3WJMB

Crystal structure of bombyx mori sp2/sp3 heterohexamer
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
668
structure length
668
Chain Sequence
EFKTTPVDAAFVEKQKKILSLFYNVNEISYEAEYYKVAQDFNIEASKDCYTNMKAYENFMMMYKVGFLPKNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQGMFLYAYYIAIIQRSDTASFVLPAPYEAYPQYFVNMEVKNKMDYVKMMDGCLDEKICYNYGIIKENEQFVMYANYSNSLTYPNNEDRIAYLTEDVGLNAYYYYFHSHLPFWWNSGKYGAFKERRGEIYFFFYQQLLARYYMERLTNGLGKIPEFSWYSPLRTGYLPPFNSFYYPFAQRSNDYELHTEKNYEEIRFLDIYEKTFFQYLQQGHFKAFDKKIDLHSSKAVNFVGNYWQTNADLFEEDFLQFYQRSYEVNARRVLGAAPKPFNQYTFIPSALDFYQTSARDPAFYQLYKRIVQYIIEFKQYQVPYTQEALHFVGLKISDVKVDKMVTFFDHFDFDAFNTVYFSKEELKSSPHGYKVRQPRLNHKPFTVTIDIKSDVATNAVVKMFLGPKYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKEDSLPMAEIYKLLDQGKIPTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKAVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGELFPYLFNIPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arylphorin
publication title Crystal structure of Bombyx mori arylphorins reveals a 3:3 heterohexamer with multiple papain cleavage sites
pubmed doi rcsb
molecule tags Oxygen transport
total genus 210
structure length 668
sequence length 668
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00372 Hemocyanin_M Hemocyanin, copper containing domain
B PF03722 Hemocyanin_N Hemocyanin, all-alpha domain
B PF03723 Hemocyanin_C Hemocyanin, ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1280.10 Mainly Alpha Orthogonal Bundle di-copper center containing domain from catechol oxidase Di-copper center containing domain from catechol oxidase 3wjmB02
2.60.40.1520 Mainly Beta Sandwich Immunoglobulin-like Hemocyanin, C-terminal domain 3wjmB03
1BT2A 4Z10A 4HD7A 1WX2A 4HD4A 4P6SA 1NOLA 4YZWA 1HCYA 3NQ5A 3NM8A 4J3RA 3NQ1A 3QJOA 5I3BA 3NQ0A 3GWJA 2P3XA 1JS8A 4Z0ZA 3NTMA 4J3QA 5CE9A 2Y9WA 2ZWFA 2ZMYA 1HC1A 3AWVA 4HD6A 1OXYA 3AWTA 4D87A 4Z0YA 2ZWEA 2AHKA 2Y9XA 2ZMZA 3AWYA 1BUGA 3AWZA 3AWUA 1BT1A 1LLAA 1WX4A 2AHLA 1LL1A 3AWXA 4J3PA 1WX5A 4L37A 3NPYA 4J6UA 3W6WA 4P6TA 2ZWGA 3WJMA 3HHSA 1BT3A 4J6TA 3AWWA 3W6QA 1WXCA 4L37B 2ZMXA 3WKYA 4OUAA 3AX0A 3WJMB 3HHSB 2ZWDA 1LNLA 4P6RA 5I3AA 3AWSA 5I38A 4J6VA 4OUAB
chains in the Genus database with same CATH superfamily
2YJQA 4JDTH 1KCRL 5BRPA 3LH2L 4IIQA 4PLOB 3WTVA 4AYEC 2X6BA 1UGKA 2Z31D 3I9GH 3K46A 1E8XA 3FO9A 2VISB 2FJUB 1M7IA 5FW6A 5F1IA 3TT3L 3LXUX 4JZJC 1I7ZA 5DURD 2YKLL 4NO2A 4RX4A 4TSAL 4V1DE 3KHOA 2GUYA 1BG9A 4CW1B 1B6DA 3WUWA 4R2GB 1IAKB 4XMUA 4KNQA 2Y23A 2VLME 1IGTA 3QG7L 4KK9C 4HQQH 5C0CE 5AD0B 2J7LA 2QR0A 5IT2H 3L1OL 4P8QA 2HVBA 3L08A 4GXFA 3B9KA 5EU5A 3T0XA 1KGJA 1YUHB 1ZE3H 2X88A 3U7WL 5DHDA 4JPWL 5TFSH 4IOIA 1BYNA 4UAOC 4G9FE 4UYQA 3ZTNH 4ZMZA 4Z7IA 3QXVA 5LVEA 3L6FA 6FABH 1G7HB 2MMXA 4PJ7A 2PYEE 3IKCB 2JCCB 5EA0H 3CVHB 3GM8A 3SE8H 4DKEH 5KSAB 2ZXAA 1QEWB 1NC4D 1UACL 3MROA 1D5ZA 3PUCA 3PU7A 4P4KD 5EHFA 3MC0A 4MNHA 3SPCA 3NCMA 5KBNC 3UJIH 2XYCA 2AC0A 3NEXA 1MNNA 2V7NB 5B39A 4Q74A 2BY3A 1LL1A 3GMPB 4YNYB 3S0PA 3RY6A 1U8QA 4EN3B 1UWXK 3BIKB 2LFGA 2YGVA 2QBWA 3I75B 3F5WB 3QIBD 4QGTA 5IQOA 2WXOA 4JKLA 5HI4C 3AQDA 3T0DA 1VF5C 3U82B 5T1KD 4KVCL 3TO4C 4UILH 5D7SL 5I1LA 4XXDA 1PMYA 4ABUA 1WRFA 5CD5C 4O02L 1UVQB 3IDGA 1P7KB 4RAUA 3ZDZE 4U7KA 5F88B 1NFKA 4ZG1A 1S7RA 2BY0A 1TDQA 4I1NB 5D1XA 1BEXA 4W6XB 5CFAA 1YUKB 5DO8A 2JFCA 3ULVL 4KZDL 1KB5L 1QRNE 1LO4L 3O3AA 2CIKA 4B5EA 4Q97A 4K23H 5B1JC 3FOLA 1L7TH 4FMFA 1JGEA 4LP5A 2J2ZB 3CPLA 1QLRA 2Q2LA 3OJDA 1OAXL 1A4KA 3VXRD 3CDCA 3OHXC 4N0UE 2V2TA 3R06A 2UZYA 1A6VH 2J8UB 4I0KA 2K8QA 1IC7H 2EDJA 1EGJA 1G43A 4O58H 5DEGA 3MLSL 5MEOB 1VDGA 3MUGA 5KSBE 2V9RA 1WZ1H 4WW2B 2ID5A 2Z31A 3F8UB 1XMWA 1UM6L 3RBSA 1AD0A 2YPVA 2ZOKB 1S5IH 4KUZH 1JGLL 2XZCH 2Y07L 1N3NB 3LSOB 4TNGA 5EFIB 2LVCA 3JV4A 4KX9A 4NWTL 5FO8B 3L1EA 4H1LG 3NFSL 3LKNB 3PF2A 3TA3B 2YAMA 4PWIA 1ZHBA 3QQDB 3VI4E 3O4LD 2MOQA 3KBEA 3FB8B 1FL5B 3AXLA 2GJZA 4PV9A 4JHZA 3FQUA 3CVIL 3HRPA 1E0OB 2MCPH 5HDOA 3A5VA 2YZ8A 3Q8FA 4ZTOL 1CDGA 4XT1C 2PNDA 1ET7A 4P3WA 5LBSA 1VZGA 1VADB 2YPKA 2FJHA 3OZ9H 4G6AC 1PD1A 1EAJA 1HCFX 4P2OB 4LMQE 4YBHA 3A6CH 3RGVC 1OWWA 5SV4A 3P3SA 2B1AL 5HVWA 2A7BA 1I9RL 1WHOA 3O3DB 1CXHA 1C16B 3CE1A 5HPMA 3SBPA 3HVDA 1OCWH 4HXAL 4Y2DA 4NGHH 4YDIH 1M57B 4P4KA 3LIZL 4JQVC 1VZIA 1A4JB 2B2XH 2OM5A 1U3NA 4M6NL 1RAMA 4TULL 3I6KB 3NH7L 5C07B 1CE1H 4Y5VB 2PWGA 3IXAA 4HZLA 2ZT9C 3LVTA 4LQFL 5CLXA 3A23A 4S2SA 3VD4A 1KCRH 3QIBA 1SJEA 4WI0B 3VAEA 3ZKNC 1VGKB 3KE0A 1YO4A 5T1KA 3OJVC 1NCWL 4LLVB 5D7LA 1BREA 4P6TA 3WN5B 3KXFD 3MRRA 3TO2B 4HAGA 1R9FA 1DSFH 4YHIB 4EF3A 4PJAA 4UDTA 5E9DE 2CLRA 3N43F 1YC7A 1OTTC 2VQ1B 1QSEB 3PGFH 4DO5A 3MRCB 5J6SA 3L1OH 3HZYA 1EO5A 2QSTA 3GC3A 5LAXA 2OXHB 1MPAL 3BWAB 1QZNA 1M2VA 3QO1B 3VXRA 3VU2A 2GTZB 4HKBB 5I73B 4NCC2 1RIVL 2XIBA 5HDLA 1AQ8A 3CBRA 2YXVA 1NGZA 1GAFL 4U1GB 4WWPA 4ZUUB 4WQOA 1UQSA 4KK5D 4YLQT 1KJ2A 1VACA 4LSDA 4YDLC 5AAMC 3QIWB 4HUKB 3GJFH 3FRUA 4Y1SA 5I0WA 1DVFB 3OKYA 5A2IH 1K9TA 5FEBA 4AJ0A 4JQXA 4X4KA 2UY7A 3HUJE 4YC2C 2DQEL 1L7IH 3RIAF 1D5BA 4UOW1 4A7SA 3II3A 4WO0A 2FJFB 2DQJL 5TE4L 5HGHB 3MJ7A 3O4LA 5JOFB 3CX5J 3ULUL 4LVNB 1N7ML 4GG8A 5FA4A 3BN3B 3MBWB 1RIUL 3HB3C 4XCEA 1AKPA 3U30C 4CA4A 4BGDA 2QSCL 4I5BA 4WFHD 1MHEB 4GSDH 1L3WA 1DL7L 4DGUA 1LMKA 3MU3A 1TFPA 4FZEH 1A7BA 3AWTA 3LH9A 1U8HB 4MJ5A 1PG7X 4TXVB 5KVEH 4TL4A 2P52A 4ZMYA 4KZDH 1Q9OB 3DSNA 1KB5H 3L45A 1OGTB 1U3HD 3LZLA 1LO4H 3OZLA 4KXAA 5TDPB 5IMKB 5JPMC 5LQBL 2W60A 2VZOA 3W57A 3OC5A 4QHLA 1SF3A 5E00B 3PGDB 3RG1C 2VNCA 2WQVA 1E2ZA 3V7MA 1XF5B 3PHQB 1OAXH 3QPXL 1PEWA 4X9GA 4PP1C 4C56E 3BLKA 1JXJA 3SDAC 1L4IA 2EEBA 2WTRB 4Z3JA 3MRQA 1MY5A 2IPKB 2WXQA 2Q8AL 1V8HA 5KTEL 5FC9A 4KX7A 1MJ7L 3C08L 4M43H 4DKTA 3PHOB 3MLSH 1E5CA 3BUDA 3VYPA 5JIQA 4J8QA 3BQVA 3PAUA 4AV0A 1HHGB 1UD3A 4JRLA 4P06A 4NPYB 4PEEA 1T5WA 3KXFA 4MJJA 1ED3B 1EEZB 1E9OA 5FX3A 3BRFA 2NYZA 1HT6A 2DY2A 3AU1B 2KQNA 1QVOA 3ARGC 4BRJA 4CSZA 5EPMA 2QSVA 3H9SB 3ZZQA 3OKKA 2GAZA 2DOCA 4Z77A 4LPWA 5A3IC 1MFCL 4PV8A 2Y7LA 1TTUA 5EO0A 1BGXH 3K8KA 4U6VL 5IMLB 3FHEA 2AJ3B 4K15A 3MI6A 1KGXA 2R27A 3KDPB 1HL9A 3MZGB 2RMNA 4AQEB 4HZ1A 4QR7A 2BNRD 4R4BA 3ATBA 1PNDA 2BINA 5GIRB 1PZCA 5TTRA 3EJUA 4U05A 3EYOA 3QDGD 1UOLA 2R0WL 3RI5K 1JNHA 2CG9X 4DCQB 1YJDL 1ZHLB 3UP6A 5I1GL 2NOYA 5F7AA 4Z23A 3CSPA 1LO5A 5D93C 2Z91A 5CGMA 3SGKA 4PLKD 1T20A 1N0XH 1ITBB 2ERJC 4HBQA 3WTWA 2UVFA 4JG5A 4JLRA 4M00A 4PREA 1RZFH 3WNJA 4BUQA 5CCKH 4LQFH 5FFLA 1JD7A 5IHHA 2VZ1A 3N42B 1YQVH 1KTLA 2LAGB 1P4LA 5E24E 3HBGA 1X5KA 3MRKB 2CXKA 1Q9KA 5IFHL 5HGBB 5C8JA 3VGGA 5JOEA 2XWTB 4O9HL 5ICXB 3N0PB 1BD2D 3D69A 1JZFA 1TVBB 4DOHB 4F2MB 2DQCH 1X5HA 2RCSL 3E1F1 4WIQA 1NWOA 1SLWA 2LW3A 2P48B 4NS0A 3NJVA 2W9EH 3O2VL 5CILL 1J1PL 4ANWA 1JG9A 1U3HA 4JVPA 4DZBB 5F3BB 2CLZA 4Z8FL 2WD0A 2Y1YA 4KBPA 3K71B 4JM2B 5T33H 2GBAA 2OULB 4NRZA 2W8CA 4QRRB 2X4OA 3D2UD 1DE4B 4PJ7E 2R0KH 3PY9A 1T0OA 3WDIA 3CFUA 1J0ZA 3T65B 1FWXA 1HH9A 3VFRA 4FNUA 5G2NA 7CGTA 2VC2B 1OTSD 1RIVH 4U1SA 2IPTL 5BUPA 5K59F 1I7ZB 4KI5F 1FVCA 1MH5B 3HZMB 3KPSB 2F08A 4KJWC 1ZLWK 2O5XL 2B3RA 3QUKA 2ZCHL 4QCIA 4XN1A 1YEJL 3QUZC 3U0PB 3CN1A 4Z3EA 2ZF9A 3SGEH 5C0GA 1I31A 3UBXA 1UWEL 1LWHA 1B0RA 3DLQR 1KLGA 2WZAA 2DMCA 2QVFB 4J3WA 3MV9D 5D9SB 5K1NA 4FXKB 4HH8A 3MREA 1PFCA 3RWEA 2DQTL 2DQJH 3AU0A 4ZMOA 3AS2A 4LXFA 3VYOA 3UEQA 4K71B 1JFQL 3VFOB 3ZHFA 4YDNA 5AVRB 2EIEA 4QO1A 3UDWC 1TJHL 5D1XE 5TF1H 4YFLI 1LO2L 4IGBB 1Y1DA 3CVHL 4OQ1A 3QH3B 2XX1A 2CO4A 3ZDXE 3LEYL 2OTUB 5IJKC 4JO3H 4W9CC 4HU8A 4C59B 1HZLA 3BQUB 2XN9B 2AK4B 4HS3A 1TVHA 3AS3A 4HBCH 1EZLA 3KR3L 3MROB 5DK3A 4H26B 3GD1C 2EUWA 1UJ3B 2CUMA 3D34A 2NY2B 3SKUD 4MNHB 3T6QC 2BNRA 2Q9OA 1YMMD 4A55A 4QYOA 1FFOA 3ARUA 3QZOA 4WI9A 5IGXH 4IK7A 3NJHA 3UXFA 2C9AA 4K7PL 3DHJA 3OVUB 4G6JL 1MHCB 1QYGH 5E8EA 1EMTH 3QPXH 1S9KC 2KLRA 3QDGA 3QDJB 2YD8A 3H3PH 4NQXA 4IU2B 1BZ8A 4YHKH 3W56A 1CGSL 1BLNA 1UUSA 3QQ9D 4GW5B 5D8JH 2XJLA 3LEXB 1UZ8A 4GB9A 5K9KB 4WFED 3PP4H 1ASQA 2G5RA 2H3NA 3EH3B 3IF1A 2F0CA 1P4BH 4KROD 1NMCB 1OE2A 1PL3A 4QHUB 4GKZB 4NFDA 1MCRA 1SFDA 4G1MB 4G2AA 4OLVL 3UGXA 3AQZA 4OIFA 5KJRH 12E8L 2F53B 3B5HA 4ODTL 1FZJA 3GZQA 3B6SB 4Y88A 2Z93B 1GHFL 2J88H 4PH8A 5TE7L 5I75C 1AYOA 5T5NG 4M48H 5I8KH 1BECA 3BD3A 1ZMYA 3OJDB 4Y2NA 2DDQH 3LQAC 3LB6D 2Y7OA 2UUDK 1R3JA 4LAJH 5C0RL 2F7QA 1D7DA 1YC8A 2J6EL 3GLZA 1MHPL 1KDIA 4DGIL 1AD9A 3B1TA 2NXYB 2OJEB 3BW9B 1SF5A 4G8IB 2R7EB 5DZNA 4L9LB 4LCUA 3IMTA 1RURH 5FK9A 3RTLA 4M4PA 1NGYB 1CGVA 2AS5M 2WXJA 1K85A 3JV4B 1CD8A 4XP6L 1MRDH 1N4XH 3SB3A 1AKJB 1P5UA 3D3VB 5T1LB 1GS6X 2YEQA 2RB8A 4N0FB 2HZHA 4OKVA 2HKHH 5FV1L 2CXGA 3TBYA 1L9RA 1A9EB 1U95A 5ADPL 1J8HB 3FQUB 3DROA 3CDYA 2EABA 4GEIA 3IJ8A 4WEBL 1N6UA 3MV9A 2WY3B 4XNZC 2FL5A 4YLCA 3RY5A 4XN4A 1NL0H 1F2QA 3CSGA 3EBHA 4LOEA 1RUAL 4NKMB 4PJAE 4PJDF 5D96B 2W5PA 1TG8A 4LSSL 4MQXD 1H3PH 3PIQA 1YN7B 4G8FA 1JPST 4U0RC 1IC4L 1YEIL 3JXAA 3KWWB 3WFCL 5C71A 1N5YL 1LEGB 2VERN 5H37A 3PCYA 4U1IB 4DP2X 5IQMA 3NIGF 3OGOE 4P4RB 1FDLH 5BOPA 1GTFA 1ZHNB 1ONQA 1E40A 2GCYB 4GI6A 3GSWA 4Y2DB 1JNNL 3VXRE 1FGNH 1U8OA 1LNLA 3AY4C 3C75A 1E5UI 1YMMA 1YAZA 3P0YL 3T08A 4Z0BH 3L4XA 5AW3B 4Z3TA 4KJPC 1QHPA 3KYOA 3QHZL 5G5DA 4IBQA 1IV8A 1YCSA 1BOYA 4AJYV 1QUNA 4LRIC 4E41A 1RU9H 2Z4QB 5FCUH 3G04B 5D7LB 1MUJA 4A6YB 4KMTL 2OYKA 1PZ2A 2B1HH 1I7UB 1XF2A 4NQSA 4NAMA 5FS5A 4U3XA 3ZYOA 1XF3A 3TONA 3CDZA 1JXGA 4D8PA 1YEJH 3CAFA 4GY4A 3O4LE 2ZX6A 2CPCA 4UDTB 5E4AA 3VXNA 5IB3A 2BZCA 5I19L 4L8CB 4M7LL 3O8XB 3NABH 3GGWA 4XNYL 5DRZB 4LCWD 5DZJA 1OGPA 2G4EA 1I1AB 1OB1A 5CJ5A 3OMAB 5LAXB 4MMXA 4QJ4B 4PRHD 4R7DA 3UROR 2BSSA 4MD5A 5C6TH 3FO0L 2DQTH 2V2XA 1TTFA 5EUOF 4FYSA 1N59A 2F1BA 1U8MA 4M8QA 7FABL 2R4SL 3QFJA 2UXVA 3PL6C 4JX0A 1I85C 3GJFK 5CEYA 1KV3A 3IDUA 3D1MC 4PJHE 2VN3A 2KPWA 3ARZA 1O6TA 1JHTB 1ZDQA 2ENQA 3F58H 1UQSB 3BKYL 5SX4H 3S5YA 1A6ZA 1VACB 3MMEB 4FCHA 4G82A 1HOCB 2DMGA 3LEYH 4G83A 4PJEA 2WYHA 3EOBB 4GIAA 5L8JB 1CFVH 1Y6KR 3FFDB 2AGJH 4PJFB 5EOCL 4A7GA 1EHNA 1FPTH 1XD0A 1R46A 1SOKA 5SX5H 1DQVA 3O0RL 4Y8AA 2IIJA 1D5BB 3P40A 4PVBA 3A47A 1WX4A 4M6OH 1U8PA 3VRIA 3L3GA 2YZ1A 3WENA 5T1JA 4I3RL 3RFZA 4YGVB 1C5CL 5JPNA 1J88A 1RIHH 4OGXH 1T1WB 3ISRA 2M1KA 2C7FA 2ICWJ 1GC1L 3G9VA 4K0OA 1EHLH 1A7QH 3KXFE 1AH1A 1PY4A 1JYNA 4JPKL 4BCZA 3ALXA 3QQNA 3NIFF 2H2PD 4RGOH 4FNPA 3BP6A 4WJ5A 2PXYC 5HD8C 1YY8B 2F9BT 4WU5A 5I5RA 1TCRB 4R8WL 3R1GL 2C9XA 1PW3A 3P77A 5DQDL 4NQDB 5FOBA 5F6IC 4D2NA 3NJMA 2Y24A 3D9AH 1QNIA 1J11A 2Y5QA 2XQYG 3EHBD 1DBKL 4BFEA 1NZRA 1FAKT 3DOSA 2P5EB 1NLBH 1T83A 3VXTA 1VZHA 2XG4A 3TYFB 4Q2ZB 5CLTA 4TPRH 1FZOA 5IVXA 2BIPA 5DUML 2JB6B 1DFBH 1P6FA 3VQ2C 2AXWA 4WRLA 4MD4A 1CDJA 3Q6FA 3CHPA 4HUVA 4N85A 1Q94B 4PRIB 3NK4A 1BVNT 3VXOB 1PJ9A 2FSEB 1D9KB 1FLRL 1NBVL 4HUXA 5FYJH 4P07A 3VRJB 3BZFA 1HCYA 4XRCB 3FT1A 3KJ4C 1GGYA 2EXTA 3CFDB 4GINA 2CHNA 2DLFH 4KDVA 4ELMA 3JUZA 2LLGA 2VDQB 3K0WA 2ADIB 3GSNB 4XCCL 2OJ1A 4JFFB 4LKCB 1NCBL 1W2KT 4HJUA 4LCWA 2J5LC 3BAJA 3FOMB 3T3PF 3WIAA 3ASOB 5B3JF 4KKAD 2MNWA 2D4FA 4PRHA 3HI5H 4KRLB 4WFHE 4ZX6A 1BYOA 1TKWA 4NRXA 4KKZA 5AW9B 2EXYD 1XL4A 4IDJH 5F3FA 2ICWI 1A6AA 5AL8A 4F8OA 4PB9L 2KC0A 3K0YA 4CU7A 4L8SB 4LSSH 4PJIB 5TH2B 2XV2A 2QQQA 4P46C 2WAQA 3WFCH 3II2A 2NXZB 4OLUH 4XOBA 1KCKA 2B20A 5FGSA 2OL3H 2F61A 1TJGH 2ZX9A 1CFNA 1MCCA 3QXDB 4WUKL 1OSZA 2V6HA 2X70A 4XP9H 2Y2WA 3LN4B 3FYEB 3NCJL 2HLAB 1TYJA 1YDPB 3O3UN 3FF7A 4E0RB 2J73A 1OQXA 4ZFZA 1V3JA 2ZUTA 2WNWA 4TNWF 2ROXA 2N7SA 4OQTH 1HQRA 1CU4H 1GKEA 3WFBH 3EOYG 4Z7QF 3H9HB 3QHZH 5D5MA 2VLLB 1KG0B 2ZSWB 3NQIA 2CKBB 2B9BA 3LZNA 2AJVL 2EH8L 5HYSB 1RY7B 1S3KL 2QQKH 2BXZA 5BRZD 2DI9A 4GBXB 1DBML 5DJ8A 2OR9L 4R5VA 4HX1A 1ZIBA 3CC5B 2OMWA 4Q7DA 4P5MB 1HI6B 2WOBA 1K8IA 3DX9B 3N9GH 4N2FA 4OZ4A 4XNYH 3RWFA 2R4RH 3BXNB 2BC4A 1OAJA 1JWMB 3CXHK 3GSOB 1UWGH 3FTYA 2VC2L 3M46A 5E1GA 3UBHA 2O6FA 3TNMA 4E2OA 3D0LA 4KJQD 3Q43A 3L2LA 1EDYA 3HR6A 2IALB 2DI8A 2F8XC 5IB5A 4GXVH 4YE4L 2I32A 5C09D 3UTQA 1OANA 1H0DA 1WT5C 2BNRE 5FA3B 1Z0NA 4R90L 2WO4A 4AX3A 3ASWA 4NKQB 3GBNH 4YHYB 1CTNA 3U1SL 4P9HC 2OMUB 1IEAB 1ECZA 3ARWA 2HJFB 3CQPA 4AKQA 4NP4H 3WG7B 5IJVB 4FE9A 1N5AB 3QDGE 3HNVL 4U1JB 4ZXBD 5MEPA 4XTRC 3GSUB 4AEHH 4RZKA 1ZT7B 2VSCA 3VXUB 2HJKA 2CCLA 3FQNB 3BDYL 5C92A 1M3JA 3WFDL 5CCHE 2X41A 3QRGH 5DD5L 3PGCB 4U33A 2KS0A 3GIZH 3MRFA 1C5CH 1A3LL 2CA4A 3APCA 4MASA 4YUEL 3INUH 4YDKL 4KZEL 1XAKA 2VE6A 4K5NA 2IV8A 3GBML 3ABKB 2X2JA 3BH9A 4H5SB 3UPCA 4C4UA 1BD2E 3T0VA 1MW0A 1PFOA 1VERA 4PW3A 4PY8J 3VI3B 5FYJD 1PZAA 1NCNA 2L7UA 2XBTA 3FT9A 4UQEA 2E5EA 4B95C 5JQ6H 4YHMH 2EIZB 1F1GA 4DVRL 1JERA 4Y16B 4B41A 3W38A 1AQDB 4QRSA 2OMXB 1IGFH 1PIFA 4NC1E 1DQQA 3DUUB 3DVNA 5KOMC 4GJTB 1HL4A 5J89A 2YAQA 2CLVB 3L4YA 4NQED 4H8VA 1NCJA 2FX7H 3O41A 4QTHA 2AJYL 3NIDF 4ODWA 2WLKA 1BAFL 4XAWL 4AQ1A 2VABA 5KVEE 3MA9H 1P84K 4GRLC 3G5ZA 4LHQB 2Y7QA 3CFJA 1KCUH 1NPNA 2WIIA 1A1OA 3BKMH 4EOWL 3HS9A 4M5SA 5DS2A 4LLDA 1MJUH 4IU3B 4PPTA 2ZWKA 1R17A 4UNVA 3MV9E 4X7EC 4XMWA 5D1QC 3APNA 3W11C 5MI0B 3WJMA 5A2BA 3ZRFC 4YZFE 4GRWH 4I9XA 5ES4B 2PTUA 3U2SA 4MDJA 3C6SA 2ATPB 5TQ2H 3RHWF 3ZE1B 5DJCA 4QWWD 4YFLF 4GP5B 4ZQTA 3NJJA 1A64A 2EIBA 3JTBA 4PTUB 1S7WA 4EUPB 1QRKA 1CGUA 2HJLB 4Q6YA 2IJ0C 4D9RD 2PPCA 3TCLA 1EEYA 1A66A 5FK9B 1K6QL 1WEJH 2WUBL 5C09A 4PY8I 3VFUA 4Z7VB 4YVNA 1JI2A 5FYLL 5HHQA 1YMME 3LPPA 1U58A 4JFTA 1LJMA 4OZHB 1RZQA 3AW5A 4WHCA 3JYBA 3OXSA 1DO6A 3CZFB 1J0JA 2AABL 1NCIA 2ZUVA 3W37A 4ZXBA 4EDXA 4YMPA 2DL9A 1MJJA 3NCJH 1HESA 2ZWSA 4HWEH 4E5XG 3BP4A 1OVZA 2Y5TA 4RZCA 4OI7A 3DIFA 1DVFD 3FSAA 4WFEE 4QF1B 3U4EA 4U4IA 1T22B 2Z1KA 3ARVA 1CB4A 4PGCA 3FT3A 4FFZL 5FDWB 1WF5A 4RDQG 4HKJA 2WAHA 3GHPA 3PIQB 2OTPA 3TVMD 2EVGA 4AL8H 4HIIB 1K3IA 1BM3L 4EI5B 5HHNA 3FU9A 1DBMH 1CYXA 2AJZA 1XB6A 4QIRA 3MHZA 3TPKA 3RAJH 2OR9H 2YSSA 3ZY7A 1OAUH 1FH2A 3GK8L 1J48A 5GZNC 3W0WB 2A1WH 2V7HA 1E27A 4KMLB 1IBHA 5ITFA 1TETH 4WK0B 3NSDA 3LRGA 3N2JA 4PJEE 4PHXA 5HGAB 1INEH 1KCVH 3TOPA 4A6YL 5FO7B 2ARWA 5CZXC 4E41B 3Q5OA 3TFKD 4NQEA 2AAVA 1NDGA 2BVOA 3WN6A 4ACPA 1PSKL 1GGBH 4BQ8A 3C2AL 3L3HB 3P0GB 4R90H 3GXFA 3C09B 4O51A 4U6HB 4WI8A 2I9LA 5EF0A 2CE6A 1ZSDA 3HNSL 2XWCA 3T4AC 2HCZX 2OL3A 3BKJL 3FCBA 5CZRA 2BRRH 1KMGA 3ULVC 3OLIA 1NTDA 1I8MB 5GGVH 2K1MA 2JELH 1E4WH 4CC1A 2W94A 2XETA 2DD8H 5AOIA 4ACTA 1UYWH 4Q4IA 4JN1L 4OQTA 5EOQH 1AFVL 4FG6C 1PKQA 3MRMA 4YUEH 2D7TH 4BFJA 5DZ9A 2EYRB 1OP3K 4HHAB 4XBEL 1U41A 2FIRT 2PO6D 3B34A 3ULAB 2GJ6B 4WTZA 4OZFG 4ORZC 1ND0A 2A6JB 3KYMA 2Q3XA 2AQNA 2BK8A 1WSST 1WFUA 1FFPA 4GKSA 2ARJQ 2GK0A 1BJ1H 2I07A 3IDMB 4ZPTA 3DK2A 3U2IA 3QWOA 2CSPA 1OY3B 2HVKA 2O5YL 4OJCA 3V0DA 2W81C 3DGGA 2VM9A 4X6CF 5GGUA 3UTOA 4DVRH 4Z7WB 4NKDA 2OI9C 5F9AC 4XWOD 2F2HA 2YQ3A 3L3OC 5IVXE 4IBLT 4AW7A 3GMRA 4K9EL 4LRNH 4L8DA 1YNTA 4Y5XB 3B5GA 3NCXA 1C1EL 3QEUB 2AP2A 4LP4A 1BXXA 2C5DC 4NJAH 2C7UA 2FYYB 2PABA 3GHEH 1XXDC 5J3HC 1AHWA 4FLRA 4O4YL 1IAIH 2CMRH 1P2CA 4IKIA 1DQLL 4Y9GA 3ARDC 5KYNA 1CICC 2EDWA 4ELME 4HK0B 3E3QC 1NKGA 3ZO0A 4ZX3A 1AGCB 3TVMA 3B1UA 4J3QA 4HJGA 4LCWE 5ID0A 5IESL 1CGXA 1BQHB 2WINB 2FEDC 4PRHE 2R2CA 4K07A 5T5FL 4EVNB 1MNUL 1RZPA 3EFOB 5IVOA 1NCTA 1JF1A 2Z7YA 3QAQA 3H9ZA 3WD5L 4BHUI 4IMLA 3R4DA 5I1CH 3O6LL 2FT6A 3MR9A 4FEIA 3WY4A 1G9NC 3QIUB 5J11B 2CGRH 4M93B 1OGAD 4Y19D 4UT6L 3A4AA 5CCJA 2G30A 1FFTB 2JJSC 3MRBB 4X5RA 2M2DA 3GHBL 3N41F 4YHPA 5LXGH 4LF3A 1Q1JL 3DTDA 1BFOB 2VDQL 3GSNL 1J9TA 4JM2D 2C1OB 3EUUA 4XBGA 1JYXA 2Q10A 1CF8H 2QV2A 4HA1A 2A6KB 3X3GH 4I13B 4IBUA 2R56L 4OGAC 3OX8A 3RDTD 1H6UA 3X3FH 2A74A 1F4YH 4LGSB 2WYZA 5T3ZL 4DPRA 1BJMA 5C08B 5CSZB 2NY0C 3ALPA 4NNXA 4JY6B 4LU5H 2IBZX 4B9PA 4NRXB 4UTCA 4CMMA 1U4EA 3QUXD 4OLEA 1A6AB 3TBWB 2CCVA 3QEQD 1XFPA 4KY2A 2D7PA 3WHE1 1OPOA 1U91B 3LKRA 4NUMA 3ZT6A 3EJYD 3VFWB 4AM0Q 1ETZA 3PWJB 2A9DA 2PP9A 4WUUB 5I30L 4U7SA 5E56A 5FFOA 2HKFH 2PO6A 3KCWA 3CFQA 1E3FA 5D6CB 5E8PB 4OUAA 3ZHDA 2IQ9H 1JZ3A 3DX7A 3KPPA 3CFTA 2AJXL 3M8OL 3NOIA 1OLLA 4U3SB 3B2VL 4YPGA 1ITCA 2Y3AA 4ZOCA 2PPAA 3KJ6L 4HJJL 3PXHA 3X2QB 2HYMA 5J6GB 3D8MA 5CWSB 2R69A 5B8CA 2CR6A 2CKBL 1FI8C 3GK8H 2CALA 2DQIH 4H40A 4J6IA 3NJGA 4QEGA 5HI3D 1MFEH 4R7XA 3ARBB 4IRSC 5D5MB 3QRFM 1QNZH 4OFYD 2WSDA 3ULUC 1R3HB 3K6DA 3MLZH 4PRNA 1GZPA 3LPOA 2NY2D 4XP1H 5JHAA 3DX6B 5J7CC 2WXPA 4KO7A 4G7YH 5EBLA 3QXAA 4JFXA 4MJHA 2VXVL 4MAYB 4E42A 4L5FH 4GMTH 1HX0A 2K9FB 1L6XA 1QFWM 4MKMA 1N19A 4UMGA 3S3JA 1R33A 4L4TD 1CL7I 2ZWLT 1XIWD 2X1OA 4HX1B 4AYFA 5IWLA 4B9CA 5KBPA 1GJUA 1SM3H 2WVVB 2ALWA 2P7TA 2VLJD 4RMUA 5E7BA 2VR4A 1BBDL 4YSEA 1CTOA 4KQ4H 4Z7NE 2WYTA 3ENEA 1WBYB 2XPGA 2HFGL 3AWVA 2JJTA 4EPSA 5CR8A 4P5KA 4JN1H 4V2BA 1TLKA 1XAUA 1JV5A 4RQQA 1OD7A 1S9VA 1F8TH 2QSQA 2WLHA 3B7TA 4XBEH 4S1RL 3FXIC 1OGAA 4LDEB 3V2AR 4Y19A 1A0QL 2A4ZA 5GSVA 1H5BB 3T4YB 1LWJA 3CMOH 1CFSB 2BCKA 1FYTB 4KZ0A 3FH5A 3IFLH 4IJ3C 5FUZH 5ACZB 3Q2VA 3QORC 3SE3A 4BSWB 3LKOB 5JO5A 4CSPA 1T7WA 5K5YA 3FQTB 5CD3A 5HYEA 3TJHC 4DK5A 2CUIA 3JYCA 4LPXA 3UX9B 3OKEA 3L3JA 2EKSB 1YEFH 1NJ9B 4FQIL 1S7VB 4B7LA 5GGQL 3MXWH 2WW8A 3WE6A 2EDHA 3T0EB 4N9OB 2BSBA 1F4WL 3NEOA 4HS8H 5B38G 5BRZE 3BFOA 4ZDHA 3STLA 3AZUA 3ESNA 3QUXA 1DR9A 5ENWB 3BVVA 1J8HD 1SY6H 3QEQA 2NQDA 4W9DC 4PGJA 4PS8A 2PW2A 4OUUB 4LHJB 1TNNA 4Y4KB 5DVOA 2FBJH 5E6IB 5HJDA 4GW1A 1YEHL 5C0AB 3MOBH 5IESH 3OKMA 3QT2A 3MNWA 2CHWA 4QOKD 2WPGA 2Q8BL 3DV4A 1L0PA 4NBXB 2J5WA 3DX0A 1EWHA 2QPUA 1MNUH 1NCOA 3O3EA 3TV8A 2NY5L 3P4MA 3ISYA 5C09E 1YJDC 3O41B 3WEMA 3Q8EA 1XGZA 3LQZA 4KVPA 5LGHL 1L5GB 5IF0B 5IIEA 4BCXA 1NEZA 2BVQB 3COOA 4JZNA 4OFYA 4TNEA 3RWCA 3U6XA 4HYTB 1GY2A 4UBDD 3GHBH 2A9BA 2KQMA 1IBFA 3LDBC 4TLSA 5E1AA 2FHFA 3HI6H 4XMZA 25C8L 1BMGA 1HSBB 2HAZA 2FATL 2L4OA 4NN7B 1S3RA 2YUZA 3C5ZA 3OG6B 1MJ8H 3MA7A 4JFEB 4S1SH 4F1SA 5C2BH 3MCKB 1SJHA 2ZUQC 4L4TA 3SDXF 2B16A 1M42A 1XIWA 2AV7A 3NJLA 3HCVA 5LN4A 1F4HA 3QNXA 3L4ZA 2L0DA 2XDHA 1S8DB 2VLJA 4FFVD 1TZAA 1AHMA 5LXVA 2A9ML 4MZ2A 2WTOA 1EO7A 5D2NA 3RI5F 4JN2A 2BS71 2Y06L 2HT4D 5FYJE 5DMKA 1E9QB 4M5TA 5E8DH 5AW5B 1H9DA 2MH4A 1KJ3L 2WMPB 2XRAL 4R2GC 1L9SA 4RCAA 1QW9A 1UA6H 4JDEB 2R1XA 5ESQB 5T3XL 3G3LA 4CVWA 4F7KA 5I16B 1E28A 4CMHB 2AJXH 3M8OH 2EUZA 2VERA 4NQEE 2R1WB 3D4CA 1HK6A 1AIFB 2A73A 1KTBA 3CBJB 1SDYA 3L5XH 1MAMH 3C8KA 3MPCA 4A68A 1LDPL 1B4JL 1KJVA 1SYSB 4XCYB 1D5IL 4ZD3H 5KSAC 4NO0D 1QBAA 5CP7B 2G3MA 2QHLA 4OLXH 4R4ND 2CNZA 3MXVL 1S6NA 2NNFA 3U46B 2AJZB 4XVUC 4LPVA 3ZLQC 3IETA 2YSSB 4JKKA 1A4BA 1MCJA 2GT9A 4E36A 4EN3C 5DJ2B 3K5SA 2X6MA 1CD0A 3IXTB 4PCTA 1N8OE 2VKWA 4BKSC 1PKQE 2WC7A 4OZIA 1F4AA 2XVGA 3KL0A 5HI5D 4NQCD 2XV6B 3LNIA 4QOKA 1KFAH 1LEKA 2K7QA 5D7KD 2SEBB 1SXBA 4D9RE 3BO8B 4J8RA 4QXUL 1EJ6A 4NPKA 1M2OA 4KC3B 5F71A 3U7YH 4DUVA 5D4IA 3TBTA 4XOEA 3KLHD 4FQPA 2X4NA 4HF5H 3LNGA 3HR5A 3HJEA 4WWKB 2YO3A 1JYVA 3EH1A 4A7VA 4UZGA 4X8XA 5JW5A 1XH3B 3ATAA 1RFDL 3BKCH 1DDHB 1J05A 3LHPL 4GQRA 3X11B 4OB5H 4NERA 4JQIA 3CXDL 1KY6A 3UPRA 1DVQA 4JR9H 1CFTB 3MV11 1HHHA 1IFRA 4YXKL 1WGOA 4EKJA 3GJEA 4HEPA 5CGTA 3BJLA 1MRCH 3S35L 3W39B 1UURA 4JFOA 3BAEL 3CFKB 1IKOP 2W0FB 3CH1A 3MLVL 4WW2C 2DMKA 4KI1A 1KXTB 1F4WH 1WV7T 4KKLC 5DSCA 4FA6A 2YD2A 3GYRA 4I0PD 3VH8G 1J1OL 1NA8A 1R5VB 4LHUB 4MSWB 4AKOA 3HMWL 2BVTA 1CXKA 4RFOL 3SKOB 3TA3C 1OE1A 1FNSL 1DVSA 1K2DA 3O11B 5CIPA 5A2JH 4P3DB 3PWPB 4X7TB 1RV6X 1VFBA 4TSBH 3TL5A 3IDJA 3FU0A 3GMRB 1XL6A 4Y9BA 4XPFH 4XVSL 2F58L 4ZW7A 3WEXA 4AXWA 2D7NA 2R59A 2WN2A 1DSYA 3B37A 3EJRA 2C7UB 1CBJA 2NY5H 1F5WA 4KKPA 3KCPA 2NXZD 2Q20A 4ESKA 1KPVB 4P2OC 2N0MA 2H6UA 5DD3H 1SN5A 1XXFC 1G7MA 3BVDB 2PW1B 4G6KL 4EBQH 4E9LA 3MV8D 4HDIA 1KXQA 2ROYA 3N85L 2OYMA 4V33A 3WIIL 1YZZA 2HT2D 3VSUA 4OFIA 4GG6B 5F3HA 2V8MA 1AGFA 3T2OA 3ZL1A 1MHHA 3ZT7A 3OSVA 3BZ5A 4PJ8D 4JJHA 3O3BA 4J6RL 2X1PA 1FG2A 2HFEB 4QRUB 3NK3A 2IEPA 4HW6A 3U79A 1IT9H 1H15B 3CFNA 4JUSA 4U0QB 4H8WL 4LL9A 4KKBC 1ZGLB 4ZSOA 3JTSA 1D6VH 4JGNA 1P4IL 4NQCA 5AB0A 2A9MH 3CFMA 3L5HA 1RUQH 2L04A 4NUQA 4OM1H 2PTVA 4MB1A 3WN5C 3QGVA 3BZEA 4WNQB 4GW4B 3CHSA 1EAPB 2FLRT 4O5LL 2DQFA 4GRWE 3O6FD 1SY6A 1KJ3H 1RULL 1NAKL 2JJUA 1JPTL 4GAFB 4GUPA 3IN0A 5E08H 4QKXB 1XGUA 2AQPA 3D39A 4DSYA 4XBGB 5ABAA 4MQ7A 4JPVH 2UZPA 5DWPA 5D70L 4B5ZA 2RAMA 2PCXA 1TTGA 2WWOA 4JFUA 4G8GB 3A0OA 5FFGA 1EAOA 1SBSL 1ZHKB 1XR8B 3BT2H 5I73C 4XCFL 1E5ZA 3NM8A 3BUPA 2IG2H 4F58H 1A6WH 2WLYA 5JORA 4NM8L 3UAEA 2QKSA 3MNMA 3T8XA 3HE6A 4GO9A 3LKPA 3QIWC 4OD2B 2Y6SD 3Q5YA 4KHXL 4IKJA 2CUHA 3RQ3A 3WKQA 2HRGA 3QJXA 2EVJA 2CDFA 3V0JA 1MCSA 4HIEA 1H3GA 5E2WH 5HVHC 3LKQA 2VDKH 5D7JD 1DBJL 2PR9A 4I0PA 4LO9A 5DR5L 3NZ8A 1KYOK 1F4XH 4RGMB 3T1FA 4YPGB 4G1EB 2Q6WA 5DUPL 3L4WA 3U0WH 3O2WH 2AZUA 4QJ3B 1KGWA 1HXKA 3GB7B 4X9HA 3UMTA 3OXRB 1NMAL 2ZOLA 5BVJB 4LSPL 4XPGL 1HHKA 1OGAE 1JWUB 4N2GA 4Y19E 4Y7MA 4YHNB 2OR7A 2BW5A 2FB4L 4KPHL 1YEEL 3LV3A 1L0XA 4HHWA 2NW3B 4NZTL 2WSPA 4QXUH 3TX4A 3UAJC 1SRDA 2I25N 5GS0L 1R3LB 3FQWB 2E8ZA 2X4UA 4XC3L 4XHJC 3VFSB 5JR1H 1GC1C 1ZLSH 3IDNA 2NLJB 2ED6A 4IRJD 3RUGA 3MV8A 5DFVC 3QJFB 3ARED 1EEUA 3QG6B 5F7NC 5I18L 2GEQA 4LSRL 3GMMA 5F7BA 3RVWD 3SE4C 2FDBP 4OT1H 5IB2A 3T3ME 2VQ4A 4PJ8A 3G5VA 3A22A 1HAUA 3ZE2B 1BJ8A 4H2CA 4HWNA 3FBQA 3SIKA 2BIHA 3TN0D 5IV2B 3MGOB 4EE2A 3FZUC 2DEXX 3BRGC 3QEQE 1BEYL 1KNOA 1LWRA 1VPOL 5C0JB 4JHAL 5D72H 4M4RB 3WE1A 4A7TA 1G7IA 3KWTA 3EH4B 1LD9B 4X99A 3RA7L 5L2JA 2BCMA 4L4JA 1FZMB 3QDHA 4CUCA 3IS0X 5GS1A 1PVHA 2WN3A 5CZVH 2ZKHH 3ARRA 1GW6A 4BFNA 3F12A 1IE5A 3L81A 4JM4L 5L2KD 3O6FA 2W92A 1FUNA 2BNUB 3ULVF 2C9UA 2NUTA 3LRLA 1UXWB 3KGTA 3I3DA 4N8VG 3S48A 2VAAA 3HPLB 3U7AA 3WXVH 4B0MB 1INDL 2F68X 2NNRA 2E0PA 1T2QH 4QPEA 2VDOB 4JPSA 4TNFA 2BIMA 3QUMH 5F1NA 3SBWA 2EEFA 4X7FC 5CBEB 3KMDA 4D94A 2EDDA 5SWQB 1FE8L 4OBSA 3V4PA 1WX2A 4N2LA 2LLLA 3ESUF 3HE7B 4KKNA 1BCIA 2D4DA 3KS0H 3T5WA 4QNPF 4L4TE 4OCYH 4XI5C 2P9RA 5DJXA 3D2TA 3ILPA 2XVLA 3N1MC 4UQ2A 5PCYA 4PLJC 3RX9A 4XPAH 2J71A 3LZRA 3WUWG 3ZQWA 3RPBA 3SDYH 2AV1A 3LZFH 4AYDC 1LP9B 4QRPD 1T7ZA 2WBJB 1HEZB 2VLJE 3IYLW 3QNYB 4LMQI 3UC0L 4S1DC 1N0LA 5BJTB 5D7JA 1GJWA 3HIZA 4OJFL 4ZAKB 2I27N 1SBBA 3JT2A 2CAKA 2F7OA 5D2NE 4OJYA 2OFQA 1S7TB 3SQOL 3HG0A 2R29L 2XTLA 4YWGL 2BVPA 5EBWA 1DBBH 1SDDA 2WXRA 3K6FA 4HAKA 5AVZB 1OWRM 3NTCL 1NFDA 1MIEL 5ILTL 1IRAY 4OF7A 3TEXA 1BVLB 5DS8B 5CGYC 1WLHA 2IOIA 2WLLB 2KPNA 4LLQB 2GYSA 4PVNA 1S7QA 4OU3A 3RWCB 4QAWA 2OX5A 2KZ1B 1NAMH 4MX7B 4AEEA 3GKWL 4F7TB 5C0BD 3QJHA 5E99L 1J5OH 4MTMA 1A02N 1BZQK 1RULH 1JPTH 1MCBA 1VEOA 3BGMB 3C5ZB 3WEAA 5CJOH 2CR0A 4I1PA 2APTA 3AREA 1HQ4A 3P9MB 3UTTD 3CD4A 5IBTL 2VZTA 3F7KA 1X4XA 4JRWA 1CBVL 5C1MB 1O0VA 3MLWL 4GMSH 2Y36L 3RL2A 3G5XA 1R3IL 2GJJA 5ABZA 1E4XL 3UAAA 3I50L 5DFAA 4YL9A 5E6UB 3TN0A 5DJDA 1Q90A 1J8HE 1WZAA 4LOUC 3UADA 2GW5A 1OGSA 2PYFB 5FYKL 4OZIE 4X98A 2NW2A 1X4ZA 2W9DL 4QOKE 4XPBL 1OE3A 2FNWA 2BMKA 3DI3B 4FXKC 1AP2A 3M07A 1IL1A 3ABMB 3NG5A 3V6OA 3HW7A 1S9WA 4HETA 4K71C 1Y18B 3DWTA 3TZVB 1AZNA 4Q14A 1O6VA 4N9GB 4NWUH 3C8KB 2J72A 4IGBC 4UOZA 4PJDB 2AMGA 2N7AA 2NY6D 4Y89A 3OR7A 4IBWA 3DX2A 1KJVB 4NX0A 4OLYH 5G4OA 4UUJA 3VW3H 1P7QB 1CF1A 5JW3L 2ICEB 3VQ1C 2YGPA 1T2JA 4XC3H 15C8H 1MCWM 4HD4A 2Y9RT 4OKDA 4BIKA 2HMIC 3DYPA 1UJ3C 3NIGB 3ABLB 2YPLD 4KITB 4RMQA 1NBQA 2BOLA 4X83A 4X9YA 2ZIDA 4QRAA 4WHTB 4QRBA 4OCNC 1T03L 4QRPA 1BF2A 5E6RB 2IFFH 4BJLA 1NDMB 3GPEA 3ECQA 2PTTB 4PBWD 2KDGA 4X6BA 3ULUF 2LE9A 1LNUA 4G9DB 4Q6IA 5GISH 3S36X 4L5FE 4N5EC 5ACMA 1KDJA 3UABA 2WQUA 4R96A 3X17A 1QR4A 1U92A 3TBTB 1DDTA 3QNZA 3CLFH 5BV7B 2BOCB 3GSVB 4XO8A 1NMCC 2VZUA 4FQCL 5D7HA 3ZX1A 1IGJB 4P59L 2VMDA 2UWEF 4OLWL 4NCDA 1MY7A 1KN4L 3M1BA 1LE5B 2H9GB 2ILLA 5AB1A 1HWWA 2YAPA 5C0BA 1T7VA 2R0LL 3TIEB 1AR2A 2DAVA 4JFDD 3GSXB 5B22A 5IBUG 1RK0A 3VGAB 2V9UA 4ZMVA 4MDIB 4I77L 3IVKA 3AWZA 2ZP0T 1FVDA 1SFHA 2BIOA 3SODB 3SBRA 3UTTA 2DL2A 2XTSA 3HLAA 4NYLB 4TUJA 1KXQE 3B2UD 2NXYC 4LPUA 1MI5B 1LO0H 1IBBA 5KYWA 3FONA 2GHZA 4L9LC 1AQMA 1TO5A 3GO1H 1KTRL 3AT8A 2FZ3A 4GFTB 2VDPB 1JPGB 4QTIL 2WGXA 3V9CA 2AQ1A 1WZKA 3LEVL 4NZUL 1YPZA 1OHQA 1BVKB 1G7QB 4AVJA 1KBKA 5CAYB 4M1DL 1F90H 3NFNA 2VN6A 5EZJB 3QCVL 3V0GA 5EBMA 4PRBA 1KELH 2X7LB 3G6DL 4GAYA 5DFWH 3OM3B 4ZSOE 4KV5F 4NQCE 1U8IB 5KVFL 4JHBA 1JGUL 5D7KE 2DZEA 2P43B 4HOXA 2YLKA 1JOIA 3P2DA 2YLHA 5DMJB 3UO8B 2DWEB 2R9HD 3W2DH 4G5ZL 1UXLA 4XVJL 2LVEA 5D96C 1AOHA 5CJQL 4U31A 1WITA 3DSFH 3HAEH 3TF7C 1JV2A 4QRQA 5IG7A 3FDWA 4H25A 5DJ6A 3NIFB 4BQBA 2I7OA 3D0VA 4GQ9H 3RIFK 3MJ8B 3EYSH 3Q5TA 5BZDB 2RFXA 4AMKH 3QYMA 4Q9RL 5F3HB 3SPGA 5EO1B 3HC0B 2V5TA 4Y2DC 4QT5A 2AEPL 1UWYA 2BOBA 4P4KC 3WKMH 1XCTA 2B7DT 2YOCA 4FNLL 4PJ9B 4TLKA 1FC2D 3SGJA 4JDVA 4XN2A 4I88A 4TSCH 2WZPD 3S88H 1NIAA 2YUVA 2BS9A 3S3PA 4EXKA 3IPEA 3FN3A 4NKOB 2Y36H 1QPXA 4FQXA 3H7BB 3QUMA 4W4OA 5E2VH 4NXSA 5HBBA 1R3IH 2DWXA 4WGKA 4YSSA 4FKKA 1MIML 3Q44A 2ZWNA 4EAEA 2FIKA 3QISA 1PQZB 4KKRA 1S9XB 5LG1A 3DNKA 3ZIMA 2V17L 4X6DA 4B53A 2EQDA 4IS6B 2E86A 3RX7A 3X13B 2OSLB 3D39B 4PVLA 2EXWD 5DHVA 3RZWA 2JQAA 4MQ7B 1L0YA 3O8XC 4EQ3A 1V10A 1OIOA 3VD0A 2W9DH 3WDJA 1H8NA 4UOQA 3LPFA 3UZQA 4X4XA 1I1AC 2NUPA 2ZMZA 5GGSB 2AQTA 4F7PA 2IGFH 2ESVD 1X5FA 2BSED 1DN0A 3H4FA 4JFDA 1DSWA 1G6RB 3BIBX 5AYUL 3V0EA 1BWWA 1DQTA 5LGYA 1U36A 2JQMA 1IB5A 4MJ2A 2G0LA 4HCRH 4PWJA 3SCMD 3NGBB 4I2XA 3L5WA 1F58L 5I0VA 4FP8H 4ONHB 3RUGE 3MV8E 5JORB 3TYGL 2BS8A 5JXEC 5DZAA 4P2CG 1CLZH 4JCMA 5F7EL 4TQ8A 3TBCA 2ITDB 1XGRA 1NAMA 1R24B 3KPRB 4M61B 4P3CH 4JQXC 4HIEB 3IFPB 1MWAB 5CUSH 3X12A 1BT3A 3S6CA 4MJID 4AOFA 1R5IB 1P1ZA 3JV5A 4MLIA 5B7EA 1UG9A 4Z76A 1TU2B 3VM7A 4Z3FA 5AKTA 4DGWC 3N04A 2MTAA 1BF8A 1FFNA 2F19H 3M45A 3PWNB 5IW1B 4K9EC 4Z7QB 1EUTA 4OZGA 2ADGB 1T1XA 1T04A 4KVNL 1USQA 1WC7B 1AI1L 1F56A 1NCDL 3F7YA 1N64L 4Z7UA 4Z6AT 2JCCF 3JVGC 4Y1AA 1IEHA 3IDNB 2YQBA 3BP7A 4JRXD 1T4KB 4FC3E 4P9ML 1V7MH 2XQBL 3MUUA 4NRYA 4YBLB 4E9VA 2Y72A 4XXWA 4ZMLA 3GZKA 5INDB 3HC4L 4AG4H 4ZYKA 2JIXD 3HG1D 3I9PA 4DVBB 3CBKB 2DM3A 4CKQA 2QPSA 2G5UA 5FB8B 1QHQA 1OAKH 1WUZA 2WZPA 3TPUB 5EU7C 2X0VA 4ZO6A 1FHGA 2LR4A 3MUJA 4PYHA 5I3BA 2E3VA 5DJ0A 3UBFA 3WBDA 4LAQL 3IJSA 1G7IB 1H6FA 3MBEB 1MCPH 3AAZB 3VFPA 3VCLB 3ZXAC 1T1YA 3FUDA 4H1LB 1BXUA 4X4MA 2OQJB 4NZUH 4A39A 1D9KC 2YUWA 3KLAA 5HHMD 1MVUA 4I3SL 3UCQA 4LEEA 3S5LA 3ZW3A 3HS0B 3ZL2A 3BEWA 4AC2A 3JWNC 2VDOL 4G43B 1S46A 1RHFA 1G7JB 4RISH 3RZCB 4HUCA 2ZSVA 1JTPA 4YIQB 5H2BB 1NFDE 3L8QA 1DJIA 3QQ3A 4QAMB 1SZNA 1XCXA 2J8UF 2N1KA 3RTQD 2ESVA 1W0WB 2BSEA 4WDIB 1SLUA 3ZE0B 1H3VA 4LASL 4YVUA 1V05A 1E8YA 4P57B 3HKFA 4XVJH 1S9YA 3SCMA 1OAYL 4WW2F 4L3CA 2RQEA 4XB7A 32C2A 4KHTL 3ERXA 5F7YC 4AZ8A 4Z7AA 4L8SC 5KW9H 1XZ0B 3LRKA 1A6UL 4EDWL 2DS4A 3CXFA 3ILPB 2VR5A 2YD0A 4P5TB 4MQTB 4LBEA 1K4CA 2BSRB 3HMXL 1B88A 3PE9A 4WTXA 4BBWA 4Q9RH 3P2BA 2QKIB 3RWJA 5T1MA 1QFHA 5IVZA 1JK9A 3VFGL 3PHAA 1I1FB 1PLBA 1KCSH 1N8ZA 3NMEA 4MJIA 5C0DA 3ZTJH 3B2XA 3OD3A 1HSAA 2KMWA 3CJJA 1KZQA 3MRLA 2NZ9D 1QMUA 3D4YA 5K33A 2NZ1A 1RH8A 3THML 5L9DH 5D7IA 1IQDA 1MIMH 4LSTH 4XN5A 3SPVB 8FABB 1T6VN 5L6YH 2A6DB 1KYAA 3SE9L 5BS0D 3ZE1E 4WV1A 4OBRA 1O9WA 1HINH 2R0ZL 4GBXC 3V6OE 3POHA 5L2KE 1FL6B 2FQGA 3WCYA 2E27H 4H8HA 3V4LA 2X4TA 3BH8A 1R3KA 4XO9A 4JRXA 4EIGB 3VD9A 1ZXQA 1AXIB 1U3HC 4NCC1 5BMFH 1ZPLA 4AK1A 2NY4D 1SXCA 1VB9A 4FXGB 5AVXB 3NSYA 2OBGA 4AYBA 5M7QA 4A2HA 3S37L 3VO0A 3ZZLA 3VI4F 2DKSA 4JANA 3RL2B 4RSVA 2JIXA 3HG1A 1PY0A 3KPQB 3ATEA 3ZR6A 5B3NA 4O2EA 1IKFL 1BAWA 1JF5A 2FX9H 2XKNA 3VE0A 1J0IA 1PZSA 2I9TB 2F5BL 2MPAH 1YYCA 1FFRA 4HUMB 1XO8A 2WCGA 2YAHA 4JM0A 1SDAB 3VG9B 2I26N 3BUYB 4LL4A 1KC5H 3GZPA 4WI6A 4YXHH 3TBSA 4YHYC 5E1IA 1G9MH 1NGQH 2UXTA 5EOTA 3VNYA 1MCIA 4QRPE 5EDXA 1CLOH 2L3BA 1Z5LA 3FB6A 1WA0X 2GHWB 4G7VL 4TTDC 3ZL4L 2BMKB 2GSIA 4K2UH 5MENB 3GTVA 1NSNH 4R9HA 5L4MA 4U6XB 2JXMB 3EW3B 1W72A 1N70A 4HPOH 4AJVA 3OWEA 4F15B 1DLHA 4JGMA 5I8OL 1MREL 1OT2A 3DYMA 1F6AA 3F84A 3NA9H 4XP5H 1JTOA 3T9WA 4RNRA 2MPVA 5F70A 3VB9A 3RTQA 3I6LD 1VIWA 5KN5A 1CR9L 5C0BE 1H3UA 1JGVL 4P04A 3RWDA 3V5KB 4HLJA 4UIKH 3T09A 2YKKA 5B4MD 1WCBB 1HXMA 1AR1D 1N6QH 4NKIL 5F7LB 5KS9A 4Y16C 3BYYA 3UTTE 4FKHA 3B2MA 3DPDA 4JG1H 4I0CC 5K9QG 5FHAL 3VQMA 5I8CB 1S7SA 1V7NH 5HDQH 1OARL 1HNYA 4M6AA 5GHWH 3QDMB 3EG9A 3OAUH 3O6KL 2HG5A 1AXTH 2WWMD 4IMKA 5KYYB 3H42L 3UO1L 5BV7L 5IFJB 4HCRA 1YPZE 2EILB 3DMMA 2NNXA 4G6MH 4OF0A 5TDNB 4Z0XB 4JUTA 3STZB 1FV1B 5IOPA 2FT8A 1H6EA 3HI1B 5DQJB 4UQBA 3GTNA 1FGVH 1WWWX 2BERA 4YSDA 2OYLA 1W8OA 4D3CH 1FN4B 5J1AB 3DHMA 4UM9B 2UZIH 1NGWA 3M6DA 5DVPA 3GEFA 4JQIL 4JO1L 5BS0A 2YC1A 3M17A 1RLBA 5DF0A 2Q7YA 5MI0C 1LMIA 1UCBH 4HIXL 4UT7L 5DLML 5GXBB 2YN3A 1FVDB 1QKZH 3B7RL 4IEFA 4MXQC 4KK6C 4RVBA 2W95A 1KBWA 2BHYA 3T6ZA 3HLAB 2VDPL 5E8NA 1IGYB 3FU3A 4P99A 1CN4A 1TTBA 3NJXA 3H2PA 1RCYA 1ZTXH 2C3VB 3FMGL 3BE1L 3IKKA 1M7XA 4LLUB 4ZO9A 5KZCB 2NYKA 1LXMA 2VXSH 5FKPA 3OR6A 3CHOA 2JK5B 3U9PH 1NOLA 1MLBB 5EDSA 4PBDA 1BFSA 4N4YB 4APXB 1HU8A 1KBVA 2YPLE 3O6MH 4EDWH 1BZEA 2ZPKH 1G1CA 1ADQA 2CDEB 3NFNB 4G8GD 4ODUB 3LN5B 2ZQKA 4HIJB 2J20A 4LCCA 5D55A 4MMZA 3BCDA 4ETQA 5JHLH 4DO6A 4FTVB 3L9BA 3QUHA 2DIEA 3MRGB 3F85A 2BFGA 3CZGA 4HUNB 4Z18A 2YD6A 3DXAB 3J8F7 1OAZH 3BC9A 1EJOH 4JFWA 5EUKB 3AGWA 5H94A 3GMNA 5TPWL 2YEVB 2ZCKH 2R2EA 3REVB 3OAZH 1QBMH 2Q3AA 4N1EA 4X6DE 3H55A 4OZFH 3VX0A 4EO5A 4WKZA 3BFWA 2YR3A 3TU6A 2DQUL 2WYIA 5I1KL 1LVEA 3FO1B 1COBA 3D0VB 4GAJH 1CK0H 2P4AB 2GSMB 4EI5C 2IAMB 2N56A 3GMLB 4PS4L 4BUHA 4JFDE 1DUZA 1Z9SA 3L16A 3OF6D 4P5SA 2G75A 3RBGA 3PV6A 4HK3J 3CGTA 5JHDD 3UBXI 2F1AA 4X80H 1K8DA 4X4YB 2RH0A 4I2XE 3IDIA 4RMSA 2X3BA 2MCAA 4FMVA 3MNZB 4K7FB 3MYJA 5D1ZD 1HXYA 3SD2A 5LGJA 2OMYB 4PRPB 3UGUA 2MHAA 3FH8A 4MBOA 5LCVH 1E8ZA 2WZ0A 2R2BB 4Q0XL 5E6YA 1IKFH 3EKCA 4LSQH 3ETSA 2WKOA 3QWQB 4WLCA 2VMCA 2NCMA 2O26U 1ZVSA 4GSUA 5JIPA 3C09C 1RZGB 2E7LC 1PDKB 4M56A 1GMEA 1RVFH 1REIA 2OTWB 3EF7A 2OMTB 2IDCA 3CSYA 1M71B 3IJ9A 3HZKB 4TUKH 4JZOB 5DC4B 4F9PA 5DHVB 2OK0H 1G6RL 3WNPA 2OMVB 3H8NA 4WO4B 1GGCH 4G7VH 4YSTA 3EYVA 2KDYA 2NUPB 3UBGA 4OCXH 3BUTA 4YBQC 4MMXC 2BVUA 5F1SA 4OZGE 5DK0B 1ZA3A 1JZEA 2IH8A 4UAHA 3RY4A 4KI5D 3BPCA 1KIRB 1OP4A 2UV3A 4Z7UE 3UG3A 1U30A 2NX5B 2XN1A 3CVDA 1X5MA 3O9WD 4A63A 1PAZA 4N2KA 4L3EB 1RPQA 1ZT4A 5EWIL 1NPUA 2YGNA 2Y25A 5CHNB 4LSUL 1MWAL 3MODL 2C9PA 2E9BA 1OP5H 3VD5A 3UAFA 3G08A 1SXSA 2CDGA 3OLGA 4POZD 2FE0A 1HN1A 4NLHA 3E8UH 5CFHA 2N59A 3MLYH 3EJCA 1RUPL 5DYOB 2KL6A 1IAIM 2DQHL 5A43C 1UZGA 5CN1A 3FQRB 2X4QA 1ACYL 5FHAH 3FCTA 4KNTA 1SOSA 5D2LA 5C6WH 4WI4A 2I60L 3RFZC 1HKLH 5T1DH 2MCMA 3C60D 4YO0B 1GYCA 1H8LA 3C6LB 1GPOL 4X4ME 1NGXB 2W07B 1U93A 5IKCA 3DV6A 4Z7OE 1U21A 4LLYA 5I76B 4PJ7F 5GGRA 2XFXB 2CGZA 3IDXL 1EJFA 4FQLL 2VSDA 2J3SA 3ZGHA 4MD0B 2VDNH 2YBGA 3CPUA 4BH7A 4DO4A 1KENL 4JO1H 5K9QI 1OQOA 2ESVE 2OP4L 4ZW3A 4R4FL 5F0LB 2P8MA 3EGXB 5F96H 1IZJA 3OF6A 5KVGH 5AUMA 5K1JA 5AG9A 4WHDA 5JHDA 1YY9D 3GSQB 4Z5RB 3OKNB 4GKOA 4JRYD 4PGDB 3WTSA 3V4VB 2ARJB 3O2DL 2ICWB 2UYLA 5D1ZA 5BVPH 4PGBB 5J11C 3QIUC 4XOCA 1KTJA 1Q0YL 3GPSA 4M93C 3RIAK 1S7XA 4YSPA 4BWTA 4JCLA 3O0LA 3DUHA 5DUBA 4D8OA 4H8WC 2WUCH 3WNLA 5HGDB 1U8LB 4XC1L 1NH6A 3V55A 3VFNB 1IKNA 3GNMH 4MJIE 1KGYE 4JL1A 1RZ8B 3QZBA 5E6SB 3ZK0A 2IH1B 1MQ8A 1MLCB 4NUGH 1P69B 2H3KA 4E5XA 4PJXA 2XOTA 3WU1A 2CK0L 1WAPA 3CFCL 3T2NH 2DPKA 3BEVA 4MRCA 4RIRB 5CU5A 4RFEA 3GBDA 5DRWA 2ZCLH 1FBIH 2EDTA 3BX7C 3S3BB 1LTXA 5EU3B 43C9A 4XCNA 4X7SL 5DJZB 5FHBL 2QGDA 2ZOOA 1YEDA 4LE8A 1NCHA 2FRGP 3VXPA 3O9WA 2DJUA 3NRPA 3MX0A 4JRXE 1JNLL 2VJXA 1A2YB 4GQPH 4LLMA 1M6OB 3FW6A 1BT2A 4F33A 3I2CH 4ZTPH 5I1EL 1CPUA 4HIQA 4N87A 4GRMB 5FYJU 2D03H 5GJTL 4MCYA 1B6UA 1AGBA 3EH2A 2ZJSL 3HG1E 2IFGA 2HG0A 5IVZB 4R7VA 3QI9D 3VG0L 5TJWK 3TASA 4C55A 5C0DB 3PG2A 4NM4L 3U0TA 2OMZA 3C6EA 2H8PB 3ARBC 5DZVA 3C60A 3MRPA 5MEQB 4KGLA 1U8JA 5IEKA 1EZVX 3IMWA 4UB0H 5DDHA 1Q72L 2HX7A 3VMPA 3Q8AA 3P3UA 4GP8B 5D7IB 3MO1A 5HHME 2RACA 3EDEA 4MAYC 4JKNA 4R7NA 4X0KB 1J9RA 4HD6A 5E4EC 3TIDA 2BSDA 2VT0A 4UDUA 4W68A 5GS0C 3L1FA 3WOVA 5K39B 3P4NA 1A7OH 1C5DA 4BKLA 4EI6B 5L4JA 5JHLA 3SDXB 2EUVA 2IADB 1JZIA 2BP5M 3ME0B 4G6FB 1AE6H 4HKZB 4AM0B 4JO2L 1NBYA 1JMZA 3Q1SH 2IPUK 4FQHB 4KMQA 3KLLA 2VJ8A 2E4FA 1BUGA 4KRPB 4X2UA 4ODBD 3T6XA 3MLXL 2CJSA 2PPEA 3OGCB 4I4WA 4JRYA 1FO0B 1P6AB 5D71H 5HJBA 5I5JA 1JDAA 1Z0MA 4R0LA 4OZFA 4LDOB 5KS9E 2FQDA 3KH4A 1GOHA 1VJSA 4LOFA 4F80A 5HYQB 3TBSB 1EFQA 1EK3A 2RGSA 4FYRA 4NXKA 4PJAF 1H5BC 3JV6B 1I3GH 2APWA 2LU3A 4MA1B 5MP6L 3FB6B 3AITA 4X7CC 3CFEB 3SGEI 4GUOA 3US9A 3ZRSA 1BBJB 2A9AA 4GSQA 1T5XA 3DKHA 1RUPH 1XGQB 4XMVA 3U4AA 1AVAA 3QFDB 4HC1H 1ACYH 5KSVA 4ZFOB 3BZ4B 1DLHB 5EF3A 2HLFC 2ZMXA 5CN2A 4DGYH 2Z7ZA 1I7TA 1UB6A 2FR4A 1GPOH 5LCVA 1FA4A 2AQQA 3MJ9L 3T0EC 1PYWA 3K2UH 4BINA 3GS7A 2A83B 4UIMB 2O61B 5KN5B 4KK9D 2JI1A 5BS0E 3ULSA 3BMWA 2Z35B 3MOQA 4P46B 2DWDA 4G7SB 1A3QA 1VGEH 4PJFF 3GI9L 4QY8A 2AQ2A 2IMNA 5KYUB 4HSQA 1EDQA 1MF2L 1F86A 2K0RA 4Y4KC 3QR2A 4FQLH 4FLSA 5E6IC 4JJ5A 5IQ7H 4QXTA 5DEJA 3VU1A 5EN3A 5T8IA 4HULB 5B7FA 3AACA 5JOPD 2JV6A 1KN2L 1ERNA 2FVNA 1A6PA 3U4BH 3DIDA 3H3BC 4B27A 4IKLA 5DI8B 1NANH 1UM5L 1ID5I 1G94A 3JBG7 3SQRA 3T0WA 2Y5EA 1OK0A 3QI9A 4ICXA 4AV4A 2CO2A 4JFSA 4YLBA 3MGAA 3NESA 3G6AA 5EIQA 2O5ZL 2D2CC 3DMMB 3P11H 5EIVA 4ZUSB 1LQSR 4GAGH 4AQ1C 4N24A 4YAQB 1HTYA 2HN7A 3QCTL 3ZZ1A 1QLEB 1U33A 4N6RA 3MGTA 1J0HA 3LZOA 1KLUB 4W9IC 2B08A 4XC1H 4XN8A 3EGSA 4PB0L 4CN6A 3OMZA 4N25A 3OAYK 4NN7C 1RKRA 2W0PA 5HI4D 1QLFA 4QRTB 3TO4D 4BM7A 3DTXB 2F6AA 2HWZH 2IWGA 5F44A 5CD5D 1WTGT 1I1YA 1JPEA 2GB2A 2HB0A 4QHNB 4XNQA 4RGNB 2VLRD 2GSGB 1ULVA 5E0QA 1ZLVK 5DTFA 1QHOA 1YMHA 2O5NA 3AM8A 3SJVD 1J5DA 1A7PH 2ZUWA 2WKGA 1A5FH 3I6LE 1XR9A 3IJHB 5CZKA 5EIIA 2F54B 5CP3H 5CEZH 4L0ZA 4BFIA 3VXQA 2V33A 2GBTA 2L8AA 1SVCP 1KPUA 5C0IB 1YLBB 3NN8B 4JHWH 2WQAA 2GC4C 3UTZB 5A1AA 1S2EA 4AK2A 2XZQL 3WL9A 3WV0A 4Z78B 1V27A 1THCA 2IH3A 3POCA 4GLRH 4NENB 5DHYA 3DO7B 4J3PA 2JTYA 2VMEA 3VGFA 3AUWB 1WX5A 1Z6JT 3EYUH 4LCCB 4RWYL 4ATWA 2BY1A 1IC5H 2G9HB 2A5UA 4K3DH 4CMHC 3OG4B 3RL1A 5EUOA 1E6OH 3VG0H 4X5WA 3TJEL 1U42A 1T66C 4YHLH 4NM4H 2VRQA 2C1PB 1DQIA 2R2EB 4XP4H 1OOAA 4ZUTA 4GXUN 4JZJA 4Z95L 1D6EA 5AEAA 2K6YA 1B90A 1I8LC 4MKTA 4PJIF 2VAJA 2AXJA 3WYRA 1TQUA 5ISZD 1V5JA 3RWGA 1I8KB 3L95B 4ANKA 3K72A 3BSZL 3MNVA 3I84A 2YEZB 3EYQC 2G75B 3ZDYE 1GYVA 4K7PX 3SYAA 1G7LB 3FUMA 2A2QT 3L3KB 4DT2A 3PAZA 2V2WA 2OCCB 4RBPK 4G6AD 2RQ8A 3FQXA 3TP4A 5KYXA 2EYTA 2P80D 5CGBA 4G8EA 3RGVD 4WENB 2EEXA 1WS7A 1Z3GL 4HFUL 4UF7C 1DFXA 4ONFH 3MLXH 3Q3GA 4UTBH 4HJTA 1NUDA 1ORSA 2WM0A 3G6JB 3RPIB 4U1LA 4M03A 3EO0B 3FN9A 3ARFB 1R6VA 1KBBA 5CLZA 4XVOA 5D6DA 3IFOA 3LIUA 4WWKC 5SWSA 3D5OF 1Q9LA 2VRKA 4G8GE 4WHYH 3RJQB 5ESVA 2YJLA 3HN8A 3QVAA 5D2LE 3SY0A 3KNBB 4DTGL 1TTCA 5GRJL 4GIOA 1LO3L 2FTAA 4NUJA 1PU0A 4UT9H 4D0CA 5FXCH 3QHFH 3ZKXB 4APQB 2YD5A 1AQKH 1UEMA 1JHLL 4MVBD 3ZKND 4F9LC 1IBGL 1XWVA 2N01B 2BDNL 2G60L 5KJ4A 1T3FA 2A4EA 2ORBL 3TO4A 3DPBB 3BPCB 4BKTC 3HFFA 5IP4A 5J9PA 3KWXA 1M7DA 5B38A 2VLRA 5BW7C 2CHXA 3NVQA 4HCIA 2EZ0C 2VDRB 2VH5H 1OP5K 3SJVA 1JPFB 3D25A 1SGKA 4S10A 1AG0A 1BQSA 5FF6B 2F8OA 1OTTD 3VWKB 3EADA 2G2RB 3QPKA 4DZ8A 1HCVA 4XO3A 4WJKB 1HOEA 2GTWB 5SX4I 3AMKA 1LK3H 4WGVB 1WP6A 5B1JA 4P2RB 5JHDE 4IM8A 3VUAA 4NNYA 4X50A 4Y9FA 3CN0A 3EBAA 5CBAA 4PJCA 1CT8B 2VTFA 5H35B 1OHZA 4I18B 5HHOB 5I17A 2E6JA 4U4BA 4D0BB 3S9DB 3T8MA 1Q9WA 1KN2H 3OHXA 5CMAA 4JPIB 2WLJA 2X4QB 2BVEA 4FAAB 2FX8L 3NFPB 5DMGC 5GRZA 3VACA 5C0EA 5JMOC 2GPZA 5FWQA 4UTAH 3RILA 3RWHA 5CEZD 4RLDA 5EO9B 3MRHA 3KBPA 3F04A 1AYRA 4LCIH 1RUKL 1O5PA 2DLTA 1OF0A 2JF1A 2BNQD 2VXUH 2O5ZH 1JWSA 2XVKA 3EOAB 4DIXA 4W70A 4DEWA 1ORQA 3AT9A 3P73A 3L7FB 2C9VA 3CN4A 1MG2C 4MJ6A 2FEJA 4F2FA 4PJXE 6PAZA 2WLMA 2XI9A 5G4NA 4BH7B 5ISZA 5KSUB 3CNKA 1BZ9A 4L48A 4V1DA 2A77L 2FJGA 2P8MB 3HB3D 3V4VL 3GBEA 4YHOL 2JLLA 3P30H 1SJXA 4NFBA 4U1HB 3CLEH 4J1UA 3DARA 4KI5E 4JG0H 1E90A 3PHSA 2BP3A 1C5BH 3PWVB 4HC1A 4YL4A 2CO6A 3ESPA 5A2FA 5A2KH 4DW2L 4XPHL 1UCTA 1Q0XH 1UWXH 2YMTA 1SEBA 3IGLA 1N2RA 2P80A 4WTQA 3IB4A 1QASA 5HDBF 3DYOA 3RGVA 3T77B 5IQ9B 1AXSA 5F1KC 4K9JA 3V0FA 4CNIB 4D9LH 3OKLB 1NBCA 3C2SA 5IW6B 1YN6A 3L3DA 4ZQKB 1M4KA 5AB2A 1KSRA 4HS6B 3T4AB 4PP1D 4JQVA 3KPNA 3SDAD 4YDVA 4L4VD 2P3XA 2DWYA 1FIGH 1CZ8H 3A67L 2QHRL 4P2QD 2KKQA 3LS5L 4EKXA 5I15L 4W9JC 1TJIL 4QGYA 2JKSA 2NPLX 4K3JH 5D4HA 1XGYL 4BQ9A 2QADB 1SN0A 2XHNA 1J8RA 3EO1B 1ZTXE 4WU7B 3MACH 1NC2B 3WHXA 4DKFL 3TJEH 4LP8A 5GGTL 2Q86A 1YYMH 5K93A 5ID1A 5ITBL 4KDTC 5LGKA 4J3TA 4N28A 4WVRA 1GOFA 4M3KB 5ICUA 1SMOA 2IWEA 3SBQA 9CGTA 2Z3FA 3ZRCC 2QTEA 3ZIYA 1V3LA 4HPYL 1A1NB 1KB3A 5K9JL 2K7PA 3MLTA 3ARGD 3QHTC 1NEPA 1CXIA 3PDOB 4B3EA 3BLPX 1Z9NA 4GEJA 5CJBA 1HE8A 4B50A 3L4UA 5DD1L 4MCYB 4KAQH 5A3ID 4KTDH 4OFQA 4RGMC 4FN0A 5AWNL 2PCFB 4BZ2H 4LEBA 3OC8A 1QUPA 1X7QB 2X4PA 3CDGA 4JRYE 2A3TA 3ET9F 1QI5A 3SDCB 2P24B 4BD4A 5KEZA 4LLWA 2XWBB 2UZXA 3NP4A 4PRAB 2OMZB 4YSCA 2ZYHA 2K45A 1DP0A 4YZFF 1PCSA 2VR8A 5J57B 3KWUA 3WJJC 1GS8A 3MV7B 1RZJL 5AAMA 5CP3A 2TRYA 4N2CA 1NGPH 3UL4A 4XVTL 2W91A 2AK1H 3V4UL 4EJ1C 2BNQA 4TUOB 3TWCL 4FZ8L 1CICB 2O6EA 2AEOA 1DEEA 3S36H 3VDAA 2VLKD 2YBRA 1CO1A 5KSBA 4BV1A 3PQYD 3UYRH 3V6FA 5IB1A 2OPCA 1AY1H 1E30A 3D08A 3FU7B 3LQAH 5E8OA 8PAZA 5IWLC 4QTFA 3SQBB 3UYOD 2BJML 2NY1B 2QPDB 4OY9A 1IAOB 1TZHB 1LILA 1J10A 1IM9B 1FO0L 3OLDA 3B3IB 4HFWB 4PP2A 4A2LA 4FABH 1TT6A 4KKCC 5FKAB 3VNZA 2F5AL 4HWBL 4UM9D 4LQ1A 3A3YB 4OCSH 3R19A 4TKWA 1CI5A 2DYPD 3IN2A 3WDHA 4DP1X 1M1SA 1FORL 3FB5B 1O75A 3VH8A 5LKNA 5I74B 1DQDL 2ICCA 2JKIS 5JMRA 4ZX5A 1M7UA 3RU8H 4HIPA 2CO7A 4RA3A 5KOVC 5KVMC 5I0DA 4GO8A 4K73A 2QDWA 5JPMA 1QSFD 1AJ7H 5C9JA 4JHUA 2XSKA 4TNWK 1A9BB 2Z9TA 3CSFA 4ZFOL 4JFPB 4HOMA 3HG4A 4J12A 1T5XB 5JQHC 3ELAT 3SDAA 1MFAH 4ZFGH 5LWYH 3QARA 4L4VA 1GMIA 5AW1B 4J3OC 5KZCD 5F9OH 5F7DA 2QJDA 4KJWD 4NO5B 1M53A 1JHKL 1TZGH 2NR6C 1JZ4A 4YEFA 2IAND 1FL3A 4NNPH 3UTSD 3QZMA 1T21B 3QUZD 1RUKH 5DJAB 3S96A 3F6JA 4UTBA 3HE7C 5F89A 2E7MA 1B0IA 3CSBA 3GTTA 4JKWA 2N1TE 4PJEF 3CX5K 5IY5B 5JHBA 3DUSB 3VXSD 4FFWC 4PW4A 1J9CT 3REWB 4JFQA 2AXFB 2AXGB 4PJGB 4B6ZA 4LARL 1TMCB 5IM7B 2WBJC 2DTML 5DRXB 2CO3A 2FD6L 2VO5A 4U1KB 1FSKB 3QULA 2A77H 1Y0LA 4UT9A 4ZAKC 5HHVH 3X14B 4X8JA 2JKWA 1PIGA 3SKMA 6CGTA 1BSIA 4FQ2H 1DJHA 5E9DA 5AG8A 3RNKA 4EZMA 3FJTA 4NSKB 2OYPA 1IC0A 2VDLB 1CFQA 1QLEL 2V9QA 2FWSA 2V5YA 3D30A 3TH2T 1M3IA 1OSYA 3PJLA 4LK4A 5TQ0H 2GIMA 3QEGL 4ELKA 4F7MA 4AYSA 1IM3B 3P9WB 5BZWA 1MRFL 2L7JA 1FZKA 4C57C 5I6KA 2IAAC 3NPYA 4PRDB 1QTPA 5KVGE 5HYFA 5EUOE 3V6ZA 4D0DA 3HBQA 1UD4A 3F7VB 4B97A 1CQYA 4MMYA 2VLKA 4WW1B 3C5ZC 4YR6B 2VO8A 4M62L 4FERA 4M02A 4XZUB 1DZ0A 4CL7A 3PQYA 5ICYA 1GYAA 4XNMA 5ERWA 1MOEA 4HUUA 1M1XB 2D31B 2BP0B 2QQNH 4XMXA 2FWOA 3GIVA 1ZLDA 5DD6B 1QA9A 3R8BB 3MRJB 3BHBB 1XSOA 1EZUA 4Q9BA 5EU4B 4DKFH 2FO4A 3CK0H 5IVXF 2VXTL 3WFHA 2VZVA 2HT3C 2P8PA 3NUKA 4FRWA 3QB7C 5D2NC 3GKZA 4G42A 5I66A 3NSFA 1ADQL 4MLSA 2PETA 4ISVA 5LUMA 3ROOA 2DYPA 2QGCA 2BVYA 4WWOA 2BSTA 4HPYH 4K94L 1MCNA 3K1DA 3WL9B 5KG9A 5JOPE 2QQLL 3KVPA 4PG9A 3N6YA 2BHZA 2EYSA 2HFTA 2COVD 3MQIA 4PJ5B 3U6RB 1QSFA 3L9RA 5JIKA 4ELMF 1XBRA 3F7QA 4P6SA 1ZS8B 4L3ED 2AI0L 5DD0L 4YZWA 1HH6B 4L29B 3D7PA 3NIFE 4J4PA 4DEUA 3ZN6A 3TZVC 5I24A 4AH2A 5JIDA 3FO2A 3D85D 3CCHA 2X38A 3MRNA 1JE6A 4JFZL 2FWLB 1OZUA 4HEPG 1JK8A 4YDJA 1ETJA 2IANA 4YJZL 4ZMQA 2H6PB 5I2IA 3UTSA 1Z9LA 2O72A 1AGEA 2ICEC 1BQLH 4LEXL 3L9EA 3TWCH 3RHWK 2Q76B 1QFUH 1XBDA 4OLZL 5AW0B 4X6CA 1I3RB 1KLFA 1BJ1J 1YQ2A 2HFFA 3VXSA 1JGDA 2BIQA 1JPSL 2RD0A 5KVDH 5KBMA 4NIYE 2VLRE 1TZIB 4ODVH 5C7XL 2ITCB 3SJVE 4OV5A 2BIIA 1I1CA 4LEOB 3F3HA 1FO0H 1OALA 3WLBA 4OCWH 3BJ91 4HIHB 3E0GA 3D0AA 4ZMWA 3SDDB 5D5MF 2W65B 5JZ7C 2H0EA 1E3ZA 1PKOA 5CCGE 3QUYB 4HWBH 3NJKA 3QWNA 4PJCE 3W81A 1BZOA 1JL8A 3PLYA 5BV7C 8CGTA 3WTXA 1EAQA 3FSOA 4KZCA 5B1CA 2VITA 5E5MA 4QHPA 2DN7A 5ESAA 3U25A 4HT1L 5SWSB 3T3PE 1B0GB 4N2AA 1INQA 5EN2A 4ZK8A 1CD9B 1FAIH 3VFMA 1HIML 4KJPD 5AZEH 4N8VA 4WY7L 4PGEA 3VGAC 4BZ2A 4U2YA 5IJDC 3LPWA 5IMMA 4HV8B 2XNAB 2FH6A 5J56B 1F6LL 1ET5A 2VDRL 5K9OA 5BNXD 3GZOA 2BY2A 5KUMA 1IGCH 3FT4B 5E70A 1JHKH 5FECB 1U8KB 1TCMA 1T0MB 5ISZE 1YEGL 2XICA 3O45A 4Y4FB 1WAEA 4PV1C 4NJ9L 4XMLH 5JDJA 1H9VA 4N20A 2AEQL 3TT1H 4AWJC 1IGML 4X8GA 2XG5A 3HPJB 4JE4B 3L2MA 4UU9A 1ZLWH 3E38A 2WXIA 3WIHH 3WS3B 4MWFB 4G7RB 4LARH 1TQTA 2CR3A 3PL6D 5DWUL 4KXZH 2NY7L 4BE5A 4NAJA 5K69A 2EE0A 3NT0A 4KDWA 3QS2A 4C47A 3U2JA 4JFYB 3S5ZA 5SWZD 4JO4L 1CLYL 5J6HB 3MRIA 1ACCA 5EEUA 43CAB 1KTCA 3ZKMD 2EDQA 4OGYH 4X7DC 1GGIL 4JPQA 1R5WA 3D85A 3PRZA 4KY1L 4A37A 1ORQB 4CADA 4TVPL 1IAII 5MERA 3FTVA 2YK1H 3VGHA 3GXMA 1CTMA 2NRDA 4LSVL 2CM6A 1JZGA 2ZMYA 4BYHA 4V1DB 5BQ7A 3RVVC 4YSQA 2FJGB 1L9MA 4PD4J 4PJ9C 3DBXB 3EFFB 5JXAL 2JCWA 4Y2LA 5C0CB 2PCPA 1AZBA 5HPOA 1BXAA 4Y4HB 4XZ4A 2P8LA 4XE5B 2AKRA 3F83A 3FTGA 4LNVA 3I6GA 4IBYA 1E9PA 2PXYD 5HD8D 5AENA 1UXSB 3UZEA 4P9HH 5HHXL 1WDAA 3DK0A 4XNXH 4BZ1L 5DEFA 3MJWA 3IGKA 3FU5A 3W5MA 3OPZL 1S5HA 4NOFA 3IPFA 4NZRH 5HTSA 2NY3B 1FJ1B 4G9FB 3D87B 1YNLH 4HWZA 4ODSL 2A9NL 4QMEA 3AY4A 1IVTA 2EACA 4IHOA 2PYEB 5DJYA 4DGVH 4BDVA 1QBLH 1GIGH 1KIQB 1MCOL 1FC1A 4XE0A 5CEZE 4DFHA 1O6SB 3LD8B 5DD0H 3HRZB 2BNQE 5ALBH 4LRIA 3NGBC 4MNQD 4F3FA 1F3JA 2UUDH 1AZRA 1GZQA 2X2UA 2B5IB 1CL7L 4HXBH 4N0CC 3QXWA 3HE6C 2B0SL 5F9JA 2ADYA 3X1FA 4A2EA 1EVTC 3GI8H 4Q9QL 1K3ZA 2XX0A 3NDZE 4B9GA 1TPXC 4JKPH 3INOA 5LDSA 4HUWA 2L7EA 5BO1L 4KJYA 1X6NA 5M95B 1QACA 3ZDZB 4PY7A 3HFMH 5INCB 1I9IH 1SLVA 3NIDE 2EDFA 3BGFB 5TGBB 5E51A 1D5MB 4C4KT 2MKLC 4HH9B 1QRNB 1JUFB 4FI8A 1FNFA 1CDUA 3QDAA 2VXQA 4FULA 5ALCL 3PL6A 3MN8A 1I85A 4JJOA 4XBPB 4AQOA 4JB9H 4P46D 1CG9B 3JTTA 4N1CA 2IXQB 1NPJA 5SWZA 1G7PB 3KPOB 4ALAC 4N0UB 4LCYA 5IFAH 1MKFA 2MQGA 3FCSA 3IWUA 5E2JA 1EXUA 2OJZL 3VDBA 2VKXA 2QTVA 4AQAA 5KSBB 4L4VE 1EEQA 1XCQA 5DS1A 4P2QE 1A14H 4YBLC 2DQGL 3OB0K 3QK0A 1NC4A 3RVXC 2O30A 2XPYA 3ZZSA 4P23B 1JVOA 1G9NL 1KJMB 4YX2L 2VIRB 2X4RB 1C7TA 5LB1A 2H32B 3VI4B 4X42A 5BXFB 5FW7A 3QO0A 3WXWL 3LH2H 1AGDA 1VFAA 3FTXA 1NKOA 3LVEA 3PJSB 3MBEC 3VH8B 3DVGA 3TT3H 2MIZA 2PXYA 2YKLH 2CJUL 2YAFA 4PJ6A 5EZIL 5F97E 2WXHA 5A2LH 4TSAH 4CVZA 4FJZA 4S1QL 3GDCA 4ZFFA 3K6SB 3GDBA 1DLFL 5E5UB 3FFCD 3HS0C 3QG7H 4MCZA 4ONGL 3RZCC 1ZVYA 3C8DA 3GRWL 1PLCA 1T1ZB 3H3KA 1BOGB 3APFA 2XZAL 4HP5A 1EFXB 1OF2A 4FQJL 2HRPL 3D12B 2A6IB 4L1SA 3SKJL 1R47A 5BUAA 2Z92A 1MFNA 4R6UA 2XV0A 3P4OB 3ATDA 3ILQC 3U7WH 4CRPA 4JPWH 3S4SA 1ES0B 1NWPA 3P9LB 4MNQA 5DHEA 4PCYA 4ETYA 3TBVB 2X2HA 2WQRA 2VLKE 1UM4L 1RHHB 4XTRD 1CGTA 5HDRA 4ONOA 4MCMA