3WJMB

Crystal structure of bombyx mori sp2/sp3 heterohexamer
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
668
structure length
668
Chain Sequence
EFKTTPVDAAFVEKQKKILSLFYNVNEISYEAEYYKVAQDFNIEASKDCYTNMKAYENFMMMYKVGFLPKNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQGMFLYAYYIAIIQRSDTASFVLPAPYEAYPQYFVNMEVKNKMDYVKMMDGCLDEKICYNYGIIKENEQFVMYANYSNSLTYPNNEDRIAYLTEDVGLNAYYYYFHSHLPFWWNSGKYGAFKERRGEIYFFFYQQLLARYYMERLTNGLGKIPEFSWYSPLRTGYLPPFNSFYYPFAQRSNDYELHTEKNYEEIRFLDIYEKTFFQYLQQGHFKAFDKKIDLHSSKAVNFVGNYWQTNADLFEEDFLQFYQRSYEVNARRVLGAAPKPFNQYTFIPSALDFYQTSARDPAFYQLYKRIVQYIIEFKQYQVPYTQEALHFVGLKISDVKVDKMVTFFDHFDFDAFNTVYFSKEELKSSPHGYKVRQPRLNHKPFTVTIDIKSDVATNAVVKMFLGPKYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKEDSLPMAEIYKLLDQGKIPTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKAVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGELFPYLFNIPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arylphorin
publication title Crystal structure of Bombyx mori arylphorins reveals a 3:3 heterohexamer with multiple papain cleavage sites
pubmed doi rcsb
molecule tags Oxygen transport
total genus 210
structure length 668
sequence length 668
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00372 Hemocyanin_M Hemocyanin, copper containing domain
B PF03722 Hemocyanin_N Hemocyanin, all-alpha domain
B PF03723 Hemocyanin_C Hemocyanin, ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1280.10 Mainly Alpha Orthogonal Bundle di-copper center containing domain from catechol oxidase Di-copper center containing domain from catechol oxidase 3wjmB02
2.60.40.1520 Mainly Beta Sandwich Immunoglobulin-like Hemocyanin, C-terminal domain 3wjmB03
5I3BA 4J6VA 3NQ5A 4OUAA 4Z0ZA 3HHSB 1NOLA 3WJMB 1OXYA 1HCYA 4J3PA 3AWSA 2AHKA 3W6QA 3WKYA 3NQ0A 3AWXA 4L37A 1LNLA 2ZMYA 1HC1A 3GWJA 4P6RA 5CE9A 3AWVA 1WXCA 2AHLA 3WJMA 4HD4A 1JS8A 4J3RA 3NM8A 5I38A 2ZMZA 1WX4A 4YZWA 4P6SA 2ZWDA 3HHSA 2Y9XA 2ZWFA 3W6WA 5I3AA 4J6UA 4Z0YA 4J6TA 2ZWGA 1WX5A 3NPYA 2ZWEA 4HD6A 3AWWA 4J3QA 2Y9WA 4D87A 1BT2A 1WX2A 4OUAB 1BUGA 4Z10A 3AWUA 1LLAA 3NTMA 3AWYA 1LL1A 3QJOA 3NQ1A 1BT3A 4HD7A 2ZMXA 3AWZA 3AWTA 3AX0A 1BT1A 4L37B 4P6TA 2P3XA
chains in the Genus database with same CATH superfamily
4G9DB 4AG4L 2DMBA 2DLFL 4QTHB 3H9SA 3NCEB 5B3NA 3WI9A 4XO4A 1INDL 1F00I 2CKBB 2VN5A 4N2FA 3ZIMA 3PDOB 1T83C 3NG5A 3HZ3A 3VXQB 1FSKB 5EEZA 3CFQA 1UHVA 5IB5B 2X4QB 2JKSA 1P2CB 3K2IA 3GXTA 4LASH 5CEZD 2VLLA 4XC3L 2Z65C 1ZA6B 4JGJA 43CAA 1NMCC 2JKWA 2ZD0A 5L8LB 3FAWA 5GGVL 5DHYB 3P0VH 5I5IA 2NXYB 1KELH 1FFNA 2X53A 1DJXA 1MCIA 2ZICA 4DFHA 5AQ0A 2OL3B 4PWGA 5F7DA 4AMKH 4AKQA 4LDEB 2CSPA 3VFGL 3HZMA 5IKCB 4N2MA 3RU8L 3T4YA 2HTLD 5C3LD 5HDQL 4PJHA 4TQ8A 2QHRL 2IF7A 3DSFH 3SGKA 2JCCE 2VKWA 3VI3F 3DX9B 5HHPA 1JHLL 4RFNB 3U6RB 1VACB 2F54A 2PW1A 2EABA 1G1KA 2VDPL 4H0HB 3IXTA 3X17A 2WHVA 1WC7A 4E2OA 4LCWA 3IFOB 4PJDE 4I48B 5DEFB 5ALCH 5D7SL 1WJ3A 1MSPA 1TCRA 2VQUA 4FDWA 4L8CA 2WXQA 4IIQC 4MZ3A 1I1YB 5DFVC 1JCKA 3GJFA 3NIDE 4YHIA 3JVFC 1N59B 2K0RA 2Q0ZX 3DURB 4G6AC 5E03A 3LZQA 4GAYB 3TJHC 4LLMA 1PL3A 1H0DA 3OKYA 5I1DA 1NIEA 2HX7A 5A7EA 3M1OA 3TLRA 3LIZH 2P5EE 3X11B 3CHQA 4XVUC 4RRPG 3LZFL 4X4MA 2V2XA 5L0QC 2EXTA 3ILPA 4KK8C 4LAJH 5FM4A 1S7UB 4QTFA 4PRPD 5G4MA 5AW6B 1TTGA 5MEOA 3BQUB 3LKSB 1E7VA 4X9YA 2VT0A 3VWKC 3MV7A 1M71A 5D7JB 4XNZC 5EIIB 1SMOA 5E4EB 4C4BA 3NQKA 3HR5A 3RWFA 3FQ4A 3W1ZA 4B9PA 4YC2C 1G7JB 1NLDL 2RH0A 4QRPE 4ZS7L 5G2NA 2J1ZA 5DTFB 1DFXA 4M56A 1EDHA 2G9KA 2NSXA 1A6VL 2VWEE 1R3JA 2ZWSA 4WO4D 2UV3A 1M1XB 2BXZA 3WY3A 5F7FA 1WFOA 3E9UA 4Y16B 4YHMH 5ICXA 3QIBB 4OUUB 2ICEB 5EPMB 3SJVB 4BKLA 1RUML 1A4CA 3KVDD 2F1EA 2FT8A 2JB6A 4XXCC 2R1YA 1XSOA 2AI0L 4MD0B 2VQ4A 5B7MA 4NKIL 1M7DB 4J6VA 2WBWB 2B39A 4YFLF 4L4TD 1OO2A 4K4KA 2NQDA 3CSYB 3H1ZA 2Z92A 1LEGA 3I74A 4G5AA 1K9TA 1NLBL 3UYPA 4EI5A 5K9KA 5TF1H 2B16A 3RILA 1KB9K 4HT1L 4BZ1A 3T6VA 4MXWH 4UZSA 5J6SA 4AJYV 1KB9J 2FNBA 3MVSA 7FABL 4B5EA 1WBXA 3PQYE 3LQAC 5INDB 4B9GA 3V5DB 2PYFB 1QRNA 5LQBH 1JWUA 1HAUA 4MS8D 5D96C 4DEPB 2BOBB 4N87A 2IDUA 4DKDC 1AGEA 1WHOA 1ZWIB 1TTBA 4G9FB 2AHLA 1FA4A 2QZQA 4JFQA 4YXHL 4RIRB 2IDQA 2YAPA 3ULVD 4DGYL 5D2NC 3V4PB 1L6ZA 5KBKA 3LNFA 1XF4B 5CR8A 1E9QA 3VDBA 3WNPA 3HPLA 2FIKA 4UBDD 4ZOEA 4JDTL 1MVYA 5C07A 4AC4A 3RNKA 1T0MB 4YSPA 4EI6B 1E4XL 4QD2E 1BEYL 1F3DH 1L4IA 1BVLA 1BD2B 1CD9B 2ZCHH 3FSAA 4M61A 4XCCH 1F86A 2P4AB 4Q8BA 1CK0H 2OX5A 1FNHA 3O6LH 3AU1A 2OW7A 4RFEA 2VLKB 1SDAB 5K39A 1EX0A 3NUKA 3QIUD 1HHKB 2E75C 3B9KC 4NHCH 4BGLA 5F70A 1G7MA 4OGYL 4BXSV 3D85B 4ANVA 1FE8L 5DXWA 1Q9OA 2D73A 5CFAA 5I28A 1BZ8A 3INOA 1JZHA 2BFGA 2GHWB 2E9GA 3BVVA 4AQAB 1RZJC 4M7LT 3P0YL 2AABH 1CDCA 3E6HA 1BQRA 2BHYA 4DN3H 5E2WL 5LN4A 4UOZA 3MUHL 4WWPA 2KI6A 4MDIA 4OVVA 1KPVB 4QWWD 4U6XA 3D3VE 4P4KB 1E5UI 1OPGL 4B7LA 2FX9H 4OAWA 2FL5A 1SLWA 5IVXA 3MXWH 4QRRD 5J6GB 3QWRD 1M7XA 3C5XA 4R7DA 5D6DC 2F74A 3DGGA 1YEEL 3KWWB 4RGND 5D1QD 5D72H 4H88L 3N44B 1WA1X 3L9YA 3AROA 3D2TA 4WQOA 1RK7A 2I27N 3UJIH 1E42A 2R59A 1ZV2A 2MCPL 3O9WC 4HWZA 5GHWL 1MJJA 4L1TA 1IBZA 1BZ9B 4M4PA 3VFMA 1HYRC 4EOWL 5AKVA 5CGMA 4MNHB 4P5MA 4N25A 5GS2H 5HVFB 2IG2L 2VCOA 2I9TB 2WMPB 4AH2A 3CCHA 3TPUA 4N24A 1CZ8L 5FWRA 1KZYA 1ZSDB 1ORSA 5IB3A 5FA3A 3GHBL 3M17B 4L8BB 2EZ0C 1MIEH 3RFRA 4E41E 4ABUA 2HN7A 4NC0B 1EHLL 1RJZB 4HKZA 1I9JH 3CPLA 5KSAC 2PYEE 1Y6NR 5T3XL 4PJIF 4R0LC 1UFGA 2HJFB 1TFPA 2CO6B 2EIBA 3FFCD 4X5RA 5DRZB 3GFUA 2BWIA 5JHAA 4TRPL 1HHJA 4JN1H 2R0KL 3VE0A 1Q72H 3RIKA 1WBYB 2VQTA 4HX1B 2NY5L 1PSKH 2H1LM 4MCMA 1BBDH 3GBMH 1RZGA 2QADB 4DEWA 2Z4TA 3PP4H 1UT1A 5C09D 3CV5A 4DH2A 1R24A 2IPUG 2OTUB 3AG4B 3H6AA 4PI2A 2MOQA 3BP4A 1XF3A 3HAEH 1Z9NA 3QAZC 5J4MA 1OOWA 1QSZA 1WIPA 3DX2A 3HI5L 5E5MA 3VXMA 3L5XH 3QDGA 2BVPB 4YX2L 1OEZW 1B0WA 3IJEB 2YZ1A 5EO1B 1K8IB 3QAQA 1CLZL 3RIAF 2P49B 3VXSD 4O9HL 2LHAA 4NUJA 3OJDA 5I8EA 4HUNB 4UQ2B 4Y7OC 3BCDA 1A7RL 2ADJA 4LHJB 1YECL 4LOFA 1FNGB 5B39G 1A3QA 4AEHH 1KZQA 4G8GE 1TCMA 3TBCA 5I3AA 2X2UA 5E56A 3TV3H 1S7XB 1MQKL 4OLXL 2X09A 1XMWA 1P7KB 5C97A 5GGSB 3TYGH 3QDME 3CBKB 4UT9H 3KPOB 3PL6B 5DQJB 1T6VN 1RHHA 1E2VA 3K2UL 3EOBA 4LBAA 4W9ZA 5DEGA 2WTOA 1CF1A 4WUUB 1ZEAH 4XI5C 3K6SA 4TNEA 2Q7AA 4G83A 3CK0L 4M43L 5E8DL 4N2DA 3GRWA 1YC7A 3HUJE 3MA9L 2W65A 3F7VB 4KKNA 2P5WA 3S96B 2GT9A 2JJUA 4Y19D 3SBRA 3AWYA 4O51A 5FK9B 4Z77B 1FVEA 2O93L 3CFKB 3E80A 2XN9E 4FXGB 4JFHE 3S88L 4L2YA 4QRSA 3KS0J 4XWOD 3JTTA 4CVZA 1QUNA 4JG9A 4PI0A 5HHXH 3U79A 2YA0A 2QKIA 2WQVA 2XZQH 1T04A 5C9JA 2HH0L 1WP6A 3QUXD 3C6LB 4B9JA 5TFSL 1JGLH 3LN5A 3JWOH 5FUZH 1HZLA 3B34A 4JN2B 4QRFA 2IBZX 3WG7B 1K4CB 3DI2B 1NBYA 1NFIA 2GEEA 2CBPA 1MI5B 3PV7A 3KPPA 2WYIA 3ZDXF 3ESMA 4YHYC 1TJGH 2Y36H 4F80A 2BNUA 1YCSA 4KO6A 1G7LA 1T4KB 1SBBA 2WKGA 1AD0B 2Y3NA 3T0DA 2Y6SD 1TU2A 1GIGH 5BZZA 4QHUA 2E6QA 1UT2A 2NDGA 3MRRB 3N1MC 1QWUA 5IB4B 5F89B 3WMQA 2OZ4L 3GRGA 4PJFB 4JB9L 5D5MB 2ED9A 1G7PA 4WJ5A 3GC3A 4HMDA 5CEYB 4NAJA 4D9QE 1HINH 1HKFA 5AW7B 2YSTA 2X2YA 3KGSA 1FAIH 3FZUD 4PTTA 4KKCC 4NO5A 4JFUA 3TOPA 1DQIA 4K71B 4WI8A 2WZ5A 5T5NG 2JI2A 2RFXB 2RB8A 2MIZA 4ODVL 4FMKA 4MMXB 5C0JB 3FT3B 3MREA 1WCBA 1UZ8B 1MCDA 3DMMA 4JG1H 4OIBA 3TVMC 3B2VL 1G43A 1UZ6F 4A68A 3L1EA 2CLVA 3FCTB 3I6KB 4KTDH 4YNYB 3V5KB 3DTDA 3GI8L 4BSWB 3VH8A 4YZWA 5F7EH 5IW6B 3MYJA 3VFVB 3AWFA 4O4YH 2YAQA 2GAZA 3EFFB 1HHGB 2LTQB 1PZAA 3LKRA 4IK7A 5FFOA 3SKNA 3BKCL 3WKQA 3TX4A 1A1NB 4X6CE 4F58H 3SE6A 2I5YH 4MD5A 3CZEA 2AXFB 1GTNA 4JHWL 2J3SA 3IWUA 3LRSB 4S1QL 1MG3C 3RB5A 4WW2A 1G4RA 1HTYA 3WLBB 4J4PD 3X3FH 4PRIB 4M7LH 4F57L 1L7TL 1NCCH 1XGYL 3WIHA 1D5ZA 2ZAGA 4HHAA 4X9BA 3GXDA 4J8RA 1LO0H 4WK2B 2PP7A 1IAOA 2NDFA 1TJXA 4PJ5D 4PJXA 3TTYA 5A3ID 3OKKB 5LBVA 4JCMA 1BIHA 3K2MC 5EF0A 1CURA 4G42B 2NX5D 3BSZH 4G8EA 1E5YA 1XR9A 3WELA 1O7SA 2BZDA 1C5DA 3UC0H 4KJWC 1F6AB 3CC5B 1ZLUK 3QQNA 2DYPA 3ET9F 3CN0A 3GMNB 4YDJB 4PJ9A 2YARA 1WAAE 4JPIB 1UM6H 1JWMA 3FTGA 4UUJB 4WHDA 4NZTL 1HKLH 4G6KH 3MFFB 4TVPH 2XBTA 2GI7A 1U91A 4K7PY 3RY4A 2Z4QB 2XVKA 4W4OA 1FYTA 2K4AA 1JGDB 5BOJA 1J0JA 1XMEB 1YEGH 5C6TL 1NMAH 1J5DA 5AB1A 1M57B 3H8NA 3RWGB 4H26A 5ACMA 5AWNH 3V4UH 4PJ8D 5ID1A 1HQ4B 1AZZC 4JFZL 1BAGA 4PHXA 1PYWA 3BRDA 4Y4HA 1ESOA 3LRKA 4FN0A 5DK3A 3DYPA 4BIKA 4WCYH 3ARBA 5FKPA 2C3GA 1NGQL 5C0RL 2YBRB 1LD9B 2ZWZA 4XP1L 3KYMB 5CGYD 2MKLC 1ZVSB 1BP3B 3WV0A 3T08A 2V37A 4GYBA 1JF1B 2DQEH 3RWDB 1K8DB 5FGSA 2D3JA 3F84A 3B9EA 3KHQA 4UQIM 5FHAL 3TIDB 5FPIA 3WTWA 3L3GA 3T4AA 2DJSA 2ODHA 3ECUA 5J9PA 2AK4E 2G5RA 4XAWL 4A7SA 3L1OH 1OL0A 2HG5B 2Y1ZA 2CHXA 3NRFA 4ZD3L 4RMBA 1BWMA 3T0AA 4FJZA 1J0HA 1OAKL 4P2CG 4RZKA 3PHOA 5ESVB 5I6NA 2HT3D 5D71L 5FGRA 2QSCL 4Z6AT 1JD7A 1YEDB 1SVBA 3ZYOA 4TV3A 1RZKC 2Y7SA 4L3FA 2ICWJ 3NZUA 3U6XA 1T66C 3NESA 4NN7B 3S3CB 3LEVH 1TSRA 5EBLA 4XCNB 1R3HB 2DQIH 2HKFH 3GZQA 4QXWA 4Y2NA 1A4AA 1TEGA 3UTSA 3EFDH 2GJ6E 1KGCD 3NACL 1S7VB 3PFUA 2FH8A 4L3EB 4I3SH 4D9LH 2CPUA 3VG0H 1SDDA 2X70A 1I3UA 3W39B 2Y9WA 3MA7B 3B5GA 4KMTL 4Q58C 3RNQA 1GGIH 4ZYKA 3CXFA 4JZJA 4FKKA 1PVHA 1AGCB 3V6ZB 2NXZB 4JY6B 3IRCA 4I9WD 5E1AA 3II1A 1QTPA 3DI3B 4PB9L 4X80H 3FHEA 5DDHB 3V52H 2UX6A 3HN5A 3L5WB 4K9EL 4NZUH 1DVTA 4K8RH 5L2JA 4RAVA 1TJHL 3P30L 3MLWL 4OCXH 1ZVNA 3TZVC 1L5GB 3GZPA 2HVBA 1DP0A 3MMEA 2X2JA 4HOMA 5D7IA 4PMEA 5AAPA 3AX0A 3KPQA 4FQLL 5B1CA 4CC4A 1HH9B 1YDPA 3VD4A 3F7QA 1M7UA 1KJVB 2VERA 1A4KA 4JM4L 5FR3A 1SJXA 4U31A 2VSKB 1GCFA 4F20A 1RK1A 2NXYD 4ZX5A 3OGOE 4BCZA 4XVJH 3U30C 4HCGA 4G7SB 4ZW8A 3LD8C 4NJ9L 5JHDA 3QH3B 3WHXA 1Z2KA 3HG3A 4GIPD 2X4RB 5KOVC 5FLUA 4UAOB 3RA7L 5JPMA 4ALAC 3VX1A 4I5BA 4BQBA 2FO4A 1T22B 1YNTB 3J7HA 4M29A 2BRRH 1EZSA 5IMMA 2AGJH 4UILL 5CJ5A 4OGXL 2H47C 1DQDL 4U6YA 3UAJD 2WVVA 2YEZA 4FNSA 3FF7A 4Z7UA 3N41B 4OM0L 2L4OA 5JHMA 2DW5A 5DUBB 4YHOL 5DURB 1FZOB 3QZWB 5LXGH 3BGFB 3H6JA 3AWVA 4IEFA 4TTDD 5CZVL 4FTVD 1LO5A 2ZYHA 4J3OD 5E1QA 3HZYB 3TS8A 3QO0B 4BK5A 4AZ8B 4JO3L 3BFQG 4KJQC 4E9TA 3C6SB 4H1LB 1F5WA 4P5KB 5ICUA 5EBMA 3BUYB 4KRMB 3ATFA 5LO7A 3KYNA 5KYXA 4NWUL 5IV2A 2XFXB 4HHGA 1LEKB 1YEKH 3FSWA 4JW3A 4BFJA 3BQUD 1MNUH 3D0VA 2IQ9L 3B5HA 1TZOA 3ARTA 3L7FB 2BJML 3FT1A 3PHQA 1CDUA 4XMTA 5HDLA 4GRLA 5FIEA 3UO1H 3FTVA 2Q76A 1HS6A 1RIUH 3SD5A 5T33L 3KMDA 3GSRB 3C2AL 5KSUA 2WP3O 3DGCR 3RZCB 5J6HB 1PIFA 4WI3A 3KPMA 1JXFA 4Y16D 1FGVH 3OB0H 4TQEL 3VXUB 1X4YA 3OKDA 2X6BA 4N28A 3SJVD 3MJ6A 4PJAA 4PV9A 4AJWA 3SKJH 4JDEB 2L0DA 3EO9H 1EO8L 3ZHNA 3AREA 2C3WA 2HRPH 3DV6A 3F01A 4HS8H 4KI5F 4XMPH 4M03A 5HJDA 3RWHA 2G5UA 1OB0A 4B9YA 4WSGA 1JFQH 1KB5L 3AWUA 3FH8A 3RWEA 1KJMA 4ZO9A 5G4OA 5JUEL 3OLDA 3FFOA 2WVUA 1F4WL 2AJYL 1LP9E 1TIUA 1JPGB 1RK0B 4JO5A 4NNPL 1F3DJ 1SY6H 3TNNA 3CSBA 3QQ3B 2R69L 2NPLX 3BN9C 2I7SA 1KCUL 4AL8L 4MJ5A 4D8OA 2ENPA 3OBAA 1UXWA 2CALA 3ZX1A 4AT6B 2AJVH 1DJWA 1WT5C 1KCLA 1TVBB 2LFGA 4G9FD 4GKZB 1UUSA 4ODXB 5JR1L 1HHIB 3IJYA 2IH3B 4FZ8H 3VU2A 4IIQB 1U8KB 1GGUA 1DBMH 1JNHA 2H32H 3R1GL 4LOUC 5DVOA 3ESPA 5KVGE 4R5VA 4AIZB 4IKLA 3C5ZC 4JPWL 4UI2A 2ZNXA 1BD2D 2GCYA 4F24A 1MCOL 4K73A 4NQEB 4LESA 1JRHL 1XTLA 3MRCA 4MKMA 1X5MA 4N8CH 3GSOA 5TK4A 1NSNH 5BW7C 4WFFE 1MCBA 2DYRB 4GKSA 5CBAB 3OAUL 5IHUH 3T6ZA 3TNMB 3T8XB 5LN8A 2VLKD 1A22B 4XPHL 3M88A 3MTRA 3VWKB 1MRDH 4YDLB 1M9SA 1WZAA 3QR0A 1ACYL 2ZCKL 4LLQA 4KKRA 2G2NA 4MZRA 1GPOL 1YUHA 3NM8A 3GM8A 2XETA 4YC2B 1D6EA 3LEYH 5ITFA 5EU5A 1CD8A 4JVUA 2I60H 4FXKC 2DRUA 2VXUH 2MKWA 3EBIA 5F1IB 4BH8B 3CZGA 3EYUL 4G8AC 5E7BA 1T80A 2WLLA 2O61A 5FS5A 1S6NA 3ZMEA 4KKZA 4P99A 1NKOA 3AT9A 1RUKH 3GO1L 4TL4A 1U8LA 5IWLC 5J1AB 4H7VA 4QEGA 2NUPB 4P4KD 3X1GA 2R51A 5FO7A 3SE9L 4AYFB 3TH4T 4N0UB 1N9PA 2NYYC 1NDGA 3FOLB 4F7MA 3TIEB 2JQZA 1DJSA 1HSAB 4E68A 1OP4A 1C16A 3I9PA 5HHVL 2ZX6A 3QS3A 3G3LA 3QZMA 5FYJD 5CD3B 3P0GB 4K7FB 1X9UA 2J6EH 4OTXH 2H9GB 1RURL 4PVBA 4ADJA 4HS6B 4NYLA 4F3FB 5A2KH 1WFJA 4X50A 2B59A 5CP3H 4BXVA 2X10A 5JHLL 5JW3L 4JE4B 4DP1X 1GJWA 3ZE2B 5SWSA 1E6OL 1C12B 2Q3AA 3TP4A 1TQTA 2YAHA 3KYOB 3TONA 4X5XA 5JIKA 4XBEH 3GRBA 4KV5E 3WIFA 4M3KB 1YMME 5HGBB 2NR6A 5GS1A 4L05A 5GS0L 5BVJB 4DK5A 5A2AA 1IV8A 4P49A 1D5MB 3O3DB 5IM7B 5D1ZA 3HS8A 1FORL 2K9FB 2LE9A 1T5WA 5HI3C 3P2DA 1SYSA 4OF6A 2BIOA 5JIQA 1AS8A 4MQ7A 2X4NA 3HHSB 4AYMC 2JKTM 2VLMD 1K72A 4MMYA 4K0OA 3V0IA 5CF3A 2VZOA 5EOCJ 5IB1A 5L4JA 3EXJA 4JNXA 2WQ8A 1BSIA 3ZT7A 2QADD 4LASL 4PLJD 1HCYA 5DVNA 3QJVB 2O6FA 3RIFF 4QY8A 4FXLA 4MJIE 3TYFB 5I73B 4H8UA 3P0VL 4GRMB 1KELL 1YQVL 3L3KA 3HAEA 2QLYA 3B9KB 3QQ4B 1M56B 4D0DA 4YFEA 3OJMB 1TTAA 3RVWD 2NNAA 5KSBB 3IFNH 1LVEA 1GZPA 4AMKL 4J2XA 3GWJA 2E7DA 1ADWA 3F04A 1YNTF 3MJWA 2F8OA 2YJQA 3D05A 3DSFL 4ELMA 1FFRA 4LOVA 4PD4K 2BSDA 3BJ91 4JLRB 4JR9H 1XIWA 4GI9A 4AE0A 3SDXB 2BVOA 2GB2A 3CFIC 3N41F 1MW0A 2OS7A 4GQPH 4Y4KC 1BOYA 4PD4J 3WNMA 3MGOB 1HIML 1JHTA 1N8ZB 1U42A 1E3ZA 4QXVA 4XZUA 4TUKH 3U7WL 2P26A 1K3IA 3EO0A 3JV6B 3QQDB 2DQFA 2N59A 2F0CA 1AFVH 4LLUB 1G7IA 4OV6F 2FO8A 4U3XA 3W0WE 5FKAA 1UKSA 3U46B 5L2KB 3PL6D 2AVGA 1T3FB 1L0XA 2VDPB 3CXDL 3ILQC 5JXEC 3B2UD 2RGSA 4WUUD 1U0QA 5E1IA 1SJEB 2Y2WA 1P5UB 4PLOB 5T1MB 2FZ3A 4IOFD 1ILUA 4Q2ZA 2WUCH 5FW6A 2ITDB 3RGVB 5J5EA 2EKJA 3KJ4C 5IUCA 2PXYA 1DVSA 5CP7B 4IRSD 1MPAH 3I3BA 2OXGA 3SCMC 2W9DL 4XTRD 1KLUA 2GTZB 4XCYA 2I07B 4WI9A 1SXZA 2B15A 2A99A 4Q6IB 5HHOA 3C6LD 1AGDB 5AVUB 4N8VB 1OP3H 4GI8A 4I0PD 1OE2A 1BAFH 1URZA 4NO3B 4R0LB 3SQBB 1XL6A 1MI5D 2Z8RA 1FCCA 2D8KA 1KXVA 5DQ9B 3OV6A 4JFXB 4YHML 1RU9L 4AYBA 3MBWA 5IROA 5TDNB 3LPWA 3TH2T 4AZUA 3AWGA 4HOXA 5HP5A 4J3OG 2VXQH 3OZKA 4JRFA 2WXRA 2J43A 1CDBA 4TUUA 3BVNA 3D33A 2FWLB 5HYEA 1E4XI 2VW6A 4PY8I 4B50A 1TVHA 4Z7WB 4OQTH 2EYTB 2H8PB 1CIDA 1MFEH 1VEMA 3IE9A 5CBEA 1JZ4A 4AM0B 2XYBA 4CDHA 1JTPA 5EIVA 1OD7A 5IK3A 1MCCA 5TF1L 1UWXH 3MX0B 2XT1B 3FCUB 2ZOKB 4ATWA 5D93C 3EKCA 2YD4A 2CR0A 2GYSA 3JYCA 2R1WA 4MXWL 5L6YH 2IGFH 3BJLA 4JE0A 4A2DA 1ZLSH 3ZKSD 1X5ZA 4FCAA 4XNDA 3KM1A 5LQBL 5DRWA 1UXLA 5HYJB 3FTWA 3KW7A 4BFIB 5BS0B 2J25A 1AG6A 4ACTA 3V0JA 1ZT4B 4F2ME 5T1KA 4NQSB 3F58H 4JJOA 5EUOA 1SJVA 3EJPA 4OZFH 3RI5K 2P42B 5MP6H 2E86A 1WXCA 2X9YA 3CSFA 3EDDA 5DD1H 2HT2D 4DKEH 4POYA 2A5UA 1S9VA 4LMQI 3S5LG 4Z7IA 3X12A 2GI0A 1HCFX 2R1XA 2BVEA 4A2MA 3HNVL 3CHXA 3U1SH 3U9PL 4P3CL 1KBVA 2ZCHL 2AEQH 1JI1A 5E6IB 1IGJA 4U1KA 2D9CA 2C3VA 4HIHB 3CVCA 4KI5D 1AQDA 1XFPA 2H3KA 4F92B 2HVKB 3O6LL 1LO4L 2FSEA 4R96A 2IH8A 4LCCB 4JGUA 1GY1A 4Y9EA 5JW5B 4PRID 4YBLB 3VSVA 4X4ZA 2QGCA 4N0CD 1WV7T 3ES6A 4JFEE 5LGYA 2Y4SA 1RIHH 3EZJB 2OMVA 4HH8A 1BA9A 4QOKB 2A9NH 4GSQA 4G43A 4W6WB 4P2OC 3WFCH 2LAAA 1Z7JA 3K8MA 2KDGA 2VAJA 3BSZA 3QI9C 1Z9SA 1AIFA 4X6BA 5F1OB 4D9RE 4ZNCD 4JHAH 1QLFA 2F8IA 1UXSB 1TKWB 1KXQE 2VN3A 4HU2A 2CBQA 4J3TA 4PJCE 4Z0XB 4DN3L 2Z7UA 4UTBL 3L2MA 4PAZA 3TESA 3L16A 3PWPA 4YSOA 3B9DA 1HFUA 3T0EB 2FX9L 3A22A 4MHHI 4EDWH 3KDPB 3MXWL 4HH9A 2B1AH 4K3EH 1BVKA 1F6FB 2V0AA 3QORA 2IFFH 4X7EC 3SGDH 1L9SA 4YSRA 1ZGLM 1NEPA 5C08A 3QFJA 5EU6B 5D72L 1OPOA 1QHPA 1VDGA 3EGDB 1NCNA 3L3JA 3SDDD 4XBGB 1SJMA 3FXIC 4Z7NB 3UJIL 4ZQKA 4EXPX 3AWTA 5IB2A 4F27A 5JA9A 3ZE2F 4EPSA 2MTAA 3EDJA 4RBPH 3WTUA 4XE5B 4MXVF 3JYBA 4F7EA 1G6RB 5I8KL 3HG4A 2BSTA 2ICES 1CN4A 4IGBD 4JQXC 1PFOA 2Y0SA 3QYCA 5C0IA 3SDAA 4CMHC 2BP8A 3F05A 2Y7MA 1EA9C 1ECZA 1MIEL 2JSFA 1H6TA 2XTJE 2JLPA 2R4RL 1U8PA 1P6AB 2Y2YA 1AIZA 4PLKC 1NM9A 4AX3A 3FB5A 1C7SA 2DQJH 2IGTA 4WV1A 3BYTA 4ZPTA 1CFVH 4E9RA 4PN6A 2VUKA 5SX5K 1HEJC 4W9HC 4HJ0D 4JN1L 5I6OA 2OMYA 5I30H 1Q72L 2BINA 2F54E 3NRPA 2JKXA 2VXVL 4ZUTB 2IAAC 1EJOH 1FL3A 4CA4A 3DETD 5HI5D 1X6NA 4K23H 5I1CH 4A2LA 4AUYA 4LCWE 3K4DA 3QG7H 2COQA 5DK2A 1BBDL 4AMWA 2QR0A 3GBML 3L7EB 3QP3A 3PP4L 1PNDA 3WFBH 4M6OH 5GZND 2YKLH 1E27B 3NFPB 3CZSA 1DLHB 3C60C 2V5TA 4ZSOA 5DA0B 3L13A 5GRUH 1GMIA 4F9LC 1EAPB 4P57A 3L5XL 1JYXA 4IKKA 4X4ME 1E9OB 4MSWA 2J8UB 5CEXB 4L3ED 1B0RA 4ISVB 1DDHB 2ZX8A 4KQ0A 2ZXAA 4MRCA 3VAEA 2HFEB 1TNMA 3GTTA 5IQ9A 3M7FB 3MV7E 4M9PA 2VN6A 3LSOB 3K72A 4AEHL 2J5WA 3BXNA 3WNLA 2VISA 3O6FA 3GB7A 1T5KA 2VDQH 4MJHA 4TVUA 3TV3L 4A7GA 5J57B 3NIFB 3ASOB 3DPBB 3PWUA 4O2CA 1J5IA 1Z1WA 4FHBD 1I1AB 2X7LB 1WCQA 4UM9A 3NIGB 2AEIT 2HA1A 5IT2H 1GYAA 2OMTB 4YHZH 1ZANL 5FLVA 4RETB 1W0WA 1UVQA 1NPUA 5KSVB 1IAKA 1ZEAL 1MZZA 4JFDD 2P24A 3RX7A 2ZXCA 1TQWA 3I9GH 3BPCA 3UADA 4DP9X 1HK6A 3N0AA 1IAMA 4G1EB 4LIQE 2R56H 4I77H 2GEQA 1MREH 3PHAA 4D94A 4L4VA 1BPLB 1DEDA 3MRHA 1AYOA 3BAXA 3ZTJG 2YGQA 4F91B 4UNUA 3I9AA 1MRFH 1F42A 1L9TA 2F53A 2OMNA 4R6UA 2XZQL 4Q7DA 3WDHA 3AXLA 3ZN6A 4X9HA 3CGTA 4FI6A 3HS0A 2EDBA 1JGLL 2QPFA 2RA1A 2WIMA 3L45A 4Z78A 5I71C 3BH9B 3L4YA 2F15A 4NKMB 3K74B 1NFKA 1QBLH 2EDRA 1YN7B 2XVGA 3CVHH 3JBG7 1UOKA 1MNNA 5D2LA 3W9DA 1QRNE 1TJGL 2Y36L 3AQXA 1ID2A 3DX8A 5DURD 5IVZA 2HFFA 3WJJA 3QYNA 2NTFB 2CG9X 1FV1B 3WEMA 4BWWA 2BNRB 2LABA 2LVCA 3IRZA 3MUJA 1GIGL 4Q89A 4Z7WF 5J89A 1BYNA 3BMWA 2CIKB 4PM1A 2KT6A 3NDYE 2ZOWA 3MV9B 3OB0K 2VZ1A 3UYRH 3DX7A 3UYOD 3RUGA 4D7BA 3ZL4H 2YPLB 2LR4A 5AENA 1HU8A 2A83A 3OHXC 1E5ZA 4PBDA 4WHYG 1HINL 3TT3L 4ZRGA 3PV6A 4S0TD 4YSAA 4NXKA 4O5LH 4JGMA 4NHUA 2ATPB 1O6SA 5EU7E 4RSYA 4Y9GA 1A4JA 3DTXB 4APXA 3BD4A 3MODH 3QWQB 4MMZA 3VQ1C 4NRXB 2NY0C 3W56A 3FU7A 2EC9T 3U0PB 3BWUC 4CSTA 1CFSA 4JG1L 2NY4B 4HZLB 3TBYB 1FNEB 5ENWB 3RZCD 1R3IL 1RZIA 4XPFH 4KTDL 1ASPA 4YPJA 2Q7YB 3VXUD 5C0BA 3VFPB 1TQCB 1AP2A 3A4DA 4YDZA 1QX1A 2IVFC 2OULB 4O4YL 1KTJA 3QYMA 4KKPA 4KXZH 4G5ZH 3R7QA 1A3RH 2NY1C 2WGNB 3ZGIA 2I5YL 2UXVA 3F2LA 1NBVH 4GW1B 1A6TB 1LK3L 2ZOLB 1XF5B 4LQ1A 5JQHC 4GO9A 2CPCA 3U30B 1JD9A 2HPTA 4N9GB 4ZW3A 2CO3A 2EDDA 3QDAA 3VWJB 3IDUA 4ZZKA 5JPNC 3JQOB 4JO1H 4KXBA 3OG4B 3DRTA 4KI1A 1LO0L 2X6AA 1WGVA 4RRPA 1NOFA 5AKTA 4LGSB 1VRSA 2R4SH 3BAEH 5ITBH 3T2LA 3IMSA 4Z10A 1ASOA 4CU7A 4KNSA 4LCVA 3O81A 4XNAA 4E9SA 4LK4A 3UC0L 2DLTA 3AB0B 1R75A 3VSTA 2EIJB 3N06B 4HGWB 4XNQA 1WBZB 1PZ3A 5EBWA 3S3DB 4DZBB 5K1JA 3NGBB 1LM8V 2XQYG 1KTKE 3LXCA 2BC4B 3QCVH 4G8IB 4G6KL 1A6UH 3FYIB 4LSUL 2DIEA 4UU9B 5FYKD 4PWIA 5GGUA 3SPCA 3B2DC 4NQED 3VM7A 2AQSA 5B4MD 1S3RA 4X6EB 4Z7NF 3D39A 3T9WA 1JZ6A 2XIBA 4XO8A 4HEPA 2X4OB 2A6IB 4L0ZA 4BSVB 4POUB 5KWYC 1O7DE 1YEGL 1UWGH 5SX4I 5D4JA 4N0FA 1NMAL 3WTVA 2DIAA 3K91A 4PYHA 2H0EA 5E9AA 4KTGA 5HPMB 4GUCA 4IRJA 5DD6B 5EORH 1N64L 4KNTA 5CWSA 5AWNL 2D31A 3HC3H 4S10A 1BZDA 1W72A 3QJFB 3W6QA 4OLZH 4HIXH 1PZ2A 3V4UL 5A2CA 3BEVA 2A0LC 5LBSH 4FG0A 4ODSH 3G6JA 4L18A 4OH2A 1I7TA 1KCRH 4WCYL 4KO7A 4NT6A 3TJEH 3VXME 3C09C 3QDGE 4TUOB 3L4WA 4Z3HA 2Q10A 4PJGF 1NOAA 4H8WH 3SKMB 2DQEL 1VCAA 2JCCB 1D9KB 3ML8A 1MWAL 2YQ2A 3H9HA 4UT6H 3EJYD 4NWTH 5TD4A 4U1HA 4FP8L 5CS7A 1XH3A 3PAUA 2A1WH 4LSQH 3L1OL 4N26A 2K6WA 1KSRA 3UZQA 2DWDA 4WEEA 4N5ED 2DLHA 3WYRA 3DIDA 2F8VA 5GSRA 2EXYC 4PJDB 5DMJB 3F8UB 3GD1C 1MCWW 2Z93B 2I25N 3T5WA 4NX0A 1JV5A 3TEUA 4AUUA 4XN4A 3NIDB 3LEVL 2ZUQC 1KFGA 5CP3A 2DQIL 1Q90A 4FX5A 3ROLB 4QTIL 3DSNA 3EGSB 2ZWFA 2P5WE 2OJEB 2P5EB 3EFDL 5DMGC 5BZXA 4D9LL 2XV2A 4I3SL 3VG0L 1J05A 3RWJA 4X6FB 2YMOA 3GSVA 2CXGA 4OI8A 5E2VH 1VENA 3FQWA 1IBBA 3A6CH 3SIKA 2X4TB 2NUTA 4KUZL 4ZK8A 1J1XH 4LHQB 1IM9D 5C0AD 1BF2A 2E7MA 1GGIL 1OAQH 2J12B 4X0NA 2F1BA 3RFZC 4KX8A 3ARXA 1RZQA 4JANA 4QT5B 1XGRB 4OD1H 1TJIL 3WJLA 5ACZA 1MCPL 3NIGF 5ISZE 4X80L 4F37K 5MEPA 4FXTA 4QRPB 4NZUL 3C5ZB 1ZTXE 3ARFD 1MLBB 3POHA 3BIKA 3LXUX 1MHHA 4R90H 1H6EA 4KC3B 3CFUA 4TPRH 4KU1A 1C8PA 3GEWB 4N85A 3NSDA 5KJ4A 3SY0A 4FFVC 5IEKB 3DHJA 1VSCA 1J9RA 5H35A 1SXNA 2IAMA 3MROB 1ACXA 2NZ1A 4GQ9H 2J1YA 3V9EA 3L3OB 3MCG1 2F5AH 5AZEL 2M26A 5EWIL 2RJMA 3EYQC 3BDBA 5I74C 1A8JH 4XP5L 3FRPB 4K3DH 3UXFA 2BRRL 2AGJL 2XRAH 2YD1A 2ROYA 1NBZA 1NDMA 3FJTA 2VL4A 4P46A 2MQCA 5T5FH 4J3PA 3TCTA 2VJ8A 1QZNA 2OK0L 1MDTA 2BS9A 2BHZA 4EUPG 3PQYB 4Q0XL 1HQRA 2XG5B 4BHUA 2BOCA 3L3IB 4M7ZB 4YFDB 3EJTA 2LU4A 4BFEA 4N2BA 4Z0BL 1OARH 5LXGL 3KJ6H 5ANME 3QXAB 1AMYA 2CBOA 2P46B 5GGQL 5C3IA 5GZOA 3RWIA 5L2KD 5JOFB 4HVBA 2QVMA 2EDXA 5FGBC 4LPWA 1XCQB 3BC9A 3MJ7A 3U0TA 1NICA 1ETZB 4IHOA 1JXJA 5KBPA 1WDAA 4BDVB 4Y4FB 3LN4A 2D7TH 1P5VA 1OOAA 2BFVH 4PIRF 3RGVD 2BS71 4QHLB 1J48A 5AALA 4P04A 1YEKL 1XCWA 1MNUL 4KX9A 4NM4H 2B5IB 1MUJB 4OZHA 3T8VA 2GC7C 2NY2C 5ICZA 4XBPA 5C71A 4KZDL 1UWXK 3KLLA 2CU9A 1L9RA 1J7VR 1MH5A 3UO1L 4C56E 1RIUL 4NCC2 1SN5A 2CJSA 2I9LB 3D18A 5E7FA 1AR1C 4ZI8A 4NQCA 3VFWA 3FB6A 1KIQB 4KXAA 5FFGA 3SDCC 4YO0A 4F8NA 3L4ZA 4ZXBA 1SXBA 3ZPDA 2KBGA 4PJXE 4ZO7A 1FGVL 3FONA 5JIDA 2X1XR 2FJHA 3PWLA 1UA6H 5HI4C 5F3BB 1PX4A 2VXQA 1U8MB 4F2FA 1NCJA 3EO9L 5B39A 1J8HA 4UZUA 4HS8L 4XMPL 2HRPL 1NC2D 2AXHA 4H1LG 4LKCB 5GJTH 1JRHI 3W11C 2ZJSH 1JFQL 5CR1A 2CKBH 3K0YA 3V0AC 1M6OA 2YR3A 3CZLA 4JG0H 2IOMA 5IOPA 1D7CA 1H5BA 4U49A 4LU5L 3OAWA 1SY6L 4E9XA 3PP3H 4XB8A 5EOTB 3OGCA 4IOIA 1CDGA 1Y0LB 2XWXA 4Y8DC 2EUZA 4GRWE 3PHSA 3T3MF 1KB5B 4JFOB 5BRZE 1HYSC 4Z5RB 5GPRA 5E5RB 4KO5A 1S7RA 2OKMA 2AJVL 4GI6A 2OL3H 1JZDC 2WKLA 4JM2B 4P4RA 1J0KA 4M3JA 4QRQA 3P4LA 1EUUA 1SEBA 4GAJH 4CRPA 4HWBH 4FZ8L 2EO1A 4FG6D 4POZC 4JKPH 3HG2A 4NPKA 3THML 1IO4C 3HBGA 4E41B 4TULH 1B0GA 5KVDH 3AWSA 2YIHA 2PYEB 4X5QA 4PGEA 4XMKL 3TCLA 1ND0A 4XWGH 5E6ID 3WCYA 2XPGA 3ARWA 1J5HA 3HZKA 1W6LA 1LNLA 5LGHL 4N8CL 3FUHA 2UVFA 4W93A 3KEHA 1B0IA 1TJMA 3NFNA 3QA3B 4IBSA 3QUZB 3P40A 5EU4A 2Q8AH 4AENB 5IHUL 3ZHLA 5TE7L 3GSNL 2ZAHA 3I75A 4JS7A 4MA8L 1KNOB 5F1SA 4XZ4A 3ISYA 1I4FB 3MLTB 4FHJA 2YEVB 4KK9D 5LVEA 1MEXL 2V3EA 4KTEH 3LEYL 3MRIB 2LGNA 4QOKD 4PRPA 4L4JA 5E2TL 1KLFA 2VXUL 3MRKB 4OKVB 4XRCB 3EBAA 3UTSE 4FQIL 1XAKA 4HPHA 3CIAA 3C9NB 5I1GH 2VE6A 1OANA 2JCCF 4MYPA 1E4KC 4ABWA 3EBGA 4Y5XA 3TT1H 4HULB 4N6RB 5E1GA 2ICWI 2FAUA 2EYSB 2F19H 1ZLVK 3FUMA 3T0ED 4G8GB 5I1EH 8PAZA 3ELAT 3H3PH 3P4NB 4NQQA 3REVA 4M02A 5EU6D 2L7QA 4E36A 5C1MB 4Q56A 1LWRA 1OAYL 3QDMB 4MFHA 4R4FL 2ZWEA 1CMOA 1AQKH 2J6EL 1PG7W 1NUFA 5E00B 3ZKQD 3WE6B 2Z8WC 4XAKD 3KAAA 1KTLA 5FOBB 5I82A 4R97C 4KK5C 4L4TA 1T1YB 1T1WA 3HCVA 3HFFA 4PCSA 3V0VA 3HUJB 5FA4B 4APQC 4J3UA 4HSQA 4XNYL 3CBRA 1AQHA 5C0DA 1ZMYA 2APTA 4KHTL 4XBEL 4OJFH 3BEWB 1DZ0A 3L2NA 1YJDC 4JDZB 1H8OA 2XN9B 1S78D 3UABA 2XSKA 3ZSSA 4E0RA 2A3TA 4JMXA 3HB3B 2XPZA 2XTSA 3UTPE 1BECA 4HJSA 4LLYA 1HDMB 3VI3E 1TZHB 1JL8A 4IMLB 5CIPA 1W16A 4LCUA 4U1JB 4UIMB 2ATAA 3IXAB 2EDWA 3QULB 2JKIS 2BVYA 4FNLL 4G7VL 5IOKA 2MWCA 2K9UA 4F7PB 2ZSVB 5K69A 3UTZB 2NYKA 3ZRSA 1K5NA 3M46A 3MJ9A 2XLLA 4AQ1C 2Y5TB 3HBPA 3CIQA 2FJGA 2XNAA 2MJWA 2ICWB 2WXOA 3QXWA 3WMSA 3RY5A 1FH2A 1IEAB 4ZUVB 5BZWB 3KBEA 1E5AA 4KGJA 1ZHKA 5FHBH 1WH0A 3E38A 3FT4A 3K4ZA 1YN6A 1OQXA 1U6AH 2ZUWA 1CTNA 2ADYA 3P3UA 3FULA 2ZONA 2K6YA 3CZJA 3QPQC 4Y88A 4W9EC 5EZOH 2XWDA 1DR9A 3ZE1F 4JR9L 1OZTG 1Y18A 5J06A 2XA3A 4ZFOA 1K85A 3VFSB 2XWJB 1KLGA 4NO2A 4YHKH 4TUKL 3R0MA 3MRQA 4UDUB 1LWHA 3CHPA 4D0BB 1AFVL 2KZKA 1FG2A 1F0LA 2FBRA 2JH2A 2LVEA 2ZWYA 3D2UD 1I1AD 3SQOL 4AMXA 4MQXC 4CADA 3GIVB 4G1MB 1KCVH 4KZCA 2XOTA 5I6LA 1NGPL 2AJSL 1UH3A 1BX2B 3STZB 2WQUA 3GSUB 5DQDH 3MGTA 4D0CB 3SGKC 2R8SL 3CWGA 1FZMB 5M94B 1RZ8A 1PY9A 2YQGA 4PJAE 4R3SA 4S1SH 3L9EA 1A7OH 2WUCL 1ZD6A 4NKOA 5CJBA 4QRRA 3QWRA 2PCXA 4L8SA 5IQLA 1NAMA 1R5IA 2AHIA 3JWNE 1T20B 3QJXA 3BX7C 2V17L 1MPAL 3C5SB 3HMXH 5D1QA 4X6CB 2BERA 5F3HB 5FYJH 1WA2X 4PPTA 2VDRL 3BDXA 3DOSA 1AXIB 4B3EA 4ONFH 2WYZA 1IFHL 3QZLA 1T1ZA 3OWEA 2NY3C 3NSJA 3U2SB 2XWRA 4D87A 1DBJH 2XWTB 2VMFA 2BP0B 2EVIA 1DQMH 3LZRA 4P9ML 4FQPA 4B9KC 3IDNA 4UQ3B 2JJSA 3PGCB 2WO2B 3WUWG 2MOGA 1P0SE 5I9QC 5KS9A 2FBJL 2KPNA 3GUFA 5IF0A 2BNRD 1HCVA 1LL1A 2V2TA 1CS6A 1A47A 1NBCA 3APMA 3JUYA 5DHXB 5TDOA 1FVCA 3KYKH 1PLGL 4UQ9A 5CINL 4LCYB 2JB5H 4OQTL 1JWSB 1MFEL 3BWZA 3OQ3B 1U8NA 3GUTB 2IADA 5FFLA 3QWOA 5LWYH 4KRLB 1Z6JT 3MKGA 3K2KA 4J3XA 1BVOA 1UD5A 1PLAA 3HVDA 4UTAA 4BKSC 3A4EA 4IRZH 2RACA 2A4EA 5DYOB 4XPGH 4JZOB 3A4AA 3RG1C 3IETA 2HVJA 5L6YL 1XX9C 2IGFL 1ZLSL 3EJZD 4HPYL 2WXNA 1CGUA 1XGPB 1ZT1B 1G9MC 3L17A 3CFBA 3K46A 4AW7A 3V4VH 4JM2F 4NNXB 1UATA 1IAIM 5DVLA 3EOAB 3RPIB 2NY4D 3RRQA 4QCIB 2OMXA 5BJTB 1J86A 1S7TB 3F58L 3G6DH 4A6YA 2CK0H 2DEXX 3VXSA 2DWTA 1GSMA 3A6BH 3FU0A 2CZNA 4EI5C 3GYRA 4PV8A 5DHDA 5DD1L 2ZOOA 2UUDK 5DUMH 4DKEL 3LHAA 5GRVK 1KJ3H 3RDJA 1KFAH 3QO1B 4PLNC 2O26U 1S7WB 3U1SL 2OI9B 4AIXA 4O58H 3B1TA 4J3RA 2C9PA 1QFHA 2AEQL 4NUGL 1EEQA 8CGTA 1HXMB 1UB6A 1SMDA 3MNVA 3GIZH 1X5HA 3IJ7A 3CDYA 3O2DH 2AK4B 4WFHD 4U6HB 1DYZA 3VWJD 4XCEB 2DEWX 5F88B 2YO3A 4HEME 5T1LB 2FX7H 1M3JA 4DGWC 4B3VA 5IFHH 4HISA 1KB3A 1RIHL 4NGHL 5CKAA 3HC4H 3O3EB 2A9NL 2BP3A 1JPFA 3DARA 2WTRA 3QPXL 5DRNA 5I75B 3WFCL 2C8NA 3X13B 5SWSE 4ETQB 4F5CA 3OKNA 1BVZA 4JHAL 1AHKA 2D0HA 3U4AA 1P84K 3WXVL 3QUXA 2GJ6B 2ESVD 4DKFH 5IMOA 2WQSA 1QO3B 2ZUUA 1J11A 5E0FA 3V9CA 1P84J 5H2BA 2C34A 3Q6FA 3WNIA 4XODA 4ZFQA 5I66A 2VC2H 4I1PA 3QEQA 4OD3L 4WI0A 4HUWA 4EDWL 2B3RA 3KPSA 3UFIA 2PTUA 4K3EL 1ET5A 2IFFL 4PJIE 2D2OA 1EEZA 2NCMA 3KW8A 3OHXB 3RVTC 1PQZB 3TO4B 1AD9B 1U92B 1E2WA 5I1IH 1QLRB 1RH8A 3GJEA 3KZ8A 3HUJF 1KJ2H 3GPEA 2J7LA 3ILDA 5E8PA 1LQBC 1S8DA 5HHNA 4MYWB 3Q9PA 4N2LA 5DC0A 2ZIDA 5D1XD 1X9RA 3U36A 2XBDA 2V7HB 3UZVB 4KQ4H 1VFBA 1XH1A 4N3TA 2ADGA 3ZDWA 1PEWA 5HYSG 3L3DA 1UZGA 2G75B 3O45A 1EHXA 1ZTMA 1IC5H 2DQJL 3FB7B 3V55A 4ELME 4YSEA 4HS3A 1E9PA 1CFVL 4UOQA 3LMJH 3PIQA 3VD7A 1D9KD 1GC1C 3D06A 5I30L 4UT6A 3ZKMD 4LHUG 2G9HA 3MO1B 2YAOA 1EJOL 3CH1A 1KYFA 3M1BB 4H25B 4K23L 5I1CL 4O02H 1U36A 5DEZA 5DO8A 3QG7L 4LSRL 4OZIA 1BJ1H 4OZGA 4PY7A 4RNRB 4LPXA 5F21B 3EF4A 2F7OA 1IKNC 2WN3A 4WDIA 3BZFB 4M6OL 3PU7A 4WU5A 2YKLL 3SHSA 3WO3B 3ZTNH 4BFFA 4P6RA 4Y1AE 1P4LA 1PIGA 1S9YA 2YZ8A 2UY6B 4AJVA 2BO0A 3M45A 3HLAA 5DD3H 5GRUL 4LPCA 3LZNA 3VUAA 4QGTA 4HSAC 1D6VL 4QYOA 1E3XA 4G2AA 5FDWB 1DUZB 1T7ZA 1Z3GH 5ABZA 4KGLA 3H4FA 5F9OL 1YY8B 1BFSA 2L8AA 3FC8A 1O7DC 2ADIB 4BQ6A 4NSKA 5DS2A 1GR7A 1QA9A 1ZLEA 4AXWA 1OK8A 1URIA 2ADFL 4OV5A 5HHOE 2VDQL 2ROXA 4U1SB 2WWNA 4HXBL 1SHMA 4GKNA 3FQXA 3MHZA 4PJ5A 4UQBA 1BFTA 1WAEA 2Z91B 1Q0YL 3IJ8A 2BSCA 3RX9A 4B96A 2AQRA 2NX5A 2GFBA 5IT2L 2PO6D 4YHZL 1U8OA 1IAIH 4A2HA 1ILSA 5KANI 3HG1E 2I26N 1R47A 2ENYA 5IW1A 5FUCC 2ETWA 2YGPA 4PS8A 1HHHA 3QNYB 1RJYB 3FU5A 4M6MH 4RVBA 1BQHB 3GS7A 4MHHG 1MREL 3BFWA 1GSKA 3ME0A 5F7BA 4URTB 2AP2A 3ULSB 4NO0B 1IGFH 2OCJA 3WLWD 4B95C 4I3GA 5K9QG 2OAAA 1U2HA 3MUGA 1KGJA 1L0QA 1R3KA 4HC1A 3DDFA 4Y9CA 4TXVB 1BXAA 1LP9B 2W5PA 4HD7A 1QBLL 5T5FA 1XEUA 2IQAA 1IM3D 4PJ8A 4MX7A 3CVHL 5IHZA 5LGJA 2VJ0A 1TZGH 5AG9A 2V6HA 1D7BA 3CVDA 4WK4B 3BAIA 3KLSA 3CFJB 1AHWC 3I02A 2XDHA 4AV0A 2I32A 4L9LC 3CQQA 2P3XA 3EOTH 5C7XL 1M53A 3QZOA 1MAJA 2O5ZH 5EUOE 3W81A 1QABA 4CSZA 5TDPA 2QKIC 3T2PA 1VGEL 1Q0EA 3UYRL 1OWWA 2TRHA 3BO8A 2P8LA 5E2UH 2F8XC 5CAYB 4Y4FD 1BZQK 3NN8A 4X0KA 1T5XA 4OLVH 4GBXC 2DWEA 1K4DB 3VXNA 3NCYS 5HHME 3FSOA 4F7CA 4LVHC 3T6XA 4JPSA 1ZAGA 3LKQA 4O5LL 5I0ZA 1ZT7A 1UB5A 3QGVA 2FLMA 3GXUB 3SN6N 3EYOA 3UCQA 3MODL 3QFDB 2C26A 4N2NA 3OXRB 4X8XA 4ZUSB 5GRWA 1ZIBA 4Z7QE 2WBJD 3NA4A 5IR1B 2V5RA 1EANA 2AV1A 5E94A 2X0WA 2Q20A 3CQFA 1J5OH 4XPFL 3PABB 1VEPA 2JJWA 1HEZB 5INCB 2AS5M 1F4HA 1K6QH 3SO3C 5KBLA 2F7QA 4IBVA 2CO7A 1CICB 1Y6MR 5DK0B 1BZ7A 2CA4A 3VJ6B 4AIOA 4PGCB 4JQVA 4XN1A 1QP1A 5DHVB 1A3RL 3DWTA 2Z1PA 1NINA 1F18A 4QTHA 1F6LL 4GSRA 1NBVL 2NSQA 4M5ZH 1RLWA 3VXQA 4QXTB 4JPVH 5EUKB 4XX1G 4Q4IA 5GRXG 4ZTEA 3QFJE 4OVUA 5C08E 3WMPA 2X4QA 1Z9LA 2ZT9C 5HDWA 5F8QC 3D50A 35C8H 5IREA 3SPVB 1UTDA 4JO1L 1OD9A 2ZUTA 3UERA 5IJVA 5C0GB 3S5YA 2QELA 1NIAA 5GRZA 2BMKB 3S8WA 3VGDA 5ITBL 2WXLA 4RAHA 1D7DA 5GRVL 5IKCA 4JM2D 1UACH 2BY3A 4OUAB 4LVOC 1WZ1H 3DX9A 1IEHA 2WYHA 1BLNA 4KVNH 3JWDH 3U6RA 4ANKA 2QLVB 1YMMB 3IGFA 5EDXA 4E41D 2QPSA 3GEFA 1X7QB 5EBGA 1VFAA 2WINA 1JTTA 3SKOB 1FFPB 1ZOXA 2PYED 2N1TE 3IFOA 4UQDA 4I48A 4CKVX 4YL4A 1QVOB 2NRDA 3IN2A 1JNNL 2X42A 4FTVA 3QUZD 4HMEA 1OCRB 3RBGA 5ICYB 1N59A 3U4EB 4Z0ZA 1U8CB 4KITB 4GAYA 3KBPA 3NZHH 1K2DB 5L4IA 3IKCA 4OLZL 3UDWA 4ZMTA 4HKXA 3HN3A 3X11A 2EJ1A 3KR3L 3U2IA 1F1GA 4HD9A 5LBSL 2H41A 2ISDA 4ZSOE 4MJIB 4XHQA 3DRQB 1KCRL 3MGAA 1AR1B 1MJ8L 4HDIB 4JY4B 3BQUA 1JSYA 3ZRFC 1EMTH 5DFTA 3Q1SL 1MFDL 2OFQA 1QTSA 4H4NA 3IS0X 4U1GC 5CU9A 3VFUB 3ZL1A 5C2BH 1EBAA 4H8WL 4W4OC 4ZTPH 2DMHA 3NBNA 1G7JA 2E59A 1T2QH 3VW3H 1E4JA 2EDYA 4GT7A 1QKZH 3QARA 5TGBA 4O2FB 3ZKXB 4LSQL 4WWID 1R9FA 3CFCH 3O6MH 1CXKA 1JNLL 1TXKA 4Y16A 4Y4HC 5EC2A 4OUUA 3AQYA 1S4IA 3T2OA 5IJCC 3SJVA 4OLYH 1MWAB 3V6FB 1YYLH 5DZJA 3QDMD 3W0WB 4C4KT 4J6IA 4I1RA 1MFCL 2OR9H 3O3AB 3S5LA 1OSEA 5HHQB 5ESQB 2QPDB 2BSED 4QO1B 4EIGB 4DCQA 3FL7A 5FUOH 1EFXB 1M7DA 5DR5H 1TFHA 1MELA 4OCWL 4N6QA 2P80D 5DZVA 3CSYA 3T4AC 3CHRA 3MV8D 3D25A 1W91A 1J0ZA 5E2VL 3A6CL 4AK1A 2F53E 1WT5A 2XN9D 1J1XL 4JFHD 5IBLC 4DT2A 2BVQB 1CF8H 1KEGH 5I17B 1OAQL 4GUPB 1ED3B 1DFBH 1M05B 3GK8L 3HB3D 3RWCA 4OD1L 3LV3B 4NBXB 4QKXB 1BT2A 4U6VL 2W91A 1CFBA 4IDJH 3VI4A 2JNZA 3EH3B 4G9FA 4PB0H 5D2LE 4NC2B 5EO9B 1P6WA 5KAQF 3MOAL 3O4OB 4MQSB 5GS0D 3PG2A 5GS3A 2XZCH 3V4PA 1HH6B 5LNEA 5K1NA 4QPEA 2QMKA 2YGVA 3SGJA 4GIOA 1N0LA 4EI6A 1XH0A 2E7CA 2PNDA 4JZJC 4IM8A 1BD2A 4GQ9L 5F9WC 5FYKH 3UTOA 5JORA 1A0QH 1BREA 3DBXA 5B38B 4JREB 3RUGE 4MD4B 1FC1A 5FXCH 1KC5H 4E9WA 4B9CA 3BP6A 4S1DC 4QJ4B 1DBAL 1ETJA 3DKHA 3SDYL 4EIZC 3HI6L 1LP9F 1MVFA 5D9SB 1E3FA 4K3DL 5DS8A 4D9QD 2YBGA 2VLKA 5JNYA 1S5IL 3IGAB 3VGGA 3PAVA 2XRAL 5D6CB 1CGWA 2F68X 1DQLH 4CC4C 1UJ3A 4NOFA 4TNVK 4W9KC 3Q3GB 4NZRH 4JFVA 5F6IC 2HTKD 1OARL 2WD0A 2QVIA 3KLQA 5DZPA 3ATDA 4Z23A 4EI0A 4F2MB 2DM2A 3C08L 1MF2H 3EAKA 3QR2A 1IQDA 4NERA 5CMAA 5JPMC 2QMJA 2VUYA 3BVXA 5C0BE 3KGUA 2JCWA 1KPVA 2FUQA 4MBOA 1KG0A 1YEIH 4P4KA 4I88A 5IFJB 1SEQH 5J6GA 2WBXA 1E0OB 3S4SB 4F33B 4MB4A 3E2HC 3KWWA 4PP2B 1HOCB 4APQB 5I1LA 4NM4L 1TTCA 2FT6A 1RULH 3FRPG 2V5SA 4FFWC 4BFBD 1WO2A 3ULAB 2IXQA 2FGZA 2OM5A 3OAZH 3Q01A 3P54A 1Z32X 4JUSA 1XF2A 4OY9A 4JGNA 3QRGH 1BZ9A 1ET7A 2OCFD 4BK5C 3T0WA 4JKLA 1HXYB 1S9WB 2K45A 4OUOA 1CDHA 4MNHA 4P2RE 5LAXB 4PJEF 3WFDL 4LOEA 1U8JB 3IBEA 1X4XA 1NAKH 5FF6A 3DHPA 4LO9A 2WMPA 1XR8A 3EHBB 3FOMB 3UACA 3GLZA 5AYUH 3ZR6A 1ZSDA 1HEHC 2D7MA 3DJ9A 3PREA 5HJ3A 4OIFA 4L8BA 5ADOL 1SRDA 1UA6L 1IC7H 4X8GA 2HP4A 1UYWH 5GGTA 5KYWB 2B9BA 2Q6WA 3CDGB 1ZPLA 2HJFA 2CO6A 1GYVA 4YXKH 3LKNB 5DRZA 4AQ1B 3K6DA 4GRLC 4PJCB 1CGVA 2VSDA 5EFIB 4JO2H 1BM3H 1IE4A 3EUDA 4DQOH 2CKBL 1WBYA 3L8QA 4HX1A 4JG0L 3GTNA 2WWMC 2ODIA 3TBVA 3H3BC 4H8PA 1VPOH 4AG4H 1S7SA 2DLFH 1LLAA 1PBYA 2OXHB 3IWVA 4AV4A 4Y0GA 3CC1A 5PAZA 4HUVB 4HJ1A 3NSFA 2OTUA 4YQXH 2GIYA 3DROB 4KKLC 4L5FE 3UTTE 1LE9B 2NY6C 3V9FA 1JZ2A 5E95B 4BCXA 1WEJL 3R4RA 3AREC 2OL3L 3MRLB 4PUBL 2W0FB 3DYMA 2N1KA 43CAB 4JFTA 2H2PD 4TKWA 2C4FT 5GGVH 2OMWA 4KTYA 4GAJL 2DMGA 4DO4A 4HWBL 2O4EA 4KV5F 3ATBA 1RZJH 1CT8B 1T6BX 5F7DB 1FNGA 3RPKA 1WRFA 3QRFM 4TULL 2XTJB 5KVDL 3FU8A 4X9IA 1GGBL 4L0PB 3CFEB 1PY0A 5JXEA 3SY6A 4GJTB 4XWGL 3H2PA 3RDTB 1C7TA 3C8DA 1JHLH 2E3VA 2F54B 3PL6A 5EG6C 5DQJA 2QVTA 2H32B 4L37A 2Q8AL 3S37L 3IPEA 3IXTB 4DF9A 2W0PA 2AK4D 3QUKB 2G5BB 4WUUA 1OAZL 1GS7A 4LCWB 3SCMA 1TCRB 5T1LD 4L8CB 2D7OA 3FT2A 3ASWA 5DF0A 3ZT6A 1J9QA 4N5UA 4YHIB 1X9LA 5ECJE 1ORQB 3CFKA 3QS2A 4FXGA 4LLMB 1H0DB 2WTPA 4IRSA 2O1AA 3ATEA 5I1DB 3GSNB 2RAMA 2PPCA 5I1GL 4A2GA 2V2XB 4AUJA 2WZAA 3Q8EA 5E70A 2GJ6D 3B7UX 1SBSH 3C6LA 4P59L 3V6OE 4BJLA 4RWYH 4JN2A 5MEOB 3ML9A 4KUCD 4XXDB 4DGUA 3HE6D 4I0PA 3QBTB 3QJHA 3MV7B 1M71B 1CO1A 1BPVA 1MI5A 1XCTA 4ZX6A 5I1EL 3FNKA 3HR5B 1JXKA 2Y07H 3H3PL 3IDIB 4EO5A 3WFEH 1T4KA 1LYQA 4LPTA 4ZS7H 1GXEA 5I76A 3IGKA 3TO4D 3BIAX 2YN3A 2AF2A 4GKLA 1SUJA 2FX8L 4I0KA 5AB2A 4OIIL 4WNSA 1OP5H 5IB4A 3FHAA 5F89A 2R9HC 1A6ZA 4PJFA 4BKLB 5D5MA 1CFMA 1SXSA 1RUMH 2WQXA 4QHKJ 5CEYA 3RGBA 3ZLQC 2R1YB 1U58A 4KROB 4BFOA 4EQ2A 3O4LA 6PCYA 4OJFL 4YR6B 5DZNA 2W95A 3A0OA 4DERA 2QGEA 2X6MA 1KXTB 1P69B 2G4EA 3H56A 4YHNA 12E8H 5DJ8B 5FV2A 5GS2D 5EEXA 5K9KB 5DJ6A 4MMXA 2GTQA 4AQOA 5C0JA 2CDGB 1WICA 2GKIA 1UZ8A 1Z5HA 2ID5A 3BZ4A 4GW4A 1ZGLP 1ITBB 1NEUA 5CGTA 7FABH 1WBXB 4TLKA 3GHPA 2DJMA 3VA2C 4YDNA 5BO1H 1QRNB 1BFOB 2VR5A 3I6KA 1F11B 3QEUB 4YNYA 3V5KA 2YD6A 4OCRH 1DJYA 5DJ2A 3DOIA 2EXSA 3M8OL 2J73A 1AGEB 4FCHA 3VFVA 3CUPB 2HYMA 2OLDA 4AYEC 2NR6C 4JFQB 1NCGA 3BUQA 5GS1C 3NCJL 1FL6B 4GSXA 3SYAA 5FHBL 3IAGC 1E9QB 3FQNA 4AC2A 4P05A 2FIKB 1AYRA 1U6AL 4EN2A 2BIPA 1INEL 5D1ZC 4ZAKD 2AXFA 1RZPA 1FIGH 1WWBX 1R5VA 3LRSA 5C8JA 5EZOL 3CZKA 2A4CA 3QIWD 4P2OA 3VXRD 4JJ5A 1YA5A 4M61B 1XB3A 3C12A 2JQMA 3RVXC 3CN3A 2OX5B 2AJXH 3VB9A 1TQVA 1ZS8B 4TM9A 3AU1B 1XF1A 5K39B 3ZHFA 4KJPD 5IJKA 4ACPA 2PKDA 1S7QB 3OKKA 4NQCE 5FYLH 4YJZL 2PR4H 3DPDA 5SWZD 2XN2A 1DUYB 4U1LB 5IGXL 4LRIC 4R2GC 4XVSL 1FE8H 1NCIA 1Q9OB 4K7PX 1PD1A 3EO1B 3UBGA 3DVIA 1CGYA 5H94B 3KWTA 4YDJA 4XHJC 4S1SL 1XIWC 4JPIA 4NN6B 1A7OL 3TN0B 4Y2DB 1J8HE 4UUJA 4DGIH 2GIXA 1MAKA 3GDCA 3O8XB 4OSUL 3E6HB 5MEQB 4MJ6B 3FYEB 4R4ND 4NO0D 3KPLB 3HMXL 4MDIB 1EEYB 1IX2A 1OAXH 2MFNA 3CE1A 2YJLA 3FFDB 5CSZB 2Z4QA 3SDDA 3VG9C 1H3UA 2DKMA 5E4AA 1JYWA 1XSIA 4ZG1A 5E99H 3QXDB 1YAZA 4AYID 2WSPA 4YSDA 1G9HA 4N3UA 2RQEA 1DBJL 2R7EB 4NQXA 1G6RH 1WZKA 3LYRA 4IGBA 2VDRB 3F12B 1OTSD 5JMOC 3VFRA 4W70A 5GHWH 3VFMB 3CN2A 2YBRA 1LD9A 4X5PA 4U0RB 4QXUL 1ZVSA 4J27A 4PRDB 4PJCF 2IG2H 3KYKL 1OTUD 1TZIB 3CCHB 1F3JB 1JF1A 2JB5L 3R19A 3RWDA 5A7BA 5F72S 1CZ8H 3CHOA 3TGXA 5GIRB 5IB3B 3TIDA 1I1FA 3B7RL 3JWOC 5LWYL 2XFGB 1EHLH 3RQ3A 1FO0L 4FERA 5EZLB 3C60A 4IRZL 1XGQA 5FDYA 1JDDA 4ONOA 2AXGA 4LFHD 4XPGL 1KBWA 4AM0Q 4F9LA 1JPST 1KXVC 1HHJB 1OIOA 5ESVA 4TRPH 4GLRI 4U3CA 2B1HH 2R0KH 5IROC 4CBPA 1YEDA 4LLAA 2FQDA 3BKJL 5TPWH 3HR6A 5JW4R 2K8MA 3V4VL 3IMWA 4BEIA 1RZGB 1ADQA 4XCNA 4Z1PA 1XVSA 4HJIA 3F6IA 2DTSA 3CTTA 4HYTB 3G6DL 2WWKO 1XZ0A 2W0LA 2CK0L 1BJ8A 3A6BL 3NEOA 2PCPB 3W39A 1G6VK 1BIIB 3FT9A 5F9DC 1CICD 3DV4A 3FRUB 3KPRA 3MA7A 3NA9H 3VXMB 3HI5H 3QDGB 2R15A 3MV11 4PJHF 4YHLH 1U33A 5JQIB 1KFAL 2WB1A 1L9OA 4H0LC 1AGCA 4P2QE 3V6ZA 1WUZA 4G6ML 4JY6A 4O58L 5I8EB 3OJDB 4O9HH 3AAZB 4KH2A 1MFAL 2ADJB 1NCTA 4KQ3L 3GIZL 3O3BB 4NIKB 4YLQT 2X0VA 2EKSA 2FATL 3BH8A 1RPKA 2WPGA 3O2DL 4TYUA 3RVVC 4JFDA 1ZS2A 4EZLA 3DJZA 2EDEA 1MFBH 2KLRA 1KJVA 3RX8A 4F1SA 3CVIH 3V2AR 1ACCA 3HC4L 5HVHC 4XR8C 3EOBB 3OMZA 3QDJE 1SJHA 3K71B 4XN9A 3K6SB 3UPRA 4JZNB 3MKKA 1J5CA 3CK0H 4JRWA 4KY1H 2W65B 5D55A 2X4RA 3MA9H 5ILTH 1U3HD 2P5WB 3JT2A 2GT9B 4NFBA 4DKFL 1T22A 5CN1A 4A7TA 4M48H 4ENED 3ETSA 3FMGH 3OKEA 4QRSB 3S88H 4HLZG 1KYUA 2V7NB 5DJCA 4CVZB 1YMMD 2VC2L 5E8NA 5D2NE 2IPUK 2DQCH 2XXCB 3RYMA 5C9JB 3D9AH 2IWGA 4MXQD 4YDVB 4ODUB 2BIHA 2UZIH 1VCBC 2BRQA 3LN5B 1OP9A 5ISZB 1FZOA 1MCLA 2Y6TE 3QZWA 5JHBA 3S2AA 4HXAH 3BLKA 3KPPB 5AUMA 3LAFA 3HZYA 5I1IL 4MNGE 4RESB 2BNUB 9CGTA 4AZ8A 2EILB 1KJ2L 3EIFA 4YE0A 4Y2OB 3Q6GH 3WEXA 1PAZA 4H1LA 1RZKH 3RLSA 3O6KL 4QHUB 1BMGA 3BESR 2JJTA 4LXFA 5H37A 4MJID 2DJ4A 1ES0A 1IE5A 2EADA 4JL1A 3QORC 3TURA 4KQ4L 4WI6A 5HYIA 1MVUB 2OZ4H 4FL4C 3RVUD 3VXPB 4JB9H 1IC5L 3SEPA 2DQHH 1XL4A 3LMJL 5FO9A 3L9BA 1C5CL 4K7PH 5EB9A 2B1OA 1Q9KB 3HG0A 4HFWA 4MNQD 3SPJA 3RZCA 5DMKA 4WU7A 3ZUCA 5J6HA 4FKHA 4O02L 4ODVH 2X12A 1F8TH 1WCBB 4HD5A 4PRHE 5BV7C 3SDAC 3VO0A 2MCG1 3DMMB 3PGFL 5CGBA 2K7QA 5ANMB 3UIZA 3W0WD 1TTRA 4JDEA 3U48A 4JRXE 4JBSA 5F3FA 1DVXA 2CLVB 3QHFL 5DD3L 3KYAA 1EFXD 4WV1C 1VF5C 5F7AA 3VH8B 4GS7B 3GI8H 3SYQA 3ZQWA 2V3DA 3KXFE 3C75A 3VA6A 1CLCA 4LEBA 4LLDA 5I5RA 3SKNB 2P7TB 5IFAH 4RGNE 3BKCH 4LSSH 2W59A 1OTTC 1KDJA 5BUPA 4ALAH 1D2OA 4G7YH 4LVOB 3W57A 2CBMA 2P43B 4JHWH 1BQKA 2BCKA 4WW2B 4F37F 3NZ8B 4C56B 1A1OB 5EIQA 2OPCA 4Y8AA 2NOYA 1GOGA 1I31A 4PGJA 1L7TH 1IAIL 1XGUB 4ODXA 4DNLA 2GUOB 4GKZA 1MW1A 1ZRUA 2VDQB 2IH3A 1IAOB 3A21A 4AWJC 3Q8CA 3SOBH 4RMTA 5KS9E 2DQ6A 4MA1C 2J55A 4M6ML 2APVA 1XR9B 1A4BA 3ZKND 1V3JA 4AIZA 1C5DB 2WUBL 4LNRB 3O2VL 3GT6A 3MUY1 3O6FC 1T0PB 3AABA 4UOW0 4NQEA 5LAPA 4BCYA 4PJ9B 5SWQA 5IVXF 2WXGA 1OSPL 1JWMB 1JK9A 5CBAA 3HAEG 3L9RA 4K8RC 3TNMA 1KGUA 3T8XA 4GG6A 3SD2A 1ZPUA 1MFMA 3MBEB 1R3LB 2AJUL 1U91B 1T0OA 1F56A 3IKKA 3ARDD 4GRWB 1ZXKA 5I1AB 2DQMA 2OTPA 1FC2D 1QSED 5BRZB 1PZ5B 2GBUA 3EOTL 3AS1A 4H26B 4BH8A 2O5ZL 1IC4H 1YY9C 4WI4A 4TMPA 3CVHB 5CHNA 4V2CB 1AOZA 1MW2A 4KXZI 1FUNA 1PYWB 4JFZH 4Y4HB 5IG7B 2FWUA 3HS0C 4WEUD 3ARBB 3QE5A 5FKPB 2EQDA 3L3HA 1N67A 5KW9H 4WRLA 2NUPA 3KWXA 2QFPA 4AYFA 4OLVL 1VZIA 3GMRA 3WN6A 1R17A 1IGTB 1WLHA 1SPDA 5DHEA 3WKPA 4M8QA 2YD3A 2FR4A 4QHMB 4QLWA 4RZCA 1USQA 4JPQA 3IK2A 5J9PB 4ZS6C 3UJJH 4DGVH 3Q48A 1MCNA 2H9GA 4D3CL 1HC1A 4G80B 3QFGA 4HS6A 2HLFC 4F3FA 5AB0A 1OAKH 2VR9A 4KMLB 1EGJL 3F5WB 1SNRA 5DJZA 1C12A 5J1SC 1KGWA 1J5OL 3L4VA 5AZ2H 1CL7H 1HZHL 3OJVC 4X7FC 4ABVA 4HP5A 3EHBD 2CQVA 3UG5A 5EBLB 5FYLE 2NW2A 2ED7A 2AQNA 4DP0X 2NSMA 3FHQA 1IM9A 5C0AA 3GMQB 1OM3H 3UTSB 2VRAA 4CSPA 1L6XA 3NACH 5FW7A 4MDJB 2Z35A 5JOPE 4DVRH 1CXLA 2ZG1A 4RMRA 2X70B 3O3DA 4ZO6A 5IM7A 1P9MA 2A4ZA 4MMZC 2BY2A 3EDEA 3JXAA 5KANG 4ABQA 3QEQE 4M5ZL 2JK5B 3ARFA 5DJYA 3GKWL 3KPSE 4LFHG 4JZJB 4ZYKB 3RNQB 5F9WB 3HHSA 2BP5M 1I7RA 3FO9B 1HSBB 2A73B 3HLKA 3G04A 4PB9H 4G11A 4ETYA 3ETBJ 4XPTH 2R0LH 5L2JB 5CLWA 3TYFA 2CUHA 3P30H 1HL5A 2XCMC 1YG9A 2JI1A 4JFFE 4RDQG 1QR1A 2DJUA 4UT7L 4EQ3A 4A7VA 5KSBA 1WZLA 4FQLH 1IBGH 1OKEA 2VO5A 1UACL 2YMTA 1A4KB 1GOHA 1H3WM 1Z3RA 2EE6A 3EADA 1LMKA 1OCWH 4JM4H 1XO8A 3WE1A 1RK1B 1XTMA 4XMVA 4KVNL 4JLRA 3JWDL 1SHWA 5CSBA 3SDXA 5C0CE 1EXHA 3MGOA 1CR9H 1N8ZA 2XTJD 3H85A 4BRVA 3RJOA 4X7DC 2ENSA 3JV6A 3QQDA 4PJGE 2FO4B 4LLUA 1A9BA 4JUTA 4JRYA 2MRYA 1CFTB 5IMMB 3RDTD 3C5JB 3VI3B 1IBYA 1MHPH 3WUWA 1I8MB 4OGXH 1JGEA 2F54D 3LS4H 4U6YB 1DQDH 2YEZB 3WO4C 4OZIE 4PVMA 2MPAH 1KBGL 5DFWH 1SJEA 3NZHL 2MNWA 4LCWD 1P5UA 1T03H 2CK2A 3C6EA 2GY5A 3F7KA 1DVZA 3QISA 4YFLI 4MAYA 2ITDA 1LO5B 1O75A 3FAXA 2EDJA 3KS0H 4RSVA 3RKDC 1DEEA 4AQZA 3P11H 3TEWA 5CN3A 1DJIA 5EBMB 5C2BL 4NLHA 4Q6IA 3KYNB 4M7KH 4ZTPL 2C7FA 4NWUH 1AGDA 1KPUA 4N8VA 1SQMA 2IC2A 2YQ3A 3VW3L 3TO2B 1QKZL 3TPKA 2IQ9H 4IRJC 1MRCL 3MV7D 4NUQA 3BKMH 1T2XA 4XMXA 5LCVA 3CFCL 3PHQB 2BJMH 3O6ML 3DIFB 3QWNA 2HFTA 4EIUA 4JFXA 1FG9C 4AVIA 1JZIA 2KKQA 5TDNA 3S2CA 2OMUA 1DVFD 1C8QA 4X7TB 3C2AH 2OR9L 2FUTA 5CUSH 4L0YA 3KPMB 1NC2A 4LZKA 3UCRA 3D08A 2R23A 4TQEH 2XA8H 2Y7OA 5CSGA 1P7HL 4PJAB 3GGWB 2NY6B 2WV3A 3APDA 4KROD 4RCAA 2F7PA 3MX0A 4ZUUB 2EIZB 3DV6B 3DGDA 4KHXL 4UWQB 1CF8L 5IBUB 1KEGL 1J1PL 1SF5A 1X7TA 3EYFB 4FQCH 4A38A 3RWEB 3MACH 4WW2F 4Q6KA 2FTAA 5F1KC 3FQTA 1J10A 1HL9A 4BFIA 3R8BB 2AITA 2XBZA 2AJYH 2YD5A 3ZY7A 1CFNA 3MNMA 4PGBB 2FEDC 2B4CC 4NNPH 2F7RA 3MNZA 4IU2A 3TNNB 3AWWA 4IDJL 3TFKC 3APFA 1ZT4A 2IPTH 4MBRA 3GBLA 4PJXF 3ARQA 1G5AA 4I0CC 4RWHA 5I2IA 4RMVA 3VCLA 1QRND 1AZCA 1I8AA 1UXWB 3II2A 2XZCL 3VFOA 4X6DA 3V0FA 4OFDA 3B1UA 3JV0A 3K8LA 4WLCA 2B0SL 2G3MA 4MS6A 2PTTB 1U8HA 2WZ0A 1DVQA 3IJYB 3QQ9D 2VQ1A 5DWPA 5FYKL 4ORGA 3OX8A 5A6LA 5E6IA 4UV7L 3WJLC 2FYYA 2KZ1B 1NANH 1JNHB 2FE0A 1I3GH 4X99A 3R1GH 3BPLC 4FG2A 1B4LA 1BAWA 3T6QC 1QFUL 3VGAC 4JPWH 4LCCA 1RHFA 2WYTA 5JW5A 4GRWF 1DQLL 3H7BB 1JRHH 3GSOB 1QWNA 3STLA 4A1RA 4GKSB 5F96H 4M1CC 4DEUA 4NZRL 4XGZB 15C8H 4FNRA 3HKZA 4R84A 5AL8A 1W0YT 2IAMC 2DIJA 3S3BB 3BUIA 5BRPA 2DL9A 3IM1A 2E8ZA 4KDWA 4LLQB 1KGCE 1NTDA 2VDOL 2ZCKH 1HOEA 3NJNA 1GPOH 1MF2L 2WAQA 5EEYA 3J2PA 4G6FB 4WWKB 5EU5B 4OCYH 3QUYC 5HD8C 4Z76B 1ZLUH 1EUTA 2DD8H 1YEIL 5MENE 4P46C 2O61B 4BE5A 1JMXA 3TN0D 4Y2DD 2J8HA 2ZXWB 4LHUA 3T0EA 3MLSL 3O8XD 5B38G 5JZ7D 1AO7D 1BDYA 3FTXA 4HIIA 3QJSB 2IWKA 2CR3A 3Q2LA 5EU6A 1U8LB 2X9XA 3EGDA 4ZDHB 2CRZA 1RULL 1FZKA 1UEMA 2LQRA 4XBGA 5FO7B 1LEIB 4LDCA 5GZOC 2EDQA 1TEFA 1NDGB 5J12C 4YE4H 3MUZ1 3QRGL 4DQAA 4K3JL 4ZMWA 1C16B 3LQAL 2ZYRA 1SHSA 1NAKL 3FB8A 3LY6A 3T3ME 1SDYA 1RUQH 5AYUL 1RURH 2J57A 3NFSH 2MEJB 5HDOA 1WGOA 2B59B 1PCSA 2GUYA 2IPKB 3LKOB 4ENZA 3ULUC 4M7JL 1UYWL 5SWSB 1QHQA 1G9NC 1E6OH 3M1CA 2BNQE 3NCCB 2PWHA 2TSAA 2IGLA 4NB7A 3BQVA 2J2ZA 2NNXA 3GLAA 4JO2L 4TSCH 4YBHA 3US9A 5GS1B 3HIZA 5E6UB 2C1OA 1YRKA 4OCMC 2RTTA 1VPOL 3S7GA 2BSSA 1BJMA 1FVDA 4PJIB 5D1ZB 5IP4A 1P4BL 3AADB 2XN0A 5JYMA 1E90A 4OCNC 1FORH 1T5WB 4FTVE 2XXMB 2YAMA 2KLSA 1E27A 2PPFA 1SYSB 2IALB 2UXTA 3NFPA 5D7IF 4YQXL 5EF2A 1DLHA 4MQ7B 1L9NA 2KUTA 4P0DA 4GEJA 2ZXDA 1NWOA 1EJ6A 1B6UA 2HLEB 2NY7L 2Y7QA 4LKXA 3NJMA 2YOAA 4PGDA 5TE4H 2LT9A 1E9OA 1MFNA 2ZF9A 2J8UA 4I7ZC 3H55A 2HJLB 3L3KB 3NP4A 1YQVH 2AANA 2HFEA 2C9UA 4ZODA 1H5BC 1RZJL 3TA3D 3NCBB 1IU1A 1GZPB 3AJ7A 2W94A 4W9DC 5KBMA 4JHZA 1PGRB 3GMMA 1MJUH 3BHBA 5KYYA 2J20A 1HN1A 4NQTA 5ADPH 3D2UA 1CYWA 1I1AA 3AXIA 5MERA 1MCWM 2YPVH 4Z7UF 5EF3A 1P1VA 2OMTA 1P6FA 1JHTB 1ODUA 1HIMH 2PCFB 2MQGA 3KH4A 4XB7A 5KSVA 3U7WH 3EO0B 2HTLC 2DQFB 1LO3H 2D3NA 3ZBMA 3KCPB 4JFPB 4OGZA 1GZHA 5FKAB 1PKQA 5A6IA 4UINL 2A2QT 4NDMB 4Y1AB 5I6PA 3OR6B 3CXDH 1HX0A 3V79C 3UBXI 2MSPA 1KN2H 2FZ3B 5BCAA 2HT4D 4OFKA 1G4MA 1PF3A 4Q2ZB 2A7BA 4IBZA 1FDLH 3FH7A 2P5WD 4W6YB 5J13B 1SBSL 1FN4B 4Q9QH 1LGVA 1NC4A 2Y2TA 3BH9A 4RWYL 2PXYB 4HCRL 1T0NA 5F9AC 5DMIL 3BKYH 1HE8A 2OXGB 1EHKB 3VGEA 1YN7A 5C7ZA 1E8XA 1KLUB 3ABZA 1IBFA 2W9DH 3QUMA 4FG4A 4XCYB 5BMFH 1YQ2A 5E8OA 5HHOB 2Y07L 2K3TA 5KEZA 3WFEL 4R7XA 4M5SA 5DJ0B 5ISZD 2NTFA 4NZFA 3UZEA 3VI4E 1FV1A 3GSXB 1ZCRA 2DLEA 5DLMH 3RTLA 5DJDA 3HG1B 2ATKB 2CIKA 5KYUA 4EN3A 1PPIA 2R0WH 2A6KA 4A55A 5DUJA 1Z66A 4PJAF 1RU9H 4Y5XC 3ZDXB 3UO8B 2ZP9A 3AC0A 4HEPG 2EVGA 4GUOA 1NJ9B 1TYEB 4XVOA 3VMNA 5KJ7E 5DJXB 2E7LC 1V05A 3VQ2C 4BK4A 1P53A 4E9YA 4BBWA 2LLGA 3N2JA 2ATPA 2VLRD 2OZ4A 1P4IH 4H13C 3WY4A 3VFTA 12E8L 3DTXA 4EBQL 2H0FA 3DX1A 3LZOA 1DSYA 3VQLA 2YWZA 3U0PA 2R1WB 3N6YA 3UBXB 3ZE1E 3D6GA 32C2B 4HZLA 1OGAE 4M4RB 1FNEA 5ENWA 5T1DH 3OMIB 1X5KA 3HE7B 4HK0A 1UENA 1PNCA 1WFUA 2I7OA 5DRWB 5BO1L 2N3JA 1A5FH 2X1PA 3NAAL 2Q7YA 2F58H 4OCRL 5E6SB 3VFPA 3MLRH 1TT6A 3DMMD 4PWJA 4L3CA 1B6DA 1HNYA 5T1KB 2CGYA 4JKMA 2FECL 2GQHA 5EHFA 2APXA 4M62H 5EUOB 2EDKA 3I3DA 4DP2X 4EUPH 4TVSa 4MS8C 3DVGB 3ZZ1A 2YD8A 3WFHA 4MLSA 3EFOA 6CGTA 4GW1A 5HVHB 2JFCA 1P7QB 1ZLDA 1QPKA 1XF5A 2ZOLA 1FIGL 3B56A 4K2UL 3R4DA 3MFGB 3HNVH 1LE5B 3U9PH 4N9GA 3B3IB 4YGAB 3VNZA 4P3CH 1IGJB 3VWJA 4YMPA 3ULVC 3JTSB 5HHMB 1AKPA 4W81A 2C3VB 4UF7C 2WP3T 2HLAB 3OKOA 1AQDB 2AJXL 2V9RA 1AR2A 4UBDC 5DJAA 1XWVA 1SVZA 4FABH 4X98A 3ZGHA 1LO4H 4OF7A 2EUWA 4C56D 5DMYA 5FYLL 3T0VA 4L9DA 4Z7QB 3LRMA 3RZWA 2PR4L 1YYCA 5MHSD 1JJUA 5KN5A 2OMVB 5GGRY 2ESVA 5IQ7L 1NUNB 1V3LA 2E5EA 4HGWA 4ERSH 1WBZA 4ZMPA 4OF8A 5I26A 4PREA 3UG4A 4DZBA 3IEAA 3QIUC 2WB7A 1FLTX 1FH5H 1AIFB 1Z9SB 4X6BB 4DGIL 2O30A 3ARGB 4G59C 3JZYA 5GISH 4YGVA 2EH7L 2J1WA 1XBDA 1OAXL 4UTBH 3GZKA 4R9HA 2WZPA 4MAUH 4WI5A 3HZVB 3SSGA 4PJ9D 3VQMA 2A6IA 5ETUB 5BVPL 2MPVA 4XXWA 1QI3A 3G9VA 5E99L 3U0WH 1MHEB 1BVKB 3JSSA 4DUWA