2ICWI

Crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
110
structure length
110
Chain Sequence
QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGPQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASVHRSDSAVYFCAVSGFASALTFGSGTKVIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal structure of a complete ternary complex of TCR, superantigen and peptide-MHC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 18
structure length 110
sequence length 110
chains with identical sequence K
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2icwI00
5T33L 2FECI 5BV7C 4M7KL 4XXCA 1T03L 4PB9H 3X14A 4M48H 2C1PB 4MQSB 5IW6A 4NC1E 5K93A 1KJ2B 4NUGL 1YEJH 2K1MA 2Q6WB 4HGMA 3DETD 1M4KA 5EU5A 4I9WD 2H9GB 2DBLL 4R7DA 5DVMA 5D5MA 2G2RA 1HHKB 1OP9A 4JAMB 3H9SA 4H20H 5F93C 4NQSA 1JIBA 1ZLSH 3KS0J 4IMKC 4GMSH 4YHYB 1F3DH 3K2UH 4HWZA 4LOUC 1FZOB 3GMRA 4OD2B 4U1IB 1KXQE 3R1GH 1HILA 4UV7H 3T3ME 4BSWB 1MIEL 1JUFA 3G5VB 3NPSC 2BRRH 1LEKB 1KELH 1S9YA 4ZNCD 2MWCA 3NTCH 1IGFL 1MI5D 3LDBC 5ALBL 4AENB 1T0NB 3B6SA 2YD8A 1FNFA 3VFRA 1E6JH 1NKOA 1B0GB 4NOFA 1G0XA 4M1DL 4TPRL 4XPHH 3TFKC 5I17A 4JPIA 2VLJA 3V6FA 5IESH 2FJHA 2EC9U 3DROB 3T0ED 3QIWD 4KK5D 4I3RL 3BX7C 3IAQA 3VFNB 2BNUB 1T04A 2A6DB 4NSKA 4GG6F 3QXWA 3VXUE 4JFOA 5KS9E 4WTWA 2VLRE 3S37H 4WENB 4Q7DA 5BCAA 1NGZB 2OL3H 2BOBA 4HG4J 4NQDE 3FB7B 5HHVH 1GIGH 5KW9L 1KENH 5FECB 1MFDH 2QJDA 3IXAA 4LBEB 4HV8B 3O2DH 5IMLA 4FABL 5GGTA 2ZCHL 4M61B 3SDCC 2HWZL 4RWYL 4WUUD 1DQQA 5F71A 1ZA3B 3BZFA 2PCPA 3N85H 3PGFH 5I1EL 1JZ4A 1LQSR 3S8WA 1G6RA 5I1LB 4GRLC 3WDHA 3SKJH 4FTVE 4MMZC 3U36A 4HFWB 3W81A 4NGHL 2ITDA 5E4IA 1LEIB 1CBVH 4JZJA 4RQQA 4OT1H 3HKFA 4HCRL 3MUHL 4J3VA 2HT2C 3DETC 1T20A 1XMWA 2R39A 3QIUA 3NFSL 1U41A 5ENWB 1D6VH 3E8UL 3PNWB 4NQXB 2IQAB 4KDTA 4NQVA 4I4WB 5EG6C 1FFOB 3KPSE 3N9GH 4HKBA 4Q9QH 3IDUA 1J1PL 2R69L 2EIBA 4LEOA 2ORBL 2WSKA 2FO4A 2NY7L 4WFED 4CBPA 2Y7QB 3B9AA 5DK2A 5IFHL 5J4MA 5EZOH 3FO2B 3EYSH 5F89A 4POZC 4LPYA 2YA1A 3BRDA 1NMCC 4O9HH 5JLZA 1U9KA 1GGBL 5FUZL 1DEEA 5B39G 2L4OA 2XFXA 1UZ8A 5T3ZD 2GT9B 4PJ7F 3BP4A 1AO7D 2Z8SA 5HYSA 3QIWC 4KK5C 1NAMA 2ZOKB 4G6KH 3BKYL 1QBLL 4ELMB 4M9PA 3ZHKA 2I5YL 3QNYA 1T2JA 4XMLL 5LQBH 4Y8AA 1BZ7A 3G6JF 4X9FA 1IAII 2AJYL 3NACL 3BE1H 1BOGA 3O3EB 1IAIH 2NY4B 1BWWA 4KK6D 4QCIB 4F9LC 2HA1A 5DZNA 4PRPA 4ZXBD 1V7NL 4UQ2A 5IROA 4QEGA 3ARVA 4OQ1A 5HHOB 5L2KB 3VMOA 1IT9H 1XFPA 4MDJA 5DJZA 4HQQL 4HIEB 3TCXA 4LCYB 4GXVL 3QDJE 1T2QL 2AABL 2EXYD 4ETQA 3GNMH 1DFBL 5FKPB 2Q86A 4HMCA 4PJGF 5D7LD 4R4BB 4JFQB 4NQTA 1F6LL 2QR0A 3RA7H 1BF8A 5JW5A 3QWQB 4JO3L 3O8XB 3LPFA 5FA3A 4ODSL 3CDYA 3Q6GH 1X5ZA 3CFJB 1VPOH 3UJJH 4OCLC 4QHLA 4WHTB 2ZJSL 1RUQL 3LQMA 5T1KA 4L9LB 3MMEA 4YHKL 3L5WB 2XY1A 4UU9A 1DQJB 4K3EH 1KTDB 2YR3A 3FT2B 3QXAB 1GGCL 2P5EB 5FM5M 4YWGL 2XZZA 2AXJA 2ZUQC 3VFVB 2V7HA 1FYTE 4JREB 1TDQA 1HWHB 2X4UA 3NABH 3OKLA 1NUDA 1JPFA 2CMRH 1CZ8L 4XPTH 4D0DA 1MPAL 4YE4H 2DQGH 4A2LA 2J8OA 2ITCB 2BSED 4PJXF 2R0LH 3HG1D 1X6LA 2VE6A 3P0VL 1QLEL 1A3QA 4ZDHA 1JGDA 2D2OA 4X4YA 4GRWE 4MHHI 1BX2A 3PHSA 4HG4K 4NNYB 1A6WH 1HYRC 2BVPB 1RK0B 4WI2A 4K23H 5F88A 4HKJB 3V4VL 3TO4D 4OGYH 3V6OE 3C5JA 4ISVB 2DDQH 5INDA 4HPOL 2W65A 1WAAF 4L3CA 2JELH 3O9WD 1CL7L 1NCDH 3N50A 2WANA 4ZXBC 4KH2A 2X1PA 4L4TA 1N26A 4PPTA 4R4NC 4Z7NE 2E5EA 3BEVA 3PGDB 3IDNA 4P5KB 3MA7A 2VXVH 3MNZB 5ICXA 2AJ3B 2J6EH 4XNUL 4JFXB 2EXYC 3U7YL 1UT9A 5C0AB 3KXFE 3Q0HA 4AT6B 3OKNB 3VFWA 4PLNC 2XN9D 1DQML 4OCSL 5DQ9B 3MV9B 4DGVL 4L3ED 4LQFL 5C2UB 5DJDA 1A7RL 2BCKA 1MAJA 3UYPA 3O6LH 5F1IA 4JPVL 3SDAD 4E9LA 2OP4H 2GJJA 4N0YH 2DLFH 2EH8H 1YEDA 2H2PD 1AKJA 4N8CL 2P8MA 4LCWB 3HZYB 1JNNL 2Z31D 3T8XB 1QBBA 3QIBD 3BH8A 1UVQA 3TBVB 4IRZH 5FKAB 3RGVA 3BW9A 4HIJA 1K5NB 1HXYB 2DKMA 4EUPG 3ARUA 1MELA 2DMKA 4X4MA 3TVMD 1MJ8L 3S5LG 2BY0A 4G80A 5HGDA 4EI6A 3WIHL 4M93B 1JPTL 2V9QA 1DZBA 3W0WD 3VDAA 3NGBC 2CIIA 5H35A 4PLJC 4N1HB 3PIQA 2WP3O 4Y5YA 1QA9A 4CJ1A 3VXRD 2PW1A 3X13A 3DV4B 4U1SB 2YD2A 3KYMA 2IG2H 1AGBA 4JY5H 5BO1H 3CLFL 5J3HD 5KSAA 3IU3B 3SO3B 2FGWL 2AEIT 3LD8B 2X42A 4KRPD 4X6FA 4URTB 1HIML 5BZWA 4L8SA 3GBLA 4DZ8A 5CZKA 4UQ3B 5IOPB 4PJCA 4P46D 4X99A 1AXSA 4OLXL 4U1HA 1WVZA 3DRTA 4G7VL 1R5IB 2QSCL 5AZ2H 1RZKL 3ZTJG 1U91A 4ZOBA 4LLDB 4YZFF 3BGFB 4MAYD 1DBMH 1OAZH 3EAKA 1XGQB 1CFSB 4DK6A 4G6JH 4Y4FD 2VMFA 4F7PA 2ZZUT 3GUTA 4HGKC 4WO4D 4ZPVA 2MCPL 5I1JH 3QJHB 1VHPA 3O2VL 4ZTPH 2BXYA 1P7QD 1MAMH 1G7HA 4GW5A 5I0DA 2YHGA 2OBGA 3MRKA 2B0SL 4M5YH 5IEHB 4R6UA 4CADA 5GZOD 5J6HB 5T1DL 4Z8FL 2VZTA 4H25B 2YC1A 4ZD3H 3PL6A 3W39A 3LQAC 5BS0A 2EDBA 4G8IA 3CU7A 5JHLH 2OJEB 3QXVA 4JVPA 2Q3ZA 2CDGA 1WZ1L 4Y16A 5JOFA 3CSYA 2DQIL 4Y2OA 5DD5L 1MCQA 3MLYL 3RL2B 2VN4A 1P6AB 3EDFA 3TPUB 3MJ9L 3TVMC 2EE6A 4NM4H 4K3JH 2NY1B 3LIZL 3RBSA 3TT3H 1Q94B 1CYGA 5BZDA 2DI7A 3A67L 3ZE1E 5TQ2L 4YFDB 5LJYH 5F9JB 4NOBA 4QNPF 2X10A 4AH2B 1G7PB 1GPOH 5EZIH 4G9DA 4PTTB 5DMKB 1TJGL 3ECBB 5DUBB 4D9QD 1KEML 1NCCL 5IEKA 1CICA 3ARYA 3AGVA 1CIUA 1XR9A 3BXNA 3QUKB 3QJFB 1FNSL 2VDQH 3B9VA 4OF5A 1XGRB 1RZFH 3HB3C 1XIWC 1EAPA 4M7LL 5HI5C 5MENB 4TULH 2A0LD 3TEUA 5DJ8B 3QHZL 4OLYL 3OWEA 1CFTB 4P46C 2A9NL 2Z8WC 3QO0A 4GKZA 3AREB 1IZKA 3FB8B 1P9MA 3F7YA 5IHUH 2VDNL 3AU1A 2B4CL 3V4PL 1RJCA 2ARWA 4MAYC 1FDLL 5FXCH 4FXGA 4OD3L 4XVSL 3TIDB 4R96B 4Y4FC 5T5FL 4CU7A 3IJHA 4MWFA 4WO4C 1QOKA 1BIIB 2DQCH 2AW2A 1JPSL 3WNPA 5SWQB 1U2HA 1I9RH 1CD8A 2DICA 2HFFB 4J1UA 4PFEA 5CUSL 4ZSOB 3KPQB 1T4KA 4LSTL 1B0RB 1QSFA 3FJTA 3KGRA 4WU7B 1QRNB 4G6ML 4I0PD 2PO6B 3L3IA 1CG9A 2I9LA 5EZLA 5BVPH 1LNUA 5FOBB 4XPBH 4MDIB 4O02H 4Z77B 1KB9J 2XI9A 4O4YH 2PR4H 3WXVL 3I9GL 2DS4A 5F7DA 3KNBA 3RNKB 2R2EA 1ZGLA 1I4FA 3IDYB 3AC0A 1IAIM 3TC9A 3MRRA 4U6XA 4HDIB 1A2YB 1NFDA 4LPVA 1A7BA 5FM8A 3WS3B 5SX5H 3U4BL 3HZKA 1D5XB 4UB0L 2WWKT 3OPZH 5D2NC 3G6AA 5BRZA 2NX5B 3RWEA 5T3XH 5H2BA 1YPZE 2QKIA 1JL8A 4Y19A 1REIA 2EYRA 2W91A 4NFDA 4NO3B 1AXTH 3IT8D 4C56D 2ZSWA 4YHOH 4HFUH 1H3PL 3OKOB 4PJFA 2P4AB 1FFNA 2A0LC 3K7UA 1RUAL 4O2FA 4DTGL 1W72A 3MRBA 4OKVB 1A7OL 3MOQA 5ADPL 1J0YA 3SGEI 5T1MA 2OTWB 4PRBA 5HJ3B 3WUWA 1I8KA 1KLUA 4XCYA 3RRQA 3MA9L 4HHAA 4KMQA 4BZ2L 1S8DA 1UXSB 2XY2A 43C9A 5KS9F 2FD6L 3O0RH 3PWLA 3VXPB 2UYLA 1ZA6A 3MODH 4P57B 4E0RA 2WWMD 1TVDA 1LD9B 4MZ3A 2VZUA 2VR9A 4EQ2A 3JBG7 4N8VG 7FABL 1MJJB 1KIRA 1WFOA 5GRUL 1RFDL 3WNKA 3PP3K 3O11B 1TQBC 4I0PC 3QQ3A 3UPAA 5ID1B 4L29B 2F54D 5ABDE 1IM9B 3IF1B 5EU7E 3SKNB 1LK2A 4UBDD 2HRLA 4LFHG 1CGWA 1MCDA 2EDYA 3QDMA 2EDFA 3C8KA 3HC0B 4P3WA 2UV3A 4LASL 3U4EB 1AGFB 5DVOA 5C0ND 4OZFG 1PZ5B 5HHMB 5AEAA 3IFLL 2PXYD 4NNPL 2QHLA 1JFQH 1H0DA 4LNRB 3RDTA 4LQ1A 2EDQA 3OKKB 3ES6A 1JBJA 2HVKB 3QG6B 4RA3A 5EOCJ 1WT5A 4X6BA 4M43H 3V6ZA 2ZG1A 4ELME 2G9HA 2A74A 3LEVL 1N2RB 3BDXA 3D1MC 4RSVA 1KC5H 2FIKA 2NY5C 5HYJA 4D9RE 1SY6L 1IJ9A 5DHVB 5L8LB 1A4KB 1MHCB 5TDNA 4RX4A 5L2KE 2YKLH 1F4HA 4OLWH 5I30L 5IK3B 3VGHA 1MHEB 1CDHA 1I7TA 4LKXB 5D7IB 1JGLH 4LVOC 1BLNB 3B9DA 3CD4A 1V3JA 1EFXD 1AFVH 1PQZA 5TFSL 2QADD 2VERN 3O4LB 2W0FB 1D5BA 1GHFH 5IMKB 1OAKL 5IB2B 3QEQA 2EE3A 4GRMB 3LV3B 2CRZA 2VL4A 3UDWC 1L6ZA 4Y4HD 4CMHB 2PYFB 3O6KH 1PJ9A 4K8RL 5EOQL 2AK1H 3EOAA 2FEEL 2HKFL 5A2FA 4GG6A 1UB5B 4RBPK 2WWMC 2DQHL 5DRZA 5EBWB 2W9DH 1HXMB 4XAWH 1KB9K 4QOKA 2CRMA 3SJVD 1YNLH 4Z7OE 1Y0LB 4XB7A 5ANME 3HC3H 4MA1C 5HBBA 1CR9H 3QB7C 4GRLA 4RZCB 1KBGH 4N0UB 4PGBB 2AQ1A 4OLUL 1Z9OA 4EDWL 2ESVA 5EO1A 2A83A 5GZND 2WAHA 2IBGA 4UBDC 1JWSB 3DURA 5I1AB 4X98B 5C0EA 4PG9B 1LP9B 4OTXH 4OF3A 2OK0L 1RJYA 5E7FA 1BVLB 3ZSSA 3DHMA 2DLTA 5D8JL 2RR3A 4PJ5A 3RPIA 5EN2B 3QI9B 2PXYC 1E28A 3HRPA 3V7AG 3VRLE 3LKOB 5GRZA 3WIFA 5FF6A 4XWOD 3QUXD 3B8SA 3MRPB 4FS0A 4ZOEA 3MV8B 1HZHH 2VZVA 4HIHA 2IAMA 3HHRB 3AS0A 3WEXB 2PYEE 5EO9B 3WFBL 2I9TA 5C0CB 3OGOE 2ADGA 4MXQD 5DRXA 4P9HC 4DCQA 2NNAA 5ISZD 2P5WA 1CLCA 4ZO7A 5GS0H 1RVFL 1QSEB 2APVA 1GXEA 3QEGH 5TH2A 4UNVA 4IOSD 4K2UL 5H37H 5JZ7D 3T2QA 4QXGL 2UY6A 4WY7H 3LPWA 3SDDC 3SQOH 2XZCH 1XGTB 4JRYB 5GSVA 2YMXH 4S1RH 5IVXE 1JGUL 1NSNH 2YSSB 1OQOA 5F8RC 2V2XB 5JO5B 1DQLL 5FCSH 2J4WH 2WINA 5C0AE 2BHYA 2N7BA 2X1WL 4OGAC 3WIIH 4IBLT 4JFDE 2QADC 1T80A 5I8KL 3OKEB 1KIQB 1KPRB 4D9LL 3VJ6A 2FYYA 4X0KB 4GRWF 1JE6A 3RIFK 1AJ7L 3UTSB 4F9LA 4PJ7A 2OSLA 5E2VL 1A3RL 4Y4HC 3F65A 3U0PB 3MTRA 2VLKA 4LLYA 5TE6H 1X4XA 1D9KD 3RY6C 1CFNB 5GGTL 1HHJA 5JPMA 3F7QA 1EVTC 3K80A 4LCWE 3G6JA 4FQXD 4NDMB 4RMWA 1Q9WA 1KACB 1GSMA 1OGAB 2DI8A 4P23C 3G5XB 3SGKC 3ZDYE 4MCYB 4Z7NF 3HCVB 3U0TA 2O5XL 4H0IA 2OJZH 3S36X 5FUOL 4EDXA 2C7UA 3S7GA 1BEYL 2RAMA 2Y4SA 3DTXA 3QCUH 1FZMA 3X11B 3RTQD 3X3FH 4N5ED 2EDKA 5GZNC 5JR1L 4YR6A 2MPAL 1Z9SA 5KVEH 3V95A 5F7EH 3U83A 5EA0H 3DX9A 1A9BB 4HUVA 4S0SD 1JRHI 3VA2C 2CK0H 4YAQA 4YHML 1UM4L 4UIKL 5FO9A 1QYGH 1FVEA 1JRHH 2H26B 3GHEH 4HJGA 1JWUA 2DYPB 4PJ8B 5DLML 2G75A 4AY0A 1GZQA 4XNQB 3MJGX 5D1QD 3F7PC 3CUPB 5TGBA 1LO0H 9CGTA 5H8DA 1E6OH 5GJSL 4FA8A 4PJEE 2R23B 1G7QA 32C2A 3BO8B 1J0ZA 4S1QH 4WEUD 3I75A 4MXQC 4JPKH 4Y0GA 3S88L 3VGDA 4I2XA 1NEZA 4EJ1C 4F2MB 4KMTL 1N59A 3D3VE 3OXRB 1R3HA 5AYQA 5DWUL 4NC0B 5EWIL 3W11C 5L88H 3S6CA 1YDPA 3V7MA 2ZPKH 1ZTXH 2XA8L 1OB1A 1G9ML 2ZCKH 4MCZB 4JEGB 1BWMA 3BPOB 2YRLA 4U2ZA 2VABA 4PGCA 4C4KO 4GAYB 1NAML 3F5WA 1HH9A 4YDLB 4L8CA 2BDNL 4OAWA 4PRDB 1B9ZA 1D5IH 1OGTA 4N1EA 1ZHBA 2YBRB 4UDUA 3AS1A 2YPKA 4TSCH 5IT2L 5EU3B 4JZOA 3ME0A 3QYCA 3TH2T 5D9SB 4U1LB 1C5CL 2QQLL 4LHQB 4CKVX 1D9KC 4WJ5B 3KPPA 1FG2A 3FMGL 5EOCL 1Y18B 4PLOB 4BKLA 5HHQA 4R7NA 4FQXC 2X4SB 1G7JA 3MBEC 4MYWB 2NTFB 5E9DB 1U3HD 3L7FA 2BC4B 1NDMB 3ARFD 5LCVL 5D96B 4JDVB 4PJHA 4KKBD 2LVEA 3CK0L 1E4XI 4RAVA 2A1WL 5DEZA 4GW1B 2HG5B 3MYZA 1FFPA 3OL2A 5HXMA 3P4NB 3RTQC 3U4AA 3KPRB 1CDYA 4V1DB 4N5EC 5L6YH 2CO7B 3L7EB 4JKPL 1FPTL 5CEZD 4OZ4A 1A9EB 2DN7A 5DD1H 4NO0B 1U8QB 2BJMH 2WBJD 5CD5C 4HT1L 1F90H 4WIQA 1N6QL 3WHXA 4JFFD 2QSTA 1I3GH 2DJSA 2D9CA 4PJDA 4N9GB 2GY7B 3WNMA 1MCRA 1MCPL 1QFWL 1Y6KR 4TSAL 3ZKMD 1KNOB 5MENE 2HLAA 1DBBL 3SKMB 4BQ8A 5CSGA 3MV7E 1EO8H 4PRHB 1BOYA 1SBSL 3PQYD 4HUXA 5KN5A 1NH6A 3WCYA 2NY3B 4JJ5B 4ZYKB 1AR2A 1C08B 2YPLE 3SCMD 1T7WA 1BIHA 4LHUD 3ZE1F 1RUMH 2JF1A 5J13B 4P4KB 4RGMB 5EBMA 4CVWA 3BQUA 4KKCC 5TE4H 4LLVB 1IC5L 3GGWB 4TTGA 5ESAA 3IDXL 2X5PA 2DQUH 5MEPB 5K9OB 1O5DT 1FNEB 4YX2L 3ILQD 5FYJL 3HZVA 5EUOB 3U2SA 4ZSOE 3D39A 1CDGA 3QZWB 4RA0C 3EOTL 4W6XB 1HDMA 4OD1L 5GGRA 1QRNE 5E5MB 5IMOB 3C09B 3T4YA 2VDLL 2IBBA 2VR4A 5DJYB 4QTHA 3U6RA 1ZANH 2VXUL 1K8IA 1LO4H 4K94H 1IM3B 1P7KB 3WFDH 2HTLC 1IL1A 1U3HC 5FGCB 2O61B 5K9KA 3ARFC 5IIEB 3S96B 4X5XB 1YEIL 4FZEH 5DMIH 1EX0A 5C08D 5CIPB 2RQ8A 4PBXA 1UJ3B 2HJKA 2ZP0T 1IAMA 3MJ7B 3EJJX 2NX5E 3CMGA 4P5MA 3RX8A 1IC7L 4NZRL 3R06A 5EU5B 2IC2A 1FL5A 4R7DB 5D5MB 2G2RB 3M17B 1FC1A 1NGQL 5KANI 1FCCA 3UBXB 2KUTA 4Z0BL 4EN3C 3P77A 2QQNL 1U93A 3OKYA 3FQWB 2ICEB 2R2BA 5JOEA 1LO5B 5D7SH 1NMBL 1CDIA 1HILB 2QLVB 3SCMC 3HFML 1A1NB 1ZKAA 1HH6A 3RI5F 1S9YB 2BNRA 5CSZA 1C5DA 4U4BA 3B6SB 1XIWA 3VFRB 1MWAA 1X6NA 1YPZF 4R90L 2NY6D 1JNHA 2V5SA 2VLJB 3V6FB 1E0OB 5F6HJ 2FJHB 4R9HA 4JKLA 5IQ7L 4CVXB 1U3JA 4OM1H 3L5IA 1U8OB 5TF1H 4JFOB 5C9JA 2OMNA 3ARPA 1KN4L 5C8JA 1BAFH 4KPHH 4RGOH 3EO0B 5FFLA 4DQOL 5FYJU 2AK4A 2BOBB 4NQEA 5F9OL 3IVKB 3IXAB 1VESA 3KLDA 3VG9C 3VD3A 3DMMC 1Z2KA 5IMLB 1GZPA 2CUHA 5SX4I 4YK4B 3Q3GB 3ULVD 5HHME 5SX4H 3VRJB 1DQQB 1PAMA 5FGSA 3BZFB 2PCPB 1P2CA 2MQ3A 1JI1A 1BFOA 3P4OB 3U1SH 2JJSC 2CRYA 3CH1A 1XAUA 1F58H 4F3FB 5MEOA 4MA7H 3TN0D 4KVNH 1OAYH 2VXQL 3MV11 3WE6A 3VXSA 3U36B 4TVPL 3TWCH 1EMTL 5TE7H 1W0VA 3PJSA 2V2TA 2VZSA 1T6VN 4DVBA 2Q7YB 4AIOA 1T20B 3QIUB 3GO1H 3TIEA 3ZT7A 4FP8L 1KB5H 4TVSa 4DGYL 2K7QA 4QRSA 1MFEH 4JHAL 1A6VH 4Q9CA 2H6PA 4WEBH 3I2CL 2R29L 2E6JA 5CWSB 4LEOB 1TJHH 5ITBL 4LIQH 2QEJA 2GJZB 1KTLA 3O4LE 1WITA 3SGJC 5T3XE 4LFHD 3C2AH 1XR8A 2ADFL 5CBEB 4UIMA 4HEPG 1EGJA 3PDDA 4ELMF 1I8IA 5JLZB 1B2WL 2Y6SC 3UO1L 5D71L 3EO9L 1DEEB 2PETA 2P24A 3ZYOA 4KROD 2XFXB 2NY6C 4MB4A 3GI9H 3BP4B 3I84A 1FIGL 1M6OA 1QZ1A 2IADB 2Z4QA 4R97B 4J4PD 3QNYB 5F9DC 1BQSA 2W0LA 4N0UE 4QRRD 1UEMA 2XZQL 4X4ZA 1TITA 5KVFL 3HLAA 1WIPA 4PRPB 2VC2H 2WMPA 3FO0L 4UQ2B 3O6MH 5F1OB 2DM7A 3CFBA 4PRAA 2NXYB 2B1HH 4MDJB 5DJZB 1LP9E 1G7LA 1A5FL 5EORL 3MQIA 1EUUA 5CJXC 5AZEH 4TTDC 4ETQB 4D3CL 1A47A 4LK4A 5KS9A 3JVGC 4GMTH 2BSSA 3U0WH 2OI9B 2VLRA 5LGHH 2G5RA 3BMVA 3TN0C 5LWYL 4R2GB 4Z7OF 5C0CE 1RZ7L 5JW5B 4NQDA 3P0YL 5FA3B 5KJRL 1QSEE 3BP7A 1RMFH 4NN6C 5JNYB 4HKZA 5AYUH 4QHLB 3LSOA 5ILTH 3RVVD 3QCVH 5TDOA 2H2SD 3QFJD 5T1KB 1OM3H 5CBAB 2IFFL 2UVEA 3MMEB 1NLDL 1R3LA 5IFJA 3THMH 4UU9B 1WIOA 4JRYE 1AGEA 1BBDL 3QNZB 4YFLF 1IEBB 3FOMA 4FTVA 4LVEA 5EU6D 5F9WC 3B83A 5F7WC 3VRLF 2V7HB 3BT2L 4IM8A 5C0JA 4PJ9C 4JFED 1ZK9A 3OKLB 5B8CC 3HE6A 1S7TA 3BKCL 4HK3N 2APBA 3UTSE 1T21A 4L3AA 5E99L 2YK1H 4ALAH 3MO1B 2HTKC 4NO5B 4X9GA 4PJBB 1BZ9A 4KROC 1ORSB 2CIKB 2VE6B 4HWUA 5L2JA 1G9NL 3KPSA 4ZDHB 3VFPA 1JGDB 4Q0XL 1OGAE 2KH2B 4IOIB 3LKRB 3V4UH 2QHRL 2WP3T 5KTEL 1LO2H 3U7AA 5A3IC 1EO7A 2F5BH 5F88B 3CXHJ 5IVXF 3W5MA 4M6OL 3C5JB 5INDB 4I48A 2W65B 4L3CB 2CK2A 4OUUB 2X6MA 3L3KA 2WIIA 3BD4A 4Z7UF 3DIFA 5H94A 3MUY1 3ZO0A 5FK9B 3TYGL 3U9PL 4Q2ZA 1YZZA 4FABH 3KPLA 3MA7B 4K3DH 1LWRA 1PKQB 4U6VH 4O2CA 1H3XA 2NW3A 3MRGA 2V17L 3VFWB 4LGRB 3H42H 2B2XL 4L5FH 1RIVL 4Y2DA 5BV7L 3MBXL 4IRSB 2C3XA 3ZDYF 2A6JA 3NZ8B 5DJDB 3BIBX 2Z35B 4RMUA 1HI6A 5DTFA 5I18H 1EA9C 4R8WH 2HT3D 2V5YA 4HCRH 2Q8AL 5KSUA 2WQ8A 1AKJB 2P8MB 4ZO6A 1U8HA 3LRHA 4Q97A 4M8QA 3NFSH 3W9EA 5IJVA 1E4JA 2H2SC 2IH3B 5HVWA 3RGVB 2DQEH 3BW9B 4HIJB 4JFPA 5I9QC 2EICA 1D5MB 5SWSE 4PD4J 1MCOL 5EU4A 5DD0H 1TCRB 4MXWL 5HGDB 5CILH 5E8PA 4X7DC 1H15B 1KCSL 3PWVB 3C60D 4HIXL 2D0FA 1A7QL 4ZOCA 4LDOB 4YDKH 4FMFA 4M62L 2ATPA 4PJEF 3V79C 3DBXA 1CTOA 4XT1C 3CMOH 5H35B 2HH0H 3GDBA 4XNXH 4Y5YB 2PW1B 1M05B 5C86A 3SDDA 5CJOL 4I77L 1AGBB 1O7SA 5D1XA 2E7CA 1MEXL 1YYMH 4H5SA 4JM2D 3VFGH 3VH8B 5MHSE 4JKMA 4L9DA 1RSFA 3ROOA 2F58H 1YN6B 5I73C 5GRWA 5E9DE 1JF5A 5C07D 4LVNC 2BFVH 1EIBA 5BZWB 4L8SB 1FYTA 5DHXB 4NBXB 3VXMD 1YEGH 2VJXA 1AXSB 3FFDA 1OW0A 2EYTB 1CE1H 1KGCD 3KPRE 1NCAH 4V1DE 3BFOA 5I1HH 1VFBA 1J5OH 2UZXB 1UQSA 4ODBD 2LVCA 5L9DH 3O6FA 4NKMB 1FH5H 3TNMA 4GT7A 2YN5A 4F7PB 4DJMA 4NPYA 4YBLC 5DJ2B 3GUTB 4ZPVB 4P23A 2J88L 4Z5RA 3OJMB 3SGKA 2ICWB 3DV6A 1A6ZA 4WFFE 3MJ6A 1EK3A 4Y5XC 3V6OA 3MRKB 4NCC2 1AD0A 3OJDB 3MXVL 1MCSA 2IWGA 4PRHE 1NLBL 4X4XA 1IC1A 2LE9A 2YC1B 4KI5E 5I15H 4S2SA 2AS5M 4G5ZH 1YQVH 5B4MD 2FR4A 4JFZL 3JWOH 3VW3H 1BD2B 4PB0L 3QUZD 2CDGB 3KXFA 4Y16B 5JOFB 3CSYB 2F53D 4XP4L 5DJ0A 3BHBB 4P3DB 3IDMA 4ORGA 4S1DD 2IPTH 4GKNA 1NC2D 3HMXL 5EUOE 5FYLH 5FUCE 2R1WB 2D3VA 3C60C 5GGQH 2BVOA 1S3KL 3HNVL 5GS2H 2DMCA 5KOMC 1GGYA 2X4NA 2B1AL 4N68A 4NYLB 3GBNL 3QQ9C 4KUCF 5C6PB 4KHXL 5FHBL 1A1MB 3WSQH 5DGQA 3AY4C 3KJ4C 1CICB 3IXTB 2W1NA 4NFBA 1A14L 3CXHK 3CC5B 3FO9B 4JM2C 1WFTA 4R0LC 5HI4D 3AB0C 1LDSA 4UAOC 1N6VA 1NBVL 5C0BA 3FTGA 5FGCE 2MOVA 1QG3A 2Y07H 1MFCL 3QULB 5HGGS 3VFUB 2P49B 3FFCD 5JXEC 3MRHB 4GKZB 4QLRA 4LPCA 3FQUA 2V2WA 1NC4B 1CL7I 3EIFA 2RCSL 2XWTB 3AU1B 4YC2C 4PY7A 1CL7H 4L4VE 2EE2A 4P2OB 3L3OA 5IBUG 3RZCD 1VADA 4FXGB 4HXAL 1E4WL 2OS7A 3IJHB 4MWFB 5E08L 3MBEA 3SOBH 4YPJA 3MNVB 1BP3B 4U49A 4QTIH 2OZ4A 4LRIA 4FNLH 2CGRH 5D5ME 1PYWA 2R56L 2HAZA 2XTLA 1WTGT 3S97C 4KTDL 4ERSH 1T4KB 3W2DH 4KQ3L 1VACB 1QSFB 3C6LD 1F4XL 4MNQB 4CJ0A 4U7SA 3P0GB 3FRUA 1F45A 1CG9B 3L3IB 4RMTA 2I9LB 3D0LA 4XMKL 1LNUB 4JPVH 4X7SH 3PHQB 5IB5A 3BIAX 1GCFA 4PD4K 1FAIH 4XC1H 4ONOA 4AK1A 3CFKA 5DUPL 2JE8A 2K7PA 1T7VA 5ESQB 4YHPA 2V5TA 5E1AB 5IF0A 1ZGLB 3QUZC 4OLVL 1ES0A 1FAKT 4D0BA 1V8HA 4U6XB 1SHMA 1NFDB 4XP1L 3BPNB 3OAZH 4HS6A 4S1DC 6FABL 1UXWA 3HNSL 5KANG 1S5HB 4MNHA 4RAUB 1JN6A 5I75C 5C0GA 4KK8C 1FLRH 3HI6H 3LMJL 4CL7A 1YEKL 2AJZA 2VH5L 3G6AB 5E8OB 3DO7A 3RWEB 5F3BA 3EKCA 3QA3B 1EHLH 3PWPD 5H2BB 4KUZH 3ARGB 3NZHH 1CF8L 5DEGB 4PBVC 2A6KA 2QKIB 2C3GA 3FO1A 4Y19B 1MF2L 4WW2C 4XP5H 2JB5L 1MIML 1DR9A 1T89A 2VDKH 4O2FB 1TXKA 3RWHA 4EEEA 3N1FC 1N3NA 1XH3B 1IFHH 3MRBB 3B2VH 5IGXH 4QHNA 5D7KD 1KXVC 4P2QE 5T1MB 1ADQA 1NCWL 1DUYA 1YYLH 3M8OL 3VFTB 4LLWA 1KLUB 4XCYB 2EEBA 3OZ9H 5C0RL 4BFGA 1GGTA 1TQCB 1I8MA 4P9ML 1LO3L 2QSQA 2UYLB 1G6VK 4IEFB 1NMAH 1MFAL 5FO7B 1ZA6B 7CGTA 1R3IH 1S5IL 4DKAA 1A0QH 1E27A 1UH2A 5GHWH 1DSFL 1DE4A 4GKOA 4JG0L 1YJDH 3HI5H 3C6LC 3FQNB 4ZFZA 4HS8L 5GSRA 2Q3AA 3QQ3B 4LRNH 4J3OC 5TPWL 4KKAD 5BV7B 4ZS7L 3HNTL 5ALCH 1LK2B 2IPKA 4XNMA 2C1PA 1CXFA 5GS1C 1F6FB 4ENED 1LE5A 3VXTB 4UT6H 2Q6WA 1N8ZB 3ALXA 5CLWA 2AEPL 4MB5A 4AMKH 2DQIH 1HHKA 2E7LC 4K9EH 2EDRA 4XVUC 1H0DB 2XG4A 1U92B 4PS4H 3HPLA 4LCIH 3I85A 4EN3A 3JWDL 2NCMA 2R1YA 2BMKB 3ES6B 3HAEH 1ZS8A 4X6BB 4OD2A 3GI8L 5EIVA 3E2HC 4U1IA 3V6ZB 3WXWH 2DQJH 3G6DL 5E6IC 2G9HB 3MLSL 2OYPA 5TQ0L 4NM8L 4TSBL 4XNYL 4FQ1H 1SJEA 3ULUD 1N0LA 1CDJA 4KJWD 4F9PC 2GK0B 1JI2A 3QDJD 2DTSA 5HYJB 3PP4H 4XZUB 5DEFB 2GK2A 1WSST 3LN4B 3LDBB 1YY8B 5TDNB 1BM3H 4AENA 1T0NA 4ODUA 5I8OH 3SE9L 1I7TB 4M7LT 3DROA 3STLB 4PG2C 3ZHLA 2QQKH 3MRLB 1OSPH 3A6CL 1PQZB 1PG7H 1P4LA 1YPZA 2ZUYA 1NGZA 3EJYC 2GTZB 3S36H 2IAND 4WFGE 4G6FB 4X7TB 1DCLA 3EOAB 1B4RA 4FMKA 4I3GA 2E9WA 3DMMA 4HV8A 4M1GL 1L7TH 4APQD 1XF1A 5DRZB 3SDCB 5FYKL 3C9NA 4M61A 1JPST 1CLZL 4BZ1L 1EEUA 2R0ZL 4J6RL 2GJ6B 1LP9F 3H2WA 2JJSA 2VDMH 4OCRL 3VG0L 5KAQF 1NQBA 1NGYB 4GRLB 4AQ1B 5I1LA 4F8QA 2IEPA 4Q6YA 5EPMB 3LQAL 5EO1B 4QF1B 2A83B 1TFHA 3DX7A 3BKJH 3T77A 3OAUL 3DURB 12E8H 3U79A 4ENEC 3AAZB 1MCWW 1JGVH 5B22A 4OIIH 4DEPC 3LHPL 4LSVH 3CPLA 3UTTE 5ENWA 1YECH 1S9KC 3RPIB 4IIQC 3PNWA 4PJBE 4NQXA 2IQAA 5FF6B 5T3ZH 4XBEL 2NY0D 1UEYA 2CR6A 2JCCB 2VLMD 1FFOA 4HWNA 4HIHB 2Y7QA 2ADGB 4DCQB 2NNAB 4LIQE 1WC7B 1OARH 4UINL 3SGJA 3P3YA 1A7NL 4NKIH 2UUDK 1I1YB 3L3HB 4XCFH 5TH2B 2GSIA 3DXAA 2EH7L 5JQHC 1NMCB 4DUXA 4M7ZC 5GGVY 1I1AD 2G60H 1MI5B 1MWAL 1YNKL 5CP3H 2XICA 4P2RE 1A7PH 3QIWB 3JTSB 2EKJA 1PKQE 2ZOKA 3NCEB 4EI5D 1I7ZB 2WINB 2GFBA 4BK4A 1MCIA 2HKHL 5DUML 4ELMA 4CMMB 3ZYJA 3QCTL 4Z7VB 4G7YH 3VJ6B 3E0GA 1IGCH 3HUJB 3O3EA 2IPUG 4BM7A 3JV6B 4OCMC 2VYRE 4PJ7B 4QCIA 1N5AA 4X9IA 4EIZC 2OSLB 4ACPA 5B21A 4R4FH 4LLYB 4MD4A 5L2KA 3T09A 3ILPB 5JPMB 1V3MA 1IGML 1QHOA 3G6JB 3UP1A 4WUUB 1Q9WB 2AJSH 1AH1A 1YEEL 1QSZA 3S37X 5IW1B 3JVGA 3C08H 5FKPA 3U0TB 4JR9H 3HRZB 2WUBL 1DLFL 1FZJB 4EDXB 4KVCL 4JFQA 4MA3B 4X4ME 2EDNA 4X6EA 4UT9L 2GTWB 2OL3A 1JNJA 4I5BB 4YR6B 2M1KA 2AQ3A 1DANU 3DX9B 4CVUA 3MRDB 3QDGE 2VXTH 3TBWB 5E94B 1X5AA 3BISA 4YAQB 2EZ0D 4WHTA 3O2DA 1FVEB 1JWUB 4FQLH 3O2WH 4JO1H 4N8VA 3SDYL 3HPJB 1GZQB 5ANMA 5TGBB 1UYWL 2FJFB 4OQTH 2DL2A 2YN3A 3FT2A 32C2B 4DKEH 2UVFA 3I75B 1K6QL 1OSZB 2ZUQB 3LZFL 3RU8H 4NRYB 1RULH 1YA5A 4GAJH 3VFVA 1FFRA 1ZT1A 4PJ9A 4I2XB 1NEZB 5B8CA 2Z8RA 2CH8A 1T22A 4ZNEA 1EGJL 4LGPB 3U7WH 4JN1H 3BDYH 4N90E 4MS8C 5HHPA 3L1OH 1U95A 3UC0L 1MRDH 3MC0A 2VABB 2Q87A 3F5WB 4JDTH 4NBZB 4JO4L 3BGAA 3PF2A 3EZ8A 4MJ4A 5CZVH 5CZXC 4L8CB 4OSUL 4UNTA 3IU4L 3TJEL 4EI5C 2JJVA 2PYEA 1OGTB 4KJQD 4NNYA 1ZHBB 2BVPA 3QUMH 4UDUB 2DTMH 1X5LA 3EOBA 4ZAKC 2LU3A 1WZMA 1N7ML 4CN6A 2F8OA 4MQTB 4ISVA 5GS0C 2VOTA 1NUNB 5ADOH 2QL1A 3ET9F 2E7BA 4ZXBB 4UT7L 1T2XA 3PXJA 3MYJA 1FVCB 4POYA 4OM0L 5J57B 4K8RH 2FX9H 1RHHB 1UM6H 3KPPB 2HKFH 2Q20A 3M07A 8FABA 3NCBB 5IBTL 5FHAH 5IVXA 4BKLB 5HHQB 4P5KA 4R7NB 4JB9L 3ARSA 1CDUA 1G7JB 4OLEA 1QRKA 1QFUH 1BD2E 3FT3A 4JFXA 3L7FB 5C0AA 5DSCB 4GSDL 3RWFA 4Z7UA 1G0YR 1O0VA 4JFDA 5D7LB 4PJHB 1RV6X 4RMSA 1WFNA 5DQ9A 1GJIA 4NQCD 3P30L 2FIRT 1QNZH 5HDOA 1SM3H 3CFDA 3OX8A 3DI3B 4XP6L 4OZ4B 2XZAH 3F58H 4H8WL 4LCWA 2VDPH 2EZ0C 5IFAH 3CXDL 4GBXD 3T8XA 1IVLA 4H88H 5GRJL 3TBVA 1SQ2N 3OAYK 4YXKL 4KI5F 1J8KA 3ZL4H 1K5NA 1OHQA 3GSRB 2X4OB 4PJDB 5DD6B 2BHZA 1A21A 4LPTA 4BELD 4AL8H 2F15A 5CCKH 2AJUL 4LGSB 4LSPL 3GB7B 2EEAA 3NPZB 1TMCB 5E2JA 2NXZD 3RUGB 3F7RA 4HUXB 4XTRD 2NY5L 5KN5B 3NGBB 4KI5C 5D1ZC 3DUUA 1JTOA 2HFGL 4HUWB 2K9UA 5EUOF 4ZS6D 4Q58C 3EFFB 3DUSA 4MD0A 3DV4A 4U1SA 4AEHH 3RZWA 4ONGH 1J1OL 4WWKC 5JW3L 3L5XL 3K46A 3QRGH 3STBA 5ESAB 3BGMB 2R0KL 3ELAT 4QGYA 4PJEA 3GK8L 2CKBL 5FAAA 5GJTL 4MX7A 2GHWB 2ARJQ 2WLYA 5JQ6L 4YH6A 1WZLA 2FBJH 2XXMB 3D39B 4UOJA 1BREA 4UQ3A 5IOPA 3D3VA 15C8H 3P73A 1QSFE 5GGRB 4MNQE 4PY8J 4WHYG 2APTA 3S3JA 4LLDA 3T4YB 4LSDA 4DUVA 3GJEA 1S7QA 1CFSA 2QTEA 3U6RB 2UUDH 1A02N 1K8IB 3FN0H 4IRJC 4F7MA 1KV3A 3MUZ1 4ODHH 1IL1B 1KJVA 5FA4A 5K9KB 5DC0A 4AG4H 2XN9B 1Z9LA 2ZKHL 1G6RH 3QUMB 4Y5XA 5F7HA 1NFDE 1AGCA 2A9ML 2R8SH 4L3EB 1HINH 3FCTA 2X4RB 2E9JA 3U9UA 5D5MF 3WHE1 4H1LH 3UYRH 5DD3L 4P5TC 1CXIA 4H25A 4Z6AT 5EBGA 2D7NA 2I26N 5CS7A 4P5MB 5J12C 4GBXC 1U8KA 1LGVA 3V52H 1XGPB 1HNGA 4FFYL 4KAQL 4NP4H 2HLFC 4WGWB 1FL5B 1B4JH 2J6EA 1AP2A 5C6TH 2EKSA 1IQWH 3TVMB 2FLBT 3TPUA 1BQLL 3GKWH 3BD3A 3W0WB 2YXMA 3UJTH 2JIXA 3P77B 4E41A 5F9JA 3V0AC 2NXZC 1U93B 3ZKSD 4XTRC 3CFCH 4AH2A 2R2BB 2NZIA 3T4AB 1AI1H 2FX8H 3VXRB 4PTTA 4ZS6C 3ECBA 2Y23A 1FORH 3AY4A 4AJ0A 2DQTL 1BZQK 3QJFA 1KFAL 4JM2A 2MJWA 5A16A 1Q72L 2BNRB 4ZUVB 2B20A 5I6XC 4R0LA 1C5DB 5J56B 1FSKC 1XIWB 3QP3A 1MWAB 1W8NA 4KK9C 5MENA 4JGUA 1VKXA 5D7JC 5DJ8A 3MV7A 4YHLL 5JXEA 4P46B 2Z0BA 5JW4R 1C16A 1TIUA 1RK1B 5C9JB 2YPLA 3FB8A 3UJIH 1ZE3C 5C8JB 5FCUL 4HSQA 4OCXH 1NAKL 2V5MA 2YD5A 4OCWH 4Z0XB 4MAYB 2AK4B 4NQEB 5GGUA 4Y4FB 4WO4B 2CLRA 1BIIA 4G9FE 1AY1L 2FWOB 3J7HA 1DBKL 1GZPB 4DFHA 4M6NH 5LCVH 4S11A 2A77L 2DD8H 1PKOA 5F72S 4P2YA 1B0RA 1P2CB 4LVHC 2RFXA 5CP7A 1BFOB 4JQVC 1FBIH 1QRNA 4NCDA 4HBCH 1F3RB 2NY4D 4D9RD 2PO6A 4U6TA 4YUEH 5MEOB 2YZ8A 3F7VA 3WE6B 1V05A 1C5BL 5AD0A 4R26H 5HHOD 4Q6IC 5FB8A 5E4EB 2OXGA 3NIGE 5E2UH 2CSPA 2V2TB 2I24N 1VGKA 2VISB 3AXLB 2X4PA 2Q8BH 4MJ6B 4XBPB 4K94C 1FE8L 5HYJE 3TIEB 2YOCA 5JOPE 4RRPG 5CGYD 4HDIA 1A2YA 3H9HA 1QFWI 4QRSB 2XQBL 1QFWH 4TSAH 2H6PB 3WS3A 3EYOA 1YEHH 1CK0H 3O4OC 3V8CA 3MRIA 5D2NB 4KXZH 3HAEG 3TT1H 3O8XD 4PTUA 2NX5A 3HE7C 4NWTL 1KXTB 4Y5VC 1R0AL 1XR8B 4OLZL 2WM0A 3GSQB 2HJLA 1I8IB 1Q0XH 2X40A 2P24B 4U3CA 1SYSA 2P5ED 3KPOA 2OR9H 4UV4H 2Z4QB 2XYCA 1DBAL 2MHAA 5K9JH 2GJ6E 4Y1AD 5JUEL 2APXA 4WDIA 4B50A 1IEHA 1H8NA 4Y88A 35C8L 4X6DE 1MNUH 1I8LC 1UXSA 2WIMA 1UGNA 4MJID 1P84J 3CFBB 3VXPA 4PRAB 2AJXL 2OZ4L 4P57A 1HKFA 1CLOH 1GH7A 4I9WE 4N5UA 2ZWLT 1QLRB 4DKFL 1FN4B 4DN4L 1UWEL 4FQ2L 5KS9B 4JPWL 1TQBB 2BSSB 3WDIA 4I0PB 3O11A 2MTPA 2VLRB 1V3LA 2JCCE 3VWJC 4RGND 4JHWH 5ID1A 4KDWA 4YIQA 4P9HH 3FL7A 5DO2D 3IF1A 2OR8A 4NQDB 4YPGB 4WHDA 5IM7B 1F3DJ 2OTUB 1YC8A 3GHBL 3BP7B 4XCCL 3EYQC 3SDXB 2WWKO 5E2WL 3TBYB 3QWRD 4ZUWB 4YHZH 1HKLL 1PFCA 2ADIA 2UZYB 4RFNC 2H1PH 1MI5E 3QHFH 1R3LB 5IFJB 4G8GA 1ZHLA 3CVHH 1EV2E 3MLRH 2DWDA 3MV9D 2HMID 5IHLB 1AGEB 2AVGA 3T0EE 4G3YH 4HJJH 5CLTA 2AV1B 1QVOB 3M1BB 3FOMB 4HULB 1MRCL 2CLZB 3QG6A 5E6IA 4PJBF 3VXQA 2OX5A 3RAJL 3EGSA 3PWPA 1RU9L 5HHXL 5C0JB 4F9PA 4Z7VE 1GOFA 4YQXL 1N5YH 3HUJE 2D7TL 4RFOL 1HSBA 3GBML 5DHVA 2LABA 2VDOL 3WJJA 5GRYA 3TA3D 2P45B 3BSZH 4U7KA 1BZ9B 5DC9B 1L0YA 1QP1A 1RJLB 5L2JB 5IK3A 3VI4E 5I66A 4LKXA 1OOAA 4LVOB 4WUUE 4YXHH 3E6HB 3KYAA 5IQ7H 3BP6B 1BLNA 1A6AA 4GXUM 2CKBB 5DQDL 1ADQL 4GQ9L 2XRAL 4NRZB 3TLRA 1OPGL 1SVZA 1Z3GH 2HJFA 2IH1A 1DL7H 3PE9A 5IMKA 4LSRH 2CDEB 4OJFL 1FGVH 3GRWL 1MQKL 3L3KB 2PYFA 1IILE 3HS0A 4ONFL 5H94B 3BAEH 3KYKL 1CFVH 4Q2ZB 3KPLB 3CLEH 1MJ7L 1Q9LB 1J7VR 4O2CB 1HXMA 1JP5A 1FGNL 5IB4A 3MRGB 3L9RB 1Y0LA 4MA1B 4YDIH 3MXWH 2KQMA 4RZCA 4N0UA 2WV3A 1B90A 2N56A 4PGBA 4RGNC 4LSUH 4WFEE 1KT2A 1KYOK 2Q76A 2A6JB 4TVPH 5F96L 4UILH 4LSQH 1EMTH 1HI6B 1JWSA 2GQHA 4I2XE 2A73A 5I1AA 2CRIA 4X98A 5HVGB 5KSUB 1LP9A 4Q9RH 4FQCL 3S34H 2AJVL 3IDJB 4M8QB 1BVLA 3W9EB 5IJVB 3IDGB 4IIQA 2PXYB 2LQRA 3N06B 5EN2A 4OF8A 1M7DB 4F58H 4JFPB 4DN3H 1XEDA 5T3ZE 2W92A 3NH7L 1AO7E 4TQEH 5EU4B 4LP4A 3G9AB 4L1HA 5C1MB 5I76B 5IR1B 5E8PB 3WEXA 4PRID 4QYOB 1NBQA 5C0CA 1XCQA 1IQDB 1SJXA 4YXLL 3PWJA 4OGZA 1CDCA 1RIHH 2QBWA 4K7PY 1ZLUH 3R8QA 1NL0H 4NHCL 3L95A 5DT1H 3V8OA 3DBXB 1JZ6A 2NPLX 2P8LB 5JA9A 4ONHA 1LDPL 5C92A 2VXSL 1XT5A 2FSEB 1CE6B 2WBKA 3T0DA 3SDDB 3TA3C 4S1SH 4JVUA 1XGTA 3PHOB 4PP2A 4XVJL 4JRYA 3CVHB 1CU4L 5KBNC 4KWUA 3ROOB 3QZWG 5JO5A 1NUFA 1U6AH 3UZQA 1EFXB 1X5GA 3B9KC 1P84K 2HN7B 2O5YL 2QADB 3O3UN 1DBJL 5D7LE 4PJHE 3DWTA 2VB5A 1KIQA 4QXUH 4PGEB 5HDLA 3PUCA 4J8RB 4X0KA 5CMAB 1MRFL 4MGXA 4ODXB 3D9AL 3UTSA 2XWBA 4XMPL 4Y4HB 4GKSA 2X4TB 3N1PC 3RPKA 1UQSB 3WFCH 1Q1JH 4N0FB 3LKQB 3GMLB 3HR6A 1DDHB 2FX7L 3TNMB 1CFNA 5B39B 4PGDB 4F7EB 3STZA 1VENA 2UZIH 2ZG2A 2NY2D 4NDMA 5DR5L 3QDHA 4P23B 3H3PL 3DV6B 2BK8A 1UM5L 1A6ZB 4KKNA 3ARED 4PJDE 1S7VA 3Q5YA 3JTTB 2DKSA 2W60A 2E3VA 4M7JL 3X11A 5DJCA 1H9VA 1FO0H 2RBLA 1J1XH 3BN3B 1KN2H 3RUGE 1MH5A 25C8H 3P40A 4WI7A 3IFNL 3TYFB 1A9BA 3IETB 2DBJA 1N64L 2X89D 3OG6B 1JWMA 2H26A 1RZGB 4PJ8A 3LH2L 4HWBH 1FQ9C 3ZSTA 4KHTH 1MUJB 5I2IA 2IFFH 5DI8A 3HG1E 2CD0A 4XNQA 3BP5B 5ETUA 2I60H 2W9LA 3MFFA 2R4SL 1FV1B 4ORGB 3CVIH 1UZ6E 3FQTB 3WKMH 4YGVA 5HY9B 2FECL 4PB9L 4M48L 5ISZB 3D39E 4J2XA 1RHFA 3ARDD 3OXRA 1YEJL 1MCBA 2VSDA 1IAKA 3D18B 4JY6B 5F7LB 1J0IA 5FV2A 3WLWD 2NZ9C 3IJSA 4TUJB 4H20L 5SWSA 4GAYA 2BSRA 1FZKA 5DGRA 5EIIB 3WD5H 1W72H 1ZLSL 1G9NH 4PRDA 4GMSL 1WV7T 3K2UL 5C0BB 3FTGB 1RURH 4ZAKA 2DLEA 2YBRA 5FYLD 2XN9E 3IYLW 2WQRA 5EU3A 4XWGH 4UNUA 4UV7L 3VCLB 5BW7C 3D85D 2F5AH 2BRRL 4JY4A 4L3EE 3LB6D 1KELL 1JJUA 2V2WB 4OFKA 5D9SA 1WK0A 1QFWM 3VE0B 3NTCL 5DXWA 4OFYD 3P4MB 3L3OB 1D9KB 2E27H 5CEZH 1JHLH 1E6JL 1VADB 4E5XB 3IKCA 2EEDA 4XPHL 5GGSA 1T5XA 5IESL 4FQXB 3MBEB 2J8UF 2NY2C 4M6AA 3PDOA 5E9DA 3TPKA 2BC4A 5FGBA 1EJOH 1F11A 1RJZA 3AMKA 4JDVA 1FRGH 3K8KA 4QRUB 3S37L 1GC1H 2HG5A 3RTQB 1H8SA 1ZWIB 3TGXA 2OL3L 1VGEH 3LKPB 3I6GB 3RJQB 3W0WE 4ZFFB 3FRUB 1TJIH 4V1DA 1GIGL 5F6HI 3D0LB 1MHHA 4H1LG 3ZKNC 5IB5B 5F70A 1NFDF 1KENL 2BNQD 3SE4C 1MFDL 3TNNA 3WFEH 5L7XH 3T65B 4M00A 4JO2H 3O2DL 3MRQB 3LKNA 3CFKB 3VXRE 4NO0A 5IHBA 4KQ4H 2FL5A 5IF0B 2C9AA 4CU8A 5DURB 1ES0B 5KVDH 3N85L 3KLAB 3PGFL 3FHAA 5D6DC 2BNRE 2CUIA 4RNRA 4HS6B 3SKJL 3FRPA 1UXWB 5JDSB 4MNHB 1JN6B 4DW2H 3SKMA 1P4BH 5C0GB 1IM9D 1QFHA 4CDHA 1CBVL 3ARDC 4OT1L 2AJZB 5D1ZA 3DO7B 4JJ5A 4ZYKA 1C08A 1DVFD 1I7UB 3TBTA 2NMSA 2VAJA 3N1QC 4LF3B 2H8PB 4PLKD 1EBAA 2A6KB 2FRGP 1D6VL 3FO1B 5HHMD 4XX1E 4NT6B 2GUOB 4WWKA 3JWOC 1XGYH 1TZHB 2AXHA 5F44A 2XTJD 3N9GL 3INUH 5HYSG 4Q9QL 3VMNA 4EUPB 5LBSH 4Z95H 1FNEA 3S5LB 1ACYH 3RWHB 4MJ2A 1VFMA 1BHGA 3QH3B 5EZOL 4QHNB 3REWB 3EYSL 3TZVD 1RUPH 5KSVB 1K4CA 4QRPD 3NA4A 1DUYB 3LB6C 1QD0A 5E5MA 4U0RC 4X7CC 5IMOA 2X2YA 4O9HL 4KMLB 3BUTA 3QPXH 4WV1C 3MLUH 4LMQE 4U05A 2X1XR 1YMMA 4FFZH 4IRJA 3ARZA 3EO1B 4I8DA 5HYFA 2JJTC 1FNLA 3HR5B 1IM3A 1P7KA 4G6KL 2R1XA 4OFPA 1XF4A 1U3HB 4B5EA 5IWLC 1B3JA 3ARFB 2O61A 3DHJA 5IIEA 3S96A 5LQBL 3O4LD 4HWEH 1DE4B 3BE1L 3VI3E 1IAIL 4ZFZB 1UJ3A 4N0CD 5GSRB 3ALWA 2R2CA 43CAB 4L4VA 4P5TA 4LARH 5D2NE 4G6AD 2R15A 2VWEC 5ACMA 5J9PA 3MJ7A 1IT9L 3P9LA 2NR6D 2IPKB 2ZCLH 4D0CA 4XNMB 4G8EA 2JJWA 4WI4A 4KTEH 4QHKJ 1QPPA 4D9QE 1LE5B 4ODVH 4UUJA 1OAUH 4IDLA 4FRWA 4OF7A 3UZEA 2IJ0C 5JXAL 4HS3A 1RZIA 2YD7A 3NIGF 3M17A 2FEDD 4X80H 2AGJH 4NKQB 1CGSH 3RVTD 3UBXA 3LN9A 3HPLB 4EN3B 1UCTA 3RA7L 5HGHB 1G0DA 2R1YB 2LFGA 1ZS8B 3P2TA 3Q6GL 3FQWA 1VPOL 2ICEA 1CLYH 1MOEA 1MHPH 1V5JA 2IMMA 1HEZB 3UJJL 1DVFC 1LO5A 1SJEB 3SCMB 1A1NA 1S7XB 2F19H 2HT4C 3S35H 1X5YA 1K9TA 1T83C 3QI9D 5L8KB 1PLGH 4K3EL 5CKAA 1T66D 2XTJC 5T5NG 4ZUSB 1TVBB 4IJ3C 3MV8D 1I9JH 4ODUB 5D7JA 5KG9B 1HOCA 3ULVH 3C5SB 3ARWA 3VWKC 1M7XA 1AD9A 4CVXA 5F7FA 3L5HA 3NABL 3TZVC 1U8OA 1QSED 2CMRL 5IJKA 4XPTL 1NJ9B 2Y36H 1P4LB 1YPZB 4Y4KC 4YE4L 4F8TA 1INQB 2XKSA 2DQGL 1JZ7A 3EO0A 4OB5H 2R0LL 4JG1H 3SO5A 3GJFH 4WW1A 3IVKA 5GRXG 5IW3A 5ID0A 3VG9B 1SYVA 3SDXE 3DMMB 4KRLB 4X6DF 1A6WL 3C9NB 3MLXH 4FZ8H 3Q3GA 3D48R 5C2BH 3VRJA 4F7CA 5C08B 1BQHG 5I19L 4OGYL 4KQ3H 3IGAA 1J11A 2ZUVA 2DDQL 4P2QA 3P4OA 5CD3A 1DN2A 3RVUD 4HIIB 2JELL 4F3FA 1NCDL 2PW2B 4LSSH 4EXPX 4P59L 5CJQH 5E0QA 1RZKC 4KY1H 3DX7B 1BGXH 2NR6C 3T77B 2JCCF 2VXVL 5DUPH 4GH7B 2J6EL 2Q7YA 1OGAD 1K85A 1JNLH 1DTUA 3CPLB 4OZFH 4C56E 2FEDC 1UCBH 1BVZA 3UMTA 3CH8A 3OXSB 3C5ZD 1P53A 3RVTC 3RVWD 4UTBL 4DGIH 1YJDC 4PR5B 4NZJA 3O6LL 5CWSA 2OP4L 1YEKH 4N0YL 1UH3A 2DLFL 2EH8L 2XT1B 3HE7A 2GJZA 3MCG1 4Y5VA 2EIEA 1WWAX 2HP4A 5CBEA 2GSIB 2CJUH 3DXAB 4IRZL 4LKCB 4YGAB 2FHFA 3B5TA 1IKFH 2Y5TB 1T66C 4Z7VF 5EB9A 2NY6B 4K9EC 1BJ1H 4AEFA 3HUJF 1A6TB 2H32H 5C09D 3T0EC 5DJXA 4XH2A 4F57H 3KDMB 2GFBB 2IADA 4X6CA 4UI2A 5HVHC 3GSNH 3VI4F 3G5ZB 2O5ZH 1EH9A 2VQ1A 3RVXD 1I8LA 2VL5A 3I50H 4B41A 2YPVH 4JY5L 1N5AB 5BO1L 4MD4B 4NN5C 4OF6A 4G43B 1J8HD 1RI8A 3VXOA 1J0JA 3RKDD 4B0MM 4XCNB 5C6WH 1HHGA 5E8DH 4UOW1 2WUCH 1YNTA 2EO1A 5AZ2L 3VWJA 3TN0B 4HS8H 2OLDA 4MD5A 1SMAA 1SEBA 3GMQA 4X6EB 1RPQA 4FQIH 1DBML 3UEZA 4ZFOB 2OL3B 3EJZD 4G6JL 4UTAH 1QKZH 4NN6B 5I1JL 3MGTB 4W81A 5JNYA 1I85C 3BYYA 4ZTPL 4HF5H 1MAML 4N8VB 5CBAA 5ANMB 5JIHA 1IBGL 1NCBH 4M5YL 3C5ZC 1MLCB 3QNZA 1JZ2A 3JWDH 1OP3H 1JZ3A 1IEBA 4M4RA 2DLIA 5F9WB 4RDQG 2C1OA 4ZD3L 4KC3B 3KYNA 1ZT1B 4PJ9B 1R24B 5F1KC 4DAGH 5TQ0H 5JHLL 5B8CB 4BQBA 3VDBA 1T22B 3SEPA 3C6SB 1H5BC 1G7MA 1GGIH 2X05A 3UTTA 1KTKE 3MO1A 3HTLX 4OZFB 1KB5A 5HHPB 4NO5A 1U95B 4KROB 4PJBA 2ICES 2UY7A 4NM4L 4K3JL 1ORSA 2CIKA 3PV7A 5JW4Q 3TT3L 4HC1H 1OTTD 3CSPA 1W0WA 4PRHD 4DOHE 4IOIA 2PYEB 1JYNA 3LKRA 3N1MC 1UADC 2BSTA 4NKOA 1I75A 5HDQL 4JFHD 3EOBB 5EZIL 2NY3D 4HZLB 1OP5H 4EVNB 3D2UD 3UPRA 4QRRB 2PUQT 4XHQA 4QT5B 4P4KD 2AEWA 4WWID 2VITB 4KK6C 1FNGB 4OUUA 5HD8D 2VDQL 1P1ZB 3MYJB 2DF3A 4PJHF 1RZFL 5FK9A 8FABB 4JZNA 3DVFA 4P2RA 5IVXB 2H32B 2XNAA 1PKQA 3CSBA 2MNUA 2BY2A 5SX5K 1UWGL 3FT3B 3RWFB 4Z7UB 1JF1A 4JFDB 1DANT 5IHUL 2AEQH 3GSNB 1KCUH 3FKUS 4IRSA 3ARBD 4EOWH 1U8IA 3RL1B 3NZ8A 3E1F1 1EAJA 4HUUA 4J3TA 3GIZH 4PJDF 3EJZC 2YRZA 5ISZE 2Z35A 2DIBA 3CFDB 1JHKH 5BXFA 1QBMH 2CKNA 3OX8B 4K8RD 1LK3H 2DQCL 5EIQA 5JHDD 2ZNWA 1I9RL 1FCGA 5K33A 3QFJB 1F8TH 5ERWB 2IH3A 3RUGF 4LPXA 3D69A 5I9QB 5I8EA 1D5MA 4GQPH 4B7IA 1K2DA 2D9QB 4RISH 1OTSD 1KCRH 5E8EA 1TCRA 5BVPL 4ETYA 5EU6B 4XPBL 5C0BE 4KZDH 1H15A 4O02L 3PWVA 2R4RH 3KPMB 4OV6F 4O4YL 3NAAH 2PR4L 4PIRF 1UZ6F 3DUUB 3QDGA 2DM4A 3G5YB 5D70H 4JFYA 1BBJA 5KVGH 4U1NA 3DUSB 4MD0B 1M05A 1Z0NA 3MRFB 4MLIA 3REVA 2IMNA 3H9SD 3VH8A 4MA8H 3FAXA 1AR1D 4PJEB 5I73B 3OPZL 3MX0A 1YN6A 4MX7B 3KJ6H 4LVNB 5GXBB 4NZUH 3B9KA 5T3XL 3WUWG 3U30C 1U8LB 3D3VB 3P73B 4WTZG 1TZIB 3TO4C 1F4WH 2XG5A 2EYTA 3O9WC 1AXTL 5HD8C 4LCCC 1X4ZA 3GJEB 4NKMA 1J05A 1S7QB 4HFUL 4YBLB 1IC4H 5DJ2A 4F7MB 2VLJD 4JGMA 3DYOA 4PV9A 1PX4A 1I9EA 1JV5A 2ICWA 1OQXA 1YEEH 1KJVB 3WFHB 1NFIB 5FA4B 3I6LD 3UROR 3P11H 3RKPA 4Y5XB 2A6IB 3GSWA 3LAFA 5KZCB 4A6YH 4KKLD 1AGCB 3FT4A 3OF6A 3U82B 2BVQA 2VTFA 2W07A 3ARBC 3OJDA 1OF2B 1Y6MR 3FCTB 4WUKH 3U9UB 1MAKA 4J12A 5LXGH 3SDAC 4Z7WB 3BRGC 3MODL 3DO3A 4K8RC 4LHUG 2H2PC 4P2CG 5K9QI 5DVKA 3AS2A 2Z31C 2HRPL 3K0WA 1O7VA 1U8KB 1NANI 3QIBC 1S7WA 5CGTA 1BD2A 1AP2B 4GLRI 5I1GH 4U7MA 5HPMA 2JJUA 3BHBA 4P3DA 2EKSB 4DWHA 3NFNB 3OR7A 3K4ZA 2JIXB 5DRNA 3C60B 2R1WA 1CT8A 1A4JB 1IGTB 4E41B 4N9OB 5I1KH 3QO1A 3SE3C 4NYLA 2B5IC 5E7BA 4IDJH 1M1SA 3QIUD 1A1MA 1DQDH 1CXKA 3KJ4B 1NFKA 1PSKH 4JHZA 3IXTA 1EVUA 3V0VB 1JFQL 4JM2B 4CDGC 5AWNH 3CC5A 5A16B 3FO9A 5J3HC 4R0LB 4NRXA 3AB0B 2C3HA 4UAOB 2B39A 3T0AA 1FVDB 1NBZB 3IAPA 4IOFD 1F13A 4M43L 4KRPC 1VKXB 4O2EB 3MV7B 1KEGH 3QULA 2BVYA 4TOYH 1PG7W 3VFUA 1L7IH 3MRHA 5BW7A 3CZFB 1C16B 1KC5L 3TCLA 2YPLB 5BVJA 3X3GH 1NC4A 4YC2B 3QUYD 1UACH 2XWTA 1BF2A 2IGFH 2P8PB 4JLRA 4P2OA 4PUBH 4KDVA 2FB4H 2YKLL 4XPGH 3CDFA 4OLWL 5CEZE 2ZUXA 5GGUB 4OBRA 5GGVH 4MJ5B 3K3QA 1JGLL 2CLRB 5DJAB 3MNVA 4BH8A 5D2LA 2SEBB 2P7TB 1MVUA 1Q0YH 3A6BH 4JFFE 1AFVL 5SWZA 1EDQA 3ZTNH 4KKLC 1VACA 3SE8H 3MRMB 1GHFL 2MQ0A 2RFXB 2GAZB 2L0DA 5CP7B 4MNQA 1UWXH 3S3SA 3H3KA 4U1MA 2J8UA 4N0RA 3GSUB 5GZOC 3F7VB 4PRPD 1A8JH 3O6KL 4EIGB 4HX1A 2AK1L 3PHQA 5AD0B 5D72H 5FB8B 5CEYB 3VI3F 2NLJA 5E4EC 4BSJA 2W9DL 1VGKB 5ESQA 2VO5A 3LS5H 4XAWL 2X4PB 5E1AA 3QUZB 4AEIH 1YNLL 4V2CB 2AAVA 3HC3L 5D6DA 1T0MA 1CR9L 2E8ZA 1KBGL 4TNVK 3H9HB 4YDJA 1Z0MA 1NC2B 5I75B 1S5HA 4RAUA 5DDHA 3EYOB 3MRIB 4WFGD 4GXUN 4JZJC 4PTUB 5E8OA 4OTXL 3QA3A 1T7YA 3ARGA 2XWJA 4WFHE 5DEGA 4WW2B 3NCMA 5LAXB 3TP4A 1GL4B 3Q2CA 5GISH 1R5VB 2HJLB 2EDTA 4X9HA 5E6YA 1HZHL 1SYSB 5FEBA 2H3NA 1Z9MA 4YHNA 5M7QA 3KPOB 4PJAA 1XH3A 3QEHB 3HI1A 1A3LH 3L3DA 3FFCB 5GS0L 4CAGA 5C08E 3D85A 2MHAB 1FNAA 4OZGE 1OY3B 3QEGL 4RIRA 4LLUA 4WDIB 3SGEH 3WN5C 3VFTA 3QUYC 4WY7L 4OFYA 1KUMA 1A22B 3KR3H 2LAAA 5IHZB 3BZEB 4XC3H 3SQOL 1BFSA 2XZCL 3Q1SH 2DLHA 4F15C 5J0BA 1G9MC 3JV4B 2YMXL 4S1RL 2JJTA 1NSNL 2XQYG 3UTPD 5FO7A 1ZVYA 5IWLA 1CTNA 2AXFA 3WIIL 3IFOA 5FYJD 1JPGB 4JRXD 4QHMB 1XF3A 3GMOA 3C6LB 3SDXF 5JMOC 3FQNA 2CXKA 1RUKH 1UB6B 4YIQB 2G5BB 5TE6L 4PV8A 5LVEA 4E42B 4L4TD 3FONA 3ULUH 2VQTA 5GS1B 4XXDA 4L8DB 4LLQA 1BPVA 4G9FA 3VXTA 4Z76A 1N8ZA 3DXAE 4RAHA 2ADIB 3EHBD 2OJZL 2Y25A 4G8GB 1ZHLB 2J5LC 1J9CT 1U92A 2DWDB 3QCUL 2MKWA 4ODWB 2C3VA 4NKDA 1X5KA 3PG2A 3X3FL 4IMKA 2BMKA 5KVEL 3ARXA 3E2HB 5F7EL 5EA0L 2WLZA 5E6IB 3VXQB 1DVFA 5MERA 1N4XH 2VQUA 2E6QA 3EGSB 3PWPB 2CK0L 4P4RB 3RX7A 1AKJD 4RWHA 3BKMH 1QYGL 1C1EH 1JRHL 2F74B 2GK0A 3B5HA 3SKUD 2C4FU 5JTWA 2Q7NA 2DAVA 4XZUA 5DEFA 1HSBB 3RGVD 3LN4A 3WL9B 3OSKA 1LO0L 1E6OL 5I1CH 1YY8A 2GI7A 1RZJH 4RMRA 4S1QL 2FATH 2X9YA 5I66B 1JMXA 3VWKA 3STLA 4JPKL 4JDZA 3ULVE 1KULA 4WCYH 1A6AB 3MRLA 3V0WH 2QSVA 3IKKA 5L88L 4DVRH 4KRNA 3MREA 1CXLA 4Y4KA 2HJFB 2IH1B 2ZPKL 2Q1EA 1ZTXL 1OAXH 2ZCKL 4JQIH 4FHBD 5T1LA 2GTZA 1KIPA 3DLQR 4AIZB 4UDTB 3HS0B 4X7TA 5KSAD 3TV3H 3LPGA 4QHUA 5DFVD 2KZ1B 5A2KH 3B5GA 1D5IL 3T2NH 3SDCA 1L0XA 2YZ1A 1AE6H 1RD6A 4TSCL 3H0TA 5IB4B 4S10A 2GJ6A 2LU4A 4M6MH 1MCNA 3BOVA 5JDJA 1NGYA 3GSOB 3MCLH 3LS4H 5EPMA 4CN4A 2PTTA 1KT2B 4X6DA 2Q76B 4O58H 4QF1A 5CHNB 3WFZA 1IARB 4LAQH 4CNIB 2A73B 1EO5A 3QWOB 3ULSB 4U1KA 4BUGA 4OKDA 3AAZA 4ZNEE 4DEPB 2P1YA 5B3NA 5C0NC 1T1ZB 3ALPA 3BZ4A 4IIQB 1VEPA 5BQ7A 3T2OA 2E7HA 2JCCA 5L6YL 1J0KA 1XCQB 3LQZA 3HMXA 4TVPD 5DD1L 3PL6D 3PWJB 5BS0D 1WC7A 1HNFA 1S9XA 3L95B 2NW2A 4O5LH 2BJML 4QRRE 1I1YA 2Z8VC 3L3HA 1PGRB 1BFVH 1P5VA 1F90L 4BFIA 4ONHB 4MAUH 4M7ZB 1I3GL 1MI5A 2ZOLA 1T3FB 1UA6H 4PP2B 2KDGA 1INDH 3T0EA 3QIWA 1I7RA 1PEWA 3QNXB 3JTSA 1EO8L 2COQA 1I7ZA 1NCUA 3F8UB 3HAEA 3MRJA 4MHHG 1OAQH 4Z7UE 4CMMA 3JWNC 2BOCA 4W6YB 4Z7VA 1RUML 1WIUA 3HUJA 1HE7A 1JHTA 2ENSA 2XWBB 5TE4L 1CICD 3JV6A 4GKSB 4G42A 1TVHA 4FQJH 3VXNA 5KSAC 2DQUL 3F6IA 1T5WB 2VDRH 1S78D 1ONQA 3ILPA 5TF0A 1JYXA 3SQBA 3STZB 1PG7X 4WUUA 3QFJE 4K71C 5E03A 2I07A 5IW1A 5F7NC 1S7VB 3HRZA 3MUGA 1FZJA 5AUMB 1T1YA 4MA3A 2W60B 4OF0A 1TTFA 5EU6E 1WBXB 5DJCB 2GTWA 1PX3A 2Z92A 3S4SA 1ZT7A 1ZANL 4I5BA 2C26A 1LO4L 1MH5B 4K94L 3WFDL 1HHHA 4XCCH 1I85A 1S7SB 3MRDA 3TBWA 5E94A 3O3AA 5LG1A 1T7XA 1JWMB 4PY8I 1QR1A 4MVBD 3OB0H 4FZEL 5DMIL 5I2IB 5DI8B 3HPJA 3KPNA 4XP9H 1QSFD 3V7AE 5ETUB 2FJFA 4XWOC 3QUXC 3MFFB 3L6FA 4WI5A 1OSZA 1U3YA 4YGVB 4NRYA 1INEH 2EO9A 2ICWJ 4XPAL 3I3DA 1H5BA 2AI0H 1IAKB 5DVNA 4WI6A 1EJ6A 3GSVA 5JZ7C 4J23A 3IJSB 6CGTA 5SWSB 2BSRB 1FZKB 1T1XB 1AO7A 1UH4A 4P3CH 4EI5B 3K74B 4ZAKB 5BRZD 5M95B 2KL6A 1OPGH 5D7SL 5I1IH 5E2TH 4R3SA 4JY4B 3DGGA 2D0GA 3QG7H 4Y19D 5IBLD 4ZXBA 4XVTL 4XAKD 4EBQH 1EHAA 1FVCA 4Z7WE 1RHHA 1K3IA 3IKCB 5GGSB 5CP3A 3NCJH 2N7AA 1T5XB 1QO3A 1YUHB 4PREA 1MJ7H 2EDWA 4RCAA 3PDOB 1F97A 4OM1L 5DSCA 4XGZA 5TF1L 1F11B 1RJZB 5D7LA 1BAFL 1P9MC 1SJHA 4KPHL 4RGOL 4P49A 1E4XH 3DJ9A 5FOJA 1J18A 4LEXH 4E41E 1MHHB 3TM6A 4I3SH 1KJ2H 3TNNB 3BN9D 3LKNB 4FQCH 3RX5A 4ZFGH 4OZIB 5K9QG 2FL5B 4OCYH 5D1QC 3GSRA 2X4OA 5CINH 3NMEA 1I1FB 3U1SL 5DD6A 1F58L 1TETH 4RNRB 4F33B 5BOPA 4MA7L 4KVNL 1S9VB 2JB6A 3TWCL 4OGXH 1UFUA 2BP3A 1OLLA 2YA2A 3GB7A 4BQ6A 5TE7L 2FNBA 3RUGA 3GMPA 1F42A 2Y06H 5D1ZB 3QDMD 5CGMA 4AYFA 1VFUA 4HUWA 3TBTB 1KGCE 3GO1L 3EFFA 5LGJA 1KB5L 2APFA 2VXSH 4BFBD 4N8PA 2HVJB 3NA9L 1CFQB 4WWKB 3HG1A 2XA3A 1P4IH 1WUNT 1MFEL 3MLWH 1A6VL 1M71A 4Z7QE 3MOAH 1NDGB 4WEBL 3C8HA 4BJLA 3RDTD 3BGMA 4IS6A 3CX5K 1TJHL 4NZTH 5B38A 1K8DA 4LIQL 3TBSA 4KZEH 1I3UA 2OR7A 3TO4A 3C2AL 3MNWB 1K4CB 3IDIB 2WZPD 2DQDH 4OZHA 3O9WA 4LCCA 3MZTA 3GKZA 3DI2B 5I0ZA 4RX4D 3K81A 3TFKD 1YMMB 4IRJB 3GI9L 2DM2A 3FB5A 5C3LD 3B2UD 2R1XB 1G9NC 1XF4B 5JPNB 5BMFH 1RIUH 2F53E 3CNKA 2XN9A 3QUMA 4KKBC 3OJ2C 4L3EA 4NQCB 3DUHA 2OQJB 1SEQH 4XPFH 3QEQD 2X4RA 5EFIB 2VC2L 4L4VB 4P5TB 5MP6H 3SDAA 3O6ML 2IQ9H 4HPYH 4HXBH 4G6FD 4JE4B 5EBLB 5J9PB 2CUMA 3B8YA 3P9LB 4HLZH 2B1HL 4D0CB 4G8EB 5J12B 3BN9C 2Z31A 4GBXB 1TZGH 3QIBA 4UUJB 5AZEL 3BPLC 1XGPA 4ZTOH 2WBJC 5B3JE 3BIKB 4QOKD 4HS3B 4GMTL 1A6UH 1RZIB 5DMJB 4M8VA 5TJWK 3U0WL 1OCWH 4ZOAA 5LGHL 3TVMA 4AEEA 4GRLD 5CFHA 3W0WA 2DJUA 2ESVD 3ZKMC 1MFBH 1FIEA 1GC1C 4GAFB 2IPUK 4OI9A 2NXZB 3UTQB 3FFCE 4TUKH 5DQJA 1RMFL 2HT2D 3SE3A 1W2KT 3T4AA 5AYUL 3VXRA 5ILTL 3QCVL 3PV6A 1OM3L 1YEFH 4PJ5D 1S7RB 5I71C 1AQKH 1ZEAH 3THML 5J11C 5I6XB 4ZUVA 1FSKB 5DF0A 3RDTC 1IGIH 2UWEB 1MJUH 4QO1A 1DP0A 3ILQC 2IAMD 5D7JB 3D0VA 1HOCB 1U8NA 1WT5C 4EKXA 4C83A 1AD9B 1V7MH 4P46A 2P5WD 2YD1A 3HMWH 3CZJA 1RK1A 4POZD 4MSWA 5AAMA 3F12A 5GIRB 4K7PH 4HK0A 2YK1L 3C87A 4ALAL 4Z0XA 4MAYA 3R4DA 4OZGF 1X7QA 3WUZA 4Y4FA 4WW1B 1D3CA 1WISA 4WO4A 5ID0B 4CGTA 3KLSA 1SYVB 2OM5A 5KSBB 3B2UC 2FWOA 2D0HA 3MV01 3V4UL 3V5DA 1IRAY 3NFPA 1P7QA 2D03H 4I13B 1LO2L 2W9EH 1I9IH 2F5BL 3W9DA 1BVKB 4F7CB 4DUWA 3LEYH 3MOBL 1PEZA 4G8GE 4LVHB 3IGAB 4P2QB 5CD3B 5IG7A 4NJ9H 1ZT4A 2ZSVA 3PWNA 4HAFA 2VLKD 1I3RA 4MNGA 4Q6IB 3VFSA 5IBUB 3EFDH 3GZKA 4WI8A 3PWPE 4ZO9A 4MLSA 4K3DL 2F8XC 3OBAA 4OIAA 3NVQA 2VISA 1F3JA 4U6VL 3AXLA 1OWRM 1F5WA 1LE9A 1S7UB 4MJ6A 4XBPA 1U36A 1R3KA 3H42L 4L5FL 3RWGB 3VD5A 3O4OB 5MI0C 5D2NA 5I18L 1JMZA 1KJ3H 4R8WL 4H1LA 3KWWA 4YFLI 5D7KE 1QACA 3HE7B 4Y5VB 1CS6A 1Z5LA 3T1WA 2EC9T 2VKXA 2Y5EA 3B3IB 3DSFH 2DQEL 4TYUA 3GSQA 3BH9B 2EDDA 3AUVA 4PBWD 5BJTB 1MREH 5DD0L 1U58A 5CILL 3HC4H 3CX2A 1ZGLP 2IAMC 3WJLC 5DZOA 4YDKL 5DJXB 4XH2B 3MLVH 4X6CB 1AGDB 2LAGB 3CMOL 4JM4H 2ZUSA 2HH0L 4XNXL 4AM0A 3WN5A 1QQDB 1XF5B 3QUYA 3ZLQC 2VQ1B 3ULVF 2VL5B 4U6HA 4TRPH 1NGPH 1YYML 3VFGL 3VFOA 4M5ZH 2F58L 1WEJH 3VXOB 2BFVL 1QLRA 1CGVA 1OT1A 1FN4A 1GAFH 1A64A 1HHGB 1YEGL 3ULVC 5GPRA 1VCAA 4NWUH 4L4JA 1YNTB 3MLZH 1P7HL 4I0PA 1CE1L 3VFMA 3VWJB 1VFAA 1NCAL 4MD5B 4ODTL 5I1HL 1U0QA 1SEBB 3GMQB 4BFEA 1J5OL 3LRGA 5T33H 5L9DL 1FH5L 2X4QB 4RMVA 4R4ND 1EERB 4M7KH 4YPGA 1T03H 3TH3T 4PGZA 5IM7A 3ULUE 3B9EA 2OTUA 1WFUA 3G04A 3SDXA 2H41A 4NUGH 3TBYA 5EO0A 4ZUWA 4RFNB 4NNXB 1EEQA 2DBLH 5JXAH 4X8XA 3E3QC 5M94B 4LNVA 4FQHB 3R0MA 2AV1A 1QVOA 3M1BA 2CLZA 2C1OB 3RWDA 5I15L 3EYVA 3KYNB 1GOHA 3DARA 3ZHDA 4G5ZL 1YQVL 4QKXB 1XGUB 5JIKA 3JWOL 3VW3L 3CSGA 1MIEH 1WCQA 2MCG1 1G7MB 3KLHD 3UTTB 5D6CB 2IANE 4C56A 2MMXA 1IGFH 1KB5B 5ALBH 3FOLA 1FG9C 1W8OA 2IPTL 3NIFE 4M1DH 4TPRH 1RJLA 3V5KB 5FYLL 1CD1B 1FL6A 5GGQL 1PD6A 3E6HA 1U8MA 4I3RH 1W0WB 3BP6A 4DKDC 2CKBA 1IGYB 2BSTB 1ETZA 4NKOB 4NRZA 4PLJD 4Y1AB 2ZUWA 5HYIA 4J4PC 3ZDZE 3UPRB 3WSQL 3CJJA 3FHQA 2CDEA 3UDWA 3BQUD 5IUSA 4MJIB 1S9WA 3C8DA 2HFEB 4GAGL 5KW9H 4BA8A 4JZNB 1HSAB 4P2RB 3QXDB 3OAZK 2ZCHH 2XNAB 2ED9A 2Y07L 1Q9LA 1NCTA 1OVZA 2HWZH 4RWYH 3D39D 2RJMA 4J3SA 4FN0A 4JRXA 1TPXC 3L9RA 1IZJA 4MZ2A 5I19H 1JF1B 4Y8DC 1BMGA 5I1EH 2VLME 4RGNB 2RHEA 4B53A 1MCEA 2F54A 1U8IB 3EYUL 2PKDA 4P59H 4WRLA 3OV6A 4HUUB 1DJSA 1EHNA 3QR2A 4NGHH 3EZJB 3LY6A 2PNDA 1BFTA 3SOBL 1OD7A 5BXFB 4PGJA 4QTIL 4FNLL 3IDJA 3GFUA 2CGRL 3ORJA 3RVVC 3IDGA 4ERSL 5FYKD 2MKLC 2PXYA 3W2DL 1M7DA 3D69B 1BQHA 3E8UH 5I8EB 2FH8A 4UTBH 3CFEA 1A1OB 1K2DB 3VGAC 5J6GA 5E8EB 3JZ7A 3WBDA 1J1PH 1VDGA 2R69H 4X7SL 2ORBH 5I76A 5IR1A 2NY7H 4QYOA 1IQDA 1FAIL 4XC1L 5IFHH 3QDGB 5I74C 2P8LA 4JFYB 1BBJB 4U1NB 3TO2A 3KVQA 3KLHC 3O3DA 3MLTB 2FSEA 1CE6A 3CU1A 3TA3B 3MPCA 5F9AC 4OBSA 1GGBH 5FUZH 3ZKQD 3PHOA 3REVB 3CVHA 3ZYIA 5I16A 1BJMA 2D7MA 1FLRL 3HI6L 4J3XA 1B88A 3BDBA 3JWDC 4GG8B 5DK0A 3B9KB 3BKYH 4KGLA 1EFXA 1QBLH 2YUWA 2HN7A 1EHLL 1LEGA 2I5YH 4KUZL 4XMLH 4PGEA 3NZHL 4J8RA 1L9MA 3O3BA 3NACH 1F6AB 2AJYH 5CMAA 4C58B 5A40E 4ODXA 4XP5L 4GW4A 4Y4HA 3BQUC 1TNMA 2C3WA 2X4TA 2XACC 1V7NH 2BNRD 2AKRB 4N0FA 3RY6A 3LKQA 1J05B 3GMLA 1DDHA 4Z78B 3QPQD 3HB3D 1XIWD 3DGCR 5HI5D 5B39A 4PGDA 4F7EA 4HQQH 1KCKA 2VDKL 3N0PB 4Y7MA 4HAGA 4PV9B 2VLLA 1AHWC 1IFHL 4OZIE 4GXVH 1JV5B 1T2QH 2AABH 3B2VL 4YHIB 2EYSA 5F8QC 2P42B 4Z7WF 3SJVA 5IGXL 1DFBH 1YYLL 5J1AB 3MJ8B 3GSWB 5DC4B 3FT4B 3JTTA 3OZ9L 2BVQB 4LAJH 1CCZA 2AK4D 4NQED 4JO3H 1UENA 1T0PB 2CLVA 4ODSH 1NMAL 2HT3C 3TYFA 3IETA 1R3IL 5D93C 5L0QC 2ZJSH 1A0QL 4U1GC 1RZGA 2ILLA 1RUQH 1S7WB 2IBZY 5JW4M 1MUJA 1KG0A 5GHWL 4YHKH 1KJMA 1TENA 1YJDL 3HI5L 1OTUD 3BP5A 5HPMB 1IBGH 3QUXA 4LRNL 4ELKA 5C7XL 1FV1A 3QFDB 4HMDA 3FQTA 1GGCH 3OR7B 4PRIB 1H3WM 4YWGH 3VXSD 5DRNB 5HY9A 2J3SA 5ALCL 4HJ0D 1CT8B 4LLAA 4JM2F 5ISZA 2ZNXA 2H45A 3CDGA 3D5OF 3AM8C 3QO1B 4UT6L 3D18A 4JY6A 1CZ8H 5F6IC 4HKXA 4AMKL 3UXFA 2BERA 4K9EL 1MPAH 3WKNA 2D4DA 2R0WL 4TUJA 3DX8B 1MY5A 4NUJA 4GUPB 4PS4L 4LCIL 1YMME 5EIIA 4NRXB 3P0VH 4CN1A 5DFWH 2ADJA 4PJIE 1QLEH 2XPGA 4QHKI 4K3GA 3T0BA 4G8FB 1HN1A 5JMRA 3WXWL 2DQJL 1U2CA 3QQNA 4Z7QF 5HDQH 1CFBA 1PVHA 4FQ1L 3VCLA 3V4VH 1RAMA 1TLKA 3TCLB 4NQCE 5BVJB 3PP4L 4HPOH 3IJYA 4WHYH 3VE0A 4JLRB 1BM3L 3P4MA 1D9KA 3KS0H 4E5XA 3QPQC 3ZZ1A 5I8OL 2NY2B 4FQXA 3T1FA 4BH8B 2QQKL