3WJMB

Crystal structure of bombyx mori sp2/sp3 heterohexamer
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
668
structure length
668
Chain Sequence
EFKTTPVDAAFVEKQKKILSLFYNVNEISYEAEYYKVAQDFNIEASKDCYTNMKAYENFMMMYKVGFLPKNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQGMFLYAYYIAIIQRSDTASFVLPAPYEAYPQYFVNMEVKNKMDYVKMMDGCLDEKICYNYGIIKENEQFVMYANYSNSLTYPNNEDRIAYLTEDVGLNAYYYYFHSHLPFWWNSGKYGAFKERRGEIYFFFYQQLLARYYMERLTNGLGKIPEFSWYSPLRTGYLPPFNSFYYPFAQRSNDYELHTEKNYEEIRFLDIYEKTFFQYLQQGHFKAFDKKIDLHSSKAVNFVGNYWQTNADLFEEDFLQFYQRSYEVNARRVLGAAPKPFNQYTFIPSALDFYQTSARDPAFYQLYKRIVQYIIEFKQYQVPYTQEALHFVGLKISDVKVDKMVTFFDHFDFDAFNTVYFSKEELKSSPHGYKVRQPRLNHKPFTVTIDIKSDVATNAVVKMFLGPKYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKEDSLPMAEIYKLLDQGKIPTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKAVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGELFPYLFNIPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Bombyx mori arylphorins reveals a 3:3 heterohexamer with multiple papain cleavage sites
pubmed doi rcsb
molecule tags Oxygen transport
molecule keywords Arylphorin
total genus 210
structure length 668
sequence length 668
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00372 Hemocyanin_M Hemocyanin, copper containing domain
B PF03722 Hemocyanin_N Hemocyanin, all-alpha domain
B PF03723 Hemocyanin_C Hemocyanin, ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1280.10 Mainly Alpha Orthogonal Bundle di-copper center containing domain from catechol oxidase Di-copper center containing domain from catechol oxidase 3wjmB02
2.60.40.1520 Mainly Beta Sandwich Immunoglobulin-like Hemocyanin, C-terminal domain 3wjmB03
3HHSA 3AX0A 2AHKA 4OUAA 4D87A 3AWZA 1BT1A 2P3XA 2Y9WA 3GWJA 3NQ5A 4J6UA 2Y9XA 1LLAA 1BT3A 4L37A 3W6QA 1HCYA 3AWYA 4HD4A 3HHSB 4OUAB 3W6WA 4J6TA 3AWTA 3NQ1A 1WX2A 3QJOA 3AWVA 2ZWEA 3WJMA 1JS8A 4Z0YA 3NQ0A 4HD6A 4P6RA 5CE9A 2ZWDA 1HC1A 2ZMZA 3AWUA 2ZMXA 4J3PA 1OXYA 3AWXA 3NM8A 2ZWGA 1LL1A 1WXCA 3AWSA 4P6SA 5I3BA 1WX5A 2AHLA 2ZMYA 4YZWA 4Z0ZA 4Z10A 1BUGA 5I3AA 1WX4A 3WKYA 2ZWFA 1BT2A 1NOLA 4J6VA 4L37B 3WJMB 3NPYA 4HD7A 4J3QA 5I38A 4P6TA 3NTMA 3AWWA 1LNLA 4J3RA
chains in the Genus database with same CATH superfamily
2X87A 4JB9L 4DKEL 5E9DB 1IGYB 1KXHA 2PCYA 4JPIA 3W57A 1EXGA 4ANKA 3W6WA 1G5AA 5DLML 1D5BA 2EDDA 4KJYA 4LVHB 4RFNB 1XF5B 4U7KA 3WNOA 1RP8A 3KPSD 3NCYS 4WEEA 3HJ0A 3EUDA 1J8HD 2WZ5A 4Y5YB 2H0JA 1YG9A 2OMZB 1KPRB 2DDQL 1BSIA 1J7VR 4XP4L 1LGVA 1MI5A 3ISRA 4C56B 3G6DH 3GMQB 4F33B 1FORL 4I48A 5CHNA 1X5KA 2O5ZL 4LKCB 4X98B 2ICEB 4LNRB 2R56L 4GBXC 1S9WB 1AQ8A 1FNGA 2OPCA 2IADB 1BGXH 3FRPG 3GSNA 1WF5A 4DJMA 1MCFA 2XWJB 1E3XA 3ZHFA 2NW2A 3QWQB 3HE7C 2X70B 2I24N 4XO9A 3FQRA 4ZTEA 3QI9B 3X1NA 5CN3A 2ZAIA 4L0YA 4HIEB 3O9WD 3L08A 4NNPL 5IB2B 1IFGA 5CJQH 2YK1H 3HPJA 5F9OH 2OJZH 2VR8A 3ESOA 3E2HC 4DVBB 4BGDA 1PQZB 5I66B 5BV7H 4N0YH 3OKMA 4O5LL 4KTEH 4HDIA 1DQDL 1T7ZA 3A4DA 2EIEA 2JH2A 5K1JA 3UTSE 4DFHA 4BZ2A 2ZUYA 3T6XA 1M7IB 3NOIA 3L5JA 2F53D 1JWUA 5EC2B 2E4TA 4LSUH 4WI6A 4ZUUA 2NUTB 1W15A 5HDQH 4IGBB 1YEKH 1UVQB 3X17A 1RZPA 5FA4B 3D3VA 5C07B 5F7DB 1I1AC 1D6EB 4RA0C 2PCPA 4ZAKA 2YXMA 4LLVB 5DT1L 1UUSA 1S8DB 3G9AB 2CO7B 3CBKB 5HDBF 4XNYL 5I3AA 3KLAB 4UQDA 5EN2A 3SPJA 4W81A 5A2AA 1L9QA 4P2QE 3QI9C 1EFQA 3V5HB 2EVFA 3EDFA 2NDGA 4HX1B 4LGSB 2DWXA 1XEUA 2PPCA 4MNGE 4GUPB 1J0KA 3LQAL 4NZFA 1Z9SB 3ZZQA 1R5WA 2OR7A 2FCBA 1UZ6F 2GSGA 4WSKA 4M5TA 4HIHB 5AKVA 2C9QA 2CZNA 3TA3C 1HEHC 2JE8A 1AG6A 2ZWKA 1JDDA 2DEYX 3PV6B 1EZVY 3LY6A 3QI9A 1GYAA 4LKXA 1MVUB 4I18A 5JW4N 1QWNA 4Y5YC 4APQA 2AXHA 4PJEF 1FC2D 5DQJB 5GJTL 5ETUA 1T5KA 4M4PA 3O4OB 3WIHA 4OIIH 2IAMB 4KK5C 1HK6A 2AEPH 4Y4KD 1SBBA 4L3AA 1KN4L 1Q72L 5D1XA 4AYEC 5CCJA 2BDNL 2H6UA 5DFWH 3M17B 3BAWA 3DHUA 3EW3B 4UANA 5ALCL 4P6RA 3I02A 3PQYE 5E9NA 4BQCA 4DQAA 1SUJA 1QBLL 4DCQB 4N5EC 4KZEL 3B1UA 4O51B 2X53A 5D7JC 1DVFC 4ZMNA 2EEAA 3UADA 4Q4EA 4G5ZH 2ZKWA 4M6NH 7TAAA 5GZOC 2N01B 1UH2A 3V0IA 3ZHDA 1HESA 4K5LA 2F53B 2GK0B 2QLVB 4QXGH 4U1SB 2CRIA 4MNQB 5IEHA 1PSKH 2HN7A 4FFZL 2XPGB 3CXFA 1D9KC 2IO5A 4H20L 3FSAA 4XPFH 3LKOB 3NUKA 2ZICA 1KBVA 4Q8BA 5FR3A 3C08H 4J3OH 1CT8A 4QT5A 3WAJA 2F7QA 1JCVA 1ET8A 4NQQA 3ZKND 2CO6A 5K9QG 5DI8B 4LP8A 3CFTA 1KXQE 1I85A 2E7DA 1AZVA 1F4HA 1WFUA 1XXDC 2COQA 3I02B 3P0YH 4X8CA 5ID0A 1U2HA 5L8JB 5ESVA 4Y9EA 4NNYA 4NM8H 5MP6H 1C08B 3ILPB 4IIQC 3SE6A 4LF3B 1QASA 2FSEA 1MCLA 3L4VA 1ROCA 2EXWD 2EYRB 2WKOA 1EAJA 2MHAA 2NMSA 2GJPA 3Q8BA 3QNYB 3SJVD 3JWNE 2BWDA 1JNHA 3R4DA 4HPYL 1YEJL 3T4AC 1P5UC 4FI8A 3UGUA 4LKXB 4I77H 5DVLA 2FWOB 3MLYL 3O6KH 3HS0B 2AJUL 2VISA 4TRPH 4WHDA 3VGAC 4QHKJ 3PWNA 5EU7C 3AUWB 4M03A 4K15A 2CLVB 1KZQA 2K70A 4PJEE 5GJSH 3QIBB 4OUUA 3CFNA 1KY6A 4KX7A 4Y4FD 3W0WB 1MQKL 1XBDA 1U8LB 3B9VA 3VXMA 3VQ2C 5B4MC 1WWAX 1ZA3A 2IGFL 5ECJE 3RVTC 3B6SB 4TRPL 3IVKA 1MWAH 4KX9A 3BKMH 4GBXD 3GUFA 3I3BA 5DZAA 4UQCA 3NQ0A 2I69A 3KWUA 3K2UH 3NFSL 1J1OH 3NM8A 2G75B 2UUDK 2I60H 4FLOA 4FOMA 5FO7A 2IGTA 4QYOB 3T0EC 1DN2A 5CGBA 1QVOB 2IEPA 1TJIH 4G8GB 3GK8H 4CBPA 5C07A 1QEWB 1G7HA 3GNMH 1NBCA 4X8XA 3VI3A 1D7FA 4HEMA 5E4EC 2AJ3A 3WNKA 1U3HB 4X5LA 3SB3A 4QRPA 2ED9A 4OLZL 4XP9H 4W9ZA 2XZAL 4GKNB 4LASL 5DJ6B 3TO2B 5JPMB 5KS9E 4NHUA 3D69A 3IFOB 4YSCA 4HXBH 1J5OH 2ARJA 1IL1A 4BFBD 1EBPA 1A47A 4Q4IA 5HHMB 1RU9H 2Z91A 1BYOA 3PHOA 2CE6A 4AKPA 3AWSA 1BQKA 3R19A 3RBGA 4WK4B 4JO8A 1RK0B 3RJOA 2X2IA 2OMVB 2CJ3A 3TESA 5J56B 1L5GB 5I5MA 4C54A 2VZUA 4ATTA 1LO5B 1LQBC 5I19L 4DEUA 1A9BB 4PI2A 1YZZA 3LZFH 3B3IA 3MV7D 4QRUB 3W82A 4LT7A 1N18A 1H3WM 3H9SA 4MTMA 5F72S 2HFGH 5LJYH 1JGDA 2DM4A 4AQZA 4Z7NE 4J3OG 1KPUA 3B2VL 3II3A 4QEGA 4ZS7L 4OZIE 4WUUD 1TOXA 3EJYD 2D31B 5I71C 4BSVB 1E0OB 1M42A 4GI9A 1C16A 1U8KB 5KSBE 4HCRL 1OV8A 3HC0A 2NY2C 3T2OA 3B2UD 1ID5I 1YCSA 3BKJH 4G9FA 3QISA 4L4JA 5TDNA 5EUOE 1HH9A 3TT1H 1KB5A 3GIZH 3VFOB 2OCFD 1D5BB 4KJYB 4DAGH 1ORSB 3HZMB 3FQ2A 2FQDA 2Y9WA 4MZIA 3ARYA 3QS2A 3CZJA 5ISZD 2RD0A 4GKZB 4IOFC 1PLBA 2DAVA 1Z3GH 3HCVB 4U1IA 1UWXK 3MREB 4LARL 4M6AA 2VJXA 4KVCL 4HHGA 4X7TB 4PLJD 1VCAA 3ZKXB 3TEXA 1E9QB 4EVNA 4OKVA 4D9QD 5D1QB 4MZ3A 1F4YL 3MNVA 4FZ8H 5E8DH 4L4VD 4XXWA 4BK5C 4D9LL 1JGVH 3FTUA 3VFMA 4ZX6A 3ZY7A 2X9WA 4GW5A 3NP4A 3HN3A 4TSBL 4X7EC 3ZDZF 2DWEA 5D5MF 4XR8C 2KL6A 3UBXI 3CVHB 2FEDD 2KQMA 2ZSWA 2VXUH 4RNRB 3MCG1 2ZUUA 2VZSA 1HNGA 1JGVL 1PQZA 5I66A 4TQIA 5ID1B 4U1HA 1FFPA 3F83A 2C9SA 3BUIA 4TLKA 4YSTA 3CZNA 1BFVL 5CIPA 5D4QA 2C4FT 4TSBH 5HDQL 2LU5A 4R0LB 4U1JB 3G08A 3QXUA 3U1SL 4XCYB 5DT1H 1J87A 2ENYA 2ITDB 4NPJA 1G7JB 4M43L 3OGCB 4XMKH 1PZ5A 4AYDC 4HIXL 3TEUA 4QLWA 5TJWK 3GF8A 2OQJA 1DQQB 1A6PA 5D55A 3B8YA 4XNBA 5DRWB 4ZG1A 5HYSG 1A4JA 1MIML 2WXJA 3NACL 4MA3A 3GLZA 4TXVB 4Q0XH 3MLTB 2XY1A 1XL4A 3QJHA 4FGMA 1EEQA 4N2KA 1XCWA 1RJZA 5K93A 2F74A 3N6YA 3QULB 5EO9A 5DURD 3MV8A 2APBA 1HHGA 2I27N 2ITFA 1FZMB 4NQXA 3AQDA 2PMZA 4YSRA 1P7HL 3UAAA 3L3DB 1ZT4B 2Q7YB 2P8PA 4V1DA 1S4IA 1PLAA 1EHAA 1FNAA 4H8UA 2FB4L 4PY8J 3HMWH 5DMKA 1MLBA 5GGRA 2CCLA 4PJ7E 5IJVA 4XHJD 4AK2A 2I07A 1FH2A 1IV8A 4P99A 5G4MA 2Z8VC 1TFPA 3TA4D 3BISA 1IC4H 2PW1A 3TO4B 4WWKA 2HT3C 1H8NA 4PIBA 3QZOA 5KBLA 3EF4A 2WMPA 3F00A 4NWUH 4DKTA 4WO4A 3B7SA 5GGRB 5HDRA 4RBPK 3NPZB 4KO6A 4F1SA 2RGSA 1EFXD 5KSAD 4OAWB 5I6XC 2OKMA 1N5YL 3PJSA 3L3DA 3RIFF 3D07A 5TE4H 4KV5E 5EDXA 4ZXBB 3TONA 3ES6B 2PXYD 4ZS6D 1JGEA 1NIBA 4OBSA 4YIQA 3RWGA 2BSEA 4FJ6A 1YPZB 2CRZA 1NC4D 1PX8A 1YY9D 1A6UH 2A9AA 3DX8B 4MA1B 5ID1A 2VR4A 1R4XA 1AHWB 4F2FA 2ZIDA 2X6CA 2GHZA 2GJJA 2O6FA 3QJHB 4DOHB 1KBKA 2WQRA 4JRXA 3NA9L 1E43A 4PY7B 4K94L 3X1EA 4HWBL 3KGRA 2NSQA 2P1YA 1CDJA 3G6JF 5DEGA 4JG0H 4HS6A 2PKDA 4YK4C 4MFHA 3BUYA 3X12A 4N6RB 1Q9KA 3QI9D 3IU4H 4HJ1A 4ONGH 2WLYA 3BD5A 4FD0A 2Y07H 1O7SA 1ZVHA 3T4YA 1RULL 4PGBB 2VO5A 3QW9A 3N1FC 5FHBL 3MKKA 4ODUA 1V8HA 1EDQA 3SPVB 3LZNA 1USQA 3MOAL 1NCAL 5I1HL 4U1HB 2ENSA 4X9HA 2K9UA 4J8QA 2GTWA 2DQGL 4KKLD 1YPZA 2UWEF 3U4BL 4CU7A 3B2DC 3CK0H 3T8MA 4LDLB 4S0SD 2NQCA 3NABH 3EH1A 2EKJA 5F1NB 3SQOL 2C7UB 4P5TD 4F8NA 5E5MB 1PFCA 4BCZA 3KWXA 3SCMA 4XBPA 3IMVA 3L48A 1MQKH 2E8YA 2G5BA 3BQUD 1JI2A 3FCBA 4MLSA 3WJMA 1ORQA 4YDJA 1DUZA 2YO3A 1E5YA 1RZIB 1OT2A 3EF7A 1CUOA 4I2XA 3BSZA 4GMTL 5FGBC 3OSKA 4L48A 5FO8A 1E9QA 4YE4H 1OP4A 3QRFM 4QRSA 3QJFB 3VFSA 2EJ1A 1BBJA 4LLDA 5HPMA 1SLXA 2VLKE 1F00I 5CD5C 4JRYA 1IRAY 5M94B 3O3AB 2C4FU 1U21A 3GK8L 4HJEA 2VAAB 5AVQB 3OPZH 1G1CA 1J8SA 1SDYA 2BHZA 5CKGA 2BCKA 4A68A 5JYMA 4NPYA 3EJUA 2ARWA 4ORGB 3WIFB 5A6MA 1D5XA 2XZAH 1SJXA 1DJHA 4NQSB 4O5LH 1BW8A 2Q2LA 3MV8B 4KXCA 5B22A 3S5LA 4E42A 5FWQA 5FK9A 2HVJA 1KUMA 2Z7UA 5LUMA 1A1MA 1S9YB 4QO1A 3CDZB 1HJBC 3H54A 4F8PA 3K6OA 3BJ91 3IJHB 5DJ6A 1CGTA 1OIOA 5EO1B 2CMRL 2GIMA 4GKNA 4PTTB 4JPVL 3QC5X 4ANVA 3HG0A 3L9BA 5KVFH 1JERA 4X2UA 4LLQA 5GSRA 4UOW0 4AENA 4E9YA 5HGGS 2WWMD 2E8ZA 3VFGL 4OCXL 2PUQT 3GYRA 2A6KA 3BN9C 3MRDA 4JPVH 1SVZA 3L7FA 1UG9A 4FQHA 4OLVH 3PP3K 5IB1B 5CJBA 4Q9QL 1J9RA 1OCWH 1RIUL 1VFBA 3VFRA 2ZUWA 4R8WH 1YUKB 2B1HH 1B4JL 2R39A 1PU0A 3ZE2E 4MA8L 3RVUD 3GBNL 3O8XA 1U8HA 4IBSA 2Y69B 3NSFA 2J43A 3NQIA 4GAAA 3GKZA 3SDYL 1T66C 4IRJB 1OOWA 1AZCA 2CLVA 1JCKA 3LNFA 2FIKB 4JL2A 4OIFA 4AXWB 2YPKA 5F3BA 1T3FB 3B2XA 3F7LA 5I15L 2V2TA 3DJZA 3JTBA 1TVBA 9PCYA 1AMXA 1BZ9A 2NQDA 6PCYA 1G7HB 3VI3B 1AYRA 3HRZC 1BMZA 4AYMC 3MUGA 1G9ML 3PGFL 1Y0LA 4GFTB 3WKNA 3G9VA 1IBZA 1KN4H 1Q72H 2A9BA 4EJ1C 2NXYD 4JFDA 4ZMYA 5BZDB 1NLDH 3QJSB 4XC3L 5D7HA 4Z7UA 5MENA 2V2WA 1U92A 3CFMA 1B2YA 1BVZA 1L3WA 2JLPA 1AS7A 1ZHBB 3VU2A 4ZW3A 4PD4J 1OD7A 5HJGA 4BFJA 3IF1B 3KBEA 4GBXA 4LFHG 4G7YH 4F8OA 5J57B 1I1AB 4L8BB 5E1IA 1JHLL 1MHCB 2YPLD 4L2YA 4XX5A 3B9KA 4GI8A 3DROA 1YYMH 2FZ3B 4J3PA 3UC0L 1A2YB 3NAAH 2I25N 1MJUL 1EV2E 1XTLA 3EJTA 3W81A 4H20H 3FH5A 5IMOB 1CLYL 2HKFL 2LABA 2MTAA 3O3BB 1SOKA 3EDEA 3UTOA 2X6AA 4K8RL 4PCSA 3MGTA 5B1CA 4FCAA 4M56A 2JF1A 3IU3A 1XB6A 1CFBA 2FSEB 3B9KC 4YHIA 5DLLA 1A0QL 3TXAA 4UNVA 3OWEA 3TN0C 3W11D 2D7NA 2K4WA 1FO0H 5ID0B 1MCJA 4ZMVA 4PS3A 1VDGA 1WUZA 3FB6A 2CJUH 2FYYB 4QRTA 3WXVH 2J20A 3MJ8B 2P5EB 3CFDA 5IFAL 3I6GA 3PGDB 1KJ2L 2YRZA 4AUJA 1GJIA 3GSUA 2CGZA 3RU8L 1UCTA 2PO6A 4HJ0D 3RVWD 2Y7QA 3S4SG 2D7TL 4L8SB 43C9B 4IS6B 2YJLA 1A5FH 1SXNA 2AI0L 2NY5L 1FG2B 3B34A 1PNCA 3MN8A 4P59L 4PJ7F 3RLSA 3GUTA 2E7CA 4QTIH 3WIHL 1SNRA 2R15A 4Y16C 3DOSB 4FNTA 3VD0A 5DQJA 3GDBA 1ZVNA 5C71A 5I1IH 1D5MB 5DJYA 1OTSD 5L9DH 4I18B 4F7MA 4DPAX 1KJMA 3RWCA 4NOBA 2ZMXA 2FJGB 4LRNH 1ED3B 2DBLL 4X6DE 2DOCA 2X12A 3PV7A 5FO7B 3DROB 3R0NA 3K4AA 1JV5B 1OAQH 2CHDA 3FU3A 5E2UL 2MNWA 1BM3H 4NO5B 4O2EA 1TF4A 4PJBF 5B21A 1ZHBA 3NH7H 3WTWA 5D96B 4JGNA 2VR7A 1TJIL 2BOBB 4LVNB 2W5PA 4FKKA 4YXLH 5JIQA 3CZLA 3W9EB 1KEGH 1MIEH 3KLAA 4LAQL 2NX5D 5DHVA 2B3IA 4PS4L 2ADJB 3K5RA 2YRPA 3KH4A 4HH9A 4XP9L 3PWNB 1JZGA 4JZJC 3ZU8A 3KHOA 5I1EH 3TPUA 5CEZE 2R0ZH 2FWLB 1Y1UA 5GS0H 2H1PH 2IXQB 3HAEH 4A04A 3SOTA 4L1HA 1KBBA 4B9IA 3DARA 4JO1H 1RU9L 4N2FA 4OZFH 4LHUA 1FGNL 1K5WA 3GUTB 1AGFA 1UM6L 4Y1AE 1P5VB 3HZYB 1O75A 3MRRA 3FO2A 1YC7A 3VFWB 1C08A 5I5IA 5B39A 2P24A 4AW7A 1CL7I 2XFXA 3MACH 4WSJA 2IQAB 4XP5H 3I6GB 1SMOA 5EN2B 2WP3O 3PS6A 3D4CA 5MEQB 1MVYA 2ZTBA 1AI1H 1YDPA 4G7VL 4Y2DC 1PGRB 3TC9A 4XVTL 5KW9H 2NY3B 1KTRL 4IGBA 1KENL 2DLHA 4ODVH 2P5WE 1LM8V 4TPRL 3IGLA 2OTUB 1VCBC 4N2IA 2PCFB 3HUJF 1ZLVK 3OAWA 2BVOB 2F53A 2GK0A 4Y2LA 3BKJL 3VXTB 5ABZA 3V0WL 4EDWH 5EPMA 1U33A 4LDOB 5C0GA 1SBSH 2WVSA 4W9JC 4X7DC 1M7DB 5IMOA 1NCBL 2OJEB 4I3GA 1KGXA 2ERJC 2HMIC 3WL9B 3EJSA 5D7IE 4C59B 1MFEL 2R1XA 4XNZB 3BH8B 1KOAA 2HJLA 4HWEL 1WEJL 2NZ1A 5F9WB 5L0QB 2DQEL 4JPIB 2FEEL 3WTUA 3ZQ9A 1KYOJ 4ELKB 1T89A 2C1OB 2W07A 1RV6X 2BZDA 2JKWA 3FPYA 1EJFA 1JRHI 3DTXA 5EORH 3U83A 2IADA 5IJDC 4XZUB 5KYWB 2LGNA 3PWPD 2WNXA 3NSXA 1FCGA 1MUJB 3HG1E 5EU4A 4NKOA 3ARBD 5B38B 1IKFH 3A6CH 4YDVB 4GO8A 4I48B 5FO8B 4BQBA 1KIQB 4H1LH 2F58L 4H8QA 1UM5L 4P2AA 1KPRA 3OLDA 3T8XA 1T7VA 1QKZH 4NQCE 4HK3J 1SM3L 3NCCB 5ECGA 1F45A 2GBVA 3NIDF 1J8HA 3FT9A 3NMEA 3HS8A 4QHUA 4JEGB 1IGYA 4WFGE 1UD4A 1CL7H 5HHOD 1YMMA 5BV7B 4QCIB 5CSZA 1DQJB 1JI1A 1VFBB 2WKOF 3KJ6L 4LHUD 2L7EA 4Q56A 1Q9OA 4R7VA 1QRND 4XRCA 4TNVF 1BFOB 1IUZA 2ITEA 3KYMB 5DVKA 1O6VA 1T4KA 1XXFC 3OAYH 3P30L 1CF1A 4GKSB 3KW7A 4OJFL 1KWGA 1H3PH 2HJKA 4F57L 1YEKL 2BP5M 3VXRB 4APQD 3LN5B 3EO1B 5FA4A 4WNJA 3TV3H 4IJ3C 2YPLB 4R83A 3VCLA 1IAIH 3VI4A 5F88A 4F7CA 4Y5XB 3IB4A 3BGAA 4XN8A 4YZFF 5E6IA 5I6KA 1CPUA 3K1KC 1RK1A 1AIFA 3E3QE 4BSWB 2JQZA 1F13A 2LT9A 4CA4A 1JF1A 1RZJC 2ADFL 1NBZB 2ZD0A 4ZUTA 3W3BA 1OAXL 5DD1L 5L4IA 4AQ1A 4NQTA 4OQTL 2X09A 3HPJB 3INUH 4BK5A 3ESVF 1JNNH 4XNUL 1OCCB 3N1MC 4C56E 4F37F 5E6IC 1PY0A 4P4KC 4F7PB 4ODWA 1F97A 4AQEA 5DD1H 3V0GA 1MKFA 2NW2B 3A24A 4UV7H 5EIQA 1CDGA 3SPHA 2VDQL 1MFMA 3CV5A 4HP5A 3QT2A 1RFDL 4HUWA 2WMPB 1MCPL 1HXYB 2VAJA 5IMMB 2W95A 3OKLA 1KG0B 4FXGC 3OM3B 3ZPDA 1GZQB 4A7UA 4FABH 3TS8A 2MPAL 5SWSA 4JO3L 4JDEB 4MAYB 5CD5D 2DQUH 1RURL 5D9SB 3SDDB 3FT4B 1HI6A 2XWCA 1OQOA 4I85A 3JTTB 4JN2A 2KS0A 2VR5A 3I9PA 4PRPE 4KVNH 3W38A 3GXNA 5JQ6H 3CFUA 3MJ7A 2VLLB 3BHBA 3DVGB 3PHAA 5D1XE 5TF1H 1B6DA 4KY2A 2XKUA 2ID5A 1JPFB 2IFFH 4ZTPL 4I5BA 1JZ6A 3LKNB 3MFFA 5CNHA 2Z7WA 3RRQA 5F6HI 4FG0A 4MMZA 4KJQD 5F8RC 3RL1B 3VGBA 5CUSL 3ZXAC 4PGBA 3ZL2A 3PWUB 5DUBB 3C08L 1JUFB 5E1QA 1HINH 1DVTA 2IFFL 4CC4A 4JHAH 4POZC 4P5TC 5ITBH 4KGJA 1K8IB 2V9UA 3GJEA 4W70A 2VSKB 2YPVA 5D72H 4P2QB 4R4FH 2XWBA 4IOIB 4X6FB 5C6TH 1AGBB 1RULH 3QUYD 5G5DA 5A6LA 1KTBA 4HHWA 4N8CL 2X4SA 1BLIA 25C8H 1BJ1J 1Q4NX 1FO0A 1QATA 3ULUC 1PBYA 3N91A 5FYLD 5C0CA 2PW2A 4PRDA 1JS8A 2XC8A 3K80A 4JDTH 4QRRD 3CVDA 4M7LT 1OTUD 4GG8A 2JJTA 3U0WL 3PDGA 3S48A 4U1KB 1FZJB 3HNVL 4F8QA 4B9YA 1ZK9A 3UZVA 3BUPA 1G9EA 3HI1B 4CDGC 3CXHK 1E5UI 5CZXC 3CDCA 3D0AA 2HMID 1Q9LA 2H2PD 2Z1PA 5LCVA 1E3FA 3B7YA 4YH6A 2X7LB 3ECVA 3DETC 4M3HA 1N5AB 3UFIA 5CEZD 4O00A 3W6QA 2GY5A 1WZ1L 2WW8A 1MAJA 2VLKD 2J72A 4IRSC 2H0FA 4WY7H 1GMEA 2NTFB 5HYSA 1MCWM 5B1BB 4X4YB 4KI5F 5LLIC 2EO1A 2FATH 4AEFA 4PRNB 1CD1B 3C9NA 2OMUB 3FTWA 4CGUB 1QYGL 5H94B 3GLEA 4F2ME 1BUGA 1QWHA 3MV11 1JPSH 4UUJB 1LNUA 5FEBA 3NFSH 3L5IA 2LTQB 5T1KD 4YEFA 1D5IH 3H2WA 4AX3A 2FAUA 4XGZB 2E27L 2D2CC 4XMUA 5JPMC 1BWMA 4P5TB 5INDB 1PJ9A 1YMHA 1J9TA 3DSNA 1ACYL 3KL5A 2BRQA 4JQXC 4XNQB 1A6AA 3HG1B 1JGUL 5D1ZB 4KXZH 2FYVA 4V11A 2WWOA 2DWSA 3B2PA 5IW6B 4JY6A 3RWHA 2CDFA 2DWDB 1NLBH 1WAAE 3P2BA 3QYMA 2NR6D 1SJEB 4PWHA 3UPAA 1ZXQA 4BUQA 3M6DA 4S1DC 1NC2A 4MNQD 3BJLA 3BI9X 1P1ZB 3BXNA 3F04A 1QQDA 1A66A 2IALA 4PGDB 1AHMA 3L2NA 2VXQL 2OQJB 5HHQB 2R59A 4Z0XA 3RA7H 3H9SB 3OJMB 4G7VH 4X0KB 2HRPL 4OGAD 4QXUH 3VMOA 3RFZC 3S37H 4U6XB 1XF2B 1WBYA 4MAYC 3QRBA 2VDRH 5BRPA 1QRNE 2VW6A 2VSMB 3O41B 1G87A 3G08B 3K8MA 2OSWA 2CA3A 1RZGA 3L3IB 2IGLA 1CXLA 5JW3L 1U58B 5DSCA 1CIUA 4YMPA 4UDTB 1SBSL 2E6PA 4L0PB 4UB0H 1F3RB 1CDBA 4JHVA 2BC4B 3C2AH 1CB4A 5EZPA 4LLMA 4FJYA 4ZFOA 4L37B 1FJ1A 3BP7B 2VDOB 1Y1DA 3C60A 4OGQC 5C0BA 4RRPA 5D1ZA 3REVA 1A6WL 1WEJH 2FVNA 4L3CA 1F3JB 2BIIA 1U8QA 2JTDA 2EIZA 1YMHB 2RCSH 3DSNB 3GRWH 4HSQA 4NP9A 4XMLH 1LO2L 1OE1A 4ISVA 5AKRA 2GB2A 4K3HA 4QOKD 2XN9D 2WXLA 5J89A 3QFJA 5MERA 4Z5RB 4JQIH 4C56D 1OE2A 1I8MA 4LGPB 2PWDA 1RH8A 4AJWA 5GS2D 1DVZA 4U1IB 3FB7B 2R2HB 2WBJC 1QW8A 3F6IA 4HOZA 3D50A 1RHHB 3IJYB 3O11B 1KCBA 2X9XA 4GKZA 3RDTD 2Y3AA 2AJYL 5KZCB 3UC0H 3LSOB 1HZLA 3QIUA 1W16A 5KYXA 1FL6A 3UO8B 1M9SA 3DOIA 3ROLA 2BW5A 2DMKA 1DQMH 1QI5A 2IDQA 1K6QH 3BFOA 2CCVA 3MRBA 4A2DA 2WIIA 4BFIB 1A4CA 3S36X 3HC0B 1QHOA 2BNQD 5FOBB 2E9WA 2VXUL 4LIQH 3MRLA 4AYFA 3BZFB 1PZDA 1DQTA 5DSCB 3K91A 4LLYA 1EXUA 2X0VA 4JKWA 2ADGA 3MXVH 4UQ2A 5F7KC 2Y1VA 2HTLC 1UKQA 5LB1A 4HS3A 3MA7A 3U0TB 3W0WE 5C0RL 4MASA 1H6UA 5ANHA 4DPCX 4GP8B 4U6XA 1JZDC 1XF2A 4KTYA 2B08A 2P8LB 2QMJA 3OPUA 1Q8MA 4JM2B 4K94C 1A9BA 4QRUA 5ICZA 5BS0B 4E9RA 3UROR 4R84A 4Z9KB 5I18H 3GJEB 5JHLL 2AI0H 5GRWA 1ZMYA 4PVBA 3C09C 3MUHL 1DFBL 5E8NA 3CFKB 3S5LG 4A7VA 3CPUA 1T1WB 2W60B 3OKKA 2BY0A 2LFEA 3LZQA 5KSBB 5CJXC 2WVVB 3FW6A 3MRHB 3WEBA 2AANA 5FM5M 1OAUH 2LAAA 2XYCA 4JFFB 3TEZA 3D4ZA 1I8LC 5J6SA 3RVVD 4J8RB 4R26H 4NM4H 1OP5H 3RE0A 4JY4B 3SE9H 2DYPA 2ICES 1X9LA 4Y4FC 3CLFH 4QRPB 5JIMA 1BVLB 4IRSD 3EJPA 1Q90A 1A1OB 2Y06L 2ZCLL 1DVSA 3DETD 3R06A 4ZW8A 3UOAB 1TZAA 5JLZB 3NIGE 3IE4A 4RSVA 5LHDA 4NM4L 35C8L 1TKWA 4APXA 1MDTA 1RZFH 4F3FB 2RTTA 2CBPA 1GC1H 1ZTXH 1RIVH 4HS8H 2XTSA 4U3XA 1MCPH 1SY6H 2UXTA 3JTSA 4G1EB 3EKCA 4PRNA 1N0XH 2NYYC 4GIAA 4K7PY 5EBLA 3N04A 2X0WA 1NEZG 4FFYH 5AW3B 3QQ9D 1ZE3H 1BT1A 4JJ5B 4PJDA 5GRVK 4NZDA 1C5DA 3TH3T 1HS6A 2HPOA 5DEZA 5D7SH 1I7RA 1X5GA 1GOHA 2Z64C 3V4UL 3B7RL 3H4FA 3HI5H 3J8F7 1RHFA 3U36B 2JWYA 3V8OA 1P2CA 4OVUA 5C8JA 2HKHH 3D2UA 4B97A 1TTBA 5ENWB 4GRWF 1QNZL 4F2MB 3APMA 5HJ3B 5D5MB 1A9EA 5J9PA 3HE7B 2XIIA 2SODB 1EAOA 2CO2A 4XP5L 1V10A 3L13A 1JF1B 3ZT5A 1WVZA 1Z9MA 1UWEH 1FBIL 2QKSA 2Q8BH 3P3SA 3S0PA 1E6OL 4MBOA 2D4DA 3FCTB 1BV8A 2FGZA 3BD3A 5D72L 3HRZB 3S7GA 1DBKH 4I4WA 3FCSA 4KRPC 4E9QA 4ZTOL 3BRGC 1NCUA 2NR6A 3V0EA 1R3HA 3HPLB 4UV4L 2XQ0A 3TN0A 4JGMA 3C5ZB 1BVNP 2BS9A 4ONOA 2H2SC 3MRIA 5TH2B 1NM4A 1JVLA 4LCIH 3WS6A 4LCCC 1X9UA 2DM3A 2WOBA 4NYLA 3RNQA 2FBOJ 2RQEA 4NQDE 4JFQB 1RJCA 5DJCA 2HN7B 2J2ZB 1HL8A 3EYUH 4D87A 3HAEA 4H26A 2YEZA 4MMXA 3WGVB 4QCIA 4JPWL 5GISH 2IIJA 3BZEB 2XQYK 3O2DL 4HWEH 2N3JA 1QRNB 2EEFA 2YC1B 3DVNB 3N9GH 1D9KA 2WM0A 3C5SA 4G3YL 1TTFA 4EI5C 4L1SA 5TGBA 4U0RB 4NN7C 4LCCA 2GPZA 2VXVH 4PRID 2GJ6A 1HYSC 1NFDB 2E6QA 3ULVL 4M6OH 1VEOA 2HA1A 1SHXA 4L1LA 3PU7A 3NRQA 4TNEA 1NEPA 3OKOB 4BELD 3AWEA 3QHZH 2EVGA 4KRPB 1E4KC 2A9NL 4ETYA 1OSEA 3KPRA 2XA8L 3FQXA 2DIEA 4IIQA 4F8LA 2BP8A 2KDYA 3AADB 3STLA 2Z65C 5A40E 2OK0L 3CDYA 3WY1A 5IG7B 4O2CA 3OSVA 4IK7A 2QQLH 5IV2A 1QFWL 3V4PB 2Z7YA 4FXLA 1I3GL 4OBRA 1N0LA 1JHTB 1A8ZA 3WU1A 3O2VL 4OCSL 4QHKI 4R0LC 5A2JH 4BWUA 3LRKA 1SYVA 1CTMA 1OP9A 4MS8C 5EUKA 2BVOA 4HT1L 1Z2KA 2J2ZA 4JFQA 4EUPA 1YEFL 4H8WH 1FIEA 1S9KC 1UOKA 4JMNA 3BVWA 4OI8A 3VCLB 5K1NA 2AAVA 3DV4B 4KY1L 3GSWA 4HPOH 4QXUL 3LN4B 3CDGB 5EIIG 4C47A 3MV9B 4L4VE 4CVUA 2VDRL 3C5ZA 3OJDA 2GBUA 2VDMB 1EEZA 1XFPA 3VM7A 3KYMA 1R47A 5DQ9A 2AQTA 1FL5B 1KXTB 4M62L 4KRLB 1WCBB 1E9OB 3SE4C 3M7OA 1KGCD 1T83A 2F2HA 3ATEA 3P9MB 2DZEA 5I2IA 4K5NA 4A2HA 3EFFA 1E5ZA 1JD7A 4XCFL 4LSPH 1G7PA 4KI1A 2C34A 1TSRA 4AZ8A 4I1PA 3SBWC 4Z7WF 4MHHG 3SDAA 4ZDHA 4YUEH 3AWVA 4JPQA 2IANE 2I32A 4UV7L 3ZQXA 4AGQA 2NX5B 5I1GH 3KPOB 3QHFH 3CIQA 1L0PA 2C9VA 3VA2C 2JJSC 3KYOB 2NNAB 1ZE3C 4DOHE 3P4NB 4HK3N 1A8JH 4GQZA 3TO4D 1G9MH 3PGFH 2DYPD 5JIIA 2AV7A 3S3DB 3TBCA 3X1GA 2WTOA 4EI0A 4WUKH 3KPRB 3ALWA 4WO4D 3PCYA 3SYPA 4BA8A 3S88L 2EEXA 4P07A 4NN6B 1MNUH 2IG2H 4WCYH 2JKNA 5F3HA 1QO3A 5IB4B 4A39A 4Y4HB 1FAIL 4KK6D 1H5BB 4GSDL 4QXWA 3V5KB 3ALPA 5TF1L 4BRVA 2MMXA 1NMBL 2OMZA 3BH8A 2J57A 1K6QL 5BV7C 1TMQA 1R5IB 2QBWA 4ZOCA 1JBJA 5CCHE 3E1F1 2EH7H 3MLZH 5BMFH 3A6BH 5IVXE 4DNLA 1FYHB 3JYCA 1N3NA 2VXTL 3ESUF 4OGXL 3MMEB 1SFDA 1HN1A 2EDKA 4N2AA 3GM0A 5IB5B 4BZYA 1FGVH 1H5BC 4X9FA 1ZK5A 4J3TA 4OGYL 3WNMA 2OX5B 3JXAA 3UBGA 3SCMC 4J3VA 4Z7OF 2VXQA 2NXYB 2ZWEA 2WVVA 5MHSD 1OT4A 4BDVB 4MDJA 1QI4A 4WZ9A 2I9LB 3NSYA 4GINA 5I0VA 4M7KL 25C8L 4ZFGH 4POUB 1ES0A 3JWOH 3QWNA 3V79C 1CD0A 5IFAH 4JM2A 3ZE0B 5ICZB 4JDTL 4Y1AA 5C08D 5TQ0H 1MN4A 2CKBL 1AD9A 5KBNC 4PJFB 4UM9B 4GIOA 4ANXA 1AQHA 1R34A 3QCVL 3UO1L 1SXBA 4X4ZA 1EWHA 1JOIA 4GXVL 4NRYA 3PP4L 3KE0A 1A3LL 15C8L 1JK9A 3ZE1E 5J1SC 3WMQA 1KULA 1E65A 4I3SH 2IXQA 5TK2A 5E8OB 5CLXA 2VITA 1L0YA 5FM8A 5AZEL 3SGJC 3ZHNA 1IC5L 4WI0B 4IYKA 1WHOA 5AUMA 1PIGA 2F61A 1FVCB 2J71A 4ANWA 1XTMA 4WI9A 4P2OC 2A73A 4X80L 3MROA 4GO6B 5BXFB 4XNXL 3GMRB 3FQYA 3MYZA 1MHCA 4WTXA 1I7ZB 3PL6B 3QORD 3DUUB 1HJCA 4XCNB 1CVSC 2V33A 1HHKA 3GSXB 3MUUA 3SGDI 3T3MF 1JZ5A 3I50H 3DPBB 1K4DB 3L16A 3WFHA 1N68A 4NUGL 4RGMB 3Q6FB 3DX1A 1JMZA 1MCNA 1XGUB 1ZHLA 3FSZA 4MJIE 3QPXL 4HISA 4JQVC 4K7FB 5HY9B 4X6DA 3QFJB 3ZDXB 3GIZL 1AOHA 1IEAA 1T7WA 3GB7B 4PJ5B 4RFEB 1H3UA 4MJ6A 1M9WA 4BIKA 2H9GB 2WIMA 1NCTA 4KXDA 4D9QE 1TQSA 3T3PF 1OK8A 3FRPB 3IYLW 3LV3B 1CLZL 1FFRA 3CTTA 4YZFE 5D1QC 2HFFB 3QHTC 5GQBA 4W9FC 2BNRB 1QFHA 2YMTA 2A38A 3DOSA 4RISL 1AHWC 1JZ8A 4XAKD 1CCZA 1P4BL 2WXOA 3LMJL 3PWPA 4LE8A 4LOUD 5JOFB 1N7MH 4RDBA 3AT9A 1EHXA 3FB8B 2DQTH 4R96B 4DGUA 2NNCA 3KNBA 2WP3T 2Y7QB 1BD2D 3T0DA 3WE6B 3WIIH 2YMXL 4ZXBC 3L9RA 2VR3A 2X3AA 4UNIA 4NI3A 2P5EE 4H44C 5T5FL 1VKXB 3N3EA 5DC4B 3QRLA 2B59A 3O41A 1P4LB 3VTTA 1GJUA 1IGFL 4PB9H 4ZO6A 4QJ5B 4GQQA 3IDYC 2CO3A 3GSRA 2A6JB 3DX7B 2GVYA 3IMUA 1DVFB 2YWZA 1E5CA 4EI5B 1CE6B 3NZ8B 4I0KA 4YJZL 4LEEA 4GB9A 2IF7A 5F7EL 3S97C 1GPOH 1A1NA 4W68A 4ZMWA 1SXAA 4W6XB 1Y07A 3EOTL 4PREB 3D85D 2EICA 3AG2B 3EYSH 3M1BB 4RBPH 3VJ6B 4F37K 2GC4C 2GAZB 2HWZH 2KBGA 3R4RA 3S34H 1VJSA 2JK5B 2JNZA 1IBGH 5CSBA 3W39A 4HIXH 1JRHL 5E00B 3BEVB 1GR7A 2BM3A 4NSKA 4M8VA 3NPSC 4DKAA 3EOTH 3RKPA 1BZ7B 1U3JA 3PWJB 5F1OB 3JT0A 1KCUH 1WHPA 3LSOA 4Z7NF 2BCKB 3ZO9A 2H47C 4ZK8A 1NAMB 3KEDA 4XGZA 3WSQL 3EHBB 1IBGL 4HOMA 3VB9A 2R2HA 2J8UB 2UVFA 4X8JB 3WXWL 3WO4B 5T1DH 2IANB 3LXCA 4R9HA 5EUOA 1BA9A 4RETB 5DRXB 3K2KA 4LCYB 4JANB 1EJ6A 1LEKB 1PDKA 3L3JA 1IM3B 3FOMB 1OARL 3X11B 2WLKA 3VH8A 1SLUA 2WLIA 3O3DA 3RIAF 2DMGA 3RUGA 4F7TA 3FOLA 1U8QB 3QA3B 1IVLA 5IF0A 3NTCL 2R2BB 4UIMA 4CADA 1OAYH 1F90H 2RB8A 2HVKB 2Z0BA 3S2AA 5BQ7A 1WBZA 3FCGA 5F2FA 3O3DB 3GI9L 1GRWA 5AW6B 4AQ8C 3LRSB 3KDMB 3L3OB 1AXSB 1N6VA 2AEOA 4OFQA 1H3TA 4IJTA 1CFTB 2OL3H 4DGWC 1I53A 1IQWH 1T1YB 2JCCE 3CHPA 3QIBC 3HB3B 5HHPB 2BSTA 1D2PA 5I6LA 4Z7WE 1TPXC 5ICXB 1X6LA 5GGSA 3VGAB 2B1AH 3MCYA 3EYVB 3HZ3A 2Q3ZA 5E24E 4QHPA 1PY9A 5K59F 1WFTA 3VXUD 1EDHA 1VERA 2XNAA 3N42B 2FX9H 4Z7OE 1P1ZA 3S3CB 1GKEA 4OCYL 4NQVB 4PGCA 2I85A 3CFBA 4MQSB 5DMGC 4HG4K 5SWSD 3NSCA 1TYRA 5IREA 5EU5A 2PP7A 1QHQA 3CG8A 1ET7A 1IE4A 1UXMA 2EIJB 4JHUA 3G5XB 3HUJA 4PN6A 1B4RA 3FT3B 1R1CA 2YUZA 3GLAA 4KKQA 1AHWA 3VD1A 4E68A 3AGVA 3ZIYA 3S5LB 1A6AB 2FO8A 1A9VA 4JR9H 2P9RA 3HVNA 5GRYA 2ZWYA 1RZFL 3TZVC 4X6EB 4NZJA 4A1RA 1X7SA 4ZXBA 4JFVA 2ZUQC 5F7LB 1R3JA 3C09B 3QBTB 3ECBA 2O30A 4FNSA 1TU2B 4MXWL 4EUPH 4TVPL 5FX3A 3C5JA 5I17B 4J6RH 2Z8SA 3V9FA 4YC2C 3I9IA 1OF2A 2QVFB 5CJ8A 1MW3A 5L8KB 5IQOA 2E7LA 2YMOA 2G2NA 4UU9A 4YEEA 1DBJL 1JZ4A 5IMMA 1KFGA 3QUYB 1XR9B 4JO3H 1MQ8A 4PJCF 4W4NA 3CQFA 1MLBB 4DGVH 4XTRC 5GZNC 1OGPA 3LPPA 3KYKL 4YR6A 1SJMA 1LNLA 2FJFA 2VQ4A 3NJXA 5CFHA 4N90D 5DURB 5FCUH 2K1MA 1S7TA 1C9SA 4N2HA 5CM1A 3OXRB 4WV1C 3GDCA 4Z7WA 2RFXB 2Q3XA 1UA6L 1UJ3B 2VE6B 2P5PA 3D2TA 1WBXA 5D7LE 4OGXH 5AL8A 3CFEA 4BWTA 5KVGL 2CGRH 2G60H 4XN4A 5DXWA 4RX4D 1NFKA 4CU8A 1E6JH 1JAEA 2D3NA 3H85A 1E4WH 2JTYA 2X10A 1XGUA 1KCVL 2QPSA 3G5XA 4JFEE 4UM8B 1NOLA 2VC2L 3SQRA 1M6OA 3OGOE 4G6KL 1IEBB 3KZ8A 4PJAB 2YPLE 2QZ5A 4UDUA 1A14L 3MR9A 1BF2A 3T3ME 3D39B 3BUYB 3Q2LA 3VI4B 1OCRB 2X4NB 1R5VB 1MFUA 4Z7UE 4KFZC 1IC1A 5DD0H 2YWYA 4JJHA 5HDOA 3GI8L 3MR9B 1I82A 3QORC 4ZMZA 3F3HA 1KIRA 1OEZW 4PG2A 1C1EL 2E46A 3RWDA 4BQ6A 1I3VA 1FQ9C 3H42L 2OYLA 3RL1A 1U3NA 4TQHA 5CIPB 4Q6YA 2DD8H 4ZDHB 2BXZA 4NKDA 1BQHA 2NY7H 3KS0H 3U0WH 4LCWD 2XWDA 3GBML 2WJ7A 4PJFA 5DZOA 1IBBA 3CVHA 4M1GH 4WIQA 2W9LA 4GPVA 3VFGH 5D1QD 4LBEB 4N9GB 5GRZA 2PPAA 2LVCA 5F96L 2DMHA 4GQRA 5IF0B 1SOQA 4OLXH 5A1AA 4FEMA 3ULUH 1EEZB 3VH8B 3QO0A 3PIQA 1DBAH 5HDBE 1QLEH 1NC2D 4LCYA 3DV4A 3HR5A 2VUYA 2VWEC 2J6EA 4XN5A 3C5JB 3SE4A 1BXUA 3MNWB 4IKKA 3P3YA 1RZ8A 4FLRA 3X14A 5JXEC 1NGZA 1MHEA 3IMTA 1A7NH 1SEBB 1UD3A 1BEXA 1N0LB 4FTVD 4G1MA 5E9DD 2XPZA 4WNQA 4ETQA 4XX1E 1SLWA 2XN9A 1U8CB 3VSVA 5CZVL 2EVHA 5GGUB 3QJTB 4MDIA 1WO2A 5TE6L 1OM3L 4D0DB 1HSBA 7FABL 2CHZA 2FT7A 5EPMB 1UH3A 3OQRA 3F7PC 4MAYD 1N8ZB 3ASWA 5C0BD 4GAJL 5GHWH 5LXGL 1JHLH 1OAZL 2BLFA 3BQUA 2R2EA 2PWFA 4ABQA 1I3UA 3ULSA 2PLTA 2WB1A 5D96C 2FLBT 1KFAH 2YPLA 1OM3H 5CBEB 4KZEH 3OGCA 2P80A 5H37H 3I2CH 5L88H 4X5XB 3THMH 1KLGB 4C4BA 2AW2A 5TDPB 4N6QA 4XMWA 5C0AB 3TO4C 3CXDL 4NDMA 1KJ3L 1P4LA 5E8PA 3ZJAA 1ZANL 3D4GA 4PRPB 4YBQC 2G5RA 4NZTL 3ML9A 3P4MA 3UPCA 4I18C 3HBZA 5I8CA 3GIVB 3P40A 3QAQA 2Q10A 3IFOA 1AGFB 1ZTMA 3BSZH 3MRJB 1FZOA 2MIZA 3C2AL 1FO0L 1LO4H 2YJQA 2YSSB 5CEXB 3GRBA 4XE5B 5F21B 5EG6C 5JMOC 4Z7OB 4DKDC 1VGKA 4RZKA 5AG8A 5IBLC 1E2ZA 1LO0L 2AK1H 4MMYA 3C2SA 5G2NA 3SE3A 4WUKL 3K6SB 2A9DA 5TH2A 2FD6L 5EBMA 5I8OH 3HI6H 1DJYA 4AIZB 2E3VA 1CZ8L 4HH9B 3HPLA 4X4XA 5T1DL 1MNUL 1IILE 2IG2L 3APNA 2ZZUT 3F7VB 5T1LB 3WIHH 4PSPA 4UCFA 4NQCB 3ENEA 1SYSA 3VI3F 5C70A 4Q0XL 1JPEA 2OMWA 1FYTE 3VFTB 4KKPA 4UTCA 4PWIA 3HE7A 1MCKA 5E70A 3H9ZA 2Q2EB 3P02A 4KKAC 2HJLB 5IV2B 4CN1A 2JIXB 2X89A 3D0VA 4N0UE 1IGIL 1PZCA 3GMOB 4MSWB 3JV0A 1AGDA 4MHHI 3UAJC 1M7DA 1D6VH 1HZKA 1HKFA 1NAKL 2DQIH 1JSYA 2D31A 3RPIB 5EF3A 1JL8A 5T3ZH 1V7NH 1DL7L 4B0MM 1A21A 1PL3A 3SBWA 4K2UL 3ZN6A 1UQSB 6TAAA 1MIEL 3MFGB 2PXYB 4NO3B 4L8DA 2EXYC 1ILUA 1FRGH 2J8HA 5D7LB 3U4AA 1YEHL 5IVXA 3RTQB 3D9AH 4FS0A 2CUAA 2XWTB 5GIRB 5GS0D 3LNIA 2FT8A 5BO0D 2NT1A 2JVUA 1SVCP 3MJ8A 1H15A 4LCCB 4F7EA 2FO4B 3LH8A 4E41E 2FJHA 4FTVA 1MHPH 3AS3A 4KV5F 3C5ZC 1G43A 3VX0A 1NCJA 4FQIH 4Q7DA 5DC0A 1JHKL 3SHSA 1K5NB 3DO7B 3NFNA 4N8VB 4NAJA 1XZ0A 5C0IA 2OX5A 2EVJA 2XPGA 1DVYA 1BM7A 1AC0A 2EDTA 1EAQA 3BH4A 3JWNH 2WUBL 4KHXH 1S9VA 1TVDA 1BFSA 3AVEA 3P9LB 3RNQB 1UHVA 1DCEA 3BVDB 1BPLB 2AJ3B 1DEEA 4HSAC 4K94H 1ETB1 1LDPH 4HBQA 1P84K 3STZB 5TE7H 1UT1A 3SBPA 4XVTH 2Y06H 2ZCLH 3DX9B 3VG0H 3QPKA 3K0WA 4UINH 2UZXB 3E6FB 4MWFB 2J6EH 2NY6D 2J12B 1ZTXL 2D73A 3UBXG 3D18B 4YDLB 3EO9L 2AJVH 3V6FB 4PV9B 5D1XB 2F5AL 3H0TB 3WFZA 1CWVA 2PXYA 3AY4C 5FM4A 4IQHA 2GBAA 5D5MA 1CG9B 4RGMC 5FCUL 3DSFH 5AENA 2QGBA 1PZUB 1PKQB 2XKSA 2V9TA 5GS1C 3EO9H 5J1TC 4NIYE 3U46A 2DQEH 2VISB 3QAZB 4Y4HC 4F7MB 2X40A 4HC1L 1RKRA 2KC0A 2WLHA 2V5YA 1BJ8A 2DTMH 4N8VG 4JFTA 3BWSA 1ECYA 1JK9B 1LMIA 2H2SD 3TBYB 4JE4B 3AWWA 3LDBB 5ITFA 3AX0A 5EFIB 2ZQKA 1W0VB 2VC2H 3A6CL 1KYUA 3Q2NA 2OJZL 1RHHA 4YE4L 1X5AA 3H7LA 5KOVC 1YECL 3NZHH 3VFRB 5BS0E 3ALXA 2Q8BL 3ATFA 2R4SL 2P42B 3KWWB 4HD6A 4HMEA 4G1EA 5DMIH 1I1FA 4XCCL 3EGDB 3IT8D 1M6UA 3NCYP 3HNTL 4QNPE 2DQCL 3MLRH 4JS7A 1SHWA 1OSYA 3FTGB 2W38A 4WI5A 5SWZA 4P46B 1H6EA 3UGXA 1E8ZA 2J1XA 3GO1H 2AS5M 5B3JF 4LSVL 1RPUA 5JNYA 4JY4A 2E75C 2JIXD 3CZSA 3WCYA 2F8OA 3OG4B 4I0CC 3ZL4H 2MQCA 2YK1L 4J8RA 3LB6D 2XX0A 4FYQA 2NY1B 4UT7H 3RBSA 5C0EB 2L04A 2WWKO 3AY2A 4N8VA 1S7QA 5I8CB 1WFNA 1A4KB 3F7QA 4QRRA 4E36A 1OSZA 4CMHB 4CMMB 4F15B 1UJ3C 3SOBL 5DJ2A 3HMXA 3GXPA 1R5IA 5AVZB 1KB5H 4HU8A 2A83A 1BBDH 4WW2F 1MW1A 2IPUG 3ARQA 2MRYA 3V5KA 4B9JA 2EC9T 2NY4D 4OSUH 1Q38A 1DBAL 4KU1A 3WLWD 3AS0A 3UCRA 3ULVH 1IEHA 3M17A 1GGTA 3NCEB 2XWJA 4I3RH 3QH3B 4JRYB 3FQXB 4I7ZC 3O9WB 3QIWB 2XZCH 3IXAB 2PWEA 4X7CC 5EOTB 1J5IA 1EXUB 5F0MB 4CC1A 5GSVA 2DF3A 1FVEA 3OL2A 2UY7A 2MNUA 3UYRL 5DF0A 2BPBA 1XGYH 4RAHA 5DYOB 1HE8A 2ZG2A 3D06A 4HW6A 3TFKD 3TNMA 3PNRB 3B4NA 2YOAA 3L95B 3GMOA 2AJZA 3PV6A 2QVIA 5F3BB 2EAEA 2F54E 3VVWA 1IARB 4QRPE 4MD5A 4PH8A 4G6FB 1DO5A 3R1GL 1KEML 1KGIA 1Y6MR 3BPCA 1FL5A 1WFIA 2NY4B 2WKLA 2B1AL 3LQMA 4FXKA 3LPFA 5JQ6L 1J0YA 1A7QH 3OMAB 1WYJA 3HR5B 5IHHA 4KRMB 3RKDD 5FUZL 2X5PA 1RIHH 3MNZA 4S1SH 5L6YH 4XPFL 1CU4H 1TJGH 5E5LA 4NUJA 1FE8H 4XBEH 1R3HB 3LN4A 4M4RA 1ODUA 2Z92B 3JWNC 1TPXB 3IPBA 5JDSA 6FABL 4B9PA 3J07A 4Z6AT 4MNHA 1M7IA 2VRAA 3WS3B 3Q01A 2J1YA 3FMGH 4PRIA 3D05A 3PL6D 2K3TA 5ABDE 5H2BA 1WIOA 1GGBH 4LPVA 3N40P 2KHAA 3FQNA 3BDYH 3UDWC 2KI6A 5B8CA 1AGCB 4HIEA 2CPUA 2WZ0A 1CLOL 1WBYB 4MJHA 5L7XH 3P3TA 3QGVA 3TL5A 4OZHE 4BCYA 3UAFA 1J5CA 2JB6A 2CJUL 3WXVL 2W0KA 4Z7VF 3GWJA 1OPOA 1SMDA 1K9TA 5FYLH 2QPEB 1QQDB 4P5RA 1Q1JL 3ZTEA 2IBBA 1GSMA 4XI5C 3UAEA 3I75A 1AG0A 1BIHA 4AV4A 1NCNA 4LHUG 5LQBL 2NY5H 3BYYA 2DQGH 1KIUB 1RZIA 1CF8L 4M7JL 1NCGA 2IGFH 2UY6A 4HCRA 4AJYV 1S5HA 2J5LC 2A74B 4AEHL 1M56B 1F11B 2OSYA 3K72A 4XPAL 5ILTH 3NPSB 1SQ2N 4GSRA 1I3RA 2DJ4A 3QWRA 5IBTH 1GW0A 3VXQA 1NGPL 2AJXL 1I3RB 3F5WA 4FL4B 5D1XD 3WMPA 5KBPA 1DFXA 3RVVC 1HWGB 4NBYB 2DY2A 1X5JA 3DX6B 1P69B 3SYAA 2EO9A 1MH5A 4YSUA 3QJVB 4LZKA 4O9HL 4KXBA 3K3QA 3ARBA 5SWQA 5SWSB 3OHXB 4O02H 4PBXA 3WNPA 3GI8H 2Y7NA 3I75B 1A4JB 5IQ9B 1JXDA 4JDVA 2NNFA 5GGVY 4N6RA 4ZFGL 5KEZA 1ZGLM 4AC4A 3DI2B 4ZQKA 2BVQA 4CSPA 3MV7A 2FL5B 1RZJH 2PP8A 3RAJL 2H0PA 4F7PA 4DQOL 2H1PL 4OZHA 4PVLA 4I0PC 3QYNA 2GSMB 2J6WA 3W5MA 3ZTCC 5I0XA 5K1VA 1BD2A 3RGHA 5HJ3A 3KLSA 5JIKA 2OMXB 3CX5J 4H13C 1DBBL 3O0LA 3VUAA 3HG3A 4JE0A 4H88L 3QDMD 4P5KA 4LP5A 3TVMB 1S46A 1FL3B 3EZ8A 5TK4A 4UQBA 1AC6A 3GRGA 4DGYH 1E27B 3CPLB 2FL5A 1H9VA 5C0BE 2WWKT 2ZWZA 5EZIH 5LAXA 5D71H 3RP1A 3H9HA 2O6EA 4P2QA 1WD8A 2GT9A 3TBTB 2AQPA 3D7PA 3LEYH 1IT9H 4PJAA 5GZND 1DE4B 1M6OB 1WTGT 5EBLB 2VZOA 1PCXA 1TZHA 5LNEA 3V6BR 4GFXA 1VADA 2B1HL 1NA8A 1B4JH 3S3PA 4R90H 3VRIA 5IROA 3QIUC 1K85A 3F62A 5MERB 2Q7NA 3L3OA 4HWUA 3T0ED 1MFAH 2F08A 3EJYC 5CSZB 3SDYH 3F58H 4AJVA 3KYNA 4G6ML 1MFDL 3CFEB 3EGXB 4MNGB 2DTML 1E50A 1FZMA 4NQXB 3BHBB 4Z7NB 2O5XL 3JWDL 5BCAA 2YZ1A 1L3NA 5C7XL 1G0YR 2X4UB 5DVMA 1CIDA 3RQ3A 4G9FB 5T8IA 3BIBX 4KK5D 4G72B 4RCAA 1HWHB 3VXUB 4Y0GA 4G6MH 4HKZB 1IKNA 3ZK0A 3FN9A 4IMKC 3IRZA 1XGRA 4WU7A 3U9PL 2ZOLB 2XVGA 4ES9A 1G5GA 2YD9A 4LLWB 3OKLB 5DZJA 1FFOA 1QUNB 3DBXB 5EIIB 2IMNA 4MDRA 4G7YL 4BH8A 2G2RA 4BFRA 3IDJA 4H5SA 4ZUWB 2G3MA 1PZ5B 3FB5B 3KCWA 1HH6A 3AT0A 1GMIA 4F9LC 3CSFA 4PV8B 3TT3H 1TZ8A 4WENB 3AWFA 3ERXA 4Y5XC 2K6ZA 3GO1L 3HVDA 2ORBL 3P0VL 1A7BA 4UQ2B 3S36L 1FPTL 4W4OA 4P2CG 4ICWA 2JK5A 3SIKA 4QF1B 1JNLH 4MD4A 4UILL 1R0AL 2B0SH 1SJEA 2B2XH 3CHXA 1NANI 3H3PH 3IKKA 5L4FA 1AGEB 4PRIB 5CEZH 2VQ1A 3ZRFC 3ZW3A 2Y3NA 1ZIBA 4DN3L 2HG0A 2BNRD 2H6PA 4NQVA 4PGCB 3TBWA 1VFUA 5LN8A 3QCTL 2LR4A 4G6JL 4K7PH 5GS1A 1TQBC 1M05A 5HDWA 1U3HA 4IRZH 5JHLH 3US0A 4F57H 2B2XL 4N3UA 3BEWB 3GGWA 1J05B 3BH9B 3WBDA 4F93B 4G8GA 3WUWA 2BS71 3A4FA 3S3JA 4EZKA 1IBFA 1HC1A 1IAIL 2ADIA 2KDGA 3ZUCA 4OZFA 2YBRB 1VZHA 5IESL 4JN1L 1ZLWH 5B39B 3TF4A 4CNIA 1E90A 3L9YA 1S7UB 3TVMC 2WQVA 2VC2B 3RKDC 1TNNA 5I1DA 3KGUA 1ZLUK 1ZA3B 3LRLA 2VQTA 4WJ5A 4YXHL 4DZBB 4LLUA 3E8UH 5FW6A 4Y1SA 2X7LA 2DWTA 1GOGA 1MFBL 1SDDB 3REVB 1BREA 1SJHB 4ZX4A 2CIIB 2HTKD 3QA3A 1BAFH 5IVZB 5KVFE 1V7NL 1IGTA 2WK2A 3VDCA 3PHSA 4PI0A 2WLIB 1G1YA 3BAIA 4A67A 3MV9E 4L4VB 1N5YH 4YHPB 1UC6A 5GGQL 4NQEE 1Z7JA 1TG8A 3MRKA 3SDXA 1JNHB 4PJ9B 1DLFL 1EERB 2ZCHL 1MG2C 2QDWA 8FABA 1NICA 1BZ8A 1ECZA 3SYQA 1UZ8A 1RLBA 3GMMB 3H0TA 4WWID 3OKDA 4K23L 1MFCL 2VDQB 3JV6B 1ZWIA 1YMME 3A23A 1L9TA 4XCNA 4NJ9H 2FHBA 3WHE0 3ESPA 4DIXA 2ZCKL 1L0XA 4QXGL 5SX4H 4J3XA 3D4YA 3BXNB 3T04D 3UBXB 3BEVA 4NSKB 3GSOA 2TSBA 2AXJA 3MV8D 4KKCC 5EOCL 4KUZH 4P46D 2GAZA 1S7QB 3OLIA 1FBIH 2AGJL 3WHE1 2DWDA 1SXZA 3RZCA 5E8EB 1RZQA 2B15A 3HG1A 5FHBH 3CFCH 4BFGA 2VIRB 1CLOH 1BQHG 4M61A 4KWUA 3GTNA 1FLRH 4QHMA 3DI3B 5DVPA 3UZEC 3QEQA 5KVMC 1X9QA 3NABL 3T2NH 5I9QC 3SKJH 5KW9L 4Y4HD 2Y2YA 2C9PA 3KWWA 4MB5A 5F7MC 4JCLA 4ENEC 2ICWI 2XWTA 1DVUA 3M46A 1R3LB 5D6DC 4ES8A 3TA3D 5DMYA 2CQVA 4ZO8A 4G8IA 4MAUL 1R33A 4BH7B 1KCRH 1QSEB 2VL5A 5BRZD 3GZQA 4Z7UF 2K9FB 3BX7C 3L1GA 1CGVA 2R56H 4OKDA 1WFOA 4PJGF 4KHTH 1YRKA 3HZKB 2F5BL 3L1FA 2JI1A 2AHLA 4FXGB 3T0EA 5EEXA 2H26B 1FNHA 3ET9F 3GEWB 2H32H 3OF6A 3ZQWA 4ZMLA 3CFIC 1UA7A 3W9EA 3IDNB 4MX7B 5HHVL 1QRKA 3BMVA 4DTGH 3VXNB 1WAAF 4LF3A 1LEGA 3RY6A 2YUXA 2P3XA 1J8HE 3GNML 3QARA 3IJ9A 1I9RL 4RGNB 3RHWF 4NO5A 4O2EB 4FN0A 3IXTA 1SVBA 2JFCA 3QJUB 4MQ7B 4YPGB 1T7XA 5DJXB 4YOKA 4GRWH 3BAJA 4K3EL 2F58H 1G6VK 3MROB 2YN5A 3Q05A 2XICA 4HWZB 3TBBA 1OALA 2WYTA 2ILLA 4QHNB 1TCRA 4JFEA 2PCPB 1SF5A 5J12C 1CGWA 1CT8B 1IGJA 2VUKA 4D9RE 4JCMA 4DF9A 1JGUH 3BP6B 5DTFB 4DK5A 1AHKA 3VMPA 4XHQA 4XXDA 1TCMA 3UTQB 4G6AD 3T71A 3K2IA 4NRYB 2YSSA 5CEXA 1KTKE 1U8HB 3WEMA 5F7AA 3F12A 2PWHA 4HEPG 1ZCRA 5C09A 1OCWL 2WLLB 2CD0A 2PO6B 1H3PL 3VYOA 4IU2A 4WDIB 1BYNA 4NLHA 3DA0A 1JNJA 4MJIB 2DLFH 4Y2DD 3HB3D 2PYFB 1IU1A 1B88A 2VTFA 3IS1X 2AV1A 3RGVD 2MKWA 4PWEA 4CJ0A 1TQWA 5D9SA 3G6JA 3SDDA 3SJVE 3MX0A 4PRIE 3PDDA 4G8FB 3WUZA 4XCFH 4PJGE 4YHIB 5TTRA 4U49A 1UQSA 5LAPA 1OAXH 4HWBA 2NY3D 1BQLH 4Y2OB 3TT1L 3MGTB 2WLZA 5IB5A 4Q9QH 5LBSA 1A7RH 5CJOH 4L0ZA 3GMQA 1QACA 3CDZA 1RP9A 4YXKL 1AE6H 4D2NA 2NY2D 1KTCA 3W2DL 4MSWA 4AGMA 3R7RA 5E1AA 4KBPA 4OCWL 1YVLA 1J8KA 5CZVH 2IAND 2WVUA 5HYIA 2BY1A 5KAQF 1Z5HA 1Y6KR 3W9DB 2ZSVA 4XPHL 1HILA 3I6KB 4CILA 3BD4A 5E23A 1H3VA 3VFSB 5F9WC 3MRPA 5BZDA 2PF6A 3QEUB 4ENZA 3DDFA 1CGSH 5L4JA 4FJZA 4BQ8A 1N64L 3QO0B 4AVHA 1BVKA 3NA4A 4YBQD 2AJSH 2JCCA 4Y89A 4NQCD 5DRNA 4Z10A 1A0QH 4P2QD 4BFEA 5JHLA 4DP9X 3CMGA 1KJVA 3HE6D 3SCMB 2IV9A 1JWUB 3KJ4C 4FXTA 2B4CH 5HGHA 1YYML 2IV8A 3ZYIA 5I76A 2V8LA 1NGYB 3U1SH 5C09B 2H1XA 1YMMB 5E2WH 2WQ8A 2NXZD 5TQ2H 2CO4A 4FG6C 1IAII 2HZHA 3PPEA 2D3JA 5ALBL 4BUGA 1NGYA 3NJLA 3MV7E 1CXIA 3U48A 3UTQA 4RIRB 4IBTA 4W93A 4PRPA 2N4IA 3QYCA 5C0RH 4FQHB 2WNWA 4KK9C 3SYOA 4OIAA 2X1XR 4QPEA 4YHZH 5J1AB 1W6WA 5K59E 3FO0H 1MJJA 4ZPVA 2LVEA 3QC6X 1KIRB 4JFEB 4N8UA 3SD2A 4AI7A 3EXJA 3N0PB 1NFIA 5CGYD 4J5VA 3FONA 1INEL 4M6MH 1ZDSA 4JKMA 4JLRA 1H6FA 3TCXA 3NIFF 5E5UB 3VM5A 3TFKC 1YN6B 4Y5VB 4A2FA 4D3CL 4KQ0A 3AB0C 3T3MB 4LRNL 3VSTA 3NZUA 5T1JA 4UDUB 5FIEA 3TJPA 2GSIA 3NFPB 3W9DA 1RJYA 4QWWD 2X3BA 4UZUA 4D0DA 4MS8D 1MI5B 5HI3D 3UP1A 4OGZA 4DP1X 5E7FA 3QQ4B 4L9LA 5LDUA 4TOYL 3BLKA 3IETB 1OAKH 2YD2A 1OGAD 2QTVA 3AG1B 4G1MB 2VXSH 1PCSA 3OX8B 2G9KA 3HS9A 4EI5D 2N1KA 1E42A 1OTUC 4L1DA 1U93A 3QUKB 5EU7E 4G8EA 4XNMB 5B3JE 3MRMA 1WFJA 5DHYB 3WEXA 3RY5A 4YBHA 2GG1A 5T3ZL 3HIZA 2WTPA 5KSUB 3DRTB 4CMHC 1LLAA 2FLRT 1ZDQA 3ZGIA 3FQWB 4QTHB 2BSCA 3L5XL 4KMTL 1MFCH 5E03A 4WWKB 4BM7A 4NQED 3Q43A 5IIEB 4N9OB 2EDLA 4RSYA 5IHBA 4RQQB 4AC2A 3RAJH 3S35H 3K74B 3Q5OA 1NIAA 1ORQB 2GJ6B 2VN3A 2P5EA 4YN3A 3WHXA 5BPPA 4DW2L 3L3OC 2FYYA 4QRTB 1A6VH 4S1DD 2P24B 2VMJA 3TP4A 3P77B 1QZ1A 2FT6A 1BMWA 5C0DB 4PEEA 2CPCA 3MBXH 4LCWA 3LEVL 4OF7A 1P7QA 4NUPA 4CVWA 4XMPL 4ZS6C 1P7BA 2YN3A 4HEPA 3VNYA 1GS8A 3HAEB 4H26B 3T65B 1XT5A 3QULA 2UWEE 1YN7A 3SPVA 3HNSL 4KKLC 2DEXX 2Y0SA 3D39D 3BSGA 1G7IA 1OTSC 2XZZA 2UXVA 4ZFZA 4DGIL 5HHXH 4JCWA 5BZWA 4HKJA 5HGBA 2I9TB 4UYPA 2W9DH 3WO4C 4LDCA 1Q9KB 2FRGP 5J0BA 2FHFA 2YXWA 4L18A 5DEGB 1GPOL 3BFQG 3VE0B 1SN0A 4K4KA 4OI9A 4N86A 3FCTA 4MCMA 3G6AA 1T04A 4Y2NA 4TNVK 4HS3B 2F8VA 3GRWA 2AKRB 4AV5A 4MAUH 1MFDH 1UEMA 4LVNC 4MXVF 4AYGA 1A9EB 3DHPA 4TPRH 3EYUL 2BY2A 3MJGX 4JO4L 3E38A 4Z77A 4N2NA 3SJVB 1WPCA 2RH0A 1I31A 4UOW1 4XVSH 3II2A 2R7EA 4JM2F 5CR8A 2KH2B 3V0WH 4JO2L 4WWNA 5CSGA 1TVBB 1NCBH 3RWEA 4NRXA 3T3PE 4DT2A 3MSPA 2Y23A 5KS9A 5CGMA 3G5ZA 4U6TA 2E59A 4M5YH 5IVNA 3WXWH 3QG7H 1JD9A 1S7XA 1T20B 1FL6B 1MJ8H 2EDJA 3M8OL 3ASNB 3O8XB 3QDHA 4UQAA 3G3LA 4WKZB 5AKTA 4PP1C 4GIPD 3VI3E 1NCDH 4EQ2A 1H0DB 3VWKB 3OMNB 2A9NH 2FGWH 5LNDA 4EI6A 4PJBA 3TJEL 1OKEA 5BVPL 5JR1L 1G6RA 2XX1A 4MGXA 4K3GA 4HFWB 4P9ML 4S1QH 5AL0A 5KAQG 4OM1L 2W81C 5DMIL 1TKWB 4DWHA 4LMQE 3LB6C 1UXSB 4KKCD 3FPXA 1BX2A 1HHJA 3VA6A 3GI9H 1SJVA 4MCZA 4X5PA 3C60C 5DJ8A 1BZ7A 4N0YL 3IU3B 2GHWB 4Q6IC 5I1KH 4AOFA 5BRQA 2OI9B 3TVMD 1CXFA 3FT3A 4I2XE 3IDXH 1ESOA 1UCBL 4J3OF 3QDGE 3II1A 5D2NA 3J7HA 3O6FD 4KQ3H 1U8PB 4Y19B 1BQ5A 3CFKA 5HBBA 4N2CA 1CGYA 1TLKA 3ZDYF 1AO7E 3HZVB 5F8QC 3EG9B 3MBEC 2YD0A 4UIKL 1G84A 4DUVA 2AMGA 4WHCA 4OSUL 5E9DE 1CDYA 4LSRH 5IFJA 3MJ6A 4K9EH 1ZPLA 3OF6D 3AU0A 1XH2A 4ELMB 2BP0A 4FQ2L 1RK0A 1NIFA 2ED6A 3CVCA 2O5NA 3RX7A 4YXHH 3L9RB 3D25B 3Q8EA 5T3XL 2MQ0A 4LLWA 4R26L 5HYQA 3LRSA 3MRKB 1XHHA 1NUNB 2ZOKA 2CUIA 2H7WA 4RNRA 5FDYA 2ZSWB 3KD4A 1DUZB 4WK2B 4AG4H 2CDFB 4MB1A 5JPMA 5EF1A 5KSVB 2CJSA 4UTAH 1JZ2A 4LEOA 5ERWB 1UEYA 3C75A 1NMCB 3GMNA 2ZOWA 3D85A 5LCVL 2HFFA 2EXYD 2HSIA 3MCKA 1DLFH 2V37A 2N56A 3MU3A 4ODXA 2ZCHH 2LU3A 4I9XA 3MQIA 4EIBA 3RUGB 1FNEA 1HNFA 3NJVA 3O11A 4KH2A 4OZHF 3D25A 2XQBL 3KVDD 3CE1A 3CSTA 3ELAT 1EK3A 1A6ZA 1OLLA 3UBFA 2NY2B 5C86A 3LDBC 2QZQA 2WZAA 2BP0B 4IOSA 4LGRB 1QBLH 1N64H 1T04B 3QXWA 1N4XL 3JYBA 3G5VB 5ADPL 2CIKA 4GKLA 1I8LA 5FV2A 3IKCA 1UOLA 2ICWB 2Q3AA 1TJGL 2RMNA 1B0GB 4QGYA 5I0YA 4EDXB 3UAJA 2VJ0A 4IIZA 3FT1A 5JW4R 4HS6B 3LKSA 2FEDC 3FHAA 4JHAL 1MY5A 4LEOB 5EUOF 4WI0A 1QNZH 4GY4A 4PJ9C 4NUMA 2UXFA 2IWEA 1XF4B 2VDOH 4PS8A 1CC3A 1FGVL 3T2QA 2X05A 2Z31C 1AYOA 4ZTPH 4EZLA 2A5UA 1VSCA 4PRDB 3T6QC 1RPQA 32C2A 3QWRD 1N8OE 1KBPA 1P0SE 5HD8C 5DD3L 3F01A 3LX9A 3DX7A 1INEH 1WG3A 4M6ML 1HHJB 1FYTB 2VDPH 3X3GH 3QEGL 1NEZA 4WW2B 1NEUA 1LO5A 5AAWA 4P3WA 3ZRSA 5JHMA 2DM2A 4S2SB 5KJRL 2I9LA 2J1ZA 2ZUQB 5PAZA 3PHOB 2X1QA 3NSJA 3TO4A 4ATWA 4KDVA 4L4TE 1Z5YD 3CFJB 4WKZA 5EF2A 2ZJSL 3V55A 4OCMC 3VXUA 3HA0A 5JOFA 4A7QA 3WJMB 2YD1A 5GISL 5AOMA 1T20A 2VJ8A 2DI7A 1DQLL 1PG7X 2CR6A 3JBG7 6CGTA 5KJRH 1XEDA 1TQBB 1E8YA 2VLME 1AP2B 3F5WB 3LV3A 4JZOA 3HNVH 4G9DA 3U4EA 3C87A 3NN8A 5FFLA 3HG5A 2H3XC 2ZAGA 5I8KH 3MXWL 2XIBA 3JWDC 3KG5A 3IDMB 4N87A 5EHFA 2XXMB 3PYCA 4YHKH 3WFEL 2F74B 1MWAL 2YEVB 2PXYC 1UXLA 3AY4A 3FFDB 3MGAA 4OQTA 3BGFB 5AB2A 1KIUA 2MOQA 3I50L 1RUPL 3DPBA 1EFXA 4MJ4A 4ZNEA 2DQHH 5KSAA 2I60L 3BQVA 1F8TL 4ELMF 2NTFA 5HYSB 4DKFH 4NP4L 1Z5LB 2WLNA 3QPXH 4YHKL 3WFEH 2EUWA 1R24B 1BIIB 5AD0B 4HLEA 4ZW7A 2FQEA 4LSQH 1BJ1H 1MZYA 3G5ZB 2A74C 4NBZB 1G7JA 3MBXL 5BQDA 2O6DA 5KVGE 1V5JA 3MLVL 1FGNH 3DLQR 2O5YH 3RWIA 5DZLA 1LHZA 1M4KA 1OCOB 4HETA 2EACA 4R0LA 3I9AA 3PUUA 1YEEL 5T1KA 5CBAB 1V3JA 2TAAA 4IHBA 1EIBA 4RIRA 1PD0A 4RH4A 5AZ2L 1PNDA 3UZQB 3UIYA 1FHNA 4FHKA 2B9BA 3OZ9H 4NX0A 2YFOA 5LDSA 1AZRA 4R4NC 4UM9A 4OZHB 1P7QB 2EDOA 3WNNA 3WIIL 2KMWA 3P9MA 5ESVB 1J86A 5CZXD 5C0JB 3PPSA 4OY9A 3PRZA 4R4BB 4OAWA 5E4AA 3D5OF 2BIQA 2MPVA 5KG9A 4RQQA 1A6WH 3KLQA 4MJ2A 3RA7L 4EDWL 3QUXB 4HKJB 3VQMA 5C2UB 4YLQT 4Z7VB 1I8UA 1KCKA 1BFOA 3PAYA 4IRSB 2F8IA 1E8WA 4Q6KA 1AO7B 5L2KD 3MFFB 3DX6A 1UD6A 3H9SE 1XDTT 2BJMH 2IWFA 4TVUA 3EOAA 1MFAL 5C9KA 5I0DA 1MCRA 2QPDB 3F58L 5F7BA 3VXQB 5EBWA 3DVGA 2RBLA 3KLDA 2VDKH 3QG7L 3FUNA 2O5XH 2MTPA 1MAKA 4IBYA 3JVFC 4RAUA 2HH0L 4LPYA 3CN1A 3FT4A 1YSOA 1CFMA 4ZFQA 3BWUC 3TZVB 3GRWL 4X99B 3AU1A 4LEXH 4OZIF 1MJ7H 4QKTA 3DTDA 1BZDA 5CEYB 5MI0B 1KG0A 4DERA 3NJKA 1OHQA 2AEWA 2X4PB 4ZMTA 5F6IB 1M71B 1PVHA 5KYWA 3N1GC 3DX0A 4CVZA 3BAKA 3OKOA 5FYJL 1UFGA 4XB8A 3WD5L 3AU1B 4CRPA 1S7RA 4RFNC 1EHKB 1EO5A 1TITA 3Q8FA 4XCYA 5CU5A 4WHTB 1XCQB 3NCJH 4PJXE 5HHME 2WZPA 2ZXDA 2IDUA 1KGCE 2A83B 1JF5A 1KJ2B 2Y5TA 4IU2B 4WDIA 1I1YA 3BVUA 3ZYOA 1FSKC 1FPTH 2AC0A 1IL1B 1HL9A 3IJEB 1J8RA 4P57A 4RFOL 3LXUX 2QQNH 1MY7A 3LKRA 4FL4C 5C0GB 2BSED 2WNGA 3H3PL 2ZG3A 2F7OA 4WW1A 2OMTB 2PR4H 4TULH 2OR9H 5DDHA 5DZVA 4UBDC 1EGJH 2H32B 3UJTH 5AWNH 3K4ZA 4HWNA 4GW4A 1RUMH 3APFA 4U1MA 3SE9L 3B43A 1NCHA 3EZJB 3LN5A 1KMGA 1DANT 4BEIA 3GSWB 1EANA 4FQ2H 4GEIA 3P54A 2P47B 3INUL 5FB8B 4WW1B 1K8DB 4QYAA 4X8GA 3FO2B 5FYKL 3L1OL 4PTUB 4GG6B 2VRQA 5EFIA 1AVAA 5KOMC 3MI6A 1M1XB 4XN7A 3RFRA 3RJDA 4DPBX 5AZEH 3E8UL 2YLKA 4FXGA 3OR7B 4O2CB 1RL1A 3HZKA 3EHBC 3KLHC 4HH8A 5C8JB 2UZYB 1TZGL 2OULB 3W56A 3NEXA 4J7RA 2XFGB 4FABL 2YKLH 5A2BA 1J1XH 1F3DJ 3U7WH 4BSVA 1J5DA 1E2WA 2HLFC 3GMPA 4NC0B 1H3XA 1J12A 2XVLA 1MRDH 3MRPB 1D5ZA 3H3KA 1Z5LA 2DTSA 2F7PA 3I6KA 2VN6A 3TYGL 3PABB 2ICEA 3DTXB 1N0XL 5I71B 2CCWA 1NBYA 3T4AA 3MX0B 4ZX3A 2Y1ZA 3HS0C 1X6NA 4HZLA 4M8QB 1PD1A 1G7LA 1NFDA 3QFGA 1JV5A 5FYKD 4PWKA 4AE0A 1EXHA 2A7BA 1WX5A 3VWKD 1CLZH 4AVJA 1TDQA 1QFWM 1SPDA 1AD0A 3I74A 3Q1SL 4H40A 3IDYB 3MV01 4IMLB 2YD7A 2Z91B 5EOCH 4FKEA 3F12B 3O2WL 4YHLH 1VPOH 3HLAA 4LQFL 3T6WA 2XY2A 3F84A 5AW7B 4F80A 2A6DB 1KCVH 5MHSE 4NYLB 5DVOA 1UA3A 4NNPH 1XZ0B 5C0IB 4ZODA 1KDJA 2Q6WA 3P3UA 4UNUA 4F58L 4WLCA 3NJGA 5IBUB 1T1WA 3ZZLA 3G6JB 1P84J 3FBKA 4PUBH 5SX5K 1KC5L 2OXGA 2AXFA 3LH2L 2EXSA 4HJ0C 2WJ5A 4F7EB 3HE7D 3UAJD 5FECA 4LAJH 3IMWA 4LSVH 1KIPB 5IHUL 4LDEB 1MCSA 4DP5X 2PWGA 5FO9A 5IWLA 2R0LH 4AMWA 1AKJD 3QJXA 2FDBP 3U4BH 3MA7B 1MCCA 3B5TA 4PRHE 1MCBA 3ZSTA 1BQRA 4NLAA 1B6UA 1LO3L 5HHOA 4P23C 2LAGB 5J9PB 2BFGA 3SQOH 2EH8H 3IFNL 3IPEA 3QJZA 1ZKAA 4DZ8A 1JRHH 2ZG1A 1MVUA 4Z7AA 1E7UA 2PN5A 4PM1A 4Z7VE 3WJLC 3LZLA 1TQTA 2IVFC 3KM1A 4XMZA 3O2DH 1HKLH 4K3DL 4AM0Q 4YSPA 4WWPA 2J88L 3F64A 3ARPA 5IROC 4LK4A 3UYRH 4ZW5A 4GUPA 5EU6D 1HEZA 2CLRA 2DLIA 3IMBA 3V6FA 1KY7A 1HNYA 3FB7A 4RESB 3VXNA 3ARGB 3SDCC 4OD1L 3DWTA 4FE9A 2DKSA 1Q0XL 1Z66A 4LSQL 4OFYA 4LO9A 1ED3A 1FH5L 4AL8C 1YAIA 2OSLB 1J05A 3A67L 1F90L 2Q86A 1B3JA 5KVDL 4M61B 5I38A 1PIFA 2G0LA 4W9KC 4L9DA 1FN4A 3QRGH 4PJ9D 2WXNA 3NEEA 2DWYA 1GH7A 4BZ1H 1TEYA 4NJAH 5ALCH 2CJTA 3LRMA 2PTUA 5E2VH 5T3XD 4KKBD 3V4PH 4BH7A 5JORB 2M1KA 1CI5A 3MRJA 3SO3C 2J56A 3NQ1A 4P57B 4W9DC 4QRPD 5I5JA 4YLCA 1IO4C 1LJMA 2EZ0D 3GTTA 3ESMA 1NC4A 1FE8L 2K3HA 4XBEL 3QRGL 2QDVA 3GBDA 4M6NL 5EEZA 1UGKA 4K9EL 1KFAL 3WNLA 3MUY1 5IUCA 4ELMA 1NH6A 3A0OA 4N2GA 4N28A 3VSUA 3WY3A 5TDPA 1YJDH 3A22A 2GI7A 2V8MA 4WFFD 5I1GL 3QHFL 3RTQA 4OCYH 4RDQG 3ZZSA 5D1XC 5A6IA 3AM8A 2XVKA 3HZVA 4L8DB 4FLSA 3HC4L 4A63A 1QUNA 3E2HB 5GGTH 1TJMA 5D2LA 1S9WA 3FU6A 4HIJA 3ZBMA 1BQLL 2QLYA 5CEYA 3RPIA 4NN6C 4WU7B 3Q6GL 3RNKB 5DEFA 4F33A 4DP8X 1CFSA 3E6HB 1MLCA 4U2YA 4X5WB 3HR6A 4XOCA 4PJ8A 1EEYA 3REWA 4ADJA 3I3DA 3WDIA 4BXSV 4M7LH 3LTVA 4FQPA 3D0VB 2PNDA 3TX4A 1Q9WA 2HH0H 4GAYB 2H1LM 3S5YA 2ZKHL 2OW7A 5FYJD 3NCFB 4G6FD 3CVBA 3KPPA 2KPWA 4M5ZL 3E0GA 2ICWA 3T77A 5E9DA 4RMTA 1AIZA 1NCCL 1E5AA 2YGQA 4JFPA 4NO0A 3X13A 3VWJA 4MJ5A 4XODA 1G6RB 1G7QB 4L3FA 1I8MB 1NDMA 5KZCD 1TFHA 4NRZA 3SKOB 1TIUA 4NBXB 1WCQA 3PDOB 5D7IA 1S8DA 2WBJD 4MXQD 5FUOL 1CGSL 1UOVA 3RWJB 5ICYB 1RZKL 1MRFL 2QL1A 3BH9A 4TM9A 3UXFA 1DUYB 2C7FA 5I1JH 2OA9A 3S4SA 2HRLA 2V6HA 1WV7T 4OB5H 3DJSA 5EC2A 1RD6A 1HINL 4G82A 1OB1B 4RFOH 1GS7A 1HT6A 1RZKH 1SF3A 1U36A 3MTXA 5K39B 2EDBA 2GCYA 2X4QA 1CICB 1H8OA 4ONHB 1TO4A 5DJ0A 1E4JA 4Z0YA 1CD8A 1DN0A 4HUMB 5C6TL 3B8SA 5GRJH 3T08A 5CAYB 5ISZE 4Z1PA 3QEQD 3VRLE 3VACA 1S3KH 2RIKA 5ADOL 2BWIA 4X6CE 3UJIL 2NXZB 4XE0A 5AOLA 5HHOE 5AYTA 3VX1A 3UERA 1TZIA 1B9ZA 1AKPA 2XSKA 1UD2A 5F93C 5F1IB 5E0FA 2XWBB 4NS0A 4NQDA 4PR5A 4EQ3A 5F9JB 2ZJSH 4JDVB 2RAMA 4Q9BA 3VH8G 5E9AA 4I9WD 1LTXA 4X98A 4W6WB 4XNXH 1NGWB 3QNXA 4YDIL 3MLPA 2VQ1B 5D2NB 3GT6A 4GO9A 5I19H 4NZUL 1G9NL 1CR9H 2HLAA 5L9DL 4KZ0A 4MDIB 5JOPE 3GQFA 2YUWA 2EP6A 1JZHA 4QMEA 3WY2A 3NIDE 4HS8L 5C08A 4NQSA 5IEKB 15C8H 4ZJ9A 4QY8A 2FLMA 3LEYL 3O8XC 1P53A 2VXSL 4RMBA 4TVPD 5INDA 1T2XA 3B9DA 3MLWL 4PV8A 4FFYL 1I9JH 3FB5A 2R8SL 1UXWB 3FQUB 2NZIA 1F11A 4J3WA 4MKMA 4I13B 3RURA 1CBVL 1P6FA 5GZOA 2VLJE 4PJBB 3C6SB 1WC7A 1LXMA 1NFDE 1ZS8B </