2ICWI

Crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
110
structure length
110
Chain Sequence
QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGPQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASVHRSDSAVYFCAVSGFASALTFGSGTKVIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal structure of a complete ternary complex of TCR, superantigen and peptide-MHC.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 110
sequence length 110
chains with identical sequence K
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2icwI00
4FQ1L 3CFKA 3ULUE 4IRZH 2EKSB 3JVGA 1HCFX 3MRMA 2VXUH 3B8SA 4JREB 3T2OA 1WEJL 2BHUA 3HNTH 4TRPL 4LSQH 4JRXB 2Q87A 3DUUA 3T65B 4NZDA 3VFNB 1VGEH 2OR8A 3BWAB 1X4YA 2CD0A 3QCTL 4HXBL 4X9FA 4OF7A 1XR9B 1WFUA 2J8OA 3LRGA 4GRWF 4AG4L 3FMGL 3KR3L 4HXAH 3HLAB 2MOVA 2WP3T 3RX8A 5DA0B 4ERSL 4NNPH 2XTJD 3WD5H 1FFQA 3WIHH 1D7FA 3EDDA 3LN5A 1DVFB 3EGSB 1EHNA 5EZLA 1EAPA 4X4MA 3B9KB 4QXGL 3PWJA 1CICD 1DEEA 3ZT7A 1QBLL 1H9VA 3Q5YA 2P42B 4X6BB 5DUMH 1DQJA 1T1YB 2CIKA 5MENA 4ZDHA 3ZL4H 1OB1B 3DX9A 4EUPH 5D7SH 2C3VB 3MRLB 5ISZA 3SGKC 1FH5H 1AO7D 4YZFE 2FJFB 1OGAD 3RIAF 4ETQA 2W65B 4XGZA 3VFRB 3TVMC 4HC1A 4LQFL 1MJ7L 1IQDA 2BVOA 2YD1A 3H3BC 4DOHB 1YNTA 2R0ZL 4KKLC 5L88H 3LKQB 3V5DB 2HFFB 5LCVH 2X4RA 3VFVB 5L0QB 2B39A 1CFVH 1KCSL 3KPLA 1JYNA 4JN2A 2GEEA 4HJJL 1UXWA 4ZXBB 1G9MH 3T08A 1HDMB 2ZCLL 2A6JB 3PQYD 5E99H 4NKMB 2NX5A 4C58B 3ZKND 1VGKB 1HH9A 3VFMB 3C9NA 3VA6A 4XHQA 2Q86B 5GJSH 4P2OB 3SDYL 3R1GH 2EXYD 3SDXE 5B22A 2VZ3A 4LLUA 2ATKB 3DECA 1I1AC 1UCBH 5FCSH 4ZO6A 2F5BL 3WFEL 2ERJB 3F7PC 1PVHA 1JPSH 1LP9A 2DM4A 4FQCH 1DBML 4BUHA 4HW6A 4YHYC 2VDKH 4PJFA 1KT2A 2FX9H 1I7TB 2XFXA 4TVPD 4YGAB 4RGNE 3MA9H 1VFBB 4ZFFB 3K3QA 2B1AL 5ENWB 4OD2B 5E6IC 1IKNA 1HKLH 1ZT7B 1EJ6A 5IUSA 3NTCH 1VESA 3K2UH 3DXAB 2GTWA 4P2RB 4MNGE 1U8NA 3WXVL 3QO0B 3V4UL 3X14B 5DGQA 1BD2B 1F58L 1HSAB 2LE9A 2Z8RA 4F9LA 1DQTA 3TO2B 3MRCA 3VXQB 3E6FA 1TZIB 4OF5A 4XP4H 5FKPA 5KS9A 1EFXA 1P9MC 2LVCA 2DI8A 1OAKH 4YWGL 1QSFE 2VLJD 5TQ0L 4P46D 2EDDA 1S9KC 2QR0B 3PWNB 3WYRA 4RAVA 3BO8B 4FOMA 3NABH 3OKEA 5JMRA 3CVHA 4HF5H 5CFHA 4FP8H 3O6FC 3ZYZA 2P48B 3GMQB 2KZWA 3MQIA 1DLHA 2EC9U 1MSPA 5IVZB 5HVWA 1DBKL 2XA8H 2QEJA 4Z7QF 5IFHH 3GJFH 2PO6C 5JNYA 2V2WA 3HCVA 4WTWA 2EYRB 1A6ZA 4LCIL 5C9JB 5HHQB 3QHZL 1KGCD 2YPVH 1MJUH 1MAML 1DUZB 3EKCA 1L7TH 4NSKB 1FJ1B 2VISB 3NIDF 5CD5D 3VXRD 1PZ5B 3OF6D 1I8LC 4NN6C 3MRFB 2N56A 2CQVA 2OQJA 1U92A 1P4IL 4ODHH 3ROLB 1VFAA 2H1PL 4MXVE 5JW3L 1EEQA 1WWAX 1IAMA 4PR5A 1HHJA 3TBVB 5JOPE 4HWZB 4LDOB 1TQCC 3PGCB 3STZA 3P4LA 3LSOB 1UEYA 2NLJA 4KRMB 4OUUB 4YX2L 1KCUL 4PJGF 4JO2L 1OM3L 3O9WB 2ZSWA 3H9HB 1S7SA 4JVUA 4ZO8A 1J7VR 5GGVL 3T0EC 5D7JC 5ID1A 2W07A 2VNCA 3I50H 2GK2A 5GRJL 2ITDB 4I8DA 4Y1AE 3F12B 3VXME 4BFIB 4EIGB 2YPLA 3ALPA 4K3DH 2YC1B 4FXGA 4GAGH 1FNSL 3QDMB 5ALBH 4C4KT 3G5ZA 3VFGH 5D70H 1G9MC 1S5IH 3ZYOA 5FOBB 4Y89A 2R2HA 4HT1H 3F6IA 4LSPL 4X6CF 2GSGA 4FNLH 1XCTA 5BRZD 1BVKB 5HI3C 4NUGL 3UZQA 4N1EA 3TCLA 1RMFL 4GFTB 5E6IA 3WHE1 4TYUA 4HH8A 2VLMD 3WSQH 4AEIH 5I1EH 1B4RA 2Z35A 5BVPH 3QZWA 2XT1B 4JFEA 3U9UA 4ZOBA 1YYLL 1RIUL 4U1IB 1MFCH 1NL0L 5KZCB 4QO1A 5KSAB 5LWYL 5D7LE 1U8OB 3L3HA 3T04D 4JFOB 4XPBL 3VGBA 5H2BA 3M8OL 1G9NL 3IFNL 5HHOA 2YRZA 2I26N 5ICZB 3WFCL 4GKSA 5FO8A 1UACL 4X9HA 5E8DH 3DJ9A 3E6HB 3KPOA 1UZ8A 1A5FL 4L29B 2BVUA 5DUBA 4MNQD 2IC2A 4DKFL 1CWVA 4G6KL 3SGDH 1TPXB 3PABA 1G7LA 3BXNA 2HFEA 4HAGA 4LLAA 5CP7A 1CXEA 4U6YA 4Q9QL 3O6FA 1RY7B 1X4XA 4QHKI 3OAYH 5I1IL 1EGJL 1F3RB 2X9XA 2OTWB 4LOUC 3RY6C 1NFDF 2OJEB 4OQ1A 2J6EL 1WAAA 4QRTB 1GZPB 3IXTA 3QFJA 4QRPD 3LEVL 4M7JH 5KVMC 1CR9L 3VGGA 4CJ1A 1CL7H 5BO1L 4F57H 3BHBA 3V7AG 4MS8C 1NGZA 4DEPB 4DUXA 1YMHA 4U1NA 5I8KL 5IESL 5DEGB 1FFOB 4PLNC 4JREC 3UPRB 2G60L 3CNKA 2EC8A 1A1NA 1NANH 5L2KD 3O6LH 2HP4A 4AENB 2C26A 3EFDL 4PGDB 4YHOH 2HVJB 3MRQB 1NEUA 3JV6B 2MSPA 4HLJA 4NQDD 5E2UH 1IGYA 3ULVE 4ISVA 2NW2B 4H88H 2QSQA 4EBQL 3MXVH 2AP2A 2XN9A 5I73B 3D87B 1NGQH 2DTMH 1DN2A 3T0EA 1HHGA 5D7JA 1DN0B 1SYSA 3GSNH 3CUPB 4N0FA 5AG8A 4PBWD 1OAYH 3NCCB 1L9NA 3VI3E 5TPWL 1DBAH 4Z7VA 4LLYB 3QI9D 2GJJA 1LE9A 1V5JA 1DVFC 3NH7L 5TE7H 2P8PA 4RGNB 3B9KC 4UU9A 5IF0B 3P0VH 5T1MB 4JM4H 4S2SB 2NNAA 4CADA 5ALCL 5GZOC 3U46A 1YEJL 1HILB 4EOWL 4HH9A 5AD0B 1L0XA 1V05A 1M05B 1AGBA 1A6UH 1Q72H 1OP3H 4QGYA 5B4MC 4MNGB 5I75C 3MROA 4JFDD 2OCFD 1N5AB 3S8WA 1CK0H 4IEFB 1A6TA 5L0QC 3GSRA 1P69B 2VDOH 4KK9C 2VXVL 4JDTH 4QRRE 1G0DA 1NGWB 4ZXBC 5LQBH 1GRWA 3AFLA 4IDLA 4JRYA 3QEQA 4X80L 4R4FH 2FBJL 4GG6F 4M8QB 4GRLB 4KROC 4TSBH 1UVQA 5JDSB 2P47B 1QSFB 4JB9L 1JUFB 3MLVH 1B0GB 4QLRA 5I8OL 1FZKA 1MQKH 3L3JA 4GBXB 4UOJA 4P2OC 1FZJB 2H9GA 3QXUA 3DI3B 5CJOH 1WWCA 1N0LA 5IB2A 4H0GA 1J0ZA 2ERJC 5DMJB 1DANT 3PGDB 3QWRA 1U8LB 5IGXH 1GL4B 3RWIB 5EU6A 2W9EL 4HUUA 5EC1B 4LPVA 3ULUH 1KPVB 4UUJA 1QVOB 4G9FD 2VXSL 3FB8A 4HIXL 5TDOB 5D5ME 5C0BD 4ZPTA 1KTDA 2APWA 2VQTA 1UB6A 3ZMRA 3ABZA 3P9MA 3FB6A 2Y25A 3B43A 1YEIL 1F6LL 3IFOA 4HV8B 2VQ1A 1EERB 3DVIA 4PRBA 5GJTH 4X83A 4PJBE 3TNNA 3CLFH 5DRWA 4GS7B 4P9MH 4OFDA 4JANB 3GO1H 4H5SB 5DD5L 1AQDB 2ARJB 4MJIE 2Z8VC 4D0CA 4GXUM 3TO4B 2EKSA 3N06B 2JJTC 3VXMB 4OCSL 2VQUA 1R5IA 1A02N 3T65A 2K7PA 3LRSA 3JV4B 3BWAA 3GHBL 5J11B 2O5YH 1XR8B 1XR9A 3RWEB 3L1OH 1QQDB 1MUJA 4YDKL 1RHHB 3SDCC 3DTXB 4P2CG 2OS7A 4MLSA 5DJ6A 5LAXB 4AL8L 4QOKD 5DWUH 4D94A 3VH8B 3EGSA 5K9JH 4Q6YA 2R29H 2QQKL 4ZUTA 5FB8A 3PV6B 4Z18A 4X6BA 4MQXD 1T1YA 4LF3B 1OB1A 1X4ZA 3IGAB 4APQD 3W2DL 4U6VL 2C3VA 3MRLA 4A6YA 5ID0B 2FJFA 4C56D 1X44A 1UC6A 2W65A 3VFRA 3RAJL 5F6IB 2ILLA 3LKQA 1LO4L 2HFFA 3DV6B 2B4CL 5I1HL 3VFVA 5D7LB 3VFTB 2FR4B 5FK9B 4ZUSB 3VG0H 3O9WC 4OFKA 2CGRL 4JFHE 4ZXBA 1RZFH 4DGVH 1NMAH 4OB5L 4L4TE 3MNVB 1U95B 5A16B 2A38A 2PKDA 3L7FB 2PF6A 3RJDA 4UV4H 1JBJA 4NKMA 3VFMA 5GS0H 3IJHB 4JJ5B 1NLBH 4NQVB 2ADJB 5HBBA 2V7HB 2Q86A 4JO3L 2KH2B 2B7DT 4XNXL 5EWIL 5L8KB 3A67L 4PY8J 3TGXA 2ATKA 2DD8H 1G0XA 4OLXL 5AWNH 3L7EB 4LIQL 3DRQB 3QXAB 1ZVSB 1MLCB 1KYOK 3KPSD 1GYAA 1I7TA 2GAZB 1VFBA 5DDHA 4YXLH 1DJSA 4N9GA 4ZFFA 3K2MC 5T1LA 5ENWA 2R8SH 4OD2A 1ZT7A 1R3IL 3D0LB 3F5WB 4WIQA 3VXTB 2CXGA 1PD6A 4DVBB 1MCOL 4P2RA 4U6HB 2Y7QB 1MNUL 1MCIA 2JELH 3HPJA 3ULUC 1G6RB 3QO0A 5E2WH 3X14A 4JR9L 2Y4SA 5KSAC 1HSAA 3S34H 5E95B 4PJDE 4S1RH 4B50A 4JQIL 5GGUB 1EEYB 1JFQL 1TZIA 3CLEL 1BQUA 3REVB 3MV8D 2YKLL 3GI9L 1OF2B 3B9DA 4JHBA 1ZXQA 3GNMH 1N6QH 4JPIA 2YMXH 2QR0A 3PWNA 3ROOA 1TPXC 2AJYH 4NO3B 5TFSH 3O4LE 1BEYL 3ZHLA 4CMHB 4HLZG 4BZYA 3JWDH 3GMQA 1B88A 1MRDL 2V5YA 4KPHL 3S3PA 5JPMB 3A6BL 2I07B 3OHXB 5A2KH 4JN1L 2HLFD 3UJJH 4FG6C 1I1CA 2YEZB 3U9PL 3S36H 4PJ5D 4ENED 3MUY1 2EYRA 1RURL 2AQ3A 5HHQA 3B5HA 4YDLB 3QIWB 3ET9F 4GKOA 2EDQA 1DUZA 4JO4H 2N4IA 5DJZB 3MNZA 5J7CC 4DEPC 4OZFG 3U0WL 1PZ5A 5GS2H 1LP9F 1MHEA 2XXMB 4PJFF 3DETC 1X5JA 3MRFA 3EYSH 4QRRB 1A8JH 4OSUL 2Z8WC 1W72B 2X05A 3ROLA 5IR1B 5IMLB 5CSZB 4LL9A 5JW4N 4O58L 4PREB 4HC1L 3TBVA 4HWZA 4HKJA 3PGCA 5KSVB 2A9NL 2C3XA 4TUKL 4OUUA 4AJ0A 1I7ZA 3MLRH 4MVBC 1LQSR 2I9LB 5MHSE 5I73C 2ZOKB 1NDGB 3H9HA 3MACL 4RWYH 4M6ML 3HTLX 4MWFB 2AK4A 3V0VB 2ITDA 3F12A 3ULSB 1T5XB 3AY4C 4BFIA 4I5BB 5KS9F 1D5MA 4WCYL 2YC1A 2A6DB 4I3RL 4WEBL 4YHKH 4RGNC 5IBTL 3QDMA 2ADIB 1OAUH 1IAKA 2GJ6D 2IAMB 1BQHG 5D5MB 5FOBA 3RUGE 4KJPD 2BVTA 3SKOB 5GS0C 4ZD3L 1LO2H 4UOW0 5EG6C 3DVFA 4KJWC 2FECI 4MA7H 1BVKA 1BOGB 1MY5A 2VLLB 5F7YC 3BKCL 2YRLA 2R0LL 3HMXA 5FYLL 4PJBB 5AYQA 2AI0L 4F9PC 3AREC 1KC5H 4GRLC 3HZKB 4GMSH 4MJIB 2WBKA 4GBXC 5KSAA 4XB7A 4TULH 2C3WA 5EZOL 5GQBA 1BP3B 4TSAH 5HGAA 2DQEH 5ICZA 1I9JH 4TTDD 5I16A 3VD4A 4X8JB 3S88H 4K8RD 2F5AL 5F6HI 3E6HA 4FQJL 5MP6H 5SWZE 5F7MC 3N85H 5H94B 4HSQA 5GRVK 1PKQE 3VXUE 3TYFB 4LSTL 4XX1G 1G6RH 4XCCL 3PXJA 1WIUA 3WS3B 5AZ2H 3MCLH 5F8QC 3MX0A 5ICXB 4R6UA 5T3XL 1KENL 2O5ZL 5ESQA 4OZHA 4ZOCA 3QWOB 4J12A 3MRNA 1GZPA 1FORL 2JJSA 3DARA 4M5ZH 1EX0A 3UTOA 1J1XL 2A9ML 5KTEL 3WKNA 3TN0B 5E1AA 1IARB 1UA6H 2DBLH 4GS7C 1MCBA 4LSVL 4BSWB 1EEUA 3OMZA 3U0TB 2VDLL 3ARFB 3BT2L 3MLUL 3S7GA 3O2DH 5DEGA 3TO4C 3B2UC 5E4EB 1SYVB 2FZ3B 4HGWB 1ODAA 5DRNA 1JZ7A 4JM2D 4KHTH 3UPRA 1INDH 1EFQA 4L4TB 2EDEA 4AENA 4PGDA 3IJYB 2C3GA 2HVJA 3MRQA 2ADFH 4LSRH 3JV6A 2WWMC 4F7EB 4S1SL 5J11C 2IAND 5T5NF 1H3WM 2NW2A 3BZEB 3HE7D 1OP5H 2W91A 4EDWL 3L6FB 4MDIB 4NQUA 4G6FB 1E4WH 1DN0A 3CUPA 2DYPB 2CRIA 3V5KA 3AY4A 3MA7B 3L5XL 1WBZA 4LLYA 4R7DA 4WWKB 3OTTA 3F7QA 5DEFB 3GSVB 5IF0A 5IEHB 1WCBA 1OD7A 2DTSA 1JGUL 2DKMA 4S2SA 4PFEA 3NFPB 3SEPA 1ZEAH 4OGXH 3W11D 1HILA 4PP2B 3VRLE 4YEEA 1M05A 4WENB 3MUHL 1KLGA 5F6IC 4MNGA 1MWAB 1CD8A 1R3HA 1N5AA 3WNLA 3I6GA 4XPTL 2E7HA 4XP9H 1P7QB 1WAAF 4PJDB 3RGVB 4K9EC 5C07D 1NGWA 4F9PA 3VFOB 1IILE 4M8QA 5E2JA 4GRLA 3SCMD 1Z9OA 5IFAH 5JDSA 1QSFA 1N8ZB 1KJ3H 4M6NL 5DTFB 1JUFA 2VR9A 1B0GA 1NBQA 2FSEA 5HTSA 3O4LB 1T1ZB 1E4XH 4GBXA 3EOBA 1YEGL 4NZTH 1FZJA 4WUKH 4AZ8A 4J3WA 4JFZH 3CC5B 4NHUB 4UB0L 3D3VD 5DVMA 4KZEH 2Z0BA 3H9SD 3DLQR 4KJQC 1BAFH 2HYMA 5B8CB 3BRFA 1Q9KA 1ZA3B 1WFTA 3EHBD 3G6AA 4KK6D 1ZV5A 5E8OA 4Y16B 1ZLUH 4EUPG 3F65A 1EBPA 1BOYA 1O5DT 4QEGA 3G9AB 4LVOB 1WF5A 3MLTB 3VD3A 4LKCB 4IRZL 1IJ9A 3MV9E 1TCRB 3BFOA 4NZRH 1NMCB 2VXUL 3HNTL 3SGDI 4PJAE 2DQCH 3F7YB 3D39D 2C4FU 2APFA 4HHAB 4LSQL 2R2BB 3UTPD 1A4JA 2C5DC 1VGEL 2GITA 3UBXB 4JANA 1FE8L 3ULVC 4WFED 1AQDA 2ARJA 1NLDH 4L1HA 4CMHC 4OCMC 1V3LA 4HXAL 4Y4FB 3TO4A 5D7IE 2AJSH 4NNPL 4U1SA 3IAPA 2C7UB 3WD5L 3VXMA 3WIHL 2ESVE 4YIQB 2DAVA 1CL7I 3W9EA 4NT6B 1QP1A 5DUML 5C70A 4FQHA 1HN1A 1XR8A 3ZL4L 5BW7C 3RWEA 5D7SL 1FH5L 1A6VH 1QQDA 4QWWC 4YDLC 3QIWC 3RUGB 2Q76B 3DTXA 5L88L 1NANI 2FD6H 5LAXA 3OB8A 2X4PB 1CFVL 3EYQC 3VH8A 3QUXD 4CVZB 1CQYA 4ELME 2D7NA 1G9ML 4D0DB 3PV6A 4LF3A 1B6UA 5E99L 1GGYA 1ZHNB 5ID0A 3V4PH 4HK3N 3MRBB 2FECL 3LIZH 1JF1A 2EE9A 4WFHD 3X17A 5GJSL 4Z7NE 3R1GL 4ZS6D 3DV6A 4RZCA 3KAAA 5D7LA 1FDLH 2FR4A 5FK9A 3NGBB 4ZUSA 1UCBL 1DE4B 3QXVA 3V0AC 1JPSL 3MNVA 1U95A 4OIIH 2FX9L 5SWZB 5IOPB 4POZC 2CH8A 3MA9L 1PKQB 3IJHA 4IMKC 4JJ5A 3VXUB 4NQVA 2ADJA 2HN7B 1MWAH 2V7HA 1P7KB 3ZTNH 2EDTA 4Y4HA 1OL0A 1HKLL 3ARDD 2L4OA 3NTCL 3QDGD 5I1GH 1VFMA 3K2UL 1QR1B 2IAMC 4PGZA 1WBYB 4CDGC 2OI9B 2BNUB 1F6AB 3DRQA 3JTTB 5EU5A 1ZVSA 1MLCA 4HX1A 4X6FB 1UM6H 1G1YA 1NFKA 4XP4L 3Q48A 1VHPA 3QQNA 3F5WA 3VXTA 3MOBH 5AG9A 3P0YH 4M6AA 1OAKL 5EFIA 4KHXH 3TIDB 3QQ3B 4WUUE 3EUUA 4DVBA 2YUXA 1FC1A 2Y7QA 1I9RL 5J89A 4X7FC 4NWUH 3NABL 4HF5L 4FP8L 4KGLA 4J8RB 2Z31B 4L9LB 2ZG2A 3RL1B 1EEYA 1FG2B 3QBTB 2PTUA 1JHTB 5IFHL 1OF2A 3RKDC 2C1PB 1A0QH 2YPVL 3NCYP 1MJUL 1V3MA 4NO3A 1WT5C 1EVUA 5JO5A 1A7NH 1EXUB 4KTDH 4LMQE 4R7NB 5JPMA 2E7LC 3LPGA 2I07A 3OHXA 1P53A 1MI5D 3OR7B 3Q6GH 2P1YA 3WDHA 3WE6B 4ODHL 2YEZA 2R39A 3S4SG 4WTZA 1NCTA 3QIWA 5IJKC 5I1CH 1X5LA 1EZVX 2FH6A 3MJGX 3H0TB 4KXZH 1R5WA 1MAKA 4JFFD 3ARFC 4QY8B 4IJ3B 2CDEA 3I50L 4GKNB 4HK0A 1E0OB 4QRRA 3FN0H 1W72A 1H15B 5IR1A 5IMLA 5CSZA 4K3DL 3U83A 3C09B 4GAGL 4PREA 5KSVA 2LABA 1C7TA 1RZJH 2NY1B 3C5SB 4G3YH 5ALBL 4NKQB 2FATH 5GS3A 4U1MA 3VFGL 1CD1B 1NBVH 3D2UA 4L4VA 5D70L 1CE1H 1FIEA 2I9LA 1CU4H 1S5IL 1LD9B 4YFLI 5DMIH 1OSPH 4K7FA 4MWFA 4WW2B 4HT1L 3EOAA 4LCCA 3V0VA 4WJ5B 5IBUB 1T5XA 4FNLL 3QHFH 2A6DA 3QJFB 4WWKC 5D71H 2F9BT 1X5ZA 4IMKA 2A83B 2Y6SD 4AM0B 3DV4B 4UT6H 4AEIL 3SHSA 5EO0B 5I1EL 1I85C 1UADC 1AH1A 5D5MA 5BVPL 4XBPA 3U6RB 2FB4H 3SKOA 1RPQA 1KPRB 4L8CB 1MFCL 3MNWB 2Y1VA 3MV9B 5E03A 5C0FB 1BOGA 4OLUH 4PJAB 3TYGH 3DO7A 1UWGH 4HWEH 2H6PB 1JP5A 3MRPA 4PJBA 2JIXB 5D96B 4QRSB 2NCMA 5E8DL 1RUMH 3S3SA 1G1CA 3HZKA 1I8IA 1XGRA 2KBGA 3ZE0E 3IFLH 5FOJA 1X6NA 2FJHB 4WI2A 5D7IB 2CK2A 1Z9MA 5D1QD 2OL3A 4RX4D 3T0BA 1PEZA 3L5IA 4NYLB 4K71B 2ESVB 4LCYB 1RIVH 2AJZA 2DMCA 3PL6B 2VMFA 4X0KB 1C1EH 3GK8H 4UBDD 1CG9B 4HJ0D 1VB9A 1ZWIA 5H94A 5B8CC 3CX2A 5D93B 3TYFA 3H6JA 4M7JL 4PJ8B 5EBMA 5AEAA 4Z9KB 1CL7L 4Y16C 4Z7OE 3WS3A 4KUCF 2IF7A 4F57L 3D48R 1K8DB 3JV0A 4V1DD 3OG6B 5ICXA 5JXEC 5E9DE 1EUTA 1EZVY 3ZDXF 2E7LA 3L5JA 4UQ3B 4YC2B 2AJXH 4MJ4A 3EOTH 3QWOA 4ELMB 4LCWD 2ZCKH 1NMCC 3QIUD 1HXMB 3QNZB 3O6LL 1BVLA 3OL2A 4YHOL 4FQXB 5IJKA 3TN0A 5E2UL 2MNUA 4BSWA 4MXWH 5HPMB 4BH8A 2EKJA 4H88L 4KVCH 3MXVL 3PXHA 2QL1A 1NGQL 2DTML 3ARFA 1GC1C 4Y4FC 2NY5H 3GSNL 1SYVA 2FZ3A 5IWLC 1OAYL 1KXQE 4H0HB 4L4TA 1PG7H 1DBAL 43C9B 4EKXA 5C0CD 3MFGB 3IJYA 5TE7L 1FNHA 3BPCB 5IMMB 3MGOB 3P0VL 5BS0A 4JM4L 4M1GH 4LNRB 2W9DH 4KVNH 5DVNA 2PYFB 3N50A 3BZEA 4LKXB 3ULUF 2NZ9D 2G75B 3L6FA 4MDIA 4V2BA 3L3GA 1A6UL 1Q72L 1N7MH 5FGSA 2DYPA 2J4WH 4OUOA 5E94B 1ND0B 1RZJC 3MA7A 4NQCE 1CK0L 1HEZB 4RDQF 4WWKA 4KQ3H 2VDOL 3PDGA 4JDTL 3GSVA 4YXHH 5IEHA 5LQBL 3ALXA 2YD9A 4R4FL 3NFPA 4Z8FH 3RVTC 1I85A 5L8LB 4PP2A 3MXWL 4TSBL 3QEUB 3VFUA 1LEGB 4CGTA 5C0ND 5DRXA 1NFIA 5EUOA 4WUUB 4JKKA 3MLVL 1TMCB 2F54D 4OD1H 1MWAA 4NRYB 3UEZA 4PRHD 3MV7A 4B0MM 1J05B 5CJOL 1P7QA 3NGBC 2AJ3B 2X4SB 4PJDA 3RGVA 4ONHB 1HK6A 3CZFB 4DKDC 3VFOA 4MHHI 2OP4H 4LHUG 4YZFF 5IGXL 1N8ZA 2DB8A 3ULUL 3O4LA 1T1ZA 1KYOJ 3VXSE 2VLRE 3VDCA 4L3EE 3CC5A 3TT3H 4I3SH 4KK8D 4XH2B 2UZIH 3KJ6H 3RKPA 3D25B 3SBWA 4JY5H 2ZKHH 2OI9C 1FSKB 2VR5A 1EA9C 5EIVA 2YD6A 1ROWA 3ETBF 1UKQA 2D9CA 1PG7X 3AS2A 2XA3A 3IDYB 4D9RE 3EIFA 5GJTL 1ZA3A 5DC0A 3I3DA 1RSFA 3CLFL 3O8XD 4LLVB 4U7MA 2NYYC 2VZVA 3LCYA 4NO2B 5ANME 2QQQA 1TXKA 2CXKA 3GO1L 3MLTA 2HTLD 2NTFB 1TCRA 5JOEA 1CGYA 4LBEA 4K94H 3F7YA 4YDJB 2R2BA 4L9LC 1UJ3B 4NUJA 3BMWA 1NBZA 1XGQB 2O5YL 3UBXA 4YDVB 4ZPVB 1FNAA 3L1OL 3KJ4B 1TVDA 3NVQA 2ICCA 5KOVC 5IWLA 1DUYA 1AR1C 1MELA 1L0YA 2DJSA 3ARBA 5DWUL 2C7UA 2DF3A 1H8SA 2NY3D 5K9JL 4LGSB 3CU7A 3WNMA 4OI7A 5HDQH 2R29L 4NJAH 3LMJH 4NT6A 1P6AB 5KSUB 2MCPH 4EJ1C 1IGCH 4M43H 3BH8B 3NN8B 4YO0B 2VN4A 1TDQA 1AJ7H 5DXWA 4G8IB 4NO0D 3RUGA 2X40A 4QNPE 2AABH 2IPTH 2X4PA 1NAMA 3VG0L 4CVZA 3ZSSA 4IJ3C 2BNRD 4Y4KD 3EYVB 2DI7A 4D0DA 1RZFL 4MAYD 4DGVL 1NMAL 1F4XL 1QBMH 3WL9B 5ISZD 4S0TD 4NP4L 4UV4L 1ZHNA 5I19H 3VMOA 3ILQD 5GS0L 3C09C 1NLBL 4LNVA 1X5KA 3C60D 1MCWW 3RJQB 3S37H 5CJXC 3G5XB 2VDML 2R1YB 1ETZB 2DD8L 5ACLA 3ZT6A 1CF8H 4RFOH 5AWNL 1BJ1H 3LV3B 1D9KC 4WW2C 4MXVF 3CFIC 3BI9X 5SWZA 1WFOA 1NCNA 1Z9SA 2LAAA 1PKQA 3KVQA 4YXLL 2ENYA 2HN7A 3K7UA 1P7KA 3P3YA 2VTFA 1TVHB 5FYJH 2R8SL 5T1KB 5EA0H 3ZLQC 5KN5B 1ZT1B 5EOCH 5I1LA 2EO1A 3IAQA 2H2PC 4LEOB 1WBYA 5E9DB 4TTGA 2AEQH 4XHJC 2VR4A 3VXNB 2VKXA 2BNUA 1C08B 1F6AA 2JELL 5D2NE 3JTTA 1J1PH 1XFPA 3S34L 4K3EH 4X6FA 2HTKD 1A2YB 1HE7A 4S1RL 3KPRD 1TZHA 1E4XI 1Q0XH 2OXHA 1N59B 5J3HC 3TJHD 5D96C 2X9WA 4CU7A 4OFYA 3FO9B 4RMTA 2W60B 5A1AA 2FWOB 2V5RA 3QQ3A 4R4NC 3GNML 1N6QL 1MFBH 2YMXL 1JMXA 1QUNA 4G5ZH 3LKSB 5J56B 2AJYL 5TFSL 4U1GB 5C6PB 4CN6A 4XPHH 3JWDL 1WGOA 2VIRA 2Z31A 4J8RA 2FO4B 4PD4K 5CIPB 2V17H 4L9LA 4K71C 1FG2A 4B5EA 1E28B 1SEQH 1YPZA 2AKRB 1AXIB 3V6BR 1JHTA 1RZKH 5DQ9B 3S36L 2C1PA 4YQXH 3G9VA 2D0FA 5D93C 2YD8A 4K94C 4PJ8C 3UCRA 4DK3A 3S37X 3T1FB 4JO4L 5BJTB 4D2NA 1Q1JH 5IB5B 1U8PB 1WZLA 2VSDA 3TBWA 1EXUA 4YHIB 4NQCB 5T3XD 4YC2C 1FFRA 3HUJE 5DI8B 5CEYB 3RPIB 3OR7A 3OX8B 3MJ6A 3EYSL 1BREA 3WE6A 1I8KA 2VITA 3AVEA 4I0PD 2OK0H 5F7LB 4FQXC 4P5KB 2FBOJ 2CJUH 4Y5YB 1IGIH 2QHRH 4GAYA 2CO6B 3OXSB 2WIMA 3UZEA 3H0TA 1OWRM 1QKZH 4RWYL 3NIGE 1OARH 4GKNA 1ZHLB 4OJFH 5KOMC 1SY6H 1LDPH 3T0AA 1H15A 4MXQC 3VW3H 3VWKB 1S7UB 4MYWB 5CEZE 4DAGH 3TVMD 2MTPA 2IJ0C 3UDWC 3PJSB 4KKLD 4YHKL 5KVEH 1EIBA 5EBGA 3C5SA 2E3VA 1OAUL 5CJXA 1CD1A 3NCYS 3VXSB 1F8TH 1KIPB 2VLRB 1WV7T 4L3EB 3HE6D 1LD9A 3RVWC 3O41B 2FHFA 3UTTD 8FABB 1YN6B 4WW2A 3LKPA 4YBQC 3JWOH 3UP1A 4I48A 1KXVC 1AE6H 4WJ5A 1LO2L 2KUTA 1AGEB 4MA7L 3C6LD 5CZVL 1YA5A 3QJFA 1KJ2H 1YYMH 4IS6B 2ICWI 3ULVF 3B83A 4O4YH 3WUWB 2ATPB 9CGTA 3DV4A 4OGYH 1I1AD 5ANMB 3OG4B 5EO0A 1M7IB 1KC5L 4HDIB 1IC4H 1U8JB 1UCTA 2J2ZA 3CK0H 4GMSL 4X6EB 3VI3F 1U3ZA 1JHKH 1IQWH 1KPRA 1GGCL 3MV9A 5C0FA 4TULL 2BFVH 2COQA 4TSAL 4PJAA 3UYPA 2DQEL 1I9JL 3MJ7B 3S88L 2JIXA 4QRSA 5J12B 3V8CA 5MP6L 1AGCA 6FABH 1NDMA 3N85L 1NGXA 3EOYG 5MEPB 5DMKA 1G6RL 2EIEA 1BZ9B 5AZ2L 3MCLL 2P5ED 5D7IA 1IEBB 4N8CH 3GFUA 3G5YB 3OJDB 2BC4B 2ESVA 2H2SC 5F1SA 3WNNA 3LEYL 3PL6A 1FSKC 3AM8A 4X0KA 3WFDH 2EEAA 5HI4D 4M5ZL 2X4TB 1JGLH 2BVEA 4HKBA 4PJ8A 1C5BH 4M1CC 1OOAA 1UA6L 3O6FD 3WS6A 4AQOA 2DBLL 3UYRH 4C55A 3QG6B 1K8DA 5E5MB 2W0PA 2ZG3A 5CIPH 1RZKC 5JHDD 1KUMA 3O2DL 3N1PC 2PO6D 4ELMA 4G6AC 3CU1A 2GY7B 4KHTL 3ZKMC 1INDL 1HXMA 3LKNB 5FUZL 2LTQB 1UJ3C 3W0WE 2ADFL 4LSRL 3BPNB 5D5MF 1J10A 1IGTA 3EZJB 2IH1B 2Q7NA 3TT1H 5HPMA 2K9UA 2LU7A 3R06B 2CIIA 5CJBA 3UBXI 4J6RH 3KJ4C 1E4WL 3T3ME 4U1LB 4QHUB 3TZVD 1HHHB 4PJBF 4FHBD 43C9A 4KKBD 1KB5B 3UDWA 4JGUA 2NXYB 3IF1A 4PLKC 1D6EB 2VJXA 3MGOA 3U4EB 2FJGB 2YK1H 3P0GB 4KXZI 5FYKU 1ZEAL 4OGXL 2PYFA 4LKXA 2CLZB 3BGMB 4XP5H 5ESVA 4F7TB 4GLRH 4QHLA 3T4YB 5DJCB 5E94A 1VEMA 5D2NB 3FT4A 4XP9L 4IRSB 2AEWA 3ARXA 4R96B 2IADB 1LEKB 1YNLH 2EECA 1DZBA 1MFNA 3JWOC 4XTRC 2VL5A 3QEUA 5IFAL 1LEGA 1LK2B 1ULVA 4GG8B 1KJ3L 3HC3H 1G9EA 4ONFH 1JPFB 4WUUA 2B5IB 2UVEA 4LARL 5TGBB 1LWRA 1A3QA 1E4XL 2ZUTA 4NZTL 1JHLH 4WUKL 5DT1H 4JFZL 1J05A 2EDOA 2RFXB 2AJ3A 5IVNA 2X4SA 1BWMA 4KZEL 3QRGH 3PF2A 3ZO0A 4ONHA 3L3KB 3REWB 3CZFA 2X10A 1RULH 1BAFL 3KXFE 1MCPH 1P1ZB 3RVVD 3LEXB 3ES6B 4U1JB 3B9EA 5SWSE 2X4UB 1RZ7H 4XH2A 4CKVX 3QH3B 3D25A 1IM3B 2H41A 3HUJB 4NZRL 2DWEB 3PWPD 4OCLC 2W9LA 1JK8B 1YUHB 2DQCL 3R0NA 2AAVA 2D4DA 4GXUN 2W1NA 3FRPA 1OTUC 4WFGE 3BZ4B 4ORZC 2J1KA 1MCQA 3H42H 4NO2A 3CFEB 1P6FA 5KJRH 4LLWB 1CGXA 1S3KH 2VDPH 4LVEA 1TETH 1NLDL 4LPYA 4U1GC 2NTFA 4DCQB 3V79C 5H37H 2AJSL 5E2TL 2DRUA 5AAMA 4U0QB 4RMRA 2YN3A 3OZ9H 4NFBA 2V7NB 3U1SH 1XGQA 2P8MB 4CL7A 4ZPVA 5B39G 3IVKB 1A6VL 4NRZA 1KBGH 4AYFA 3CH1A 4U49A 4PJDF 1MCSA 5CD3B 2FD6L 1G6VK 2AXFA 4JRXD 3B6SB 4PRNB 2XTJE 2HMID 4TOYL 3K4ZA 4D8PA 6CGTA 2I9TB 5E00B 1UT9A 3NMEA 3SQBA 3BH8A 3NN8A 4HGMA 4YO0A 1N5YH 4PBXA 2UZYB 3V4PL 4WHDA 4OLWH 1XIWD 2EH7H 1AO7E 5FHAH 5F89B 5BV7B 4OCWH 5EBWB 1KB5H 1DVFD 3PHSA 1FDLL 1YQ2A 3B9KD 4XRCB 2QADD 4OIAA 4H8WH 4O2CB 3UXFA 1JWSB 4X7DC 5GZOD 1CXKA 1HYRC 3EYVA 4NC1E 4WVRA 1KN2H 3IDXH 3WL9A 2D03H 4OIIL 1T04B 4O00A 3V6ZB 3VWKC 3S6CA 5B4MD 2JF1A 4NZJA 3OXRA 3BGFB 1T0MB 3PQYE 4HWBH 1MWAL 3ZTNL 2DICA 2OR9H 3G5XA 5I1GL 2R1YA 1ETZA 4GXVH 3LV3A 4KROD 1UENA 4MNHB 4NNXB 1AY1H 1SEBA 2UWEA 4P2QD 5T3ZE 5HGBB 1E27A 5F9JA 1UM6L 2IPKA 4N0UE 4TVPE 4P2OD 1TVHA 5HDOA 5T1KA 4YE4H 2G9HB 3MOBL 5KN5A 3SKNB 3P0YL 1ZT1A 4KHXL 2Y36H 1KFAH 4PG2C 2BRQA 5L8JB 4LEOA 5E9DA 3ZE1E 2RCSH 3VXNA 4HEPG 4FQ2H 1HHIB 1C08A 4NWUL 1QSZA 2DIBA 1OP3K 3CDGA 4NC0B 1XCQB 1X9QA 1NEZB 4KJYB 3RZCD 3FMGH 1A2YA 3CGTA 5A2JH 2BVQA 1F6FB 3WUZA 3ARSA 1N59A 3D85D 3W0WB 5J12C 3DXAD 2FGWH 3RUGF 2FWOA 1A0QL 4GAFB 8CGTA 3LKSA 2GT9B 2VLJE 3S5LG 4MA1C 1BD2D 1AKJD 3BQUB 2E27H 4PB9H 1RJLB 1A7NL 3HG1E 4P4KB 2VXTH 4KTDL 4O51B 1J9CT 2FO4A 5CIPA 4LQFH 2MHAB 5L2JB 3HA0A 1IGJA 1E28A 2YSSB 2AKRA 4TPRH 3O4OB 3Q6GL 5DZNA 5I15H 4X98B 5DQ9A 2WP3O 4GMTH 1XAUA 5FFLA 1J8HD 1FL5B 4R90H 2Y72A 5I1CL 3T1FA 1OT1A 3ZKXB 2MCG1 1NMBH 4PRPE 1R24B 1U8PA 1AGDA 2KQNA 5CEZH 4NQCA 4P99A 3S35H 2DQFB 3BX7C 3VXRE 3SDYH 4J3UA 5GHWH 5CEYA 1CCZA 1JWUB 3OX8A 4BSJA 3FN0L 3VXPA 4J3VA 3FRUB 1NC2B 4MA8H 3LHPH 3SDCD 3SDDC 3SDAC 2LTQC 1NCAH 3ARGC 3TFKC 4P5KA 4Y5YA 5CBAB 1RZJL 3BPNC 4G3YL 4F2MA 5CJ8A 2FATL 2VH5H 1OAZH 1NBVL 3OXSA 1JTPA 2PYEE 1CE1L 4NQEE 1CU4L 2D7OA 5DMIL 1ZHLA 3IDIB 2HG5B 3KXFB 3QHFL 2APBA 1S7UA 5D71L 1X3DA 4KKCD 5BV7H 3PJSA 1INEH 2NXYC 5CILH 4FTVE 4UT6L 5SWSB 1F4YH 3BW9A 3BP6B 3G6JE 3GUTB 2VLRA 1KIPA 3FN9A 3O9WD 4L3EA 4XC3H 1NSNH 1E4JA 4FQIH 1YN6A 2FB4L 2NXZB 2DQUH 1TJGH 4FXKB 1AGEA 5HYFA 5IP4A 2BDNH 4XAKD 3GSWA 4OLUL 3TYGL 4IRSC 3MV11 1YJDH 1UWGL 4Y5XB 4HWEL 5BRZE 5JW5A 4DKEH 1ZLVK 2DIAA 2YWZA 3WUWA 1YY9C 2AERT 1RUML 3JZ7A 5ANMA 4HFUH 4HDIA 2VLME 4KI5D 5BXFA 5ELIA 1U8JA 1QSVA 3EO1B 3IFLL 1UH4A 4X6EA 1NPUA 5T5FH 5DZOA 2B5IC 1IZKA 1XEDA 1AP2B 2AEIT 1LE5A 1I1YB 3TLRA 4AY0A 3UO1H 2YZ8A 3MJ7A 1RIVL 3QISA 2ZUUA 4LP4A 3VRLF 1YEEH 3GK8L 1LILA 3R0MA 2F58H 4G43B 2YXMA 3BDXA 5DJXB 3QUMB 5MEPA 3ULUD 1RAMA 1BJMA 1S7QB 5KZCD 1BZ9A 4JHAH 1HNGA 5E7BA 1CDUA 2A6KA 1IEBA 5HD8D 4ZAKD 3G5YA 3MJ9H 3MRRB 3NZHH 2BC4A 4OZGE 1T7YA 2XTJB 2AJXL 4AIZB 3EOTL 3MV01 4EN3B 5EO9B 2FEDD 4FN0A 3T09A 1CLCA 4B7IA 2ZCKL 4LMQI 5SV4A 4JO2H 1BMGA 3KDMB 5MERB 4K2UH 2X4TA 5L6YH 3QB7C 4L9DA 1MOEA 4XNQB 4QRPE 3IETB 1II4E 5I17B 1OTTC 3QG6A 1AO7B 3IDUA 4MXWL 4X4ME 4WW2F 1X5XA 4KVCL 3I75B 2R4SH 4NRXB 4FG6D 1UM5H 2J12B 4IRJA 1HI6B 1PG7L 3LKNA 1I3RA 3NCEB 3O2VH 3PQYB 4R4BB 2Y9RT 1FG9C 4M1GL 5AUMB 2IH1A 4NQDE 2W9DL 4KVNL 1PX3A 4LLDB 3SJVD 2WQRA 3R06A 5EN2B 3Q5TA 5I0ZA 5DRZB 1TTGA 1N7ML 3Q2CA 4PJAF 2P44B 4U33A 2J88H 3QCUH 2J4WL 4U1LA 5F44A 1F3DJ 4N90E 1HHHA 4HIHB 2OX5A 4KQ3L 1WFNA 2PNDA 2R0KH 1D6EA 3QULB 4N0UB 4MX7B 4X6DB 4YXHL 4W6XB 3U4EA 1FCCA 4Z8FL 1JNJA 3BGMA 3DNKA 4F7TA 5D7IF 1B4JH 1AFVH 1QA9B 5J13B 1T83C 3IDNB 3T4YA 4HWBA 4OD1L 5BV7C 1TNMA 5D2NA 3IXAB 1SBSH 4X4XB 2NY4B 2C3HA 1KJMB 4IRSA 1FLTX 4LGPB 4OKDA 3O2WH 2IADA 3GJEB 3QXDB 2MQ3A 3GMNB 3C87A 4R0LB 2OP4L 1NC4D 3RA7H 1LK2A 4GG8A 4JAMB 3N1GC 2J5LB 5GS0D 4Y0GA 4HK3J 3BGFC 2VLJB 3VDBA 1YJDC 1ZGLA 1A1MB 4PYGA 3CSYA 2Z92B 3TT3L 3EYFB 4I3SL 2RFXA 3HG1B 4ELMF 5D6DC 2UZIL 3KJ6L 3TV3H 4PGEB 3AAZA 1P2CB 3HC4H 1GXEA 1U8QA 4JY5L 1PJ9A 2ZKHL 1PGRB 3L3KA 5MEQB 3ARED 3UX9B 4MZ2A 2VE6B 5GRUH 1VACB 5BOPA 4NO5B 4S1DC 5GGTH 4DGYH 1KTLB 4Z7NF 5HJ3B 3LEXA 3ES6A 1PZUB 5IFJB 2PUQT 1S7XA 3VRJB 4YR6B 2X4UA 5DD3H 2AGJH 4PRPB 2VDRH 4G9FE 3PNWB 5DFVC 3QH3A 1A6WH 1UH3A 2EE2A 4HMEA 3VXRB 3VWJD 4E5XA 1IM3A 3HUJA 2E5EA 2DWEA 4Q9CA 4C83A 1JK8A 4K94L 1YUHA 4XVJH 2ITCA 1R3LB 5DO2C 2PW1B 4Z78A 3FB7A 2I5YH 5I66B 3CFEA 1S8DB 2L7UA 2R2CA 3KLDA 3P11H 4LLWA 3QUKB 2PYEB 5DD6B 1QYGL 4NQEB 4F37F 2X09A 4Y2OA 3INUH 5TH2A 3RVXD 4XMPH 4EOWH 4Y19D 4QRUB 3BQUC 3PWLB 4G6MH 5DR5H 4YUEH 4M7LH 4YNYA 2DMKA 5HDQL 4NJAL 2V7NA 3LMJL 4H1LG 4FTVB 2MCPL 2P8MA 2R9HC 1IGCL 4M43L 1CFSB 3G6JB 1YEDB 3IVKA 4X7EC 4HS8H 4OAWA 3B2UD 4LVNB 3TO4D 2O5XH 5J8OA 1IFHH 4MD4B 5GGRB 4Y1AD 4ZTPH 2H26B 5CD3A 3TJEH 4P23B 2IPTL 1H3XA 1WWWX 2HLAB 4NGHH 4DQOH 5GS2D 3WO3B 4PRNA 5I8OH 3BUYB 4QOKE 2K1MA 5BRZB 2EH8H 4G8FB 5E00A 5GRXG 5IBLC 2ZUSA 3QFDB 4MDJB 1QBML 1CDIA 1OWWA 5I19L 4ZUVB 3KLHD 5FUOH 5CWSB 5GGVY 1JZ3A 5F89A 3S37L 4AT6A 5EBWA 5T3ZH 3CAFA 1Q9WB 4XRCA 1Z5LA 2X4QB 4O2CA 2CLVB 1CF8L 2E9IA 3NCJL 1JWSA 4RFOL 2FX7H 3LY6A 4PV8B 4U31A 4YH6A 3EJYC 5J1SC 1DL7H 4JFEE 1T04A 3I6KB 3V6ZA 1RQ5A 4GLRI 1FO0B 2UVFA 3U36B 2VXQH 5FYJL 4CBPA 2CR3A 5HHOE 3PWVB 1WISA 5EA0L 5EOCL 4DVRH 5D6DA 1X5YA 3V4VH 4OZGB 3UZVB 3D69B 1Q0YH 5EDXA 1VA9A 2NXZC 5EIIB 4NNXA 2HFGH 5FA4B 4UIKH 1T1WB 1J1PL 5HGBA 4K3EL 4YHZH 3U7WH 3MC0A 5C08A 4OBSA 4OQTH 1Q0XL 3UTSD 4I13B 1WBXB 5I8EB 4QRPB 5CZKA 2G9HA 1G7JB 3BGAA 5EZLB 2ARWA 3PWJB 1MFBL 1DEEB 3MLZH 4ZFOA 1HHIA 3DVGB 1DQJB 1TFHA 2X1WL 4NFDA 4XPHL 3U48A 3B4NA 2VLKD 3X12B 1NEZA 4KJYA 4H0IA 4P59H 2V17L 2BVOB 4JQXC 3MJ9A 3BP5B 4HQQH 1SEQL 3W0WA 1RZKL 1XF4A 3OKDB 4NQDB 4YQXL 4GO6B 4KDTA 1KB9K 4FMKA 3FQRB 2GT9A 4R2GD 1JGVH 1RK0A 5F96H 5T1DH 3BQUA 4G42A 4D0BB 5DJ2B 1Q1JL 4WI4A 1RJLA 2YD5A 4P4KA 4CDHA 1B0WA 2MHAA 5L2JA 1S9VA 2DJUA 3RBSA 2XTJC 2AQ2A 4EN3C 3TIEB 3QI9B 4JHZA 3C8DA 3TBTB 2XN9E 2YHGA 4X98A 4XXCC 3ZE0F 5F6HJ 1FNGB 2OK0L 2BOBB 1VERA 4PY7B 3RTQD 5DSCB 1NUGA 4PJ5E 4XPGH 3NCMA 1FL5A 2CJUL 1IGIL 2QHRL 4Z7VE 5KVFH 4XCFH 1R24A 3BRGC 1EBAA 1KG0B 1QKZL 2DQFA 1OARL 3C2AH 3HC0B 1JWUA 4OJFL 4IOIA 1SY6L 5ITBH 1LDPL 4NC1C 3FRUA 1NC2A 4QWWD 3VW3L 4Z7OF 1D6VH 4DAGL 1I8MB 4U2ZA 3GGWB 5KVEL 5CBAA 5TJWK 4EZMA 5ICYA 3CDFA 1F8TL 5LBSH 2KPNA 3E6FB 4JRYE 2Y5TA 4EVNA 2EXYC 1EO8H 3JWOL 3HAEG 3GMMB 2IALB 1AE6L 2AV1B 2HG5A 3N1MC 3KXFA 2CKNA 3KLAB 2BY0A 2XQYK 3QAZB 1UM4H 1YYML 3CVHB 1C16B 4O4YL 2RR3A 3VFWB 5SWSA 4OGYL 3BP6A 3GUTA 3BKYH 4PJ9D 1J1OH 3FT3B 3GRWH 1IC4L 1YECH 4G9FB 5CHNB 5JQHC 2GKIA 3CK0L 1QLEH 1JHKL 1IQWL 2VZ1A 5J13C 5F1IB 5EU6E 2V2WB 4FXKA 4POZD 5EH1A 2BFVL 1CN4A 1O7SA 2NY4C 4PJCA 1FO0H 1BEYH 2AXGB 1XGYH 4Y5XA 3HPLB 4AEEA 2IAMD 4R0LC 2FYYB 6FABL 2MJWA 5CLTA 2J5LC 3EO1A 2HT4C 1FRGH 1BWWA 1VFAB 2P7TB 2PTVA 4ZO9A 3EDKA 1AP2A 1C5DB 1CT8B 3ARVA 1N4XH 1I1YA 4N8CL 5IHZB 4KQ4H 4R97B 1N26A 1O7VA 5EOQH 2XZCH 2B1HH 3WFDL 2F74B 4Q9BA 1IBGH 4X4YB 5C86A 2OMBA 1JGLL 4G43A 4MJID 5DJXA 1U8KB 3QUMA 1S5HB 2IWGA 1S7QA 1ZK9A 2X9YA 1IE5A 1TENA 3UYRL 3FFCD 5DQJB 3MYZA 2HH0H 3MRRA 4OGAC 4QOKB 5CD5C 5EO9A 4UQ2B 5FECB 4ZQKB 4XXCA 1CICA 3KDMA 5MERA 3ELAT 2R2HB 3QUYD 5EOTB 1RUQH 4XVTH 4XNQA 1AXTH 5JZ7D 1KPUB 3IETA 4NNYB 4GAJH 5I17A 3DYMA 2CKBB 1AO7A 1OGAA 3WIFA 3TT1L 4MCYA 3MJ8B 4G7YH 4WEBH 3MRHA 3I75A 4NRXA 1TIUA 4J6RL 1VFUA 3HRPA 1F4HA 1TVBA 1ZSDB 1RZIB 2PN5A 2Z35B 1HI6A 2OTUB 4XBEH 3QZWB 1Z6JT 4JFEB 3RL2B 1OSZB 3PQYA 4R4BA 4GUPA 2WIIB 2M8XA 2YK1L 1D3CA 5HHOB 4IDJH 4HUXB 4LLDA 4Q58C 4M3KB 3WJJC 4GKSB 5FO8B 2R0LH 5EN2A 4XP5L 4JFHD 1C12B 3BD3A 1UZ8B 3BD5A 3GMPB 4QHNB 2V9TA 4P23C 1T21B 1F4WH 1C5CH 5CP7B 2BY1A 1MREH 1I7RB 3QULA 4U6YB 4N0UA 4MX7A 4X6DA 4DFIA 3DX6B 5KW9H 1YNLL 3W81A 1G7HB 3BIKB 2C1OB 3HC3L 1JI2A 4ONFL 1QA9A 2DQIL 1FNEA 3IDNA 2RGSA 1JHLL 1MF2H 5DT1L 3T4AB 1KJMA 1T66C 3IS0X 4J3XA 3CVHH 3FOLA 1D5ZA 3QRGL 5GRZA 4JZJB 3GJEA 3BHBB 3QXDA 3GMNA 1NGZB 4JKWA 2EDLA 1RULL 4R0LA 1FVEB 1YEHH 1L6ZA 4U1NB 4ODVH 1MCPL 4JAMA 3MV8B 4ONGH 1QSED 3SO5A 2VLJA 1CQKA 4OQTA 4P46A 2DS4A 4LLMA 4UAOB 3HI6H 2ZUQB 2F8VA 5F97E 2ED9A 3MYJB 1RZ7L 3EYFA 4WI7A 4DTGH 1FFNA 3GMLA 5B38G 2BHYA 2A0LD 1I4FB 5IVXE 4PGEA 1P2CA 1IAOB 5SV3A 1H8OA 1IGYB 4PLJD 5MEQA 4Z5RA 4ISVB 3H9SE 2XN9B 4JG1H 3HI1B 4NO5A 1WJ3A 1HHGB 3BT2H 4HCRA 5HJ3A 3VG9B 3F7RA 4PJ5B 4DW2H 4KK5C 3VRJA 3H42L 2X1XR 4Z7VB 4YR6A 1JRHH 5KJRL 3MRIB 3PNWA 4UU9B 4U6TA 1S3KL 2VDPL 4ZUWB 1TETL 2NNAB 2WUCH 3VXRA 2X70A 3U46B 2YA1A 1T4KB 5F9OL 4PP1D 3OF6A 1W0WA 4Y16D 1NCUA 5CMAB 3V5HB 5IW6B 3B2VH 1R3LA 3D39E 1N3NB 2PW1A 3MROB 3OZ9L 4RAUB 3UTPE 4MAUH 3U1SL 5I66A 5JXED 4JPWH 5E8EB 1S8DA 4NM4H 5JHLH 4G6JH 2YWYA 3GSRB 4OV5A 3QUKA 5IB4B 5DD6A 2E7BA 4JRYB 1X5IA 1ZMYA 1KBGL 2J3SA 1NGPH 4I3GA 3T3PE 4N0CC 2DQGH 2UY6A 5HVHB 3PWLA 2JJUA 3GIZH 4KFZC 7FABH 1FZKB 2AJVH 3V7MA 2DWDA 2WK2A 4BK4A 3QI9C 4XCEB 1LK3H 3G6JA 1YEDA 1N5YL 2AK4E 5IQ7H 4Y4FD 4OLWL 4XWOD 2EH7L 3KYMB 5FHAL 3M1BB 1FV1A 1LO5A 4OCWL 2H26A 1ZKAA 1KB5L 5EU6B 2HLAA 4I18B 5K9KB 1ORQB 3BUYA 4H8WL 4OLYH 5EC2B 1X6LA 5BRZA 3NFNB 4MDJA 1KN2L 3IDXL 1XGTA 2D03L 2DKUA 4XVUD 4NHCH 2RQ8A 1A4KB 1MJ8H 1PX4A 1UB6B 4RRPA 5E56A 4ZUVA 3VD9A 4HWBL 2HKFH 3BWUC 2OR9L 4F9LC 1Q9WA 3GKWH 4WFHE 4KI1A 2FH8A 3HUJF 5EU3B 4XBGA 3GRWA 1GGBH 5DRWB 3NZ8B 5JA8B 2CLVA 1N0XH 4GXVL 4OV6F 4UILH 3Q5OA 1AY1L 3I6KA 4D0CB 1T89C 3SQOH 3QAZC 1FO0A 4N8VA 3U36A 4MNQA 3OBAA 3NIFE 3GDBA 3OSKA 3PWVA 4YE4L 1D5XA 1KTRL 2Y36L 1KFAL 3NIGF 1R5IB 3LRSB 3QDGE 4XXDB 1WZ1H 2YA0A 2RCSL 2VWEE 4OZGA 4FQ2L 4P3DB 4QHMB 3D69A 4MJ5B 2FIKB 5F9AC 5EIIA 1BM3H 1FE8H 1QACA 3OAZK 5FA4A 1T1WA 5SX4H 3I9GH 5C2BH 3VXUD 1MUJB 1DR9A 4PV9B 1K3ZA 2BVPB 1QPXA 5C71A 3T77B 3VRIA 4NJ9H 1WBXA 5I8EA 4M7LT 5DJ6B 1ZHKA 4QRPA 1WC7B 1HXYB 1G7JA 2FGWL 4OZHE 2ED8A 4HG4J 5FB8B 4ZUTB 3CXDH 3DVGA 1A9BB 2VAJA 1U0QA 3CFCH 2E27L 1IC7H 4PB9L 4A6YB 5JXAH 3X12A 4ZO7A 2VXTL 3MZTA 3JXAA 1A3LH 1L4IA 4JM2B 2NYYD 3BP5A 4WO4D 5L2KA 4R97C 4TPRL 1FN4B 3OKDA 4ZSOE 5I15L 1KCRH 3OKLB 4NQDA 1MFDH 1CGUA 3WMSA 4GMTL 3FQRA 4R90L 5GRVL 3W5NA 1W8OA 3HE7B 2GW5A 4NDMA 4L8BB 2EYTB 1NMBL 4D0BA 5DJ2A 4QXWA 1YEKH 5CEZL 5IMOB 1JWMB 3WHXB 3S35L 5F7KC 5GHWL 3TIEA 3QI9A 4AK1A 3TBTA 3IT8D 1FNGA 1SMAA 4MA8L 3AB0B 2WZPD 1ACZA 3LHPL 2BOBA 4PY7A 1XH3B 5DSCA 1NCAL 1JGDB 1P5UA 1TNNA 1AR1D 3VDAA 2VH5L 1OAZL 3HNSH 3WNKA 1F2QA 4HUVB 5DDHB 4N9GB 1ZOXA 5T1LB 1KG0A 4JFDA 3HC0A 4RA0C 3FT2A 4JFFE 5EZIH 5DLMH 5F7FA 3GBMH 2QQNH 1I8MA 3HPJB 3GGWA 5BV7L 1INEL 1U3YA 5CILL 3D5OF 4D9LH 1F4YL 4QRQA 3FONB 4XC3L 3OR6A 1NSNL 5ERWA 4FQIL 4JVPA 3VFPB 2X5PA 2PCPA 5IVXB 1GHFH 2RB8A 4GRMB 4ZYKB 5DHVB 3GMMA 2IALA 2DQUL 1M71A 1GAFH 1TJGL 2AV1A 4JPIB 3H9SB 2K3TA 3ROOB 2E9JA 3CVIH 2WWKO 1T89A 2BDNL 3KLAA 4LSUH 1I9RH 3S9DB 1YJDL 4DKEL 4LFHG 1C16A 3CX5K 4CMMB 2R1WB 3VFWA 4RGMB 3WLWD 4P49A 4HFUL 3FT3A 3T3MF 4G9FA 5CHNA 2PXYD 1D9KD 3ESUF 3BD4A 5T5FL 3I2CH 3V7AE 5F1IA 3K46A 5C0BA 1IKFH 4KU1A 1MHCB 2R0WH 3SE3C 2AXGA 3UO1L 3T0DA 3P40A 3HPLA 2P43B 3D39B 3HR6A 2P49B 3MNZB 1YEEL 1S7RB 1FVCA 2FYYA 1PG7W 4LAQH 2H2PD 4M93C 5DJ8A 1OQXA 4E42A 3RWHB 2F58L 3L9RB 1MHEB 4UNUA 2QSVA 4LRIA 1WQVT 4JHAL 2P7TA 5D4QA 4F37K 1CT8A 1C5DA 4UAOC 4X7SH 4HKJB 3MJ9L 3NZHL 5IHZA 3V2AR 2LQRA 1I7ZB 3B8YA 3O6MH 4YBHA 3LKOB 2F74A 4MMZC 1HOCA 4X4YA 1CBVL 4K2UL 1IGFH 1U8KA 5L6YL 2A73B 2AK4B 3TP4A 1S5HA 1KEMH 3UYOD 3VG9C 4ENEC 4A6YH 1CDGA 1YC8A 2KL6A 1D5MB 1RUAH 5DQJA 2OM5A 12E8H 2GFBB 3T0WA 2R4SL 3QIBD 4I77H 1UM5L 4QOKA 1IAKB 4UQ2A 2NR6C 5FECA 5B21A 4ZQKA 3MLXH 2OTPA 2JJWA 3BVNB 1QTYT 2AXJA 3NA9H 4AEHH 4J2XA 4X9IA 5EOTA 3O2VL 1KPUA 4NNYA 3W82A 4N5UA 4APQA 2CKBA 2XY1A 1CFTB 4C56A 2FLBT 3B3IB 3MJ8A 5FAAA 3C5ZD 1XGUB 3OGCB 1ZSDA 2J88L 3QCUL 4EI5D 4EQ3A 1B3JA 1RZIA 5C0IB 1B90A 5HVHC 4FQXD 4WNQB 2OTUA 2R0KL 3RL2A 1FAKT 1OSZA 1HNFA 3FCTB 2WIIA 4HUXA 5HGAB 5INCB 1VPOH 5I16B 2P45B 1L6XA 3ARDB 4PGJA 3TPKA 3DVNB 1B4JL 1AFVL 1C12A 1XT5A 3QDGB 5GISH 5DMGC 3GMPA 4QHNA 1GOFA 3BKJH 3ILPA 3O45B 4P4RA 1SBSL 4KJPC 4WHTB 5HI5D 2R1XB 1T21A 3O6KH 1DDHB 3SGEH 3O2WL 1UXSB 1ZAGA 3LPFA 1I7RA 3KPSA 3JBG7 1VCAA 3DX6A 3WNOA 3RA7L 1NUDA 3RVWD 1G7HA 3BIKA 4MD5B 3EJZD 2CDFA 2C1OA 1FZMB 5ESQB 1UH2A 4OZHB 4YBQD 4LGRB 4ALAH 2FX8H 4OF8A 4RMSA 3MRNB 5ACZA 5FUCE 2F54E 3SE3A 3T4AA 5E1AB 5L7XH 3TV3L 3HC4L 4JZJA 3WFHB 1FVEA 5GRUL 1RVFH 5GRYA 1JMZA 4ZSOB 5GGTL 4DGYL 1IT9H 5A3ID 4K8RC 1WK0A 3MV8A 4ONOA 5DRNB 5FYJD 4FA8A 1LNUA 3QUZD 1U8HA 4LPCA 5DD3L 2AGJL 3MYJA 3U4BH 2VDRL 1ED3B 1I4FA 3MLSH 5FKAB 1IAOA 1K2DB 1A6WL 1ACYH 5I71B 4B7LA 3P4NA 5JIPA 4OTXH 2WBJD 3O11B 3HI1A 1SJHB 3SKJH 3GHEH 4J4PD 4XVJL 1CLZH 4PJ5A 3V5KB 5FA3B 2I5YL 1WBZB 4R7DB 5DMYA 2X89D 4OZIE 3P11L 4AQ1B 3MRIA 4JZNA 4ZUWA 1WCBB 1MCKA 4OBRA 3PIQB 3INUL 2D7PA 1HZHH 3LH2H 2LU4A 1T4KA 4XMPL 5FGBA 4JFFB 4G6ML 1M7DB 4X6DF 1T5WB 5DZLA 5DR5L 3ISWA 4YUEL 4M7LL 1KLGB 5CMAA 1MCCA 3V5HA 5IW6A 4JM2C 4I1NB 1Q8MA 1N3NA 4RAUA 1R3HB 3I6GB 4FABH 5E8EA 4NKDB 3ZE1F 2HT2D 5IB4A 4R8WH 4HS8L 2O5XL 4G6AD 5HGHA 4ODSH 2EEDA 3JWNC 3HE7C 1IFHL 3MXWH 4ZTPL 5TF1L 4E41D 2A74B 3TJEL 4JFPB 4WI8A 2B20A 4NGHL 4ODUB 4DQOL 2FSEB 1RUKH 1SJVA 4JFQB 1MRFH 3EOBB 4L4VE 2EH8L 1B9ZA 3NPSB 3ARPA 4XCEA 1F45A 3HMXH 1JNLH 4QF1A 4TUOA 3AB0C 5ADPH 3QNYB 3RIFF 5FUOL 3KYMA 3M1BA 1CDJA 2DLTA 5D2LA 1Q9KB 5T3ZL 1ZTXH 4HAFA 3G6AB 4PLKD 4LSDA 4HIJB 4I18A 5E8OB 5K9KA 1ORQA 4J3OC 3DURB 3MR9B 5EC2A 2FX7L 5KANI 3NFNA 2BNRE 1DL7L 1GCFA 5K59E 1OTSC 3G6DH 2HJFB 1A4KA 4LEXH 1QD0A 3NCBB 1NCDH 2VXQL 4BSVA 5I0DA 1Q94B 1RK1B 2BRRH 5E1HB 1KLFA 2OXGA 2BJMH 1H3GA 1KELL 1PW3A 3JUZA 1A4JB 4DVRL 3BJLA 3M17B 4QTIH 5EU3A 3NZ8A 5D1QB 2GITB 3V4VL 1Q0YL 2NY7H 5HYSG 2XXCB 2HFGL 4UIKL 3BSZH 4NWTH 5SWQB 4YHZL 3PUCA 3U7WL 3LD8B 4QXTA 4X5XB 4OQTL 2BCKB 3UAJD 1ADQH 4U1SB 4K7PH 4RGMC 3EHBC 2FNBA 3UC0H 4KK6C 3W9EB 4OLVH 4FFVC 4UV7L 4X5LA 3QYCA 4XXDA 3MLZL 4PGCB 1NCCH 4P3DA 4QHMA 4FQHB 2FIKA 4MJ5A 4NZUH 1VKXB 2UUDK 4HGKC 4PLOB 4P59L 4PV9A 2BVPA 3RVUC 3T77A 5JW4Q 3G6JF 3QIUB 4HQQL 1WC7A 1HXYA 3KPRE 2ICWJ 3EJJX 2NY0B 1ZLVH 2D7TH 5J1AA 2X42A 5AZEH 1K8IA 4P3CH 3FAWA 1BFOA 1JGVL 1A9BA 5F96L 1G7PA 2JKXA 3VGDA 5T1DL 5TDPA 2IMMA 35C8H 3E2HB 3WLBB 1JF1B 2GHWB 4JM2A 4GT7A 4J7RA 3QDAA 3HB3C 4M1DH 3HMWH 1RHFA 4RZCB 1DSFH 1JRHI 1FN4A 4R9HA 3OKLA 2UYLB 2VERN 3KLSA 3ME0A 2IANA 3MFFA 4XPGL 2BERA 1F4XH 3HE7A 3IDGB 4R3SB 5KVFL 4NP4H 4L8BA 4XCFL 5HYJD 2EYTA 1FPTH 1Y6NR 4R26H 5BS0E 5IMOA 1JWMA 3WHXA 2OBGA 4Y4HB 1A1OA 3C2AL 4WV1B 5T3XE 3LQAH 2JE8A 2VO5A 1SMOA 2VDMH 5ITBL 5CP3A 2VABA 1D6VL 1XH3A 4N8PA 5JPNB 1A3RH 1JGDA 5EU5B 5LKNA 4OCNC 4K7PX 2JTDA 3DHJA 2W0KA 4HX1B 2F53D 3V6OE 4BQ9A 5C0RH 4NQCD 2F8OA 4HUVA 4OZGF 5LBSL 2V2XA 2F54B 3FN3A 1QPPA 4D9QE 2I24N 1EO8L 5EFIB 5C6TH 3VD7A 1FL3B 5EUOE 4XB8A 1JJUA 1F97A 1UM4L 5M7QA 1BQSA 3SCMA 3MV7E 1A64A 4UOW1 3GSXB 1HINH 3BKYL 1J1OL 3FONA 5DK2B 3GRWL 1CVSC 3IB4A 4DZ8A 1DFBH 1YECL 4XX1E 2WANA 3SN6N 3VFPA 3ARDC 5F8RC 5IVXA 1QLEL 4RQQA 4GRMA 4ZYKA 1QFPA 2VWEC 3D3VA 5DHVA 3UTTE 3VWKD 2HJLA 5IQ9B 1G7QB 4F7CB 1J0YA 3H9SA 5B3JE 3FO2A 1WSST 1FO0L 2EDNA 1XGYL 5IW3A 2BSTA 3VXSD 1SVZA 5JO5B 4CMMA 2R1WA 3S98A 2BSRB 2EDXA 2B2XH 2WLZA 2X1PA 3O8XB 3F7VB 4OZIB 4HZAA 1D5IH 1OAXH 2BNQD 2VAAB 1FRGL 2HFTA 1F42A 2JJSC 2Z93A 3QPXH 3DPBA 1MHCA 3T0VA 1N4XL 1RD6A 5E5RB 4QYOB 1OCWH 3FKUS 3NFSH 3AU1A 5IMKB 4KQ4L 3D39A 2UV3A 1T1XB 5EOQL 1XZ0B 2XZCL 1S7RA 1U3HD 1R5WB 2B1HL 1IBGL 3RWHA 3L9RA 5C6WH 2CDEB 3HN3A 4N1CA 4HK0B 4RWHA 2M2DA 1JPST 5SX4I 1G7IB 4X7CC 2P5EE 4MCZB 3TWCL 2HH0L 4U1MB 4WI9A 3D2UB 4L4VB 5I71C 3LKOA 3Q6FB 1OQOA 4S11A 4K7FB 2A73A 1AD9A 3EOAB 1RUQL 3BAEH 4LCCB 4XVTL 1AXTL 4GAJL 3T0XA 2OZ4H 4NO0B 4G7YL 1LO3H 2GFBA 1F02I 4K7PY 4YXKL 5I1JH 1BX2A 4M61B 3QUXA 4K9EH 3QDJD 2CRYA 2BNRB 3BVNA 4XBEL 4XBPB 5AAWA 1NJ9B 4Y4KB 5HXMA 2GCYB 4XCNA 5CBEA 4X4ZA 1QO3B 1C7SA 2GJZB 2C4XA 3CSPA 4P0DA 1CFTA 5CZVH 4IDJL 3B3IA 3LQAC 3DO7B 1FGVL 3C60B 1ZLSH 3MRPB 1DQLH 1CXHA 3ECBB 2OYPA 4J1UB 3S36X 1XGUA 3OGCA 3P9WB 1X7QB 1I8IB 3SDDD 1XGRB 3SDAD 5C0IA 4WNQA 3ARGD 3TFKD 1F4WL 2KZ1B 2YRPA 1C5CL 1R0AH 2IQ9H 1GGCH 1MREL 5GGSB 1U6AH 5KW9L 3KPNB 2OL3B 3FCTA 3NPSC 2CO7B 2YS4A 5INCA 1TQBB 2Y6SC 1X5FA 2AJZB 3QCVH 3ARDA 3DVNA 5HYQB 3QDGA 3H8NA 1T80A 3O45A 1ZWIB 4BQBA 1MF2L 2CSPA 2XKSA 4Y2DD 5EBMB 4WHTA 1QBBA 1CTOA 2NXYD 2R1XA 4OZFB 1DDHA 3CVHL 1IAIM 1UXSA 4PRID 4U1KB 1YEHL 3KPRB 4MD5A 5DHYB 4ODVL 1FZMA 4ONGL 3LEYH 4HIIA 5KAQF 3ULVH 4B41A 4N5ED 2EIBA 1ADQA 1BVLB 3BP7A 5INDB 4PJGA 3HI6L 4DTGL 5E8NB 2X1QA 3LS5H 2FLRT 1BFVH 5D1QC 2Q7YB 4BH8B 3WFHA 2VC2H 4W68A 1K5NB 4JG1L 4ZSOA 1EJOL 1CD0A 2V9QA 3LD8C 3QQ9D 4HJ0C 1IMHC 1GGIH 4MJ2A 4DW2L 4QTHB 5FUZH 1S9YB 1JRHL 3LN4B 3MTRA 4PG9B 2O26U 1ED3A 4M62H 1YPZE 5DJAB 1BQHB 5BS0B 5FKAA 3MBED 5T5NG 1K2DA 1EGJA 2WUCL 4X6CA 1M4KA 3GMRB 3MPCA 3O11A 1MI5A 1SJHA 3L3GB 5C0GB 4I0KA 1KXTB 3NACH 2J6EA 4Z95H 2DM2A 1W72H 3B2VL 4BK5A 5JTWA 3QIUC 4I0PB 5FA3A 4MAUL 4JPWL 2NY0C 4NM4L 5JHLL 1PQZA 1AI1H 3G5VB 3OJ2C 4G6JL 3MGTB 2AEPH 3PIQA 1NGPL 3LRHA 2Y06H 1YQVH 3VFUB 4JFFA 2DQGL 4YAQB 3E2HC 1M7DA 1NFIB 1T5WA 5DRXB 5EUOB 3GIZL 5KSBE 3H9YA 7FABL 2AJVL 2X1OA 2QLVB 2YUVA 1IM9D 3MV7B 4WW1A 3TVMB 2IPUK 5GGQH 4G7VH 1LK3L 4NKDA 5DK0B 5F21B 5F1NB 5I6XB 5IQ7L 4UINL 4TNVF 4UNTA 3HE6B 1BF2A 4LPXA 2YZ1A 4L3AA 1KOAA 3UTTB 2A74A 4JFPA 5CEZD 3B9AA 4ODUA 4LARH 3C5JB 4JFQA 4OLYL 2X44D 4Y4HC 1NFDA 2XKNB 1NCBH 3C6LB 4WV1C 3V8OA 4MQTB 4WI5A 4BZ2H 5EU4B 1MRCH 4NHCL 1MJ8L 3QNYA 3J8F7 1LDSA 3KYKH 4YGVA 2HKFL 5FM4A 1MFEH 1BVZA 4Y8DC 2GK0A 5C0NC 2GYSA 2EDJA 3GKWL 5FUCC 4YHYB 4HIJA 3WDJA 1GGBL 3DURA 4Z77A 2OL3H 3MR9A 1N0XL 2WLYA 1A6PA 1QRKA 2A1WH 3ARRA 4O2FB 4UILL 1T20B 2HJFA 2GY5A 4Z7VF 5FHBH 3BN9C 3SQOL 4KY1H 4LBEB 4XNZB 1Q94A 1RK1A 3TESA 1JYVA 3OPZH 4NUJB 3SGEI 3M17A 1NBZB 2P5EB 1WZ1L 2VRAA 3CX5J 5D1QA 1CXFA 4RX4A 1KCKA 2Q8BH 3DMMD 3TBYB 5DJYB 3KS0H 1MCNA 2NY6B 4KK8C 2Z91B 4LU5H 43CAA 1BM3L 3I9GL 5SWQA 5C2BL 3BPOB 4P2QE 4X5XA 1DUYB 2BCKA 2X41A 3DGCR 5E2TH 4NJ9L 1PBYA 1O0VA 5FM8A 3ARBB 1AXSA 2AK1H 3O8XC 1EK3A 3CXDL 4V1DA 5KG9B 4PGCA 4RISH 1JL8A 5IHUH 3CFCL 1VKXA 3LQZB 1IC7L 4JDVB 5JXAL 2PO6B 4JFYB 1A3LL 3AS0A 4LCWA 1QRND 4PTUB 1CFQB 3QIUA 4LPWA 4N1HB 1QZ1A 3DHMA 3MOAH 1KCRL 1NAMB 4TOYH 2NY2B 1OAQH 1MFDL 2HT3C 5EPMA 4XP6H 1BJ1J 4YDIH 4NN5B 2CUIA 4G8GD 1UKTA 4RFNB 1MCRA 1YEKL 3WLBA 3NAAH 4PUBH 4KRLB 2OZ4A 1UQSB 3G04B 3TZVB 2KKQA 2ED7A 5C0CA 4JQVC 1F90H 1B0RB 4P2YA 5EOCJ 4LFHD 2UYLA 1U2HA 4MGXA 3GB7A 3ARWA 4LCCC 3BQUD 3IDGA 4R3SA 4EUPB 5C1MB 1IZJA 3HNSL 5GS1A 1HCVA 3C8KA 1IAIH 5IT2H 3SPVB 4WV1A 4Z7UE 2YN5A 5I1LB 5EZIL 1PEWA 1CS6A 5DLML 3GBML 4M4RA 2QQNL 3FFDB 3QRFM 4Y4KC 1CFBA 4WEUD 1J0HA 1UYWH 1ZGLP 3CPLB 5F71A 5JPNA 2K7QA 2DBJA 3EAKA 4D9LL 5CSBA 1T7VA 3UJIH 1KIRB 3ILQC 2YD7A 3C60C 1L7IH 1TZHB 2F54A 5TQ2H 2EIDA 2JCCE 3QXTA 4TVSa 2ID5A 1GHFL 4TN9A 1NAKH 5CKAA 2XICA 3LB6C 4U0RB 1GAFL 1FL3A 4QKXB 5E7FA 1T6WA 3CVIL 4JCLA 4LSUL 1QNZH 1RJZA 5A2IH 5HY9B 2E6PA 2VUOA 4FZEH 4YJZL 4S10A 3GSXA 5EORH 2VIRB 4PJIE 1TQBC 4G8EB 3KHQA 5DK2A 4F8TA 4IIQA 1YPZB 3EJYD 3WKMH 2DQTH 3I2CL 1FYTD 4JM2F 5C92A 5FYKE 5IQ9A 5IVOA 1IKFL 1G7QA 4F7CA 2GUOB 2XWTA 3KPTA 2R0WL 4EDXB 2VL4A 1UG9A 3NA4A 4XAKE 1WVZA 2PTTB 3VMNA 4BYHA 1HHKB 1DQQA 3TBWB 2BSRA 3EDEA 5BZWA 4LAQL 3M45A 2WM0A 3O8XA 3F7VA 3PP3K 4G9DB 4QXUH 4OZIA 4XI5D 1QFOA 2DMBA 2NXZD 4K07A 4L5FH 1P84K 1I8KB 2VAAA 2VITB 4KI5E 5ACMA 5F7EH 2EDFA 1GC1H 5L9DH 4X7SL 5KSBB 4QYOA 4HPYH 4Q7DA 3TN0C 4BJLA 4GAYB 1ITCA 5FCUH 3VGHA 5IMKA 3MRGB 1T1XA 3O6ML 3I3BA 1E4KC 1XZ0A 4YEFA 4PJXE 4UTBH 1F13A 1IGFL 3GJFB 1KEML 5E4EC 2EDRA 4A6YL 4GH7B 1EEZB 1DBJH 1RUAL 4EXPX 1G7IA 12E8L 5JIKA 1V3JA 4MCZA 3OKOB 4I77L 3P4OB 3R8QA 1BLNA 2XV6B 4JQVA 1MIEH 5HHXH 2VDNH 1NAMH 5IJVB 3MLXL 2E9BA 4HUWB 4MQ7B 2P46B 3Q6FA 1TJIH 3CSGA 3NA9L 4AEHL 3LKPB 3DYOA 5E4IA 4WU5B 4I48B 4PRAB 1NBYB 4I0PC 2DN7A 5I1KH 5IKCB 5IVXF 1XIWB 3RIFK 4NO0A 3V6OC 1FZOB 2W92A 4EN3D 1V7MH 3VGFA 5AYUH 3IKKA 4DK6A 1YC7A 2DQHL 2QADB 4M61A 3HZYA 2BNRA 1NJ9A 4Y4KA 5D72H 2GCYA 4MAYA 4LHJB 1QO3A 1A22B 1DLFH 2GJZA 4NQSB 1CGSH 3QT2A 4HBCH 5I75B 1JZ5A 1VPOL 4W70A 3C60A 3RGVC 5I6XC 4YFEA 3RDTD 3SJVE 3ECBA 5GISL 3TC9A 5CGYD 3HE6C 1AGCB 4J1UA 1P7HL 2B0SL 3U2SB 3BKJL 1NDMB 1NGXB 1X7QA 1TLKA 3BEVB 4NIKB 3PDOB 4KROB 3O6KL 4MD0A 5DMKB 4P2QB 3RY4A 5IIEA 5GGSA 1OT2A 3C6LC 3FTGA 3KPNA 3EYUH 4JO1H 2FHBA 4KRPD 3S4SB 3SBWC 4Q0XH 3T3PF 4ALAL 2UWEE 2FX8L 5HYQA 5C0AD 3QEHB 2DKSA 1TZGH 3QPQD 3L5WB 4L3CA 5CZXC 5C9KA 2N1KA 5T3ZD 4HKBB 2HKHL 4OZFA 1A6AA 5L7XL 3VI4E 2FDBP 3CZJA 1DANU 3RZCB 3TA3D 4U1KA 1ZVHA 2H32B 3KPRA 1RVFL 4LVOC 3SE8H 3D85B 5DHYA 1FAIH 3O3EB 1IT9L 2D4FA 2C4FT 1W2KT 4XNZC 3RWGA 5JORB 2NY4D 1S7TA 5INDA 1J88A 1D5BB 5E8NA 3U4BL 3RWCB 1AKJB 4MB4A 2PW2A 3MLSL 1JIBA 1H8NA 4GKZB 1ACYL 1IGTB 2Q7YA 4LCUB 1RUPH 1E4KA 2NY6C 3GI8H 1K5NA 2CIIB 4OTXL 1X5GA 4OCRH 3SKJL 1NKRA 3BPOC 2HT4D 3GHEL 2R15A 1HQRB 3TBSB 2JB5H 1VEPA 1CLZL 5HI4C 1S9XB 5DGRA 5FV1L 4QTHA 5DJ0A 3ARBC 3BESR 4HKXB 4XMLH 1S9YA 3CDYA 3HG1D 1J8HB 3LN4A 4PG9A 3IF1B 5DJAA 1BQHA 1SJXA 5D9SA 1FIGH 2XKUA 4Y5VB 1HZHL 3LH2L 4Z7UB 1XF5A 3GMRA 3BOVA 5ESVB 2W38A 5C0GA 3NIFF 3OAZH 4QHLB 1A47A 1ONQB 2E7CA 4RDQG 4FFWD 4I0PA 5JIIA 3SDCB 5F88B 3DI2B 4PRPD 2DLHA 4FABL 3FT4B 1PFCA 3G5VA 3V6OA 3MGTA 2NY2C 4OGAD 4R8WL 2JCCB 4ODSL 1U58A 2CK0H 4NOBA 3DUHA 4FQPA 2VL5B 4NN5C 3GKZA 1J0JA 4YAQA 1CD9B 3BN3B 4RFNC 4Y19E 3GSNB 2EXWD 3OJMB 1RUKL 3SGKA 1MRFL 5HGGS 3TZVC 3JSSA 4KKBC 3TVMA 3ZKQD 4OZHF 2PYED 5IHBA 2G2RB 1A7QH 1KTKE 3HMXL 4NQED 5D1XD 5DK0A 4J3SA 4YFDB 1JNLL 4PJIB 5ADPL 3HRZB 3IDJA 3L3DA 5F1NA 2IBZX 1P4LB 1YMMD 5E0QA 4UDUA 3HE6A 1VADB 5ETUB 3PG2A 1NUFA 5CJQH 1U93B 2CR6A 3UTTA 3CFJA 1ZTXL 2P5WD 2EIZB 3C5JA 2N7AA 1FBIH 1QLRB 4Q97A 4FTVD 2XKNA 1BPVA 3LDBB 3C6LA 2V9RA 1HH6B 4UI2A 4U3HA 5LVEA 2E8YA 4KTEH 5EU4A 3G6DL 2BHZA 4LEXL 2FGZA 4KKAC 3VA2C 1I1AA 1NCDL 1M7XA 4JFXB 1JF6A 5EULV 2BRRL 4P23D 2BJML 2QJDA 4QTIL 4X8XA 2PR4H 4M6OH 3FZUC 2D7MA 2Y5EA 4O2FA 2NY7L 4U0RC 4WWID 1T20A 3BSZL 5C09D 4NWTL 3CD4A 4PJXB 5HHVH 1OHQA 1KIQA 4NPYA 1ES0B 1ADQL 4K7PL 4LDLB 5F3BB 1T66D 3RVVC 2Z31C 3FB5A 3UC0L 4OLVL 4F7MB 3K8MA 5DURD 3GSOB 3ZTJH 3ZZ1A 2P5EA 3FHQA 2KDGA 1FVDB 1NCCL 3TBYA 4ZAKB 2H32H 5DJYA 2Z91A 1TTFA 2YPKB 4NZUL 4Y7MA 1QYGH 1P9MA 5GSVA 5TDNA 4NRZB 4QCIB 5IB1B 2QKIB 2IEPA 3CH1B 2EZ0C 4CN1A 2AXFB 1ITBB 4Z7WE 2CRMA 3UTSE 1T7WA 2D7TL 5AZEL 4D8PB 4ZUUB 4P3CL 3D9AH 2ZOLB 4NOFA 1HSBB 5KG9A 1PAMA 1VFOA 3BZFB 3MLYH 4ZNEA 2F19H 5JHDA 3LQZA 4KC3B 35C8L 4JDVA 3D0VB 3IRZA 2PO6A 3UTZB 4JFYA 4NKIH 3H3PH 2VLKE 4PTUA 4TSCH 4KK5D 3L3IA 3ZDYE 1CFQA 4M1DL 3HMWL 2MWCA 4JY4A 4UT9H 4JDZB 1DSFL 4LHUB 3T1WA 3KYOB 1V8HA 3HR5B 5MEND 5ABDE 3SJVB 3FO0H 2IBZY 1I8LA 5F93C 1FPTL 4R26L 4UIMB 4BZ1H 3OXRB 2ZUVA 5H8DA 1UQSA 3TH3T 1A9EB 2NY1C 3G04A 3TZVA 5J9PB 2P24B 1I7UB 3WIHA 3LQAL 4EEEA 2HMIC 1B0RA 5DS8A 3W5MA 3NCJH 4LSSH 4P48A 3SDXB 1A3RL 1SEBB 2AW2A 4M48H 2UWEB 2NX5D 3FOMA 4N0CD 4EUPA 3E0GA 4GW4B 4N90D 1E27B 4YBLB 1N2RB 5C0RL 4W81A 5F9JB 1XIWC 2IPKB 1HIMH 1SQ2N 3CCHA 1QEWA 3OQ3B 3SPVA 5HDLA 3EFFA 4YHLH 5C6TL 2QADC 1C8PA 5DFWH 3WHE0 3K1DA 3FFDA 1MH5B 2EYSB 1XF3A 1BGXH 1NC4B 3CPLA 4HMCA 3CDGB 1X5AA 4GSDH 5FYKH 1KIRA 1AD0B 1HINL 3MODH 2BVQB 1FHGA 1DFBL 5FYLD 1MHHB 1CE6B 3AREB 3VH8G 2Q6WB 1MVUB 4RFEB 2IMNA 5HY9A 3C08L 3KWWB 1H0DB 5JUEL 2B2XL 4G8EA 1EFXD 1IGJB 1JI1A 1D5IL 4I9WD 3DX8B 1OAXL 3PL6C 3AM8C 3TM6A 1FCGA 1K3IA 3QPXL 4W6WB 4BFBD 2GUOA 3UPCA 3VWJB 4EDXA 4MHHG 3PWPA 4AIXA 1OCWL 3WS6C 3NFSL 4OKVB 2PTTA 2L0DA 3KYNA 2ZPKH 3MSPA 4W6YB 1T7ZA 3RZCC 1AGDB 2HA1A 1HHKA 4FFZH 5C3LD 5IM7A 3PDDA 1UWXK 4G9DA 2JJVA 5CKGA 2SEBB 4JZOB 3TEUA 3VXPB 3BDBA 1JNNH 4XC1H 4YHMH 3RY6A 3O3AA 3IU3B 1N64L 5KSBA 2X7LA 2ARJQ 4JHWL 4Y19B 4F2MB 2A77H 3P30H 5C0JB 3MRGA 1UZ6E 2YR3A 1LO0H 5KBNC 3STLB 5DVOA 1T2JA 5T33H 3GJFA 3BAEL 1Y18B 3TNMB 1EEZA 2OZ4L 4TNVK 1LO3L 3FFCE 4Y1AB 3OKOA 1KEGH 3P4OA 4RNRB 4JRXA 3E8UH 3THMH 3BW9B 1OLZA 5I1JL 4Y5VC