4ESKA

Crystal structure of a strand-swapped dimer of mouse leukocyte-associated immunoglobulin-like receptor 1 (nysgrc-006047)ig-like domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
96
Chain Sequence
b'SLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukocyte-associated immunoglobulin-like receptor 1
publication title Crystal structure of a strand-swapped dimer of Mouse Leukocyte-associated immunoglobulin-like receptor 1 IG-like domain
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 18
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eskA00
2OL3L 3MV01 2KPNA 2MPAL 2X1QA 1HK6A 1K4CB 4JY5L 4LGPB 4DFIA 1YQVH 2NW3B 4DGYL 1CLOH 3K4DA 5FYLL 2B5IB 4KK9C 1SJEB 2EXWC 1FIGL 1MCNA 1PQZB 4HF5L 3NFNA 4OM0H 4HIXL 3C6LD 3TH3T 3VWJB 3ZKNC 1BFVL 2ITCB 1KFAH 2Q87A 4KVCH 3SN6N 2BXZA 4UTBH 4TUJB 4M43L 4PJDA 3D3VB 1UXWB 4MA7H 1HHGB 3U2SA 3QUXB 5HYSB 2VZ3A 2ZUXA 4XBPA 5F7MC 3PL6C 4OQTA 4ORGA 1GIGL 5IBLD 2CGRL 3O9WD 3EYFA 2DQGL 4ZUVB 3CLEL 5IFJA 1Q9OA 4GSDH 1MFEL 1DSFL 4GRLA 4UIKL 1M7IA 4WU5A 3GHBL 5CILL 5CLTA 4FMFA 4K55A 5E4IA 5B3NA 5IW1B 4G7VL 4N1HB 3E2HB 1M6OA 3SCMC 5A40E 2E3VA 3MV8A 3QUZB 3MLTA 5F6HJ 3QJFA 3G5YB 2ADFL 4PJEE 4QGYA 4Y2OA 1MRDH 3GHEL 3KPLB 2F8XC 3SGJC 2WWMC 1JJUA 4RWHA 1A8JH 2NY6D 2DOCA 2H6PA 4DZBB 3CVIL 4XXCA 4ZUWA 5INCB 3NPSB 1N6VA 2NY0C 2XZQH 4I3GA 1BF2A 1D6EB 3MNVA 2JIXA 1U3HC 4HWEL 2Y5TA 1JHTA 2VXVL 4X0KB 4OLXL 3IJSB 3SJVA 5HYQA 1I3GH 5GIRB 4EJ1C 2OP4H 3CXHK 3LN4B 4PREB 5E1AB 5F9WB 1NANI 3F7VB 4MJ4A 3T3ME 5FYLE 2OMBA 1KLGA 4GRMB 4H25B 4YXHH 3ZO0A 5T3ZD 1T0NB 3MACL 5HTSA 5FUOL 3VGAC 5EU7C 1A7RL 4PJ5B 2WAHA 4M4PA 1YNKH 1ZHBB 5F97E 5DK3A 1KJ3L 2ZUWA 3FFCD 5GZNC 1QSED 1BZ7B 1EFXD 2QJDA 4NJ9L 1CFQB 5ALCH 1L6XA 5LAXA 1K6QH 3IU4L 1CLCA 1B4JH 4O9HL 3KWWB 1G84A 1I3VA 3ROOA 4JZOA 3P4LA 2R2EA 2ZOLB 2DQDH 3RUGF 5FHBH 5ESAB 5M7QA 2BFVH 2OQJB 2FH6A 1MWAL 1OTTD 3P0VL 5C08E 3V95A 1IEBB 4N0UA 1MJ8H 4GKOA 2CRZA 3UZEA 2G75B 4DFHA 4XTRD 1JYNA 3PWNB 4C4KT 1T80A 1OGTB 2P1YA 4PBXA 3RUGA 4N68A 3U1SL 5MENB 1NSNL 2ZOKB 4XX1G 1HKLL 2YD3A 1A6ZA 3VGDA 5FEBA 3HFML 3H42L 1H3PH 3T4YA 1RFDH 1CLZH 3CDGB 4KRLB 4KMQA 1PY9A 3J8F7 2EECA 3L9RB 2CLZA 3HAEG 1I8MA 2Y4SA 1NGXA 1X3DA 5B38G 2AJXL 2VLJD 1HQ4A 3EYVA 1P7QD 3W2DL 4RMWA 1KTDB 2X89D 2HTKD 5HDBF 5BW7A 1FAIL 4R4ND 4M6ML 3DYOA 3D18B 3ILQC 2RQ8A 3K74B 2CIIA 2V2XA 1G1CA 1SYSA 3WIFA 1FZOA 1MVUA 4LLYB 4N9GB 3WLWC 4EI5A 2I24N 1A7BA 3B6SA 3C2AH 3DXAA 4U1NB 1WWAX 4QCIA 5C9KA 1SY6H 2Z35B 5MHSD 4MZ2A 1TJGH 5IBUB 4Z77B 4X4ME 3MLPA 3MBEA 3O2DL 3K0WA 3MV7E 2Z8WC 3C09B 1HNGA 3M8OH 2NZ9C 4ZFZB 3UTTD 3MRKB 5I30H 3CC5A 2HJFA 5F3BB 1EGJL 3IKCB 3FCTA 1WWBX 3DURA 1PKQE 1U93A 1WT5C 3LKRA 3T0WA 5BV7B 3BP4A 4KJQC 4EN3B 3VWKA 4PJ8A 1YUHB 1AO7E 1KNOA 3D85B 4WHTA 1L7IH 5E99L 3NMEA 4KJWC 2IAMA 3SHSA 3TZVD 3S4SG 4PJAE 4D0BB 1LK2B 5EU7E 4EUPB 1FGVH 2H9GB 4WWID 4JANB 4IS6B 4LLQB 3S6CA 1AQKL 2CK0H 5CJ8A 4RMSA 2FR4B 4NWUH 2FEDD 2KL6A 3JWNC 2ESVA 3IRZA 3OKNB 5TQ0H 5IQ7H 5J1AB 3LN5B 4Z0XA 3TBVB 1F5WA 1OLLA 3QIBC 1BD2E 2GW5A 3OMZA 1C5DA 3VFWB 4GG8B 4NRZA 5TFSH 2FHFA 5EO0A 4MNGB 2VIRA 1EHNA 2CUIA 5ACLA 5C0DB 3Q2CA 3V79C 5HGBA 3L95A 2F5BH 2VDKH 5MEOA 4R4FH 3LKQA 1ZT1A 3UJIL 1MHEB 4X9GA 3W0WE 1NKOA 3L3DB 3RY4A 3MJ8B 2J8HA 1F13A 4ZS7L 3JSSA 2AJYH 2VERN 3TA3C 1TCRB 1WEJL 3MCG1 1YEEH 3QXUA 4Y19E 5CGYC 3QXDB 4NDMB 4XNXH 2J2ZA 5EFIA 4GLRH 4MLIA 5D1QD 5C09B 4M5ZH 4F7CB 1X5GA 1Q1JL 1OPGL 1U8OB 3IDIA 1J0JA 1N5AA 5D7JC 5L6YL 3UPAA 2VDOL 1PLGL 4MYWB 4JLRA 1OGAA 4YC2B 5AZ2L 1LE9A 2VLLA 3ZT7A 4MAYA 4W4OC 5ACZB 4H26A 5D1XB 4KROC 2BJML 5BJTB 5JXEC 2X4UA 2HT2C 3KLHD 1TZGH 3ELAT 4PRIA 1F02I 4P23A 3BKCH 4OF7A 4KK6D 3WHE0 3VXUB 4XNYL 4YHYC 3IDJA 3MOAH 1ZGLA 2A6DB 3CSGA 3HZMA 2FZ3A 3P11H 1JGDB 3WFCL 4LPTA 4OD1L 3DBXA 1J1XH 5K9KA 2EDFA 2HJKB 3QIWB 2EDKA 3ZSSA 1HSAB 2VLKE 5FO8B 1WAAF 2GSIA 4I5BB 4LCCA 4F7EA 2PW2B 1PSKL 1CR9L 4JO3H 1Q72L 4HH9B 1I1AA 3DUHA 4PJHE 2P5WD 4JRYD 5FUZH 3FKUS 2F54E 4P3CL 4AENB 3VD7A 1Z9MA 3RA7L 1DQJA 4FQIH 4GKNA 3OBAA 2V7HA 3C60D 1KULA 4WFEE 1FNGA 3FQRA 1WAAA 2CD0A 3MV9D 3FJTA 1AIFA 1PYWA 4ZPTA 5FDWB 1FYTB 3V5KB 3VD3A 1DBBH 2FGWL 2ED8A 4JM4H 4Y16C 5EOTA 3QEQE 3SKJL 5JHDD 3T1WA 4IRSB 2CKBA 5JMOC 4AK1A 4HUVA 4WWKC 5DQDH 4WNQA 1QVOB 3HNVL 5DF0A 1T22B 5JPMA 2VABA 3U6RB 5FXCH 1OLZA 3IDUA 1LE5B 4K8RH 5HYJD 2MQ0A 4FXGB 4JJHA 2JF1A 1HHKA 3GFUA 3PWPA 1UZ6E 4K71B 1AY1H 4OGAD 3S9DB 3L3KA 2GJZA 2H2PC 1XGQA 1QFHA 1AGFA 1CXKA 1QSZA 5FB8B 3STZB 5DJXA 1MPAH 2AI0H 4JKMA 3K8MA 5F70A 5KS9F 1UWEL 3MOBL 1TFHA 1CICD 1CIUA 4QTHA 1XGRB 4NQVA 4B7LA 4EQ3A 1IJ9A 3MLXH 3O41A 1NAML 1LVEA 2LV4A 1CCZA 2VDRL 3BUYA 4NN6B 4LNVA 4QRSB 4EDXA 3G6DH 3GK8L 3LPWA 5AEAA 1CWVA 1NLDH 1K2DB 5FKPB 2BNRB 5KS9A 3PP3H 1TITA 4JFXA 4OFPA 3SKNB 3U0PA 3BGMB 3RWDB 2OTWB 1C1EH 3JZ7A 2J8UF 2W9DL 1KCVH 1RZ8B 2Y07H 1G0XA 2K7QA 3FAWA 4Q0XL 4M48H 5EORL 1EEYA 4G6JH 3KAAA 5FUCC 1G7IA 3QUZC 1U8NA 1MRCH 3UC0L 4I48B 3VG9C 5D2NC 3V9FA 5A43C 5C9JB 3G6JE 3BX7C 5D93C 4YDVA 1YEHL 5F7UA 2J8UA 3RWEB 2I5YH 1F3JA 1INEL 1DBKL 1YEGL 3RWGB 1U2HA 3T2NH 2QTEA 4OSUL 2BK8A 5C07A 5BMFL 2QL1A 4LCWB 4ALAL 5ICYB 1MI5A 2A9NH 2P8PB 5C6PB 5F9WC 4WGWB 4H1LG 1MY7A 4YHKH 1IGFH 1CTOA 4JFHD 2HVKA 3O8XB 4Z7UF 4M1DL 5GGRB 2IGFL 4KK8D 4D9QD 2BOBA 1CGVA 4UQ3B 4S11A 3CVHA 5F7EH 4OD3H 5HGDB 2P5EB 5KSAB 1JGVL 2JJTA 1DBAL 1ROWA 3U7WL 4NHUB 4TSAH 5I1CH 5DJCA 1I3RA 5I1EH 1TTFA 2YPLD 1X5HA 4Z7UA 2GTZA 2I9LA 1NUDA 1HH6A 2VXTH 1IBGL 4I3RL 1FORH 3BQUD 2UVEA 1HDMA 2BMKA 4BZ1L 3E0GA 4HFUL 1PX3A 1F4YH 4MXVE 2D0GA 2JB6B 4KRNA 4J12A 2BNQA 1YDPA 1FG2B 1I85A 4I9WD 3DX7A 3UAJD 2IALA 5JPNA 2YMXL 3DVFA 4PJ7F 1R5VB 3B9KC 5HGHB 5D71L 4XPTH 5L88L 4Z7WB 5I1HL 3OKEA 4OKVB 1DE4B 3DX9B 4YNYB 1ACZA 1E0OB 1GC1H 1BIHA 1F45A 1IQWH 2ZSVA 2XKUA 4PRAA 2X05A 3TBSA 1ZT4B 3BT2H 4PY7B 4MDIB 4C83B 3IXAB 4Y1AD 4IOIA 1GZQA 4JM2B 3S37L 2WINA 5JOPD 3D3VE 3ZTJG 4Y4HB 1ACYH 5JW4N 4PRHE 1CL7L 5J57B 3PHQA 4QHUA 4OZGF 2VL4A 3P77A 4IIQC 3V52L 4E5XA 1SEBA 5ILTL 4NM4H 3KPSB 2ATKB 2NCMA 3WIIH 2OS7A 4PV8B 1B6DA 3NH7L 1IAKB 5MP6H 3LN9A 4LF3A 2YBRA 1DR9A 5D1ZA 1JPSH 3KYNB 3NACL 4M7LL 5I8OH 1AFVH 3ARPA 1EJOH 4OLWL 4XVSL 3L5XL 5FUCE 3WUZA 1U58A 3Q48A 1LO2L 4OZGA 3VMNA 4NFBA 3JV6B 3EZJB 5D2NE 4ZD3L 3OHXA 3V6ZA 3CFJA 5CP7B 1XGTA 2SEBB 5GS1A 2P7TA 2O5ZL 1R3HA 4NCDA 3QDGE 2EE3A 5IMMA 4Q97A 5CGMA 4NN7B 4DCQA 4X6CF 4HK3N 4NQUA 1S7TB 2Q7YA 1Q9WA 5EBLB 3BKML 1C5CL 5I1LB 3RIFK 5ITFA 1J88A 2HVJB 4EN3C 1I7UB 4EI6A 4QY8A 3N1MC 5I16A 5HHNA 2A83B 1KB9K 5F9AC 5J6HA 2ATPB 3VD9A 1UB5A 1JF1A 4YR6A 2UYLB 4R3SA 4XVJH 1GGTA 4W6WB 3BEVA 2VC2H 3MUY1 4PFEA 5D6DC 1Z3GH 5CEZL 5CEYA 4X6CA 1R3JA 1X5LA 4HJ0D 5K9QG 2W92A 3G5ZA 4LDLB 3UTSA 3NCYP 3CK0H 2JCCE 3O9WB 3FQNA 4UNTA 1OP5K 4QHLB 5CIPH 3BW9B 4GKZB 4JFED 2W9EL 4P99A 2RFXB 4M1CC 1LO5A 4JDVB 4P2QA 5J6GB 1H3VA 3BGFB 2NY7L 3BKYH 1NFKA 2Y9RT 1PEZA 2FIKB 2IH1B 4HJGA 2V5MA 1OSZB 1PG7W 1X6NA 2ORBH 3DVNB 2MKWA 4NBZB 2E7LC 4O58H 1NGPH 1UKSA 5DD0H 1ZHLA 2P8MA 3VXSA 4YXKH 3PHOB 2EYTA 3FQUA 2YWYA 4MDJB 2FATL 1CGSH 3BO8B 3HMXH 2E9BA 1KUMA 4OUUB 2CMRH 3TV3L 1Z9LA 1MUJB 2EIBA 3MXWL 4JAMA 4HK0A 1VFBA 5SWSE 1KB9J 1V7ML 3IT8D 3C6SB 4JZJA 4QEGA 4AQ1B 3QZWA 3T0AA 5AZEL 1UM6L 1UKQA 2I60L 2XWJA 2EC8A 1J8HB 4G6AD 2YWZA 1RJLB 4IDJH 4L9LB 5IWLC 5KVGH 3OPZH 3MROA 2VH5L 2VJXA 5D7IF 1QSEB 4ZTPH 4UTAL 2Q8BH 2VDQL 3BAEL 1J9CT 3H9ZA 5D1XC 4LHUA 3R8BB 3FONB 1GH7A 1U8HA 3MR9B 5BVPH 2R0WL 3MRMB 1YMMD 1BQSA 4R96A 1BMGA 4BSVB 2DJUA 2Q3AA 3N06B 3MCKA 3FRUA 2VR9A 1JWMA 1KEGH 5D7IA 1IAOA 8CGTA 4OZIF 1I9JL 2EEAA 3HE7C 4JO1H 4K3JH 1H3GA 3FZUD 4LCUB 3H9SE 2EH8L 2AK1L 1TETL 3EDKA 4GO6B 2IMNA 3QIWC 1IQDB 1O7VA 1ZA6A 1EAJA 3SE4A 3SDXE 4XPBL 4UAOB 1JGUH 4OZIA 2APTA 4MQXD 3HZKB 5SX4H 3QI9D 1AI1L 1UWGL 1C12A 4KRMB 1LP9E 1VGKA 2G60L 2AXJA 4HSQA 1ZK9A 3TBYA 2V9RA 3DRTA 4ODXB 2W07A 1XF4A 4XCCH 1P7QB 2E27H 3BD5A 3O11B 3SDYH 4YFLI 3I6LD 1U8QA 4M61A 2CDFB 2VLME 5DFTA 5IF0B 1MCIA 2O93L 1DBMH 2FX9L 2JTDA 1WWWX 3QRGL 3RY5A 3M17B 2Q3ZA 1QSFE 4JFPB 1B6UA 1IC5L 4JN1H 4XNQB 3S88H 1UVQA 1CXHA 2BSTA 5KAQF 1I1FB 5H2BA 2OR9H 2IC2A 1EBAA 1LEKB 3B3IB 1MCQA 5K9OA 3GRWL 3U9PH 4OT1L 1RZFL 5IJKC 3WFDL 3NFPB 4K07A 1MCWW 1A9BA 3U9UA 5IVZB 4Q9RL 4MNGE 2CLRB 2V2WB 3F12B 3KPOA 4J4PD 4ODVL 1S9XB 1MFCH 5DD1H 4B41A 3JV5A 2ENSA 5DD6B 4WENB 5BVJB 3E6HB 4QXGH 1A6TB 2D7NA 4P9HH 5FYJH 1J1PH 1A6VH 4XMLH 3SKMB 5IG7A 1D5BB 1SEQL 2J6EA 5DTFB 4BKLA 5KN5B 5LXGH 2CLVA 1XGPB 2HLAA 3LD8B 2ERJC 4HS8L 3MJGX 4ZAKD 4OLUH 2CXGA 2G2RA 5C09E 4YPGB 3ZE0F 1T89A 4G43B 3X3GH 2CDGA 3VA6A 1P9MC 4NKDB 1KPUB 1RUAL 4QOKA 4IHOA 1XR9B 2AJSH 3ARFA 4NZRL 4CU8A 4ZNEE 3O6MH 1CBVL 4F15C 4N0RA 1FO0H 4XCNA 1IM9A 3HG1D 4S1RH 4XP5L 5FYKL 4WO4D 5IB1B 1TNNA 3MJ9A 5I1IH 4POUB 4XH2A 3RZCA 4ODSH 2Z31D 5D72H 4NN5C 3RNQB 5FECA 5E24E 4GRWE 4ZUTA 3L7FA 1MSPA 5IMLB 3ES6A 4CMHB 4GS7C 2YD7A 4JFFB 1VFMA 4OGXL 4NZJA 3EOBB 2GJJA 4MNQA 4ODUB 1EV2E 5HYIA 4U1MB 1JHLL 4PGEA 2WW8A 2DN7A 4K8RD 4JG0L 4OGYH 3TBTB 4LPUA 4PJ9B 5E6ID 2UZXB 2HH0H 3QH3B 3WEXA 2QSCH 3N85H 1HKFA 3V6FB 2ADIB 2R0KL 4U0QB 4XXDB 2XXCB 3BVNB 2J5LC 3TBWB 1RZJH 4YQXL 4ZSOA 5DQ9A 2GFBB 1PZ5B 1OQXA 1QQDB 1R3LB 1FN4B 4JPKH 3ARUA 2AQ3A 4MAUH 2APFA 1H5BA 3GEWB 1MCWM 3BIKA 1WIOA 5DUML 4R8WL 4EQ2A 1GGIL 4JRXA 4S1SL 1DFBL 1AXSA 5MERB 1NPUA 2F5AH 4G8GD 5FGRA 3AS2A 1AGEA 2IFFH 4HDIB 3UEZA 5D4QA 1S9WB 3VXOA 4PTTA 2PCPB 5TH2A 3IDYB 3GI9L 4BH7A 1S9YB 1F00I 4F2MA 2VZOA 2X09A 2NTFA 1N3NB 5DI8A 1D6VL 4FXLA 4G5ZL 4I0PB 3QNYB 5JUEH 3Q6GL 5GGQH 3LRHA 1BOYA 3EJYC 1RD6A 5IHUH 1Z6JT 3JVGC 4OCWH 1ZHNA 2P5WB 5E8PB 4JRYB 2VRAA 3O3AB 3WV0A 3ILPA 5KSBE 3I3BA 4X4YA 5DK0B 4LVNB 3ROLA 4LEXH 5DJ2B 2WV3A 2GJ6A 5IW6B 3S5LB 5CZVL 3DVIA 4TPRH 1U2CA 3PGDA 5CJBA 1KJVB 3S34L 1IAIL 3H2WA 3FB8B 4M93B 4M62L 1BREA 1TVBA 4OCSH 3TPKA 2OZ4H 1WF5A 1ZANH 4OLVH 3ZYZA 3CFEA 1OD9A 1KCUH 5MEPA 3ARBB 3FQTA 1FL3B 3C5SA 4ZFFB 5EUOF 4E41B 1L9MA 2O61B 4NN7C 4TRPH 4R97C 1HHIA 5DJAB 5DGRA 1G1YA 2B4CH 4R0LA 4XP6L 5ABDE 3A67H 3C6LC 1J05B 1GPOH 5T3XL 1Y6NR 2ENYA 3IB4A 2XFXB 5EUKA 1KIRA 4PS4L 2QADD 4LSRH 1CICB 1NMAH 4WDIA 5EUOA 2AV1A 5FOBB 2XPGA 2MKLC 5MI0C 5DLML 5E8DH 2UZIL 3BN3B 5IBLC 3O9WC 2QLVB 4MSWB 5GHWL 3Q1SH 1WSST 4YAQB 4RAUB 3N9GH 3V4VL 2V5SA 1TIUA 4NUJB 4DAGL 1YJDL 3SBWC 4AG4L 5JLZA 4O02H 1FFNA 4IJ3B 5A2KH 4AMKH 2W91A 3EYSL 5SWZA 1KF9B 1QBML 2D31A 3BP6B 1A1NA 1FGNH 3KYMA 3MUZ1 4H0HB 4PJGB 3MA9H 4M7JL 2C3VB 3KYOA 2CJUL 4IM8A 3V5HB 2NY6C 4KTDH 3JWOH 4LLMA 3IGAA 2H8PA 3D2UA 4MA1C 2XQBH 2HN7A 4LEOB 4Z7OF 4Q6IB 5DVOA 2AV7B 1HHHB 3G5XA 1DEEB 1UG9A 3NCMA 3MLZH 2X4QA 2HRLA 3R1GL 3FT3B 3MLUH 5D9SB 4RFNC 5SV3A 1NC2B 4IMLB 1KELH 4XC3L 1ZLVK 3QDMB 1OWRM 5I2IA 1YNLL 3VI3E 4NGHH 4YHML 1CE6B 5DMGD 4L9LC 1S7QA 1P4IH 2V9QA 4F58L 1CGYA 5CCKH 3QO0A 5CJOH 4BSJA 2ICES 5M95B 5I75B 4Y4FA 3MRCA 4V1DA 5GGSY 3CPLA 3BDXA 4G9FD 2PTTA 2A6KB 4YK4B 2XN9A 4U1SA 1DBJL 1A9EB 1EEZB 4K7FB 4WIQA 3ULSA 5KVMC 3AM8A 4FFVD 1OTTC 3WUWG 4IRJD 5I1GH 4PLOB 2KQMA 2C4XA 4ONOA 3RX5A 1QLEL 3U2SB 4XTRC 2OTUA 1OARL 4QHKJ 5JDSA 4XBPB 3ZHLA 3TO4D 3VJ6A 4YPJA 3BUTA 3EYFB 3O81A 2I07B 5FO9A 1BQUA 3FMGH 4WI3A 4CNIA 5I15L 4TNWK 3O6FA 5IFJB 1GCFA 1GAFH 2LU7A 4GRLB 5L2KD 5C7XH 2GI7A 3QFJD 3HCVA 4BELD 5CWSA 3QRFM 4HFWB 3H3BC 1T83A 4Y1AB 5IHBA 3FB6A 4M5YH 3MLYL 3GMLA 1G9NL 4UU9A 3TVMA 5IK3A 4YXLL 2DKUA 4BK5A 3MV8B 1WBYA 3MLTB 4XPGL 3WS6C 4PLKD 2Y23A 4P46D 2RCSL 1QFUH 4X98A 2BHYA 5EZIL 3HUJB 2VXSL 3NCBB 3MODL 2HTKC 4ISVA 2Z91A 1Y18B 2H6PB 4R4NC 4BFBD 4Y2DD 1C16B 1CQYA 4JKKA 4OFVA 3MNVB 3GBMH 1B0RA 2JIXB 3GBLA 2Y5TB 1JHTB 1BJMA 1PVHA 4K7PL 3SJVB 2GAZB 5HYQB 2J7LA 4XI5D 4FHBD 4LP5A 5ADPL 1KLGB 1BECA 3LVEA 1IE5A 5GGVH 3OKOB 3T77A 2Z8VC 4YHPA 3TJEL 3K4ZA 1NBQA 5K9JH 3RBSA 4I77H 5JIHA 2KDGA 4OB5H 5D7LD 3RDTD 2GITA 2QKIB 4GG6B 2EH7H 4KKLD 1P4LA 1OT2A 4CBPA 4PB9L 3BKJH 1MFAH 5LAXB 3WIHA 4FZEH 1HIML 4YWGH 1AD0A 1NFDF 4F37F 1S7XA 3BI9X 5ANMA 4JZOB 4RNRB 2R2EB 5CINH 3UP1A 2DS4A 4G8IA 3TLRA 3UDWC 3REWA 5T3ZE 5KOMC 3TZVC 4NZTL 3O0RL 5SX5K 3ALPA 3E3QE 3X12B 1DP0A 4R26H 4N0UB 1MCPL 1AR2A 3FFCE 3PQYA 1NFDA 1QSEE 3L3HB 3OV6A 5F21B 2ED7A 4K9EL 2FEDC 1JNHA 5BRZD 4XNUH 3RUGB 4AEHH 5EOQH 3O2VL 1A6ZB 2WIMA 1TJIH 3EO0A 3T4YB 3QUYD 2A77H 5GGVY 1FNSL 4CMHC 4Z7NE 1XMWA 1GZPA 1QLFB 5DVKA 1G7QA 2AJVH 2GQHA 3EIFA 5JXAH 1DVFD 5ENWB 2E7HA 4PBVC 1Z5LA 4EOWH 2CLZB 5J89A 1I8MB 3IDNA 1VGEL 3ARGD 1HQ4B 15C8H 4FQ2L 3EYVB 4KUZL 3QNXA 3LS5H 1AE6H 3GJFH 1TPXB 1DN2A 4DN4H 1NUFA 2V2XB 1SYSB 3WIFB 1FZOB 1MVUB 2DLGA 4MCZA 5D1QC 5J9PA 3ARED 5LGHH 1RUML 3QIUD 2WIIA 4EI5B 2HWZH 2OL3H 3SPVA 2X40A 1ZLWK 3B6SB 1CDJA 4JY5H 2WBJA 3DXAB 4QCIB 2Z92A 5EOCL 1EFQA 4DGYH 1GHFL 5CJXA 2VLJE 1FIGH 3PWVA 4HF5H 3KLDA 4HIXH 5E2JA 3NOIA 5FYJD 1BFVH 3P9WB 4XVTL 3KLHC 1CG9A 3BIBX 1HCFX 2X4NA 1A3RL 4M43H 4KK6C 4PGBA 3IDYC 1YNTB 4P0DA 3DURB 1U93B 4PGDA 3LKRB 3CH8A 3BP4B 3LQAC 3VWKB 4PJ8B 4F9LC 1QBLL 2B7DT 1KNOB 5KVEL 4HKBB 2DQGH 4WHTB 4Y4KA 2VSDA 5MHSE 4I13B 1DLHA 5J11C 1MFEH 5IHLB 4UIKH 3L3OA 5CILH 4JO4L 3T2OA 3D39D 3OAUH 2RGSA 3QHFH 1KOAA 3BPLC 4FOMA 5C0CD 4GMTL 2AKRA 4DK3A 2FEEI 4DUVA 3UTTE 5DD3L 3IVKA 1W0WA 2E7BA 1MHPL 2IF7A 2YD1A 1BAFL 3VFUA 3T8XA 4LVNC 3QI9B 1IAIM 2ESVB 4X9IA 3IDXL 1X4ZA 3GHEH 3RJDA 4YFDB 3C60C 1JPST 3LAFA 1D5ZA 1LEGA 3QQ3A 4UNVA 3BP7B 4Z0XB 2BDNH 4KI5F 3CVIH 5I66B 3P9MA 4TVPL 2YN3A 4NRZB 1EJ6A 4HWEH 3LKOA 4IMKA 5EO0B 2VIRB 4XBEH 4RZCB 3HA0A 3HR5B 4DTGH 2FNBA 3LKQB 1ZT1B 4OGAC 3SDAA 4WTWA 3MACH 1XF3B 3CUPA 5FUOH 5C0IA 3LQAL 2EKSA 4J3XA 5AYUL 1ZS8A 2DLEA 5J56B 3WJJC 1F6AB 3H9YA 1KJ3H 3CFKA 4LSSL 1NCDL 1CICC 5EFIB 4HWZA 5GRXG 3IDIB 3T0EA 2FL5A 1N5AB 3E8UL 1KCKA 2YA2A 1ZLSL 3I2CL 1OGAB 1LE9B 1OAXL 3RY6A 2VLLB 2EDTA 4WUUA 1U6AL 1W0VA 1ZOXA 3GIZL 4DUWA 5HPMA 1H3UA 1XF2B 1T0MB 1ZLUH 2X4UB 3BH9A 4PRIB 2R8SH 4LLVB 2DQUL 5IB2A 2F53D 4S1DD 4M7ZC 5DJZA 3IDJB 2A9ML 2QR0A 1NCWL 3U1SH 4CUCA 4OF3A 1NSNH 2FZ3B 4HWUA 1N4XH 1A4KA 5T1LA 5F6IB 3QUML 1G7PA 3QXWA 1X5YA 5FDYA 3E6FA 4P5TD 4LCCB 2WWKT 3D9AL 3UX9B 1I1AB 5LJYH 5JNYA 5EU6D 1F90L 5DXWA 3KPQA 4R7NA 1DQJB 1I9EA 4GKNB 1OM3L 2V7HB 4ZDHB 3U46A 3TP4A 2H32A 4Y8DC 1FNGB 1ZSDA 1NLBH 1JV5A 2RHEA 1DQQA 4D9LL 1NGQH 1FAIH 4G9DA 4M6MH 3IJYA 3FB7B 4KK8C 1R5IA 1PAMA 5AAWA 2BZDA 2CUMA 1CVSC 1K8IA 4R9HA 3V0WL 5E8OA 3U79A 4WNQB 4NQED 2CH8A 3FRPA 4N9OB 5JPMB 2VABB 2P5WE 4JRYE 4L9DA 3MLWL 1WUNT 3PWPB 2I25N 1NBVL 3O2DH 1MCOH 1XGQB 3BQUC 1Q0XL 2BC4A 5KBNC 3CMOL 4URTB 1AP2A 4PY8I 4M6NH 5FA3A 3HB3D 5K33A 3OL2A 3UTQA 4QTHB 4NQVB 3LRGA 4LDEB 4YHLL 3GSNA 1EGJH 4NQDD 1JI1A 2UUDK 4C56D 1BJ1J 3UAJC 2AGJL 3NZ8A 2DMKA 1DLFH 3SQBA 3LRSA 3VI4E 5HYJE 2OXHA 5L7XH 3LB6D 4FQLL 2NX5A 4W81A 4FQCL 3OB0K 5KS9B 1QEWA 1RK1A 3U0PB 3ULVF 3UPRA 1KIPA 1A7NL 2N56A 5H37H 5C0AA 1A6AA 3CSBA 5ITBH 1A64A 1G7IB 4B7IA 1U8NB 3WNNA 4K3HA 5GS0L 5I1AB 2W0LA 2DQFB 4TTGA 3GSRA 4QT5A 4YGVA 1FZMA 2PYED 5EU3A 3B9AA 4XGZA 5GQBA 3PIQA 4APQD 2VQUA 5GRWA 4KVCL 3P30L 3EDJA 3K1DA 4FTVD 1EHLH 5CEXA 1V3LA 1IGTB 4ONHB 3QO1A 3QXVA 5I8EA 3DUUA 5C07B 1AQDA 2GK2A 1VHPA 4EXPX 4UIMA 5DRZA 3KJ6L 3MYJB 1LEIA 1U91A 1S7UA 1VACA 2HVKB 4NWTL 3UJIH 1HWGB 4JZNA 3MRJB 2DF3A 3INUL 1S5IH 3QEUA 1KLFA 3WFBL 1JRHH 1WEJH 2NY1B 2BOBB 3TNMA 4C55A 4P2YA 3K2UL 3FO1B 4X8JB 1F4HA 1OPGH 2Y06L 5DJCB 3D25A 1I3RB 3SDCD 1KG0A 4OTXH 1RU9H 2VDOH 2VZVA 4Z7UB 3KVQA 2UWEF 5I19H 2I9LB 1MRDL 5IESL 1HH6B 5AZ2H 5C0FA 4BJLA 3EOTL 4JFHE 2QADB 1QP1A 4OZFH 4P2OA 2BMKB 3EYQD 3KPPA 3BPNC 1X5FA 3QDME 4JFDA 4S0TD 4RGMB 2FEEL 4HJ0C 1GVIA 1ZWIA 4D9QE 1TLKA 2BNQB 1I3GL 3IFOA 2R23A 4ORZC 4HS6A 4QRPD 2OP4L 1OAUH 2UWEA 5D70L 2IALB 5JPNB 4YXHL 3STLA 3W11D 3OKEB 5GSRB 4RISL 5T5NF 3QWQB 2DQIL 2YD8A 3WHXA 4WI6A 5BS0D 2FIRT 2V5YA 2Y36H 3TBSB 3PWJB 5HHOD 4UB0H 2C1OA 4HHAB 4HIJA 4KDTA 4Y5VC 1S8DA 1CR9H 1Q72H 2QSVA 2WINB 4WHYG 2E7MA 4PJ7B 1J5OH 1K6QL 2Y6SD 1DN0B 4NPYA 2LU4A 1BOGB 2JJSC 3LCYA 2NY2B 5E2TL 4I9WE 3RA7H 4AT6A 1RIVH 5EC1A 2DQDL 3PWUA 1TPXC 2APWA 1K85A 5FHBL 5ICXA 2BFVL 3PHQB 4QHUB 5TGBA 2COQA 3P77B 5DWUL 1SEBB 4E5XB 3EFDL 2XIDA 3SKJH 1MJ8L 1K3IA 1AR1C 1TZIA 3KJ4C 5D96B 4LF3B 2YBRB 3HNVH 4Y1AE 5D1ZB 1CFSA 4OBSA 2PNDA 2CIKA 1MQKL 4HKXB 1NGWA 5E95B 3THMH 5JOPE 3FO0L 4OZGB 4G6AC 3VFVA 3V6ZB 1XIWA 3HUJE 3CFJB 5GS1B 4OJFL 1R3HB 1NQBA 1SBSL 3ZE2F 1XH3A 3H0TA 5JDJA 1BX2B 1YYLH 2FECL 1UWEH 3MOBH 2R9HD 4DCQB 5DJ6A 4G9FB 3BJ91 1Q9WB 3SJVE 5C0GA 2VDRH 3DV6A 5ITFB 2WBWB 2LU3A 4FQXA 2IG2H 4EI6B 3VFRA 4KPHL 5HHNB 5F8RC 5I16B 1YN7B 4JKLA 4PJXF 5J6HB 3EW3B 5CSZA 3QJHB 2K1MA 1UB5B 1JF1B 4FFZH 1M1SA 3FZUC 4YR6B 5DEZA 3X11A 3B43A 1INQA 1CE1H 5KTEH 3VXRA 1KB5H 1CFTB 3DROA 3PG2A 1R3JB 2W9DH 3BPOB 3LH2L 4YDKL 4X6EB 1X5AA 2NY4D 5EZOH 4HH8A 5DEGA 5GJSL 4GG6E 3C2AL 4QWWD 4OCXL 3UC0H 4PJXA 1SY6L 3B9DA 4MQXC 5JW5A 1MJ7L 3QI9C 4HMCA 1TJGL 5CIPA 1HN1A 4LSVL 1R3KA 3OAYK 3U36A 4GJTB 4P2QB 1INEH 2X42A 1U41A 1FRGH 2R1WA 5F88A 1LD9A 3O6LH 2ZCHH 5DVNA 5E4EC 5BMFH 4DGVH 4ALAH 2VISA 3VXSB 1ZHLB 2P8MB 3SKOA 3QPQD 3MUHL 5DA0B 1IZKA 3FQUB 5C6TL 1L7IL 3DARA 3P4OB 3WHE1 2G5BA 2GSGA 3BZDA 3CCHA 4JFEE 1ZTXL 3WD5H 1T5XB 2IGFH 5DURD 4HWNA 3O4LD 2CQVA 1P1ZB 5IEHB 3AVEA 3HAEA 1JGVH 1EHAA 4HK0B 5B38A 3U7WH 3ZDYF 4NWUL 3BPCA 2C3XA 4JZJB 3QZWB 4DVBA 1GRWA 2FX7L 2XWJB 2R1YA 5TQ0L 5IQ7L 4J4PC 2AQ2A 2CO6B 1NCTA 3MROB 2X4SB 3RDTB 1D9KD 3CH1A 4U6VH 4LSUH 1JVKA 4FMKA 5TDOA 1N0LA 3C8KB 1U8HB 1II4E 5HSFA 2IPTH 4A2LA 4B50A 4ZAKC 1R0AH 2VDKL 1VFAA 4R96B 2ZUUA 3WSQH 4CGTA 4R4FL 3T1FA 1LK3L 3FRUB 2W65B 5CBEB 5D7IB 3LZFH 3VRJA 1AKJA 4JFOA 5HDBE 5IOPA 1AJ7H 1KV3A 1MLBA 2AJYL 3EOYG 1RK0B 5F6IC 4ESKA 3QWOA 1YEEL 2PXYA 3MGTB 4WO4C 1ZA6B 1ZAGA 1S78D 2VO5A 2NYYD 3KHOA 1I75A 5BRZB 3MNWA 2Z31C 4GBXD 2R1XB 2CRIA 2EDYA 1BIIB 4N0YL 2ADJB 3WNKA 4D0DA 4K2UL 1F4XL 3K3QA 2E6QA 4OZIB 3GMNA 5KZCD 5D5MB 5FHAL 2YEZB 3QUYB 1YMME 4PJCA 1C12B 2DQCH 4Z7VF 4R2GD 1RUQH 1Q0YH 2OXGA 1CL7H 2DQEL 3OXRA 1VGKB 3OX8A 1DVFB 3U30B 1OF2B 2FHCA 3V52H 5BZWA 2Z93B 3TBYB 2OJEA 3GMMA 2VXUH 4K8RC 3ARGB 4Q58C 1XF4B 3NH7H 1VPOH 5E6IC 3MOAL 4JQIH 3NACH 4M7LH 4OFKA 4Z7VA 2E5EA 3X14A 4OLWH 1U8QB 4XVSH 3L5XH 4FQ1H 1MJJA 3P11L 1M7DA 3L6FB 4PD4K 1IC7L 4KHXH 3RTQD 4CN1A 1PW3A 1I4FA 12E8L 2H45A 2E9IA 3QP3A 4RDQG 3K80A 1UVQB 4YBLB 4JQVC 1QLRA 5H2BB 5FV2A 2RR3A 4I1NB 3RGHA 1BF8A 1CXIA 4ERSH 1A9BB 3U9UB 5F9DC 3BKMH 1C5CH 1R3IL 4FQIL 3EYUH 4BFIB 3I6LE 4Q9CA 1UWXK 1U8KA 1IKNA 4LRIC 3JUYA 3AC0A 3VRLF 4NT6A 1SQ2N 4L4TA 1DBBL 5CEZH 4JM4L 5GSVA 4LHUG 4Q9QH 3HI6L 5E03A 3MRBB 2CLVB 1O5DT 5F7WC 5DHYB 5DQDL 1FVCA 2HLAB 1I7TA 4MD5A 3BESR 1I1RA 2HFGH 4HCRA 2G2RB 4K8RL 3MO1B 1CT8A 3F7RA 1AY1L 4MHHI 3AS1A 1IM3B 4XNMA 4DK6A 2AEIT 3ARFB 5HBBA 2F19H 1JZ7A 1MPAL 3VH8B 4QNPF 2AI0L 4XCNB 2NY7H 4U1JA 3MUGB 1KPRA 3B9VA 3RZCB 4JQXC 2DWDA 3MLXL 5ESQA 2DAVA 1OL0A 4FQHA 3NA9H 3GB7A 5E9DA 5FECB 1WBXA 3SO3B 3WL9A 3G6DL 1KCSH 4PD4J 3L7FB 5EPMA 5CSGA 1BBJA 5C0BA 3ES6B 1FL5B 1PJ9A 4JFZH 3MMEA 4ZTOH 4MJIA 4MNQB 2VZ1A 5BV7H 4F33A 3LY6A 1C1EL 4PGEB 1KCVL 2Y07L 1G9EA 2AXGA 3HG1E 4U3CA 3MXWH 4DOHE 4EUPH 1MRCL 3WEXB 1V7MH 5DK2A 4P4KD 3ZKQD 3BFOA 1UM6H 3L3GA 5F93C 1RZGA 1AD9A 2QADC 5E94A 1I7RA 2I5YL 3RWIB 4IOSD 6FABH 4UTAH 2VDQH 4H5SA 3MRLA 1B0WA 1G6RA 1ITBB 1JMXA 1WAAE 2VZSA 1HEZB 4RGMC 1QFPA 1N0XH 3QDJA 2W9LA 2A9NL 3QDHA 1H5BB 5EC2B 2R0WH 3GO1H 3EKCA 2M1KA 1WZMA 2Q1EA 3OR6A 3MRGB 1L0QA 3DYMA 5IQ9A 3MJ6A 1GC1C 4JRXB 5DUBA 3KXFA 1AXSB 3L1OL 1EERB 5I74B 5SX4I 2LAGB 1I9JH 2XNAA 4WV1B 1AGEB 4ZUUA 4MQTB 5T33H 4U6YA 1TETH 1IGMH 4PGCA 4PTTB 3VXOB 2F53B 4BH7B 1F3DJ 4F2MB 4OD3L 4PYGA 4RRPA 3EFFA 2NTFB 4XC1L 2MMXA 4Z9KB 1OP9A 4LQFH 4XPBH 1JPGA 2RJMA 4MS8D 1X44A 5I1EL 5DI8B 4U05A 1YN6A 5E8NA 2VLRA 1UWGH 2JE8A 1FORL 2GYSA 1U42A 2VLKD 1LO3L 5IFAL 4G8GE 5J13C 1F4YL 1ZHNB 3DWTA 5EU6B 2LVCA 1G9ML 5KS9E 2I9TA 2D3VA 3ZZ1A 1T1YA 4X4YB 3L3JA 2V2TA 2V7NB 2PO6B 4XNZB 2GJ6B 1UJ3B 3GMOA 3PGDB 3MJ7B 1DANU 3C5ZD 4U4BA 5HHMB 4OFDA 4JVPA 2NNAB 4G6FD 1TVBB 1CK0L 5DMGC 1NCUA 3T0XA 2R0LL 1JNNL 1YA5A 5DVLA 1CDIA 1PY4A 3CFEB 5DHXB 1EHXA 4NZUL 4NQEB 4OCNC 5MEPB 1DQLH 5DQJA 2V5TA 1MNUL 1DQTA 3C5SB 1IGJA 5C0EA 3GGWB 3NIDF 3GRWH 3ARDA 2VUOA 1HHIB 1YECH 4OT1H 5I71C 4ZOBA 4QRUA 3WFDH 2Z4QA 1NAKL 4UZGA 5I17A 4LKCA 5TDNA 3PNWA 1ACYL 4Q9RH 1ZHKB 1Y6MR 1ONQA 1FFPB 1S7SA 3MYZA 4FFVC 4H1LH 5EUKB 5FGSA 3TH2T 1MY5A 2QQLL 4IRJC 2AV1B 2BY3A 2DQHH 4NQDB 2NW2A 3Q6FB 4JY4A 4C56B 1SEQH 3JTTA 5F7HA 1V5JA 5MP6L 5T1DL 3VXTA 2VDPL 1JPSL 5I8OL 4LMQI 3TO4C 1UH3A 5E6YA 2VN4A 5GGSB 4FA8A 3W39A 2X1WL 4W4NA 2ZKHH 3NABH 4M8VA 5ESVA 4NOBA 4ZG1A 4NO5A 3L3IA 3RPKA 1T66D 4NZRH 5JLZB 1CBVH 5DC9B 1FFNB 4X5LA 4J2XA 1A1OA 4UDUB 5FYKH 1NDMA 4LKXB 1K5NB 2D31B 3ULUF 4PLKC 1A1NB 3KYMB 4P46C 4FQQB 2YZ8A 4PJBF 5JOFA 2KQNA 3KYOB 1W8NA 4QXUL 4V2BA 1N6UA 4O5LL 4Y2DC 3TGXA 4FTVB 3VGHA 5B8CA 3IGAB 3GSXA 3D2UB 4KTEH 3VGFA 3KG5A 2HN7B 2MFNA 4XVJL 3V0VA 2VC2L 5HGAA 1Z3GL 2WM0A 4XI5C 3ZSTA 3GIVA 4PJBA 3AY4A 2F74A 4KUCF 3GSUA 2AK4A 4A6YH 2AJZB 1QRND 4YJZL 3C9NB 3PDOB 5I2IB 4PJ7E 3GNMH 4YO0B 2P24A 1NFIA 3RDTC 4YQXH 25C8L 4WW2F 4KKLC 3QO0B 4G8FA 3WXVL 2X44D 1UB6A 3EOAA 1ORSA 3MRCB 4Y4FB 4V1DB 1MCLA 1YPZF 2X2YA 3RIFF 4OLYL 2YSSA 2PTTB 2XN9B 4ZO9A 1J12A 4U1SB 1NGPL 5DD0L 3ULSB 4RSVA 4YXKL 1M4KA 1DFBH 1JN6A 4MB5A 3TN0D 4L4VA 4WW2A 1T20A 4CJ0A 3HMXL 1JF6A 4OZGE 3RNKA 3KS0H 3GI9H 4QRPB 4U33A 4D9RE 1YPZA 4AM0A 4KZEL 1BEYL 5JDSB 3RI5F 3VW3H 1BZQK 1I8LC 1IC1A 3O4OC 2WANA 4Z5RB 5HHVL 3VJ6B 4AEIH 5FO9B 3MNZA 1IFHL 5JW3H 3ZE1E 4BYHA 3O6FB 4G9FE 6CGTA 3QHTC 1D6VH 1CIDA 3QUYC 3Q6GH 4KY1H 3ZKSD 2DBLL 3OPZL 3BZEB 3MRNA 3HCVB 4X9FA 5HHOB 2VAAA 3VWJD 1TVHA 3FB6B 4P2CG 4WFHD 1DVFC 3U30C 3GMLB 4XP9H 5IK3B 1WBYB 3SGKC 1HOCB 2JJVA 3ARGC 3D3VD 4ZYKA 5BVPL 4L3AA 5FKAA 2N4IA 3QUXD 2VITA 1OP5H 1VFOA 5CZVH 4ISVB 2HFTA 2AAVA 4QRRA 3QG6B 3S34H 1IAIH 3RPIA 1OW0A 1T4KA 2LTQB 3MFFA 4ZFOA 1U8JA 3GKZA 3PP4L 4M62H 4X9HA 4JO1L 4K3JL 1ZGLP 1B0RB 5L2KE 2WP3O 1X7QA 4QXTB 5CAYB 4S2SA 3AREC 3GBNL 5EU5A 2HP4A 3QIUC 3GJEA 1IKNC 5C1MB 3T2QA 4AIXA 2GK0A 3MRRA 3NPZB 2FCBA 3T77B 1A14L 1JWUB 4WTZG 1JBJA 4JVUA 4XP6H 4U2YA 5GGRY 4P9HC 5T3XH 1L6ZA 3VXSE 4HGWB 4M6AA 5C2UB 4PS4H 5FK9A 2GITB 3ESUF 4NO3B 2ZCKH 5HVHB 5EZLA 3TJHD 4XCCL 4PJFB 1CDBA 1AD0B 4E42A 1MREL 5DLMH 5C70A 4LLWA 1IRAY 4QHNA 3SDYL 5HJ3A 2PW1B 1QG3A 3DUSA 3T65B 2GUOA 4G8IB 5AD0A 3OZ9H 3NBNA 4J3OC 2NLJA 3V4VH 2JB5L 1DBML 4DAGH 1YJDH 4OZ4B 1J0KA 3DO3A 3A6OA 4D3CH 1JWSB 4AG4H 2PKDA 3N1QC 4PJ5D 1HXMB 3NCJL 1VCAA 4JN1L 3IF1A 3PJSA 4LPXA 3S88L 4U1HA 5D7LE 3F65A 3PQYB 1NFDB 4FFWD 2R2CA 3EYSH 4F7TA 1QBMH 2D03L 3U9PL 1JNHB 1JPFA 1X5ZA 5GGUA 4M7JH 3SO3C 2XYCA 4ETQB 1MHHA 1MFCL 1ED3A 4W6XB 4O00A 1GZPB 4Y5XB 4PJEF 1MEXH 4KZDH 4QXGL 4P9HL 3EUUA 2PYFA 5EO9A 3GSQA 3IDNB 5TDPA 4XRCB 5F1SA 4YE4H 3O45A 3QNXB 4Y5YA 3ZT6A 1NCNA 5BRZE 1JUFA 2J6EL 1RZJC 5MEND 4PJEA 1ADQA 1YNLH 5BXFA 3T3MF 5D5ME 2NMSA 3O6ML 3ET9F 1R24A 4GW4A 4MCZB 4QRTA 5J9PB 2WIIB 5I1IL 1TQBB 3DMMA 1WZKA 1PDKA 2WBJB 4WUKH 4AIZA 2Z92B 3DRQB 2BVPA 2OL3A 1J1OL 3DSFH 1HE7A 4ZUSA 1Q9KA 3PWVB 3QXAA 3QULA 5CEZD 4J3VA 5DHVA 3VXMA 4WV1C 4X7TA 3BP5A 4M8QB 4BSWA 4LAJH 1K4DB 4R7DA 3ZKXC 4Y88A 1A2YA 2Q8AL 4PGBB 1JF5A 5T1KD 4LPWA 4S1DC 1QLEH 2ZCLL 1OARH 4PGDB 5HHQB 3FTGA 1CTNA 3KR3L 5HYFA 2HH0L 5GS2H 5F7DA 3N85L 5I15H 3LV3A 4JVWA 4Y4KB 4MWFA 1JL8A 5A2JH 1DUYA 1T1XA 1DLHB 3FT4A 3U4EB 4QHMB 4LAQH 3ZHDA 4P5TC 5FYJE 1RZJL 1NDGA 3IVKB 2JELH 1G9NH 4YXLH 5C08A 3HE6A 2YPVH 3DX8B 3EBAA 3H7BA 3N0PB 3T8XB 4MAUL 5KZCB 1FV1A 2RCSH 1KCLA 1MLCB 1A02N 5EZIH 4R2GB 2W0KA 2VXSH 5IROA 3MODH 5IFHH 1LEGB 1UJ3C 1F2QA 3QQ3B 1RQ5A 4WJ5A 2F5AL 2X1OA 2EDJA 1WFUA 4KK5D 3T0DA 5FO7A 4JN2A 3EAKA 2F8OA 1CFVL 3LKOB 4K7PH 1OAQL 4X6FA 2LVEA 5C0CE 2B4CC 3O3EA 3QT2A 1QFOA 3V0AC 2GTWA 3WFHB 2A73A 3F6IA 4L8CA 3SDAB 1TTGA 4L3ED 3RTQB 3CUPB 2E7CA 1ZS8B 3NFSH 3QWRA 3QG7H 5L2JA 3BHBA 3H9HA 3SGEH 2ICWB 1WJ3A 3HB3C 5IHUL 3CFKB 3PL6A 4M7KL 5HVFB 1NJ9A 3DIFB 3R4DA 1L4IA 4U49A 3QCVH 3FN0H 4PB9H 1HIMH 4KVNH 4NCC2 1WFNA 1PZUB 3DETD 1OTSD 3NIGF 3LB6C 1E4KC 3ARRA 4X6DE 1RHHB 4WUUB 3SCMA 4OCSL 3O0RH 1A7PL 3MC0A 1JIBA 3BH9B 1ZANL 4X4MA 2YRZA 4F57H 1O7SA 1MCPH 4XBGA 1MWAA 3MV7A 3SGJA 5IB2B 2IADA 5KW9H 1BZ9A 5DJZB 3SOBH 2QR0B 1IILE 3MLRL 4K9EH 4TRPL 1U8IA 3JWOC 4PJAF 2A6IB 4K7PY 1U3HA 3TIEB 5GRVL 2A2QT 1PKQA 2YC1A 1AGBA 1A4KB 4JDTL 4APQC 4DQOH 4JGMA 1KACB 1G7PB 2XKNA 1AO7A 1G7JA 3E6FB 1TZHA 2UY6A 1RZKH 2VKWA 4DKEL 4NKMB 2WUCH 1NMCB 4PJAA 4D0CA 4ONGH 1A5FH 4M3KB 1VGEH 2F53E 4JREB 3RIAK 4HBCH 2CK2A 3VXUD 5D7SH 3U46B 1NEZA 1CXFA 2IH3A 3UYPA 3Q1SL 2VR5A 4K7PX 2RB8A 2NXZB 4G9DB 3IJYB 1R5IB 1HZHL 4PRNA 4N0FB 4R4BB 2FO4B 1MCJA 2D7TH 5E8OB 3U0WH 3PGCA 1RUMH 1J0ZA 3SDCC 1BD2A 5EU6E 1D5MB 4K94L 3MA9L 1V8HA 1GHFH 4MX7A 5DJDA 1MFDL 4KTDL 3JWOL 2BC4B 3EYQC 4HV8B 1NMBH 3A6BL 3T0VA 5F7FA 3W0WA 2XQBL 1JP5A 4LDOB 4HS3A 1FYTD 4R90H 4UMGA 4BUHA 4MMZC 2XWTA 3MLUL 4Y19A 3EGSA 2K9UA 4GUPA 4ZPVB 3MLSH 3NIFE 4IRSD 4OCYL 4NQEE 3MQIA 3NZ8B 3BRGC 2VWEE 1EGJA 1DJSA 3LRSB 3T0BA 3W11C 3NAAH 2NY3D 5KVEH 9CGTA 1DCLA 3FOLA 4ZMAT 1UXSA 4ELKA 3OWEA 1U8PB 4NGHL 4NQXA 1QEWB 1RK1B 5FYKD 3UPRB 4Z78A 1N2RA 1DDHA 2HFFA 5C0AB 1A6AB 2X7LA 2BHZA 2Y6SC 1BAFH 5DJYB 5FF6B 4NQDE 4C56E 1E28B 3BXNB 3IDXH 1NC4A 3GSRB 1U8MA 4M7LT 1NBZB 4YGVB 4PJHF 5EU3B 2ZSWB 2OJZH 4XGZB 5HI4D 3PIQB 3U7YL 5C0ND 4LVHB 3ZHKA 3ARVA 5CEXB 4PJIE 4TVPH 1H0DA 3QQ4B 2BNRD 4JHAL 1AQDB 4LOUD 2FB4L 5JR1L 5FA4A 4UIMB 1IGIL 5DRZB 1LEIB 1TCMA 1U91B 3UBXI 1GOFA 2XA8L 2ICWI 4PLJD 4PJHA 3DO7B 4CL7A 2F54A 4JZNB 3HMWH 5ECJE 3QCTL 5JQ6L 32C2B 5C7XL 3QEUB 3GSWB 1WT5A 3TNMB 5IGXH 3D0LA 1TQCB 1UACH 1DUZA 4LSSH 1UZ6F 4FTVE 4M5YL 2R9HC 1FJ1A 4U1KA 4XP4H 3D25B 5HVHC 4XMPH 1A0QH 4OZFB 3E8UH 3QEQA 4LSQH 2KBGA 4LCWD 1ZLSH 2D4FA 3I2CH 4HC1H 2CRMA 5IJVA 5HDOA 3ZDZE 1A7QL 5TE7L 3ORJA 1N8ZB 4HIIA 4P2OB 1U6AH 3V8OA 1UKTA 1Z0MA 2XZAH 3KPPB 3O8XD 4JFDB 2PN5A 5D2LE 4JJ5B 4Z7OE 1ZWIB 2DQUH 4X5WB 2NY4C 4HS6B 4I18C 2UWEB 5C0JB 2FRGP 4YHNB 2X4RA 4QWWC 3MRPA 1A3LH 2P5ED 1NCWH 5KSAD 5F89A 3RJQB 3QIBA 4TNWF 3STLB 3OKMA 2X4TB 3D0VA 3LPFA 4PGZA 5K9JL 4U1IA 2Q76A 4EKXA 5AUMA 2L4OA 4OB5L 1UJTA 5GGTA 2XG4A 4HIJB 4Y5XC 1VEMA 5JO5A 2EH7L 4AYFA 5E8EA 3G6JF 3BKJL 1MFAL 1QHPA 4FZEL 1F90H 3V5DA 1VADA 1MF2H 4NPYB 3TA3A 4QRPE 3QPQC 4AT6B 1WCQA 5EC1B 3D69A 4NIKB 5CINL 2ZUTA 3NGBB 2WNGA 4P59L 5ICXB 5TGBB 4D9LH 4X7SH 1A3QA 1XAUA 1CFNA 5IVXB 2VDLH 5D7JA 3VXQA 3G6JA 3SDDD 5BS0E 1T03L 1FBIL 1TZIB 3V0WH 4OCRL 1ETZB 1DL7L 5HHOE 3OR7A 4W4OA 2BSRB 2BVQA 8FABA 1CFSB 4MB4A 3LQZB 4JM2D 5F44A 4AEHL 4GW5A 1NGWB 5EOQL 5T3XD 1RJZA 5JXEA 5AWNH 5DYOB 3TT1L 3CAFA 1NBVH 3DOSA 4OZHE 2C1PA 1TJIL 4Y4HD 5J1SC 1D9KC 2OK0H 2A77L 1Q0XH 3LPGA 3L5IA 5F1OB 2HTLD 5IIEA 3H0TB 3BGAA 2B20A 3QSKB 5DJ6B 4GXVL 4EOWL 3ISWA 2DYPA 3KPSD 5E08L 3WNPA 3I75A 2BVOA 5C0GB 5ISZA 5E0QA 3DV6B 2AGJH 2DLFL 4FQXB 1NAMA 4MXVF 1AE6L 2APVA 5CSZB 4CADA 3FFDA 4FQLH 4HUUA 3B2VL 3X11B 4FQCH 4DN4L 1INQB 4X80L 1CGUA 1S78C 1ZVSA 2NYYC 2XTJB 5I18H 4NO2A 2A74A 1A7NH 4GBXC 5LGHL 4Q6YA 2BX5A 1T1WA 4L8SC 1IEAA 2HWZL 5DEGB 4PJDF 1S7RA 3QFDB 3K46A 4YLQT 4PJXB 3BE1L 4G8EB 5JW5B 4KDWA 5GS0H 4LP4A 4Y16A 4K23L 4PJFE 2HMID 5IB4A 4R2GC 4DW2L 1R3KB 4IDLA 3U36B 4WWKA 3EDFA 3CFIC 3PDGA 3P30H 3IAGC 2R1WB 2Q6WA 1K4CA 1JRHI 3IU3B 2FLBT 3VMOA 5HPOA 2NW3A 4CMMA 4M4RA 4HIEA 2DL9A 3PDDA 2X9XA 1EO5A 3KJ6H 3SKOB 4NWTH 5IMOA 2DIJA 3M45A 5F6HI 2G5BB 2GSGB 5T5NG 3CCHB 3RTQC 4OQTH 4DEPB 3INUH 1HHGA 4YX2L 3WFBH 3OAUL 3QHFL 5FOJA 1F58L 3HAEB 4PRHA 4J3UA 3K2UH 1JZ5A 5B38B 2ZUYA 2Y06H 3BPCB 5F1IA 4ZXBD 4RGNB 5ID1A 4DVBB 5IESH 2R1YB 1I8IB 5IW1A 5TF0A 3EOTH 2BDNL 4WHDA 3ZTNL 5C8JA 4J6RL 3QUZA 4O4YL 3F7PC 3F58L 1FE8H 3G5YA 4YEEA 5TDOB 5D2NA 4XBEL 4LVOB 1A6UH 3O4LE 5GS2D 3QDGA 1ZLWH 3EO1A 2M8XA 1P4BH 5D70H 3T1FB 4DTGL 5KSVB 2EZ0D 3VDBA 2CUHA 4JFOB 4RISH 4QRQA 5DMIL 1KENL 3IJSA 2DQIH 1T21A 1Q94A 1J8HD 3GSOA 3QWOB 2JCCF 4NO0A 1WQVT 2HT3D 2PXYB 3LN4A 4PREA 5F72S 3UO1H 4F7PA 2B1AH 3F7VA 3L5JA 3MV11 4RX4A 5GZOD 4NQCD 1I3UA 1KT2A 4Q74A 4GRMA 3MNWB 2AEPL 2JK5A 3STBA 1NMCC 4PBWD 3ZYIA 4D0DB 5DD5H 1U92B 1KXTB 1ZHBA 4NHCH 5E2TH 2JCCA 1BZ7A 3S4SB 1N5YH 3OXRB 3Q5OA 3OX8B 5C6WH 5DWUH 5BZWB 3EFDH 5TE4L 5BO1L 2R8SL 3GMMB 3KWWA 2IPKA 2AERT 1KJ2A 4NQTA 1EEQA 3VFNB 3DX6B 4GQ9H 4L3CA 4GAYB 4Z7VB 4P4KC 2OQJA 3X14B 1MQKH 3KPNB 3TM6A 4UOW0 4KRPB 3FO0H 1MJJB 1N4XL 3G04A 3OF6A 1IEBA 1MFBH 1AHWB 2R39A 2G75A 1U3JA 3CSYA 4JG1H 3UCRA 4OJFH 1SBSH 3P0YL 4D94A 1WFOA 3CXHJ 3B9KA 4BFGA 1YYML 4GQPH 2ZOKA 4WTXA 3CLFL 1EUUA 3B5HA 5FGBC 4XHJD 5SWSA 4KPHH 1U8KB 3WFEL 1EZVY 2OTPA 4WCYL 1NLBL 1NGQL 4LSPH 1RPQA 1U8LA 4NT6B 4L4TB 3JTSA 5T1KB 1IC4H 4FABL 4L8DA 5GSVB 1YEJL 1P69B 3LH2H 4YDKH 4I4WB 4MD5B 2YD4A 4JRWA 3HI5H 2D9CA 4G6KH 5I9QC 1CDCA 5GJSH 3TWCL 4MS8C 1CT8B 4KJPD 1MCCA 3G5VB 4OCXH 4IIQA 5DFWH 4AEFA 2MJWA 4CW1A 1MJ7H 1CD8A 4WU7B 3SY0A 1MCOL 4LLYA 3OJMB 4LSVH 3O3DA 3HLAA 4N9GA 1OSPL 4H88L 3SDXF 4M6NL 3TNNA 1EZVX 4HUWB 4YHIA 1KPRB 2YUVA 1RMFH 4KI1A 2DWDB 2Z35A 3H9SA 4Z77A 1LP9F 5E9DB 1WBXB 3WL9B 1DLFL 3ARSA 3BSZH 3C5ZC 1SJHB 5EPMB 4L1HA 1VSCA 1BBJB 5C0BB 1BJ1H 5L7XL 5C6TH 4TUOA 3SDXA 3FO2A 5F3BA 4MJIB 4F33B 2EDBA 5SWQA 1ZTXH 4PRPD 3TCLA 1LP9A 4EN3A 2AXGB 4OFIA 4X7EC 2W0PA 5ITBL 1LDSA 4HUKB 3D85A 4NNPH 2YK1H 1N64H 5DK2B 4L3EB 2XWBA 5D6DA 1LK2A 1NBYA 2FX7H 3L3GB 5F96L 3RGVD 3WDHA 4BZ2H 1RZGB 1BQHG 5B39G 5CKGA 5E94B 1HXYA 1I7RB 4LLQA 1RJCA 2C3HA 1EHLL 1ODAA 4JFFD 1R5WA 1MH5B 3ULVL 3BD3A 3OKNA 3I3DA 4KQ4L 1QSFA 5J1AA 3LN5A 3CDCA 3JBG7 4LASL 1RZ7H 4MA8L 5DUBB 1LK3H 1BVLA 1I9RH 3KXFB 4PJ9D 5B22A 1WTLA 2OI9B 2HYMA 3VFWA 2XNAB 4GG8A 3VFPA 4MNGA 1T66C 5C0DA 1S5IL 4U6YB 4PGCB 1CL7I 1JRHL 4TULL 3QCUL 2E7LA 4FZ8L 4NC1E 2EDHA 1EDQA 4PPTA 4UILH 1MCKA 2RIKA 3L3DA 4OTXL 4N0YH 1JPGB 1EAPB 4KFZC 3P3YA 4K2UH 3SGDH 1F4XH 1RU9L 5I19L 1YN6B 1TCRA 5FHAH 2VLRB 5KVDL 1GGCL 4U1GC 4J1UA 1MCFA 4TVPD 4NDMA 5C09A 3OB0H 4F7CA 1OY3B 2DQEH 1JCKA 2B2XH 1RIHL 2CO7B 4GRWF 5CZKA 1P2CA 5HHPB 2I9TB 4U6HB 1BFTA 4ZNEA 2V2TB 5IWLA 5CP3A 1OAUL 5ACZA 1I8KB 2D7PA 4U7KA 3GMOB 5D1XA 3SE3C 3P73A 2YPKA 4ODHL 1RHFA 2OBGA 2EC9T 2BRRL 1IC7H 4UBDD 2E6JA 4I0PD 4WI7A 1G0YR 12E8H 1VB9A 2Y36L 5DQJB 4UB0L 2A6DA 1IGJB 5C0EB 1C7SA 3VFTA 4RBPH 3HE7A 3F6LA 4H1LB 5I0ZA 1J5OL 2Z4QB 3MBXH 5I17B 4S10A 1R3IH 2QSQA 3QIWA 2ZUQB 5FO8A 4EVNB 1RIVL 1S7SB 4I5BA 2PW2A 3TN0C 3M1BA 1FFRA 1MCHA 3V7AG 3G9VA 1FDLH 3LEVH 5DC0A 4OF0A 4P2RD 5DSCB 2NW2B 4JY4B 3Q3GB 3OGCA 4LU5L 3JTTB 3HI6H 4Q2ZA 1JZ3A 1MOEA 4MA3A 3VXTB 5EULV 1CGTA 3ARBD 4YHZL 4E41D 3KPRD 2NY3B 1PG7L 4HW6A 4LARL 3W39B 5CD5D 5FDWA 2CKBH 3THML 2CSPA 5ESVB 4MB3A 2B5IC 2DQTH 2WSKA 3LKSB 4LBEB 3VWJC 2Q86A 3CMGA 1A1OB 1FFOB 1YYLL 1JFQH 1NDMB 4FXGA 1S5HB 4I3SH 2ARJQ 3ARXA 3OJ2C 4RRPG 4J7RA 1ZMYA 3QUXC 5JOFB 3AS3A 3KGRA 2YA1A 3F5WB 1ND0A 3E1F1 2FSEB 2IG2L 4LRNH 4PG2C 3CFBB 1EVTC 5KSBF 5B8CB 1YY9D 4UDTA 4FFZL 1XGRA 1OAKH 5IJKA 1CE1L 3V0VB 4A6YB 5KTEL 4HKJA 5HGAB 3UTZA 1KB5L 3GIVB 4PJBB 3E2HC 2F74B 2FJGA 1BQLH 2FJFA 3GSUB 5ERWA 5EZOL 1WIPA 1CLYH 4HPOL 5KSBA 3EJJX 4WHYH 3SKNA 3BGMA 3RWDA 2O5XL 1B2WL 5DDHA 1BBDH 1NFIB 4YDLB 5GXBB 3I9GH 3QEGL 3WE6B 1Q8MA 1FRGL 3S96B 4G8FB 3NPSC 3TJHC 3O6LL 1UB6B 2ZCHL 3EOAB 1N7MH 1ORSB 1P9MA 4DGVL 2EIEA 5JZ7D 5IVXE 1SYVB 4DKFH 2YSSB 5L8KB 3K4AA 1KCRL 3LSOA 5AAMA 1QRNE 1JN6B 2JKXA 1H3WM 1NC2D 4DGIL 3L1OH 4NBYB 3QDMD 4WW2B 4NRYB 3V7MA 3TT3L 3WD5L 5ICYA 2CDEA 4M1GL 1YPZB 4JGJA 4FFWC 4LSDA 2IANA 3AMKA 4XC1H 3S3SA 5GS0D 1VFUA 3RL2A 1OTUD 3MNZB 4P3DA 4BUGA 3CVHH 3TIDB 4HAGA 3KDMB 3FB5B 1Q9LB 2BOCA 1NCBH 4ACPA 5HGDA 2VAAB 2QQKL 1LO3H 2J4WL 5AG9A 5IFAH 4NHUA 4U6VL 4NQSB 4LSUL 4NNYA 3GSVB 1V3MA 4GMSL 4YH6A 2CRYA 1G9MH 3N50A 4XWOD 5DRNB 2IPTL 4ZYKB 1T5WB 2EKJA 1XCTB 3I3EA 5FKAB 2AJ3B 1R0AL 1GXEA 2R4RH 3WSQL 4PP2A 2FH8A 4MMXC 4AZ8A 4QRRB 2DDQH 3LZFL 2K3TA 3MFFB 1T4KB 1UZ8A 2VR4A 4ZFOB 1U8JB 2JB6A 3OAYH 1CK0H 1AJ7L 1AHWC 4ODWA 3SDDB 1ULVA 2R0LH 1JNNH 3I6KB 5DT1H 1QFWL 1X7QB 4GRLD 4S2SB 3R06A 4NZUH 1WWCA 5TE6H 5EU5B 1UFUA 3GJEB 1MNUH 4OFYA 1AGDB 4WFHE 4N90D 3VI3F 2W0FA 2GK0B 1DE4A 5TQ2H 3MV8D 1RV6X 4QF1B 1NAKH 2VL5A 4RCAA 3NTCH 2DQCL 1RUQL 4YFEA 1Q0YL 4JO2H 4KXZH 4C83A 3IXAA 5CHNB 2ED9A 4PGJA 2QQLH 4U3XA 3QNZA 1HSBB 1UM4L 5EZLB 2VXUL 2JIXD 4E42B 1VPOL 3SJVD 5T1DH 1YEIL 2VDPH 4JQIL 4QHNB 5HJ3B 1FHGA 3JVGA 4TYUA 3DUSB 2CKNA 2GUOB 5J8OA 5AD0B 2GCYA 2NLJB 4FQ1L 3GI8H 1VENA 3VRIB 4RGNE 4KHXL 4YFLF 4RFEA 2EE9A 1IAKA 4UQ2A 1BLNA 3C09C 1FL6A 3CX5K 3PJSB 4DVRH 3P4NB 3KYNA 1BJ8A 4OV6F 5BCAA 2Y7QA 5LKNA 5IKCA 2C26A 1NL0H 3RU8L 4F7TB 3BEWA 3BDBA 4RIRA 1J0YA 5GGUB 4ERSL 3MRIA 2YN5A 3ZDYE 4V2CB 4EZMA 3NZHL 4KQ3H 4POZD 1CS6A 3EYUL 4QXUH 2KZWA 5BV7C 3MRFA 4CVWA 4JPWL 4O5LH 1MHHB 3EZ8A 1ED3B 4KK5C 2RBLA 2MCG1 2PYFB 3LEXB 1ES0A 4PJ5E 4Q9QL 5I1LA 1UM5L 3C6LA 3I02A 5K59F 2IWGA 2HVJA 5J4MA 3FO9A 5CZXD 1F2XK 2HFGL 3RI5K 3VGBA 1HYSD 4R6UA 3I50H 3JV4B 2UYLA 5DEFA 5FV1L 2LQRA 1XF5B 4PJEB 1URLA 1KBGH 4TSBH 4HCRL 5BXFB 2F19L 1A7OH 1ITCA 1R24B 4GW4B 1OP3H 3RL1A 4C58B 25C8H 2VDML 3O9WA 4RDQF 3WXVH 5LQBL 4QHLA 3I6GA 3V4UL 4ZXBB 3UJTL 3T4AB 3HZVA 4GKZA 4AIZB 2BVPB 3NA9L 3SBWA 4OLYH 4ZUSB 2YZ1A 1KCSL 1OTSC 3DETC 4JCMA 1Q9KB 3IETA 5J6GA 4P49A 1MFNA 3QXAB 1K8DA 3QULB 3CX5J 4Z7VE 4P57B 3VFMA 4JFZL 2FIKA 5DHVB 4ZTOL 2IH1A 4LNRA 2YD5A 3VXMB 5MENE 5BV7L 4BSWB 4U0RB 5IEKB 3HS0A 1KGCD 3DVNA 1JHKL 4R7DB 1A2YB 4QYOB 2YRPA 5F7YC 2WUBL 3MPCA 4X99B 4KZEH 1BEYH 3PHOA 3VG0H 4MJ6A 1TDQA 2OSLA 3FTGB 1Y0LB 4EI5D 5IHZA 5F7DB 5HHVH 5K9QI 1UH4A 1IFHH 3BO8A 2DTML 4MWFB 3CDFA 3DXAD 5DGQA 1DUYB 4NKIH 4XCEA 4YC2C 4OUUA 5HHXL 2ZPKH 1IAII 2DBLH 4PYHA 3FL7A 3MBED 4NQCB 6FABL 5CEZE 2OCFD 1NDGB 4M3JA 3C6SA 4GOSA 5C08B 3HE6B 4L4TE 1N0XL 3H7BB 2OR8A 4Z18A 1FV1B 4FG6C 1RJLA 4L9LA 3GO1L 4Z7NF 3FFCA 5C71A 1QSEA 3LQMA 1EFXA 3REVB 3VWKD 2ZG1A 4HUNB 4PJ8D 1ZVHA 1W72A 4G42B 4KKCD 3PP4H 5FO7B 3FONA 1F6FB 3GM8A 2IAMD 4XAWL 5T33L 3MR9A 5BQ7B 1IGML 4JR9H 3VRLE 3ETBF 4OGZA 3MRMA 3QR2A 1FQ9C 3GBNH 5TJWK 3O3EB 1C5BH 3QAZB 1F3DH 2Z9TA 4LQFL 4AH2A 3PGFL 4JCLA 2GTWB 4L8CB 3RWHA 4LCUA 1A14H 2GT9B 4L5FL 1EPFA 2ESVD 3FQXA 5L2JB 3CJJA 2YUWA 1T2QH 3PL6B 1XCQB 1NJ9B 3VXPB 4KKAD 4H8WL 3BD4A 3HZKA 4IRSC 3MRQA 2EEBA 1MREH 4RAVA 5DVMA 1I9IH 5KJRH 2GY7B 1RUKL 2Q7NA 2NY3C 4FXKA 4K71C 4RQQB 1XR8A 4L3EE 2JB5H 4ODXA 5DJ0A 3V2AR 3WS6A 5F7KC 2AJUL 2ADGB 2VLJA 5DZNA 1P7QA 4PUBH 3NCJH 1MWAB 3MV7B 2HAZA 2D7OA 1DQLL 2IADB 3O11A 4U6XA 2X89A 1BZ9B 4G3YH 1AXTH 1TNMA 1HH9B 4JPIA 2D03H 5IF0A 2P45B 1HCVA 1YECL 3X13A 4F7MA 4ZNCD 2NY0B 1U3HB 1U36A 3DHMA 4NN6C 3HRZB 2YC1B 5HI4C 1OGAD 4XNQA 3HNTH 1NGYA 1ZA3A 5C0NC 2XKNB 4MAYD 1G7JB 3KXFE 4M03A 1TZHB 5I1JL 4HGKC 3V6OC 1I7ZA 2DQHL 4LOUC 1WC7A 2VTFA 4PJAB 3HN3A 2CLRA 4PRID 3WKNA 4PRDB 2AEQL 4P23D 3T04D 1RY7B 4PLJC 1S7VA 2YXFA 4OIBA 3UTTA 1KTRL 5T5FL 5BVJA 3E6HA 1NEZB 2IH3B 2J6EH 4C54A 2AP2A 2DRUA 2ZKHL 3NABL 3QISA 3UTPD 4YZFE 4PRPB 5EDXA 2B8OT 1D5BA 3OAZK 1LQSR 4K3EH 4MXWL 5KANI 2GKIA 3BZ4A 1KYOK 2DM3A 3PGCB 4P48A 4YPGA 3UDWA 2BRQA 3WNOA 1BD2B 4WEUD 3TZVA 1I1AD 4N5UA 4NKDA 4NSKA 4ZOCA 3RGVB 1KPUA 5HD8D 1J1OH 4MX7B 3MJ9H 1K3ZA 4CVZB 3DTXA 3VXUE 4N8CL 2Y1VA 1FG9C 1E6OL 3T3PE 5IB1A 5D7KE 3O8XC 5EA0H 1Z2KA 4KTEL 2BSED 2LE9A 4YHOL 2QQNH 2VQ1A 2Q8AH 3RNQA 4GUPB 2ZCLH 2X1PA 2EIDA 4A6YL 5KSAC 3T08A 3ULUL 3KR3H 4TN9A 3EOBA 2FHBA 3UBXG 4U1MA 3FOLB 1UXSB 3GNML 2VE6B 3PWPD 4ELKB 3KPTA 1KJMA 1WICA 5IBTL 4Z78B 1D3CA 1N2RB 1DDHB 2HFFB 3TC9A 3OKDA 4IOFD 5CKAA 5B3JF 1W2KT 3V6FA 1A4JB 1FYTE 2ADIA 1QKZL 5DZLA 2WQRA 1LWRA 4HMDA 1ZLUK 3TBWA 3TH4T 3RX7A 1NC4B 1U8MB 3P4MA 5D1QA 5JHLL 1ZE3C 1QQDA 2A6JB 5ALBH 1QFWM 1ZEAH 1R3LA 1FN4A 1KYOJ 2B1HH 4KAQH 3RWFA 3SGEI 3SDDC 4ELMB 5FYKE 1CFVH 3IXTA 4X7FC 3ZDXE 5JA9A 1OAQH 4OIIL 1FVDA 5E70A 3VW3L 3LKPA 3DJ9A 5J3HD 4JM2C 4AEIL 4N8VG 4BK4A 5JW3L 2F54B 3DSNA 4HJJL 3D1MC 4Y4HC 1JNLH 3B9EA 2PCPA 1NEZG 3OKYA 3QQNA 4WFFD 4Z6AT 3WN5B 4KY1L 1JZ8A 5ICZA 3D0LB 2HTLC 4HLZH 3GZKA 3IS1X 5F9OL 1DUZB 4F9LA 1N3NA 4M7KH 1OD7A 2XOTA 4U1KB 1U95A 4XP9L 2BNRE 3V6OE 2V6HA 3P9LA 5C07D 4LSTL 1OVZA 5IUSA 1JMZA 1YJDC 1MI5D 2HJLA 5IJVB 2MHAA 2P42B 3IJHB 2P5WA 4HIIB 4JRYA 4JHWL 4EDWL 3RHWF 4P2RB 2FBOJ 1A7PH 5DJ2A 3VI4F 3HC4H 4ZFOL 3C60A 5IW6A 5H35A 2NY1D 1QACA 4JDZA 5CGTA 4U1LB 1KJVA 2B0SL 2X4RB 1INDL 3KPRB 3MV9A 4NC0B 3MRPB 3MLRH 5F89B 4TSCL 1F11A 1CDGA 3PUCA 5JHDA 3OKMB 2HMIC 3VMPA 2MTPA 4LCWE 1QYGH 4LIQH 1QR4A 3D0VB 3ZL4L 3W9DA 3WUWB 3CD4A 4JDTH 1FL3A 4U1IB 5AUMB 4HZLA 1S7WA 5HYJA 5IB3A 3RFZC 1TJHL 5DRXA 1WZLA 3QUMA 2VSCA 2ZCKL 4DKEH 5E8EB 4XPFH 1G7HA 1QBAA 1CDUA 2ICCA 2N7AA 1H8OA 1E4XL 1VADB 5LWYH 3RVVD 3WJJA 4DN3H 2BNQD 1G7LA 5CJQL 2EO9A 4GKSA 4YBQD 2P5EE 5H37G 1FZJB 3D69B 1CICA 1JYWA 3QB7C 3OZ9L 1YEDB 2W38A 4I8DA 4D3CL 4I0CC 1HZHH 3VXQB 3G6JB 4P5MB 3BGFC 1IT9L 1UT9A 2BVQB 2W60A 8FABB 1T3FA 5B4MD 2BNUB 4QTIL 4ZXBC 2CR6A 4KROB 5FAAA 4NUJA 3B8YA 2NPLX 4GW5B 1RJZB 4RFOH 1VEPA 4K94H 5F7LB 2AEWA 5HY9A 2C1PB 2NY2D 1MFDH 3A6BH 3FT2A 1GGUA 1FNEB 3RKPA 5IIEB 1MEXL 4KZDL 3GMPB 3FQWB 3B8SA 5E5MA 4Z7WE 4O2EA 3KLAB 4WI4A 5F1NA 3FN9A 3IAPA 2C3VA 2KKQA 4YE4L 4OCYH 5ISZB 5A16B 4WTZA 4TUKL 2EZ0C 3NCYS 4XWGL 5D1ZD 3F7YB 1FVEA 2AQ1A 2JLLA 3FFDB 5E6ZA 5T3XE 3F7QA 2BSSB 4HUUB 3F62A 3E3QC 1HHHA 4C4KO 1N26A 4ZFGL 5FCUH 4NP4L 2IBBA 1G9NC 2HT3C 1G7MB 5D9SA 3ZT5A 1KC5L 5A3ID 4D9RD 5GZOC 4X4ZA 1ZVSB 2A74B 4I2XB 1ADQL 4IMLA 1T1WB 2FJHA 1UEYA 1GL4B 1S7RB 4WUKL 3KPSE 5EO1A 3DSFL 2J1KA 5F3HA 5IB4B 4QHKI 5I8CA 4FQJH 3NFNB 3WCYA 5I1KL 3U7YH 5L8JB 2MQCA 3LEYH 5ETUA 2Q6WB 2YPLA 4PJDB 4CMMB 4JHAH 2A6KA 4HIEB 1RAMA 2DLTA 1A9EA 1EEZA 4K7FA 3BQUA 2FB4H 5JR1H 1IGIH 4NM8H 2XA8H 4ORGB 3QAZC 3UTSD 4Q7DA 5IMOB 4UAOC 1JZ2A 3VFSA 1Q9OB 3QCTH 5JQ6H 5LGJA 1M7IB 4WU5B 4F9PC 4LAQL 3BZFA 2XZZA 4PRHB 4P2QD 2JELL 4L8BA 1M6OB 2I07A 4HKZA 1P53A 2YPVL 5T1MA 5F1IB 2HKFH 3HUJF 3QJFB 4FFYL 4XHJC 5ID1B 5IFHL 3TPUA 3KNBA 4HFWA 1WLHA 4Y1AA 3VXSD 1A7QH 5TE7H 5C8JB 4UV7H 1A6WH 4ZUWB 5C0RL 3C8HA 2P48B 3VG9B 4K9EC 5D2NB 3VXNA 3HUJA 4WRLA 5D93B 2F58H 3QDGB 4GXUM 3EO1B 3ZLQC 1Y18A 4KJPC 5IMKA 1C16A 1RULL 3SQOL 1RZKC 4QRQB 2GAZA 1T21B 2C4FT 2VB5A 1Q94B 3NFSL 3GSOB 4NO0B 43CAA 3QG7L 4GG6F 4F7PB 4UT9H 1KT2B 3FHAA 4LHUD 2Y5EA 3OKOA 3VXME 1C8PA 3QCVL 1N59A 2JK5B 3FN0L 1MCBA 4RMRA 2E6PA 1CQKA 4KVNL 3LD8C 3ROOB 2QKIA 2JCCB 3WIHH 4GG6A 2WZPD 1UQSA 4P59H 5INDA 4LFHG 4CDHA 5JIKA 3PXHA 1J8HE 4F57L 2IPKB 1KJ2B 1T03H 1FBIH 4OCRH 4RNRA 1DL7H 5KW9L 4NQCE 3SOBL 4L3CB 3K8LA 3WS3A 1BFOA 3U4BH 5HYEA 3RGVC 3X12A 3TT1H 3G04B 1SVCP 2FX8L 3CXDH 1JE6A 4DQOL 2FO1A 3CSYB 2IBZY 3L3HA 1JPTL 3AFLA 4UUJA 1QNZH 1RZKL 5HYSG 3B9KB 4TNVF 2WUCL 4JFEA 4UINH 1OHQA 4GXVH 1QPPA 5E08H 4HULB 4ONGL 1A5FL 1NGXB 1CXLA 5HVWA 2ZP0T 3VD5A 4HBCL 2DLFH 4PJ9C 1KIQA 5D7SL 2ARWA 1QLFA 4Y5VA 5SWSB 3D6GA 2X10A 2DMBA 3B2VH 5ENWA 1JZ6A 1U8LB 2CIIB 4MVBD 3JTSB 4JPVL 5JA8B 5L8LB 3ARYA 2Z8RA 3IAQA 4L8DB 4X80H 2JJSA 1JI2A 2HLFD 2D7TL 2IBZX 4J8RA 3U0WL 3O3UN 1T04A 5JOEA 5GS3A 4IIQB 4F80A 43C9A 2OM5A 3ARWA 3BE1H 4CW1B 3ALWA 3U4AA 4HWBL 4K23H 3SY0B 3LIZH 3MBEB 4DW2H 4YBHA 2PETA 3O3DB 1SY6A 3HLAB 1ORQA 1NMBL 3TYFA 1P5UA 3TNNB 2BY1A 4YHIB 3CC5B 2HJFB 3H9SB 4R90L 2DLIA 3FCTB 3RIAF 3MLSL 3UXFA 5IV2A 4XPAH 3NAAL 3QPXH 5IW3A 3NIGE 3SDXB 4TUOB 1FC2D 3FO2B 2IAMB 4UBDC 2DJSA 3IFLL 4I0PC 1S3KL 5SWQB 2V17H 1YNTA 3WN5C 2R69H 1YMMA 4YX2H 4QOKD 3TCLB 3ARFD 1LP9B 1F58H 3WJLC 1IM9D 1YMHA 4PB0H 4HKBA 1XGYH 4BA8A 1YQ2A 4NUGL 1CU4H 2XWBB 3RZCD 1I1YA 1NBYB 4RGOL 1FNAA 3VCLA 2R2HA 2OJZL 4JKPL 1HXYB 3H6JA 3ZTNH 4M93C 4DJMA 2GY5A 5HDLA 4J6RH 4JFQA 4O4YH 1R5WB 2QV2A 3F58H 1C5DB 4MNQD 2XA3A 4RWYL 2VN7A 4PRPE 3QI9A 1QSFB 4ZS6D 5HGBB 3ARBC 4B0MM 3L95B 1KN2H 4EIZC 1YEFL 3BP7A 3IKKA 5I1DA 5MEOB 4Z95H 5CD5C 3OB8A 5I66A 1BVLB 4NZDA 3HMWL 4Z7QE 3WNMA 3VFPB 5HDQL 5DMIH 5HGGS 1KENH 2O5YL 2AS5M 3FAXA 5IGXL 1UACL 4RZCA 3MA7A 3HR5A 4JFFE 2AEPH 4XP4L 5JORA 1XF1A 4XMPL 1XF3A 1A0QL 4LSQL 5LCVH 4JLRB 4HC1L 3S35L 1F6AA 3RVXD 1FH5H 1G6VK 4J1UB 3WO4B 4MAYB 1YY9C 4JHBA 4H26B 4JRXD 4UI2A 2P4AB 2XZAL 1RVFH 5FCSH 4ZO7A 1LO4L 3QEHA 3HZYA 4X83A 1P2CB 1GOGA 5TE4H 4OF6A 5BO1H 4PP1D 4P23B 4ZQKA 2FECI 2EDDA 4J4PA 4IJ3C 4LK4A 2AABL 1A3LL 1MRFL 1ZGLB 1NEUA 3ECBA 5IBUG 3ABZA 2I26N 1XF2A 3P73B 1T0MA 1FZKA 3HZMB 2YPKB 2DJ4A 1JGLL 4LLVA 1J11A 3DBXB 4GRWB 5K9KB 7FABH 4TTDD 4ZAKA 1AC0A 4TVPE 4XVUD 4OI8A 2GSIB 3P0YH 1AC6A 3LOWA 4F7EB 4Q6IC 5JZ7C 1EO7A 3VFTB 1YYMH 1P6FA 3HE7B 4N8PA 3G08A 4ELME 5GGTL 1PD6A 2EDWA 1MF2L 3CLFH 3HHRB 2FBJL 3HG1A 4D8PA 4WO4A 2PO6D 4O2CA 2GJ6D 2X9YA 1RURL 1O0VA 3WFEH 3M1BB 3N1PC 4EUPG 3FQRB 4KV5E 2Z31A 4L1DA 4WCYH 1AIFB 1PYWB 5HHMD 4ZPTB 4X7SL 4CVUA 2VDLL 2ARJA 5EOTB 4FABH 2V5RA 2CKBB 1YEJH 2H32H 3OGCB 4Q2ZB 4HUVB 4MA3B 1ZKAA 4ZDHA 5GS0C 4D2NA 4WEMB 1OTUC 5I75C 3TWCH 1MIML 5H8DA 3PHSA 1HHKB 3FB7A 3UJJH 1GOHA 3LMJL 5AWNL 3T2PA 4YK4C 3L3KB 3UMTA 1NKRA 1S9KC 2GJZB 5FYJU 4KKBD 3IFPA 1J86A 2NR6D 2OK0L 1AGFB 5E6IA 2Q86B 5DJXB 5EIQA 1OSPH 3B5GA 4H88H 4KJYA 4IBLT 1W8OA 5I76A 3BDYL 4P2RE 4XWOC 1CI5A 3O41B 2R0ZH 3WYRA 4HPYH 3BUYB 4EDXB 1ND0B 4KKNA 4RAHA 4JQVA 4E41E 3KPRE 4LLUA 3GSNH 2A0LD 4UDTB 4JFXB 4HKJB 4GRLC 3UTZB 2PR4H 3EO9H 4KC3B 4NNXA 3SE8L 2NQCA 3BH8A 5I18L 3VDAA 4PV9A 2FJGB 1EEYB 2FJFB 4G8GA 5ERWB 4O51A 1YZZA 4LRIA 2EDNA 2D4DA 4KMTL 5CUSL 5SWZD 4XPHL 5KSBB 2C5DC 3BMVA 4WI2A 5F96H 4M6OL 4YDVB 3O3BA 5DDHB