2ICWI

Crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
110
structure length
110
Chain Sequence
QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGPQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASVHRSDSAVYFCAVSGFASALTFGSGTKVIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal structure of a complete ternary complex of TCR, superantigen and peptide-MHC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 18
structure length 110
sequence length 110
chains with identical sequence K
ec nomenclature
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2icwI00
1RIHH 3NA9L 1C5DA 1IKFL 5SX4I 4XNZB 4C83B 1QYGH 2GTWB 5LAXA 4PP1D 1ACZA 2A74A 2JJUA 4UOJA 5A2IH 1F02I 4OZFB 5C0AA 5I76A 4RDQG 5D8JH 2X1OA 3AS3A 4S10A 1OB1B 1ZLWH 5HGHA 4NKQB 5T3XH 5F7EL 4HWZA 1RUPH 2VH5H 1OTTD 3F7YA 3MODL 1IAOB 5CUSH 5IGXH 1CIUA 2VERN 4QF1B 5KZCB 5F70A 3ARWA 1MUJB 4G8EA 1U58B 4WW1B 3P73A 3WFBH 3CSPA 3D39A 4ZUUA 5FUZL 4UBDC 5DDHB 5F89B 2C1OA 1TZGH 4N0UE 1T22B 3TN0D 2Z93B 4KK6C 3G04B 2VISB 5I8KH 4U3XA 2FX8H 1E4XI 4RGOH 1MJ8H 1SBSH 4AIOA 2R1WB 4R4FL 3TFKC 4JPIA 4P3CH 5IBUG 5E2JA 1Z5LB 4K9EH 5DD1H 5FECA 1CU4L 1ZS8B 1FBIH 1WZKA 4OZ4A 3MLSH 3MV9B 5F9DC 1T4KB 3GSOA 2F53B 4JRWA 5FKPA 4NN6C 4BFIB 4MAUL 4NO5B 2JJVA 3AUVA 5AAMA 4FQ2L 1K5NA 2BY3A 12E8H 4DW2L 4PLKD 5SV3A 1XGUB 1OP5K 1CDIA 5C0NC 3CFKB 4ZPTB 3MJ6A 1MCLA 4PTUB 4PRHD 2JLLA 5DUBB 5CCKH 1P2CA 2O93L 5AUMA 4QXTB 2CGRL 3QXVA 1CTNA 4D8PB 3QNXB 5TE4H 3S3SA 1D5ZA 4LCIL 3RFZC 3EOTH 4QWWD 5EOQL 3P9MB 1T1YB 5BO1H 3TNNB 3EYVA 3L7FA 4CAGA 2BCKB 1I8LA 3ELAT 3CC5A 3GMMA 3OR6B 3THMH 3UO1L 2APWA 1RK0A 5HJ3A 5D93B 3S34H 4RGND 1MLCB 5C7XL 4YHLL 1I9RL 1HN1A 5C07A 1RUQL 3PQYE 4MHHG 4CU7A 4ODHH 5JQ6L 2EECA 1IFHL 4LEXH 3QEGL 5D2NE 2YUXA 1WICA 4ZUSA 3AS1A 2AXFB 2V2WB 1MH5A 4P23D 2FJFA 2CR3A 5GS1B 5H94B 2BRRL 4KJWC 4ONGL 2DICA 3PL6D 4HHAB 4LQFL 5LGHH 3Q0HA 1A9BA 1NAKL 1AR1C 5I1AA 5HY9A 2J6EH 1L9NA 4L8CB 2WBJA 1BP3B 2A77L 4UNTA 3MA9H 4NUGH 1JNNH 4ENED 2WWMD 1HYRC 1QLFA 2A6JB 4RMQA 4D0BA 3L3HA 1N0LA 5M94B 3WN5B 2FECI 5I17A 2R0LH 1MELA 3PQYB 2L0DA 2B2XH 4LSTL 1YYLH 3VWJB 5JNYB 2NX5E 2VDKL 3V6ZA 2I9LB 1R3LB 4P2QB 1FV1A 1FH5L 5KAQF 1VEPA 4WFHD 1CICD 5JPMB 3H9SE 2ZSVB 1DLHB 4ZOBA 2X4PA 4NQEB 3OV6A 3AU1A 5IHUH 3ULSB 1FZJB 3P3YA 1PSKH 3KYAA 4FZ8L 1O7SA 1FVEB 4NQDE 4JDTL 1W0WA 2FH8A 8FABA 1CG9A 5SWZD 3DX7A 4MA8L 1HSBB 2ZCKL 3RVUC 1G7IB 3D2UA 3BMVA 1MI5E 1FE8H 1VACA 3CUPB 1C16A 4QCIB 5JW4M 2BVYA 1PQZB 5JW3H 1QLEL 1U6AH 4TUJB 1UKQA 4P4KB 1YMMB 1J10A 1KCRL 1A14H 5IG7B 3UPCA 5GISH 3TBTB 4H8WH 3MNZB 3TJHC 5EBGA 4NQDB 5D1ZB 3MRRB 4K7FA 1TENA 1UKSA 5CEXB 4JR9H 4R0LA 1BM3L 2JE8A 5C08D 5C0JB 3GI9H 2CXGA 1DQDH 3T0AA 5I6XC 3J8F7 4NN7B 3BVNB 4P5KA 4YEEA 3GUTB 5LGJB 4UV7H 1XGQB 2VLRB 4MNQA 1MFEH 1JGLH 4OB5L 3ARBB 1E4KA 2XYCA 3HC4H 4HG4J 1UACH 2WP3T 4PJBA 4G6MH 3QWOA 2XXMB 2OTWB 3SKOA 3QUYA 3KNBB 4U1KA 2FWOB 4ONFH 3AS0A 4Q9QL 3RX5A 1U93A 1KCSH 4FZEH 4Z7OE 1UWXH 3MX0A 5CIPA 4NCDA 3QG7H 2VABA 4M4PA 4JDVB 4G6FD 4LLQA 3LEVL 5F1NA 2VXSL 5IVXF 1FYHB 2DWDA 2JK5A 1F58L 2JELH 4PREB 4XWGL 5D6DA 4IEFB 4PD4K 3QIUC 3P9WB 1RQ5A 1CDCA 1QNZL 1UT9A 1OAUL 5C3LD 5IWLA 4XH2A 4NZJA 4TSBL 5DEGA 4NZRL 4C83A 4JRYE 4UV4H 4XP4L 2VAAA 1H15B 3TPUB 5F7LB 4RFNB 2RQ8A 3RBSA 4DZ8B 3H9HB 2XQYG 5E6IA 4N9GA 1J1OL 5EORL 3ZMRA 5A3ID 2WINA 3LPWA 1JYNA 1TJGL 1IAOA 2IWGA 3FN9A 4XHJC 5JXAH 1FL3A 4KQ3L 3EW3B 4HPYL 4A2MA 2AK4E 2C5DC 5C0BE 4IDJH 1JVKA 4K3EL 3ILQD 5TFSH 4JN1H 4ZNCD 5BW7A 2FD6H 1SY6H 4XXCC 1GIGL 4P48A 2CD0A 5T3ZE 2CUIA 4J1UB 3S4SA 2OK0L 4KTEH 2R0WH 3MACL 5E2TL 3WDIA 3TYFB 1FVCA 3TT3H 2Z4QB 1IKNA 1B0WA 1A3LH 2IPTL 4BH8B 3MPCA 35C8H 5L88L 5LXGH 1AO7D 1DP0A 4OFYD 1TVBB 1KENL 1T4KA 4JAMB 1AGDB 3HG1D 3U79A 3C60A 2Q1EA 1BOYA 1YDPB 3ARQA 1OVZA 3GDBA 4UI2A 43C9A 4F7MA 2F9BT 1JV5A 1NJ9B 2DS4A 3LEXB 2ICWB 3HUJE 2QQKL 3RUGE 4N0UA 4MX7A 3KLAB 1NGXB 1HQRB 1TZIB 3CFKA 3LVEA 2CRMA 4ZPTA 3JV0A 4UTAH 5KVMC 3V79C 3WXWH 5CAYB 2Y6SD 2X1XR 3OR7A 1YUHB 4FQJH 4X8JA 2YBRA 3VXNA 3DLQR 5DUBA 2EDXA 1MVFA 2P42B 4NZUH 2VN7A 4K3JH 1FZMA 4HSQA 4JFFD 1II4E 1KPVA 1RPQA 3HC3L 4LEOA 5I9QC 1KEML 4Q0XL 2ZUXA 4XBEH 3QNZB 2ZG3A 1NMCC 3D48R 5HVHC 3W9DA 1K85A 4M9OA 3LKRA 3HNTH 4MCYB 4IRSB 1UH3A 3B3IB 3OR6A 4NKMA 3MRCB 2YN5A 5DRXB 3DBXA 3IETB 3PABB 4IHOB 1MLCA 3U83A 4BQ6A 3L1OL 3D3VE 3HMXL 4TSCH 3BKJL 2AEWA 1YY9D 1UCBH 3OKMB 4J23A 4OLZL 3HLAB 3KYMB 2EIZB 3RUGF 2IPUG 5MEPB 1OTUC 3P11L 4XP6H 1HHKA 3VA6A 4J3OC 5DC0A 5GS1A 3QXUA 4K3HA 4KAQH 4M03A 1K4DA 5KVFL 4HJ0C 4OCLC 3DVGA 1SQ2N 3HMXA 1F4XH 3BYTA 1NBVL 5EUOB 3DETC 3C6LC 1SM3L 4L8CA 4MZ3A 2YRPA 1BIIA 3RWHA 4BELD 1G7QA 3LMJL 5FGCE 5D71L 4KROD 2C7UB 4XMPH 1S78C 3PQYA 2CJUH 4JQIH 3RP1A 3AREA 4X83A 2DBJA 3VWJA 4FFZL 5JNYA 4HGKC 4DK6A 5D2NA 2IANA 2NXZC 3SE3A 5DZNA 2E9BA 3TT1H 5I30L 1CGUA 4S0TD 2F8OA 4N8CH 2VZTA 4RBPK 4Z0XA 5MHSE 4N1EA 3NAAL 1JWSA 2P7TB 2ZSVA 4R7NB 3RWIA 3SJVB 1MHHB 1NFIA 4R8WH 2VR9A 5GSRB 3WIFB 4OM0L 4LLDB 5I18H 4P2CG 3TZVA 1ZSDB 4KJQD 3WD5H 3T0EC 4NO0D 3NFPA 5FA4A 3OXSA 4O2EB 5KSAB 1JF5A 4GRLD 4HIJA 4NQSB 5I1DB 5DHYB 3RX7A 1YEEL 1KIQA 3QUKA 2ATKB 4M7LT 2FB4H 3G6JF 4M7ZC 1U92B 2NX5A 3RI5K 4I48B 1NUNB 4GQ9L 3WHE0 1OAQH 4ELMB 2HP4A 1RY7B 4NUJA 4J7RA 4NHUB 5EWIH 4P4KA 6FABL 3H9SA 3KR3L 4NNPH 2D4DA 4YDLB 1YNTA 2DL2A 1G0DA 4Q9RL 3WXVL 1S8DA 5DQDL 1CDGA 5C1MB 4HEME 2EDTA 3TVMD 1RSFA 5H37H 1IAMA 1R3KB 1MFCL 1N64H 3ARFC 4NQDA 1N3NB 3HZMA 5D1ZA 4OZFH 3FN0L 3I50H 3VXQA 5BMFL 2FJHB 1RURL 5DZOA 4ZFFB 4FQQB 1ZK9A 2X4QB 3O3BB 4LLVA 3HRPA 4BZ2L 4RMWA 5LGJA 5I15L 2YKLH 1MI5A 3BPLC 1KLGA 1U3HB 1DVFC 4MD4B 5GRJL 5FYLH 2XT1B 1GHFL 2FATL 3D6GA 2X4OA 1A1NB 3EHBD 3IFOB 3W0WE 1DQMH 4DVRL 5HYEA 1GAFH 3SQBA 1NH6A 2FWOA 1DE4A 1A6UH 5GXBB 2F15A 1A1OB 4PJEF 3LDBC 1D9KA 4WI6A 3U2SB 1YNKH 1O7VA 1H8SA 1ODAA 3PHQA 4XNYH 5BS0B 3DROA 4L3CA 4YHYB 5T33L 4GW1B 1MY7A 4G6AC 1JZ5A 2F8VA 2K9UA 1VKXB 4UZGA 1HIML 5T1DL 1NL0H 3ZYOA 5J1SC 1CGSH 4Q9CA 4ZFOL 4PREA 5FHBL 4HIIA 4HUKB 1A2YB 3OHXA 1S7QB 4LSUL 4LK4A 4ORGB 3ARGA 3W0WB 5IBUB 2R39A 3KPTA 3DMMC 4ALAH 2XKNB 3SCMA 2HLFD 2W60B 2CIIB 5I2IB 3MLPA 1DBAH 3I6GB 4ZFOA 2ZZUT 4PBXA 5BRZB 4APQC 3RY4A 4CVUA 4WIQA 3PP4H 1QA9B 1GC1L 5LG1A 5I8OL 4LIQH 2DQIH 4C59B 2P8LB 3P2TA 2BNRE 3C5SA 4WTWA 1CGYA 2VDQL 2V5YA 3KPPA 4N0CD 3T09A 3E2HB 4G9DB 1U8IA 3TO4C 1FG9C 1QLRB 4XWOD 2PW2A 1CZ8L 3FCTA 3NCYS 5HD8D 4BYHA 3HNSH 3LEYL 3FONA 1EVTC 4YBQD 3O3EA 4JRYA 3ZKNC 4KC3B 2OCFD 3WLWC 4OM1L 1SYSA 3G5XA 3MLTA 5IV2B 1T20A 4OF8A 5FYLD 5F7KC 1BECA 5CP3A 1EJOH 1UWGL 4KI5D 5DK3A 3CFCL 4G80A 4Y16D 3M8OH 2E27L 4XPAH 4C56E 2D03L 4JVPA 2AJZB 5T3ZL 5I73B 4XPBL 2F54B 1TVBA 2AK4A 4JAMA 4R7DB 5JPNB 1YEGL 1CK0H 3BAEH 4NOBA 5J9PA 5C0BA 4U1GC 2YEZA 5FYKD 2OJZH 3Q1SL 1NJ9A 2OI9B 3GMRA 1AQDA 4OV6F 3KJ4C 4UMGA 5HHNB 2DKUA 1U8QA 2UZXB 4YDIL 3TCXA 3UC0L 4K23L 5CZVL 1I9JH 4NJ9L 2F53D 1LK3H 2N56A 1Z9SA 5CBAB 2D0HA 5GJTH 3T4AB 2CK0L 4DUVA 4HCRH 4PJ7F 4NWUL 4C56B 1K3ZA 1NDGA 1RUAH 1G9NH 5IP4A 2PO6A 2EYTB 4WO4D 4WHCA 1IQWH 4FQLL 2YXMA 3QNZA 3ZDZE 4PJ5B 1XIWC 2P8PA 3MRPA 2HT4C 1JGVL 3IF1B 3O6KH 5FYKU 3H8NA 1NGPL 1MCOL 3HUJA 4XB8A 3GNML 3RUGA 3KPLA 5EU6B 1AY1L 1CLOH 1Q0XH 4B5EA 3P30H 2VDNH 4KDTA 2Y1VA 4WJ5A 1MAMH 2L7UA 2RAMA 2IQ9L 2Y9RT 3R0NA 3HE7A 3NACH 3OKMA 3HLAA 1QBLH 2QV2A 4FN0A 4WNQA 2GJ6D 3K8KA 4YQXH 1ZHNB 5BVJB 3LS5H 5D1QB 2H2SC 5DK2A 5KAQG 3WS3B 2AKRB 4KUCD 3A6BH 3OB0H 3LH2L 4I4WA 3SDYH 3WFZA 2O26U 3O4OB 2FR4B 1OPGH 3BIAX 3ZLQC 5JA9A 5GS0D 2NY4D 3D3VA 2GK2A 3P77B 2Y07H 2EEDA 5B4MD 1AGCB 4KZDL 4Z0BH 2YPLD 5JHLL 5GGTL 3RJQB 4HXAH 1RVFL 2VXUH 4NSKB 4MJIE 3WIHL 4MCZB 4EXPX 5I1LB 1IZJA 5TH2A 5C70A 5K9QI 1WBZB 4UIMA 2J8UE 3PJSB 3VI3E 1Z2KA 2XA8H 4P2RB 1UZ8B 4YNYB 1YEFH 3D5OF 3GFUA 2Y5TA 3QIBD 2KL6A 5C0CB 1YZZA 5GGTA 1DQQB 2R9HC 5DEFA 1GJIA 4OAWB 1PKQE 3UP1A 1XGTB 4LAQL 2C3GA 1D5BA 3WIHA 3KVQA 3IVKA 3T2PA 1I1YA 5HHQA 3U4BL 1N5AB 2ATKA 5I1GH 1FSKB 4RAHA 5FO9B 5CJ5A 4PUBL 4QHLB 2CKNA 1IAIH 1TVDA 4MJIB 5K9KB 4Y2DB 4NHUA 1HHIA 4P99A 3R8QA 2Y36L 3ULUC 3O0RH 1A4JB 4OCYL 2XWJA 4WCYH 3PGCB 3T0XA 2QLVB 4XAKD 1RZFH 3TIEB 4OZGF 5F9OL 2H6PB 1ERNA 4IMKA 2W0LA 4DN3L 1UM6H 4U3CA 3U9UB 4C58B 4YBLB 3WHE1 4P4RA 4EOWL 4BSWA 4NYLA 2X4QA 5TF0A 4CMMB 4LU5H 1AC6A 4EI6A 5I1JH 4G7VH 3GBNL 5J6GB 4QYOA 1WC7A 1XH3A 1T1WA 2WIIA 4UU9B 1MCNA 4MD4A 1C5BL 5IUSA 3VFNA 3K2MC 2BK8A 3KPOB 1R3IL 3QQ3A 3FRPG 2W9EH 2AJSL 4M1GL 5DWUL 1G9EA 2EIDA 3GBMH 5IKCB 4F7PA 3LQMA 3R06A 4HWUA 3TO2B 4EN3B 1KEGL 2WUCH 3SKNA 3WKNA 3STZA 2ORBH 1PX4A 2IFFH 3D0VB 5KVGH 4WUUD 5HGAA 3VXTA 1FIGH 5T1KD 3WHXA 4LVNC 1BLNB 2EDFA 5IBTL 3V8OA 1NCCH 3BN9D 1FL6A 3PHOB 4CVXA 5CSZA 4AL8L 1YYML 2NY2B 1EO8L 2O5ZH 2Y06L 3HB3D 3K7UA 2RCSH 5GRUH 1J9CT 1D5XB 1ETZA 3FJTA 1D6EB 1FQ9C 3WDJA 2OP4H 4LLYA 5IOPA 1YEHL 4FTVB 4FFVD 4D3CL 2A6DA 1A7OH 1U41A 1A5FH 4MXQC 1HXMA 1S7QA 3FO1B 1JWUA 4N0YH 3W0WA 2NY6B 1KXQE 2OSLA 3BKMH 4XC3L 4QRPE 3T77A 4LRNH 5IMLA 1AHWB 3IDUA 4P2OA 3D9AL 5IK3B 1A7NL 5EC2B 3I6GA 5FUCE 2ZOLA 3QJFA 4XP1L 4C55A 5EBMA 2BOCB 1FNSH 1J0KA 4FABH 3UBXI 3UTPE 3QXDA 4ZSOE 2AW2A 1I1AC 2YD3A 2P8LA 3QJHA 3GHBL 1U8NB 3DYOA 4ETYA 5L2KD 3U6RB 1FFOB 5CP7B 2UWEF 5DJ6B 1BWMA 3RA7L 2BJML 4NKOA 4R3SA 3WS6A 4X6CE 2CKBL 1J86A 4R90L 3J7HA 2IH3B 1RZIB 1IAKA 4DTGL 3G9AB 2Z31B 1YA5A 5A2JH 3BZFA 5GGSY 4BKLA 4HEPG 2FIKA 1RAMA 5JLZA 4BUGA 5GSVB 5CKGA 1F4HA 3IDNB 4OCWH 4MS8C 2A73B 5IV2A 4N0FA 1CFNB 1FP5A 2JCCE 2OL3L 3DI2B 5J11C 2X2YA 4TUKL 1FGVL 2HKFH 1PEWA 1YEIL 4LPTA 5HDQL 3VFWA 2WUBH 3V0WL 2E8ZA 4RAVA 5SWSB 3TNMB 3GJEA 4MQTB 2BNRA 1YJDH 1KCVL 1WLHA 4YPGA 1BZ9B 4IRZH 2VUOA 1EXUA 3GIVA 2HFFA 4RCAA 2OL3A 1JWMA 4OJFH 1XGPB 3DV6B 4M1CC 2JTDA 2GY5A 4U7MA 4YK4B 2HH0H 1TJHL 3C2AH 5EA0L 1AIFA 1RZKH 2R15A 1LO3H 3CXDL 4HQQH 4R2GD 4Y1AD 3VGFA 2IALB 1WF5A 1LO2L 3CZFB 1CE6B 1Q9WB 4JHZA 3FFCE 3OJDB 3EOBB 1HYSD 2HA1A 1GRWA 4C56A 4I18C 5CGYC 1KXVC 3F7QA 1HOCB 1BJ8A 3G5ZB 1AKJA 4L9LC 5I16A 4QRSA 3EO1A 1TQCB 5J1TC 1WWWX 3SE8L 3NCEB 3QDJE 1YEDA 1UEYA 2JCCF 2XWBA 5L7XH 1C1EL 2VXTH 3B2UC 4KFZC 5ID1B 4PP2A 1YN6A 4X5XB 5GGSB 3WLBB 3QA3A 1PYWA 1K8IB 5F3HB 3CD4A 3VD3A 2ITDA 5EPMA 5MP6H 5ENWB 3CU7A 4ERSL 3L3JB 3D0LA 3UJJL 2HTLD 2LVCA 3OGOE 1J87A 4J4PA 1CQYA 3FFCB 3PDOB 4GS7B 3MLUL 3MRBA 3GMQB 1HSAA 5AWNH 3EO0B 3LSOB 2EDRA 3WFCL 1JI2A 3FRUA 1BREA 3T3PE 2C4FT 1UB5B 5ADOL 5B3NA 2ZCHL 4LHUA 1CFBA 3RU8L 5BVJA 1K2DA 3N9GL 1LO0H 4H5SA 5JOFA 4TQEL 4XVSH 1T7ZA 2FX7L 3RZCC 2J7LA 2ARJQ 4DKFL 5IESH 2NXYC 4EBQH 3OQ3B 1ZHLA 4Q6IB 1PG7W 3MUHL 4DZBB 3SDAB 2CRIA 4NM8H 1MNUH 4K71C 2G9HB 3IDJA 3NIDE 2X4NB 3O3AB 2DQEL 1EGJL 5ICXB 5JHDD 5ESAB 4M6OL 5DJ0A 1AH1A 5I1LA 1NAML 2XTJC 1QEWB 4YUEH 3TCLA 1MIMH 5HGBB 4ZAKB 4LCCA 4JHAH 2VLJE 1A0QL 4IDLA 4PJ9B 2NY7L 4P23C 3VXRE 1VGEH 4OAWA 5HYJD 1T6WA 1JJUA 3AAZB 4I0PB 4WWKA 3FQWA 1NAMA 2OZ4A 7FABL 4F57L 3CFJB 3UYPA 4QNPF 4UB0L 4WI5A 1NC4B 1IEAB 1V7NH 4OLYH 1VFBA 4EJ1C 5FO9A 4OZGA 4TUOB 4PJXB 4QHLA 5EOCH 4Z7WF 1OCWH 3DIFA 4NT6A 4HUWB 4MJIA 4S1QL 5IMOA 5JR1H 3PWUB 4U2ZA 3PP3K 3SGKC 4M7LL 2J8UA 1J0IA 1L0XA 4PG9A 5F96L 4S11A 5D7KD 2I5YH 5K9OA 1ZHBA 3PGCA 3FMGL 3BZDA 4YFDB 2A83B 3RWGB 4FOMA 4L3ED 3LKPB 2FJGA 3FB5B 3KXFE 2AQ1A 2LFGA 3U9UA 2CDEA 4IJ3C 1IGMH 1PKQA 3NZ8B 2J88L 2EEBA 4MA7H 4K7PX 1S9VB 1SJXA 2NZ9D 1Y0LB 3DHJA 3IJYA 4Q2ZB 1F3DJ 2VL5A 3O9WA 4HGWB 4ZFGL 3ALXA 5KJRL 2KPNA 5C9JB 3QIWC 4U6YA 4ODTL 1P4LB 2R1YB 1EHLL 4DGIH 4U33A 5AAWA 1ZANH 2DJ4A 3SDCC 4E41D 2B4CL 3GSVB 2AXHA 1LP9E 1N8ZB 4OCRL 4K94L 5ICYA 4L8BB 1BLNA 4ELKB 2R8SL 3F7PC 1RIVH 3QI9B 1LK2B 2AJXL 1TETL 3VFPA 2OX5A 1HKLL 1T1XA 1X7QB 2R4SH 1JZ6A 1M71B 4IIQC 3RNQB 3TESA 3VWKD 5K59E 1JPST 1PGRB 4XHQA 3LOWA 4BK5A 1TDQA 1JPGA 1P4IH 2XZAL 1FNLA 3DX9B 5IMMB 4NRYA 4OLEA 4HZAA 5D7LB 3FO1A 5BXFB 3MGTB 3O6FB 2EIEA 3FT3B 1DN0B 1EZVX 4CL7A 4M7KL 4H26B 1FGNL 1RV6X 2P5ED 5B38G 3WFHA 2X4SB 2W0FA 5E4EC 4L4TB 3V6BR 4S0SD 5D96B 2E9WA 2BOCA 4O00A 4OZIE 4X98B 5IQ7H 2FRGP 4X4YA 4CBPA 4GKNB 4MB3A 2WWKO 1VFAB 1QSFB 4J3XA 2EE3A 4LVEA 3NPSC 4RWYH 2GCYA 4OGAD 1UM5L 1Z0NA 1U8LA 4HJGB 5D1XA 3S3PA 4POYA 4QRPA 3OKYA 2NY1D 5K59F 15C8L 4HF5L 4WU7A 1WVZA 4HWBH 4P46D 5IJKC 3SKUD 1KB5B 3CJJA 4Y5VC 2VXVL 1CT8B 1IGFH 2VL4A 4OD3L 5SWQA 5ACZA 4K7PL 4ZSOA 5DRZA 2WQRA 3CFIC 4ISVB 3HCVA 4PRPB 3ZDXE 4IRJA 1BZ9A 3F7VA 5DT1H 5ITFB 1KFAH 3BYYA 4X6CA 2CSPA 2YXFA 4G8FB 3QO1B 1X3DA 4AJ0A 1X5KA 3SBWA 3QISA 5DYOB 3TYGH 4JANB 3I85A 1MRFH 5HDLA 4H8WC 3U0TA 4HUVA 4MMZC 3MLWH 4X5WB 3BEWA 4PFEA 1OTSD 4I77L 4U1HB 1MPAL 4AEHL 1RZJL 2JCCA 4PJHB 1L7IL 3HFMH 1CE6A 5DJ8B 1ADQH 4FQXD 5E2VL 1R3HB 1EK3A 3OJDA 2QQLL 4HC1H 3JWDL 4QRRB 2HJKA 5H2BB 3RGVB 3G5ZA 5E8OA 1AE6H 3QXAB 1E0OB 2ZOKB 1Q1JL 2V5RA 1L6XA 4TOYL 4X6DB 3T65B 5B39G 5F1SA 3D1MC 2V7HA 1C5CL 2Y4SA 5FYJE 5F3HA 3L5WA 4WV1A 1LEKB 3CFEB 3SDXF 4LOUC 3QWRD 5BQ7A 1MF2H 1I3RA 2H26B 4JRXE 2AI0H 3FFCA 3GMPA 4DEPB 1YC7A 4G5ZL 4M43H 3CH8A 5I71B 3DX8B 1MQKH 5EOTB 2DYPD 2XFXB 3RWDA 3W2DH 2D9CA 2Y6SC 1I7TA 4MQXD 4TRPL 4ZTOL 3QDJA 5MENB 3FOMA 4KQ4L 4M5YH 3G5VA 5HI5D 4F2MA 2FBOJ 3MLYH 4OD1H 4M61B 4RISH 4P5TC 1SEBB 2IMMA 3BD5A 1JUFA 3JWOH 4HKZA 1G7PA 4HG4K 2HWZL 1R24A 5F1IA 1KJ3H 4DAGL 2X4NA 3O3AA 1XZ0B 3UPRB 5ICXA 2Q86B 1NCDH 3PWLA 2ZSWA 4M62H 4ODVH 4L8SC 2M26A 4FG6D 4NNXB 2BY2A 4FMKA 4W81A 1IKFH 4F37F 1F4WH 5F6HI 3ECBA 1HXYB 5HGBA 5EZIL 3Q5OA 2P8MA 2GJZB 5J0BA 4G7YL 3ARTA 1I7RA 2DQGL 5GGVY 3MV8E 5JO5B 5CGMA 4NKIH 1T5XA 2DLIA 5IFAL 3BQUB 5F7EH 5IB2B 5I66A 3P4OA 3AAZA 1FO0L 4RFEB 5IVXB 1R0AL 3NFNA 1E4WL 2Q87A 1IEAA 1UXSB 5INCA 4KK9C 4OTXL 3E1F1 3K8MA 3DTXA 4P2RD 1R5WB 1JZ2A 5D7IB 3RTQA 2RBLA 1IBGL 4IMLA 4RQQB 4M5ZL 5DZLA 1CL7L 4W68A 2A9ML 3GSRB 4HUWA 4LSQL 3PWUA 1U91B 4LVOB 2P5WD 1FO0A 3QULB 4XNMA 3WV0A 4Y19E 5DSCA 4XPFH 2FSEA 1YC8A 2X70A 3IDXL 3NN8B 5DURB 2A83A 4XP9H 3RWGA 1XAUA 2VLJA 3MV8B 1Q9OA 4YAQA 1M6OB 3VXRA 1JTTA 4ACPA 4F3FA 1KPRB 1W0VB 3DVNB 5KVDH 3AY4C 3H42L 2G75B 4I8DA 3OB8A 4I9WD 3SGEI 4KKAC 5FIEA 1XCQB 2HTKD 3O8XC 4HS6A 4EI5B 2WBKA 5DJAB 2G5BA 2OQJB 3H3PH 5DMKB 1S7SB 2DI9A 4KKBC 3C5ZB 1G7JB 1J8HD 5CWSB 1L4IA 2EDWA 5TE7H 3RDTD 3RHWK 4DW2H 4HIEA 2EH8L 1ZXQA 3R8BB 3F65A 4XVUC 3C2SA 4X5LA 1GGCH 1DL7H 1KELH 5E08H 3N06B 4OZHF 5C0AD 5E8EA 1LWRA 3STBA 5DD6B 3KXFA 3PHSA 5A43C 3MRLA 1HHGB 5DC4B 3PIQA 1YECH 1MCFA 3IFLH 4LCIH 3I6LE 3QFJE 5ERWA 3GO1H 5E2UL 4RX4A 1A6ZA 3CCHB 4Z7VF 3D39D 3WE6A 4U1LB 5HSFA 5D9SB 1RZGA 3BH8B 4LFHD 4WHDA 2RB8A 5DHVA 3V52H 3DWTA 3BIKA 3U7WH 1VPOL 5IMMA 1K4CB 4OI9A 1EA9C 5FB8B 2I9TB 1FORL 1SVZA 5TDPA 3IDYC 3O6FA 4X6FA 5C7XH 1LP9A 5IM7B 1H3PH 4YFLF 2ZUQC 4H26A 3NH7H 4XZUB 2B8OT 4G9FB 4RFOL 1GVIA 3S35L 4NJAL 5JQ6H 1IFHH 4YHNB 4PJFF 3TA3B 1MJ7L 2X4SA 2X1PA 3BD4A 3LKNA 4RZCB 4NQCE 2MQCA 4WI3A 3SDDC 1P69B 2NY0C 4XCCH 1WAAE 3DSNA 1XR9A 3CVIL 2EDBA 4MJ6A 3TBSB 4QXUH 2BRRH 2FO4A 5IROA 1KJ2B 3B9KC 2HRPH 1HQ4B 1QRNE 5EIIA 1UGNA 1VFAA 5IT2L 3TV3L 2A77H 3JVGC 1QACA 3IU4L 3H3KA 3KYNA 3T0BA 3W11D 5I75C 3QEQE 4AM0B 3MRGB 2VLKE 3JV4B 3QEHB 4OGYH 1JRHL 1BFOB 4NCC2 1SMOA 4GRWE 3LQAH 5EU7C 2P45B 2G60L 2MMXA 4KJPD 4LSTH 3VXUD 2ED8A 3ZKXC 5ALCL 3MBEA 1JGUH 1UVQA 3L3IB 5C0FA 4OT1H 1H3XA 4OD2B 1IGCL 4W6YB 4Y4HA 2R0KH 5E8NA 4K8RL 1CN4A 3BPNB 4GBXC 4OZIA 5GQBA 1F6AA 4Z78A 2HLFC 4AIZA 2X7LB 4FZ8H 3ZSSA 1DQJA 2C1PA 4ZXBB 2K7QA 4JDTH 2OS7A 2PYEB 5DA0B 3VU2A 2XG5A 4JANA 4MD0B 1F4AA 1A7QL 3MA7B 1GGBH 2XKSA 5JIKA 1D7FA 1UYWL 4GRWB 4XNQA 1EFXB 4JPKL 4XNZC 5C07D 1LHZA 4HUXB 3IRZA 4NQVB 2EDDA 2MHAA 4XWOC 4A6YL 2R1XA 1TCRB 4YBQC 1DZBA 2GT9B 5H2BA 2LAAA 1QTYT 3SDXA 3I02B 1E4XL 2KZWA 1DN2A 3PWPE 1FRGH 4PTTB 3RVTC 1UM4H 1N7ML 2ZOKA 3VFSA 3B2VL 3NIGE 2WBJD 3ZO0A 3S37X 3HMWH 4A6YA 3BZ4A 3DXAE 4HK3N 1FPTH 4L4VB 5KVEL 1R5IB 4BZ1H 4PJ8B 3LIZL 1V3JA 3ULVH 3L5IA 4ZO7A 3G6JB 1T03L 4LKCA 3CFEA 1NCWL 3G5YA 4O5LH 4ZO8A 3QQ9C 3F5WB 1KT2A 1NEZA 1AD0B 1WFUA 4XCFL 4OFPA 1H5BB 2VDRH 2L7JA 2XN9E 5EOTA 1P7QA 3DUSA 1A6VL 1QFUL 3PWPB 3WIIH 1PG7X 4PJAE 4OIIL 5DJXA 5F7DA 4RWHA 1FJ1B 5EO0B 4ODXB 4G8IA 4Q9QH 3N1MC 4QOKD 3VI4E 2R0ZH 2Z9TA 2NW3A 1S3KL 5FO7B 3IFNL 4PY8I 2QKIA 4XI5D 5KOMC 4ZDHB 4K3DH 5B22A 3U0WH 4Y4KB 3D2UD 3LEVH 1LDPL 4JRXA 5C8JB 2AJYL 1UA6H 5DQJB 4HPOL 1XZ0A 2Q86A 1TLKA 5DUPL 4MNGE 1NCBL 3T1FB 4WEBH 4TSBH 4PJEB 3OSKA 1IARB 4MAYB 1CGVA 4KWUA 3RY6C 5DK0B 1YPZB 3BDBA 2JJWA 1JBJA 1J5OH 5D93C 1BQLH 1ZGLM 1NGYA 3X17A 1NDMA 5IEHA 1NMCB 4MNQD 1UXSA 2AXGA 5I1KL 3VI4F 2J12B 3BI9X 2OLDA 1A7RH 2NR6C 3Q2CA 3RIFF 1HH9A 1S7TB 3O4LE 3OZ9L 3QUYD 2DQCH 5ALBH 2FECL 2AS5M 3QULA 2A2QT 5GS1C 2X10A 3S37L 1NC4D 5BZDA 4B50A 4JB9H 3CFDB 5E9DE 5ESQB 1MEXL 3MV8A 3VXSD 2HJFB 5T1LB 2FDBP 2ED7A 2MSPA 4WI4A 5MI0B 2BSTB 1W0VA 4LRIC 1WIOA 2EDLA 4WGVB 4BFGA 3WN5C 1W8NA 5FGBC 3HRZB 1CVSC 1XCQA 5AD0B 3VWJC 5DMIL 1S7SA 5E6ZA 5EN2A 3C5ZA 3T0EE 3V5HB 1PG7L 1CI5A 2QQKH 1G9NC 3GSUB 5D7JB 5C0GA 1C08B 4EIGB 1ZHKB 4MWFA 3P0YL 4OFVA 4Y19A 3X3GL 1IJ9A 3U4EB 5KTEH 3HTLX 1KBGL 1EMTH 1JHTB 3SGDI 5GGRY 3Q6FA 2HG5B 3PV6B 5MERA 1ZT1B 4B7LA 3VGEA 4WI7A 3ZYZA 1KB5H 2I07B 1KJVB 3HC3H 1BD2E 3EYFB 4L8DB 2F5BH 4U6VL 2Z35A 3C08L 5C09E 4JO1L 4KMTL 4HWEH 3PXHA 4U1LA 5D9SA 2AEPH 4PRIE 2ADJA 2H3NB 1S7VB 1U8OB 1K4CA 4KI5F 1AGBB 1FFPA 5FB8A 5ID0A 3CH1A 3W9EB 2I9TA 3H7LA 4LPXA 1T6VN 4PJCE 2DQFB 2GW5A 1INQB 2BXYA 1Z3GL 3BRDA 1MLBB 4TNWF 2XTLA 4JO2L 5D1ZC 1IGYB 1URLA 4PGEB 4XVJH 5HHMB 3P11H 1G9MH 4X4XA 1NCAL 3TBSA 43CAB 4UDUA 3EDEA 3MLVL 3QFJA 1GGTA 4NN7C 5DJYB 3C60D 2OTUA 1P84J 2Q20A 1P4BL 3ARFB 4UTBH 1AP2B 3ARBC 3LN5A 3BH9B 1H3VA 3RL1A 3N50A 1OM3L 1C7SA 1WBXB 2GKIA 3S6CA 1JZ3A 3MRGA 3JV4A 1ZA3A 1CS6A 4JO4H 4MDJB 3S96B 2DAVA 2I60L 3HPLA 5GGRB 5L6YL 1G0YR 5ITBL 5ANMB 4CKVX 3BP5A 4DQOL 3ZL4H 3P0VH 1R3JA 4FFZH 3BUYB 3L3IA 4DOHE 1CBVL 4UT6L 5I30H 1TZHA 2AP2A 2Z8VC 2KDGA 4OD2A 5JORA 4NQCA 4M3KB 1OLLA 5B39B 1WAAA 5DO2C 1A6WL 1T66D 4UT7H 4XXDB 3QRGL 4FQCH 4PJCF 4WFEE 2IEPA 4HMEA 4U1MA 2BNUB 1RUKL 3MNWA 3DI3B 1QRNA 5E03A 2Q8AH 5B8CB 1S9KC 2P43B 3QUMB 3RL2B 1BGXL 1CXKA 1ZVYA 5F3BB 3QEQA 1WEJL 3DGCR 4M6NH 4PBWD 2VLKA 1J1PH 2BY1A 3MOBH 2UYLB 1D5MB 3V5DB 1EFXA 3A67H 4GW5B 1Q72H 2UV3A 4WI2A 5TE6H 5BVPL 3EYUL 4PRPD 1XF4B 3VRLE 4EDXB 4H20H 4KUCF 4L4JA 4RFNC 1IAII 4WTZG 1OQXA 2XG4A 2LAGB 2AABH 3QIUA 2WWKT 4WY7H 3KYKL 1INEL 1BAFL 3KPQA 2NY3B 3F8UB 2DQDL 1HE7A 4FFYH 6FABH 4P9ML 3SQOH 1DUYA 1AC0A 5DQDH 4JCLA 1QSEE 3V7AE 1F00I 3L6FB 1BQHG 2J1KA 2C26A 1MFCH 3JV6B 1QPPA 3LZFH 3FN0H 1EBPA 1XF2B 3HN3A 1RHHA 2K3TA 3UTQA 4Y8DC 1WT5C 4JFQB 4MSWA 1MCIA 4NPYB 1Q0YL 3ARED 3TO4B 2IAND 1KIRB 2FATH 3RNKA 3MRDA 4Q74A 3S8WA 1ED3B 2C3VB 4XXCA 1LE5B 1ES0A 2FHCA 2Y7QB 3SO3B 3PWPA 1QSEB 3ROOB 3FQRA 4FHBD 1WIPA 3VRLF 3TZVD 1K9TA 1LEGA 1FAIH 1XF5A 4KK5D 3DXAA 4UDTA 1JNLL 2BSED 2YMXL 1LQSR 3C87A 4JKPH 5GPRA 4U6HB 4F9LC 2Y5EA 1AGFA 1M7DA 4MXVF 5HI4C 1CDJA 1XGRB 4Y4KA 2UY6A 4NNYB 1VENA 3REVB 2X4RB 1HIMH 5F7FA 2NX5D 1RJLB 5IW1B 1CVRA 4OIAA 1HK6A 4QHMA 5C8JA 3OKLA 1AJ7L 4JFDE 4KY1H 5EU4A 2XN9A 5ISZB 1MRDL 3H9SD 2ICWI 4PJAA 5CZKA 3UCRA 2HTLC 1X5GA 2BVTA 3AM8C 2E6QA 4NP4L 4Y2OA 5GGVH 4KK8D 1MJUL 2R4RH 1HINH 3S3JA 5DK0A 5IF0B 1GGIH 2NTFA 4IRSC 2KBGA 4DVBA 5LQBL 4LLMA 4M48H 4P5MA 1QHPA 4HIHA 4MQ7B 5ABDE 1MI5D 2VDQH 1KCUH 2DDQL 1F4YH 4X7CC 3MZGB 3VRJA 3ZKMC 1JYWA 3HAEG 4JHWL 3FQUA 2LABA 4PB0H 4GRMA 1IC5H 2HN7B 4MNGA 4G43B 5JW4R 1A3RL 2X9WA 2AJ3A 2RIKA 3LEYH 4M02A 1YJDC 3MMEB 1OWWA 5I1HH 4Y88A 1PJ9A 2DIJA 3DO3A 3CVHB 1L0YA 5HHVH 5F93C 3QPXL 2HFGL 1YMHB 3FOLA 4DGYL 1IQDA 3CFDA 1D9KD 5GGQH 1UWGH 3EOAB 4X80H 4XT1C 3BKCL 3ROLB 2D03H 3QSKB 1CGTA 1RZKC 1JF6A 4LSSL 2HT3C 4HUMB 1YEGH 3JXAA 4WW2C 3C6LA 3H0TB 1KJ2H 1P1ZB 1U8KB 4U0QB 4ETQB 2ICCA 2B39A 3O4LA 1RFDL 3ARGD 1PKOA 4PR5A 3UJIH 2YC1A 1RU9L 1I1FA 3UC0H 3ZKSD 3SCMD 5CFHA 1CFTB 1M7IA 4DKEH 5E9DA 1JHTA 3OKNB 3NZHL 3WFEL 3WUWA 1FLRL 4LLWA 3X13B 5EU5B 5CJ8A 4FS0A 2BFVL 1MIEL 5KSAC 4WHYH 1S5HB 1I1RA 1OARL 1HILB 2P24A 4FQLH 4HDIA 2AV7A 1U9KA 3FFDA 4JDZA 1GZPA 1JGVH 3QUZB 2VDPL 3S97C 2W65A 5IFHL 3BWUC 3V6FB 1DBJL 3T0EA 4X9FA 5LCVH 1MCOH 1Y6MR 3DV4B 3GRWL 4R96A 1OAZL 4YJZL 4XRCB 4UOW0 4JRYD 1GSMA 4YDLC 3AB0B 4LP5A 1OW0C 3OWEA 2EE2A 4J3UA 2H8PA 2BC4B 4F7TB 3MRJB 3VD4A 4PGDB 3KLHD 2HKHH 4S1DC 5EU3A 4LCUB 3GRWA 1BD2A 3MFGB 4QRQA 3F58L 1NFDE 5C09A 3HPJA 5I8CA 2I27N 5C0BD 5KW9H 3ARFA 1A4KB 3MJ9L 1U3HC 4PRIA 2A1WH 3MV7B 1NBQA 3BH9A 4PV8A 3QHFL 1T7YA 3TA3D 3OKEA 3QDMB 1WBXA 1HNGA 2ZKHH 3QPQC 3WEXB 4EQ3A 3AXLA 3ULUF 5IB1B 4I5BA 4NDMB 4PJCA 5ILTH 4DKDC 4PGBA 1RMFL 1DVFA 5ECJE 2D4FA 1E4JA 5JDSB 3MJ9A 5FDWA 1M1SA 3MFFA 4JHBA 3GK8L 4URTB 1KTDA 2PO6D 2JB5H 3DGGB 3BOVA 5CMAB 5TGBB 3MNVB 3CDGB 4HX1A 3S36X 1RIUH 1QFWI 3E8UL 4HS3B 3U0PA 2PCPB 3VXPB 4AENA 4D0DA 2KH2B 5KBNC 3MRQB 2V7NB 1CFQB 3EYSL 1B6DA 3LB6C 5DMGD 4ODUB 5T1MA 4HFWB 5HPMB 4U1NB 2FBJL 1NFDF 4F58L 2UYLA 3QO0A 3X12B 5C0EA 2GTZB 5A16A 1FVDB 4GW5A 5C86A 4PUBH 2MOVA 4OUOA 1IILE 3IS1X 4QRUB 3HE7D 4TPRL 5EUKB 4M93C 3STLB 4HUNB 3E0GA 5TDOA 3SO5A 4OGAC 5D6CA 4AG4H 5CLTA 4WEUD 4WWID 3W39A 3DMMA 5HGGS 4KRPB 4FNLH 4D9QE 4CADB 2GQHA 3MRNA 3RIAK 1C12B 2CLRB 1SJHA 4OV5B 4LDOB 4JY4B 4PYHA 4LPVA 3E2HC 2YPKB 3RBGA 3HZKB 5TPWH 1YEKH 4EOWH 2FZ3A 4APQA 4AMKH 2CDGB 1RD6A 1JNHB 3O41A 1CLZH 3D3VD 2DL9A 3KPNB 3K3QA 3MO1B 3S5LA 2FYYA 1KLUB 3MLRL 3HI5L 1CD9B 4XMKH 3T0WA 3TO4A 4G6KH 1X5LA 2NYYD 3WKML 2R56L 5TQ0L 3OAYK 4M1GH 2C3VA 1B9ZA 4FXKB 5HYIA 1LE5A 4J3SA 4P2YA 1DBKL 5IBLD 3BXNA 5I73C 1ONQA 1QSEA 2OJEB 3JWNC 1YQVL 2EYSB 5J11B 3KJ6L 3MRFB 5CJXC 2OR9H 4LGPB 2CQVA 1S7UB 2OI9C 4NRZA 2FEEI 2PW1B 2CH8A 2JF1A 4JGJA 1D5IL 2VQ1A 1U95B 3RVXC 4QGYA 5GZOD 1G7HB 1Z9OA 1NGQL 4MJ5A 5CHNB 4MHHI 1YEJL 5KG9A 3S36L 2H9GB 1MWAB 3PWVA 3VE0B 2DTSA 4HKBB 2XACC 2D0FA 3C5JB 3HE6D 1FL5A 4PGCB 2VLLB 4JGUA 1A7NH 2Z91B 3BP6B 5D5ME 3WFDL 3TN0B 4IS6A 4G3YH 4XAWH 3RPKA 4MQ7A 4S2SA 2XRAL 1XIWA 3I6KB 3MCG1 3L3KA 3IDGA 3RA7H 2ADGB 1AXTL 1JPTL 4JFDA 1CR9L 2CKBH 4PLJC 2IMNA 3UYRL 3OJ2C 4DTGH 1ZT7A 2Y25A 1CE1H 4OCXL 5EIQA 4LSRL 1PEZA 3MBXL 5FM8A 1A9EA 5FKAA 5D1QC 2ITCB 2F19L 4RIRA 4I3SL 5CD5D 1PZ5B 4MVBD 2IPKA 5D5MB 4JZNA 1OSPL 3O45B 4ODWB 4KV5E 5HDQH 3VDBA 5T3XE 3MR9A 3FHAA 2QSTA 3V0WH 3MRMB 3MOQA 3KPRE 5C0IA 4HV8B 4LNVA 4YGAB 2XTJE 3KHQA 4PRHB 5EC1B 2VDOH 1NBZB 4HUUB 2EO9A 1ZEAL 5IW6B 1T0NB 4OLWH 5GJSH 3MXWH 1U8KA 5T5FH 2BOBB 3MLXL 1ACYH 2VDML 4NZTL 1J0YA 2W38A 4RMRA 2V2XB 4X99A 5HYFA 5CEZL 4LHJB 3ES6A 4JM2F 3GKWH 4WUKL 5EA0H 4P2OD 3CXDH 3BZEA 1SVCP 1G1CA 5AZ2L 3BPCA 4CW1A 1TTUA 2YD8A 3VRIB 5BOPA 2BSSB 3C8KB 3UTSB 1I3GL 3X13A 4LF3B 4JFYA 4RGNB 5E1AB 1A02N 3R0MA 4AH2B 3LV3A 1FSKC 3QXWA 5C0DA 4PJGE 4I2XE 3QUZA 3DVFA 3INUH 4P9HC 2PETA 4KV5F 4P23B 3QUMH 2GFBB 1JFQH 4FQHA 5JA8B 3DV4A 4K2UL 1RUML 3ULUL 5HHPA 4Y2DC 5JIHA 1VADA 3GSQA 3LQZA 1ZVSB 4P57B 3HR6A 5IMKB 3PL6B 1XCTA 5KS9E 3H2WA 2EDQA 5ESVA 2V9TA 1QFWM 2XZQH 1DSFH 1NMBH 4YBLC 4QRTA 5SWZE 3QHTC 3E6FA 4DKAA 2BNRD 2H2PC 1QZ1A 5ADOH 5DI8B 2J4WH 3SPVB 2LQRA 3N9GH 3QG6B 3EYQC 3B5TA 4XBGA 5F6HJ 2Q8BH 1A6AB 3O2WL 1KC5H 3IFPB 3NCJH 4PPTA 3MLZH 5C2BL 1CICB 2EZ0C 4QTIL 2DWEB 3MUJA 4YDVA 2MCPL 4JZJB 5HHMD 4UUJB 4WGWB 4EN3C 3PWJA 5FM5M 1X4ZA 1S7XA 1MCPL 2FLRT 1B0GA 3QFDA 2O5YH 2IQAB 3L5XH 4JY5L 4Z8FH 2WANA 2DQEH 1BQHB 1EGJH 5SWZB 3VFOA 2APBA 2OMBA 4YHOL 3T2NH 5IW3A 1B0RA 4ZS7L 1AKJD 2BMKB 3U7YL 3FB8A 2NY2C 4AZ8A 1NFDA 5E99H 1EEZB 5KS9F 3QDGB 3BESR 4P59H 3O2VL 3NBNA 3EDDA 3GSXA 4AY0A 4JLRB 1UJ3B 4JFZH 5KSBF 1A0QH 3U48A 3BW9B 5IIEA 3V7MA 1CFQA 1Z0MA 1EV2E 3DYMA 4L29A 3N1GC 4ODUA 7FABH 3FQXA 3TJEL 4HFWA 2NY6C 4E0RB 3U9PL 2P47B 5I1CL 5IJVA 1M4KA 4KPHL 4J4PD 1AHWC 1JYVA 1PLGH 2VE6B 5C08B 3NABH 4WDIA 1R5VB 3UBXA 1N6QL 3T4YB 3DRTB 1N0XL 4KUZH 4S1RL 2ZUWA 1U8MA 4LHUD 4EUPG 1MAKA 1YN7A 3FMGH 3VGGA 4GKOA 4OV5A 5E4EB 5FXCH 4JPWL 4CNIB 5JXEC 3HZKA 4KGJA 3V0VA 4XTRC 5DVMA 4LNRA 1X5JA 1T2JA 2DQTL 5E56A 5B3JF 1I8MB 4LP4A 2Z31C 1I1AA 1JK8A 3I3EA 5FO8B 2NY3D 3KPNA 1KJMB 2LU7A 5EZOH 4OLUH 4Y4FD 3D18B 1EBAA 3NPSB 2VLME 2YA0A 4J6RL 1BBJA 1I8KB 2JIXA 1OAKL 4G6FB 4NIKB 5F8QC 4MA1B 4OUUB 2ZCLH 3B6SA 2R69L 1WFOA 3I75A 3B9EA 3RWFB 1SJEB 1VFUA 2AJVL 1IC7L 3CDYA 3CVHH 3QDAA 3V4UH 2R2HA 4HBCL 2EDYA 3FO0H 2XNAA 4HS8H 1U36A 2AJXH 3HAEB 3SKMB 2XA3A 3CSYB 4WWKD 4V2BA 1MWAL 4TVSa 5EFIA 3UTZB 4YK4C 4LASH 3LKOB 4LKXA 4P3DA 1SYVB 2C4XA 3H3BC 5DJ2B 4JFEE 3ZT7A 3MRKB 1MFDH 5CHNA 2D7TH 2WLYA 4OZHB 1MWAA 2AEQL 5E8PA 1BVKB 2XZCH 4HIXL 4YE4L 3GM0A 1FGNH 5HYSA 2QHRH 1TQCC 3C5JA 4YXLL 2E8YA 3BT2L 2KUTA 3ILPA 5GRWA 32C2B 1U8HB 3GGWA 4I18A 5DJDA 3PWNA 2DRUA 4GKZA 1E28A 3LQAC 4L9LA 1N4XL 4Z7VB 5T5NF 1U8JB 2EYRA 2QADD 2A6IB 1DQLH 3I6KA 4GXVL 3O9WD 2LU3A 2GIYA 3B9VA 1H0DB 1JF1A 4GUPB 2PYFA 1EEYB 4GS7C 2ZWLT 4V1DB 1AO7B 4XI5C 4CDHA 4OGXL 4UQ3B 5L9DH 3HG1B 2BSRA 3L3GB 5JOEA 1DBBL 2WQ8A 15C8H 2Z92A 1E27A 3V9FA 3V4VL 4J3WA 2ESVE 2H32B 1RIHL 5D5MA 4JN2A 3MJ8B 3MTRA 2Y72A 2R23A 4K7PH 3GMOA 2VSCA 1RJYB 3TBWB 3ZYJA 5L8LB 4Q6IC 4L9DA 3LRGA 5D8JL 3U46A 3SDAC 4NGHH 1DANU 5EO9B 4HXBH 5T3XL 5SX5K 5DQ9B 4JFFB 1RUPL 2ADFH 1HH6B 2H1PL 2VH5L 5IGXL 5CUSL 2NQCA 3RZCA 3C9NA 2ZJSL 2XPGA 3M07A 4H1LG 5C9KA 4LCWE 4WI8A 1WWBX 3IDIA 3SEPA 2HMIC 3WFBL 3WDHA 4Z77B 3D85A 4ZQKB 4AEHH 1RZJH 3HC0A 3KYOB 4ZAKC 4DN4H 3BFOA 4DGVL 4PBVC 1TZGL 3SGJC 3KPSE 1JHLH 1W2KT 3IDMA 4PJ9C 3C8KA 4TNWK 3ULVC 3KPRA 4QHNB 5KSUB 5I8KL 2FX8L 4I0PC 1G7MA 3OAZK 5CZXC 4RGOL 1MJ8L 3TIDA 4GG6B 1SBSL 1QVOA 1ZE3C 3VFUA 3VJ6B 3JTTA 3P4MB 5H8DA 1KCLA 2YA2A 4TOYH 1WBYA 5DD1L 4P3WA 5H35A 5F9JA 1IGJA 4P23A 4LSVH 2AV1B 3RWJB 1U42A 4R4BA 5D1XD 3IYLW 4KH2A 4QRPD 2MKLC 1ZLSH 4PY8J 3VFVB 4O2FA 5IMKA 4X6BB 4I0CC 3FT2A 3VFMB 2FH6A 2HVKB 2QSQA 1CWVA 1G7LB 1DEEB 12E8L 2B5IB 2O61B 4D2NA 1FAKT 3UTPD 3VG9B 1K6QH 3VMOA 4KROB 1ZT4B 4EVNB 5BJTA 5KN5A 4NO3B 4IRJD 2DN7A 2RFXB 3K80A 4TRPH 2YPVH 5CCKL 4PJGA 4D9RE 4I2XA 4KQ4H 2ICES 4OQTH 2AXJA 2W59A 2V2TB 3U36B 3QZWA 2OXHA 5TE4L 2J5LB 3DSFH 3FT4B 5B21A 3EOTL 3KWWA 4Z7UE 1JZ8A 5BO1L 5KS9A 1X5AA 1T80A 2YUVA 4UINH 4XCNA 4F7CA 1GZQB 2C3WA 1S9XB 1I8IA 3GMNA 4NO0B 3QIWA 3THML 1I4FA 3ISWA 1BQHA 5SWZA 4GRLB 1J12A 3QI9C 4L5FL 3S34L 1ZLUH 5GIRB 3V8CA 2ICEB 3CSGA 3SDCA 3LKSA 1J0ZA 3KDMA 2QJDA 3ARUA 4UQ2A 4ODHL 1N59A 4X7SL 3VA2C 3FO9B 3H7BB 5EZJB 3RGHA 1J8KA 1JI1A 1OP3H 2K7PA 3P4LA 1FNAA 3X11B 1R0AH 4IIQA 3T2QA 1MCSA 2V17H 5LGHL 3BGMA 3O6FC 1QQDA 4GW4A 3TVMB 5I19H 1S7WB 4M8QB 2J6EL 1MCRA 4OTXH 4UNUA 1NFKA 1JNNL 2F5AH 4O4YL 4PJIE 3KS0H 4G42B 2R29H 5D96C 3T3ME 3DRTA 2R0LL 3O2DL 2B2XL 1JPFA 1M7XA 1T2QH 1YYLL 1J05A 2LV4A 3QDJD 5IROC 5EU7E 2J6EA 4XCEA 2F74A 2ADIA 3FZUD 1ND0B 4ZD3H 4CNIA 3REWA 4RMSA 3QQNA 2CDFB 1FFNA 2A0LC 1I8MA 1M05B 3H42H 4Q58C 3K8LA 5IHUL 3O2DA 1PSKL 4OI7A 1MFAH 3BWAA 3DUUA 5DS8B 2VIRA 4HKJB 2LE9A 3ZE1E 5E7BA 5C6TL 3L3DB 5E5MB 3IXAB 4HFUL 5FUOL 5EIVA 1UXWA 1LILA 2LTQB 1FE8L 3GJFH 4JFXB 4NQXB 5JW3L 4POZC 2APXA 3G6AA 1U6AL 5IJKA 1NC2A 4KMLB 1F90L 1ZKAA 4Y5VA 3CPLA 4KU1A 1A14L 3A0OA 3Q3GB 4PJBF 4YHKL 3T3MF 3SKMA 4H8WL 1NKOA 3CSYA 2ENSA 1VERA 1CFSA 2GI7A 1H3UA 1KACB 2QTEA 5CBEA 5J8OA 5E2UH 5DJ2A 3RTQD 5FYLE 3ZE0F 4JR9L 3WO4B 5FCSH 3GI9L 1DQDL 3I2CH 1T7VA 1PDKA 2XIDA 1TMCB 4ZMAT 1G9MC 5JZ7C 1E6JH 2ZPKH 1KIPB 1X44A 4UV7L 3C09C 3GBLA 4FP8H 1JGLL 2FX9H 3RGVC 3HC4L 4D0CB 4HK0B 1UACL 5GGUA 2DQJH 2VLJD 4G6ML 4BQ9A 1ORQB 3VXRD 1UJTA 3B5GA 1F11A 4N1CA 3FB7B 1KCSL 1AQKL 2NNAB 3MV9E 4RNRA 2A6IA 1BZQK 2F53E 4RMVA 4JFEA 4LPWA 5IT2H 3TV3H 4Y16B 3BE1H 1MOEA 4Z5RB 1EEYA 4DEPC 1S7RB 3IU4H 1J1XH 3WSQH 4NRXB 3TM6A 1DUZB 1HI6A 1F3JA 5HGDA 5I71C 3S88H 1JRHH 1WFTA 1NBYB 3GKZA 4B41A 2WBWB 3B43A 2JELL 1XR8A 1Q8MA 4QY8A 1I7ZB 3KXFD 5ALCH 1AXIB 3HZVA 1IL1B 1R6VA 3OKKB 1IT9H 5JIPA 2B1AH 1CLYH 1QBAA 4LIQE 5IHZB 1P84K 1RK1A 1RJYA 3RWCB 3UZQA 5E1HB 5K9JL 1I9EA 1BOGA 1RHFA 2ENYA 3OXRB 4RX4D 4JPVH 4WI9A 4KK8C 5DFVD 3MROB 5E8DH 1V05A 1BF2A 2W92A 2X4UA 4P5TA 1EUTA 4WO4B 1UH2A 3UAJC 3EFFB 3AROA 3SY0B 3CU1A 5D70H 1FZKA 1GPOL 3F12A 1T1ZB 4Z18A 4D94A 4WFFE 2CLVB 4IDJL 4YXKH 4PRNB 3VW3H 1VSCA 5TFSL 5KSVB 1VGKA 4JN1L 1EO7A 2ESVA 2FD6L 1JGEA 1SY6L 1CFVH 4L8SA 4GG8B 4HKXA 4YIQA 3BQUC 4XPGH 5DXWA 3L95A 1ORSA 1OT1A 2Q76B 4FFWC 2R0WL 1E4XH 1FNEB 2RJMA 4QHUA 5FK9A 3OX8A 1A7PL 2YPLE 3B2VH 3TT3L 1AD9A 4XPHH 2O5XH 1LGVA 1A3LL 4KKLC 4NKDB 35C8L 5LXGL 3IU3B 5KVEH 1MHEA 2GJ6B 1SY6A 3QQ4B 3FB6A 4U1SB 2ARJB 4LCWA 3UTSD 3EFDL 3EJYC 3VXMD 4LVOC 1Q94B 1NCWH 4HGMA 3HZYB 3MBED 25C8L 3EJZC 3VFMA 3G08B 3BHBB 4XCFH 4M1DH 3N0PB 1NGZB 4KTDH 4Y4HD 3KPSA 2ZUUA 4P2QE 5DVKA 4KZEH 4LARH 1X5YA 4HLZG 3I9GL 4PRDA 4UTAL 2R2EB 2NY4B 3WXWL 1ZT4A 3PGDB 4FQJL 5CJQH 3CFBB 2YPLB 1IGTB 3VFGH 4LCYA 2ICWJ 4NZUL 4NQEE 2X05A 4K3JL 2VAJA 4EI5C 1ZGLA 2V2TA 1GYAA 3C5ZC 4OSUH 4S1SL 4K8RD 3PNWB 3AY4A 3Q6GH 2UUDH 2VNCA 3GMLA 5DUMH 4PV9A 3QIBB 4XAKE 1KN4H 4EUPB 1FYTD 3HNTL 3O8XA 4NO0A 4U7SA 4HPOH 4L1DA 4GRLA 5DUPH 1YY8B 1YMME 1HHHB 4TSCL 1NCBH 5CEYB 3ZTNL 5DRWA 5EBWB 3VH8A 1UCBL 4W4OC 3UTTD 4YX2H 3QBTB 3KLHC 5IB3A 5L2JA 4NBXB 3H7BA 2GSGB 5F7NC 4UT9H 5FAAA 4PY7B 2GSIB 1KB9J 2QR0A 4Z7UA 4KAQL 1IEBA 3HAEH 4YHZL 1F4XL 3M17B 2X1WL 3ARSA 1LO5A 2DM3A 4WUUE 2HFEA 2VLRE 4YO0B 3DJ9A 3QDGD 5I1KH 4UBDD 2CRZA 3GEWB 9CGTA 1KPUB 3TA3C 2X42A 1QFOA 1P7QD 2D7OA 3OZ9H 4PJDE 2GITB 1AXSB 4XMPL 4K07A 1CD1A 4KK6D 5MEQA 4JQIL 2CO7B 2BHYA 1K3IA 3VMNA 1JGDA 2A9NH 2V5MA 4YHIA 3TT1L 1PZUB 3TFKD 4M7JH 4N8CL 4E42B 3HS0A 3O11B 5JMOC 1WJ3A 1TQBB 2A6KB 3SDDA 2N1KA 4GAYB 2CDFA 1NUFA 4Z76B 1OSZB 1U2HA 4OGZA 2EKJA 4R8WL 3MJ7B 4WUUB 5T1KB 3KAAA 5I18L 1T5WA 4JRXD 3B9KA 1ZMYA 3V2AR 1BX2B 4PJIA 3JVGA 4LPYA 1A6TA 1PG7H 4PJDB 2HVJB 3FQNA 2FB4L 5GRXG 3M1BA 4N8VA 3FQTB 3BPNC 4Y8AA 4YWGH 3QH3A 5BV7B 2YD5A 1KBGH 3TPKA 4FRWA 2HT2C 4E9LA 1OAQL 4ZS6C 3QT2A 2P48B 1ZLVK 1KGCE 4ZXBC 3Q3GA 3LY6A 2H32H 4GBXA 1INDL 1N64L 1TVHA 4PB9H 1YQ2A 1LEIA 4JG0H 3FTGB 4XNUL 5T5NG 4XVTH 3BP4A 1RZ7H 3LPGA 3DO7B 4Z7NE 4XP5L 1P7KB 5L2KB 2GTWA 5FYLL 1A1MB 1JN6B 2BVOB 3MGOB 4OZFA 4ZOAA 4N9OB 4JO2H 1OB1A 2MPAH 1DQML 4NC1C 1T89A 4JO3H 3ZE2E 1GAFL 4HH9B 4PJ8C 4KJWD 3OMZA 2GY7B 1A6UL 4JFPB 4H1LB 4Y1AE 5ICZB 4QF1A 5I1IH 4LFHG 2NNAA 1AR1D 4LMQE 4UAOC 1MUJA 1P4BH 1OGTB 1YNKL 4ODSH 4Z6AT 4WW1A 1U58A 3VXOB 4Z7OF 4XNYL 1H5BC 2XY2A 5DDHA 4Z5RA 2Q7YB 1S7RA 5F89A 1OM3H 4Y19D 4RMTA 2DM4A 1T22A 1NBYA 1NL0L 2I60H 2Z93A 3BX7C 1CGSL 3G04A 2VISA 5ITBH 1OWRM 4Y5YB 3RPIB 2YHGA 2R1WA 4IBLT 5TDNB 1JHKH 5EOCJ 1IM3B 3MOAL 1JTOA 1Z5LA 4V1DD 1ZS8A 4ALAL 4Y1AB 4R2GB 3MV9A 5DJCB 4Y4KC 1CF8H 1RUKH 2VC2L 2F53A 5D2LE 4NCC1 3WL9B 4MDIB 3WNNA 5ETUB 1MREH 4X6EB 4BFIA 3PP4L 1BGXH 4NO5A 1ZLWK 4LIQL 2EXYC 1F97A 1XGUA 3UZEA 3RVUD 3MUZ1 2FL5B 1QO3B 3DARA 2EE6A 1FLTX 4PTUA 5GRVL 4TYUA 4MAYC 4PRNA 2YK1H 4WFGD 2XWTB 4O51B 4MNHB 4OLXH 4QXTA 3HNSL 4W70A 5GZNC 4D8PA 3QNXA 3I6LD 3QFJD 3TJHD 1WITA 1LO4L 5D2LB 1W8OA 4M6MH 5CILH 3P9MA 1NLBH 1T1YA 4R4ND 1EJOL 1BPVA 3TNNA 5A2LH 2BCKA 2VQTA 4N8PA 4XPAL 5EUOE 3RY6A 1JCKA 5HXMA 4JKMA 3WUZA 4X0KB 2ARJA 4ONOA 3RVVC 1CK0L 1S9YB 3BAEL 1DDHB 1MHCB 3HZYA 2YS4A 1HHJB 5EBLB 2OJZL 4XNXH 1XGYH 4GKSB 4NQCD 5HI3C 5JW4Q 3HUJF 3CDFA 2AXFA 3TBVB 2V2WA 3AFLA 1HDMB 1S5IH 5MI0C 2QEJA 5J89A 1W72B 5H94A 1LK3L 2E6PA 1IGTA 2YPLA 1QRND 3SJVE 4YGVB 5IEKB 1ZTXH 4HHAA 4WRLA 5JHDB 1OGAB 3MCKB 2V5SA 3IGAB 1RUAL 1G9NL 2YMXH 2VLKD 5LVEA 4JQXC 5DVOA 2YD2A 3P4NB 2A6JA 4LRIA 5D7JC 1QR1B 2N7BA 3L3OB 3ARXA 3WN5A 3O6KL 5FGBA 4L3EE 1FG2B 4WW2B 2NPLX 4LL9A 4HCRA 2G2RB 3QNYB 5HYJB 3QIUD 2I9LA 5A2FA 1R3LA 2VO5A 4P2QA 1CLOL 1JE6A 1Q0XL 3LN4B 4BH7B 4ELME 1WCBB 4PRAB 3P30L 2VDNL 5JPMA 2QSCH 5CEYA 3IAPA 1DLHA 1MAML 4ORZC 4QLRA 4FXGB 4AT6B 5JUEH 3HI1B 4GO6B 4M4RA 4NQEA 2EXWC 4QXWA 3NACL 3ULSA 1FZJA 4YC2B 4L3AA 1QBLL 1FVEA 2HJLB 3U4AA 1MCKA 3GM8A 4MXWH 3LS5L 4XHJD 1HSBA 4YDJB 1L0QA 1ZGLP 4QHKJ 4L3EB 3A6BL 1G7IA 4O2CB 3SDYL 5I1EL 2DQUL 3BMWA 3CUPA 1KNOB 4QCIA 1PQZA 1OPGL 3IT8D 5J56B 4U1JB 2IAMD 4XC1H 1N6UA 1D6VL 4RRPA 4TUJA 1YMMA 2HRLA 3MREB 5IG7A 2Y07L 3TBTA 2X9YA 1TFHA 1F5WA 3MNZA 2HFGH 1BQUA 2VXUL 3DXAD 2VRAA 3MRRA 2YUZA 1Q9LB 5CEXA 5DJZB 1S9WB 3BKCH 5C0JA 4E41B 2XA8L 3NOIA 4NQUA 5BS0E 1YEFL 3BVNA 1UADC 3GUTA 4WUUA 2YR3A 1XGQA 1NCTA 2VLRA 3RY5A 4JG1H 3ARBA 1OF2B 8CGTA 3RKDC 2FHBA 3RVWC 2XN9D 4U0RB 4PJDA 2OTWA 3QAZB 4G6JH 5ELIA 5I1GL 3O6MH 1RU9H 3VWKB 3X14B 3KNBA 3D69B 3D25B 1IVLA 4UILH 1IAIL 4HJJH 4BA8A 5B8CC 3FO2B 4OLVH 5FYKH 4MD5B 3O0RL 4F33B 4OKVB 4WCYL 5BRZE 1UZ6E 1RZFL 1KTKE 1Y6NR 4JDVA 2P5EB 1UM6L 5FF6B 2PTTB 1OL0A 1LE9B 2VDPH 5FHAH 1ROWA 3RHWF 4V2CB 4DCQB 1KTRL 1OOAA 5LJYH 4LU5L 1FCCA 4JM2B 5I1JL 4G7VL 2JB6B 2NY3C 3V6OC 1P7KA 4F7EB 5JOPD 3NA4A 2DD8H 2HLAB 4Y4FC 1H15A 1A1MA 1G0XA 3TPUA 1JN6A 1BFVL 4M93B 2W9EL 3QUXD 3H9YA 4DZ8A 1WIUA 4GSDH 3H9HA 1OTUD 3GBML 2NY1B 2OR8A 1QFPA 2ORBL 3F58H 2IFFL 1N26A 4HJ0D 5KVGL 4J2XA 2VITB 2F54E 2EKSB 4P46B 4Q7DA 3C6LD 4PS4H 4X7FC 5C3TA 2IADB 1UWXK 3O4LD 4O58H 4ZUWB 2O5ZL 2Q7YA 4HAGA 3S4SG 3QHFH 1UZ6F 3C6SB 1MCBA 2RCSL 1I9IH 4YR6B 1WT5A 5DRNB 3SO3C 1S78D 5IHBA 5LBSL 4J1UA 5E9DD 4G8GB 1A7OL 2ATPB 4JY6B 3OL2A 1XMWA 2CMRL 3DPBA 1A5FL 2NXZD 4Y0GA 3TYFA 4QXGH 2VZ1A 1XT5A 4JFOB 2Z4QA 3GK8H 4GMTH 4XCYB 4BH8A 3ARDB 2XI9A 4LRNL 4OF3A 2B1HL 1EUUA 4Y1AA 2K1MA 5GS0H 1AGEB 1UEMA 5DTFB 1AGDA 1E6OL 3OJMB 4FQXB 4PJ5E 4NFDA 1YDPA 3T0ED 4FABL 2Q6WB 4D9LH 2Y23A 5HYQB 3LEXA 2ICWA 4IOIB 4EKXA 4F9LA 4R26L 1DFBH 2CIKB 5EU6E 1Q9KB 3KLAA 1F2QA 1NGXA 1HQRA 1TZIA 1XEDA 4N90E 4F58H 4J8RB 2MQ0A 1YUHA 1T3FB 4TPRH 4EUPH 1G1YA 4KHTH 3CAFA 2YSSB 4OBSA 3L7EB 3MJGX 1BD2D 2DI8A 3V5KB 1OLZA 5C09D 5CS7A 4DUXA 4OCWL 5CD3B 3AM8A 5D2LA 5KSBB 5J6HB 2HKFL 4KKCD 5IB5B 4PRID 4BSVB 2WUBL 4JE4B 4MCYA 2KQMA 1F2XK 2DYPB 2SEBB 4IRSA 3B3IA 2NW2B 3MRCA 1YJDL 5D72H 5DRXA 1MHPH 3IETA 3PABA 4IHOA 5J1AB 4ZO6A 4K55A 4NBZB 5FM5O 1DVFD 1HEZB 3OGCB 4NO2B 5DVLA 4LGRB 3E6HB 2HH0L 4JJ5B 3KYMA 2EIZA 3C2AL 1RZKL 1CD8A 1PAMA 4Y5XB 5MEPA 3F62A 1LO3L 4HQQL 3MRHB 5E5RB 4P2RE 4YGVA 4P49A 5EUOA 5C0CE 4EDWH 4X8XA 1G6RB 5E95B 5LWYL 2AQ3A 1KG0B 4Y89A 3P9LB 4HLJA 4G6AD 5I74B 4QTHB 4YZFE 2WAHA 2C7UA 2VXTL 3ZDZF 1D5IH 3NVQA 1BEYL 4WW2A 2CLZB 1NGQH 4GMSL 5HBBA 2VDLH 3LN4A 1YEJH 3DMMD 4WFED 3S36H 3UYOD 1QHOA 1WZ1H 2P7TA 4R7NA 3SJVA 1MHHA 5BV7H 1A64A 5AWNL 5GSRA 3WIFA 4H0GA 4LLDA 5IB4B 1J8HE 3QUZC 1ZSDA 3DX6B 4APQD 3HR5B 2CRYA 2P5WB 3WFDH 4O2EA 5KSAA 4NQSA 5I1DA 5DHYA 2YZ8A 1ZWIB 3AB0C 4L3EA 5HVGB 1LNUB 4TTDC 4XVSL 1U92A 4U1IB 1JPTH 1B4JH 1CR9H 4I48A 5IESL 4ELMA 4ZODA 1BBDH 2WV3A 3LHPL 4NM8L 5SV4A 5IQ9B 1OW0A 3WLWD 4KVCH 5CLWA 3MBXH 2F19H 1J8HB 4N5EC 1R3KA 3RDTB 4LSPH 1N3NA 1C5DB 2FJHA 4ZFFA 4FQQA 4YUEL 2A74B 1GGUA 2EH7H 3QCVL 3O3BA 2J8UF 1QFWL 5C0AB 3VI3F 5I76B 2CUMA 4NFBA 4H1LH 3Q48A 5HGHB 1U3HA 4FQIH 1VGEL 4HWZB 1OP5H 3T0DA 4FTVE 3F7YB 5I0ZA 3MLXH 1MCWM 2VDMH 5L8JB 1C8PA 5EH1A 1A1NA 1V7NL 3IFOA 2AK1H 5CEZH 4KRLB 4WUKH 3D39B 3D69A 5EOCL 4ZUUB 3VG0L 4TULL 2ERJB 2C1OB 5JR1L 1A1OA 5DR5H 2QQNL 4MD5A 3U2SA 3QR2A 1DR9A 5BS0A 1N5YH 4ZUVB 1BJMA 4R6UA 3EBAA 1T7XA 3OJVC 1XIWD 3VXUE 4GW1A 1LMKA 1VKXA 3S9DB 4JPIB 4JFDD 1IGML 5FECB 3ARVA 5JQHC 4OZ4B 3MYJB 1IM9D 1A2YA 2AGJH 4MA7L 3ULUH 3GSOB 1BVLB 4CVZB 2JB6A 4ORGA 1PX3A 5FKPB 4KRPC 4GAGH 2XKNA 2XQBH 1K5NB 2W60A 2CIIA 5I2IA 4DGIL 1ZANL 5BRZA 1GOFA 4IOSD 1QA9A 4KRMB 2XKUA 5SWSE 1RJCA 5ADPL 2H2SD 3VXUB 1F45A 3FAXA 4F8QA 1P2CB 4I1NB 3EOYG 2L4OA 5AUMB 4KXZI 3RAJL 1RIVL 3MSPA 4G9DA 3O3DB 5LKNA 1HZHL 1QLRA 5BOZG 1KTLB 2R4SL 1D5ZB 1TJIH 3MCLH 2PN5A 2FEEL 4ZUWA 4AEIH 1QKZL 4JREB 5F9WB 3EYVB 3L7FB 3GSNH 3CK0H 3CC5B 3GMMB 1X5HA 1RK0B 5HJ3B 3U1SH 3U7YH 5C07B 5CEZD 2AJZA 4PP1C 2HFTA 2F54A 2YD9A 5DTFA 4R7DA 5JPNA 1W72H 4ZUSB 1MH5B 2WIMA 2R9HD 5E70A 5CJXA 4XPTH 2FJFB 2Q6WA 2PXYD 5KANG 3SOBH 2COQA 4IOIA 5IQ7L 1OTTC 3O6LH 5HHNA 3NGBB 1FNHA 1A9BB 3U9PH 2AJUH 5HY9B 3GSWB 4KPHH 2WBJB 4QOKE 4RWYL 2GK0B 1QLFB 4X6CF 1FC2D 5GRVK 3LAFA 1NUDA 5CBAA 3T4AA 5C2UB 3L3HB 1QG3A 1N6QH 3BGAA 3L7EA 3ULUD 5I17B 3V5KA 1KN2H 3TN0C 2OXGA 2EYTA 1WK0A 5CD3A 4YDKL 3CLEH 3V6ZB 1FV1B 4PJ5A 1IGFL 4MB5A 3IF1A 4WHYG 4Z7QE 1N6VA 5CSBA 2SEBA 5IVOA 2DQTH 3MXVH 4OF6A 3AU1B 5EU6A 1OAYL 5DT1L 3BEVB 1KFAL 1P9MC 1MCJA 4QOKB 1W0WB 4GLRH 3ZSTA 1F8TH 1VEOA 1CG9B 3TYGL 3DX7B 1MRFL 5AYUL 2BVQB 2PTUA 4TVPH 4PLKC 3A6CH 3D2UB 4O9HH 2X89D 1VACB 3MRHA 1ZHNA 2VYRE 3HFML 4XGZB 2YWZA 5D1QA 1WWCA 3WS3A 2AKRA 4HC1L 2DB8A 2IG2H 3ULVE 2FR4A 1AE6L 5HPOA 2FGZA 3E3QC 4QWWC 3QRFM 4QTHA 4HW6A 4K7FB 3P77A 2CUHA 3IAQA 1AGCA 4R0LB 3VXSE 4PJXE 4HC1A 4F15B 3W5NA 4MXQD 4P5KB 4BUHA 4OCSH 3WYRA 1OGAD 5CGTA 2D0GA 4NSKA 2OZ4L 4MCZA 4RGNC 5JTWA 1JMXA 4MNQB 2NY5H 1WBZA 5CJOH 3PJSA 2AI0L 4P2RA 1UZ8A 3W82A 4EIZC 3QB7C 4YNYA 4PJBB 3QWOB 4P9HL 5C0CA 3BT2H 4M43L 1MQKL 3SKOB 3DX6A 3QUYB 4U4BA 5FCUH 3W2DL 4ZNEE 1DQQA 3T3PF 4U1KB 4HD9A 1XGTA 1I1AD 1CYGA 4CMHB 1U93B 3ARRA 4YHMH 1N4XH 3LPFA 4M5YL 4PLOB 5AZEH 1N5AA 3VCLB 3PL6C 1NLDL 1PFCA 3GI8H 3LS4H 4X9BA 1A47A 4GXVH 4TTGA 3PGFL 3VXSB 4OD1L 2VXQL 4RISL 3OB0K 4NWTH 4ENEC 4XMLH 2VABB 2WWMC 4K9EC 3QHZH 5K9KA 4H88L 4LLQB 4E5XB 2QQQA 4Y2DA 4J3TA 5F1NB 2E7HA 2DWDB 1QSVA 3PF2A 1A4JA 2JK5B 1DBBH 1KJ3L 3TH4T 4MS8D 2BNQD 2J2ZA 4X7TB 3NIDF 3TIEA 1MFBH 3ZKQD 2H6PA 1JIBA 1J8HA 3NPZB 4M62L 4ODVL 4I3RH 3P0GB 4TVPD 1NANH 3IJSB 4XH2B 1F4WL 1CICC 5ACMA 5DEGB 2I25N 2VAAB 4CMMA 4JZJC 1T7WA 3EUUA 5J6GA 4NKIL 2IFGA 4UU9A 5E6IB 2EC8A 4N9GB 3CMGA 3ZTJG 2WINB 3KPOA 2H1PH 4M1CD 1OAXH 5CJBA 2ZJSH 1FL3B 1WUNT 4DFIA 5D7LE 1UWEH 5IKCA 2KZ1B 2DTMH 3TO2A 4EN3A 4CJ1A 4U49A 4C4KO 3D0VA 3RWEB 3UJTL 4DGVH 2P49B 1UJ3C 3IB4A 4L4TE 5CGYD 3PHOA 1MFNA 1AFVH 4XPFL 3S4SB 4ZUVA 1SEQL 3OKOB 4XP9L 1D5XA 1D6EA 3B2UD 4HK3J 1FVCB 1QSFE 4FTVA 5KVDL 3BPOB 3MYJA 3WJLC 4GAJH 5HHOD 4JCMA 1BVLA 5E2WH 4CVZA 1C7TA 3C60B 4HLZH 43C9B 3H3PL 4F7MB 1EEUA 1JV5B 1AHWA 1KXTB 5TE7L 3BDYH 5IK3A 4N0UB 1P6FA 4MX7B 5EC2A 3HNVH 1GGCL 1DL7L 1KELL 5E08L 1I3VA 3OR7B 4X8JB 2YBRB 4JM2D 3VXNB 4F9PC 1IGIH 1T2XA 1U3YA 2BDNH 3VXUA 1LP9F 1U8NA 2NMSA 2ZUVA 4U05A 2MCG1 4PRPE 3U6RA 5E6YA 1FFOA 2B7DT 5CP7A 1FZMB 5DJ6A 5TQ2H 5JXEA 1H8NA 3O3DA 3P40A 1KPVB 1YECL 4LBEB 3IFLL 4LEOB 3RZCD 1KTLA 2NXYD 5GHWL 2IH3A 1RZIA 3CSBA 3GO1L 2Z31A 2HAZA 5EG6C 1NMAH 4MA1C 3W9DB 3D85D 1NSNH 2FGWH 2Q7NA 3LKRB 5GSVA 3V52L 4NKMB 3IDNA 4O02H 3U7WL 2JJTC 2A73A 1F3RB 1CFNA 4RBPH 3DBXB 4PJHE 5T3XD 2EDJA 3GHEH 3KPRD 4L5FH 1EAPB 2ZP0T 3DNKA 2XTJD 4WVRA 1IE5A 4QRRE 3TNMA 1H3PL 5SWSA 4X9GA 3NH7L 1WISA 3CLFH 4X7SH 1TTFA 2IANE 3OAUL 1BQSA 4G8GD 1HHKB 4XCCL 4X6DE 1X6NA 5E24E 3EZJB 4FQPA 4QXUL 5A3IC 1XGPA 3DV6A 1K4DB 1G6RH 5TF1H 3DVGB 4OZIF 1CLCA 2HRPL 3NCCB 3ARDD 3GSWA 4ZOEA 1BIIB 2Z8RA 3TWCH 2IALA 3RWHB 5DVNA 5HDOA 3CZFA 2ID5A 1G7QB 3QCTH 2GK0A 1Q9WA 3ILQC 1UB6B 4O4YH 4OGYL 2DQHH 3EOBA 3C09B 2PF6A 1V7MH 3LQAL 1HOCA 3O2DH 3AREB 1JGUL 5DD5H 5D2NB 2AEIT 2IANB 3EO9H 4OT1L 2R0KL 5MENE 4PJHF 4Z0XB 1KB9K 5ID1A 4X5XA 5GGSA 3WLBA 1ZAGA 1JWSB 3RWIB 1H3GA 2UVFA 1K8IA 3NCYP 1NFIB 2CPCA 3L5HA 3D87B 5ENWA 3BEVA 3L3JA 3ZDXF 1MQ8A 4ZO9A 3TZVB 4QOKA 4OFDA 2AVGA 1IC4H 3QIWD 3NFPB 5FA4B 2OR7A 3OXSB 3PDOA 4X6DF 4HIJB 1U0QA 2BVQA 2IBZX 3GMQA 4GOSA 4LHUG 1GGBL 1KIQB 3EO0A 3LSOA 3DUHA 3JUZA 4PG2C 5C6TH 3VGHA 3QUKB 3SDCD 4HFUH 5FUOH 1UB5A 1QBMH 4YFLI 3RIAF 3K2UH 2NX5B 4OFKA 4KVNH 4XGZA 1YNLH 3R1GL 3V95A 4NUJB 2PR4H 1F90H 3H9SB 4I0KA 1YNTB 4YHKH 1S8DB 1MJJB 1FRGL 1F42A 4N0RA 4ZTPH 1UM4L 5IVXE 1NPUA 4Q6IA 2OMNA 4DZBA 4R4NC 3HZMB 3SDAA 1J0JA 3HMWL 3VXQB 3ALWA 2G9HA 1FPTL 3BP7B 4BZ1L 3ULVL 5D7IE 4LLVB 2GYSA 5ESAA 3OPZH 4O5LL 4OIBA 1MI5B 3NA9H 1QEWA 1KLGB 4TSAL 4POUB 1YY9C 4ZAKA 5C71A 2XV6B 2EDNA 2VDRL 2X4OB 4KKNA 3SGJA 1X4YA 3K46A 4PJ9A 3S35X 3WIIL 1DE4B 4I0PA 3MODH 3CFJA 3ETBF 1MRCL 1AQKH 1NC4A 3VCLA 2V9RA 3BKYL 1SJVA 1FZOB 5J12B 2R0ZL 3BJLA 1D9KB 3VXSA 1TNMA 4TUOA 4PJXA 3PHQB 3DROB 4CUCA 5FUZH 4L3CB 2V6HA 2YUWA 4LLUB 2B5IC 4K3DL 3U0WL 1AR2A 4DK3A 4E5XA 3VG9C 4KROC 1KV3A 2FIRT 1UA6L 2N4IA 1NC2D 4HIIB 1PVHA 2DMCA 4X7TA 1BWWA 4X7DC 3OHXB 3T04D 3LKPA 5D7IF 3FB5A 5J3HD 4R4FH 3ARGB 4ZNEA 3IJSA 1KYOJ 2VZUA 2WSKA 1Y6KR 3K81A 2J5LC 4WEBL 5AYQA 1CU4H 3NZ8A 3I3DA 3V0AC 3SCMB 2ARWA 5K9JH 1HCVA 1S9VA 3FKUS 4BJLA 1Y0LA 4FA8A 4ZFOB 4Q2ZA 4KJQC 4RA3A 4HGWA 2VLMD 4MAUH 5C9JA 1J5OL 1BQLL 4FQ2H 1P4LA 2R1YA 4GRLC 3C5SB 2BZDA 5A2KH 3KPPB 1GPOH 3GSVA 2D7NA 3NCMA 1U8IB 1N8ZA 2PW2B 1A7RL 3FCTB 2EC9U 3RWEA 4G9FE 4WENB 4L8BA 2IAMC 4ELKA 1MCWW 2DQCL 2CGRH 1NUGA 3FONB 1LK2A 3QI9A 5ALBL 3RZWA 3O3EB 4JRYB 3ZYIA 1X7QA 5E7FA 1SYSB 3G5XB 3MLTB 1M71A 1T20B 3OKOA 1GCFA 4JB9L 3TVMC 5EOQH 1A7PH 4JFED 3RNQA 5I0DA 4G80B 5EO1B 2C9AA 2W07A 5DHXB 3DX9A 4YHPB 3UO1H 4JJHA 5D7LA 2AK4B 4LOUD 3EFDH 3SGEH 5BXFA 3MGTA 2EDKA 5J9PB 3FT3A 5C0BB 1DN0A 1SMAA 3S98A 4YHLH 1I9RH 2YEZB 2JKXA 25C8H 1RUQH 4U3HA 3GMRB 1AQDB 5C6WH 3QEGH 3IS0X 2DLFL 4L4TA 1U8QB 5DFTA 3EHBC 3I9GH 3QCUL 5KTEL 1A21A 4X98A 1EMTL 4ONGH 1O5DT 4GKNA 4LQFH 4GT7A 1NAKH 1NDGB 1KB5L 1QSFA 4LBEA 5GS3A 4P5TD 2PO6B 2F5BL 4S1SH 2PYEE 1XFPA 3V4PL 4HJGA 2P8PB 3MRPB 5J13B 2LTQC 4HWEL 2AEPL 2VTFA 2AQ2A 3HUJB 1WFNA 2ESVD 3RUGB 2VDKH 4BQBA 3KPLB 1KB5A 1FH5H 3ZT5A 1EAPA 1CT8A 4LLAA 4WJ5B 1JTPA 3ZTNH 4ISVA 4PRPA 3HE7B 4H0IA 3QUXC 5ITFA 4XVJL 1BIHA 5E0QA 3VDAA 4WNQB 3WO4C 1G9ML 4G8FA 3QO1A 3BRFA 4NC1E 5DYOA 4L4VE 3C8HA 4LCWD 1WAAF 5LGKA 4YHZH 4MA8H 1MSPA 5DK2B 2ZCKH 3G6JE 4KK9D 4X5WA 4N0CC 4UTBL 4EQ2A 4I4WB 4U1HA 4PJHA 3KPSD 5DJ8A 1QLEH 5L0QB 1UB6A 5HD8C 1R3HA 2GHWB 2EDHA