4ESKA

Crystal structure of a strand-swapped dimer of mouse leukocyte-associated immunoglobulin-like receptor 1 (nysgrc-006047)ig-like domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
96
Chain Sequence
SLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Leukocyte-associated immunoglobulin-like receptor 1
publication title Crystal structure of a strand-swapped dimer of Mouse Leukocyte-associated immunoglobulin-like receptor 1 IG-like domain
rcsb
source organism Mus musculus
total genus 18
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eskA00
1S9YA 4FQXA 3WNMA 4B41A 2R1XB 3E6HA 1CBVL 5GJTH 1FPTH 1S78C 3T0WA 3PP3K 2XWJA 4PJXE 4U1NB 5CSZB 4X6DA 2O5ZH 3G6JF 4FXKA 1OW0A 5F97E 2R1XA 2Q7YB 3WMSA 3MR9B 1VEPA 4U1NA 5CSZA 2P5WD 2J88H 3ARGD 1FRGL 5BS0D 2FR4B 5F7EH 2DB8A 2CR6A 2VAJA 5FYJE 1RJZB 1TQCC 4ZFFB 3KPSD 1W0WB 2Q7YA 4BZ2H 3NFPB 3MR9A 3Q1SL 2EIDA 4OLUH 3X17A 1RJZA 1UENA 4ZFFA 1W0WA 3NFPA 1T2QL 3HI5H 1AGBB 1N6VA 1CL7H 3N85L 2OXGA 5E4EB 3U9PL 3SHSA 5AG9A 2ARJQ 3MMEB 2QHRH 3CSYB 3MJ9A 4Y4KC 3QQ9C 1SYVB 1ZE3C 5D1XB 3RNQB 3F6LA 4Y5XC 5FM8A 3MMEA 4WWID 4LBEB 3NCFB 3CSYA 4PJ5E 4TSBH 4B7LA 4DZ8B 5J11C 3L1OL 3RX8A 1SYVA 3S35X 3D3VD 3GEWB 4JKPL 4UOW1 5D1XA 3U0PB 7CGTA 1H15A 1AGDB 3RNQA 3OKYA 2ZUVA 4HD9A 4WHCA 4J3VA 4LBEA 4W68A 4BQ9A 3MLSL 4DZ8A 3ULVH 1QACA 3O4LB 1S7XB 1XR8B 1JGUH 4LIQH 3JZ7A 1AGDA 2WZPD 3H7LA 4QO1A 4O51B 5FIEA 1KEGL 1W0YT 1IKNA 2X1QA 4WCYH 3O4LA 1S7XA 5F1OB 2AI0H 5EO0B 3T09A 1DN2A 1NL0H 1DE4B 2PW1B 4O51A 4ZXBA 3JWDH 4RQQB 4YPGB 1K9TA 3V7AE 2KZ1B 5EO0A 3GSQB 2DTML 5GRZA 1ZSDB 5EU7C 1T7ZA 5MEQB 1DE4A 3SO3C 2PW1A 3T08A 2BRQA 4RQQA 3MLUH 3NPSC 3FQXB 2A6JB 3S37H 2ICEB 4YPGA 4ENEC 2M1KA 3GSQA 1WWAX 1ZSDA 4I2XB 5MEQA 4Y4HB 4XPFH 2ITDB 3QEQB 2AVGA 3BJ91 2CXGA 3FQXA 1NGPH 3FFCB 2A6JA 4YH6A 4C55A 1PBYA 1OP5K 2ICEA 2UZYB 4U4BA 4OUUB 5IJVB 5CGYC 4Y4HA 3WIHA 2ITDA 3QEQA 5EOCH 1I3GH 4MNGB 1TJHL 4HIHB 4L3ED 3FFCA 4LLVB 1MY5A 1LNUB 1KC5H 4U6VL 5DSCB 5IJVA 3QPXL 5K9KB 3WFHB 4I0PC 4BM7A 4HIHA 1KJVB 4GSDL 4LLVA 2VXTH 1NAMB 5DSCA 2IC2A 1HHJB 5K9KA 3VFGL 3WFHA 2VZUA 5C9JB 3C60C 1KJVA 2OR7A 3ULVF 1UC6A 3SDCC 1NAMA 1UXSB 2EDYA 4FABH 2X4NB 5DURB 4OLVL 2CK0L 1HHJA 3SJVD 4ODUB 3V9FA 2P8LB 5C9JA 4P2RE 5HHOD 1M6OB 1T66C 3EO9H 4H8WC 5FUCC 1TZIB 1CDYA 1UXSA 2X4NA 4OCYH 6FABH 1U8IB 4S1QL 4G8IB 1I9EA 2P8LA 1GGIL 4R4NC 4X6FB 3MJ9H 1M6OA 2OTPA 1HKFA 1TZIA 3KPOB 2WINB 4OF7A 3SQOL 1K85A 2Z91B 5A43C 4FOMA 1U8IA 4JKWA 3HAEG 4IIQC 4G8IA 4S11A 5DUPL 1ZGLP 5CZVH 1KTDB 4X6FA 5TE4L 4AQ1B 3CVHB 4XPTH 3PGFL 4HUUB 3KPOA 3QUZC 2WINA 4F9LC 2Z91A 4HPYL 3B8YA 1KTDA 2CDGA 4RIRB 5J9PB 3CVHA 5HYFA 4HUUA 4XNXL 4W6WB 3UTSD 3M07A 3K1KC 3IAQA 2PTUA 4YHKH 2VC2H 1JI1A 4RIRA 5J9PA 4JQIL 2C1PB 3MJGX 1MPAL 5TF0A 3O0RH 2QSCH 4R97B 2P24B 2J7LA 3SKMB 4NUGL 4G5ZL 1CR9L 2C1PA 1HQ4B 2LU4A 3CFCH 1AY1H 3UBXB 3N9GH 2Q76B 2ZG1A 1MAMH 4F37K 5BW7C 3ARFD 5EUOB 4F7CB 3PXJA 2P24A 3SKMA 2FBJH 4PJXB 2EDBA 3MRDB 3HE6D 4OGYL 1HQ4A 3EIFA 3UBXA 2XXMB 4Y0GA 3KPNB 5H37H 1G9ML 3EOYG 4F7CA 3WUWG 1LEIA 4KKLD 4MX7B 4PJXA 1LE9B 4OCWL 4I5BB 2NY5L 3MRDA 3CDGB 4G6AD 4UZGA 4EXPX 2DL2A 5C3LD 2IMMA 4WTWA 2HT3D 3KPNA 2FD6L 3GSNL 1QYGL 3WHXA 5HHNB 3AGVA 4MX7A 3BMWA 1LE9A 4I5BA 3CDGA 4YE4L 4APQC 3KPQB 3MNWB 4KK8C 4YDLB 5MI0C 3U7WH 2APXA 2ADGB 1WFUA 3IYLW 5E2TH 5HHNA 1CGYA 1OD7A 1UWXK 3S5LG 4IOFC 4DZBB 3KPQA 3MNWA 5HI3D 2PETA 2ADGA 4DEPC 5LGHL 4PJDF 2W65B 2QADD 4TNWK 5IF0B 2AJ3B 3SE3A 1KCRH 3JV0A 4DZBA 4NFCA 3KG5A 4RMWA 2NLJB 4PGJA 3WSQH 1HIML 4P2QE 4PJ5B 3D39B 1CGTA 2W65A 4KI5F 3G04B 5IF0A 2AJ3A 5DK3A 4Y2OA 3VWJB 1S78D 1IC1A 4KZEH 1CFQB 2OTWB 3ZHDA 4Z7VF 5JW4Q 1J0JA 2NLJA 4LOUC 4PJ5A 2LFGA 1P1ZB 1TTFA 1UEMA 4K07A 4ODVH 3G04A 2UZIL 5E1AB 5BZDB 3VWJA 1C12B 3PL6B 1C1EL 1CFQA 2OTWA 5JPNB 4OGAC 3QAZB 3FN0L 5D7IF 1P1ZA 1NKOA 1DSFH 5LGKA 4P9ML 3NTCH 5E1AA 2VB5A 2X6MA 4MNHB 1YZZA 1C12A 3PL6A 2LV4A 5JPNA 1CDJA 1UKTA 3BP6B 3GSVB 3GBLA 4PRIE 1N64H 5DR5L 5CUSH 3BE1H 3L5HA 4XBEH 4MNHA 3CVHH 2JELH 3TH4T 3NIDE 4GBXC 4LMQI 3BP6A 4ELME 4YPJA 4QNPE 3GSVA 1I1AB 4MD4B 4LKXB 4OLYL 3WDHA 3NCJH 4GO6B 1KCSL 2YD3A 4MLIA 1H3UA 4Y4KD 3QQ9D 3ZDYF 4KTDH 1I1AA 4MD4A 1IC5H 4LKXA 2XWBB 5IM7B 3DUSB 4LSUH 2IH1B 4G6FD 2CXKA 3FHQA 4OM1H 3V4UL 1EAJA 4G6MH 5IUSA 3CCHB 1HCVA 5FYKU 5K9JH 1DBKL 4U33A 2XWBA 1C5DB 5IM7A 3FMGH 3DUSA 2IH1A 5BV7C 2ZJSH 3MV8D 2Q87A 4Q9QH 5LCVH 1X5ZA 2DDQH 3TVMC 2V6HA 3CCHA 1JYWA 1BQHG 1C5DA 1INDH 5TH2B 4YXLH 5JIKA 5ICXB 2GAZB 3QDHA 1Z6JT 1PLGH 2BNRE 3DRTB 1MHPH 3GMMB 5TH2A 4HXBH 5EN2B 5D2LE 5ICXA 1IFHL 2GAZA 1DBAH 4CVWA 5FYJH 1CD0A 3DRTA 4GKOA 3GMMA 4P2RB 2DN7A 2P8PB 4I3GA 1A2YB 3TYGH 5KSUB 3RY4A 2YKLL 5EN2A 1FJ1B 3P0VL 3OJMB 4ENED 1F45A 4P2RA 1FGNH 1FIGH 5T1DL 1A2YA 4TTGA 4L3AA 5KSUA 1FNLA 4OZFG 1FJ1A 1V7NL 4HLZG 1RJYB 3MZTA 1FCCA 3MV7E 5L0QB 5DVNA 5HGDB 3MV9E 5CGYD 4O2FB 4KVNH 1A7OH 4WFED 2NY2B 2XY2A 1MCWW 2OMNA 1RJYA 3LQAC 4LLQB 1IILE 3QIBC 2R69H 5HGDA 4AIOA 4O2FA 5LG1A 4S10A 4I0PD 2FEDC 5GISH 3TT3H 1RFDH 1UG9A 3O2VL 2DQIL 4LCCB 4LLQA 4Q74A 1H3WM 2OQJB 1RIVL 1J1XL 4P2OC 1R3HB 4YEEA 4CVZB 1OPGL 3C60D 1A3LL 1CU4H 3I02B 3VMOA 3SDCD 4LCCA 5E4IA 2OQJA 5A2JH 4F57L 1R3HA 4CVZA 3TT1H 5BMFL 3UZVB 2R56H 4LVOC 1T66D 4IJ3B 2FATH 4JRYD 5I1KL 5KS9E 5CJOL 3AY4C 2H2SC 4I3SH 5F7DB 5FDWB 2C3WA 3MLZH 4R4ND 5I71B 1N7ML 2E7MA 1LK2B 3V0WH 5I1CL 4PJIE 2IFFH 3T0VA 4EN3C 3VH8B 1HXYB 1LK3H 3MRMB 5JZ7C 5A1AA 1R3JB 3PWUB 4HDIB 5F7DA 4QRPE 2XQYK 5FDWA 1NJ9B 1P84K 5GRJL 4S1DC 1LK2A 5C0FB 3O3AB 3BGMB 3MLWL 1HXYA 2HA1A 3MRMA 3VH8A 1KCVH 3QUZD 1MJUL 1R3JA 3PWUA 4HDIA 5ID0B 4HEME 3CDCA 2VZ3A 5T3XH 3OWEA 1U42A 2ZOLB 5C0FA 3O3AA 5E2UL 2P5EE 5B8CC 3BGMA 1MNUH 3LZFH 5FF6B 1P84J 1CYGA 1BEYL 5ID0A 1FP5A 4W4OC 3B9AA 5C70A 1DFBH 4OD3L 5L7XL 5FF6A 1JGLH 1F2QA 1BAFH 1NQBA 1XF1A 2J4WH 3NIFE 4P2QB 3ZSSA 5KTEH 2R0WH 3QPQC 4JG0H 2E7CA 4TVPL 4CGTA 5I15L 4P2QA 1R5VB 4Z7OE 5HDBF 4XGZB 1IGFL 3CC5A 4ZD3H 2WNGA 4KZDH 5IQ7H 4S0SD 5ISZE 2ORBL 5DWUH 4DOHE 1R5VA 4LHUG 2OSLB 4XGZA 32C2A 1U8NB 4J23A 3M8OH 3U83A 1G9NL 4JFFE 4MJ6B 2AQ1A 2E9BA 4PRIB 1J1OL 4O02H 4APQD 4KK8D 2BVEA 2G5RA 1LP9F 1WV7T 2OSLA 3VXSE 3T3PF 3EOBB 3VI4F 3HPLB 1U8NA 3PF2A 1LILA 1B6DA 2BY1A 4MJ6A 1RPQA 4ELMB 4GAJL 5JQ6L 4PRIA 4IOFD 5I30L 4N0CC 4HV8B 4M48H 2P47B 2ICCA 3HPLA 4I0KA 4UIKH 4GRLC 5JHDE 3U82B 4JM4L 3PGCB 4ELMA 1SY6H 3HPJB 4DFHA 4UOW0 5KOVC 2DL9A 3BEVB 2QL1A 3ZTJH 3FO9B 5D6DC 1SBSL 4K3HA 5GGTA 5EZOH 1JHKH 3HPJA 2AK4E 1F4XH 3V5DA 1CWVA 1Y6NR 1QFPA 2VDOH 3BEVA 3QEGH 5ITFB 3FO9A 1MY7A 4LOUD 4HQQH 3W2DH 4X9BA 1U8PB 1AE6H 1JGDB 3SGKC 4HKJB 4M8VA 2XTLA 5IK3B 1IC7L 2WWMC 5ITFA 2AV7B 2A6IB 3MO1B 3KPMB 1U8PA 2R2EB 2BNRB 3LMJH 1MJ7H 5TF1L 1JGDA 4TULH 5KSAC 1MF2L 2EDKA 5IK3A 5C0GB 3MUGB 3S36X 2AV7A 2A6IA 5D2LB 5MEOB 3MO1A 2HRPH 3QHFH 2YD7A 1P6AB 2R2EA 3KPMA 4HT1H 5HYIA 2BNRA 1E4JA 4YHZL 1NBYB 4P9HC 1JPFA 1FH5L 3IU4L 2QSTA 4JZJB 3SE8H 5C0GA 5D72H 3MUGA 5D2LA 5MEOA 3DX9B 1ZANL 4J12A 4PGDB 3V6ZB 4JZJA 4M1GH 3S4SB 3OKKB 4Z7NF 4MMXC 5EOTB 4HJGB 2B1HH 2JJWA 3DX9A 1NGYA 3MV7B 3K4DA 5I76B 3NBNA 3U4AA 1FQ9C 3MV9B 4PGDA 3S4SA 3OKKA 2A9NL 3QP3A 1MFDH 5EOTA 3WBDA 4HJGA 1P2CB 2APFA 4R8WL 3BW9B 3QUMH 3D85B 3MV7A 3MUHL 5I76A 1TZHB 2WQ8A 3MV9A 3TVMD 1FC2D 3OBAA 3ESVF 1IQWL 1P2CA 1ZHNB 3BW9A 4XPHH 1UCBL 4K3EH 3D85A 2HLAB 2B5IB 1MEXL 4O2EB 1TZHA 2MNUA 3DIFB 4JJHA 3UDWC 2J8OA 3R1GL 5DFVC 2C4FT 3EFDH 3G08B 1ZHNA 1OSPH 1MJ8H 2EXWC 2W0PA 3DIFA 1NCAH 15C8H 2ZNWA 1A7QH 3RWGB 3F62A 2PNDA 1P5UA 3MUZ1 5KS9B 3WS6A 1YY9C 3K4AA 4MHHG 1H3GA 4LRIC 2B4CL 2BC4B 2VXSL 3HN3A 3NGBB 1KCUL 4RFNC 4PJIB 5KW9L 3RU8H 5KS9A 2P46B 1I9RH 1MCPH 2A6KB 4QRPB 5JOEA 1BPVA 4FTVD 3RWDB 1W8OA 1WICA 5HHMD 3JTSB 1J0IA 4Y89A 5KVEH 4PJIA 4ZTPL 3RZCC 1A6VH 5C0NC 3KHQA 3SEPA 1JNLL 3MRIB 2AXHA 2DLFL 4QRPA 3TBYB 3RWDA 3QIBD 3JTSA 5DJZB 1INEL 4ZSOE 4Y5YB 4Z7UE 5JO5B 2NXZC 5MHSD 4ORZC 3K2MC 3G5XB 2FEDD 3ZE0F 1QA9B 3VG9C 3HNTH 3MRIA 5LJYH 1T4KB 2D4DA 4N68A 3FRUB 5DJZA 1YJDL 4Y5YA 4P2OD 5JO5A 3E8UL 2P5EA 3D9AH 1OP5H 3G5XA 1QA9A 1DBBL 1N59B 5A3IC 2FH6A 1T4KA 3N1PC 2VDML 3FRUA 4WGWB 5C9KA 2WQRA 5I74C 4JGUA 4OJFH 4NM8L 4RWHA 1N59A 4MZ2A 3VD7A 4Y16B 3BT2H 1FORL 2FLBT 2H2SD 1F6AB 3WFDH 4ZFOL 3VI3E 1NCDL 4Y16A 2V7HB 3I50L 2YS4A 4NZJA 5ISZB 5JZ7D 1K6QL 1L0YA 4GMTH 4E42B 4DOHB 1F6AA 4F7MB 5HHVL 4S1DD 4QOKE 1N3NB 2V7HA 1E28B 5ISZA 4JFFB 1T0MB 5D71H 3FO0L 4E42A 4GAYB 1Q9OB 4F7MA 3VXSB 5F7NC 3O9WB 4PJEE 1AI1L 1NBVL 3Q0HA 3Q6FB 1N3NA 2QQLL 1E28A 4JFFA 1FNGB 1T0MA 1BIIB 4O9HL 4XZUB 5MP6H 1WTGT 4JFED 4GAYA 1Q9OA 3U2SA 3IFLL 3VXSA 1B88A 4XVTH 3O9WA 1AO7D 3UTZB 5JHDB 3Q6FA 1F2XK 1ZHKB 4HULB 3REVB 4M8QB 1FNGA 3KR3L 1T0PB 4XZUA 3BDYH 4C56B 2OBGA 3IS1X 1MCQA 1ULVA 3BYTA 3UTZA 1P7QB 5JHDA 5ANMB 3DSFL 4DGIL 1ZHKA 2W07A 3REVA 3HUJF 1MIMH 3G9AB 4M8QA 3QPQD 5CEZE 4IRJB 2AK4B 1F4YL 2DQTL 3OQ3B 2JJSA 3E2HC 3WIIH 1P7QA 4OSUL 3CLFH 1CCZA 2IGFH 1CN4A 4BZ1H 4AEIH 5DJAB 3W39B 1TJGH 4P23B 3R06B 1Q9KB 3HB3C 3OR6B 3VXUD 2V5YA 4IRJA 2AK4A 4FFZH 5HJ3B 3Q5OA 5IGXH 4MQ7B 5K9QI 3MLRH 5D7SH 5IESH 5DJAA 3W39A 4P23A 5I8KL 3R06A 4DN3H 1Q9KA 3OR6A 3ESUF 4LQFL 4EBQH 1U0QA 1JP5A 4D3CL 2BVPB 4WFHD 4WRLA 4YHMH 4MQ7A 3O3DB 1UB6B 3AFLA 1DBJL 4XCCL 4K8RD 3WL9B 4HS8L 4LVNB 5D96C 1Z3GH 4WI9A 4HUWB 2BVPA 1P7KB 3NIGF 5GGSB 1RIUH 3O3DA 1UB6A 4N0CD 4L4VE 3WNKA 5GS0D 4GRLD 5LBSL 3WL9A 1W72L 3LH2H 2DQUL 1F58H 4HUWA 1WEJH 1P7KA 3H3PL 3VFWB 3ARRA 2BX5A 1KJ2H 3MGTB 3HNSH 3LRHA 1WC7B 5HY9B 4QYOB 1NKRA 2SEBB 4UB0H 3TA3B 3GHEH 4H25B 3VFWA 1J0YA 1I9IH 3MGTA 4RAUB 4MA8L 1WC7A 2X44D 5HY9A 4QYOA 5I1JL 4KI1A 2SEBA 1ZLWH 3TA3A 1RZ7H 5BRZE 5KZCB 5CBAB 4LSQH 5BJTB 5DUMH 1GAFH 3VXRE 1TJIL 3CX5K 4HSQA 3OMZA 2YK1L 2WWMD 4GW4A 4KHXL 2LAAA 1E6JL 3ULVC 2IAMB 1HZHL 4LQ1A 2COQA 2IPUK 5F21B 5FKAB 4FQIH 3GKWH 1KG0B 5BJTA 5IWLA 5KSAD 1CT8B 4WFGD 5GHWL 1WFOA 5DMYA 2X1PA 4GMSL 5FGCE 1OSZB 1FG9C 2IAMA 1UFUA 4JDVB 4TOYL 5DT1H 5FKAA 1KG0A 1KEMH 3RBGA 3DLQR 1CT8A 5CSGA 1INQA 4U31A 1KNOB 3EDDA 3JWDC 4XCNB 4NN6C 2DRUA 2XZCL 4EDXB 2ZKHH 1OSZA 1BJ8A 3P4OB 1JI2A 4D94A 4GXVL 4JDVA 4IS6A 3ARDB 3BUYB 4M43L 2IALB 3KJ4C 5J13B 3RWEB 5IHLB 1KNOA 4XCNA 4EDXA 3WJJC 3P4OA 3ARDA 1OP3K 1JZ6A 3BUYA 2IALA 4RGNE 1QSZA 3RWEA 4PY8I 2GSGB 1V3MA 3CD4A 1EO7A 5F1KC 1TMCB 1X9QA 4F2MB 1L7IH 1G6VK 4ZSOB 4Z7UB 1U3HB 3UYRH 4NQDD 4DKAA 2UWEF 1DQQB 1KB9J 1QBBA 2GSGA 1DTUA 5TJWK 4QRSB 5E5UB 2IBBA 5F9WB 1F90L 1AJ7H 4F2MA 3CFJB 4ZSOA 4Z7UA 1U3HA 2VO5A 5DFVD 1DQQA 1F11B 4HXAL 4X5LA 1UZ6E 5JUEH 4QRSA 4WY7L 3AVEA 3U0TB 3UZEA 1GGTA 2EXWD 3FKUS 3EFFB 4R9HA 1HINL 4POYA 3CFJA 2E9WA 4UMGA 2VSDA 2PXYB 4HKZB 2ED7A 3CK0L 3FB5B 4IRZH 1BREA 1F11A 1TCMA 3RVXC 4F15C 3QUKB 3FN3A 3U0TA 3EFFA 2QJDA 1YY9D 3L3DB 2G5BB 1U8QB 1BOYA 1ZLSH 2PXYA 4HKZA 4WFFE 3FB5A 4MD0B 1W0VA 1S7WB 2D7TL 3QUKA 5DQDH 4GJTB 4Z7QE 4UOJA 2A83B 2G5BA 1U8QA 3L3DA 4HIIB 1JGEB 1U36A 4FQLL 2F53B 4CU6A 3ULUF 4NQVB 1F97A 4QOKB 1HWGB 3RZCD 4LFHD 5C0ND 3QEUB 4P4KC 4B0MM 2A83A 4HIIA 1QSFD 1H8OA 2F19H 3ES6B 1JGEA 1RV6X 3DURB 1A7PL 4NQVA 1H8SA 4HGKC 1CICC 3RDTB 4QOKA 4PJEB 2NXZD 3QEUA 4XPGL 1TTGA 4YLQT 4J3WA 3ES6A 3DURA 3RDTA 2PYFB 3QEHA 3NACL 3HNVL 4PJEA 5I18L 4JR9L 4KH2A 4YZFE 1QFOA 1UM6L 3MX0A 5A3ID 1NCNA 4XNMB 5DA0B 1CXKA 3IS0X 3QDJE 4KI5C 3BAEL 2PYFA 1UH2A 4GUPB 1S7RB 2VIRB 4QTHB 5E8PB 4XNMA 4PIRF 3TEUA 4RCAA 4LSRH 4KRPC 3OTTA 4ZXBC 1Q9LB 1GH7A 2NX5D 1MVFA 4OCSL 4EQ3A 4GUPA 3GNML 4NKMB 1S7RA 3F7RA 2VIRA 1DN0B 4QTHA 5E8PA 1FL6B 1FVDB 1OARL 1Q9LA 3BX7C 2O5YH 4NNYB 3OJVC 4NKMA 3U4BH 4AZ8A 1FL6A 5D7JC 4PRHD 1EAPB 2GQHA 1FVDA 2E9IA 5IHUH 4LSPH 4HKXB 4WEBH 4NNYA 4L5FH 5GIRB 3UJIH 2I26N 2A77L 4BQBA 1KFAH 4M9OA 2P5WE 2OP4H 1EAPA 4Y4HC 5BS0E 5FK9B 1T1ZB 4AIZB 5SX4H 2AV1B 3F7VB 4HKXA 2DLTA 1IARB 5GIRA 3KPSE 4FXGB 1T03H 4L4VB 4DTGH 1JYVA 1A6WH 1LQSR 4FNLL 4DUVA 1OP9A 3DYPA 4X80H 1YN6B 5FK9A 1T1ZA 4AIZA 1FE8H 2AV1A 5JW5B 4Q9RH 3F7VA 1I8KB 4FXGA 4L4VA 1KV3A 4GQ9H 3DWTA 3RVUC 3U48A 1YN6A 2IH3B 2CGRH 1I8KA 5JOFB 4Z0BL 4PB0H 1Z0NA 2GCYB 4KC3B 2IADB 3PWLB 2VH5H 5DRNA 3WFCH 2IH3A 5BRZB 3B3IB 3HB3D 2JCCE 3WFBL 3VXRB 5JOFA 1R0AH 5F88B 2XYCA 3D3VE 2GCYA 2IADA 3PWLA 1KBGH 1MCBA 1JIBA 5BRZA 2B2XH 3B3IA 5F96H 2YD8A 3VXRA 1YEDB 4X7FC 3S35H 4PYHA 2Y36L 5F88A 1FAIH 1FL5B 4UT9L 5AZEH 1S7QB 1BFSA 4QRUB 4AENB 1BZQK 2AEIT 3B2UC 1YEDA 1I4FB 3ZMRA 4NZTH 1FBIH 4OCNC 1OM3H 4FS0A 3TIDB 3WFEH 3LKSA 1S7QA 4QRUA 4AENA 1CE1L 4P2CG 4JFZH 4UV7L 5CD5C 3RJDA 2X1OA 3RPIB 1WBXB 2NY4B 1I4FA 2EDLA 2R23B 4OLXH 2VERN 3JSSA 4JN1H 4M7ZC 3TIDA 2ICWI 3PNWB 2XWTB 1U91B 5IR1B 3K1DA 3RPIA 4RGNB 1WBXA 1C5CL 3P30L 2R23A 1LEGB 4OZIF 2OZ4L 1IBGL 1N4XL 4RGOH 4D9RE 1CGWA 5LWYL 3PNWA 1SM3L 2XWTA 3OB0K 5E0QA 1U91A 3GUTB 2QSVA 5IR1A 5IMKB 4OB5H 2CJUH 3SKOB 3LEYH 4PJHE 5I1HL 4G9FD 1LEGA 1LO4H 2AXGB 3I75B 4PV8B 2NCMA 4XB8A 4ODHH 4NP4L 2A2QT 5KN5B 4L9LB 5CFHA 3GUTA 3ULVD 5IMKA 4L3EE 3SKOA 4NC1C 3DPBA 5CWSB 5L9DH 3F65A 2AXGA 3I75A 4PV8A 3WIFB 2MFNA 5KN5A 4L9LA 5DMGC 2DQDH 1IC4L 3MFFB 5CWSA 4XC1H 3WIFA 3UAJD 1U2HA 3B4NA 3HAEB 5BV7L 1QFWM 4EOWH 12E8L 3C8HA 1CI5A 5SWQB 4R3SB 5I66B 3MFFA 4HKBB 2C3GA 3CUPB 4QLRA 5GSRB 3SJVE 3HAEA 3ZKNC 5SWQA 4WV1C 3ZE2E 5CILL 5HHOE 3TV3L 3V0VB 2CLZB 5DJYB 4R3SA 4NKDA 5I66A 4HKBA 3CUPA 1X7QB 5GSRA 1T2XA 4MWFB 4M62H 2K1MA 2R4SL 1I7TB 2ZSWB 3BISA 4ZPVB 3V0VA 2CLZA 5DJYA 4MA1C 4PJBE 1X7QA 1J1PL 1OQOA 1CG9B 1YPZE 2BJMH 4MWFA 1GL4B 4M1DL 1L9NA 1D9KB 3QBTB 3RJQB 1I7TA 2ZSWA 3CH8A 4PUBH 4ZPVA 4DK3A 3HZYA 2EH8L 5IVOA 4ERSH 5ETUB 4K2UH 4DKFL 3B9DA 1CG9A 3N1QC 2A38A 1O5DT 1D9KA 3C5JB 4OFKA 1FYHB 2VLMD 3QDJB 3VFPB 2VDNL 1BX2B 2C4FU 3GI9L 1HWHB 5ETUA 2YA0A 3S88H 4RMUA 4OF8A 4KY1L 1JHLL 3C5JA 1Q72H 2CKBL 3QDJA 3VFPA 1IZKA 1BX2A 3E6FB 4YHPB 3LQAL 4R4FH 4RGMB 3LPGA 1CVRA 4Y19D 5E2JA 1GPOH 4ONFH 2Z31C 3TN0A 3ZDXF 4DGVL 4EDWL 1BF2A 4HC1A 1UADC 3LAFA 3EYSH 1EGJA 4DKEH 1YECH 3HCVA 4CW1B 3P9WB 4Z8FL 2BSSB 3E6FA 4GFTB 4YHPA 1UZ8B 4G7YL 5CJBA 4CW1A 4P4KD 3DGCR 1QBML 2BSSA 4DJMA 2YUZA 1WT5A 1WLHA 5D70H 4LRNH 4XMKH 1CICD 4NJAH 5ITBH 3LHPL 2P5WB 3ARGB 43CAB 1F3DJ 1TZGH 2VLRD 5GSVB 5BS0B 1T3FB 2GK2A 3L5XH 3KPSB 3OR7B 4QTIH 4ZTOH 2P5WA 3ARGA 4KMTL 43CAA 5GSVA 5BS0A 1PD6A 1T3FA 4G6KL 3C5SB 3VFOB 3KPSA 1E6OL 4KI5D 3OR7A 3B5HA 4IEFB 1C5BH 1NLBL 4F58H 3JXAA 3LS4H 1WWBX 2R8SH 4AEHL 3S34H 4BJLA 3C5SA 3VFOA 4KRPD 4HUVB 4X6CE 3LDBB 2VWEE 1HXMB 3LS5H 1XFPA 4ETQB 2BY0A 2Z8RA 2JCCB 4TPRH 2R1YB 4HUVA 3BZ4B 3T0DA 3HAEH 3B5TA 1MRCH 3UEZA 2OI9B 3QRGH 1HXMA 3D3VB 1JMZA 3KYMB 4JG1L 4R96B 2V17L 4ETQA 4WJ5B 5D7JD 2JCCA 1X5XA 2R1YA 4I18B 4NDMB 3ZKQD 5L2KD 4OFPA 3BZEB 2F54D 3D3VA 3UZQA 3UJJH 4R96A 2E6QA 2DI9A 1DCLA 4L8BB 3B43A 1NMAH 2XZZA 4WJ5A 4I18A 1YNLL 3D48R 4NDMA 2IG2L 1YQVH 1AFVH 2ERJB 2FHFA 4XP9H 5HYQB 3OAZH 3BZEA 3LV3B 1IAIL 3L3JA 4Q6IC 3QXUA 5LVEA 4OIIH 2YC1B 5HDOA 1W8NA 3G5YB 2X09A 4JM2C 3I2CL 1YEEL 3TCLB 4PGBB 1X44A 3LV3A 3FCTB 1UWGH 4OZ4B 3A6CH 4HFWB 2YC1A 2AQ3A 2JIXD 3V6BR 3RVUD 3G5YA 1CXHA 3TCLA 4K3DL 4H1LG 4PGBA 2X40A 3S8WA 4JVUA 4LCCC 3QXDB 1QHPA 1U8MB 3A67H 1NCBL 4HFWA 2CRYA 4NC2B 5J6GB 3F58L 5KSBE 6CGTA 5ICYB 4NZDA 4HC1H 4PJHB 1RK1B 5E94B 1EGJH 3N1MC 4P3CL 1OTUC 4MGXA 4TUKH 2A9MH 3QXDA 1U8MA 5SWZD 1B6UA 5J6GA 3O11A 3QA3B 5JNYB 5ICYA 3LRSB 4L3EB 4KVCL 5BXFB 4PJHA 2FGWH 4R90L 5TQ0H 3L5WB 1RK1A 5E94A 1ACZA 1X4ZA 3MV8E 3OAYK 3K2UL 2DQGL 4WENB 3R0NA 2H41A 2F5BL 4M5YH 4IMLB 3QA3A 5JNYA 3LRSA 4GS7B 4XP6H 4L3EA 5CKGA 5BXFA 4KDWA 4M00A 3L5WA 4JO2H 4FZ8L 4MZ3A 2VR5A 4GKSB 3GBMH 5CEXB 4PFEA 4OM0L 4IMLA 4LSTL 3KDMB 4LU5L 2J8HA 4KQ3L 5CD5D 4P48A 1WIPA 4GKSA 3SJVB 5CEXA 5AZ2H 4HCRL 3KYNB 5EUOF 5EU7E 3CZFB 5HHOB 1J9CT 5EO1B 4JREB 3KDMA 4PJXF 3H7BB 3LQMA 1H5BB 2OLDA 3SJVA 3CNKA 4Z76B 4I3RH 5CJQL 2I5YL 3KYNA 1L6ZA 2PCPB 5FM5M 3CZFA 5HHOA 3LCYA 2J6EA 1OAYL 5EO1A 2BRRH 4PJBB 5FYJU 3H7BA 3MRGB 3MRNB 1H5BA 3RWIB 4X4ZA 1KPVB 1QSED 4P9HL 4XCEB 4Z76A 4TQEH 4MCYB 2F58H 4XWGL 2PCPA 1A3QA 4PJBA 4DQOL 3MRGA 1GIGL 3CLEH 2K3TA 3RWIA 4JCMA 4JFYB 1KPVA 1QZ1A 4XCEA 4YDIH 5B3NA 4MCYA 1MCOL 4MXVF 4KV5E 3HRPA 4Z5RB 2BHUA 3QIUC 5DMGD 3MRFB 4ZFOB 1B9ZA 4JFYA 1MFEH 3UTSB 3BKYL 5I75B 3WN5C 3BWUC 4QXWA 4PJ7E 5FXCH 4S1RL 3TBWB 1OCWH 1FHGA 2I24N 4Z5RA 1E4XI 1F13A 3MRFA 4ZFOA 2EYSB 1BQUA 5HHXL 3UTSA 2PKDA 2F5AH 4JY5H 3TBWA 5GGVL 3GMOB 4WUUE 4TSCH 4A6YL 4PG2C 4JPVH 2R29H 1QLEH 2FWOA 2F15A 1S9XB 3ARFB 2YA2A 4NQXB 3ZYJA 5FUCE 4JRYE 1RULL 2R4RL 1KIUA 4D9LL 3HRZB 3HI6L 1PX4A 3GMOA 3HE6B 2DQJH 2LVEA 4EEEA 4KTEH 5FKPB 2IPTH 1S9XA 3ARFA 4NQXA 4KUCF 3MSPA 5F7LB 1SJVA 2BSRB 1EK3A 3HRZA 4RMSA 3HE6A 4OFIA 5CLTA 3BJLA 5FKPA 2BERA 3CFBB 1ERNA 2BSRA 4LCIL 3O6KL 1CXIA 4R2GC 1MFBL 3QNXA 5B21A 1OP3H 3MV11 4ZS6C 3CFBA 1V7MH 1X5KA 4OZHE 1M7XA 2WUBL 4Q7DA 1KSRA 1NEZG 2GYSA 2MKWA 3EAKA 1DLFL 5E00B 3WD5L 2R39A 4HWNA 2QADB 4X6CB 3FQRB 2OL3L 2Z31D 1B2WH 4FZEL 3NVQA 2XFXB 3WEXB 4NCC1 2DQCL 5E00A 1FFQA 2D0GA 4OZFH 2VDRH 5DD5H 4S1SH 4HLZH 4X6CA 3FQRA 4KGLA 3L3IA 2XFXA 3WEXA 1Z9SA 4NO2B 1WTLA 1YEKH 2X4RB 3QYCA 5JMOC 5J06A 3IDJB 2XKNB 3Q5TA 1W72B 2J6EH 4NO2A 4JY4A 3R8QA 1KJ3L 2X4RA 5GJSH 4Y88A 3GHBH 3DI2B 4UQ2B 3IDJA 2XKNA 4GRWH 4Y7MA 4EZMA 4XNUH 1Z5LB 1G6RB 1W72A 3V4VH 1CXFA 2X4SB 2G75B 2I07A 1A3RH 2CIKB 5T3XD 1XF5B 3PP4H 5IJKA 4EIZC 1RUPH 1EFXD 2NPLX 4UQ2A 1IKFL 3OF6D 3WNPA 2VZ1A 2DQHL 3MOBH 1Z5LA 1G6RA 3C2SA 1GCFA 2X4SA 3HLAB 2G75A 3B2VH 3EDJA 3QUYC 4X8JB 2CIKA 1XF5A 1I1CA 5DQ9B 2NY6C 1DQDL 1KJMB 2IPKB 2R0KH 3F7PC 5D6CB 3SGDI 4BK4A 2HKFL 1P5VA 3HLAA 3O8XD 4Y4KB 4X8JA 2B0SL 2D03H 1DVFC 5DQ9A 5KSBB 1KJMA 1NUNB 2ADIB 2DWDB 2IPKA 3B6SB 5D6CA 4Y5XB 4OF3A 1E0OB 2Q8BL 3DOSA 2ATPB 4G6FB 4OLZL 4Z7WE 4Y4KA 3QH3B 3TGXA 5I2IB 5J11B 2X9XA 1J0HA 1QBLL 5KSBA 2DWDA 2ADIA 3B6SA 4Y5XA 4JB9L 2CK2A 2ATPA 3MV8B 3O6MH 3MFGB 3QH3A 2YRZA 4JJ5B 1P7HL 3TWCL 1ADQA 4XC3L 25C8L 1EX0A 1XGYH 5F9OH 3MACL 1JGVH 3QISA 3MV8A 2FX7H 4OCRL 43C9B 4YQXH 4JJ5A 1E4XH 4DVRH 3KYKL 5E5MB 4KPHL 1CDIA 3VGHA 3UC0H 5GQBA 43C9A 3EYUH 5FA3B 1GHFH 2ZUQC 5KBNC 4JM2D 5GJTL 1FPTL 4PJ9C 2Q6WA 3RX7A 4BQ6A 1JWUB 1GGCH 1T7VA 5E5MA 3MCLL 3QWQB 4GRWF 5SX5K 3SO3B 3FRPG 4Z6AT 3S36H 2O5ZL 3WKMH 3X3GL 3NPSB 5FA3A 1UM5H 2DM7A 4AMKH 4YBHA 1JWUA 1NMBH 3BHBB 4MHHI 2J88L 3TIEB 3BD5A 2VDQH 1SEQH 3Q6GH 3T2PA 1MRFH 3RZWA 4BZ2L 5IROC 4WEMB 2WM0A 4KDVA 4HK3N 1OTUD 3FQNB 1G7JB 1P4BH 3TIEA 1NH6A 3MRQB 5E6IC 5CLWA 2I60H 3HA0A 3GI8H 2Q8AL 2FSEB 3FQNA 3HI5L 4MJIE 2AXJA 1CL7L 1G7JA 2OR8A 3LSOB 3MRQA 4I0PB 2AK1L 4NNPH 2QHRL 4WGVB 1LHZA 5BOZG 4M5ZL 2FSEA 4FQCH 1T1XA 4PJ7B 2V9QA 4R0LC 3IJHB 4AH2B 1Q0YH 3LSOA 5KJRH 4I0PA 3C60B 4NFDA 3BIKB 1H3XA 4TSBL 3SDCB 1MCFA 2ATKB 2Y9RT 4HUNB 4PJ7A 4AH2A 3IJHA 3SOBL 3VE0B 2KZWA 3ULUC 3C60A 5FYLH 1TLKA 3MLVL 1ZT1A 3ULVL 4LAJH 2ATKA 4JRYB 4R26H 5GGSY 4LIQL 3T1FA 3VE0A 4IDJH 1FFPB 4PRAB 4AM0B 4MDIB 4PP1C 1Z9MA 2D2OA 3VWKC 2QTEA 4WCYL 1J12A 4JRYA 3VRJB 2DKUA 2AI0L 3U0WH 2BVQB 4IIQB 1FFPA 4PRAA 4AM0A 1NL0L 4FTVE 5HHME 1EUUA 4U1MB 3JWDL 5EZIH 1EA9C 4PD4J 1G7LB 1KLGA 4RBPK 2GJJA 4U0QB 1DANT 3F5WB 1XEDA 1VEMA 2X4OB 3QUZB 5C0BD 3VRJA 2BVQA 4IIQA 4U2YA 1VKXB 3MA7B 4FQPA 5TE6H 4JFQB 3MLUL 1G7LA 3QIUD 1ADQH 5MHSE 3S37L 3MRPA 3HS0B 3F5WA 2X4OA 3QUZA 4OZHB 4PBWD 1D5IL 1XT5A 4NGHH 1VKXA 4FFVD 3MA7A 4XPFL 3IFNH 4JFQA 2YWZA 2W0FB 4BELD 4C58B 3K0WA 1X5JA 3HS0A 1EMTH 1VHPA 4OZHA 5BQ7B 3P2TA 3E1F1 3VRIB 7FABL 1CFBA 5EOCL 1I3GL 3GSRB 3WNOA 2XNAB 2AJSH 5BQ7A 2ZPKL 1KC5L 3VRIA 3UJTH 3GSRA 4ISVB 4QXUH 4NQSB 2XNAA 2VXTL 4NSKB 1LGVA 1OY3B 4P3DB 5BW7A 1EHXA 4ZNCD 3W0WD 2AW2A 1OD9A 1KIRB 2VISB 4NQSA 2YSSB 1A4KB 4O5LL 4NSKA 4P3DA 3DV4B 1K4DB 4QXTB 4XB7A 1TETH 4FABL 4RDQF 3RAJH 3S9DB 1KIRA 1U3JA 4OTXH 2EDQA 4R2GD 2VISA 4APQB 2YSSA 1A4KA 3BP4B 5MI0B 5A2FA 1A7RL 3EO9L 3N1FC 4YBLC 3ZTNH 3DV4A 1K4DA 1KENH 4QXTA 4ZS6D 4QKXB 3GK8H 4NKOB 4PLJC 3B9KC 4NPYB 3MJ9L 1IM3B 4JFEE 3OKDB 4K3GA 4APQA 4CN6A 3BP4A 2BOCB 4DEPB 4Z9KB 1AO7E 1MOEA 4NKOA 4NPYA 1IM3A 4XI5C 2IAMC 1AXTH 3OKDA 4XPTL 2BOCA 2X9YA 1G7PB 2JB5L 2FGZA 2EZ0C 3QZWG 1L9MA 3EOTH 4Z7WA 2EDHA 3RGVC 2X9WA 3SBWC 2GK0B 5D5MF 1G7PA 1YEGH 3RIAK 5HGAB 3IXAB 1ZA3B 4YHKL 2VC2L 4TN9A 3VXUE 5E9DD 3MREB 4U2ZA 2HT2C 1FRGH 1RUQL 1A9EB 1XGUB 2EDNA 2GK0A 3IXAA 3O0RL 2QSCL 1ZA3A 1CFNB 3MREA 3CFCL 1AY1L 1T2JA 2UZXB 4WFHE 3GO1H 1HYSC 1A9EA 1XGUA 2GSIB 3MYZA 3CMGA 1CFNA 3QUYD 4GBXB 1T2QH 1ZVSB 2OZ4A 1OAXH 4BSWB 2DIJA 4OGZA 4H0IA 4ZFGL 2NY6D 4ONOA 2GSIA 3F6IA 1DVFD 4BSWA 2D7OA 1QKZL 1T1WB 3C87A 1MFNA 5CJXA 3L9RB 3I3EA 1L4IA 3PWJA 4U1IB 2ZZUT 2I27N 4RMQA 4BSJA 4JKPH 3U7WL 1JZ2A 5T3ZH 1CXEA 3JV4A 1T1WA 4Y2DD 4OCXH 5BV7B 4KJPC 5E2TL 3L9RA 3MLSH 4U1IA 1T5XB 3TVMB 3ARQA 1S7SB 1J86A 3VCLB 4LLMB 2DYPD 5FV1L 3IAGC 3CPLB 4HUXB 4J8RB 5ILTH 1KEGH 4MJIA 1WAAE 4YBQC 1ZT7B 4KQ4L 1IGMH 1T5XA 3TVMA 1S7SA 2RIKA 4KRLB 3VCLA 4LLMA 4YO0B 3WSQL 2XQBH 4UDUB 3CPLA 4HUXA 4J8RA 4WFGE 1WBYA 1ZT7A 4PJ9D 4FXLA 4U1LB 5E8DH 3QCVH 1MCNA 4YO0A 3H3BC 5I8CB 4UDUA 4CRPA 3QJHB 5B39B 4EUPB 1E4KC 4ODVL 1N0LA 4ELKB 3TBVB 2P5ED 4OIAA 4J3UA 5CEYB 4M6OL 3H9SE 2EH7H 3JWNC 4U1LA 2VMFA 3QO0B 2IEPA 1M05A 5JHLL 3O4OC 5I8CA 1AKJD 3QJHA 5B39A 2D0FA 4EUPA 5TDPB 1DSFL 4ELKA 3TBVA 1GC1C 2CSPA 4N5UA 5CEYA 1X5YA 4FTVB 2CD0A 5HHMB 3VRLE 3QO0A 1G1YA 5DC9B 1N64L 4K71C 5CUSL 2HYMA 5E6ID 5TDPA 2VKWA 4NCDA 4XBEL 5C09D 1XF3A 2QQKH 2CKBB 3CVHL 2JELL 5INCB 5AEAA 5E6ZA 4FTVA 4G43B 3QIBB 3QPXH 2NY3C 3ARTA 4NQDE 5JW4N 4PJCF 1A9BB 5IMLB 3NCJL 1U6AL 5J6HB 2HMIC 4IBLT 2CKBA 2D7PA 5INCA 3A0OA 4G43A 1S7UB 4KTDL 3QIBA 1BJMA 4P2OB 3DX8B 1IC5L 3WS3B 3VG0L 1A9BA 4LSUL 5IMLA 4FQ1H 5J6HA 4OM1L 2Z93B 4G6ML 1S7UA 2BDNH 2DBLH 3QCTH 4M6MH 4P2OA 3DX8A 3WS3A 3BGFC 3ULUD 4WI5A 3RP1A 4EVNB 3JTTB 1V5JA 2ZJSL 4LVOB 3TM6A 2ZCHH 3RUGE 4F9PA 2Z93A 4Q9QL 5DRWB 2DDQL 2APBA 4ONHA 3V79C 4EVNA 4PP1D 4YXLL 4LHJB 1E27B 3HZMB 3VWKD 1PLGL 3SQOH 5SV4A 4FG6D 4P5KB 3AY4A 5DUPH 5T5FH 3PJSB 5TE4H 2YOCA 3HZMA 4HXBL 1VACB 2XZAH 3K80A 3RWHB 3GIVB 5FYJL 5F3HB 1QSFE 2YD2A 1OVZA 4P5KA 5KG9B 4XMPH 4JGMA 4HG4K 3EYFB 3PJSA 5IBLD 3GKZA 1MCWM 4FQ2H 1YEFH 1VACA 3RWHA 3GIVA 4XNXH 5EOCJ 5F3HA 5KG9A 4E41D 1NPUA 4HMDA 4JFEB 1AQKH 3CH1B 3EYFA 3I3DA 3U7AA 1FGNL 3QHZH 3IDXH 1AO7B 1MHHB 4NWUH 4TNVF 4DCQB 1R3KB 4HG4J 1ROWA 4JFEA 1BWMA 1BFTA 3BH8B 3CH1A 1T6VN 4W4OA 3VXPB 1A7OL 1WWCA 1CR9H 1AO7A 1MHHA 2MQ0A 4DCQA 1R3KA 4I77H 2D7NA 1AR1C 1HQRB 4GAGL 1I1FB 1S7VB 2Y23A 3BH8A 1P4LB 1K8DB 3G6JE 3LD8C 5FGSA 3VXPA 4KKAD 2NX5E 4N0UE 1ZMYA 5GISL 3TT3L 4JCLA 3U6RB 1RFDL 1HQRA 1I1FA 1S7VA 3MBXH 2ILLA 1G9MH 2PR4H 1DL7L 3VXUB 1P4LA 1K8DA 1TVDA 5DZOA 4OCWH 4JANB 3U6RA 1CU4L 3V5KB 5E8EB 1X5LA 2FD6H 3GSNH 4PRHE 2PYED 3VXUA 4NKIH 3MXVH 3TT1L 5B22A 1ORSB 2DM4A 4JFPB 4JANA 2R56L 3V5KA 2FATL 4NT6B 3GSXB 2HVJB 2D0HA 2EKJA 4I3SL 2XA8L 4YDKH 3CMOH 1ORSA 4PLJD 2M2DA 4JFPA 3B9KD 4M93C 5HDQH 4XTRC 2R2CA 3V0WL 3BDBA 2IFFL 4O58H 3DMMC 1LK3L 5LGHH 4NT6A 2XTJC 3GSXA 2OJZH 1ZS8B 2VE6B 4GRLB 4P46C 2HVJA 5CHNB 2AJZB 4XAKD 5TQ2L 5C2BH 4Q58C 4XI5D 2QQNH 1B0RB 1KCVL 2VE6A 1ZS8A 1UACL 4GRLA 1U95B 1CIUA 5T5NF 5CHNA 2AJZA 5J56B 3UPRA 2EDWA 2UUDK 4UQ3A 2EZ0D 4GRMB 3UTPD 4ODTL 1MNUL 3LZFL 1LE5B 1BM3H 1B0RA 3RGVD 5D6DA 1U95A 4UILH 3EOAB 2V5MA 2MCG1 4GRMA 2IQ9H 1DFBL 1KTRL 1NMCC 1YEIH 1LE5A 3WDJA 2HT2D 1JGLL 3FN0H 1YNKL 2JTDA 3EOAA 4LGSB 1BAFL 5K59F 1VPOL 2J4WL 1IAOB 4LPCA 1ZAGA 3SGKA 5I73C 5KSAB 1MCKA 4OZGF 4BK5A 1HNFA 1QFUH 5KTEL 4L4JA 4HCRA 5F6HJ 1HYSD 1WAAA 4XWOC 3P73B 4JG0L 2W0KA 4HIXH 2N4IA 1IAOA 1EBAA 4X6EB 5KSAA 3ULSB 5T33H 1QFWL 4R7NA 3QWRD 4WIQA 2FEEL 4ZD3L 3P73A 1XMWA 3VFRB 5GZOC 4KZDL 5ABDE 5IQ7L 1WISA 5SWSD 5D9SA 3VI3F 4X6EA 5T1LD 5IKCB 3VXMD 3ULSA 2BCKB 2NR6C 2MPAH 2CR3A 3VFRA 2B1AL 2F9BT 4OQ1A 3H9SA 1SJHB 3M8OL 5AWNL 4UU9B 5IKCA 4EI6B 4O02L 2BCKA 3IU3B 3TN0C 1JNJA 4KKBC 5ALBH 4U1JB 4KJPD 3UMTA 5FGBC 4BH8B 4N8VB 2F8OA 4UU9A 4NQDB 4EI6A 4YHYB 3IU3A 4G9FE 3ARBC 2AJVH 4M48L 1RU9L 4JGJA 4BH8A 4TRPL 4L3CB 4HX1B 3QNZB 4YBQD 1M71B 4N8VA 5EO9B 1KB5B 4NQDA 3ULVE 2WUCH 1A6PA 2BSTB 5FOJA 4LIQE 5B38G 1X4YA 1KIPA 3O41B 3AM8C 4YUEH 1JHKL 4L3CA 4HX1A 3QNZA 4ODXB 5EO9A 2X4QB 1KB5A 4D8PB 3UDWA 2YMXH 1F4XL 3QEGL 2VDOL 1HH9B 3REWB 2ADFH 3RUGB 4HQQL 3W2DL 3HI1B 3O41A 1SJXA 1AE6L 4FFYL 3ARGC 3P0VH 4ODXA 1WZMA 2X4QA 4ORGB 3D18B 4D8PA 4MJ4A 3TBTB 1DZBA 5F7YC 3SDXE 1HH9A 4K8RH 5AUMB 3REWA 2XI9A 4RFNB 3RUGA 4UTBL 3SY0B 3G5VB 3HI1A 3T0BA 1KUMA 1MJ7L 4ORGA 3PWNB 1V7NH 3AU1B 3D18A 4LRIA 1J8HD 4TULL 3TBTA 4ONGH 5DHVB 5C7XH 5GS0H 5AUMA 3SY0A 3RZCB 1UT9A 3G5VA 3EGSB 3TZVC 3QHFL 3FT4A 3ZO0A 1QSFB 3ZDZF 5M94B 3PWNA 3AU1A 2OR9H 3SE8L 5DHVA 5FECB 5D72L 2NY3D 4N0FB 3RZCA 2NXZB 3W5NA 3EGSA 4G9DB 2HMID 3PQYD 3VG9B 1QSFA 3RBSA 1ETZB 2Z4QB 3P4NB 5GS3A 1MHEB 3ELAT 2EYTB 2YPVH 4M1GL 2CQVA 5FECA 4WI6A 1J1XH 5D93C 4N0FA 2B1HL 1OPGH 5JOPE 4G9DA 3BKCH 1HI6B 35C8H 1ETZA 1FGVH 2Z4QA 3P4NA 2RAMA 2D9QB 1MHEA 2VLME 2EYTA 1PZ5B 4HF5H 1MFDL 5I74B 1FZMB 2H1PH 1HI6A 1UH4A 2H45A 1I8LC 1N6UA 1PZ5A 2VITB 3G6JB 1CVSC 2NX5B 4N0UB 1WCQA 3VFSB 5ESVB 3QG6B 1FZMA 4XPHL 4K3EL 1N7MH 3OXSB 5GGUA 5CD3B 3ZLQC 3RIFF 2EEBA 2VITA 3ALXA 3G6JA 2NX5A 4N0UA 2VQTA 4QWWC 3VFSA 5ESVA 1J05A 3QG6A 1OSPL 5GRJH 3O81A 3OXSA 3IETB 4PRHB 5CD3A 1NCAL 15C8L 1LO0L 1J5OL 4JFHD 3BPLB 1DANU 3N0PB 4NRZB 4UINH 3IETA 4PRHA 5HTSA 2VLRE 3NCYS 3NCCB 3DETC 4RZCB 1AH1A 4PJDE 4NRZA 4OD3H 1MCPL 1HKLH 4RZCA 2VDPH 5KVEL 4ZOEA 5DFTA 5HYJD 4KI5E 1A6VL 1RHHB 1Z9OA 1DP0A 1KB5H 3ZHKA 1AR1D 4Z7VE 3BUTA 5I15H 4PYGA 1RHHA 1VGKA 3O3UN 3E2HB 5GGQH 3HNTL 1RAMA 4ZO7A 1B0GB 3G5ZB 3I84A 5DXWA 1UCTA 4MVBC 4C83B 2XACC 2W9EL 1V3LA 4YR6B 1B0GA 3G5ZA 2VABB 1UZ6F 4PJFB 3RWFA 2HTLC 2NTFB 3RY6C 1DQML 4C83A 3BVNB 1HE7A 1FLRL 1GJIA 5L2KE 4QXGL 4OJFL 1P4IH 2F54E 4H1LB 1JNNL 4O4YL 4YR6A 1U8JB 2VABA 2RBLA 3BVNA 5GGRY 5D96B 3MA9H 3WFDL 3HC3L 4XTRD 4H1LA 2N7AA 5ALCH 5I30H 1U8JA 3DYMA 1PGRB 3DMMD 1NFIB 3ZDYE 3L5IA 2XTJD 3I6GB 4P46D 2ZCKH 4F3FB 1T83C 4UDTB 1NFIA 4LVHC 2DKMA 4YHIB 3I6GA 5D71L 1WK0A 1Z2KA 5DVKA 1F42A 4F3FA 4DUWA 2ZCLL 3WYRA 3ZT7A 1ZXQA 2E3VA 2WBWB 1J88A 4UDTA 2EIBA 4J3SA 4XCFL 4X98B 8CGTA 1RMFL 1U8LB 4YHIA 5MP6L 1G7QB 4G9FB 3TYFA 2BFVH 4XVTL 3CFIC 4OCLC 3DVIA 1ZV5A 3PDOB 2DM2A 5A16B 4X98A 5SWZE 1EO8H 1U8LA 3M1BB 3BDYL 1G7QA 2XIDA 4G9FA 1A1NB 3PDOA 5DC0A 5A16A 1MIML 3INUH 2J2ZA 4XWOD 3ARUA 3M1BA 1AP2B 4XXCC 5KSVB 4J3TA 4YHZH 3OZ9H 1A1NA 5ESQB 3WIIL 3WNNA 1OLZA 2AERT 3CLFL 2HN7B 4NZRL 2IGFL 2Z9TA 1WF5A 4NN6B 4XHQA 1AP2A 5GZOD 5KSVA 3SDXB 4FFZL 1F8TH 3PDGA 1G0YR 3KJ4B 5ESQA 4BFEA 5IGXL 2HN7A 5L2JB 2NR6D 3MLRL 5D7SL 3LKRB 5IESL 3ARYA 1UGNA 2VZVA 4EBQL 3SDXA 2YEZB 1URLA 4YHML 1UXWB 1MREL 1PY9A 1R5IB 4GW1A 5L2JA 3TN0D 4KKBD 3LKRA 5FHAL 3G6DH 4R8WH 8FABB 3WJJA 1Z3GL 5C0EB 4FQJH 2FL5B 3K4ZA 1FV1B 3VGEA 1UXWA 2QADC 1QSEE 1RIUL 3ARBD 4JE4B 5I0DA 3E6HB 8FABA 1UCBH 3LH2L 1F58L 5C0EA 1WEJL 1FV1A 5DLML 3SDAC 5IBTH 4FXKB 4NC1E 1FO0B 3SE4C 1KJ2L 3HNSL 2Q1EA 4U3HA 4JFOB 4MQXD 5IP4A 2WANA 4UB0L 3GHEL 1CXLA 1MUJB 1FO0A 2RQ8A 2AEQL 2NNAB 4F15B 4JFOA 3KPRD 2EECA 5IJKC 1I8IB 1RZ7L 4H1LH 1MUJA 4Y19B 4LSQL 1FDLH 3IRPX 1GAFL 1QRND 2B4CH 5ICZB 1XF4B 1BJ1H 2VXSH 2NNAA 4OD1H 1WZKA 2BNUB 1DEDA 3ZHLA 1I8IA 1AC6A 4FQIL 3GKWL 1EIBA 4Y19A 1MHCB 5ICZA 1XGQB 1XF4A 1JNHB 2JK5B 4M7JH 2BNUA 4ZTPH 3TZVD 4W70A 4P4KB 1RZJH 3S37X 1JNLH 3X13B 5TPWH 1KEML 1MHCA 5LGJB 1XGQA 4PP2B 4V1DD 1CICB 2APVA 1JNHA 3QB7C 2JK5A 1CK0H 3HTLX 2VLRB 4P4KA 2VUYA 2ZKHL 3BQUC 3X13A 1H15B 3NMEA 5EG6C 1I3UA 2BVYA 3QQ4B 5LGJA 4PB9H 4PP2A 1CICA 1YJDH 4YWGL 4U6YB 5BO1H 3E8UH 4JO4L 4DW2H 5CCKH 5DVMA 3MJ8B 2VLRA 2DQFB 5FA4B 1G7IA 4EI5C 4KGJA 2Y5TA 4D0BB 3QQ4A 5GXBB 4PJDA 4EXKA 2VDMH 3DSNA 1QUNA 4KHTL 4GG6E 4U6YA 3GM0A 3TNNB 3MJ8A 2ARWA 1H0DB 2DQFA 5FA4A 1A7NL 4QRQB 1MQKH 1L7IL 2RFXB 4D0BA 1RI8A 2YZ1A 5JW4M 4KRPB 4YHLH 1FORH 2L7UA 4ZXBB 5HDBE 4JVWA 4MAUH 4XMLH 3BMVA 2OM5A 3TNNA 4PJHF 1H0DA 4Z7VA 1AJ7L 4QRQA 2RFXA 4YHNB 1D5MB 3I50H 1KTLB 4QWWD 4BKLB 5JUEL 3X12B 4OCMC 3TPUB 4MXWL 1QLRB 4L8CB 1SJEB 4YHNA 1D5MA 5D7JB 4IRZL 4PBXA 1GGBH 1LP9E 3ZYOA 3T3PE 1KTLA 2F54B 4BKLA 1D5BB 3X12A 4Q0XH 1EDQA 5TGBB 3TPUA 1ZLVH 4D9RD 1QLRA 2P48B 4ODBD 4L8CA 5DRZB 1SJEA 5D7JA 1NGXB 1ZLSL 3KLSA 5L2KA 3DETD 4WW2C 4I1NB 2F54A 1D5BA 4GAFB 4FP8H 5TGBA 5T3XE 4K3JL 5DRZA 3WJLC 2XZQH 4BYHA 1NGXA 2AABL 5E2VH 3BXNB 4LMQE 3KR3H 3T2QA 2HKHL 5IIEB 1B0WA 1H3TA 3LPFA 5KVFH 2JIXB 3BXNA 1FO0H 5JIPA 2VUOA 5IIEA 1Q9WB 2DQTH 4K7FB 1QG3A 4OSUH 5D7KD 2JIXA 4WI3A 3K7UA 2AJXL 4TVSa 2GJZB 4JDTH 5KAQG 4MVBD 2RCSH 1Q9WA 1KCKA 4PJAF 3RI5F 1PEWA 2XKSA 3TCXA 4K7FA 4X7DC 5SWZB 4N8PA 3RKDC 5B4MC 3V4PL 2GJZA 2HTLD 3EJJX 4LQFH 2VXVL 5HHPB 4D3CH 5SWZA 1NFDF 4NNXB 5FAAA 3SKJL 5C8JB 2W9DL 2YD4A 5F89B 3DTXB 3FRPA 5IHZB 5HHPA 1LO2H 4ZYKB 4NKQB 5H2BB 5MERB 3VXOB 4NNXA 4ZOBA 4RFEB 1PDKA 5C8JA 3MXWL 1ACYH 5FUOL 5F89A 2WIMA 2CDGB 5T1KD 3DTXA 2O5YL 2ITCB 3OKEA 4Y8DC 5IHZA 4ZYKA 1D5XB 4M7ZB 5H2BA 2G60H 5MERA 3VXOA 4RFEA 4JQVC 5IHUL 3IFPA 4LSPL 4LP4A 5EULV 2ITCA 4X5WB 4WEBL 4ZO8A 3EDKA 3UBXG 3UJIL 1D5XA 3FQWA 4XP4H 1EV2E 1KFAL 3RX5A 4TYUA 2EO1A 4UTAH 3LN5B 2R9HC 4X5WA 1JPST 1QSEB 3WHE0 4DAGH 2ICES 3C5ZC 1T03L 3DBXB 1B4JH 4DTGL 5D2NE 4NYLB 4X80L 1OTTC 3LN5A 1CDBA 3HZKB 4OLWH 4Q9RL 1QSEA 3DBXA 2P45B 2D7MA 1LEIB 2AJUH 5HBBA 4NYLA 4CN4A 2UUDH 3HZKA 5JR1H 4RISH 4TOYH 5F3BB 3BSZH 3WHXB 2VH5L 3T4YB 1EZVY 4X5XB 4X6CF 4ZUWB 1HN1A 1VB9A 3WFCL 5F9JB 2M8XA 3K74B 2Q20A 4GXVH 1TFHA 4M7KH 5F3BA 1OT1A 2YPKB 3T4YA 4X5XA 1KBGL 4ZUWA 4ZODA 5F9JA 2B2XL 4WV1B 1RIHL 5F96L 1JV5B 2OX5A 1PYWB 2P7TB 2YPKA 1FAIL 2ZUTA 3F8UB 5AZEL 4ZO6A 2YD5A 1IAKB 1CFVH 5AD0B 1TENA 4WV1A 1ZLWK 5HXMA 1JV5A 4MA1B 4WI7A 1PYWA 2P7TA 4G8GD 1FBIL 3SKNB 3WFEL 2B8OT 1A6ZB 4LHUD 2GY7B 4WHTB 1IAKA 5FYKH 5AD0A 2ED9A 2QEJA 1F90H 1FZJB 5DMIH 1UJTA 5A2LH 5C0BE 3SKNA 4OLXL 3SDAD 1RUAH 1A6ZA 3MCG1 4WHTA 2AJYH 1FZJA 1HINH 1BOGA 1XZ0B 2V2TB 1JF6A 4XX1E 4GG6B 3CK0H 2BNQD 2Q7NA 1OF2B 1I8MB 1XGPB 3MJ6A 5FHBL 5J89A 3C08H 3LEXB 2CJUL 1BF8A 3LEYL 3L7FB 3MOQA 1XZ0A 2V2TA 3L7EB 4GG6A 5CEZL 2YD9A 2Z31B 3LQZB 4MDJB 3KPLB 4ODHL 3GSOB 3GZKA 5FYLD 1I8MA 1OF2A 2BOBB 1XGPA 5DK2B 3LEXA 3L7FA 2OK0H 3H3KA 3JWOH 1MIEH 3L7EA 3K8KA 5L9DL 1NUGA 2Z31A 5HVWA 3LQZA 4MDJA 3KPLA 3OPZL 4YIQB 3GSOA 2ENYA 2BOBA 2N7BA 4GKNB 3W81A 5DK2A 3QQ3B 3RWJA 2DQDL 1N5AB 1LP9B 5ENWB 2Y72A 3CSBA 1A7PH 4XC1L 2BHYA 3W0WE 4YIQA 2R0LH 5CJXC 2X1WL 4GKNA 5C08D 5JDSB 3QQ3A 1LDSA 5EIVA 1NSNH 1N5AA 1LP9A 3BQUD 4WNQB 2GI7A 4JFDD 5ENWA 3CJJA 1CF8H 2WW8A 3V95A 3EZ8A 5JDSA 5I1GH 4R4BB 1EFXB 4EI5D 3QZWB 3C2AH 4WNQA 5FGRA 1WZ1H 3HUJE 2IF7A 5EH1A 3NZHH 4UUJB 4OGXH 2H9GA 4R4BA 1EFXA 5E99H 1DUZB 4H20H 3OF6A 3HC4H 3QZWA 2VZSA 1A14L 3UPAA 3O8XB 1GZQB 2W1NA 2BJML 1TCRB 3GNMH 4UUJA 5I8EB 4AG4L 1DUZA 3FHAA 4KJQC 4LGPB 4K2UL 3O8XA 1GZQA 1TCRA 3H42H 5F7WC 1XH3B 3OAUH 3IDGB 2LTQC 1AGEB 5I8EA 1VADB 3GJFK 1Y6MR 1YN7A 3GSWB 4KV5F 1G9MC 2H26A 4XPAH 3S88L 2VZOA 3IDMB 1XH3A 2NY5C 5DD6B 3IDGA 1AGEA 1VADA 5E9DE 2FJHB 3NIGE 4R4FL 3GSWA 4ONFL 3WDIA 3HKFA 4OAWB 3IDMA 2AAVA 3DV6B 1NCUA 5DJ0B 3SQBA 5DD6A 3EYSL 5JXAH 4DKEL 4Q6IB 4YAQB 4MB5A 2FJHA 2EICA 4E0RB 5F7FA 4JM2B 1AXSB 3RA7L 4OAWA 4U1SA 3DV6A 5DEFB 5DJ0A 4Q6IA 4YAQA 4ZS7H 2PO6C 4E0RA 5I1LB 5I8OH 3T65A 4JM2A 3RVTD 1AXSA 4LRNL 5DEFA 4NQTA 4RWYH 4JPKH 4Q6YA 5ITBL 2R15A 3DROA 2G2RA 1K5NA 1TZGL 3X14B 5I1LA 3L5XL 3ZT5A 2ESVD 1YY8B 2R0ZH 1SY6A 4HMCA 4QTIL 3T4AB 4F9PC 4YK4C 4ZTOL 1DQTA 3FAWA 3RKDD 1U58B 3X14A 2B39A 4WUUD 5B4MD 1YY8A 5E7BA 4I13B 1N5YL 4R6UA 4Z0XB 1NEUA 1EERB 2E6JA 3T4AA 5IT2H 4KMQA 1C5BL 3LIZH 4F58L 3DECA 2R8SL 1U58A 2ID5A 4CDGC 4TUOB 4JEGB 4NBXB 1A1OB 4OT1H 3CSPA 4Z0XA 5C0JB 1P9MC 5EA0H 3KLHC 5F1IB 2XRAL 1NUDA 4TUOA 1A1OA 4OV6F 1MRCL 3QRGL 5C0JA 4RNRB 5F1IA 3ALWA 2EE9A 3NA9H 5EZLB 5IBUB 2LU7A 3U1SH 5IFHH 3BRGC 4CL7A 4RNRA 3P30H 3UJJL 1NMAL 1N4XH 4JKLA 2MMXA 4X9IA 2X10A 5EZLA 1SM3H 1YQVL 1AFVL 1FFNB 5EU5B 2R9HD 4XP9L 5I1HH 3C5ZD 1R3IH 1TPXC 2XA3A 4GLRI 5T3ZD 1ZA6B 4OIIL 3QUMB 2QV2A 1FFNA 1OTTD 5EU5A 5C0BB 5FO7A 1BIHA 5C09E 3ORJA 4XNYH 2L7JA 2GJ6D 3CC5B 1SHMA 4KK5C 3A6CL 1RVFH 1ZA6A 3QUMA 1VERA 3QIUB 4QEGA 5C0BA 1JJUA 4HJJH 3OSKA 1CD9B 3WN5B 32C2B 3B8SA 3FT2B 4JO1L 3QIUA 5GRYA 4HC1L 5HI5C 4LASH 2R2HB 1EGJL 1IAII 4X4YB 2YUXA 3WN5A 3IRZA 2A9ML 3FT2A 3ULUE 1HOCB 2FGWL 1FIEA 1F3RB 5TQ0L 1DQLH 2R2HA 3FO1B 4X4YA 4JHAH 5DZNA 1IRAY 4K8RC 1VA9A 4M5YL 3N50A 4KROC 4XP6L 2H3NB 3LEVH 1HOCA 4LHQB 4PG2A 4BH7B 4JO2L 3FO1A 3S3SA 3W0WB 1IM9D 3GBML 4U1GC 5GS0C 4OQTA 3IDUA 2KPNA 3P0YH 3T2NH 2H3NA 5BVPL 4BH7A 2CUMA 4LPXA 3V5DB 3IDYC 3W0WA 3KJ6L 1U92B 1IEHA 4DKFH 4ZAKA 5AZ2L 1S3KH 4R2GB 4M3JA 2GTWB 4MD5B 4G8FB 4F7PB 4RDQG 2VDNH 1U92A 5GGVY 3HUJB 4HLJA 1YYML 4I3RL 4LPWA 3QHTC 4E41E 2GTWA 4MD5A 2BRRL 4X7SH 4G8FA 4QCIB 4ZUTA 5FEBA 1EBPA 4F7PA 1NC2D 4YGVB 3HUJA 4DGVH 4TQEL 2F58L 4HK0B 1KXTB 1JTOA 5CBEB 4QCIA 1JPFB 3CLEL 4Z8FH 4YGVA 3SDYH 2DLEA 2HJFB 2VR4A 1K4CB 2V2XB 4HK0A 4G7YH 4AEFA 2QQQA 5CJ8A 5CBEA 3P4LA 3GDBA 4J2XA 1MFEL 2HJFA 4QHMB 4RX4D 2HFEB 1K4CA 3NA4A 1OCWL 1NGYB 2V2XA 2EC9T 5E9DB 2WLYA 4YFEA 2O5XH 5C0RH 5DDHB 2NTSP 4QHMA 2F5AL 2HFEA 4JY5L 5JLZB 1BECA 1A0QH 1WIOA 2PYEE 3JUZA 4TSCL 5E9DA 3O6LL 4JPVL 2R29L 1ZOXA 3NABH 1T04B 1G0DA 2GT9B 2JKXA 4WU7B 5DDHA 5IFAH 5JLZA 1E6OH 3QUYB 4MCZB 4HH9B 2DQJL 1T0NB 4MJID 3P0GB 2NY6B 1MCCA 1MFCH 2IPTL 1ZKAA 4YHYC 5B3JF 1T04A 2GT9A 3QQNA 4WU7A 2EXYC 3EDEA 1HK6A 3QUYA 4MCZA 4HH9A 1DVFB 1T0NA 4XAKE 4GLRH 5DK0B 4KJQD 3MNZB 1DVFA 2XPGB 2FB4H 2QLVB 1I1RA 1MWAH 3PV7A 4FRWA 4ZDHB 3UTPE 5DK0A 1V7ML 2CH8A 4WUKL 3MNZA 2XPGA 2NY7L 1MCSA 4ZDHA 2DYPB 4Y2DA 5E1HB 3TNMB 4KAQH 4OQTH 2V7NB 4CJ1A 1OT2A 3MRRB 2IG2H 5C6TH 2EIZB 1G9NC 5D8JH 1IAIH 3MOAH 2DYPA 2VDRL 4HAGA 4S1SL 3TNMA 2NXYC 2V7NA 2ZUQB 1Q38A 3MRRA 4WW1B 4PJ9B 1YEEH 2EIZA 1ZGLM 1YEKL 2PO6D 2N56A 4OZIE 4LARH 2P5EB 4XVSH 4WW1A 4PJ9A 2J6EL 4K3DH 3O2DH 2WBKA 3OHXB 1QVOB 5SWSE 1WUNT 2MQCA 3VXME 1AKJB 1CE6B 2PW2B 1KJ2B 3GHBL 5HGHB 4XNUL 4POZC 3V4VL 2HLFC 1A3RL 3PP4L 3OHXA 4M6NH 1QVOA 3VDBA 1FC1A 1RUPL 3P11H 4GXUN 1AKJA 1CE6A 2PW2A 1KJ2A 4OFVA 5E6IB 5HGHA 5JA8B 5C09B 3STLB 2RJMA 4V2CB 3PWPD 3B2VL 3CAFA 1SYSB 5IROA 3K2UH 4YC2C 2R0KL 1BD2D 5E6IA 5DEZA 5C09A 3STLA 2KBGA 1H3VA 1SYSA 4FZ8H 2D03L 3OAZK 4R0LB 5D4QA 3KLHD 4EQ2A 4KQ3H 4R0LA 2XT1B 3UYOD 4QHLB 3BPLC 2Q3AA 3O6ML 5KANG 4E5XB 1QR1B 3U2SB 3BEWB 2ZWLT 4UT7H 1MRDL 1XGYL 1A4JB 4QHLA 4E5XA 3BN9C 2UVEA 3VWKB 1OAYH 1QR1A 3BEWA 4I8DA 5FB8B 2UV3A 2DBJA 1ITBB 1UWEL 3CFDB 1A4JA 1J8HE 4B7IA 4DN4H 5F71A 5IHBA 4HUMB 3EYUL 1VGEH 2DF3A 3VWKA 1GHFL 5J12C 5JPMB 5FB8A 5C0AD 1BQLH 4JHWH 4KMLB 1GGCL 3CFDA 3WO4C 1I7ZB 4JY6B 4KK5D 1MCOH 2W38A 3WKML 3CDYA 1YA5A 5E5RB 1I85C 3SDDD 4AMKL 5JPMA 3PQYE 3PXHA 5GRUH 1RZKH 4MNQD 4E41B 1I7ZA 2GY5A 4XAWH 1BFVH 4JY6A 3DO7B 2D3VA 2VDQL 1SEQL 3Q6GL 1YMMD 2P42B 3JUYA 4JQXC 3ZDXE 4X7EC 2APTA 5HI5D 1CTOA 3GMPB 4XPBL 4E41A 5HHXH 5ID1B 5JXED 3DO7A 4U3XA 1P4BL 2WLZA 2ED8A 4UIMB 5EIIB 2KKQA 4NWTH 3GI8L 3GRWH 1CGSH 2YUWA 2VQUA 3GMPA 5ID1A 4WTZG 2B4CC 2R4RH 4M4RA 4UIMA 5EIIA 4KROD 3VW3H 3AXLB 4N1EA 4HAFA 4K9EH 4FQCL 1Q0YL 3LVEA 5KJRL 3TO4C 1UYWL 3AXLA 1RZJC 3FQUA 3GJFB 1T21B 3RVWC 2PYEB 4JFHE 3O6KH 4NCC2 1G6RL 2RHEA 1TDQA 1OAKH 1MFBH 3GJFA 1HEZB 4X99B 4JRWA 4YBLB 3DI3B 4JPWH 4R26L 3VDCA 1T21A 1CL7I 4N0YH 3IAPA 4AL8L 2PYEA 4A2LA 1X5IA 4IDJL 2BY2A 4GW4B 2VKXA 1YJDC 2JJVA 3B9KB 4I2XE 5I6XB 1K3ZA 1HEZA 4X99A 3HG1D 1ZHBB 1FVCB 1WIUA 1T7YA 4ZG1A 2Q86B 1WCBB 2FZ3B 3B9KA 4FZEH 1A6AB 1L7TL 2EDOA 5HYJE 2DQCH 4MNGE 1NDGB 1ZHBA 2V5TA 4UBDD 1FVCA 4FHBD 1INQB 2E27H 1ORQB 2ZUXA 2Q86A 1WCBA 2HTKC 5TE6L 2FZ3A 3MODH 4K55A 1A6AA 3CX5J 1MCEA 4JO3H 2EKSB 1ADQL 4IS6B 4M03A 5F6IC 3V8CA 4NM4H 2V9RA 1NDGA 5FM4A 3RGVB 3BRDA 5TDNB 5T5NG 3UAJC 4NGHL 3ULUH 5CJ5A 1ORQA 1QSVA 4CUCA 3IFNL 3OGOE 3H9SD 3NH7H 2EKSA 1EMTL 2HWZH 3RGVA 5IEKB 3SBWA 1U2CA 3MTRA 5TDNA 2XQYG 2FBOJ 5F7HA 1L0QA 4MA3B 5K33A 3HFML 2V9TA 2GITA 3WE6B 5IEKA 3U7YL 3VD3A 1BMGA 1OWRM 2DQHH 2VN7A 3EZJB 2DKSA 4MA3A 2Y4SA 1I1YB 3OKLB 2E5EA 2E7HA 4U6XB 1EHLL 4LDEB 3UTOA 4OZIB 3WE6A 4OIBA 2HKFH 2KQNA 4XT1C 2EXYD 5KVMC 2XTJE 5SWSB 3EYOB 4Y4FC 1GOGA 5T1LB 3VXMB 1I1YA 2FLRT 3OKLA 4U6XA 2BXZA 4OZIA 2GTZB 1A64A 3QWRA 1TETL 1YYLL 4YX2H 3RAJL 1C7TA 5I9QC 4OTXL 4TVPD 5SWSA 3EYOA 5T1LA 3VXMA 4BUHA 1NC4D 1T89C 2J5LC 2GTZA 3KHOA 4LDOB 3WV0A 3QO1B 3ZTNL 1KENL 1PVHA 1FNHA 4L1DA 1W0VB 4NHCH 1YEHH 2FIKB 3GK8L 3TWCH 1R24B 5HVFB 3QO1A 5I19H 1J11A 3FB7B 2FIKA 5GS2H 3V6OE 3T3ME 1R24A 1AXTL 1EHAA 3C6LC 1TNNA 1QNZH 3IJSB 3FB7A 2NXYD 3K3QA 4OV5B 1FZOB 3DHMA 3ILQC 4WEUD 3VDAA 5EUOE 3GJFH 1BWWA 2C3VB 1HSAB 3IJSA 3NCYP 5CINH 3MCLH 3EOTL 3DGGB 1RURH 1CD8A 4LPTA 1YEGL 3QEHB 2E7BA 1FZOA 3X3GH 4OV5A 2H6PB 4H0HB 3VXNB 1JVKA 4RMRA 4QHKI 2C3VA 2IFGA 4H8WL 1HSAA 5CS7A 3O4OB 1AQDB 3DGGA 4TUJB 1F4WH 4LNRB 1E4KA 2H6PA 4POZD 3VXNA 4MJ5B 2HLFD 3D2UD 1J8HB 1BGXL 4IOSD 4FQQB 5E2WH 1XCTB 1AQDA 4TUJA 3GO1L 4K71B 4M9PA 3RIAF 2Y07H 5KVDH 4LNRA 2FR4A 4CMHC 4KDTA 4MJ5A 3O45B 4LLAA 2Q8AH 3TJHD 1NLDH 2KDGA 3AC0A 4MXVE 1J8HA 3O6FC 3MLXH 1OAXL 4HK3J 4FQQA 1XCTA 2NY3B 3G9VA 5IW3A 1MCRA 3OB8A 2AK1H 3PQYB 1JRHL 3O45A 4M5ZH 1AGBA 3VA6A 3T77B 5EBMB 3VXTB 5EOQH 4G6JH 2FO1A 2AP2A 3ME0A 3PQYA 4YJZL 1JUFB 1SEBB 4U6TA 3D39E 1KN2H 2Y06L 1BVZA 3SOBH 5HVHC 3T77A 5T3ZL 3BGFB 1LDPL 5EBMA 3DRQB 3STZB 3VXTA 4OCXL 1T7XA 3VGGA 5EFIB 3MLVH 1JUFA 1SEBA 5I1DB 3C09C 3H9ZA 4U0RC 3KPRE 3BIBX 3U0PA 1QRKA 1XCQB 2FNBA 3DRQA 3STZA 1QRNE 5ILTL 5EFIA 5F6HI 3BN9D 1CLYL 5I1DA 3QIWC 5EORH 1CLZH 1IGML 3GIZH 1XR8A 1BHGA 3HMXH 4PJGF 5HPOA 1XCQA 5L6YL 2XQBL 3SE9L 4X9GA 1RUMH 4NO0D 4PJFF 2DIBA 4JKMA 4LSSL 2J3SA 5E8DL 3QCVL 2JJTC 5DRNB 2EC8A 3UROR 4V1DE 4YDJB 3IT8D 1D5IH 2EH7L 3RWCB 3TBSB 1ZEAH 1EXUB 1J87A 4N1CA 4N9OB 4YDJA 2R1WB 1EO5A 1JK8B 1GGYA 1S5HB 4QF1B 1IL1B 4EKXA 2L0DA 3RWCA 3TBSA 4GKZB 1VSCA 4I2XA 5JW3H 1EXUA 1RUKH 3H2WA 5EPMB 3UYPA 7FABH 5HYJB 2P49B 3AB0C 2R1WA 2CMRL 1JK8A 2QQKL 2EYRB 3GJEB 1S5HA 2ZPKH 3LKSB 4QF1A 5FGCB 4OUUA 1IL1A 2YD6A 4GKZA 3V52H 5KVGL 5CSBA 5EPMA 1BLNB 4NHUB 5HYJA 3LD8B 4MNGA 2ADJB 2EYRA 3GJEA 4GH7B 3JWOC 1LNUA 3I6LD 5DVLA 4XP5L 4XVUC 3W9EB 1BLNA 4NHUA 2XY1A 2ADJA 4FQ1L 3NFSL 4E9LA 3TO4D 1D6VH 3NOIA 2IBZX 1C08B 3FN9A 4O5LH 5DJ2B 4NQCD 5KOMC 5E56A 1X5HA 2BDNL 4XVJL 2DBLL 3RVWD 3QCTL 4M6ML 4L1HA 3LPWA 1N26A 1PW3A 4NN7C 3W9EA 2KH2B 4PG9B 4W81A 3VXQB 1GC1H 2ZCHL 5HYSG 1C08A 5DJ2A 1A7RH 1PSKL 3ARPA 2CKNA 2HH0H 2O26U 1I7UB 3DJ9A 4IRSC 2J8UF 3BKJL 4ODUA 2AGJH 1U41A 4P3WA 4PG9A 4M93B 1RY7B 3VXQA 1PX3A 2BXYA 4NQUA 3VFTB 3SDXF 3DMMB 4NQED 2XTJB 2ICWB 4P46B 1I7UA 4NO5B 3RKPA 4XP1H 4LSVL 4NBYB 5T5FL 2BSED 1XGRB 4UT6H 3D0LB 2CPCA 2XXCB 2XZAL 1JFQH 3VFTA 3DMMA 3RFZC 2ICWA 4P46A 4NO5A 4XMPL 1CDHA 2JB5H 2MJWA 3LN4B 2HTKD 4LLUB 5EDXA 1XGRA 4FQ2L 1YEFL 3D0LA 1EVUA 3F12B 3UBXI 4M7LH 5D7KE 1BBDH 4M4PA 1F3JB 1AQKL 3LN4A 1IGIL 3QHZL 4LLUA 3IDXL 4U7MA 2BZDA 4NWUL 3GMLB 4NKDB 1NMCB 3F12A 1RUQH 2EC9U 2NZ9C 3GB7B 4X6DF 5C71A 2KL6A 1YNTB 1F3JA 1JF1B 1AHWC 2FECI 5ADPH 3FOMB 2AQ2A 5GZNC 5I73B 3GMLA 4NZUL 3SGJC 3RVVD 4I77L 4H5SB 3HHRB 3OGCB 3V6OA 1F5WA 3GB7A 1YNTA 1A6UL 3MLYH 4GRWE 1JF1A 3SPVB 3CVIH 1D7FA 4U05A 4D9QD 5JQHC 3FOMA 3LY6A 3HZYB 4ZFGH 4H5SA 1OGAD 3OGCA 4JAMB 2Q76A 3MBXL 5EUOA 3AAZB 4M61B 2PR4L 1A5FH 3SPVA 1ITCA 4Y4FD 3OV6A 4JAMA 3CZJA 1QKZH 3B83A 5JOPD 3WIHH 3AAZA 4M61A 3VD4A 2J12B 4NKIL 3MXVL 1BZ7B 5LXGL 2VDLH 5FM5O 1WQVT 3TN0B 1OTSC 3WUWB 4YDKL 1BZ7A 1CZ8H 3CMOL 3HCVB 2NY0C 4HWZB 5HDQL 3EDFA 3ARBB 4O58L 2OJZL 3D87B 2V5SA 3WUWA 1N2RB 5FGBA 1S5IH 3N1GC 1TNMA 3EKCA 4KQ4H 4HWZA 5C2BL 5FUZH 2QQNL 4K94H 4NO3B 3ARBA 3C6LD 1NAMH 4F8TA 1KPRB 4PJ8C 2FDBP 2A1WH 1N2RA 3ILQD 3ZE1F 3HR5B 3S5LB 5DD1H 5DD0H 4NO3A 2Y25A 3V7MA 3KS0H 4BFGA 2BP3A 1BM3L 1KPRA 3D39A 4QHUB 4UILL 4HWEH 3KPRB 3AM8A 5MEND 2VLJD 3HR5A 3S5LA 1KGCD 4M6OH 1GYAA 1QRNB 2IQ9L 3CXDH 1ODAA 2E9JA 5JHLH 1IE5A 1YEIL 3PWVB 5TFSH 1GRWA 4DGYH 1ZWIB 4QHUA 3KPRA 5BZDA 3V8OA 4OBSA 1QRNA 1WFNA 1W2KT 1QFUL 2PTTB 3PWVA 1ZWIA 3TZVB 4HIXL 4LKCB 4L8DB 5C07D 1KN4L 4L29B 3BO8B 3O6FD 2MCPH 2VDKH 2FX8H 4V1DB 4G8GE 2PTTA 3V0AC 5T33L 3O8XC 2RB8A 3LN9A 3TZVA 1NFKA 1BQSA 1U6AH 4C57C 4LKCA 4L8DA 4LAQH 4L29A 3BO8A 2FHBA 4V1DA 4XNZC 2MPAL 4H88L 5D93B 1LMKA 3WUZA 3VG0H 2IPUG 1IGTB 3BPNC 4GXUM 4NC0B 1R3LB 5FCUH 3P9LB 4YEFA 1ZTXH 3L3GB 1TQBC 3B5GA 4G3YL 5ALBL 3U30C 2BNQE 1HDMB 5IMMB 5IB2B 3L3JB 1IGTA 4PREB 4WI2A 5EWIL 1R3LA 1QFWI 1Y18B 1FYTD 4LK4A 3RTQC 2FEEI 3P9LA 2R2BB 3L3GA 2AJVL 3U79A 1LO3L 1HDMA 3QI9C 1IT9H 5IMMA 1RSFA 1JZ8A 5FYLE 5IB2A 3VGAC 1I8LA 4UV4H 3QIWD 4PREA 2H2PC 1BFOB 2WUCL 1Y18A 2LE9A 3GGWB 1IAIM 2R2BA 1RD6A 2K7PA 4YUEL 4M02A 2D31B 1JYNA 3KLDA 4TNVK 1XIWC 1BFOA 1CTNA 2YMXL 5BVJB 4NN5C 3GGWA 4LCYB 1MVUB 1BQHB 3THML 5AYUH 4WDIB 2ADFL 5FYKD 1OAQL 5KAQF 3OX8B 1JPSL 5C08E 4CDHA 2D31A 3IJYB 2E8ZA 5BVJA 3O11B 4LCYA 1MVUA 1BQHA 4JFDE 1LWRA 4K8RL 4PTTB 2P8PA 4WDIA 4ZFZB 3OX8A 1YUHB 3IJYA 5D2NC 5I16B 4M6AA 1IGCH 4ONGL 5C7XL 5GS0L 4PTTA 1OOAA 3TH2T 3TJEH 4ZFZA 4U3CA 1YUHA 3EO0B 1V3JA 4TSAH 2OR9L 3QCUL 2Y5EA 5I16A 4GAGH 4L9DA 4U1HB 4WHYG 2IJ0C 2NY1C 5D5ME 5DD3H 5C86A 3EYQC 3EO0A 4OZFB 2GIYA 2XKUA 4U1HA 2YPVL 1HHKB 5LQBH 1DL7H 4MA7L 4XVUD 5JORB 3BKCL 35C8L 1FGVL 4OZFA 1Q1JH 1DUYB 2GEEA 1NUFA 3A6BH 1KLUB 1HHKA 2FX9H 4HF5L 4P99A 3BRFA 4V2BA 5JORA 2H1PL 3I02A 3QDMD 1XGTB 1DUYA 5DJDB 4GRWB 5DTFB 3UP1A 3FB8B 1KLUA 1J10A 3RY6A 3GM8A