4ESKA

Crystal structure of a strand-swapped dimer of mouse leukocyte-associated immunoglobulin-like receptor 1 (nysgrc-006047)ig-like domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
96
Chain Sequence
SLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukocyte-associated immunoglobulin-like receptor 1
publication title Crystal structure of a strand-swapped dimer of Mouse Leukocyte-associated immunoglobulin-like receptor 1 IG-like domain
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 18
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4eskA00
5DJZA 5HGBB 3DX7B 2ORBH 3OPZH 4WI3A 3CU7A 3RUGE 1WZLA 5B39G 3IVKB 5HY9A 3GJEB 3E0GA 4BFIA 2DLFL 5TE4L 4LVEA 3MLSH 4HG4J 3GI9L 3SJVB 1ITBB 4C59B 1T3FA 5B39A 3HI1A 4PP2A 1NBYA 3O9WA 2ARJB 3IGAA 5F7YC 1C7SA 3DX9A 3GM0A 2GJZA 1Z9OA 3T3MF 4HKJB 1VB9A 4NN6C 4ZTPH 4G5ZL 2Y07L 1SJEA 5EU7E 3AUVA 5A2KH 1UXSB 2VSCA 1F6FB 4ZFZA 2W9EL 2D9CA 1FBIL 1EA9C 5C7XH 4HK0B 3L5IA 4MD4B 5MEND 3MV9D 2Y9RT 3EYQD 5E8NB 4P2QA 4FP8H 1A6WH 4KUCF 3VD3A 1P5UA 2DQUH 1ORQA 4RISH 1N5AA 4WW2C 2X4SB 3VXRE 4N90E 1KSRA 4MAYD 4RGND 4D9QE 2MPAH 1IQDA 4FQCL 4YR6A 4WY7L 1XGRA 1P4BH 3ZE1F 1UG9A 3BP4A 1NAKL 4S0TD 1CL7L 4QCIB 4YEEA 1I7RB 4I8DA 1L7TH 5J11C 2Z35B 2ZNWA 5E4EB 3BJ91 1ZLUK 4S10A 1IAKA 4ZOAA 4ODBD 2HFEA 3HNSH 2O5YL 2ITCB 3MXVH 1LWRA 4PBWD 4OF6A 4XWGH 3GKWH 1NC4B 4UT9H 3FL7A 3BD4A 3LSOB 3TNMB 4LIQL 5I6XB 1C16B 3ZHDA 3NOIA 3QB7C 1MQKH 1N3NB 5GGVY 4XCNA 1QFOA 5SWQB 5I16A 1DCLA 3LN4A 2C1PB 1JHLH 5FGCB 3QCVL 5FKAA 4RIRB 2FBJL 2DYPD 3WSQL 5BS0B 1UCTA 4M6OH 3SE9L 3AS0A 1OP3H 4NN6B 2GQHA 5HYQA 4FQLL 3EOTH 1AFVL 1KTDA 3O6ML 3KLHC 5I17B 2GT9A 4M1GL 3EZJB 3L9RB 4POZC 2D3VA 4PREA 2VDRH 4Y4FA 3OAZK 3MR9A 2YOCA 1KLUA 2DM2A 5IQ7L 2EO9A 5T5NG 3VXSB 4PRAA 3AM8A 3KNBA 2B8OT 1PEWA 2GAZA 2QSVA 2VNCA 3HNTH 3O6FC 4QHKI 4QTIH 4UIMB 3X13B 4KHXH 4AQ1B 1J1OH 4F9LA 2DQGL 2VZUA 3AMLA 3B8YA 4PJCF 3N0PB 5JPMB 1HSAA 3WS3B 5C0IA 5E4IA 1AE6H 1RVFH 4UILH 3QO0B 5I66B 3H0TB 2XRAH 4RA3A 2X4OB 3WIHA 4UV4L 1TZIA 4JVWA 1PLGL 2JB6A 1GCFA 2XPGB 5F1IA 4HS3B 1FRGH 3CVIH 2V5YA 4D0BB 1J86A 3TBVA 1D6EB 2NW2A 4GAJH 4QHMB 1OPGL 3BZEB 1I1AB 4XWOC 4X7TA 4LSUL 1NBVL 1G7MB 2J1KA 1HHKA 4U1MB 5I30L 3MV8B 3GNML 1T1YB 1FC2D 1MREL 3BZ4B 5F7NC 3JV6A 4U6HA 4XCCL 1FZJA 1B0GA 5JHDD 3BAEH 3VRJB 2AK4B 1UQSB 3BPNB 5DEGB 2AJYL 1XF3B 2FCBA 2HH0L 3L3OA 3VXMD 3MREA 4RGOH 5AD0A 1CK0H 1OAQH 1Q1JL 3NCJH 5L6YH 5EUOB 3SCMA 3AREA 3GMOB 1DUYB 4LU5H 5T3XL 3TYGH 1PX4A 1ZT4B 2DTML 2X70A 5IROC 2VXTL 5DJYA 3MTRA 5DA0B 1MCIA 3WXVH 1BD2B 5DD6B 4JKWA 4KGJA 3V4PL 5FCUL 4Q6IA 3QQNA 2GITA 5I73B 2LE9A 1EAPB 4RA0C 4X7SL 5L8KB 2ESVA 3O6FB 3ARDC 4GRWB 4HAGA 5T1KA 4ERSL 1FFPB 3CFBB 5EBGA 3QI9B 4JDZB 1NLBH 4QOKB 4XAKE 3S4SA 5C09D 1YZZA 5FYKL 2IQAB 4HMCA 2GJ6A 5C9KA 1FAIL 2OL3A 4OCNC 5E2VH 4D3CH 3PDDA 5E6ID 3PP3H 3VA2C 2Y6SC 4Z7WB 4YEFA 1B3JA 1YNLL 1WSST 4PRHD 1DQML 3B3IA 3J8F7 3SE4C 4RX4A 4MA7L 1AI1L 1ZT7B 1HSBB 2IH3A 4OV5A 4DCQB 2X4RA 3KYAA 2FL5B 1JNHA 4M00A 1Q8MA 1YNKH 5DMGD 4YXLH 1KCRL 2EDDA 5F1OB 3NABH 1VEPA 4OGYH 3UTQB 4JPVH 2J7LA 3WNNA 1S3KL 5ISZA 5C70A 1QFHA 1G6VK 3U4BH 2VZTA 1EZVX 3D9AL 3L3JA 1E4XI 2YPLA 4OF5A 2IBZY 1TVHA 4BYHA 3VGFA 2HLAB 1KPVA 4BH8A 1JWUB 1B0WA 1NJ9A 1PKQA 5JNYA 4WWKB 4RRPG 2HJLB 1EXUB 4XBEL 4C83A 3H9SA 3F58L 3DRQB 3G6AB 4JG1H 1DBKH 3LKOA 3BZFA 1MJUH 4PG2A 4QRPD 3RL1A 1BJ8A 4KHTL 1AGDB 1X5IA 5F7HA 1JGEB 1QSEA 4JO3L 3WL9B 4LCUA 2ADJB 1ZGLB 2YA2A 1TTFA 1RJZA 3QNZA 1RK1B 3O9WC 3QJFA 3H7BB 2H41A 2BVQA 1MCPL 4JFOB 5FYKU 3FQTA 4CVZA 3MRCB 2HTLC 2H1PL 3VD7A 3EKCA 4MVBC 1XGUA 4LVHB 3ECBA 5IMMA 1II4E 1QP1A 5GGRA 4UINH 2HMIC 5HDQL 5DD0H 1FNGA 2HJKB 5AZEH 4X6DE 5C9JA 3BOVA 4LMQE 1J0YA 3UTZA 5K9JH 4PB0H 5FK9A 4D0DB 4MQ7A 3MLTA 4YBQC 4L8SC 3DUUB 1ZLWH 1ZHLA 2BY3A 3NA9H 1SMAA 1NCNA 1JZ7A 2DWEA 3BKJH 5JUEL 1A9EB 3WIFB 4J3UA 3GZKA 3SDXB 2UZIH 3GHBH 2B5IC 4HZLA 2WBWB 1MJ7L 4P5MB 1U8PA 4N5UA 3HHRB 4MNQE 4L8DA 4AZ8A 4DN4H 5H35B 2FHBA 4MNHB 5JHLL 4YC2B 8FABB 3REWB 1XGTA 3U1SH 5HI3C 1Y6NR 5GRVK 1KEMH 4PJ9D 4ODSL 1PD6A 3TYFB 4I48A 5AZ2H 5BJTB 3RGVB 3MLVH 5IMLA 4JE4B 1IEAB 5CAYB 1LO2H 4BFIB 5DYOA 2XY1A 5DC4B 4WI6A 2HKFH 2LQRA 1X9QA 4M7ZB 3HI1B 4JKMA 5KW9H 2FX7L 5KSBE 3IGAB 3NIDF 3B6SA 2GJZB 2R2BA 4NZRL 4IDJH 2AV1A 4J4PC 4XTRD 3CZFB 5F89A 3T0EE 4IMKA 3KVQA 5IBTH 3LDBC 3WNKA 4JM2F 4ZFZB 4K8RD 2J88L 1EGJA 5EOTA 3TIEA 3GMPB 4PG9B 1IEBA 2YRLA 3MUJA 3NA4A 4HUMB 2FWOA 3B2UC 1CDBA 3LEXA 1N5AB 5GGQL 4KJWC 4OFYA 5DRXA 3V5DB 2X7LA 2EDLA 4FQHA 3ZT6A 1D9KB 4P2RB 1YEEL 1VEOA 1FYTA 1FL3B 2YZ8A 1IQDB 1H3VA 1XGRB 3O2VL 5LKNA 4NO3A 4C57C 2Z8VC 5T3ZE 5DK2A 3ZE2E 5C6WH 1C1EL 3MRFA 3HNVL 4EVNA 3S3SA 1YEDA 3O2DL 1CCZA 1NGZA 2X1OA 6CGTA 1IAKB 3TBSA 1CXKA 4Y4HA 2QEJA 5CKAA 2AXGA 2HP4A 1Q0XH 3O3EB 2R69H 4GLRI 5C07B 4PJDA 2O93L 4WW2F 1JE6A 2YUVA 4XAWH 4GT7A 5IB3B 4E0RB 3VDAA 5DJDB 1I9JL 4M6NL 1CT8A 5DJCA 2F54B 3C8KB 3LN4B 5FKAB 3SE8H 3SCMC 3IFLH 3AREC 2EDFA 1I3UA 1NFDF 5GZOC 4RCAA 1U91B 1KTDB 5AWNH 4WEBH 2IBBA 3QIBD 2A83A 1WZKA 5C2UB 4Y4FB 3HPLA 3EJYC 1F3DJ 5JXAH 4EI5C 5DS8A 4Q6IC 4PRAB 2ZPKL 3FQXA 2GAZB 5DJ6A 3CFEB 3ZDYF 1CDYA 4FFYH 1KYOJ 2R0LH 2CR3A 5HDBE 3DI3B 1HSAB 5IB4A 2YUXA 2D2OA 2AGJH 5L2JA 3MLPA 2BFVH 4TTDC 2ADIA 4GFTB 1KXQE 2X40A 2FRGP 1AXTL 4YHLL 3PF2A 5E6ZA 3WIHH 1LILA 3MRQA 5LWYH 3S88L 1TZIB 3MCKA 4LSVH 5F1IB 3MV7D 5E2JA 2P4AB 3QG7L 1CIUA 1UWXK 5MEQA 4NUGL 2VZSA 3TBVB 2NW2B 3HG1B 4KZDL 4ZNCD 2EDWA 4FQ1H 4X7TB 3RAJL 3T3PF 4BZ2H 2ICEB 4QRTA 2OP4H 5M94B 3DV4B 1HHKB 3P0YL 4RFNC 1A1NA 2OZ4H 4HW6A 1U8MA 4Z7NF 4QEGA 4XC3L 1FZJB 1QUNA 3NBNA 3C6SA 3MRLA 1XH3A 4WO4B 5FGCE 1TJIL 3L3OB 3RA7H 5BS0E 2Y5EA 3MREB 5AD0B 5L88H 4J1UB 4WJ5A 3SGKA 3Q0HA 4S1SL 3IDXL 4PG2C 4UOW0 5D8JL 1Q9LB 1WTLA 1NMAH 4DZ8B 5BOZG 3FN9A 5DJYB 3VXSE 2UZYB 1MAML 4HWUA 3RTQA 2GITB 1MLCA 4GS7B 2P8LA 3GBLA 3IFNL 4GUPA 4U1NA 2G60H 3MZTA 4K9EC 2FBOJ 4OCMC 4DQOL 3S4SB 4U6XB 1IL1A 2GJ6B 3SKJL 3KPSB 2OL3H 2EC8A 2OL3B 4R0LC 4XB7A 4M8QA 4HIXH 3SO3B 3FT3B 5JOPE 1KT2A 4GJTB 5DRNA 3GIZH 1JPFA 3MLXH 1CG9B 1JRHL 3ZLQC 2P5WB 5DD3L 1CS6A 3B3IB 4EN3D 4HPOH 2RBLA 3ROOA 2IH3B 2X4RB 4NM8L 1S8DB 1RZ8A 1CXEA 3MV8E 3ISWA 3IF1B 3HMWL 1S9WB 1HHJB 1F4WH 1WFNA 4RFNB 1RUAL 1UM6L 3QSKB 4G43A 2AK4E 5ISZB 5J6GA 2XKNA 3QFJA 3WKNA 1WWWX 3CFJB 2GFBA 1NDGA 4X80L 3ET9F 2YPLB 5FIEA 3X3GH 3S37L 1BOGA 1KPVB 4PRPD 5J0BA 4BH8B 1C08B 1WUNT 3MBEA 5EUOE 3S96B 5JNYB 3RKDC 4EDXA 3WJLA 4ONHB 3QUXD 4C83B 4Y5VB 5E8DL 1UH2A 2BY1A 4XMLL 4YDVA 2EH7L 3BZFB 4EOWH 3RL1B 1MFEH 1S7RA 1BD2E 2P7TA 4CU8A 3ZMRA 3QH3A 1QSEB 2ZOLA 1CDGA 4GRWE 1RJZB 1AJ7H 3QNZB 5E8EA 3MV11 4QOKE 1BQLH 3DECA 2ZJSL 4XNMA 3HRZA 4CVZB 2CJUH 5DZNA 4IMKC 1DP0A 3AU1B 5J56B 1XGUB 1VADB 1VEMA 4Z7WE 3WXWL 4HGMA 3JWDC 1U41A 3H3PH 1BGXL 2RJMA 4JDVA 5IFHL 3DXAA 5D7LD 1I3RA 3OGOE 5TH2A 4NQDA 1WAAA 5C9JB 4GMSH 2ZUQB 3UTZB 1W72L 4L9LB 1JWSA 5EZOL 1INEH 2VLJB 1ZHLB 2Q86B 1B9ZA 3VXTA 1TQBB 4KKLD 4OD2A 2DIJA 4MA1B 4KRLB 4KJPC 2NY4D 2R1XA 1GHFH 4XZUA 1CGSL 1U8PB 2UWEB 5TFSL 2AVGA 1FBIH 3NAAL 2A74A 3DARA 5E7BA 2W9LA 1QA9A 1GIGL 3EYQC 2EYSB 1RMFH 3QUKA 1MIEH 1TLKA 1RUKH 3MXWL 1OTSD 2AK1H 1TITA 4PGJA 4KQ3H 4M7LL 2J8UB 4G8GB 2VABA 3GMRA 4Y4HC 2CSPA 4HWEL 4LCIL 3CNKA 1HXMB 2BVPA 4PGBB 5GS0H 5KSAB 1P7HL 2JKXA 5CGYC 1EVUA 5FYJD 3MOBL 4XNQB 4FQCH 4WY7H 4HC1L 3PWVB 4F9PA 4OM0H 1YEFH 3TWCH 4MYWB 1NLDL 3FN3A 1CDHA 4ACPA 1T0PB 1CQKA 1TENA 4AEHL 3B6SB 4FZ8H 5EO9B 4NFBA 3UJIH 4PJ9A 2HN7A 3BSZL 5F89B 5F7FA 2DQIH 4JFFA 4R2GD 4JLRB 3HRPA 1QBAA 1XCTB 2LU3A 5T5FH 1KTRL 5KZCB 1Q0YL 2NZ9D 3S34H 3VXOA 1EGJH 5D1XA 1T80A 4ZPVA 4HGWA 1B6DA 1IEBB 5E08L 1TVBA 4HWBA 1A14H 4TYUA 3FB5A 3CLEH 1S7UB 3LEXB 3CXDH 5DRXB 1VESA 2X7LB 3TV3H 1H5BA 3SDXE 3VXPA 2J6EA 4JHWH 1N26A 4HCRL 2XWJB 4BSWA 1W0YT 2H32A 1AFVH 3O6MH 4APQD 3MLRH 4M1GH 4NO3B 1KCUH 2YD5A 4U1IB 4G6AD 3FMGL 1B2WH 4Z6AT 1U2HA 2HVJA 1YEDB 1RUQL 5E2UL 1PSKL 4X6FA 1KTLA 2VDOL 3L95B 4IRSD 3HR6A 2DQGH 4QHNA 1C8PA 1SJXA 1QBLH 1I9EA 4JZNA 3QEQD 3KLDA 2Q6WB 2AXGB 3GGWB 4R7NA 2HWZL 1I1RA 4FXLA 1OY3B 4PJDB 5I18L 3B9KD 3QDMB 5DD5H 5T5NF 4PJIF 1EAJA 3ARBD 1PLGH 3AS1A 2UY6A 1CT8B 5IHUL 4ZTOL 5I1LA 1KJ2L 1MI5D 2VUOA 3SGKC 4KQ4H 2VN4A 2R9HD 4LSUH 3RDTD 4G9FD 4OLXL 1Q94A 3CFCH 2DQDL 2VE6A 3L6FB 4U1JA 5FYLD 5I30H 1M71A 4OTXL 2P24A 1KIUA 4CMMB 2E7LA 1JGLH 2WV3A 1ADQL 4YQXL 3CD4A 5DJ6B 4TUKH 1XGPA 4P2RE 3RBSA 5IB4B 3RJDA 4Z0XA 5L2JB 4OB5H 3QIBA 5C08D 5I1GH 5TPWH 2D7TH 1JGDB 2H2PC 3DIFA 1LK3L 2FO4A 4O2FB 5JIKA 4F2MB 4X7DC 2OSLB 3QPXL 3NCYP 4UOJA 4GG6A 4QRTB 5JOFB 4LHQB 4Z78A 1L0YA 5C07E 4YGVB 4ZS6D 4I3RH 4GW1A 2RFXA 4X8XA 1HHGB 4DKFH 5I76B 3MFFA 4GLRH 2ZCLH 4G8IB 1IGCL 1T7YA 3K2UH 3C6SB 2C3WA 2F54E 43CAA 1XH3B 1XF1A 4LBEB 3MBEC 3ULUD 4HUWA 5IQ9A 4IIQA 4MA7H 5F9WB 4H20L 4P49A 4YHPB 2CH8A 4R26L 5DMGC 1RZFL 4C58B 4WJ5B 4WW1B 1CLYL 2F8VA 3FB8A 5IKCA 4JANA 1QLEL 1KCRH 4JKPL 3U0WL 4N8VG 5T1LD 5F6IC 3UMTA 3CMOH 1S3KH 2N7AA 3MGTA 2CLZB 3P40A 4O00A 3HPJB 3RTQB 3D9AH 1RIHH 1MLCB 1S7SB 5BVJA 2P8LB 4NN5C 1L9MA 2HT4D 4U1NB 1MRFL 4N8VA 2ZUSA 3MLUL 5KVDL 3OB0K 4FQ2H 1NC2D 2EE3A 2D7MA 1IL1B 4K3HA 2JB5H 4XBEH 3QUZD 3ZE0E 5HYSB 1H3TA 2BVUA 2CDFA 2I5YL 3EYUH 4M8QB 4PRIA 1OWRM 5HDOA 3R06A 4MHHI 1KT2B 1W2KT 3EOAB 5DRNB 5TDNA 1MCQA 1JPFB 4LSQL 4KHTH 5DVLA 3GBNL 3HG1E 4JO3H 1SBSL 3QWOA 3SO5A 2X9WA 2VO5A 1XF5A 4A6YA 1A0QH 2ZUVA 1UEMA 2R4SL 3F7YA 4ORGB 3LS5L 4Y19D 4RMQA 5DRZA 5DK3A 3KS0J 5J6GB 2XKNB 3HE7A 4Q6YA 1BPVA 1WCBA 3BISA 4UT7H 5K9KB 2GFBB 1CIDA 3W0WA 1NDGB 3QXDA 5GRXG 1Z9LA 1IT9L 1DQLL 3FFCE 4NJ9H 3I75A 5FDWB 4D9LH 1OVZA 4XPBL 1GAFH 4EDXB 5HGDA 3UTPE 1EZVY 5IEHB 4ZO9A 3TPUA 2VRAA 3SDCA 2W92A 1YUHB 4F37K 1MPAL 2ITDA 4JPKL 5EOCL 5HHVL 4F15C 1S7RB 2V9RA 3RL2A 4GKOA 1OP5K 3SGEI 3QH3B 2Q7YB 2ZOLB 4FHBD 2BP3A 4BA8A 1Y18B 4F9PC 5C0RH 1KCKA 1DN0A 5TGBA 1T1XA 1IM9D 1AD9A 5E8EB 4P9HC 2XFXA 1FL6B 1ITCA 5CZXC 5HVWA 3HRZB 5JHLH 4PJ9C 4MHHG 2GJ6E 2AJ3B 3KPSE 4NKDA 1BBDH 3BIKB 2B1AH 3O0RH 4U1HA 1INDH 4EBQH 1XFPA 2V7NA 2OMNA 1I9RH 3GSUB 2P5WE 1UA6L 3DXAB 1WFTA 1I3RB 4PJAF 4NQDB 4E42B 4O9HL 4URTB 4M43H 3TT1H 3D69B 3HC4L 2HRLA 3E8UH 3VGBA 4MD5A 3VXTB 4HAFA 1H5BC 3IETB 2X9YA 4XTRC 2X10A 5ISZE 3IDIA 3ZZ1A 4K8RC 3TCLA 5LQBL 3CLFL 1NGQH 2EE6A 3JWNC 2R1XB 4XZUB 5D71H 2HG5A 2YPLE 4G6KL 5D7LA 2A74B 1QA9B 4Q7DA 3QUKB 5HHQA 2NY7L 4IOFD 2EDJA 3RPIB 1TETL 4Q9RL 5BMFL 1J5OL 4KPHH 4OZFG 4G6FD 5ADOL 1NSNL 4UTBL 2JLLA 2MCG1 2WBJA 3O4LA 3AC0A 4M48L 3F7VA 5JDJA 4OF0A 4WNQA 4C56D 4OZFA 5F96L 5ALCH 1ONQA 3W2DH 1PBYA 1UZ8B 1CDCA 4WDIA 3IJHA 2NY3D 3D3VD 5HI4C 3O2DH 2OR7A 3NGBC 4TULH 4RFOH 2E6PA 3HMXL 4I13B 4JFFB 4KVNH 2HKHL 4LCWB 2W1NA 3VXOB 1YEHL 1HOCA 5D1XB 5F3BA 3UTSD 3UTOA 2MCPL 3OKKA 4ONOA 4YHNA 5BRZD 1TVBB 5M7QA 2VLJE 4XHQA 4HWBH 2LVEA 3FB5B 1I9JH 1MFAL 4M6NH 5GRZA 4L1DA 5JLZB 1XF2A 5TF1H 1TDQA 3VXPB 2J6EH 3S35L 5DMJB 1WC7A 1FGVL 4OKVB 4QHKJ 3QIBC 4BSWB 2H32H 2UWEE 2VZ3A 4UBDD 2H32B 4HV8A 1ETZA 3EFFB 3UDWA 5HI5D 1TJHL 2Q3ZA 3IRPX 4HS8H 1ZEAL 4H88L 5D1QA 1D5IL 2FB4H 2ADFH 3UZVB 3WNMA 1U8KB 1IGMH 2HVJB 2J8UE 4YFLI 4G8GE 3MRRA 3PGCA 4U3CA 2YPVL 4X6FB 1FL5B 1KTLB 2VDQL 3OKMB 4QHNB 4JZNB 1MHEA 3V2AR 5E9DA 1E6JH 1WQVT 4R7NB 4OJFH 1RFDL 1MFNA 1HHIA 5I1JL 3BQUA 5LBSH 5HYFA 2EZ0C 2C3HA 2Z92B 2KQNA 4IIQC 2V5SA 4JVUA 1KFAH 2AXFA 1H8SA 2V9QA 4IRSA 4GRLA 3QIWA 2CMRL 5CBEB 4O5LH 2R56L 4N0CD 4OM1H 5CUSL 1Q94B 4PJBA 2VE6B 4KV5F 4U1JB 4ZS7L 1KN2H 2P24B 2QHLA 3KPTA 3SE3A 1HQRA 3MNVB 1UXWA 1BFOB 3UJJH 1U8HA 1XGPB 5E94A 2F53D 4OLUL 3UCRA 4P4RA 1XIWD 1ZSDA 1LDPL 3RDTA 3BP7A 5DHXB 3S36H 3V7MA 4KMLB 4Y5YA 4ALAL 1YPZA 5FECB 1NL0L 3BKCL 5CCKH 1ZHBA 4X5LA 3QAZB 1G9ML 4GQ9L 4HIEA 5HHOB 3JWDL 4LP4A 4I0KA 4OGAC 2KZWA 3ALXA 4HKXA 1G7JA 1EX0A 2O5ZL 1FNFA 1TCMA 2MTPA 5GRJL 4Z78B 3WLBA 2RFXB 1KG0B 2F74A 4J8RA 4YHKH 3HE7C 3QDME 2LTQB 3H9YA 2I07A 3SKJH 5KSVB 1R5IA 4R3SA 1EHAA 1G84A 4P4KA 4OZIB 43CAB 6FABL 4JKKA 5IB1A 3SGDH 4ELMB 2ZCKL 4ZXBA 4EN3C 2DI9A 3PJSA 3NH7H 4M7KH 2ED7A 1DANT 3UZQA 1KOAA 3SDCC 3CSYA 3TVMB 3ZSTA 2B1HH 1MAKA 4MAUH 4OAWA 3FB8B 3JSSA 5IKCB 3BE1L 4L8BA 4PY7A 1URLA 5AYUH 5HD8D 3T2PA 5CIPH 1SM3L 4LKXA 3QJHA 1Y6MR 5CIPB 3PL6D 1R3JA 5DMIH 1RK0A 4ZAKD 4EZMA 5DMKA 1T21A 4Z7VF 1IBGH 3QUXC 5JORA 2J4WL 4JN1L 2GW5A 5T3XE 1JGUL 1SYSA 1NAMA 5E8DH 4PRIB 1QEWB 1OF2B 1NFDB 1I8LA 2FEDC 1XR8A 4MMZC 2EH7H 4WFHE 5TDNB 2GSGB 4OCWL 4QGYA 1MJJA 3DI2B 3VI3F 1N6QL 5INDB 2XZAH 1DLFL 1OLZA 4GAGL 4TRPH 5CILL 3TO2A 3QWOB 5LVEA 1FH5L 3ZKQD 4UV7H 3LIZL 3KPMA 1NC2A 2DQHH 5FYKE 4MWFA 4IMLA 5DRZB 2F15A 4HZAA 3HE7B 3ARGD 1WCBB 5DQ9A 1Z2KA 1J12A 4QXGL 2IANA 3W0WB 5LG1A 2WWMD 5ABDE 1IILE 3I75B 5GGTL 3UTTA 4U1SA 1K8IB 2FR4B 1W72B 5C0JB 1OL0A 4KKLC 3SDCB 3TESA 3LEVL 4LRIA 2MWCA 3OKDB 1YJDL 3NACL 2ITDB 1XGQA 1U3HA 3RL2B 2ZKHH 1V05A 3MBXH 4JHAH 2F8OA 4TVPH 2QQLH 2WAHA 4O02L 4V2CB 3EGSA 4WENB 1T1XB 3K2MC 2PTVA 1AD9B 4H0HB 1OTSC 1GIGH 4OFIA 1G7PA 1XT5A 4HPYH 2G75B 4UAOB 3VFWB 3HCVB 4NKDB 4MNGA 1DSFH 5IVXF 4M7LH 4IM8A 3QUYB 4GXVH 2CRIA 3JV4B 4Y16D 1RURH 4NZUH 3MJ9A 4LCIH 4A2MA 3DUSA 5GSVA 1T2JA 2Z8SA 1T7ZA 2IADA 3HUJA 4U6VH 1X5HA 2FLBT 4NNPL 4LCCA 3OR7A 5HHMD 1KB9K 4HC1H 3ULVH 4FNLL 5HYJA 1PYWB 4ZOBA 4JQVC 4KU1A 2Z9TA 1WISA 4XNUH 3IDIB 3CDYA 2JELL 2NZ9C 2H6PB 3PDGA 4NO0D 3LAFA 2HG5B 1Q0YH 5CD3A 1M05B 3ILPB 1IM3A 3DBXA 4RMUA 4F7TB 2GJJA 3H2WA 5HHQB 5D7KE 4JFQA 5ITBL 3DO3A 2JE8A 3BGMB 3QYCA 3LZFL 4APQC 4MCZA 5C8JA 4HCRH 2WBJB 4MX7A 2Y4SA 3BYTA 4G6AC 4YPGB 4HG4K 4WNQB 4DVRL 1V3KA 1FNHA 3JTTA 5C0AB 2EDHA 4WDIB 3UC0H 4P46D 2DQFA 3MRHA 3IJHB 2DBLH 4JZOA 4IRSC 2PW1A 2E7HA 4GRLC 3DVGB 1R3IL 5E2UH 1R3LA 1PSKH 1OP9A 3WLWD 2VDOH 5B38G 2V2XA 2IFFL 4NQDE 2K7PA 4M93B 2OR9L 3S8WA 2DAVA 1BJ1H 1ZTXH 4YHNB 5D2LA 2FEEI 1DVFD 4K7PX 4U6YA 5INCA 1VACB 1QLRA 4M6AA 2QJDA 3VD5A 3G08A 4K23L 2D03L 1XF2B 5AAMA 5IHUH 4ZTOH 4OSUH 4PJXF 4LARL 3VXQB 4NC1E 1KJ2B 2R9HC 3FHAA 3RDTC 3RVWD 1ZA6B 3PWPA 2CDEA 5BZDA 3D2UA 2VH5L 4Y5YC 4GW5A 4OLXH 4JB9L 3OG6B 5C92A 4WFGD 3D85D 5D1QB 4OTXH 1OCWH 5LXGL 4K3EL 3LHPL 3MRRB 3ZL4L 1JIBA 2ADGB 5BV7L 3GJFA 4JG0L 3VH8A 1MHEB 2NX5D 2BOCB 1NEZG 3U0PA 1QLFA 3D0LA 1F90L 3WUZA 1HHIB 2NZIA 3LPWA 3B9EA 4YX2L 35C8L 4JFDB 4P4KC 2O5XH 5F7DA 1NKOA 5E70A 4UIKL 3D0VA 5KJRL 5D4QA 1F2QA 3BQUB 4ZUSA 4JFYA 1DJSA 1NBQA 3PG2A 1FLRH 1G0DA 2AXFB 2YKLH 4JFFE 3WEXB 4WHYG 3QIWB 2F58L 2XKSA 3KPRD 4LCWE 5SWZB 1B90A 3V79C 4ZS6C 1L0XA 4WI4A 1A7OL 4NQEE 4PJBB 3BMWA 4JY4B 4Y1AD 2UYLB 2COQA 2VKWA 4GG6F 3IYLW 5CHNA 4OLWH 1I3GL 1I8KA 1YDPB 3OKOA 3ZSSA 3KPNA 4H5SB 1IGCH 1RD6A 5HGHA 1UWGL 3S97C 3ULUC 3IDNB 4XXDB 5GIRA 4GG8A 3VWJA 3TCXA 1OAKL 2XOTA 3I3EA 2NYYD 1SY6A 1G1CA 1OAUL 1ZSDB 1BWWA 1I8LC 4P9HL 4F57L 2ZUXA 2VDNL 1NGWB 2EKSB 3OGCA 1QLEH 4IEFB 3O6KH 1YPZB 1DQTA 2WP3T 3S37X 3ZYJA 4JKPH 1ZHBB 3GRWA 1D7FA 5FO9B 3BPOB 2DDQH 2HT4C 3D48R 3VU2A 3I6GA 4HKXB 5IP4A 4KTEH 1G7JB 4YHIA 4DGIL 32C2A 1LO5A 2WUCL 1S78C 3WLBB 4DGYH 2IGFH 2VC2L 3X3FH 1R0AL 2I07B 2VZOA 4IHOB 5EU4A 4R3SB 5F70A 5J1TC 4YAQB 5J12C 4F58H 3MNZB 4LSQH 3IU3B 1YMMA 1K5NA 5GJSL 4ZXBB 3RWDB 3PJSB 3LKNA 2XY2A 3MCLL 4UTAL 4K8RL 2NY6B 3GBNH 3T1FB 1GGIH 1LP9A 1TPXB 1H3XA 2AEPL 2OTWA 5HJ3A 3CSYB 2OJZL 4OAWB 4LRIC 3LS5H 1QNZL 3I50H 1EJOH 4L8BB 4PY7B 4LAQL 1BZQK 4YWGL 2VLRE 5I9QB 1G7IA 4MA8H 4U1GC 4WFED 1AKJD 5ESVA 5KAQG 1AQKL 4LKXB 1G7HA 3QJHB 5K9OB 4NWUL 4Q0XL 2WK2A 5DMKB 5JQ6H 4PY8I 4PRDB 4RNRA 5HHNB 3JTSA 1NUFA 3G6JA 1T2QL 3T2NL 3EYSH 2Y7QB 2P45B 5DK0A 2C4FT 2Y36L 3MCG1 4LSSL 2AS5M 3GB7A 1FZKB 4WIQA 4Z76A 2YD9A 1YY8B 3UBXA 4KK9D 5EOCH 5ACLA 1NMBL 1MJJB 4KUZH 4LCCC 4RWYL 5A16B 5L8LB 1U58B 1P7QD 5HHOE 5ID0A 3K1KC 3NPZB 5CMAA 3O3DB 1J1PH 1EBAA 1C12A 3PNWB 4N1EA 3FOLA 3SDAA 1MFBL 3VW3H 5D2NA 3N1MC 3VXNA 4ISVA 1G9NL 1NCDH 3W9EB 1FNSL 4NP4H 1DEDA 3LKRA 1MUJA 3BO8A 5DQ9B 4OZIE 4R8WH 1E6OH 2IANB 2WQ8A 4ELME 3BGFC 1KB5A 2XQBH 2DLIA 4NRXA 4XP6L 2DWDA 1RUML 1J0ZA 4JFED 4BSVA 1QSFB 2Q8AH 5DRWA 3TBWA 3BUYA 1FN4A 3MRDA 1RPQA 4NRZA 5EFIA 3VMPA 2E8ZA 1U3HB 4HF5L 3WDHA 4QRRD 3ARGA 1KELL 2YA1A 4DOHB 2F5AH 4EIGB 4E41A 4G6KH 4TOYH 1KLFA 2I9TA 4ODXA 3EOBB 4X6EA 3W81A 5FV1L 5I8EA 2MHAA 4MNGB 4PRIE 4Y2DD 2DICA 2JCCA 1NFDE 4Q9RH 4UMGA 4D9RD 2N4IA 4G8EA 1J5OH 3MJ9H 4RGMC 4M61A 4DAGL 4FQIL 3REVA 3GSRA 3DUSB 1GPOL 5EU3A 1P2CA 3HUJB 3VFTA 3GUTA 2BNQB 1ZLVK 4FQJH 2C7UA 3V8OA 2DD8H 4HXBL 1TIUA 3C5JA 4I2XA 1HHHA 4KZEL 5HYJB 2NY3C 3JBG7 2FATL 2L7UA 4WU7B 3HC0A 2Q20A 4YHOH 4ZSOB 1CICD 5JDSB 3QRGH 3T77A 1EFXD 5GRVL 1IGFL 4Y16A 1ZXQA 3W0WE 5GS1A 1L6XA 2HKHH 3QRFM 1IM3B 3QDJB 4IRJD 5IHZA 1RUPH 5FA3B 1A6VH 4LPYA 4XP9L 1AXIB 1MFAH 3EDFA 4JFQB 4YBHA 3T3PE 4B5EA 1E4WH 3KHQA 4KC3B 3S35H 4UBDC 1ZANL 4D9QD 4MCZB 3HR5A 4TVPE 3U83A 5C8JB 5HI5C 4FQQA 4Z7NE 5D70L 1KC5H 3ZTNH 5KN5A 3JTTB 1PQZA 3ARZA 1ZEAH 1T0NB 1D5IH 3CVHA 2DQFB 3VG0H 2IPTL 3AROA 1S9XB 4JZOB 5KTEL 1MWAA 3F6LA 3V6OC 2RQ8A 3C2SA 1CXHA 2NMSA 3MSPA 1NGPH 1JV5A 2V2XB 4NKOA 5HHXL 4NHUA 1QRND 5GHWH 5IT2H 2ICWA 3ULVE 3RKPA 3QCUL 3OX8B 3P4OB 5INCB 2NTFB 5FO8A 4FA8A 1U8LA 5E00A 2I24N 3GK8H 3G5VA 1P53A 5IM7A 1OAYH 3PWPB 4N0CC 3L3HA 2NY2D 4G9DA 2CRYA 5CUSH 5KVGL 3BHBA 3MFGB 3OQ3B 4R90L 2W38A 2R0WH 1U3JA 4NC2B 5AYQA 1YEJH 3WS6A 4ZUVA 4QO1A 3PP4L 3MJ8A 3VH8B 1MQ8A 3B5HA 1QLFB 1YY9D 4LCYA 4PR5A 4UQ2A 5F7DB 5C0AE 3D85A 3D0VB 4ALAH 1X5AA 1PY9A 4ZUSB 2PO6A 4JFYB 1YN7B 2X9XA 4OCLC 4AMKH 4KRPD 3ARPA 4GQ9H 3X11A 5TQ0L 1NCWL 5IJVA 2ID5A 1FV1A 4FS0A 4L4VA 4BQBA 1S7TA 4OD3L 3C5ZD 3T04D 3OMZA 4YFLF 3QR2A 2X1QA 5GRJH 4JFPA 1LEGA 4EQ3A 4XVTH 3BGAA 3OKOB 3KPNB 1OGAA 4ESKA 4YUEL 5GIRB 4GG8B 4LVOC 3VWJB 2BZDA 4G3YL 1EO8H 2ZCKH 4B0MM 1N59B 1DQDL 2C9AA 1ROWA 1XZ0A 2X1PA 1HI6B 3LEYH 5DMYA 5MENB 2FX8H 4GSDH 1JF5A 3OGCB 1X5ZA 3WD5L 3U30C 4G6MH 3LRHA 3P11H 3GRWH 3BE1H 4FQXD 5EBMA 4UNUA 3Q6GH 1T20B 3PL6C 1IAIH 5F1NA 1SM3H 2ZCHL 3NIGE 4TUJB 1BEYL 2XA3A 3BZDA 3I6GB 4MAYB 4RGNB 4YHIB 4HMDA 4UDTA 1LO5B 3SDAC 5D2NC 4XPFH 2X5PA 1PG7L 4PV9A 3RVUD 4JRYB 3ULUF 5IG7B 2QKIA 4C4KO 4DEPB 2NNAB 4N0FA 4JFDE 4IJ3B 4RAUA 4BQ9A 2X2YA 1J7VR 1AO7D 3RNKB 4OD1H 3DYOA 1K5NB 5DA4A 4OCSH 5EOQH 5SWZE 2Y06L 3IJSA 3M1BB 2OTWB 5HJ3B 1UJ3B 1FH5H 4PJBE 5FGBA 2KKQA 4JFXA 3TA3D 1F2XK 3ZYOA 5D93C 3W39A 1M7DA 1QFWH 5JO5A 3ARGC 2QLVB 3T0BA 4I3SH 2VR5A 5DJAB 4JRXE 4JR9L 4JZJC 4OCXL 5GGVH 4CVWA 4QXGH 3C8HA 2WWMC 2WWKO 1LO3L 2A73A 3W11D 4GKSB 3EJZC 4LRNL 4ODHL 4CL7A 3G6JB 5GGSY 1AXSA 1S7VA 2IG2L 2R23A 5DK0B 4UT6L 1BJMA 3LEVH 1YPZE 4LF3A 4Z76B 1H3UA 3U2SA 3UBXB 1YJDH 1SEBA 2IAMD 1Q9WA 2DQEL 1KIQB 4MJ6B 1ZGLP 5ID0B 5TE6L 4Z8FL 1J87A 3VXUB 1YEIL 5EBLA 4BQCA 3DGGB 2Z31D 3QUML 4MSWA 1Z3GH 2OX5A 4OZGA 5FM4A 2WSKA 3AXLA 3G04B 3OJ2C 5D2NB 5CJQL 2N1KA 4ISVB 4Y16C 5F7UA 5ANMA 4QF1A 1A6UH 2QBWA 5GS1C 2JIXD 5DURD 5JA8B 3MRBB 4IRZL 3BO8B 4P9ML 2QHRL 1M1SA 3GHEH 1T1WB 5DSCA 4YK4C 1J88A 5EIIB 4K94L 4NRXB 5IFJB 1D5XB 4KKNA 4JQIL 2A1WH 4NNPH 3DX8A 1T7VA 4FFWD 4NSKA 4WV1C 3O41A 4HH8A 5FYLL 1A4JA 3R0NA 5DRWB 3TBWB 2OXGA 3DYMA 2AI0H 4ZDHB 1T7WA 4NBXB 3BUYB 3LKSB 5DQJB 1FN4B 3MRDB 2CK0L 4M9OA 2FECL 2VJXA 3UJTL 2V2WA 1YQVL 1KIRB 1P6AB 2CGRH 2EXYD 3MRGA 4DZBA 1A6AA 1KCLA 2A6DB 4M9PA 1CFVH 1RZKL 1X7QB 4XPTL 1KJVA 1JPGA 2I9TB 3CX5J 5DFWH 4I77L 1AGEB 5FDYA 5I8EB 3QWRD 4P2OA 2MHAB 3TZVA 3QNYA 2FHFA 3U0TB 2APTA 4XVUD 3DURA 2JCCB 3GMNA 1J0IA 4HHAA 1OP3K 1YEGH 3KGRA 3REVB 5CZVL 2IEPA 4YHML 2C1OA 4XPAL 1CE6B 2NY0D 1HZHL 5EU3B 3QULA 4BH7B 4YFDB 4QXUH 3MODL 3QCTH 4R6UA 3TO4D 1N5YL 1HK6A 3TN0B 3VD4A 5ACZB 1KEGH 3TJHD 4P46C 3EO0A 4W4OA 3SDYL 4YDJB 5CEZH 1DL7L 4FN0A 1MH5B 5E6IB 4HXAL 3T77B 2H45A 2BJML 3T0ED 2BY0A 1R3IH 2M2DA 3LRGA 1OAXH 4HSQA 4P5TD 4Z7VB 3RUGA 1MCRA 2VLLB 3ZDZE 3MACL 1R5VA 4PLOB 4ZUTA 2R1WA 1EO7A 1DVFC 2OR9H 4ODWA 3ARRA 4XMPL 1QSFE 3E6HB 3F5WB 1N2RA 2YXFA 1I4FB 2X05A 1OTTD 5D2LF 1CICA 4UQ3B 5D96C 5JPNA 4QNPF 3RVWC 4UZGA 5E0QA 4LKCA 1U0QA 4DOHE 5FA4A 4GKZB 3IU4L 1QBML 5DD1L 1ZWIA 1S7XA 5KN5B 3MO1A 4JB9H 2PO6C 5LGHH 4HLJA 5KVFH 4QRSB 5TQ2H 1MWAH 5EUKA 4FFZH 4QRPB 4K3EH 1JHKL 3LHPH 4K7FA 3ZL4H 3KWWA 2HA1A 3U4EA 2G9HB 3VXRA 3GIVB 1BVKB 3QHFH 5A1AA 1T83C 4NKOB 1AGCB 2DN7A 5D6DA 3HUJE 4AENA 5F93C 2BNQE 4HLZG 4NHUB 2E9IA 3KDMA 4MB5A 2HT2D 3SJVD 2ICWB 4JO4H 35C8H 3DSFH 3DLQR 1U8LB 5EIQA 4ZSOE 4YXHL 5MHSD 3EFDL 1F97A 2VLKA 4PV8B 4AYFA 4KDWA 1LE5B 1HYSD 5IM7B 4K7PY 1A5FH 3C60A 4KAQL 1A1OA 3CSBA 2F58H 3MRKB 3RVVC 2X1XR 4Y8AA 4XPHL 4OIIL 5T1MA 1A7OH 3TPKA 3VWKA 2Z0BA 3PP3K 3QDJE 3BHBB 3DSNA 4JJ5A 4LVNB 1U6AH 4LLYA 3RWEA 1JI1A 2DMBA 3LQAC 2NYYC 5I1DA 2DQCL 1FZOA 3O11A 4L29A 1BIHA 4KK6D 5D96B 2ERJB 3S9DB 5HVGB 4M1DL 4L3AA 3PHQA 5CEYA 1KACB 1UKQA 4AIZA 2QSCH 4PR5B 5DEFA 2VTFA 4C54A 2VDNH 1FFNB 3KPLA 2ZNXA 2YEZA 2VDML 5ICYA 1LE9A 5FGBC 3INUL 4H25A 4L4VB 5IJVB 5JW4R 2NPLX 1NC4D 2CQVA 1S7TB 2YD4A 4NO5B 4PGDA 3OWEA 2JJTA 4L3EB 2QQNL 4DVBA 3HI5L 3AY4A 4H1LA 1R5WA 3OJDB 4JFPB 1LEGB 3AAZA 3PV6A 1FJ1A 3QEGH 4AH2A 1BZ7B 2B0SL 4P23A 2YRZA 4HFUL 2GEEA 3K46A 3EYVB 3A6BL 1Y0LA 1J0HA 5BS0D 5GJSH 2XTJC 2YN5A 1QFUH 3KJ4B 2IBGA 3BDYL 4AEEA 1XZ0B 1GH7A 1REIA 1FCCA 3V52H 2OJZH 4CJ0A 3NZHL 4FXKA 3WIIH 5DVMA 1LP9F 5EU6B 5IW1A 4R97B 2GTZA 1K4CA 4GXUN 5ALBH 4BELD 3CUPA 3F62A 5E1HB 3VXSD 4ZO8A 1NCCH 4PJAE 4PRBA 5DHYB 3WO4B 1J18A 2A6JB 2CIIA 5SX4I 4Q0XH 4DFIA 5J6HB 5L2KD 2FSEA 4LASL 1CD1B 4PLJD 5E99L 1ZLWK 4TN9A 2QKIB 3EHBD 1C5CL 3KYOB 1K4DB 1U8JB 3QZWA 4KK9C 1QKZH 4OF3A 4I5BA 5KAQF 1TJGL 4FQXA 2P48B 5IV2A 4G7VL 5EBWB 1O0VA 1A22B 3G5ZA 1I1AD 3IDJB 1S9VA 4U0RC 1YECH 4ODVL 5ADPL 4HGKC 4XGZA 5HYEA 1CF8L 4JFXB 3IFOA 3CPLB 3W39B 1M7DB 5GJTL 5JO5B 1UT9A 1G9NH 4MDJA 1FNSH 2BNUA 2AEQL 5I19L 4LMQI 3IDGA 5LCVL 1NUDA 1RJYA 1WBZB 5JMRA 4XP6H 4PJ5D 4P2OC 1G7QA 1WIPA 1GC1L 1ND0A 3EJJX 4PJHF 5MENE 3MOAL 1F58L 5F6HI 4HH9A 4JVPA 1DBBH 3U2SB 1BD2D 3LS4L 1F8TL 3FQNA 4ZFGL 4KROB 1KELH 3O6FD 2AQ3A 5J89A 4RGNE 3QA3A 4W4OC 3STZB 2CKBL 2WW8A 3QI9D 4QOKD 1BQHG 2DQTL 4OZGB 4JRYE 4M7JH 4QHLA 1MCKA 4NBYB 2D31A 4K2UL 5EORH 2DJSA 4PS4H 5ANMB 25C8L 4N9OB 1JPTL 4P3DA 5DZLA 3HAEG 3EIFA 3O45B 2X4PA 4FQIH 1DE4B 3CXHJ 1MRCH 2Q8BL 3T65A 3X14A 4N0YL 2C5DC 3VG9B 3DX8B 5MERA 2Z31A 4TUOB 4ZUWB 4KZEH 1CICC 1N4XL 4IOIB 2Z93A 3R4DA 4NRYB 4U4BA 1HYRC 4L1HA 3FONA 1I8MA 1A3LH 1BLNA 5EU7C 2MQ3A 2V2WB 4GAYA 3MPCA 3AB0B 3MUZ1 5D5MF 1WZ1H 1IGFH 1M6OA 4IS6A 3U9PL 3T0WA 4DZBB 2W65A 4G7YH 1QR1A 5L7XH 1HCVA 2IFGA 2DOCA 4WWKD 4Z7UA 4MXVE 3G6JE 4ZD3H 4I4WB 5MEOA 3G6DL 4P2OB 3TZVB 2V17L 3QNYB 4UI2A 1NGXA 3VFGL 3DURB 2IBZX 3GMNB 1HH6A 4HHAB 5D6DC 3OR6A 1MCOH 1P84J 2OK0H 4KV5E 3KPOB 5F7MC 5K9QI 3VXUE 3H6JA 4MNQA 3PV7A 4L5FL 5D7JB 3P0VH 3U9UA 3EO0B 5CJ5A 1FZMA 4CVXA 3FQRA 2OM5A 2ZG1A 4OQTL 2QL1A 3MUGA 3LH2H 2Y6SD 1IAOB 1ZT1A 4UUJA 2XZQH 1R5VB 4NHCL 2IPUK 5DR5H 2R1WB 1RIVH 4ZUTB 3L3DB 2GK2A 2VXUH 3F12B 4JGUA 1GGBL 1V5JA 3CDFA 2YC1A 1UFUA 2PUQT 4PJEF 5ACMA 1A7QH 5C6TH 5C6PB 1J1XL 5DDHB 3WN5A 3NVQA 1DFBL 5D1ZA 1IE5A 2R4RL 3NIFF 1AD0B 1AR2A 5IOPB 2JJVA 4L4TB 5FA4B 3VXME 3E2HC 4P3CH 2J12B 4F7MA 3VGHA 1TQCB 1ACYL 1S7XB 2CXKA 2FIKA 5FHAH 4O58L 3VI4E 3WV0A 4LHJB 3LCYA 1PVHA 5GISL 4OLVH 2JCCE 1CXLA 5EUKB 4NQCA 5K9QG 3KWWB 3RGVD 4KH2A 2JJTC 3OKEA 5EZLA 1FPTH 4QXTA 3UAJD 2AJXL 4RAVB 2NXZB 3AY4C 4DK3A 3HC3H 2BRRH 3KDMB 1X3DA 2EEBA 4MZ3A 5SV4A 4MLSA 1IC7L 3O9WD 5C2BL 4KJQD 3HKFA 5EG6C 4KRPC 3WNPA 5HGBA 3EZ8A 2VLKB 3DX7A 3CGTA 4MXWH 4Z7VE 3NCEB 4X5XA 2H26B 3C5ZC 3C60B 2YK1L 3IVKA 1P4LB 5EWIL 1EEZA 3TLRA 2HMID 2L7JA 3GJEA 1S9KC 3WE6A 1ZHNB 5IVZA 2FZ3B 3VWKB 4ZO6A 1NBZB 1F4YL 2MFNA 5FHBH 1TTUA 4P2QD 1Z5LB 2XTLA 4JCLA 5A2IH 3VI3E 1G1YA 1YYML 4HK3N 4LLYB 2RAMA 4AEIL 4LSTL 1D5ZB 4YIQA 2JTDA 5ESQA 4U7SA 5I1HH 5I15H 4G3YH 4P2RD 2NY4B 4DGVL 1ED3A 1UWXH 4U33A 1IC5L 1FVEA 3PHQB 2V6HA 3O8XB 5DEFB 1JTTA 4MD4A 2O61A 4FQXC 3WD5H 1OT1A 3BKYL 1QYGH 4M6ML 2MKLC 2XZZA 3KPLB 4QRPE 2QR0A 5ICYB 3I2CL 2ZCHH 2VDLL 5C0FB 3BD3A 4YHZH 1UEYA 1H3PL 4PGDB 2EH8H 3A6CL 1JNLL 3L7EA 4H1LH 4DVBB 1R5WB 3AAZB 4PB9L 1FJ1B 4QCIA 1IKFL 2XT1B 1LEKB 1RV6X 1I7RA 4AH2B 4P23B 1P5VA 3FO0H 3PWLB 5KOMC 2Z35A 1IQWH 1JN6A 1MHPH 1JMZA 5DFTA 1J9CT 4R2GB 3L3GA 4OLZL 4MXQC 1VGEH 2B39A 5E6YA 3P9MB 2Y06H 3MUY1 2NY5C 3RU8H 2R29H 2KPNA 1NC4A 3MLZH 4Y4FD 3TNMA 3ETBF 4FXKB 4Z95L 4PY8J 5IW1B 4QTHA 4LEOB 1LO4L 4I0PA 3SHSA 2WMPA 4PGZA 1N3NA 4PRBB 5SWQA 4X99B 4J6RL 1HILA 3ARQA 2APXA 3B2UD 4OGXL 5K59F 5I1EH 5B8CB 3UXFA 4LRNH 2XA8H 4AJ0A 5BXFA 1U8NB 5C0BA 2H8PA 5I17A 3CU1A 3L9RA 4PYHA 2IAMC 4UT6H 1G6RL 4ELKA 1MCEA 3VXSA 4KI5E 1CE1H 5IV2B 3FRPG 2OI9C 1M4KA 4UIMA 3X13A 3HG1D 2Z31C 3G5ZB 3QEQB 1CTOA 5TE6H 4Z8FH 4L4VE 1IKNA 3WS3A 3QUMH 3QUMB 3W9DB 4L3EE 1IGIH 3FRPA 3HTLX 5I66A 3H0TA 4L8CB 3G5XB 5CJQH 1ZLSH 3VMOA 5H2BB 5GRWA 3DNKA 3ARBB 5D7IF 2XPGA 4HS3A 5EZIL 1KN4L 2D7PA 2BNUB 2CDGA 5DUML 4D0BA 4LFHD 3WFEL 1D6EA 3IDGB 4FFWC 4YFEA 4QHMA 1RJYB 1I1AA 4JQIH 4OZHF 5IBLC 4G9FB 4FOMA 1G7QB 4R4ND 3T0AA 3UTPD 1ND0B 4JPWL 4U1MA 4ZNEE 3I9GH 3MV8A 4NGHH 5EU6E 1K9TA 3PDOB 5F7EH 4WUUB 4HH9B 2EXYC 3VRJA 2AK4A 1UQSA 3FQNB 2F5BL 3UJTH 1YQVH 1A9BB 1UYWL 1F4XL 2VXQL 4KK5D 2ESVD 4OT1H 1UVQA 2ZWLT 2LV4A 3ABZA 3QA3B 2I25N 5T1KD 4UB0H 1BAFH 1RZKH 5DWUH 1PEZA 7FABL 5EUOA 1BMGA 2VWEE 3GMOA 4QHLB 1DUYA 4EI6B 4I77H 2GJ6D 3KPSD 4XVUC 4ODUA 5CJXA 2KBGA 4PJXE 4M62L 1CWVA 2IALA 1I9IL 1U93B 1UZ6E 1JPSL 5F88B 4ETYA 4P3DB 3BWAB 2PR4L 5DD6A 5CZVH 1CFNA 3VGGA 2W59A 2E9WA 4YHMH 5KVEH 4XPAH 4YZFE 3SN6N 4RX4D 1HZHH 1CBVL 1EAPA 5FGRA 2E3VA 1FFPA 2UUDK 3CFBA 3HI6L 3QI9A 4HQQL 3NTCL 1N5YH 3IRZA 3WN5C 1JYWA 12E8L 3SDYH 3SKUD 5D1ZC 3FONB 3T0EC 5DVOA 3K8MA 1X5JA 5ISZD 1BLNB 1PKOA 5AG8A 1HWGB 1Z9SA 1I8IA 2YPLD 4PBXA 2W65B 1QR1B 5CJOH 3RUGF 4JY6B 4HKZA 1HSBA 3RPKA 4X4XA 4Z7UB 4J3XA 4DCQA 2FL5A 4XMPH 3Q3GB 3H9SD 1OTTC 2XZCL 2AJVH 5CS7A 4LNRA 3BYYA 1T66C 4XCFH 3O4OC 1HEZB 3UTQA 5T1LB 4YLQT 2QQQA 1AY1H 5H94A 1MVFA 3BT2L 3OR6B 2HRPH 3GSNA 1QSED 3PABB 4JHBA 3LPFA 3IU4H 3FQWA 2HLAA 3UYRL 5DC0A 1JWUA 1W0VA 2UZXB 3U9UB 3DJ9A 4WWKA 4JO1L 4JKLA 2HJLA 3SOBL 1FZMB 1EXUA 4JHZA 3G6AA 4HUUB 4LK4A 4OQ1A 1AGDA 2A77L 3C6LA 3LQZB 3C2AH 1JGEA 1OARL 4X7EC 3ILQD 4YBLB 2ADJA 1ZGLA 5D72L 1NKRA 1CFQB 3BIBX 3H7BA 1GGYA 2YC1B 2PNDA 1WBYA 4XHJC 5DVNA 4Y19B 1HYSC 5FOBA 3Q6FB 1GGCH 3FCTA 3N1PC 4I18B 1U8IA 4JRWA 3MGOB 1UH4A 3NFSH 1A6PA 2B4CC 2HJKA 4F7MB 4QRQA 3GBML 3LV3A 5DO2D 3N9GL 1DBAH 4D0DA 3C09B 3DUUA 3QDGA 1KB9J 4Y2OA 4XNXL 4P59H 5BVPL 3LMJL 1A9EA 4NQCB 3SDXA 5BW7A 5GS0D 3OKEB 5EZLB 5HGAB 4QXTB 4NIKB 3N1FC 1RIUL 1IM9B 3D25A 4TSBL 4OUUA 3LD8B 5JIIA 3MRJB 4F80A 1U3YA 4M4RA 4MNHA 1DQJA 5T3ZH 5FUZH 8FABA 1MF2L 3DVIA 3REWA 1FIGL 2F9BT 5E4EC 2NY1B 1CD9B 1P6FA 1G0YR 1EERB 1PG7X 3QHZL 4M02A 5H37H 4S1QH 2VXSL 2EE2A 2FJGA 3TYFA 5ERWA 2VDMH 3WO3B 4X5XB 5BJTA 5EC1A 3RGVA 3O6LL 5KZCD 5I6XC 1E0OB 3INUH 1IMHC 1KJMA 1EEZB 1UENA 1IEAA 4MJ2A 5EC2A 3WE6B 1JJUA 3U7YL 3PE9A 5IVZB 3C87A 3SPVA 5CINH 1VFBB 2QQNH 4HS6B 4EDWL 3AS3A 4PYGA 2AABL 4OCRL 2B0SH 1VPOL 4OFYD 4YIQB 5ESQB 3K3QA 1XGYH 3CZFA 1QQDA 2R0KH 3A6BH 4L4TE 1U2CA 3K4AA 4QRUA 1FYTD 5FXCH 3TJEH 4KJPD 1ED3B 3BDYH 1JZ2A 1FVEB 3CSPA 3IFPB 3GMPA 4PG9A 4NM4H 4S11A 2B4CH 2O61B 3FKUS 1TZGH 4KRNA 3AMKA 3KYKL 3NPSB 3GEWB 4QLRA 5IF0B 2QR0B 1D6VH 3V5DA 4G6FB 4PLJC 3VFUB 4Y4HD 1D9KA 1RZ7L 4P2RA 2DLTA 3UROR 1FL3A 5KS9B 3C9NA 3EHBC 5CGYD 4C56B 4M4PA 5I8OH 4J23A 3EDKA 4WVRA 3L7EB 3RBGA 1C5CH 1FE8L 4KKCC 3D3VB 3OXSA 2VLKE 2EIEA 4KKAD 1I1AC 1JN6B 4Z0BH 4Y0GA 3L3GB 1HH9A 4ZFOA 3ARFA 1GGTA 5ADPH 3KJ6H 3O3EA 5C07A 5BRZB 3MYZA 5A3ID 4QTHB 3BPNC 4I0PB 3L1OH 5IB3A 4O2CB 5EDXA 5E2TL 4E0RA 5DJDA 1HWHB 2G2RB 2DMCA 1G9EA 4PJGF 1NCBH 4NYLB 4A2LA 4QYOA 2F54A 3C8KA 4P2CG 1HILB 4WGWB 5I19H 3WFZA 4JFZH 3R1GL 3FFDA 5CJXC 1U91A 5BXFB 5C0BB 1DLHB 2H8PB 1GC1H 3OTTA 4FG6C 1HDMB 2DIBA 4WFHD 1F58H 2FDBP 5DJ0B 4NT6A 4ELKB 4EKXA 5I73C 1JYNA 5IGXH 3CFEA 5C0GB 2IPUG 4XP4H 5DFVD 3QI9C 1R24B 3RGHA 5IFAL 3CIQA 1WEJL 3GSWB 4PJ7B 4WHDA 1ZHKB 4JPIA 2FYYA 2CKBB 3KPQB 4FTVB 3JWOC 1BM3H 1QO3B 4AG4H 4K2UH 3IXTB 1RZJL 3RX8A 4MZ2A 3VRIA 2CDGB 1MOEA 1WV7T 2LU4A 2E6JA 3ZKXB 5LGJB 3HG1A 4NJAL 1OGTB 1OP5H 3QPQD 4X6BB 4N0YH 2ICEA 4R4FH 2X6MA 3DV4A 4DKAA 1A7NL 1YYLH 3AS2A 1FGNH 1NQBA 5J8OA 2OZ4A 3GMMB 4LFHG 1Q38A 4N8PA 4ZG1A 4RQQB 5JOEA 3RTQD 4WO4A 5JW5B 5IB5A 5BO1L 3MA9L 5DQDL 4G80B 1UVQB 4WWKC 2A9ML 1CLOH 3FFCA 1XIWB 4LLMB 4J1UA 3K8LA 4WI9A 2OR8A 1GRWA 4ODUB 4X6DF 2IALB 1I7ZB 1Q9LA 4DZ8A 3VFGH 1ZA3B 5JIHA 1X5XA 1AR1C 5SX5K 5FM5M 3S4SG 1CFNB 3SKMB 1EHLH 5FOJA 1OAZL 2H2PD 2BY2A 3QEQE 4GRWH 3EYFB 3DRTB 3AGVA 3EO9H 4M1CC 3NCCB 4LVHC 1YEKL 4U6XA 2WNGA 1H0DB 4YXKL 3KPSA 1ZVSA 4X6CA 3JWOH 1RZGB 1T6WA 3QFJD 3NCYS 3FT3A 1KJ3L 5F8RC 3PXHA 15C8L 1CG9A 2BHZA 1I8IB 2P5WA 5F97E 1X5GA 2Z4QB 2R0ZL 3MBED 4HKZB 2ENYA 4G9FE 1VCAA 4X4XB 3BD5A 4OI7A 1S8DA 4IOSD 4F33B 3CFKB 1MEXL 5FYLE 5D7KD 1TTGA 3IF1A 4LNRB 4XNYL 3A6OA 2DJUA 4GAFB 1S9WA 1HHJA 1BFVL 4WUUE 5BW7C 3FHQA 3WYRA 4MMXC 5CP3A 5H94B 3C08L 2OQJB 3GSNH 3GSNB 5KSBF 5GPRA 4QY8B 1UACL 3CFJA 4LLAA 2OMBA 1Q72L 3FQWB 1BHGA 1SMOA 2HTKD 4YC2C 5AG9A 4NNXB 5J13B 1C08A 3QNXB 1W0VB 3S96A 4FABH 2DBJA 4ONHA 4Y5VA 1F11B 4IBLT 2BNRA 5D9SA 1WBXA 5GISH 2AJSL 1JNJA 3RGVC 1P7KB 4M5YL 3UAJC 3C6LB 3RWHB 3DXAD 1IGJB 4PJHB 5ILTH 1D5BB 5T1DH 2AJXH 4NQDD 4OZ4A 2FJHB 3WFCH 1MAJA 5FB8B 4M7ZC 3O3UN 4MJ5A 3U7WH 1NFIB 1CL7I 4KJQC 1WT5A 5TJWK 1EMTL 2AERT 4MJ4A 1WBYB 2Q3AA 4G6JH 5C2BH 3IJYA 5E03A 3AU1A 3K74B 1BX2A 3VA6A 5FOBB 4FRWA 1VADA 4NN7B 3FCTB 5IESH 3QDAA 1U8IB 5DT1L 4BKLB 4K3JL 4S2SB 2YK1H 1I3VA 2AQ1A 1KBGH 1HIMH 4QHUB 1IGTB 4QRQB 2Y25A 3LV3B 4Z7UE 4L9LA 3F7PC 1QBBA 1JGVH 3M17B 3QDGB 2VLJA 2Q86A 4YE4L 1YYMH 4HJGA 1D9KC 1CLZL 3VFRB 1VKXB 4EXKA 4XC1H 3V4UH 4KMTL 5I8KL 4QWWD 1W8OA 2UWEA 3G9VA 3D25B 4OUUB 1A8JH 4J3TA 3B2VH 1IC4L 2EYSA 1CVRA 1A3RL 1DQJB 5F9OL 5MP6L 3B9VA 3Q1SL 5CZXD 4K3DL 2FJFB 2J8UA 3H9HA 4G8GA 2FJGB 5ERWB 4JFFD 3PGFH 3SQOL 4ENED 1QVOB 3B8SA 4LCWD 1HXMA 2CO6B 4PGBA 5EC1B 5KSAA 1CZ8L 1ES0B 5D1XD 5GZNC 1KJMB 4CVUA 1KXVC 4ZPTB 2GUOB 5EC2B 3CJJA 4XNQA 1DBMH 3ESUF 5I1KL 2A6KB 3VFSB 3SPVB 3PWVA 1JNLH 5HDBF 4YDLB 1AHWB 4PB9H 4PJFF 4Y19E 1HKLH 4XVJL 4GH7B 5EO9A 3RWCA 3WFDL 3FO9A 1EO5A 4LLDB 3SQBA 3F6IA 1QQDB 1LQSR 4QRUB 4NO0B 1TXKA 2P47B 4JLRA 5CLWA 2PYFB 1XCTA 4Y4FC 5L9DL 1X6LA 1JNNL 1MNUL 1KLGA 3OAYH 4X83A 4NNYA 4Z95H 4JY5L 5HXMA 4KK8C 3AM8C 2KL6A 3BP5A 3AFLA 4F9LC 4HUNB 1OD9A 4OLYL 1JUFA 1S7UA 4NQCE 5SWSB 2BHUA 3ARTA 4OGXH 2W0LA 1X4YA 4WCYL 2ICCA 2XWJA 5GQBA 3C9NB 1J8KA 3MZGB 4U1IA 1EPFA 1DUZB 1YNTB 1G6RH 4YPJA 3OXSB 1G6RB 1G7LB 4HWZA 3LY6A 4HD9A 4U2ZA 5HPMA 3L95A 5HI4D 1HH9B 2ZOKB 3L5JA 1JF1B 4ZFOB 4RMSA 3ARFB 2Q6WA 3GGWA 3QISA 3NZ8A 4CN6A 5DEZA 1BREA 1BZ9A 3QDMA 3BKMH 2QADB 4WO4C 3SDDB 1X4ZA 2EE9A 2B20A 1T7XA 4QYOB 5F6HJ 5EZIH 1KN4H 4YHYB 5GS2D 3PQYA 3WFEH 4R4NC 4Y4KA 2VDPH 3CFDB 4TSAL 4U7MA 4P99A 3FFDB 5CZKA 2FX9L 5L8JB 1MFCL 2W60B 3IAQA 4NQVA 3T0XA 3L6FA 1LEIA 2O26U 4WEUD 4CMMA 2ORBL 3EAKA 3OPZL 4NT6B 4HKBA 4GS7C 5GS3A 2F5BH 4KK5C 4H8WC 2CO7B 1UYWH 2YBRA 2YD1A 1F4XH 4CBPA 4TSCL 2VXQH 2WBKA 2CUMA 3QQ4B 4JPIB 5KS9E 3PWNA 2FYYB 3MLSL 2VZ1A 4C56E 2AKRB 4XBGB 1V7MH 3SO3C 1EEUA 4LAJH 5EUOF 1MHCA 1I7UB 4ZYKA 1D5MB 3OKNB 1I9IH 1DEEB 3D3VE 2HJFB 1JGDA 1NMCB 3VRIB 4Z7QE 4OFKA 4XP1H 4F2MA 4O2FA 4R7DB 2EZ0D 4YNYA 4CMHB 2OSLA 5J9PB 3W82A 4K7PL 4JREB 3E3QE 2Q87A 1SEQH 5C7XL 4OF7A 4TPRH 5JOFA 3KR3H 3NTCH 4YGVA 4LSRH 3PIQB 5BRZE 1A6WL 2YUZA 1HHGA 2DQUL 5I76A 1CQYA 4OFDA 4RISL 4G8IA 5CP7B 3RRQA 3TFKD 2AP2A 1OSPH 3LVEA 1OQOA 5DI8B 5IB5B 4LBEA 4R4BA 4CRPA 4Z7WF 4KKBC 4NDMB 1SBBA 1AGBB 1A7PL 3G9AB 3FFCB 4BQ8A 4YHPA 4Y5VC 5TE7L 5C0BE 1KCVH 3MJ7A 4WW1A 4M7LT 2NLJB 3HZVA 2CRZA 4PRID 4N9GA 5LAXB 5IB2B 1CGUA 2ZUYA 4B7LA 3BESR 5FAAA 4KFZC 2CLZA 4M03A 3HNSL 3HPJA 3L5XH 3GO1H 1S7SA 3MXVL 3GKWL 1WT5C 4H8WH 4PJ7E 4UT9L 5IBUB 2W9DL 4OGAD 3UYRH 4LHUA 4FTVE 3O2WH 1EJ6A 4DN3H 2E27L 3OZ9L 1MQKL 5HYSA 1ZVSB 4X6CB 3HE7D 1JHLL 2DQJH 3EOAA 4NO2B 4B50A 3W0WD 3ILQC 2A77H 1UCBL 4M6OL 2A0LC 2WLZA 1EDQA 2DLHA 2ZUQC 2X44D 4L9LC 3EOTL 2JJSA 3CX5K 4BK4A 1B4JH 5CKGA 2VDRL 4MJIA 1TQBC 4ORGA 5ECJE 3SDCD 2EC9U 4MA1C 1KXTB 1H9VA 2Q1EA 5JW3H 4V2BA 5CP3H 3HNTL 1UWEL 4PJCA 5GSRA 4QTIL 4KHXL 4TVPD 5DUBB 4V1DB 5K9KA 3DMMA 4NCC2 4Y89A 5DO2C 1AE6L 4HUKB 1UKTA 5D7IB 5FDWA 2XRAL 3N9GH 5IEHA 4JN2A 1JZ5A 2BSTA 3FO2B 5L0QB 2BNRB 2CR6A 4XNXH 5D9SB 1WBXB 2VIRB 4LEXL 1YUHA 2DB8A 3QUYD 4F3FB 5KSAC 1FRGL 5GS0C 3STLB 3CVIL 4OZHB 1MCWM 2FEDD 2BC4B 3KHOA 3TBTA 1CDUA 2Q7YA 4DW2L 1A4KB 3KG5A 2EYRB 1BF2A 1Y18A 4OZ4B 1W0WB 3SDXF 3Q2CA 1EUTA 2A2QT 4C55A 4MJ5B 5IR1A 1LMKA 3OHXB 4BZ1H 4TSBH 1FL6A 4UDUB 3ULVD 4JDTL 5FKPB 2AJ3A 1FIGH 3BAEL 3IJYB 2P8MA 5E8PB 1BX2B 1VHPA 3BIKA 2X4UA 3QHZH 3QXTA 1XMWA 1T04B 3DVNA 2AEIT 3ALWA 1Z0MA 3CCHB 3RWFA 4RGOL 1CK0L 3GSUA 1OQXA 5L6YL 4LU5L 4E42A 3MOQA 2DLFH 1FO0L 5TE4H 5AUMA 3D69A 3GI9H 4NKMA 3VFPA 3IETA 4O51B 4HJGB 3WXVL 1B88A 3U6RA 4G5ZH 2BSRB 5ID1A 2Y07H 4LL9A 2WBJD 3O4LD 4HIHB 3M07A 3X12A 2W9EH 4CN1A 5FUCE 3THML 4MCYA 2XG4A 5C0AD 4PD4J 4D3CL 2FH6A 1I1YB 2H2SD 1V8HA 3KYKH 3RPIA 3VRLE 4Y2DB 4J2XA 3H9HB 4HIIA 4PJHE 3V7AE 2QSQA 5DVKA 1EHXA 3HE6A 4YXLL 5JW4N 4KTDL 3NABL 3CDGA 1UZ8A 4OGYL 3TIDB 4JPVL 1NAKH 4P57A 1A1MA 1CL7H 4KKAC 4QKXB 1EFXB 3JV0A 3RWCB 3FO9B 3TBYB 2YSSA 3O2DA 3JZ7A 3FRUB 4LCWA 2O5YH 5A3IC 4NQEA 3W5MA 1KLGB 3CC5B 4MB3A 4IRJB 4LIQH 5D1QD 4NNYB 3UEZA 3CH1A 4JG1L 3HLAB 3QDGE 1DBKL 5MEPA 3BP5B 5E2TH 1H15B 1MJUL 4LPCA 3V6FB 1JUFB 1GOFA 5JLZA 4CUCA 3FT2A 3QCVH 1CFSB 2FBJH 4JO2L 3V95A 3WSQH 4KGLA 5I71B 4OKVA 3SE9H 5E9DD 3R1GH 1FNLA 4FQLH 1X4XA 2X4QA 3EFFA 4BJLA 5D5ME 2ZP0T 2P5EA 4EUPH 4EUPB 2VDKL 3BQUD 5IQ7H 1U8KA 4HWZB 5DFVC 4UINL 1DDHB 4HUXB 4HT1L 5HPMB 1QACA 1T2XA 1FL5A 3KXFA 5DD0L 3S5LB 3OKMA 4GRLD 3QIWD 5C0CB 5AZEL 1WEJH 4GOSA 3DWTA 3GSQB 3SY0A 4PB0L 1NANI 1QRNB 4LPTA 5FGSA 3NZ8B 1BZ9B 2Z91A 3NA9L 3BKJL 4J3OC 3SGDI 4UV4H 1JRHI 2Z92A 3QXAB 3GHBL 5F9WC 1TMCB 3QPQC 3PQYB 4NJAH 4Y4KB 3QG6A 1OPGH 4RSVA 2GCYA 5CBEA 4DN4L 2NY2B 2IH1B 1NBVH 4Q58C 4NQVB 1UB6B 3IDYB 3GNMH 3T0VA 3U1SL 2ED8A 1LEIB 1MREH 1MIML 4KDTA 2EDQA 1BWMA 1KEML 4XCCH 4DFHA 4N0UE 3RTQC 4HKBB 1LVEA 3HA0A 1N0LA 5AZ2L 3MNVA 3TP4A 2VLRA 2AJYH 2PCPA 1BFOA 2YBRB 3MLVL 5SWSE 3AVEA 3WUWA 5DQDH 4POUB 1XAUA 2HH0H 3RY5A 5HDLA 2IF7A 3RZCB 1LO2L 3PWNB 1Q1JH 3GDBA 3PGDB 4JAMB 5T3XH 2HKFL 5KW9L 2VZVA 1MHCB 3QXWA 4ZYKB 1U95A 2DTMH 3GMQB 5FECA 4P4KD 4JM2A 5FUOL 2VXTH 1LDSA 2JJSC 4L9DA 4TVSa 4JFHE 4ZXBD 5HHOA 3V4PH 5FCUH 2NY6D 4YNYB 1LD9B 2GKIA 4X7SH 1FORL 3WFHB 1T5XA 4ERSH 1KNOB 5DLML 4PGEB 1YEKH 1KG0A 5FYKH 3B4NA 5KSVA 1FAIH 3BWUC 1KJ3H 4OZIA 3V8CA 3HFML 1WWBX 3LOWA 4RAHA 4ELMA 4R4BB 3HZYB 1YNLH 5B21A 2IPKA 2Q76B 1DQMH 3WJLC 4XVSL 5CD5D 1AI1H 3BPCA 3TVMA 4R9HA 3MJ7B 4NQTA 5IW3A 1MEXH 1RZIB 3HZVB 4N9GB 3BFOA 4X98B 3CXHK 1WGOA 1JYVA 3C08H 1L4IA 2HTKC 2MNUA 5CIPA 2YZ1A 5E7FA 3LKQB 1SJHB 1DQQB 2R69L 3TM6A 4LHUB 4PJGB 1FFOA 5EO0A 1S78D 3F58H 3OKLA 4N1CA 3GJFK 1QEWA 1OF2A 1NFDA 1AO7B 2AJSH 5F7WC 1TZHB 2GSGA 4JGMA 4M5YH 2IAND 3SE8L 3VFMB 3IFLL 4QGTA 3ZT7A 4HK3J 3FTGA 1J8HB 5INDA 5JXED 3L5WB 1K2DB 5AWNL 1AP2A 3UTTD 2R15A 2P44B 2FHCA 3KPPA 1EH9A 4MJIB 5JXAL 1MCPH 2E6QA 2H1PH 1X5FA 4NC1C 1P84K 1U3HD 2PW2B 4PJCB 5GSRB 5CSGA 2VAAB 1Q9OA 4FFYL 1YQ2A 1B4RA 3DMMB 5I0ZA 2DKUA 4I1NB 5HDQH 2BFVL 1WIUA 1K8IA 2FR4A 1W72A 5C0JA 4JN2B 3WIHL 2BSTB 3WNLA 5GGSB 5LWYL 4LSVL 5F21B 2CRMA 4PBVC 1H3GA 3OXRB 5BCAA 5HVHB 3OKDA 5JUEH 1P1ZA 3TBTB 4QWWC 2CIKB 3BXNB 4FQ1L 4BZ2L 1MJ7H 2HLFD 2BNQD 3T8XA 5JIPA 1GVIA 1T22B 4RMWA 5IR1B 3TNNB 5HYJD 3DYPA 3QIUA 1MVUA 2EDTA 2E7MA 5F9OH 4DUVA 1PGRB 1A3QA 1U42A 2G75A 3VFWA 4LNVA 3HCVA 2P8MB 4X6CE 2AW2A 5I75B 4ENEC 2X4UB 2JIXB 3QUYA 4ODSH 5EIVA 3DVNB 3JV4A 1NCTA 3QFDB 2NW3B 5D1XC 3RA7L 1B0RB 3RWFB 4H26B 5L88L 4ETQA 5EZJB 1RHHB 4Q9QL 3QDJD 3VGDA 1MSPA 5I1KH 5AUMB 4HC1A 1PYWA 4NKMB 3VFPB 1NMAL 1NCAL 2FX7H 2EEDA 1GZQA 3H9ZA 2XICA 4XVJH 2UY7A 1IGYB 3GMLA 3U6RB 2YD8A 4NZRH 5I74B 5IMKB 5E24E 4WFEE 5ID1B 3ZDXF 4V1DE 2H6PA 4KRMB 3SEPA 2G60L 3U4AA 2J88H 5F72S 3X12B 1M05A 3ILPA 5D7IE 1KGCD 1MNUH 4MCYB 1F3DH 2OL3L 4DKEL 4F7TA 1M7IA 4HIXL 2ZSWA 3T08A 4OFPA 2BNRE 5HSFA 4OLYH 3GIZL 3MLXL 4FQPA 5GGQH 4HIIB 1OLLA 1IC1A 4OZHE 5IROA 2AAVA 3BGMA 4AM0A 3SKOB 3I3DA 3KYNB 1CVSC 1YEEH 43C9B 4HPOL 3RIAK 4HCRA 3TO4B 4YPGA 3HE6B 3O2VH 3ARDA 3CDGB 3V6BR 5C0AA 2FO1A 1NDMB 3P3YA 4P57B 1A1MB 3OG4B 3HN3A 1C1EH 3HNVH 1FSKB 2YSSB 3DVGA 4GXUM 1G0XA 3WHXB 3PWPD 4KMQA 3X3GL 3D2UD 2M26A 3PWJB 4BQ6A 3ORJA 4NQEB 2E7LC 2PXYB 1YC7A 2DS4A 4WTWA 3CH1B 1IZKA 5MEPB 1VACA 4EOWL 4PJDF 2NXYB 4XXCA 1MFEL 5KBNC 2D7OA 2YMXL 3FT2B 2V9TA 3VXQA 1KJ2A 2VL5B 1ZA6A 4XRCB 2FX9H 2X4QB 4WI5A 1BQLL 1MHHB 4Y5XB 4PTUA 1T03L 2CJUL 4WU5A 4K9EL 4PJ8A 4JM2C 5EPMB 3QAZC 2P5EB 1CYGA 4AY0A 3D39A 4D9RE 2ZPKH 3H3PL 3LKPB 1ADQA 5J3HD 2ADGA 3KXFB 3NFNB 3RY6A 1SQ2N 1WFOA 4TSCH 3OF6A 4GMSL 3SY0B 2BOCA 2LTQC 4G8FB 1INEL 1V3MA 1AXTH 2Z91B 4JFDA 5TDOB 4EXPX 5DGQA 4YHLH 5HHPA 3S88H 1PAMA 3IDMB 3VWJD 1GHFL 3QG7H 5H8DA 4NUGH 3TVMC 3WEXA 3QG6B 4K7PH 4KZDH 2D7QA 5SWZA 2GCYB 1E4XL 1UB5B 3RAJH 5LJYH 3DETD 1AC6A 1RMFL 2V7HA 1MIEL 4Q74A 1RUKL 3P0YH 4JY4A 2AK1L 2UYLA 4LIQE 4X8JB 3TFKC 4K71B 4KQ3L 4NFDA 4XC3H 2VXVL 1JTPA 2G5BA 4L8SA 1YDPA 1GGUA 4JRXA 4H5SA 2VLRB 4X9BA 3IDNA 2PCPB 4XXDA 1OM3L 4HULB 5GS0L 4HIJA 1INQA 1TJIH 3WUWB 3IKKA 1F6AB 3RWJB 3TC9A 1A7PH 3B83A 4PJFB 2CXGA 4JRYD 1XR9B 4OM0L 5TE7H 1YEFL 3TWCL 1AQDA 1I1FA 3TH3T 1N7ML 1UH3A 4S1SH 3IDXH 1NGWA 2EKSA 4FZ8L 1U95B 5D8JH 3UJIL 4GBXB 1ZMYA 3WCYA 4JM2B 4PTTA 5FO9A 1AGFB 2DQIL 1YMMD 1MAMH 3MRPA 5T5FL 3RVTC 4D0CA 4MS8C 5C0CE 4KTYA 1GYAA 5I1AA 3S34L 1EGJL 2VR9A 2CD0A 3O81A 3IFNH 2W9DH 1Q9KB 1T5XB 1QRNE 1F3JA 3IKCA 3P77A 1JYXA 2F19L 1FDLL 4DQOH 2I26N 1NANH 2C3VB 2E27H 3OZ9H 1A14L 4IHOA 5I1IL 5E2WL 3CLEL 1UKSA 2GK0B 3CXDL 4CDHA 1GXEA 3TV3L 4YAQA 4G42B 3MNZA 2EDXA 4P5KA 3IU3A 1UCBH 4JHWL 3RWDA 1JRHH 3ARXA 2IPKB 4N68A 4J4PA 3PQYE 5DD3H 3T1FA 2PKDA 1CFBA 3MLRL 1KCUL 3K4DA 3BPCB 4NM8H 1B2WL 2BOBB 3HMWH 1F42A 3OV6A 2E5EA 4NOBA 1RUAH 1KPUB 5B4MD 1UM6H 1UWEH 2AJZA 2AJUL 1ZVYA 3P30L 1QBLL 4DK6A 1QTYT 3IAGC 3VXUD 5K9OA 4WW2B 3QIUC 4X4ME 4X80H 1ZGLM 1QR4A 5L2KB 2A38A 4QT5A 4RMRA 4X5WA 3S37H 3LN5B 4UAOC 4PJIA 2WIIB 4PRDA 5HHNA 5CBAB 3T3ME 1F45A 5DD5L 3SDAD 1FFOB 5EO0B 3QUYC 3RFZC 2Y7QA 3P4MB 5IUSA 3OKLB 4XMLH 4LEXH 1FZKA 4PRNA 1YY8A 2J2ZA 2N56A 5A16A 1U58A 1VA9A 3FTGB 2YWYA 5J11B 4KQ4L 4DW2H 3O3DA 3FQUA 3ULVC 5J1AB 1AP2B 3CFCL 5E95B 3KPPB 3PNWA 2ZJSH 3MX0A 4JDTH 3M8OL 3DX6A 2K7QA 4PFEA 3S98A 1JGLL 2LAGB 5I8CA 3W9EA 3WXWH 5DJ8A 4TUKL 4AQOA 3OJVC 1Q9OB 1BGXH 4HBQA 3SBWA 4E41D 2DIAA 4NQXA 3ZE1E 1I7TB 5IFHH 4HX1B 1JCKA 5JXEA 4AEFA 4OB5L 4OBRA 4PJ5B 4NKQB 3EJZD 1QSFA 1W72H 5EZOH 5I1GL 1FO0H 2X4TB 1FO0B 1WAAF 5TPWL 1RU9L 2D7TL 2CUHA 2QSTA 3ZHKA 5FM8A 1P1ZB 4EI5A 3B9DA 3ZT5A 2GI7A 2WBJC 3T1WA 2N7BA 1SVZA 3BVNA 2CLRA 1CGSH 3RI5K 2FGZA 3T8XB 5TFSH 3TN0D 4I3RL 3NAAH 3QIUB 1JL8A 1MVUB 3THMH 2H2SC 4PJGE 4DKFL 3EOBA 2ZCLL 5CEZD 3MXWH 1RSFA 2BVYA 3K2UL 4LLQB 1AO7E 5CWSA 4OIAA 4HWEH 4M93C 3FZUD 1J8HE 1O7VA 4OF8A 3HZKB 4ETQB 1V7NL 2BNQA 1T5WA 3MOBH 4JM4L 4XXCC 4MJIE 4KTDH 3BEWB 4P2YA 4AIOA 1KPRB 1NLDH 4WU7A 2BK8A 1FVCB 4ZSOA 1GZQB 3CMOL 5JDSA 4AEHH 3GMLB 4PJCE 4S1RL 3RX7A 3QWQB 4GW4B 1RIHL 3BSZH 3UDWC 3HMXA 2VLME 4PJ8C 5D1QC 5IHLB 4FQ2L 2XN9B 2JB5L 3QDJA 3BH8B 4JCMA 5E08H 1M7IB 3EYUL 5FA3A 2ZSWB 3CSGA 1CGWA 3RY6C 1VERA 4DWHA 4RRPA 5J06A 4AM0B 3FB6B 1MY7A 4AT6A 4JO2H 2DLGA 1S9YA 3T4YA 3VMNA 1ZKAA 5F7LB 1A0QL 3PHOA 4RDQG 2VISB 2PYEA 3ARDB 4MB4A 3BQUC 2BERA 3FMGH 3NFPA 3H8NA 1T0NA 5F7KC 2VDKH 1YC8A 1BF8A 2WUBL 5GRYA 1S9XA 4LOUC 2FIRT 4UT7L 3QIWC 4R0LA 1RUQH 3LRSB 4HMEA 4HT1H 3L5HA 3T4AA 4NJ9L 3ZTJH 3K7UA 3TF7C 3B43A 4RMVA 4D9LL 5TF0A 1GAFL 3SE3C 5C71A 1A2YB 3EO1B 2HWZH 3FAXA 5I18H 3OX8A 3P4OA 3ES6B 2NTFA 2OYPA 3UZEA 4YDIL 2HFFB 3ELAT 4HEME 1KJ2H 5C0RL 1LK2A 2DMKA 5ITFA 5DJ2A 1N0XL 3BDXA 4PTUB 3I85A 1XCQB 4WU5B 2DQDH 4PJ8B 5DJZB 4KXZH 3VH8G 1BBDL 4WUKL 1MIMH 3BPOC 2B1AL 2PO6D 2WANA 3MLWL 5HBBA 3O0RL 4EBQL 1INDL 1IAII 3D39B 4XPGL 4KI5D 3I6KA 4PJAA 1ADQH 1I9RL 4YQXH 5IEKA 4EIZC 4L4VD 5HY9B 2ZSVA 2D0GA 5HTSA 4L3ED 4M43L 3TT1L 3E8UL 5CEXA 1T3FB 5B39B 4PP2B 4YO0A 1NBYB 3O9WB 2YUWA 3DX9B 5HHPB 1OGAD 4MD0A 4ZXBC 5FUOH 1YN7A 2NY6C 4OI8A 1NGQL 1SJEB 5D71L 5CFHA 1TPXC 1LK3H 4WI7A 3BN9D 3QPXH 1FORH 2V7HB 3RVVD 1QFWI 5EU6D 3QQ3A 5DLMH 4EEEA 5DGRA 4XT1C 4P2QB 4U6TA 3RX5A 5I9QC 1ORQB 2G5BB 4L8SB 4KPHL 5FM5O 3KS0H 4JRXB 4NZTL 3P73A 4PP1D 5CGMA 3HFMH 4HIJB 1INQB 4RBPH 1E28A 5CD5C 3PUCA 1N59A 4OZIF 4XVSH 1R3HA 4YR6B 2B5IB 4H20H 4ELMF 2DKMA 1Z0NA 4R26H 1HI6A 3IS1X 1RZFH 1NCUA 2EO1A 5ALCL 1AQDB 3W2DL 1I1FB 3BP4B 5A2LH 3UBXI 1CLYH 5MENA 3MV9A 1HN1A 2R8SL 2P5EE 1HNGA 5J57B 4PTTB 3U0WH 2Z8WC 3HB3C 4TULL 4RFOL 1T20A 4KVNL 2HFEB 3MRPB 3KXFE 2C3XA 2MMXA 4D0CB 4TUJA 5I1AB 4MAYA 1UM5L 4W6XB 1MRFH 3MLUH 4KDVA 5KVDH 4JRYA 1F3JB 3IKCB 5IG7A 3P77B 4TNWK 3SJVE 4HWBL 1IVLA 2NNAA 2ICES 1JF6A 2I5YH 4XCNB 3SBWC 5MHSE 5I16B 5TF1L 2J6EL 3RNKA 5JXEC 3SGJA 4P5KB 2K3TA 5HYQB 5B3NA 4XBPA 5FCSH 2XTJD 3M1BA 3LDBB 1SBSH 1CU4L 3WHE1 2GT9B 3E6FA 1UJ3A 4PREB 4HS8L 2W0FA 3MR9B 3WNOA 1KLUB 2FB4L 2R4SH 3F8UB 4J7RA 2ADFL 1U3HC 3QO1A 3VFVA 1IGML 5BZWA 3STBA 5DJAA 3KNBB 2XKUA 2AJZB 4KROD 4ORZC 4LPXA 2DYPA 2J5LC 1ZV5A 5C0IB 1MCDA 1E6JL 4GKSA 1IT9H