZCB 2GFBA 3VFRA 1F3JB 3LD8C 1AD0A 1CDBA 5B38A 3INUH 1WFUA 1H3UA 1CFNB 1XZ0B 3KPQB 1P2CA 2PETA 5DRZB 4XPFL 3C08H 4PG2C 5JORA 3DURA 1ZS8A 4LRNL 1WBZB 4UV4H 1G9MC 2C3VA 3LPGA 3V8CA 4KROC 3Q6FA 1MCWM 5DD0H 3UTTD 3SKJH 3KYAA 1U8PA 2D31A 5J11C 1IEBA 4NUGL 4ZFOL 1JPTL 4LVNC 3F7PC 5I0DA 3TCXA 3VGGA 2H9GA 3H0TA 4HH9B 5DS8A 4HHAA 2KDGA 1TJHH 4HBCL 2Y36H 4U6VL 5HI4C 5BRZA 4R90H 1YC8A 4NQED 4G6AC 5D96B 4P4RA 5A2JH 2JF1A 3UYRH 4BFGA 2HA1A 1FFPA 4ELMB 3TYGL 4WVRA 3SKMA 4Z7VE 1LE5B 2AJXH 1FVCB 3BKCH 1XF4A 1WTGT 3VH8B 4OZIF 4NC1C 4OT1H 4KJPD 1FYTA 4LVHC 4KZEH 1LP9F 1VFOA 2MWCA 3OSKA 2Y1VA 1BHGA 4RFEB 5J57B 1TVBA 3E6FA 3RVWD 4DGVL 4RFOL 4OV5B 3QSKB 2C1OA 3LN5A 3PXHA 4GG6A 1IQWH 3LCYA 3QDMA 2OL3A 3CMOL 3VA2C 1RQ5A 3OX8A 1NGQH 4JKMA 1A9EB 3QUZD 5I17B 1AGCB 4NHUA 2HT2C 2MCG1 4EVNB 2XT1B 3QFJB 5I18L 4MD4A 2Q76B 2Z4QA 4PY8I 3V4PH 1MWAA 5B22A 4B7IA 2I9TA 3AU1A 4QT5B 2AK4A 5KJRH 4PJGB 4YHNA 2YUZA 4C58B 1ULVA 3P11H 3VMNA 4Y2DB 2M1KA 1J87A 5MP6L 1A5FH 1FAIH 4YK4C 1JGUL 4I18B 1ND0B 2EICA 1INEH 1A7RH 3FRUA 2IGFL 3FOMB 2VB5A 1W8NA 5ADOL 4TOYL 5C0GA 1T4KB 3MRPB 1HQRA 3LQAC 3BIBX 4CDHA 1EHNA 1CGVA 3SN6N 4UT9L 3F7YA 1I3RB 5HVGB 5F89B 1F4WL 1OB1A 1T83A 1TCMA 4Z5RB 3RWIA 4HGWB 2Y6SD 1J0KA 4J3VA 3C6LA 1FFRA 4ODXA 4UAOB 1D9KA 1YDPB 4M7ZB 4Z7UA 3EYQC 2HFFB 3LHPL 1FGVL 3FJTA 1BVLA 3TZVD 5L6YH 2CR3A 1WFTA 3MRQB 3DWTA 1XGPB 1PYWA 5AAMA 4RAHA 3CPLA 4O02L 1U42A 4XP6H 1ADQL 3LEYH 1BPVA 4P48A 3VMOA 4QXGL 5HGAB 4U7SA 1TTGA 3HE6A 4H1LG 4YAQB 2C4FU 1OSPH 3ARFB 4HPOL 5B39B 3SE9L 5B3NA 4MAUH 4LPWA 1CGSH 1IGML 3LV3A 2YPKB 4BFEA 5A16B 1YY9D 2CLZA 3OXSB 2NY6D 4IRSD 4I0KA 2J5LC 4GSDH 3EDEA 1FZOA 1QNZL 2HLAA 1RIHL 2FJGA 5ACZA 3KNBA 2P8LB 1C08B 1R3HB 3NCCB 3L3DB 3AREC 4JRYB 1UJTA 1V7ML 3WFCH 1S7SB 1JGEB 2Z8WC 2OSLA 4K3EH 1J0HA 3GDBA 5I8CA 2AK4E 2CGRL 4RGOH 4G6KL 2CUIA 1NH6A 1X6LA 1AQKH 2AAVA 5JW4M 1K2DB 1TJIL 4Y88A 1WIPA 1FGNH 4K7PH 3WXVH 2FGWH 4R96B 4G42A 1OTUD 1JHTB 1IC7L 4KK5C 3VGAB 5MEND 3LKSB 4GW1A 4S1RH 4BFBD 3MV9B 5JPMB 2R2BA 2LU4A 3UBXI 4GAJH 3KVQA 4I48B 1A2YB 1DUZB 5IP4A 4LSTL 1DBJL 1FCGA 1IAIH 4KMQA 2APFA 2W60A 3WNOA 3ULUF 2WIIB 2AXFA 1T5XA 2NY2B 3C60A 1BM3L 5HSFA 3S3JA 1OGAB 3DLQR 1JFQL 4Z7UE 4P59H 2P42B 1F00I 1JHKH 2O5ZH 5FDWB 4XAKD 3WNMA 4L4VB 2E3VA 5BJTB 3RKDC 1Y6NR 3TNNA 3MRIA 3IDMB 4H25A 4JQIL 3IETB 1YQVL 3WL9B 5I30H 5F1IB 3VXTA 1IKNC 4Z0XA 4CAGA 4WFHE 3GMLA 3Q5TA 5DC4B 2DQFB 4XVJL 4TRPL 3VXSB 4P99A 1KJ2B 2D7TL 3F8UB 1EBAA 3QUMA 3WLWD 1I7RB 4ODWA 4FZ8H 1QFOA 2ZCHL 1BZ7B 1XR9A 2OBGA 4BZ1L 1J05A 2FGZA 5IB4B 5GGVL 4Z8FL 1N2RA 1JV5A 4G8FA 2BFVH 1VCAA 4LLWA 3WD5L 1U2HA 2OP4L 5C0AE 1QEWB 3EDDA 4C56A 1GL4B 3NFNB 4OKVB 5D1XB 2VDNL 5GQBA 2VIRA 5D7LD 4QRTA 2H2SD 1A7PL 2DKSA 1X5JA 3H7BA 3IJSA 1Y0LA 3HZKA 5TDNB 3LH2L 4RMWA 3MGTB 1INDH 3S37X 5C9JA 5IGXL 2BVTA 4R8WH 3T2NH 3MXVL 3I2CH 1XGTB 5FYKE 1KCRL 4Y7MA 4HT1H 4PJXF 1A1NA 3F7RA 3LKPB 3VXRD 4M5ZL 1KELH 1RAMA 1QSVA 4LCIL 2AQ1A 3SJVD 1FFNB 3MUJA 4Q74A 3ZE2E 1YMMB 5L0QB 1A4JA 1TJGL 4D3CH 1NFDF 1QFWM 2I24N 2V17L 3PWNB 2B39A 2YXFA 4G5ZL 3V7AE 2IQ9H 4KKAC 43CAB 1ETZB 3FN3A 4P5MB 1GIGH 1YZZA 3O3BA 4DKFL 5DZLA 2ARJA 4FQXD 1YPZE 1UCTA 4NZTH 1TNNA 1JNHB 5F8QC 3DHJA 3V0WL 3IJHB 3LKRB 1M7DB 1FIGL 3EZJB 4KVNL 4LLQB 5HYIA 3HRZA 4UT6L 3V6FA 4QGYA 3HLAA 1I8KA 3I6LD 1FO0L 4FXLA 1PEWA 3SDCA 1DR9A 4K71B 3HG1A 5BW7A 2GITB 1W0WB 1HHKA 4M03A 35C8H 5J6GA 1OARL 1J1OH 3QT2A 4HWBH 4JCMA 2YSSB 4NKDA 4PJDE 5DLMH 3FB6A 1PG7W 4KI5C 4XCEB 3DETC 1VA9A 3CCHA 1REIA 1P5UA 4D0CA 4FTVA 4Y1AB 1JNNL 4RWYL 1BX2A 3CDFA 4KK6D 3QWOB 4DN4L 4YXKH 4XGZB 5DJYB 4NQEE 5DWUL 1IGCH 3TV3H 4XWOC 3WIHL 4R4FL 4MWFB 4APQA 1S7RA 1T7WA 5JOPE 1U93B 3L3OA 4N9GB 3IYLW 4QGTA 4QTIL 5I1LB 1CVRA 4H0IA 2P45B 2R0WL 1AHWC 4M7LL 2F19H 2WK2A 3MBEB 2AS5M 4NN7B 4ORZC 3TJHC 5I73B 4FRWA 4ONHB 2OK0H 3HR5B 2DJSA 4I0PA 1FL6B 1KBGH 3NGBB 4YDLB 3K1DA 3S5LA 4RIRA 1XCQA 4UU9B 2OTWA 4QEGA 3ZYIA 1EEZB 1ZT7A 4MNHA 2XRAH 1DE4A 1HXYB 1MJUH 4OCYL 4XNXL 5IQ9A 4FFZL 1JGVH 1BJ1H 4UQ3B 3WKNA 4OTXH 2R29L 3GSWA 4J4PA 2BVQA 1DQQA 3MCLL 5LBSL 1UCBH 4HWZA 2AV1A 3SKOB 2ICWB 1CZ8H 5IVNA 5EN2A 3EYSL 3MFFB 4KKLD 1ACZA 2LTQC 4NDMA 2IAND 1HH6B 1C5CH 1MIMH 3DV6B 1MRCL 4NN5C 1CFSA 5ICZB 4X4YB 3JV0A 2EYTA 4AG4L 3HMXH 1N8ZB 3NMEA 5DQDH 4IRJD 3HG1E 4LSRL 3PNWA 5TE6H 3DROB 5HHQB 5J11B 1G9MH 2R1YB 3OKEA 4LVNB 4Z7WA 2HG5A 4U6HA 3REWA 3BYTA 2QHRL 2Q8AL 1Z9SA 4XBPA 4J3TA 3QAZC 1CLYH 4HUUB 5ALBL 4FTVE 3LPWA 3P73A 4G8IA 4I4WA 1S7TA 3SPVB 1KB5B 3NCEB 4U7KA 3GBML 1R5IB 2R2EB 4UIMB 4ZFFB 1I85C 1JPFB 5I1EH 5HXMA 3E6HA 1T20B 1SY6H 4YBQD 1DBML 4ERSH 4Y5VC 1NMAL 1OAQL 5I1KL 4HKXB 4G9FA 1A1MB 3Q3GB 3O6FC 1DVFD 1JF5A 3OAYH 1H3VA 2QADB 1KTLA 4LVHB 1UXSB 4EI6B 3IJYA 2NZ9D 4S11A 2GHWB 4OD2B 1GRWA 1A7QH 2Z92A 4M7KL 3V5KA 4NNXB 5GGRY 1LO0H 3Q5YA 3GSRB 4IRZH 4RAVB 8CGTA 4ZS6C 3PGFL 2OJZL 1PLGH 1VFUA 1J1XH 3O6LH 5E9DB 4O2CA 4X9IA 4C83B 5E6IC 1KCUL 3J7HA 2FO1A 3K4AA 2A2QT 3BISA 2VDOH 3SHSA 1OD9A 4HUMB 5L7XH 3FO0L 3CFIC 2AW2A 4NQCD 1GZPB 5C07B 3UMTA 3BW9B 2R4SH 2VUOA 5EH1A 3S98A 1S5IL 4XB8A 3O2WL 4K8RL 5EOTB 2X4UA 4EDXB 2ESVE 4BZYA 4HUKB 1I4FB 5DGRA 5BV7L 3TWCH 4FQ1L 2XZQH 4HC1H 5ID1B 4Z7WE 1LO3L 3LQAH 3MRCA 5ANMB 4R4BB 2VLJD 4HXAL 3M8OL 4TUJB 1MH5B 3V95A 3GM0A 1FRGH 1CFTA 5J6HB 1UB5A 4DWHA 5GPRA 1JF1B 3PGCB 4RQQB 1RD6A 3AMKA 4YNYB 4XP1H 2A9NH 2VH5H 4PG9B 2BSRB 4YHZH 3I75A 4UIKL 1QYGL 4MS8C 3L7FB 5AYUH 5B21A 4AENA 4XPBL 4YHOL 4KGLA 4PY7A 3U7WL 3GRWH 3WKMH 4LNRB 5CILL 4LKCA 4DAGH 1EBPA 2J5LB 1T1WB 3ULVE 1WUNT 5DEFA 4M43L 1YEHH 2ZOLB 4JDTL 4XHQA 3AREB 2BOBA 3C2AH 3R8QA 2EDKA 2HLFC 2E6PA 3UTSA 2HFGL 5DJ0B 1Q9WA 4DW2H 5GGTH 1OF2A 1QSFD 2Q7YA 5JLZA 5ICYA 5D7SL 1V5JA 2XV6B 1LD9B 4LF3B 3OKMB 3OXRA 4W6WB 4KFZC 3ARGA 5K9QI 1EMTL 5IEKA 3CX5K 5C3LD 3AM8C 1RUKH 2ICWJ 2VR4A 4FMKA 4KKCD 2PO6C 1MFCL 4GQ9L 4WWKA 4YXHH 3V7MA 4LARL 2QV2A 4PJHF 1NANH 4HDIB 1RZFH 5CGMA 4MDIB 5DD5L 5JOEA 2F5BL 3RVVD 4HS8L 2YD1A 4DZ8B 3SJVE 2NX5B 2DLHA 2DM4A 3ZKXC 4EI5B 1RU9L 2X6MA 4HG4K 5HYQA 4MXVF 3QDAA 1L7IL 4L29A 3QEUB 4OZGB 2ITDA 3RU8L 2G75B 2EE3A 2VL5A 3UP1A 1A7NL 2NW3B 5HVFB 3DARA 3AS2A 5FYKL 5F21B 3WXWH 4Y5XA 1NCDH 2F74A 5BQ7A 2X7LA 4UNVA 4HUWB 1HQ4B 2EH8L 4S1QH 3FO2A 4H0GA 4YUEH 3DX6A 1MVUA 3FO1A 3QIUA 4OIIL 4X4XA 2BSSB 3QIBB 3FT2A 3IDYC 4XPTL 2D7OA 3D3VB 3MUGA 2A6JA 3FTGA 1M7XA 3PQYB 3RDTA 1Q0YL 3ZE0E 5IMOB 4JFDE 7FABL 4FABH 4ZQKA 1G84A 1DSFH 2W1NA 1U8OA 4PLJD 5DHVB 3E8UL 2AEIT 2CJUH 3GBNL 5IVXF 1RJZB 3ME0A 3C5ZD 5EOQL 3QFJD 1D7FA 1HZHH 1KIRA 5E1HB 1BIIA 4OCSL 2P1YA 1ZT4B 4JFFB 4Y2DD 4HJ0D 4J1UA 1LEIB 4O5LH 4FQCH 1K4CB 5B38G 1HILA 4MVBC 2PXYD 1R3KB 3L3IB 2I60L 4O58L 4UI2A 3QQNA 2H32A 2VZSA 4ZPTA 1MLBA 1OSZB 1SYSA 4UT7L 1IRAY 1RIUH 1VFBA 1WAAE 5DFWH 3NZ8A 4H88H 4U1JB 5C2BH 4OGXH 5I8EA 3CFEB 1EFXA 3WFZA 4U6TA 4JRWA 5ISZE 3ECBB 1D5ZA 4U1HA 5KTEH 5IK3B 3OMZA 2AXGA 2R15A 2BY3A 1LEGB 2WM0A 2O5XH 5CEXA 3JUYA 3BOVA 3ZKMC 3QXTA 4RZCA 5CSGA 3DRTA 1NUFA 4OM0H 4KGJA 1T6VN 2Y7QA 2VLRD 5F1NB 2DYPA 5A40E 3L3JB 5JA8B 4L9LA 4LU5L 2BNQB 5KANG 1DTUA 1NGPL 2QBWA 3PDGA 1U95B 3MUHL 4JPWH 4M9OA 4OKDA 4GRWE 1I9JL 2H26B 1E28A 3ET9F 4NWTL 4F58L 4J12A 2KH2B 5E24E 1HCFX 3MNZB 4WDIA 1FDLH 4P0DA 4FQLH 1FG9C 4B0MM 4Y19A 2C9AA 3H8NA 3FT3B 2V7HB 3VFOB 1RI8A 3U0PA 5LCVL 1OAXH 1H3PH 2X5PA 3FFCB 3Q0HA 4NQSA 3TVMA 3RGVC 4JRYD 5F70A 4NNPL 3SDAC 1FFOB 1HHJA 3VG0L 3RL1B 4OZHF 4OGAD 2DQDH 4KQ3H 6FABL 4BH7A 2FH8A 2AK1H 1A6VL 1ZHNA 2FO4A 1L6ZA 1MPAH 1UXWA 3BSZH 5E8NA 3PP4H 1ED3B 2EE6A 4JPIA 1LWRA 3KPSB 4HQQH 3ARBA 4YIQA 1I8IA 4OLEA 5J12C 5JO5A 3N85L 4M1CD 5K93A 5I15H 3MV9D 4FQ2H 3T2QA 4BZ2H 4F57L 5D8JL 3KS0H 3ZDYF 2BHUA 4M48H 2VXTL 1D5MB 3L1OL 3TJEL 2YKLL 3HMWL 3MRJA 1YEJH 4QOKB 3OGCA 3WDJA 4L8BA 5KG9A 2BC4A 3G5VA 2QSTA 1XCTA 4WW2F 1FN4B 4LEXL 5K9OA 4NQCE 5H35B 3ZKNC 2VAAA 1OGAD 3H9SB 3ZSSA 3KPQA 1RZIB 1IEAA 4YBLC 3VXUE 3RZWA 3Q5OA 3QCVH 4NN5B 5C0CD 1JN6A 2H2PD 5ITFA 3L5WB 3MOAH 4X7TB 3KLHC 2DMBA 4LLVB 5TPWL 4WEMB 4HV8B 5TF1H 3QNXA 4P2QD 4GAYB 4D2NA 2LU7A 4WEBH 1RUQH 3ZYOA 4LCCA 4MSWA 5JQ6L 4EBQL 3TBVA 5LGKA 3VXSD 1S7WA 4D8PA 1QLFA 2V9RA 4I3SL 2PNDA 3O6KL 4NNYA 4XBGA 3QAZB 4BQBA 4UUJA 2F54E 3OKDA 1TVHA 4HIXL 3B9KB 2N1KA 3VE0B 5T33H 5LJYH 4P3CH 4R3SA 5LWYH 3T0EA 5DJ8A 1QRNB 2IWGA 2FYYB 2EXWC 3NAAH 4R26H 1DEEA 4XMKH 2FL5B 1E0OB 5J7CC 1P9MA 5D1XD 4CUCA 4HGKC 4QRUB 5FCSH 4U3HA 3O6FB 3TH3T 4Y4FC 1JJUA 5JIPA 3Q6GL 2NMSA 3WNNA 4JAMA 4NO5A 3CSYB 3MLSH 3F7QA 3BYYA 1KFAL 4BFIB 4AEIL 2APBA 4NPYA 4YEEA 1MUJB 2EH7L 2Y25A 1MFNA 3GHBL 3GSVB 5I76A 3Q2CA 2A6DA 4M61B 2WBJA 3MACH 1IC5H 4IHOA 5IM7A 1WCQA 4CL7A 5CHNB 4KWUA 1CYGA 3N50A 4XNUH 1MCPL 5JTWA 1YN6B 4OFIA 1GGIL 1WT5C 3LEXA 4GKSB 2IH3B 2EYSB 2R0KL 3MJ6A 3ZYZA 4F33B 3ULVL 1QSEB 4ODTL 3P4OB 1KC5H 2AJVL 2XICA 4PV8A 5F9WB 5JHDA 4MCYB 4HS6A 5L88L 1CG9B 1KJMB 3FOMA 4U1LA 4XP9L 1PQZB 4BSWB 3E3QC 2VJXA 5F7EH 3HB3C 3WO4C 2VSDA 3CXDH 4P5KA 3RIAF 1OAKL 1TITA 4U3CA 5I1JH 5IIEB 2XN9A 1RJLB 2DI9A 2R1WA 4WV1B 4JFOA 5EU6D 4GMSL 5FFLA 1UA6H 3P4MA 4LSPH 2VNCA 5TQ0L 4Y1AD 1SBSL 2YEZB 5KVFL 4JHWH 2ED7A 4NJAH 4EUPB 1ZGLA 2B1HH 1SJXA 1RMFH 4WFFD 4XHJD 1XF2B 1NLDL 4AEHL 4ELME 2G9HA 5ITBL 1T0PB 5HGHB 3BP5A 1MJ7H 4HFWB 1XGUA 4PV9B 4Y4HC 1IGIL 5FHAH 3GMOA 1HDMA 1I1FB 1RUAH 5CJ5A 2SEBA 3MBED 4YE4L 2NTFA 2X9YA 3H9YA 2GSIA 5E2VL 4PJ8C 1T0MA 2OJEB 2ZKHL 3M07A 4U1SA 4XPHL 3WHXB 1NBYB 1EGJH 4FFWC 1C08A 1C16B 3DMMA 1DFBL 4YX2L 4DGIH 2UZIH 1WCBA 2D9CA 3QHFH 4CJ1A 4F37K 1CDJA 3QFJE 2Y07L 3CFJB 2IPTL 3BZ4A 4P2OA 1CDUA 5KOVC 1CTNA 4PJGE 1TENA 1RURL 3EW3B 5CD3A 3BWUC 2DF3A 1GZQB 2IQAA 2P5WA 2KKQA 2ICEB 1MCHA 4ZTOL 4KAQH 2CDFB 2GJ6A 4HKZB 4YO0B 1I9IL 3QDHA 3H7LA 3MGOA 1PKQB 3TBYA 5IB5A 4MNGB 3KPTA 3U1SH 3BKML 4MD0A 5E8PB 2AEQL 1Q0XH 4OCMC 1DANT 3H42H 5DD1L 3RVUD 3G08B 1NKOA 1WEJL 4GMTH 1IAKB 1GVIA 3S34H 2FDBP 4Y16C 4F15C 4JE4B 3ZKXB 2BNRB 4LHQB 2J8UB 2H8PB 3S6CA 2Z35B 3RUGB 2JJSC 3HZVB 2A6IA 5EOCL 3KR3H 1A4KB 3CDCA 3KYOB 4MNQB 3MLRH 5FUOL 5A2KH 4U1NB 5IESH 3EFFB 5FEBA 5IFJA 1GOGA 1KLUB 4UILL 1MOEA 4XVUD 1FV1B 3BUTA 3O3DB 5E4EB 3EOBA 2EXYD 1MI5B 2AV7B 2YZ8A 4G6AD 2CKBB 4D94A 4OLWH 3IDMA 4BK4A 3GMRA 5DJXB 3TBSB 2EDBA 3CH1A 3NVQA 1HHIB 4URTB 3O11A 2I5YL 2IJ0C 4MJ5A 1G6RB 4BJLA 3HZYB 2QADD 1KIPB 2C26A 5KSAC 4X8JA 3QRGL 3WFEL 4XCFH 3NCBB 1NDMB 4N68A 4NO2B 4XCYA 5EUKB 5LAXB 4PGDA 2P7TB 3FB7B 1BZ9B 2XQYK 5D7IA 2B5IC 3O2DH 4ZOBA 2FB4H 4KK9D 3GSXA 2GY5A 1CGWA 4JG0H 3IU3A 4JRYE 4PJ5B 1XGRA 4PJHB 3ILQD 1RZKL 3S35H 2UUDK 4FQQB 5IMKB 5LGJA 5ERWB 2RFXA 1KF9B 1WZ1L 5C0JA 1SBBA 1HYSC 4JO1H 2P5WE 3ROOB 4ZUVB 4QXWA 5IQ7L 1NGYA 4NQDB 5EC1B 4HUVA 4W4OC 4XMPH 4G8GB 1DN0A 4IMLB 1FNEA 1XH3B 5IVOA 3VXOB 2BMKB 2DWDB 4MXQC 4U6YA 1FPTL 4OZ4A 4X0KA 3FO9B 3NFPA 2ZCLL 2FJHA 4Q7DA 1JYNA 1NLBL 3EJZD 5EZIH 5EC2B 1GAFH 5ALCH 1ZMYA 3FQWA 4ZXBB 3O9WC 4N1HB 5IF0B 1MAML 2DKMA 3BZFB 1CL7L 3TGXA 2BRRH 4L4VE 5D2LF 2JKXA 3D2UB 4LASL 4XP4L 4CVZA 1M7DA 4ODSL 1QPPA 1U8NB 2IAMA 4HWBA 4FXKB 5IVXB 3VRJB 3CVHL 1UWEL 5FYLH 4PRPB 1S7VA 4HWEL 3QA3A 1ZLVH 2UY7A 5GGUA 3OV6A 2HKHL 1CD1B 2MPAL 2YWYA 4U4BA 4P2RB 4X80L 3V6OC 7CGTA 3WLBA 3IXTA 2UWEB 2GI7A 2XG4A 4HIJA 3W0WB 4R4ND 3RGVB 1AFVH 5DJYA 2DBJA 3V9FA 1JWSA 3I9GH 2BOCA 3QULB 4QWWC 5IVZA 5I1HL 3ARXA 4PRAB 5C0BB 1Q8MA 3HZMB 5I1LA 3JTTA 3U0TB 4YQXH 3O6ML 3P77B 3UTQA 1IM9A 4K94C 1CD0A 2GT9B 5D72L 1JF6A 3DIFA 2MQCA 1KLGB 4KK5D 4Z77B 4NBZB 5J12B 4PJAF 3V0VA 1FL6A 1S9XA 3TIDA 3BKJH 4P9HH 5CSZA 3P4LA 4I2XA 5DRNA 1UM5H 3WN5C 2FIKB 1GYAA 3V4UH 4QRQA 2ZSVB 3LRSA 4L3AA 3STLA 1MJ8L 4M8QA 3RPKA 4TVPD 3WJJC 2NX5D 1FL5A 4L4TB 1YMME 4EI5D 2R8SH 4PBXA 4GXUM 4IOIB 3EFDH 1G0YR 4K7FB 1X5FA 2XQYG 2YHGA 5D2NC 4XP5H 1I7TA 3VFWA 2O26U 4A6YB 4YBLB 3QXAA 3HMXA 3CUPB 4PJFA 4PG2A 3BMWA 1P4IH 1Q9KB 5IKCA 1W72B 2AABH 1QQDB 3BIKA 3GM8A 4RA0C 2HVKB 3MBXH 4JHAL 2HMIC 5MI0C 4XC3H 2IC2A 3QIBD 1CQKA 2Z91A 3RL2B 3UTPD 3D3VD 4U1GB 3S4SA 4OLXL 4ODHL 3DGGB 3A6OA 2PYEB 3BEWB 2X4RA 4LQ1A 5C0FA 3QDJB 4QNPE 1EZVY 5ID0B 3NFSH 1AD9B 1Z5LB 2VDLL 3D69A 3VWKB 3F62A 1SY6A 4X5WB 1KXQE 5E1AA 4HUXA 3KPPA 2EE9A 4WFFE 4ONFH 5GS0H 5IBLD 5ACLA 2VLMD 1YYLH 2QSCL 1IMHC 2Y36L 3GKWH 2EDRA 3HNTH 4GAGH 4HX1A 5FAAA 2G60H 2D7QA 4ZUWB 4AT6A 3ULUD 1G0XA 2WQRA 4H26A 3DTXB 3UYRL 5E08L 3O8XC 4PJCF 3F12A 1GGBH 3HCVB 1HKLL 5C6TH 3QP3A 1XEDA 4I3RH 3SEPA 1UKSA 4JKWA 3V2AR 2CQVA 1T89A 2ZJSL 4I2XE 5K33A 3FQXB 3QQ3B 3CU1A 1SVCP 4YWGH 4KZEL 2WV3A 5LXGL 1J8HA 1II4E 2VQTA 5HI3D 4K23L 5KVDH 3WFBL 1K4DB 12E8H 1YN7B 2CR6A 2J4WH 4O2FA 2QQKH 1S7QA 3ARRA 4XCNA 3C6SB 2O93L 4OD3H 5ESAB 1IQWL 1KCVH 4X6DA 2FSEB 5KANI 3BW9A 1FL3A 5H2BB 1Z2KA 5T1LB 1CXIA 3QHZH 5DQ9B 3NCFB 4PJFE 4Q6YA 3W81A 5I66A 2JJTA 1LK3L 4HC1A 4QHKJ 2IADB 3P11L 2ZUQC 5F96L 1K6QH 3O45A 4X4MA 5LKNA 4IOFC 5CCKL 1OLLA 2QTEA 4U7MA 4JJ5A 3IAQA 5CD5C 3QI9D 4XC1L 4JM2F 2W0FB 3CX2A 4D9LL 5DJAB 1EHAA 5SWSB 3TO4B 3D0VA 3LKQB 4CVWA 4X5XB 5FUZH 1EEUA 2EIZB 3LQZB 4K3DL 3S88H 2APWA 1WGOA 4PRDA 25C8L 1HIMH 3V6BR 4MB3A 5HYJD 4FQHB 1HH9A 3FFCD 3FFDB 4BH8A 1WBYB 4WU7B 3VFPB 5ETUA 4YNYA 4K3JH 2IALA 1FZJA 3D18A 3GRWA 2HVJB 4GKNA 1OP3H 3MROB 4Y4HB 1QACA 2MKWA 4OLVH 1HK6A 1D5BB 5F88B 4BK5A 4NC1E 3KDMA 1A7OH 1YNTB 1CGTA 5DRXA 3UX9B 4PJ8B 5LG1A 5BZWA 5C0RH 5HHVL 5B8CC 2CSPA 5HDBF 3V6ZB 5EUOB 5JIHA 5GGTA 4CU7A 1FVEB 4NIKB 4MAUL 3F58H 5DMGD 3AB0C 5E9DE 4GSDL 4NOFA 4V2BA 4QCIB 3TT1H 3ZE1E 4MA3A 2YMXL 3CFDB 1LD9A 3FL7A 1AH1A 5E0QA 3BD3A 1JPSL 2BRQA 1JGLH 4MA7L 5C07E 3H9SD 4HSQA 3SQOH 4WTXA 1TQCB 1U8HB 2AJSL 4LIQE 1QKZL 2Q6WB 2HFEA 1UKTA 3DX8B 5CGYD 4LMQE 3RWJB 5C6WH 1WC7B 4JPKL 5D1QD 4N0UA 3UCRA 3T4AB 4H1LB 2XY1A 4Y16B 4QRRB 3WXVL 4LQFH 1ZHKA 2ZUXA 4K2UH 4WI6A 5EBMB 5J13C 3CVIH 4QKXB 4Z78B 2FEEL 3MO1B 3OAZH 2XWTA 4H1LH 5GRJH 1BMGA 1G7IB 1UM6H 2V5RA 4FXGA 3BQUD 2G5BA 4PTUB 3B9KD 3UJIH 2Q86A 4OSUH 1IAIL 3NA9L 1S78C 1QRND 5ENWB 1U3YA 4Z7VF 1S9KC 5L8KB 3TN0C 3T0VA 4ZNEA 2PN5A 3CIQA 3MQIA 4YFEA 1EAPB 1IKNA 4JFHD 4F9PC 4LGSB 4E0RB 3BMVA 3U9PH 5KSAB 3AS1A 4XXDB 5I19H 4IRSA 4F80A 4GW4B 4WY7H 1AO7B 3GI8H 5E5MB 4JGJA 3QPXH 3BEVB 4ZS6D 3QEQB 5I2IA 1MY5A 3KJ6L 3PHOA 4XWGL 3HRPA 3QPQC 5J8OA 1JCKA 3TESA 5DJDA 1NCBH 4ZPVB 3QXUA 1D5IL 2JJUA 2P43B 4LBEA 1IE5A 1X5IA 4L3EA 4M1GH 1KJ2L 5C0DA 2E7CA 3ZTJH 4JFFA 2VABA 5J3HD 1LEIA 4OUOA 3BPCB 3UPCA 2VXUH 1S8DA 2CDEA 4PD4K 2FIRT 1WBXB 3WNLA 1R3KA 5MEPA 4OM1L 3VW3L 5TFSL 4UTAL 5MENA 5D6CA 1M6OB 2MMXA 2G2RA 4CNIA 1J1PH 1I8MA 1UYWH 1VKXB 4DZBA 2BZDA 4TVPE 2AGJH 2DQCH 2NX5E 4KUCF 2FRGP 2LQRA 1B88A 4TTDC 1P4BL 3GIVB 4GBXD 3BE1H 3EYUH 1ZA3A 4M4PA 2AQ2A 4OZGE 4LLDB 1U91A 2QSQA 5ESQB 1LO2L 3EO9H 2A77H 2F53B 1AGBA 1WTLA 4D3CL 4M6OL 1S3KH 2VISA 4R7DB 3DX9B 3IFPB 1FORL 4MJ6B 4ZNEE 3G5ZA 5K9JH 4ONGL 5TJWK 2BVPB 3HN3A 3UTPE 3D3VE 3MUZ1 3SDXA 2BNQA 2FECI 1CIUA 4G7YL 1FH5L 2V5SA 4K9EL 1I1YB 5C3TA 3PQYE 2RB8A 2CDGB 1BWMA 1I7UB 3P9LB 4G6JL 1E4XI 2NY3B 4KTDL 1HSBA 4NM4L 4ZFZA 4PGEB 1U8QA 1RV6X 2CMRL 5DLML 2HLFD 4R7NA 3MA9H 3PWJB 4MYWB 3TH2T 2DBLH 2VLME 3QDGB 3SCMB 5DD3H 4AL8L 4CADB 3DVNA 1H0DB 1R5WA 3TCLA 4LLMB 4P57B 1AHWA 5SWQA 4YXKL 4JFFE 3HPJA 5I6XC 5INDB 3KYMB 2Y5TA 3ELAT 1BECA 1DANU 3PIQB 3BH9B 4HJJH 4G7VH 4GG8B 5IB3A 4K94H 2ZUTA 2I9LB 1ZHLB 5HHNA 3OKOB 5LQBH 1J0JA 3OR7B 3VXRA 2IBGA 5EBLA 1GHFL 3RWGA 2YUXA 4YDIL 2BNRD 4O2EB 3RTQB 4KUZL 1N5YH 3P30L 3MPCA 3ARQA 5A43C 3QEHB 4Z7UF 5HHMB 4P5TC 1RUML 1DLHB 43C9B 3IF1B 1NDGB 3IU4H 5D2NB 4MNQD 1S9WB 2A74B 1MCFA 2ITCA 5ESVA 2NNAB 3C87A 4G6MH 1J86A 2HWZH 4G9DA 1MI5D 1A6ZB 4ZO8A 4OLZH 5C0IA 3MCG1 5FM4A 3UZVB 5DFVC 1AR1C 3I3DA 1BOGA 3MZTA 1O5DT 1N4XH 1T0NB 1T03H 4K07A 1UVQA 2BNQE 1IARB 5FO8A 2KBGA 2IPKB 1I9RH 1TETL 3MRHB 4U05A 4KI5E 5DK2B 2YA1A 4GW5B 2VSCA 1F45A 3MLXL 3ROLB 2MCPH 5DT1L 4LSUL 2YA0A 2GCYA 3PJSB 2XKNA 1ZEAH 4PJBA 1S7UA 4RWHA 4ZUSB 1G9ML 3BDXA 1OQOA 5L2KA 5ACMA 3A0OA 4M62L 5DMYA 3EYVB 1I85A 4PJ5D 5J4MA 3MLZH 1TQBB 1NCWL 1GJIA 4Y5VA 1T83C 1DEDA 4MAYC 3KYNA 4EJ1C 3HFMH 3O6FA 5EU3B 5DO2C 3C6LC 3IDIA 2NXZC 5I1DA 1D9KC 3RKPA 5DURB 1DBKH 1KB5L 3KPSE 2GAZA 4IS6A 1E4JA 2AVGA 1YEDB 4ODBD 2JIXD 3FQTA 4TQEL 4POZD 1E4WL 4GRLD 1N59B 4G8GD 1EUUA 1NQBA 3DJ9A 1BQSA 3GSQB 4FHBD 4V1DB 3T4YB 2EC8A 5KS9A 3MNVA 3BRDA 3D39A 3KPNB 5FK9B 1CXEA 2YD8A 4EOWL 4QOKE 2BVYA 3HE6C 3NN8A 4G3YL 5E94A 2UZXB 5E6IA 5HVHC 4NOBA 5D5MA 5FO9B 4TSCL 5CP7A 5T1KA 2QLVB 1MHEA 1LE9B 4E41B 5CJ8A 5SV4A 5IOPA 2X42A 3RWHA 1QBAA 4L8DA 1YPZF 3UBXA 5F9OH 3H9SE 4ZXBD 3BPLC 4WFED 2VDOL 3VFUB 3D2UD 3QH3B 5CAYB 1JZ8A 1QOKA 1Z0NA 3FQUA 5F9JA 5F7FA 3NTCL 1AXIB 3DYPA 4PJDF 1UQSB 4DFHA 3MR9B 1NC2B 5HTSA 3NIGE 1J7VR 4MJIA 3NCYP 1RJLA 2ARWA 4M02A 4NWUL 5HY9A 2GUOA 3O2VL 4WWID 3K8MA 5FB8A 4P2RD 4ZODA 4JFYA 4A2MA 2X4PA 2APVA 4Q2ZA 4LIQL 3TWCL 1CFQB 3WEXA 2XZQL 1ZLSL 5L2KE 1NUNB 3EO1B 4KRPB 3W9EB 2OCFD 1G9NC 2CRMA 3LQAL 5C09D 4KK8D 4P23C 3S96B 1JWMB 5C0BD 5FCUL 4PV9A 4IJ3B 2N7BA 3L5JA 3T8XA 3MC0A 1FG2A 3C60C 5FYJU 3CH8A 1JZ6A 1GH7A 4MA8L 4JGUA 1IKFH 5GJSH 1HHHB 1UJ3B 4U33A 1EGJA 4WJ5A 3S3SA 3TA3A 4NKIH 2R56L 2NY5L 3MRLA 5B8CB 4I77L 1T1YB 4CU8A 3TYFB 3NACL 3GEWB 1KCKA 1PX3A 4UNTA 3CFCL 3OKKB 4F2MA 4O00A 5F7YC 1A02N 2PYFB 1OPGL 5DJCB 4NO3B 3ZYJA 2DTMH 2J3SA 1Y18A 3VXMB 1QO3B 3C2SA 4JFEB 2AKRA 3A6BH 4JM2B 4MXWH 4DCQA 3C2AL 5D7KE 5IW6B 3ALPA 3ZKND 4L4JA 3VXPA 3MLVL 2FHFA 1QSEE 2BSTA 3B6SA 3OQ3B 5GS1A 3MJ7A 5IMLA 4DW2L 3AM8A 2XA8L 3M45A 4FFYH 4QF1A 2PO6A 4WTZA 5CEYB 4DKEH 4JO4L 3QUYB 5D1ZC 2HKFL 4OCRL 2CD0A 5JUEH 1I3VA 3OZ9H 2YRLA 3NABL 4H5SB 5D7JB 3UO1H 5HGDB 3BP4A 3I6KB 4TULH 1N6UA 3MRGA 3SGJC 2XPGA 5BVPL 3ZLQC 4FQIH 2HN7B 4MJIE 5J13B 1Z3GL 2PYED 3J8F7 1AGDA 4O4YL 1UEYA 1BBJB 2H1PH 4MQTB 5GGSB 3PWPB 5J0BA 5BVJA 4CMMB 4D0BA 1KIQA 2VLJA 1XF5A 3VWKD 4Q6IC 5I75C 4U1MB 3V8OA 5GSRB 4LP5A 4JZJB 4PRHD 3CFBA 3TN0B 2NW2B 3K74B 4X6CB 4TVPL 5DK3A 5T3XH 2EO9A 2X1XR 5CBAB 4YDVA 1ERNA 1P4LB 5F7MC 2AJYH 3VFGH 5H8DA 1IAIM 2CUMA 3U4EA 5HHOB 1P5VA 4D0DA 3O2DA 1C12B 4YUEL 4KDTC 3SY0A 1EO8L 4UDUB 2P5EA 3UAJC 1OQXA 4PBVC 5DI8B 1T1ZA 3QJFA 5BMFH 5JXEA 4ZFGH 4UOW1 1P1ZB 1O0VA 4JN2B 3QEGL 1ORQB 4WUKL 3PL6D 2K7PA 3MYJA 3TO2A 1MCKA 3ARWA 4OI7A 1UH2A 3REVB 2QKIB 3BRFA 1L0YA 4OAWA 2YD5A 1PW3A 3K1KC 1W0YT 5T1LD 1BFVL 4RNRB 1PKQE 3PHSA 2VXSH 4MNGE 2CRYA 3N06B 2ZPKL 4APQC 4O5LL 1YY8B 1FNAA 1RUPH 1XH3A 3UJTL 3I50H 1CF8L 3NH7L 1X9QA 4Z7WF 2FX7H 1L6XA 3OR6B 4L3CA 2BNRE 5GISH 1MHHA 3ULUL 3S4SG 2J8UE 5SWSD 3QIWB 3TO4D 2AP2A 3H2WA 1J10A 3RUGE 5T5FH 4J3WA 15C8L 4JLRB 5MEOB 3SDYH 3ARPA 4MNQE 4YGVA 4F37F 2VITB 5DXWA 1C5DA 4L5FH 4AYFA 2QR0B 4QRSA 4FNLH 1JZ4A 2K9UA 3C9NA 1KJVB 2ZSWA 4AM0A 3IVKB 4KKBD 4ZUTB 1YJDL 1G7HA 4Y4HD 4NUJB 2QQLL 2CIIB 3N1GC 4TSBL 3MXWL 2GFBB 3VFRB 4J4PC 1AD0B 3WHE1 2ATPA 5B38B 4WUUA 3ULVF 5IHZA 2L0DA 2R2CA 1S9YA 4C59B 1P2CB 1Q1JH 4PJ8D 5JORB 3L5XH 3DURB 1ZS8B 1JTOA 5F7KC 4C54A 2CK0L 4JKPH 3DO7A 2C3VB 2VDRL 5E99H 3Q6FB 4FFVC 4PJ5E 4KU1A 1A64A 1U8PB 4AH2A 1BFSA 4PJEA 3SDAA 3IFLH 5KSVA 2D31B 1IEBB 3C5ZA 2RHEA 1KTDA 4FQLL 1A6UH 3UZQA 4YHYC 3BUYA 1KTRL 2H9GB 1K3IA 2WUCL 3H0TB 3GK8H 4HHAB 3TBTA 1RFDL 3LAFA 5I6XB 4X9HA 1DQML 5CINL 5BRZB 3QCTH 5IWLC 2PXYA 4NQDE 3MRRA 4HFUL 4P4RB 4DEPB 1FFPB 5JOFA 4OCXL 3NZHH 5EZLB 3SKMB 2AK1L 5GRYA 4I1NB 1H8SA 3V5DA 3K81A 1XF4B 3T3PF 3DHMA 5IV2A 3QWRA 5EFIA 3EAKA 5CIPH 5D6DC 4Z76A 3WDHA 1FYTB 5CKGA 1XF3A 1OTSD 4X6FB 1YC7A 1VESA 3OBAA 2A9MH 1BGXL 2P44B 4UTBL 1TVBB 3E6FB 5CEZD 2CH8A 1MNUL 2C1OB 3LN5B 2D9QB 2Z8VC 3GIZL 4GG6B 3QDMB 2OL3B 3CUPA 3OX8B 1Q9KA 4NHUB 1SEQL 4MD4B 1I7ZA 2HVKA 2Z4QB 2VLRA 3MRMA 4NJ9L 1MWAB 5I1GL 4PRPE 2I9TB 3AU1B 2AK4B 3CSBA 4YHNB 4HIHA 5DUBA 3ZE0F 2D03L 5CUSH 4IDJH 5KSAD 3QDJA 3TP4A 1QLRA 5F7LB 1MWAH 4XXCC 1H15A 5TF1L 4P2RE 2A83A 3FRUB 1SM3H 3WJLC 4R2GC 3S36X 2UWEE 2I25N 2J6EL 4Y8DC 5C0GB 3W0WE 4X5WA 3QEQD 1OAZH 2YPLD 3QXDA 5B4MD 1HQRB 4NO0D 4KDVA 1EERB 4EDWL 3HI6H 1WWWX 2NY4C 3F7YB 4JQVC 4JPVH 5C0BE 1OB1B 3RWIB 3LDBB 5JR1H 1OAYH 2IFFH 4KJWC 4Y4FA 1MCOL 3C6LB 4ZUWA 4JDVA 2ED9A 4ODXB 2NXZB 3ZL4H 1D9KB 3MV7A 1MFAL 3C09C 4Z7UB 2GK2A 3DNKA 2VC2L 4WHCA 1ZVHA 4NZRL 1BVLB 3PXJA 1PSKH 4KDWA 4OJFH 2ZZUT 4AMKH 1PYWB 1WAAF 3CPLB 2HTLC 2X4SA 4MD5A 1NGXA 3QG7H 4OCLC 3HE6B 4L4TE 3ZT5A 5HVHB 5FOJA 2XQBL 1I9EA 1DQDL 3KXFA 4M4RA 3LV3B 5CJQL 2CLZB 1LDSA 1TZHA 2NZIA 3EGSA 4FZEL 1IC5L 4WHYH 1FZOB 1FBIL 1HI6A 2HLAB 5CZVH 2FJGB 2FX9H 5ACZB 3KNBB 3DSFH 5D9SA 2F53D 1NL0H 1U6AL 2HJKA 3F6IA 3FQNA 4LCUA 1CDCA 2AJ3A 5DQ9A 2B4CH 5C0CA 1MEXL 5AZEH 1YNLH 2OSLB 2OZ4L 3W82A 5I8CB 2R23A 2YPVL 4P2QA 4GRWF 3W9DA 4JM4L 3WUWA 4KJYA 5DMKA 2PYEE 2E9IA 3NA4A 4PREA 3QDJE 4NZJA 4OB5L 1F6LL 5D70H 4U6XA 3SOBH 5DEZA 1QBML 5FOBA 2EIZA 4G42B 3W11C 3QQ4A 4UBDC 4GW1B 2NY3D 5FYJD 3STBA 3JWDL 1UADC 1B4RA 4ZS7H 1DBBH 2V2XA 4DGYH 3QO1A 3QDGD 4QWWD 4LLYA 3SCMD 2W60B 1BF2A 3T0AA 2AXFB 1T5XB 4DKDC 2PTVA 1G9NH 1DLFL 3C60B 4ZG1A 4JHWL 4NJAL 4LRIA 3MV7E 3MRKA 2WUBL 5TGBA 1B0WA 2FBJL 1U92A 2NR6D 3NCMA 2CIKA 2QQNH 3TNNB 3MRIB 3UPRB 1KTKE 1KN4H 2M8XA 4H25B 3VI3E 2Y06L 2E7LA 3TPUB 3QIUC 3BZDA 3VXTB 1DBAL 2DQIH 3CX5J 3GMLB 1CR9H 5DR5L 4HCRL 4WW1A 3T3ME 2EDLA 3RTQD 3WS6A 3QUMB 3OJ2C 5HHMD 2DQHL 2VLKD 4E42A 2B1AL 1XR9B 3HI1A 1OAUH 1J05B 3MLTA 4YHLL 3QHFL 2E5EA 3K2UH 3LEVL 1NCCH 1N2RB 3QUXC 1JV5B 1DL7L 4G8FB 1ES0A 4LLWB 1KXVC 4DN3H 5EZOL 4C56B 4J6RH 4HG4J 3E3QE 4WI2A 2HMID 1BP3B 2GSGA 4H1LA 2VIRB 3BP6A 4QRTB 3ARSA 2JB6A 4ELKA 1YYMH 1XGQA 1N7MH 3H7BB 5GS2D 3IJSB 4ZO6A 5EU6A 1T04A 1Y0LB 3LPFA 3HZKB 1B4JH 2JJSA 4JZOA 3IKKA 1P6FA 5C9JB 4YC2B 5CKAA 4Q6IB 5I75B 2OM5A 1A1NB 32C2A 5ADPL 4OQTH 1KN2L 3D9AH 1A4JB 2FHCA 3FB8A 5C08D 5IESL 3L3KA 1JI1A 2Q8BH 3DVGA 1J11A 1E4XH 3O3BB 2ARJB 2VXQL 1ZVSA 5EU5A 3MJ9L 1AY1L 5EA0L 5F7DA 2CKBL 5EUOE 4V1DD 3HRZB 3V6FB 3HLAB 1I8KB 3ARDC 1ZV5A 3ZTNH 2HT4D 3BGAA 5JDSA 3SDCB 3HG1B 4NYLA 1W0VA 1JNJA 1HHKB 5J6GB 4L9LC 2YN5A 2NY1C 1G6RL 4DKAA 4XTRC 4NKDB 3GJEA 2VDQL 5GHWL 4LHUA 3FB6B 4E41D 3O2DL 1RIVH 4ORGA 2VDKL 1WV7T 1BBDL 2EDFA 4Q0XL 4D0CB 3OKNA 4FTVB 2ADIA 2X44D 3UC0H 3BPCA 3CSPA 5E2WL 2DM3A 1PFCA 3P2TA 1T66C 5KN5A 2VL4A 3FHAA 2JCCA 3G6JA 4NKMA 4CJ0A 1HOCA 3BXNA 4APQB 1S7RB 3L3OB 1AXTH 3VWJD 5GGQL 4QRRE 1NC2D 2VZ3A 4N90E 4CN1A 4G80B 3TT3H 4NCDA 4XAWL 5AZ2L 5E56A 1K3ZA 2WP3O 1ZANH 4I0PB 4ODUA 3O9WA 3MOBL 3KG5A 4X99A 4RIRB 1DZBA 1XCQB 2OTWB 3OF6D 1ZT7B 4KRPD 4ELMF 4K3HA 1MFBL 1DE4B 5IMMA 3BKYL 4AZ8A 4O9HH 3IDGA 4PGCA 5IQ9B 3UTZA 3ZHKA 3GSWB 1NEUA 2BVQB 4RA3A 1DQQB 5FYKU 4HWZB 2AV1B 4NP4L 2Z31D 3VG9C 1GOHA 5A3ID 3L3GA 5EN2B 4NDMB 4NGHH 4ZAKC 1CFSB 1AO7E 2EYTB 4N0FA 3TFKD 2VDMH 3EBAA 1JNLL 3BGFB 5DJ2A 5HHXL 4QYOA 1QFHA 3PNWB 4LGRB 3PWLB 4PJGF 4LCCC 1EEQA 4NM8H 3OKEB 3REWB 4Z7WB 2HG5B 4G6FB 4N0YH 4U6HB 4YHYB 3VXMD 4JFED 4JM2D 3N1MC 4XBPB 2N4IA 2IPUK 2J88L 1CE6A 4MQXD 3P73B 4G8IB 4I4WB 1S7TB 3UBXG 2DD8L 1P84K 3T0EC 3P0GB 1M71A 2A0LC 2JCCE 3QUYD 2WIMA 3IDUA 3WN5A 1AI1L 2QSVA 1QG3A 3BAEL 3E6HB 5DVOA 1DJSA 3ZHLA 5CJXC 3R4DA 5D7JD 1P9MC 3DUUA 4G9FB 4O2EA 1UWGL 1K8DA 1KTLB 2YK1H 3IJYB 1LEKA 5E2UH 4Z7OE 3CK0L 1MCNA 4OZIA 4P46C 3FN0H 2Z92B 3JBG7 5HDQH 3V5KB 5D71L 1B2WH 1R3LA 1LP9A 2F53E 3GMQA 3UZEA 4BKLA 4Y4KC 1H3WM 5DMIL 4O2CB 3OJDA 3I3BA 3QISA 3VFNA 3FONA 3IDXH 5GJTL 1MCRA 2AXHA 4M6NL 3KPMA 3DX7A 1HINL 5HHOD 2IPKA 4P3DA 5E00A 1F8TH 4A6YL 3U79A 4KY1L 3HNVH 3MRB