3WJMB

Crystal structure of bombyx mori sp2/sp3 heterohexamer
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
668
structure length
668
Chain Sequence
EFKTTPVDAAFVEKQKKILSLFYNVNEISYEAEYYKVAQDFNIEASKDCYTNMKAYENFMMMYKVGFLPKNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQGMFLYAYYIAIIQRSDTASFVLPAPYEAYPQYFVNMEVKNKMDYVKMMDGCLDEKICYNYGIIKENEQFVMYANYSNSLTYPNNEDRIAYLTEDVGLNAYYYYFHSHLPFWWNSGKYGAFKERRGEIYFFFYQQLLARYYMERLTNGLGKIPEFSWYSPLRTGYLPPFNSFYYPFAQRSNDYELHTEKNYEEIRFLDIYEKTFFQYLQQGHFKAFDKKIDLHSSKAVNFVGNYWQTNADLFEEDFLQFYQRSYEVNARRVLGAAPKPFNQYTFIPSALDFYQTSARDPAFYQLYKRIVQYIIEFKQYQVPYTQEALHFVGLKISDVKVDKMVTFFDHFDFDAFNTVYFSKEELKSSPHGYKVRQPRLNHKPFTVTIDIKSDVATNAVVKMFLGPKYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKEDSLPMAEIYKLLDQGKIPTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKAVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGELFPYLFNIPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Bombyx mori arylphorins reveals a 3:3 heterohexamer with multiple papain cleavage sites
pubmed doi rcsb
molecule tags Oxygen transport
molecule keywords Arylphorin
total genus 210
structure length 668
sequence length 668
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00372 Hemocyanin_M Hemocyanin, copper containing domain
B PF03722 Hemocyanin_N Hemocyanin, all-alpha domain
B PF03723 Hemocyanin_C Hemocyanin, ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1280.10 Mainly Alpha Orthogonal Bundle di-copper center containing domain from catechol oxidase Di-copper center containing domain from catechol oxidase 3wjmB02
2.60.40.1520 Mainly Beta Sandwich Immunoglobulin-like Hemocyanin, C-terminal domain 3wjmB03
4HD7A 2AHLA 3AWTA 4Z10A 3WJMB 5I38A 1BUGA 3AWWA 4J6UA 2Y9WA 3AWZA 3AWSA 4Z0YA 4J3PA 3NTMA 1BT3A 1LLAA 1LL1A 4J6TA 4L37A 1HC1A 4OUAA 3WJMA 1OXYA 4P6TA 3AX0A 3NQ5A 2ZWEA 1WX2A 1NOLA 1BT1A 3AWXA 3NM8A 4OUAB 4HD4A 5I3BA 2ZMXA 4HD6A 2ZMYA 3AWYA 2ZWGA 1WX4A 4J3RA 3NQ0A 4P6RA 4Z0ZA 3W6WA 2ZMZA 2P3XA 3HHSA 3WKYA 4YZWA 1LNLA 1WX5A 1WXCA 3AWVA 3GWJA 2AHKA 3AWUA 1JS8A 4P6SA 3NPYA 5CE9A 5I3AA 1HCYA 3QJOA 2ZWDA 4L37B 4D87A 4J6VA 3HHSB 3W6QA 1BT2A 4J3QA 3NQ1A 2ZWFA 2Y9XA
chains in the Genus database with same CATH superfamily
4MVBD 1AJ7L 1SLWA 3L13A 3MLSH 5ABDE 4NUGL 1Q9WB 3PLYA 5C0GB 4G6JL 4Z76A 4N0FB 4ZODA 3HMXH 4OM1H 4AYID 2QQLH 4JBSA 2AQNA 1NC2D 2FWLB 4U3CA 4I13B 3JTTB 3X1FA 4HIEB 3HZVB 4ALAC 2DQEL 2BFGA 5ABAA 5CGBA 4Z7VF 1MI5B 1T4KB 2OMZA 3MNVA 5ANMA 4PJDE 4NXKA 3WEMA 3JVGC 4F7PB 2A77H 4YJZL 2AQ2A 2OBGA 1UXWA 5HDRA 4FXKC 1MCBA 3FAWA 5BQ7A 2YD0A 3P3SA 2WXKA 1T22A 3ZDYF 5DUJA 4YUEH 1J0IA 2H26B 4K4KA 2CGYA 1V3KA 4S0TD 2K3HA 3QFGA 3PXLA 3GIZH 1RCYA 1R46A 2D4FA 2EXTA 4JM2F 4GIOA 1AO7B 4APQB 1CT8A 2PYEE 3DJTA 3FS9A 2EVGA 4XB7A 3IFNH 5LCVH 5KBLA 5KS9A 1QD0A 1WIPA 1HILA 4K2UH 2R69L 4YBLC 3VSQA 1IM3A 2I32A 5E08L 3RB5A 2Q0ZX 1ZLVH 4BEIA 4Q9RH 3O11A 1GR7A 4UDTB 4KROB 4IOIB 3D69A 3JVGA 3LDBC 1R3IH 4FNLL 1OTUC 4PJDA 3WJMA 3ILQC 4XPFL 3GHBH 1NFIB 5CZKA 3KWUA 3T08A 4AQOA 2VDML 3UTPD 4NWTH 1TQWA 4LPWA 1G0XA 4JLRB 2F19L 4FFVC 4YWGL 4P4KD 3IFLH 3DX4A 2DQDL 5ADOH 2XTJB 3DBSA 3LKQA 2C1OA 2CK0H 2ROXA 3BRDA 2FT6A 3QVAA 4WNQB 1MPAH 2A3TA 3IYLW 4ZFZA 1KIUA 1S78D 3LJ3A 3EYQC 1J05B 4ZG1A 2YD7A 2ZXCA 3OB0K 4RMSA 2VXUL 3FBKA 4XMZA 2UXFA 1D7CA 3LEVH 4ODWA 2OSWA 3S97C 4PI0A 3X2QB 1USZA 4ODHH 2AEQH 2OXHB 5D6DA 3BVUA 5AB1A 2FJFB 1SY6H 5IQ9A 4LXFA 3GMQA 4S1DD 4W9KC 4P2RA 3UBFA 3NK3A 4R7XA 4B41A 4YO0B 3NSFA 4RFOH 3IK2A 4F8NA 2L4OA 3HC3L 1DQLL 4D0BA 4OJYA 4OZGB 2IADB 2VAAB 2XKUA 1A9EA 2NY1D 2AV7A 4NRXB 4ESKA 4RFNC 4UM8A 2ZG1A 3CDZB 3D50A 1MY5A 1BVNT 4P9HL 2AZUA 1X5LA 2A9MH 2LQRA 4LDLB 4WWKD 1XQ4A 1N18A 3OGOE 5HYJA 5AYQA 2IMNA 2Q76A 4KXDA 1GZQA 5HI3C 3O4LE 4HD5A 1RH8A 1PF3A 4ZMPA 3H9SA 2R56L 4QR7A 3T3ME 4JMNA 5HY9A 2R1WB 2XX0A 5DZVA 1L5GB 3OAYH 2J4WH 2YZ1A 4M3JA 1YYML 3KL0A 4V1DD 3OJDA 2NY2B 5ALBH 4PJEA 2BY0A 4JM2B 4JPKH 3H3PH 3CHRA 3SDAD 2HLFC 4MX7B 3NRFA 1Q72H 2PCFB 2VR6A 4Y4HD 1HN1A 4QRUA 1T66C 3FH8A 1FCGA 1MEXH 3DBXB 4XAKE 4G8EB 4MAYA 1VGKA 3TO2A 2CJUL 4JDVB 3C6LB 5ID0A 4XXCC 1U8NB 5B7FA 2BNQA 4PCKA 4U6VH 1GW0A 4EPSA 3LZLA 2BY2A 5I1LA 4NN5C 3TF4A 3P0VL 2DTMH 2XN9B 4OR1A 4Z76B 1IVLA 1XGQA 2DYRB 2H32A 4FG0A 5I1IH 2EH8H 1WZ1L 2NUPA 4YGAB 1W72A 4APQC 3QYNA 1G7HB 4DO6A 3QIWA 3D4ZA 5F9AC 3QHTC 2OQJA 1T0MA 4Y0GA 3UG5A 4TNGA 1ZE3H 3VCLA 2ORBH 2E9JA 4YHML 2XKNB 2JNZA 2O5NA 3BXNB 3U7WH 1KXHA 3O8XC 3VXRA 3TN0B 4BZ2L 5CJXA 1HXYB 2WAQA 1JAEA 3U30B 4O4YL 5AFAA 3OLIA 3N43F 4YL4A 3MV11 1UWEL 5IP4A 4XH2B 2W95A 4L3EA 2QSCH 2CRMA 4J3OF 4XNMB 1MCQA 2QELA 3WTWA 5I71B 1PZ3A 4A2GA 4KJWC 1YPZF 1FORL 3FN0H 4HIIB 1MFAH 2I9LA 1QBML 1A7RL 1U95B 2O30A 2PTUA 2XPGA 5SX4H 3HG1A 5JOFA 3MNZA 4B53A 1G7QA 4FA7B 4X99B 2Q20A 5HYSB 4QHNA 1MCIA 1EDYA 3ARDB 3P73A 2CR6A 2CHZA 3IETB 2IDUA 5HHPB 1YQ2A 3QCTL 2EE2A 4CC4C 1KIQA 3RHWF 2R39A 2Z7YA 3QYCA 2Z65C 3GJFA 2WQAA 1I7RA 2VM3A 2GJRA 2VRKA 1JIBA 1KF9B 4ZFGH 4JZNA 4CMMB 4ALAL 2BCKB 1MCPH 4JFDB 5I9QB 2HXAA 2P5PA 4ZI8A 1MFDL 4L9LC 3BPNB 4YXLL 1BZ8A 3MBED 4LSRH 4MB3A 1DQML 4AEHL 4KTDL 4R8WH 3TM6A 4F7MA 1NLBH 2GKIA 2VH5H 3FYIB 3TJEH 3H7BB 4KI5F 4H0GA 1EBAA 4PVNA 4GRLD 3PY9A 4O02A 4Y4KD 4YC2C 2B39A 3UYRL 4PPTA 2FAUA 5E8PB 4PV9A 2DIJA 4RCAA 3U9UB 4PY7A 5L0QB 1EBPA 1ZD6A 3ASWA 1TJHH 2ICWA 3N50A 3BIAX 3V0VB 1DCLA 5DJ2B 1T6BX 3CFIC 1B4JL 3GMPA 4NJAH 1KBVA 3EOYG 5BV7C 5DWUH 2HWZL 1MHPH 1P6WA 5K59F 5D6CA 5AYTA 5HJDA 2NY1B 4XO5A 4P23D 1H15A 1TJXA 4AMWA 4PD4K 4R2GD 3BH9A 1AE6L 4LQ1A 2A9BA 3BW9A 4K8RD 4D9RE 1UOKA 3L3GB 1JFHA 5GRUH 2C26A 3CVHH 4JDTH 3C5ZD 3CPLB 3PWUB 1BAFL 1AACA 3SKJH 1TZIB 2PXYA 3GTNA 4WKXA 2LU3A 1KDIA 2BNUB 1V8HA 1NBZA 2Z64C 1QPXA 4LEXL 5HPOA 1F58H 3A22A 3QUKA 2NY0D 4V2CB 1ZLWH 2NY1C 2VQ1B 1N2RB 4KRPB 4UUJB 3BAEH 3ESPA 5L4IA 1UM4L 2BMKA 2ICEA 4M93C 4WCYH 4C59B 4JS7A 3FQYA 1EUTA 5FB8B 3MREA 4UQAA 3W0WE 2WLZA 3FK3A 5IFJA 3G6JE 5F8RC 1TVBA 3CSBA 5E4IA 3K6DA 3R0NA 3RVUC 1P5UB 4JFPB 1BBJB 2CJTA 1CLZL 2YGPA 4ES8A 1E9OA 1DCEA 2FD6H 2B2XH 3O4OC 1CJYA 2VXSL 3DX9B 4MLSA 3ZQWA 1MLCA 4HW6A 5HHQA 3BC9A 5EC2B 2ZOKB 5DK0A 2F5BH 1JDAA 5I6KA 4I0PB 2BP5M 5FKAA 3LS4L 4FFVD 1O9WA 4IU2A 4AJ0A 1R5VA 2KPNA 4L4TA 4A6YB 2Q2LA 5IFHH 3PWPD 1FNLA 1QSEE 1KJVB 2DICA 3V7AE 3KZ8A 1YNTB 2IEPA 4JAMB 4K9EL 4RDQF 4UT6A 3T8XA 1WA0X 1JXGA 4K07A 1EMTL 2R2HB 3N42F 3BISA 3CLEL 4IKLA 5E6IA 2DMHA 5BZWA 2DQTL 1H6TA 1I8IB 1V5JA 3VA2C 5AW4B 1IQDB 1CLZH 5C9JA 2R2HA 3TYFA 2Z9TA 4IRJB 3BDBA 4JVWA 4H8VA 4LOUC 1HZLA 1BD2D 3N5AA 3SBRA 4DKDC 2YUWA 1TITA 1UZ6F 3LZPA 1CGWA 1G1KA 3EF7A 5IVOA 2B16A 3T6XA 1IU1A 1VFAA 1SXNA 1HOCB 4YPGB 2FHCA 1WX4A 4HOWA 3NYKA 1FNEA 3AREA 4XWGL 4E41E 2JJSC 4NSKB 3SOTA 2I07B 4I18A 4P5RA 5CMAA 5EIVA 1PBYA 3MKKA 3HA0A 4S1SL 4KK9C 3VXPA 2R0ZH 4XMXA 4A37A 2I07A 5CMAB 1KJ3H 3S3PA 1W2KT 5C3IA 3RU8H 2AJZA 1KULA 3TCTA 1T6WA 2DQJH 5F3BB 2F0CA 4QTIL 1RAMA 1J0YA 2XN0A 2Z31D 3QA3B 4OUAA 4CRPA 4ZQTA 3CUPB 3L4UA 3PPEA 4JPVL 3MXVL 3WI9A 2R0KL 4YBQC 4DGUA 5DVOA 1S6NA 3L4ZA 4G6MH 1J48A 4HJUA 1VACA 2OW6A 3NUKA 4OFYD 4FTVE 4KJQC 4YHYB 3FUNA 4X6BB 3FTZA 3H9SE 2WP3O 3WIHH 5BOJA 1JZEA 1GZPA 3CXDL 4RMQA 1O7DC 4LFHG 2VZOA 1I8AA 3QARA 2WTPA 4LOFA 4JR9L 2IJ0C 3D4GA 2H3NA 2VXSH 3FT9A 4X5LA 5CKGA 5GSRA 3H2QA 3FUMA 5E1GA 3BGFB 1R0AH 4MDRA 3EOAB 5F9WB 2H3NB 5GSRB 4WSGA 4AJYV 2B1OA 1IGCH 4OIIL 4N3TA 2YAHA 4WHTA 4XNYL 3APMA 3O9WB 2DEYX 4GKSA 3DX8B 4Y2OB 4XHJC 3T4YB 3FFOA 3SGEI 1KGIA 5BS0E 1LNLA 5KSAC 4UDTA 3VFMB 5JIQA 1DJXA 1MVUB 4AGOA 2NX5E 2F8IA 4O2CA 3Q3GB 4UZUA 3RWFA 3BUPA 3Q7JA 4CC4A 4BQ6A 3Q44A 2EH7H 4JQIA 3H0TA 5D1ZC 3V0HA 2Q86A 4XBGA 3U36A 2RFXA 3DK2A 1EAPB 2XA8H 3OAZK 3AQZA 5J1AA 1VESA 3G5ZB 3PF2A 1SYVB 2X6VA 5EV7A 1IARB 2Q5BA 4JKMA 1HEZB 3UIZA 4OD2A 5E2VH 5E6RB 2QVFB 3RGBA 2C34A 3WY1A 5B39B 3U4AA 2UZPA 2DLIA 2A6JA 5ID1A 3K7UA 3HZKA 3WXWH 3EZ8A 2FZ3B 3QISA 4LLQA 3RWEA 3TIDA 1IGJB 2CIKA 3HFMH 1T04A 5AVSB 2VRQA 4L0PB 4HCRH 2W0PA 5LLIC 4XMPH 3GSOA 4FFZL 4OZHA 5DK3A 3EIFA 4PLKC 4K8RL 1WIUA 2GABA 4W6WB 3E9TA 4NEHB 3RX9A 4LSUH 4HKXB 5FM4A 4WUUB 3DMMB 3NDYE 2HFTA 5ETUB 3MO1B 4QTHA 2YC1A 3K0YA 5ESAA 1F90L 3Q6FA 4WTZA 3S7GA 3O0LA 3PIQA 4QTHB 4TPRH 4ZMLA 4HJGB 3T4AA 2EE6A 4JRXE 3OPZL 2PXYC 3CVHB 1EHXA 4OZ4A 1HL8A 3ZZLA 2ZUTA 2VAJA 2X2HA 4J12A 4R7DB 4RBPH 1F2QA 2NTSP 2Y7LA 3E6FB 4FQ1H 3UTZA 3EJZC 5ECGA 2R2EB 4F8PA 4BIKA 2AP2A 4KFZC 2OM5A 2AQ1A 1OAYH 3QUMB 1Q1JL 3ES6B 4OGZA 3HB3C 3ILPA 1PYWB 3AU0A 1U8CB 5JXEC 2HVKA 2BSDA 2XICA 1QOKA 4P8QA 3KM2A 4QXUL 1L3WA 3H42H 4TSAH 4AW4A 3DX0A 4EOWH 4QY8B 4J6VA 3QJRB 1MCWW 1WBYB 4AYDC 2Y22A 2XPZA 4KK9D 1JGVL 3NZHH 3VFRB 3VA6A 4MMZC 3D18B 4JDEA 4MD4B 1PD6A 3CXDH 1Q4NX 3T4AC 2ZTBA 4V33A 2BNQB 4PWHA 4JRXA 1K72A 1NZRA 3QJVB 3F12A 4M7LT 2WO3B 5G5DB 1NOFA 3AITA 3FBQA 4JW3A 3RNKA 3E1ZA 4LBEA 1D5RA 3GSWA 1ODAA 5IOPB 2XRAL 1UJTA 4KI5D 4R4FH 4CVUA 2L7UA 4AC2A 3I9AA 3PJLA 2TRHA 3NCEB 3QNZB 3TLRA 1QBLL 2E7DA 2Z93B 1A4KA 2Y7OA 3IMWA 3LHPL 4H13C 4H1LG 4J3TA 4M4RA 1EANA 3OZ9H 4KI1A 3BP5B 5ANMB 3UO8B 3NN8B 2RHEA 2VRAA 2DYPD 4HWBL 4FKKA 3QXUA 2LFEA 3BAJA 1ZY9A 3BAWA 1IKOP 2PWFA 3LRGA 2ZWSA 3PJNA 4HSQA 5TPWH 1QRNB 4UM9B 2PO6A 3QRBA 2FNWA 2FT8A 1FNHA 4PJBA 1HSAA 5B1JA 4PWKA 4XX1G 1L9TA 2EC8A 3OD3A 1CURA 3VD7A 3ZKXB 1NM4A 4EZLA 4CDHA 4GKNA 2BNQD 1ANUA 2APBA 2YAOA 2YKLH 2F74B 2JJWA 1BOGB 3T09A 5I19L 1A0QL 3GTVA 4HFUL 5AYUH 1IGMH 1RVFL 3GRBA 1ZMYA 4QYOB 4Z0ZA 1E4XL 1LK3L 1OE2A 1YYLH 3TU6A 2YUZA 4EIBA 4NRZB 4JPKL 3FUFA 3SKJL 3TO4B 3MTRA 5C0JB 3P73B 4NQCE 4HUUA 3GHEL 1SF3A 2KH2B 2WK2A 1M1XB 1PKQA 3DX6B 2QMKA 4AZ8B 1UWEH 4BKSC 2CKBH 3KVPA 3SQRA 2OJZH 1A22B 4JZNB 1ITCA 4PP1C 3UPCA 4Q6IB 2E9BA 4LMQE 1HH9A 2J2ZA 2PO6C 3GSXA 4UILL 4ODTL 2E56A 2VSCA 2VSDA 5CZXD 3RZWA 3T6QC 1KYDA 4OFKA 4HGWB 4HCFA 5IQLA 1E5UI 1XGTB 3B9VA 1OEZW 2QZQA 2IMMA 2DWTA 3RVWC 3QUHA 4G1EB 2OSLB 2WVVA 3C12A 2RD0A 4M8UA 4MKTA 4UZGA 5IROC 3EFDL 1YDPA 2ZUQB 4RDBA 3NAAH 5TQ0H 1N12A 1C16B 3ZR5A 1INQA 1DN0B 1JF1B 3ASNB 3BSGA 5DFWH 1E8WA 1E4JA 4PW9A 1A6UH 1HINL 1KPUB 3OAUH 4NRYB 3GRWA 4XPAH 2NMSA 3R8QA 2G5BB 4KJPD 2YSTA 1RQ5A 3CFKB 5SV4A 2NXZB 4GQ9L 1FN4A 4XXWA 3MRJB 3H9YA 1HEHC 4FYRA 3NQKA 1ZLSH 4HPOH 2ESVD 1P7KA 4Z7WA 2B0SH 3CU1A 4QRPD 1NFDB 4Z95H 1G9MH 4R3SA 2ZUQC 3CZUB 1Z3GH 3V6ZB 3WNJA 2WP3T 3FH7A 3O2WH 7FABH 2FH8A 15C8H 2BIQA 2E7MA 4W9CC 1CO1A 2DQDH 2FJGB 3Q6FB 1T20B 4XI5D 5ADOL 4O2FA 5I1EL 4ZUWB 4R5TA 3KLDA 1LE9B 1U3JA 4D0CA 4JNXA 2NNFA 4G70B 1N2RA 1UCBL 2P8PA 1I82A 3P30H 3IJ9A 3RJQB 1JPEA 1NDTA 3P0GB 2OJEB 1WVZA 2H41A 5FGSA 1GTFA 2WXMA 2C9VA 4MYPA 4ODBD 4ZFOL 4M7JH 3OX8A 3UTZB 2FBJL 1DTUA 2B59B 1PKQE 2X4NA 1XCQB 1VJSA 3R4DA 4MCNA 1JPFA 2OK0H 3BLBA 3J27A 4ADIA 4QRUB 3IFNL 2VLKE 2YEQA 1IM3D 1UOWA 1JPFB 3LD8B 4HZLA 1Z1WA 2BDNL 2ZX9A 4H1LB 3CX5J 4DP4X 4KX8A 3IKKA 4KPHH 5F96H 5KYYB 3DPDA 3KMDA 3OKLA 3WS3B 5ICYA 2VCOA 1CFNA 1R47A 2NRDA 2XWRA 4PVMA 3IE4A 5KYWB 4Q4IA 4BQ9A 3VXTB 2BM3A 1SBBA 4DKAA 2JKIS 5IWLC 4AGMA 4FLQA 2C3VA 2P7TA 3T65A 3TTYA 5D1QB 5KJ4A 2ZOUA 4ES9A 2KYIA 3KCPB 3QCTH 2YXMA 3I9IA 5F7EH 5JO5A 4KXBA 1OWRM 3D0LB 3WNKA 1MPAL 5E4AA 1ZWIB 1T0NA 2YD3A 2ZOLB 3HPLA 1AZUA 4JFFA 2XWDA 2V9UA 4OAWB 4P5TD 5E7FA 4NHCH 1KDJA 3TN0A 2FWUA 1JVLA 1Q9LB 4PJIE 4YO0A 4TQ8A 3DIFB 1J1OH 4XCFL 5AG8A 2I69A 2GJ6A 2VZTA 2WM0A 1HOEA 5FUZH 5KYNA 2C3XA 3WIIH 1HH6B 1WAAE 4DVBA 1LL1A 3RNQA 4B9PA 1ULVA 1XSJA 2VZSA 1K8IA 4KDWA 1F0LA 1JUFB 2I26N 1A1MB 4L9LA 3QDGD 3KJ4C 1HZKA 2YBRA 2G2NA 1MVYA 1OM3L 3OR6A 2P43B 1BDYA 4XNMA 1KWKA 1VADA 1E5AA 3GBLA 3FQXB 4MCYB 3PNRB 1ECZA 3OR6B 4ODSH 4V11A 2R7EB 5E5MB 4M48L 1U95A 1ZA3A 2XPGB 4CBZA 3TV3L 1CD9B 2JIXD 3PGCB 1JXKA 2L7QA 4X8XA 1MNUL 2D31B 3B56A 3RY5A 1LEGB 4BSWA 3R18A 3KVDD 3MRRB 3T71A 3ESVF 1CXKA 3SDAA 3VFOB 2J73A 2VGLM 3ZGIA 1OAJA 4BWUA 4KNUA 2XZQH 3DYMA 5D7JB 3INUL 2ADJA 1FHGA 2WD0A 1RIVH 2LT9A 1LJMA 3US9A 4X4YA 3RIFK 2C1PB 3TFBA 1Y0LB 1YO4A 2CWRA 3KBEA 4YHOL 2VR5A 3T2PA 3MC0A 2DKUA 1KC5L 1HIMH 2B1AL 2C1OB 4BK5C 1GSMA 2VDLL 5HYJD 4WGKA 5D7KD 3ZTCC 2OYLA 3C09B 3V9CA 4ZMOA 1ZGLA 1TFPA 5E9DE 5AVWB 5EPMA 4BCYA 3IVKA 4RFNB 5E94A 4G6ML 2D0HA 1N5YL 3H9ZA 5GJSH 2IDCA 5SWZA 3U7YH 1E2VA 1IFGA 2O1AA 1JXJA 4GRWH 5FYKH 4HEME 4L4JA 3V6FA 1CS6A 4OLUL 2FLMA 2VMJA 4N0FA 5DHYB 3LEXB 4FFWD 2J43A 5AVVB 4KO7A 1TZIA 2AMUA 2NY6B 2VISB 3CN4A 3IF1A 3OKYA 3OKMA 1N6VA 3BXNA 1IGFH 2JXMB 1KCWA 2BZDA 4HIEA 4PJGB 1X5KA 3CFTA 4TNFA 5LAPA 1EAJA 2GAZB 2HG5B 2OTWB 2OMWB 4ZXBC 5IIEB 4S1QH 2XYBA 3D6GA 4OZFA 2C7UB 1SXCA 3D05A 4POZC 4XZUB 1NBZB 4N2DA 3IDIB 4FI8A 4Q2ZB 3E38A 1HAUA 1FO0B 1KCSH 4A7UA 5HYJB 2WW8A 3PCYA 3WIFB 2K78A 4OF5A 2OYPA 3NBNA 5IB2B 2RR3A 2NY6C 2E27L 1FZOB 4JFQB 1UFUA 4YR6B 3GWJA 2WB1A 3ZTNH 1PU0A 1YEJH 3LVEA 4Z7UA 4YHIB 3D2UD 2IH9A 5KJRL 3NCCB 4DEUA 3D0VB 4TVSa 1TTBA 4PGDB 3FT3A 1DBBH 1FCCA 5I15H 3LX9A 1A02N 1YNKL 2XV3A 2MOQA 5ETUA 4CGUB 2DQ6A 4KKZA 1A4BA 2K0RA 4JQXA 3I3BA 4HKZA 1NM9A 4ZQKB 2GYSA 4ABWA 5HPMA 3LRSA 4ZTEA 2XX1A 2X1QA 2AJUH 2K7PA 4N2EA 4G71B 1G1YA 4N8CL 1OP4A 1JDCA 1OP9A 1QSZA 4LIQL 1AGEB 1JWSB 1LO2L 3IMSA 2OR9H 5CN1A 3RAJL 3TEYA 3DX7A 3JV6A 1CUOA 5J9PB 4H8QA 1G7PB 1IX2A 1EHLL 3BD3A 2XXMB 4I77L 4NM8H 1ZEAH 2JQAA 3FQ2A 2J1KA 3EJSA 1YY9D 1E40A 4GAJH 5DD3L 3OKDB 1ERNA 4JO4H 1ZPUA 4TVUA 4XAWH 8CGTA 3GMPB 3RWIA 1NCNA 1X5HA 5EU6D 5DURD 3AX0A 1BMGA 3DA0A 2AQQA 4ADGA 1O7DE 3HZ3A 3MN8A 1UXSB 4AEFA 3WFDL 2YBGA 1X7TA 4AMKL 4JFZL 1RK1A 2GCYB 4X80H 4RRPM 1JFQH 4DN3H 4NQEB 3QRLA 3GMQB 3QP3A 2UXVA 3G6AB 5CD3A 3UTSD 3CPUA 1I1YA 1BFVH 4ZS6D 1WITA 2NR6D 3II1A 3ZYOA 4Z1PA 2GSMB 2Q8BH 1RJLA 1V7MH 4WI5A 1CVSC 4TL5A 3ZT6A 4GRMA 1X4XA 3ULVL 1BJ1J 1NA8A 1RLBA 2Z7UA 1RZIB 5KYUB 3JXAA 1HYRC 3GRWL 4DN4L 4PMEA 3IU4H 3A23A 2H9GB 5HYJE 4P2QD 4AIZB 3DTDA 5K9QI 3SGDI 1TQBB 1BPLB 1P7HL 3VXOA 4NHUA 2Y5QA 5KVEL 4KRPD 4TRPL 1BFOB 5JUEL 4P5KA 4NFDA 5AW5B 1K3ZA 2KBGA 2Y5EA 3PFQA 5B4MD 4E0RA 2WTOA 3NA4A 2BCKA 2QGEA 4JFDA 4MA1C 4PH8A 1OP3K 5JLZA 2C9XA 4HH9B 4JM4H 2ITDA 4MZIA 2ZXQA 3DETC 4L4TE 4MAZA 5AW6B 1JZ4A 2Y9RT 1NCBH 4NNYA 1MXGA 5IBLD 4I1PA 3A6BH 1WCBA 1OARL 4LP5A 3LZOA 4NOBA 4OJFH 1TPXC 2HTLC 3VDAA 3FHQA 1VFOA 3DHJA 3MRIA 5DJAB 1XZWA 5I6XB 5L2JB 1NCGA 2CJUH 1RUMH 1NUFA 4O5LL 4L0ZA 4MS8D 4PP2B 4RMTA 5JR1L 4WU7A 2QV4A 3UZQB 1JXFA 1BVNP 3ARSA 5M7QA 3E8UL 2ZP0T 3NRPA 4JEGB 4XCNB 4K8RC 1UHVA 3NSJA 1C7TA 1ETJA 4JFYB 4XPTH 1U8LA 3D8MA 4Y2DA 4YX2H 3UCRA 1DFBH 1I1CA 4ORZC 4WWKB 2V5YA 2F53A 3GIVB 2HJLB 4XP9H 2W80C 3QDJA 1OW0A 3GSNB 5KZCD 5I1DB 4YHZH 2WIIA 4X9BA 2FIKA 1K8DB 2APTA 3KG5A 1DDTA 3Q6GL 4JY6A 4Q9RL 2L04A 2APSA 1E9QA 1PZBA 2CSPA 4HS3A 2WZ0A 3U7WL 4PJIA 2FEDC 1DVFC 2YSSB 3F04A 3AG1B 3V0WL 2XVGA 1G9HA 5BS0B 1DVZA 5CFAA 3HVNA 1I3UA 4X50A 3MBEC 2G0LA 3LY6A 4FQHA 5LHDA 3K2MC 3NACL 1ZIAA 3KPNB 1ITBB 3VFTB 4QHUB 2X4UA 4KKBC 3SKNA 1C5BH 1JYXA 1I7UA 1XWVA 1YNTF 5I1CH 1XEDA 4D7PA 3GSRA 4NO5B 4GAGH 3FN9A 5BUAA 3LKOA 3GTTA 1AYRA 3HHSB 3IDJA 2E76C 3L3OB 3VMNA 1U58B 2KC0A 3UTOA 4Z0XB 2DLHA 4GRLB 2F7PA 3CX2A 3I9GH 5D1ZB 1ZT4A 2C9SA 2OMBA 1QX1A 2NR6A 2VDOH 5IV2B 5AL8A 3MX0B 3O9WD 4XPTL 5EIIG 4G1MB 3D3VE 5EZOL 4KMTH 1IGYB 4E9TA 4JFXB 3M86A 2AJSH 4KK5D 1YJDL 4NO3A 3T04D 2Z6FA 4YSCA 4TLKA 1FGVH 1LO3H 3CIQA 3VXRE 2ALAA 3TEWA 5D2LB 4GRWB 5I71C 3N9GH 3S98A 2YPLD 5HGBA 3VFVA 2ZKWA 3CBRA 3N1FC 2ZG3A 3ZDZF 3RIKA 4HLZH 5HGBB 1FVEB 4OW6A 3JWDL 3AABA 1JPGA 3KDPB 2JSFA 1MI5D 1SDAB 5I74C 4G80A 2E9IA 4NO2B 5E6ID 1DYZA 4XTRD 3BH9B 2P45B 2UWEB 5I0ZA 2WJ7A 4XE0A 5J4MA 5SX5H 2IQAA 2H1LM 4JQXC 1BSIA 4XPBL 4YBHA 5E0FA 1RZPA 2FBOJ 2HUHA 1T1XA 3EF4A 3EJQA 4YZWA 2EIMB 5IHZA 4GT7A 3MLXH 2VWEE 5EWIL 3PL6D 4NUJA 4R4BA 3SQBA 1W16A 3UDWA 5AD0A 4FZ8H 4MJ6A 4OVVA 3FO9A 3JYBA 4UV7H 4L1TA 4DP5X 2X9XA 4KDTA 4RVBA 1U91B 3U0PA 4NHCL 4PJ9A 2WZPA 1IAOA 2WLKA 4RNRA 2YD5A 5GS0C 2VW6A 4OCXH 3MDJA 1F11B 4NC2B 5D7IA 2CDFA 3QUXD 4L8SA 4KTGA 1BA9A 2JK5A 3ZW3A 3B9DA 3NIGE 3SDDC 5IM7B 5FIEA 4HQQH 1SJMA 3CUPA 5D7SH 2X70A 3PREA 5KSBB 4F7CB 1ZIBA 5KSUB 5ITFB 4XCCH 5LDSA 4ZUVB 3KW8A 3R1GH 2YWZA 4EMZA 2YC1B 4FL4B 1ZLEA 3TO4C 1UZ8A 3GEWB 5K9QG 1PAMA 4MD0B 4MMXC 1FAIH 3BPLB 3I3EA 3QUZB 2ZIDA 2N1KA 3ZL4H 2J8UA 4ZMZA 4XNDA 3NIDB 3VX1A 1ICTA 5IHLB 3BEVB 1NDGA 3FU7B 3KPPB 3N42B 5HI5D 1CDUA 1S7VB 2VLMD 3LOWA 3DKHA 2EVFA 2J8UB 3HS9A 1WWBX 4BXVA 4FXLA 4MCYA 3DIDA 1S7RA 5FO7B 1IM3B 3GHBL 1F41A 2Y7SA 3QR2A 4HETA 2X4RB 3REVB 3CU7A 1E4HA 2B3IA 3CN1A 1I85C 4QXTA 5FX3A 4QAMB 5I0DA 1NCDL 4P46C 4Q6IA 3Q6GH 3WFCL 1GKOA 5D4QA 3NQ1A 2XVBA 3FUEA 5B8CA 5EF1A 1D5IH 5K9JH 5BMFL 5DJ6A 4Z6AT 3QXTA 2KUTA 1A1NA 2AXHA 3KPRE 1FHNA 3TYFB 4C56E 1PDKA 5L2KA 2QVMA 1L6ZA 3AWGA 5I16B 4M29A 1VERA 3O4OB 5CU9A 3UC2A 4FFZA 5F6IC 3CFEA 3TJHD 2GK0B 3NFNA 1IGML 4U1NA 3CVIL 1SUHA 2V2XA 3GSNA 3QRGL 1CXFA 1FAIL 1KGUA 2ZX6A 3S4SB 1UKSA 1GKEA 1YMME 4LSPH 1T7YA 5AAMA 5EN3A 5DHXB 1N5AB 1SNRA 1E67A 4MNGB 4X6EA 4GRWE 2E8YA 2GITB 2HJFA 4JPIA 4IHOA 5TE6L 1LO5A 3ULVF 3QJFB 2XSKA 2N7SA 4J1UB 3QNYB 4PBXA 4QF1B 3QNZA 5EOCL 1QYGH 5HVGB 5T8IA 4BFIB 2OL3A 1N26A 2Y7QB 5GSVB 1G9NC 3NJKA 3OTTA 1OB1B 4OCSH 3SIKA 5KJ7E 1Q9OA 1N8ZB 1MIMH 5IB1A 3QQ9C 2WSDA 5DD3H 4F80A 1KTKE 3QDGE 4OZFH 5GS1A 3F7KA 4UAHA 3NACH 5K5YA 3ZSTA 4R3SB 1T22B 3CD4A 3S3DB 3SE4C 2K8QA 3FJTA 5CINH 5AOLA 1FIEA 3FOMB 1SQMA 3LPPA 4Y9CA 2ZOTA 4XGZB 3KPLA 2VO5A 3H9SB 2GJ6D 2A1WL 5CBEA 5EC1A 5FO8B 1N6QH 4M43H 4OCYH 4E9SA 4MMZB 4EI5C 3OC5A 5AAMC 3W38A 1MWAA 1OTTD 4PJ7B 4OLZL 3N0PB 3I6KA 5G2NA 1FZJB 1M3IA 3MRHB 1KPRA 3UZEA 4XVUD 3U1PA 1PLGL 3TYGH 4YE0A 2CA3A 3HR5B 5I76B 2PW1B 3ULVH 2CO6A 3DVNB 1J1OL 2PCFA 1PY0A 2OPCA 5KBKA 2D0GA 1ED3B 1MW2A 4MA8H 4B3EA 4XZ4A 4NKOB 5EOQL 1ACXA 1HWGB 1R3LB 2JKRM 4HU8A 3AAZB 3NIFB 5EU6E 4AT6A 4HD7A 1A7OL 5CGYC 5TE7H 1BEYL 1CDBA 4ODXB 2CO7A 1WBYA 2I7OA 2CR0A 1T89A 1ZS8A 1W72H 3LNDA 3D06A 3TZVA 3P3TA 3RWCA 2VE6B 3QR0A 4WY7H 4ANKA 3ARYA 2XN9D 1IEHA 3FMGL 1INDL 5BRPA 1TTAA 3SQBB 1B3JA 1KIUB 2Y1VA 1O7VA 2X4QB 4HFWB 2CK2A 1S8DA 1UYWH 2VTFA 1MNUH 1SYVA 4PW4A 2G4EA 4GI6A 4ZAKC 3MXWL 4P46D 3CFKA 2YAQA 4PBWD 4MJ4A 3UXFA 3WD5L 1EZVY 4TMPA 1T0NB 3IKCB 3MJ9L 4XN2A 1TJIL 5CJOH 4PJBF 1NAKL 3BN3B 5EBWA 3C5SB 4PAZA 5TJWK 1AQ8A 2X2UA 4ZUVA 3CHOA 4KVCL 1ZVHA 3CV5A 3EXLA 2FJGA 5CU5A 2VLJD 3DMMA 4GP4B 2ZX8A 4LASH 4PR5A 4XO4A 5FUZL 1NLDL 2UZXB 4YIQA 3IJHB 2BWQA 4GXVH 3MNZB 4H8UA 1J0ZA 3K5SA 1NCTA 3L1OL 5HDBB 1D7DA 4XN1A 2ZXBA 3NK4A 3EOTL 2BP0A 2AJXH 4TS6A 1M7DA 5E2TL 1JV5B 1XGRA 1RZGA 1WX2A 4QWWC 3TWYA 4ZW5A 4JFHD 2X0VA 4XP6L 3ROOA 1TZAA 1M7DB 3RTQC 3K81A 1RZ7H 1DBKH 4C4UA 2BVOA 2VN5A 1ILSA 4EKJA 4Q97A 1EK3A 2DAVA 2P42B 3H2WA 5DCCA 3D51A 3CLFH 1DBJH 4IK7A 5L6YH 1P53A 5D7LE 1XBDA 3VFUB 1T1WB 2ZONA 1SY6A 2GPZA 4MJHA 4HGWA 1XBRA 4PV9B 2E86A 2FX9L 3KPSD 4X7SH 3WE1A 3W3BA 3NZUA 3ARBC 3IVKB 4N68A 1W6LA 2FJSA 1GL4B 1MJ7H 4UT9L 4QHKJ 1N64H 1P5VB 4Z7AA 3KPOB 2ADIA 3HCVA 4XCEA 4U33A 3MRNA 1N5YH 5GGVY 1HI6B 4X42A 5BRZB 4C58B 1DSYA 1QFWH 1Z32X 3QZWG 3BRGC 2EDMA 1WBXA 5AVQB 3WAJA 1HL4A 4GO6B 1T21A 5IQ9B 1FVCB 2HB0A 4QWWD 5TGBB 3D9AH 3PHAA 3V4PA 2PPCA 5T1DH 5B8CC 1L0QA 1XD1A 2QVKA 2BSSB 2D0FA 2O61B 3TT3H 5D55A 4QKXB 1U2YA 5DJZB 4P3CL 4NKDB 3RNQB 1JD7A 1XH0A 2QEJA 5JIMA 1NGQH 1B0GB 1W8OA 4M6OH 1FZMB 1YRKA 3PL6C 3QJHA 4PB0L 4YDNA 4PGZA 3GJFK 5I8CA 2I5YH 5JR1H 4PJBE 4D9QE 5BV7H 1H0DA 2W0FA 1LHZA 3JV4A 5C07E 4Q2ZA 4N24A 4DP8X 4ORGB 4XTRC 1NCAH 5C1MB 3QCUH 1M57B 4OUOA 3PABB 4YDVA 3HLAB 1YAZA 3MUZ1 3QIUA 1AD9B 3PL6B 5D5MF 1QTPA 2X9ZA 5LBSL 5BNXD 4WAFA 3QULA 4PJHF 3EDEA 5MEND 1T1ZA 2CRIA 5DMYA 2ADGB 5F21B 2GC4C 2VDNL 2FBRA 4EZMA 1WIOA 1D3CA 3HBQA 1QW9A 4PJ7F 4F5CE 4ZFFB 1HCZA 2P5EB 2UY7B 4KTEH 3HFML 3SDXE 2NQ3A 4MKMA 5IG7B 2C7FA 3CH1A 4N2MA 5SX5K 1QA9A 1ZT1A 3SZ6A 3T8XB 3UC0L 3L9BA 1AGDA 1W0WA 1IJ9A 2FQEA 2DM7A 3CZSA 4RAUB 1KEGL 4YHOH 4YDLB 4YZFE 1CK0L 4YXHL 1MNNA 5I6OA 4FABH 2Z31B 2HKFL 1U3ZA 2H8PB 4L5FE 5CBAA 4GSXA 2PCXA 5JW4M 4M7KL 2GCYA 2YXFA 4UQ2B 5DHYA 4NQTA 3P0YH 4BH8A 3MV8D 4KKBD 1GRWA 2EIDA 5DRZA 1FRGH 1G43A 1VZHA 4HKJA 2ZX5A 5KOVC 3RFZC 3GEFA 5I8EA 3FTVA 3Q01A 4LRIA 1PD0A 4HX1B 1KTJA 4GW4A 4XWGH 3S96B 1V05A 2W65A 5E1HB 4NIKB 1RJLB 1NC2B 3MFGB 4DGYH 4FNRA 3U46A 5T3XE 4RSYA 1XF3A 4D7BA 2AAVA 1Q0XL 4HK0A 1EIBA 3SDXA 3EJPA 5I6PA 4TULH 1F2XK 2VDRH 3F83A 5F7BA 1OM3H 5FV2A 3KPRA 4C56A 2YD6A 3OM3B 4YDJA 1MFEH 3C08L 3RJOA 4FQIL 4AH2A 4D0CB 4MBOA 4M6ML 4NQSB 5D6DC 1DJYA 5EUKA 1QSFA 4KMLB 1JG9A 4BBWA 1B2YA 1L9QA 3RGHA 1MDTA 4GRWF 2OR8A 3CN0A 3BHBA 3ZYJA 4WFEE 1UCBH 2QHRH 1JTOA 4N1EA 3UAFA 4X6BA 3FW6A 5E8OA 5D71L 3CHSA 4F15B 3HR6A 1MFNA 5A7EA 1ZTMA 1NEZA 2EYRA 4J4PA 3RFZA 4RZCA 2LHAA 4PJEB 4I5BB 3RWDB 4U1HA 3GI9L 3ET9F 3VH8A 2X5PA 5BQDA 2E4TA 2VDRB 5CNHA 2OULB 2XIIA 4JRYD 3E3QC 2HT2C 1IZKA 3H42L 5FKAB 2VR4A 4N0YL 3MCG1 1IE4A 1P4LB 3S0PA 5DMGC 3TNNB 4DF9A 4DPBX 5IHHA 4AZUA 2HRPH 3NQ5A 4WI4A 1H5BA 1PZ5B 2IBGA 1BD2E 1NUNB 4RWHA 1VCAA 3G08B 4UBDD 4BZYA 4G2AA 2F8VA 2P24A 2ZWGA 4QI3A 3BESR 3NAAL 1U8KB 1RHHB 1DBAL 2ZSVA 5IESH 3KEDA 4PSPA 1WF5A 3ZOAA 1SXAA 2G3ZA 1DVFB 5BVPH 3DUSB 2IWGA 3UEZA 3TBWA 3GSNL 4XXCA 3IMUA 1FDLH 5PCYA 1T0MB 1U3HA 2E7LC 4BFNA 1KENH 2DD8H 3P0YL 3LH8A 3NIFE 3DIFA 3DVGB 3UTSA 1U8LB 2NYKA 5LGHH 3IXAA 1QMUA 2VLKA 3BCDA 5C6TH 1OZUA 2UY6B 5GZOC 3SPVA 2JCCB 5L0QC 3O6FB 1KACB 4JN1L 4FXGB 1LD9A 4KKLD 1YNLL 4U3HA 5HYQA 1G7QB 1Z9SA 5DO2D 4Y8DC 3O6FA 3TURA 1MQKH 4PRIE 3RWHA 1N70A 4KVCH 3RDJA 2EDEA 2E59A 5ALCL 2DL2A 2GT9A 5TF0A 2LVCA 5DGRA 3LKNB 3ZLQC 3DSNA 3TFKD 2X2YA 3PABA 3V0IA 4FTVA 2Z1KA 4WNJA 4HJ0C 5DK2B 3Q1SL 4Z7QF 5F97E 1WZ1H 3SJVB 3GSRB 1ZT7A 4NO5A 1U42A 3S3BB 3DRQA 3MX0A 2WCSA 4JO8A 4AQ1C 5JOEA 4WHYH 1FFQA 1HHGB 3WLWC 3B43A 4Z7VB 2J88H 3EJYC 3LQMA 4MJ5A 1M1SA 1NMBH 1BD2A 5IG7A 2AF2A 1QBLH 3OV6A 2X1OA 5KTEL 2A9AA 3GI8L 5A2FA 1IBGH 4BQBA 4WHYG 3GD1C 2K4AA 4F58H 4LLDB 1FG2A 2Y2TA 1EGJL 5CLXA 4QY8A 1BVKA 2CIIA 2JKXA 4HOZA 5BVJA 1TZHA 3V2AR 1EFXA 4JANA 5IFAL 5DS2A 4P2RB 5B3SB 1G9EA 1CK0H 3UTSE 3G5XB 4GP5B 1JPTH 4UNVA 3BUYA 5IFAH 2MWCA 3DV6B 3WIHA 1YEKH 5KWYC 1I8MA 3FDWA 4JHAL 2PXYB 4XE5B 1X5AA 2BP8A 4J7RA 3FONB 5D7LA 5ADPL 4MJID 3H4FA 3WE6A 1P4BL 2GIMA 2IOIA 4I0PD 4YK4C 1Z5LB 4W1TA 3VD4A 1ZLSL 5LNEA 1QFHA 3Q8FA 1YEEL 5SWZD 3IMBA 2ZWDA 5KSUA 5FB8A 3B4NA 3ZHDA 2OTUA 3FO1A 2WB7A 4ZNEE 3EBIA 1FVDB 4Z7UF 2BC4B 1HSAB 2VDRL 1J5HA 2FCBA 1P1ZB 3CZJA 4HKXA 3OPZH 4XX1E 3N3EA 4XN7A 1O6SA 1FLRH 3W0WA 4F7EA 4GG8B 5BJTB 3F5WA 5DUML 3FT3B 4U6VL 3IFOB 3QQNA 4H88H 5ACMA 3X1GA 1XH1A 3T2LA 5JORB 2R4SH 3MRGB 3D3VD 1THCA 3OGCA 2FO1A 5DK0B 4TOYL 3HG2A 3LRSB 2HAZA 1OSPH 1NPNA 2APWA 4KK6C 4XP6H 3K6OA 2CRZA 5DYOB 3OXSA 1HQ4A 2BOCB 1CN4A 4GG6A 3O3DB 2EDYA 1TFHA 4M7ZC 3QXDB 3IGKA 3FFCE 3DGCR 1P9MA 3KCWA 5BRZD 4OD1H 3RX8A 2IPTH 4F8OA 4GKSB 3QEQA 4WU5A 5F72S 4ODUB 4F5CA 4UT6H 4TV3A 1BJMA 4H5SA 1WAAF 2W8CA 1S5HA 3WJJA 2LTQC 1FO0L 3K80A 4UTBL 4QXUH 2YQGA 3QRFM 1WFOA 3SY0B 5CSZB 3WFCH 4G8GB 2O72A 4FQIH 1K6QH 2FX7L 1JE6A 3H54A 2R29A 2J21A 3OMIB 2WO2B 3FZUD 2OW7A 3TCXA 5KVDE 2Y2YA 3OWEA 4Y4KA 5FW6A 1U3HB 4P4KB 3AY2A 5LCVL 1L6XA 5F6HJ 4AVJA 4AYSA 3GSVA 3MACL 4NQEA 1CFTB 2X38A 3ZDWA 5I16A 1I1AC 1HOCA 4YPGA 5JXEA 1OXYA 4LSSL 2X89D 1JZ8A 4KTDH 1RHFA 1TF4A 1U6AL 3OKNB 3GS7A 4YXKH 2B4CL 2HRPL 3VNZA 4YMPA 4A1RA 4JPIB 1E0OB 1XCTB 3LQAC 1B9ZA 2BHYA 3NPYA 1IT9L 3MCLL 5I23A 1L9RA 2F6AA 5H2BA 3W11C 2ZYIA 1PZCA 3FCBA 3WBDA 5TK2A 1MFCL 1LO4L 1TLKA 3ZK0A 2MIZA 4G5AA 4WUUA 2VXVH 3F7YB 4OJAA 4M9PA 3ZJAA 1C5DB 2WXHA 2LR4A 1LWJA 2YPVH 3GMMA 3PWNB 3B3IA 4HG4J 2J6EA 3ARDD 3WN5C 2WBJA 1GMIA 1KOAA 4L3ED 4PJ8D 1NGWB 1FGNH 4J2XA 4NUGH 1YEKL 2BP3A 4N2NA 2JLLA 4FDWA 5I18H 2A5UA 2G9HB 1KGXA 3CVHA 3DIVA 1XGZA 4R7NB 5GRUL 3STBA 2H47C 3U4EB 2RACA 4NQUA 1SYSA 3BUTA 4M8RA 1TZOA 1CTMA 3TVMB 5I8KH 4ORGA 1FFOA 1ED3A 1WFNA 1PZ2A 1RZJL 5FGCB 1BXUA 4PFEA 1OB0A 4D2NA 2XWBB 4NQDA 5IF0B 4A7VA 2X2IA 1M1XA 5GXBB 2CHDA 3MUY1 3Q5OA 4L5FH 5GJTL 5IF0A 2KZKA 1BJ8A 1CCZA 3PQYB 2NUTB 3HTLX 4YEFA 3VW3H 5ISZD 3P54A 5MP6H 3P2BA 2D7QA 1JZIA 4DK5A 5E5RB 4TTDC 4XCNA 1O9VA 5I9QC 2JELL 2UUDK 3VD2A 4WUKH 4DO5A 2ADFH 4U1NB 4XAKD 4FI6A 4KBPA 4X9FA 3T9WA 1FE8H 2R4RH 4ONHB 2VE6A 3C6EA 1YN6B 5CZXC 3F12B 3MV7E 5E95B 4AKOA 1EAPA 2IGTA 4OUUA 5D72L 5TF1L 3CFMA 3ZHLA 3U6XS 4NXSA 4XCYB 4UQIM 4LLQB 4DP6X 3FF7A 3CSTA 3HPLB 3L5XH 1D7FA 4M1GH 1ETZB 2BVYA 3AU1B 3LNFA 4DTGL 2Z8WC 5DSCA 1IQWH 1E6JL 2Q10A 3UYPA 4FP8L 5J13B 3RDTB 4U2ZA 5DC0A 2WNXA 1V55B 2F19H 4H2AA 4Y4HB 1OOWA 1MJUH 3HZYA 3P9LA 3O4LD 1DJHA 1CDYA 2WSKA 5I8EB 5FDWB 1P5UA 1WWWX 4OFIA 5KVGE 2G60L 2ICWI 1J8SA 3DJ9A 5FGRA 3LXCA 3D2UB 4P57B 5DVNA 1NANI 4HEPA 1CXIA 2P8LA 5DTFB 1XF3B 1GC1H 1ZHBB 5AWNH 1SF5A 4M6MH 4PWJA 2HRLA 2X4OB 3FQWB 4LFHD 5D70L 3C9NB 2V6HA 3P77B 3KGTA 1AGFA 3QW9A 1CGVA 1DANT 3HI1A 4P5MB 4UQ3B 5CLTA 4BXSV 4JZOB 3HJEA 1H3XA 2DIEA 3EO9L 3P77A 4A7QA 3OR7B 4R96B 1KV3A 1NFAA 4NYLA 3EYSL 4QDGA 3ARQA 1OT4A 3HAEA 1LWHA 3HC3H 2BIMA 2ZP9A 1JRHI 2QVTA 4H5SB 3UG3A 5A3ID 3VWJC 1LQSR 3ZKNC 2JIXA 3O8XA 1RUQH 5DR5L 1P5UC 4N5ED 3T6ZA 4AT6B 3STLA 1RUML 4OLEA 1RP9A 1QBMH 4UQ9A 4U1LB 3CLEH 1DVXA 3U6XA 1IIIA 3EGSB 3TIEB 1Y18B 4TSCL 4EN3A 2PP9A 2FSEB 5GQBA 3U1QA 2JH2A 4ONFL 3UTPE 4FQLH 1AE6H 4IRSD 4HUCA 1KJ2B 5TK4A 4RQQA 1Q9WA 4KKNA 2ED9A 3HAEH 3LZQA 4L4VA 3VWJB 4ZX5A 1F1AA 5C8JA 2HKHH 3SDXF 2VM9A 5DRNA 3K2KA 4FG2A 2UZYA 5I1GL 1PLGH 2G5BA 1YN7B 1AG0A 2E3VA 4N9GA 3CFJB 1T2QL 3HHRB 4FCHA 4PUBH 3WD5H 4HD4A 4K94H 3F3HA 5EBLA 4BFBD 1AI1H 4UI2A 3T0EE 5CCJA 2B2XL 3NVQA 3Q8BA 4ZOAA 1OCOB 3EJZD 1G1CA 4DK6A 2BSSA 3MLUL 4GEIA 5CN3A 1DLHB 1JYVA 3RU8L 3C5SA 1DEDA 5EZLA 3PQYE 4Z3EA 3RILA 4NQVA 2MPVA 3GRWH 1HHJA 4YSOA 3WDIA 4KI5C 4FOMA 4J5VA 1QWUA 3NCWA 4I4WA 1BIIA 4IJTA 1X5MA 1H3PL 1I9RL 5E8NA 3GM0A 1DANU 3KWWA 2GSIA 3S6CA 1CZ8L 2BXZA 3QEQE 3FOLB 3FRUA 2CCVA 4NKDA 1OD9A 4GUPA 3K8KA 1M9WA 1DBML 1QG3A 3HRZB 5AZUA 3ZL4L 3C5XA 1BQLL 4L4VE 5DT1L 5ANHA 3PHQB 3EHBC 1TU2B 3F00A 4JVPA 5JPNB 4HUUB 2WYTA 3NRQA 1XF1A 5TE6H 1D9KC 3CX5K 4NRZA 3I50L 3VGBA 4F92B 2CKBA 5GGUA 5GGQL 4LPUA 5JXED 1EEYB 5AKRA 5CILL 2CBPA 4PRNB 3RL1A 1SBSL 2E75C 2O5YH 4OZGE 2A6IB 1OGAE 3WKMH 4ATWA 4PG2C 4PRNA 3Q3GA 2AABL 4WDIA 1PFCA 4KUCD 5B8CB 1QWHA 1UEYA 3BFOA 4JO4L 3LIUA 4AQZA 2DY2A 4IS6A 4R4NC 4NT6B 2A9ML 1QI4A 4WDIB 2X6BA 5CINL 3HJ0A 3RP1A 1MCOH 1QBBA 3U0TA 3FO0L 3SPHA 3WUWG 1F3DH 5LBGA 3U4KA 1SMOA 2J1WA 2EIBA 4WWOA 1A7PH 2MHAB 3B6SB 4X7SL 4UAOC 5BRZA 1UYWL 4HJIA 3MRFB 3F58L 3ARPA 1SY6L 4D0DB 2WCGA 2XQ0A 1U0QA 4Q9BA 1CL7L 3FMGH 2DI9A 2GUOB 1U21A 3JUZA 3NIGF 4NRYA 4DGWC 4EIGB 3G5YA 4LSTH 5EOCH 1D5BB 1CLYH 3GUTA 2DRUA 1ZSDA 3A4EA 4AE0A 4Y19E 2V9TA 4WK4B 3GBMH 4RBPK 5LNDA 2H3XC 4WJKB 1WT5C 3LQZB 4BGDA 3VTMA 3UJIH 4LLUB 1R24B 1NFDA 1LO3L 1ZA6B 3FQ1A 5DVPA 5GRJH 3RPBA 4L2LA 4H44C 3FONA 1OF2B 4KJQD 1A1MA 5C0RH 4I9WE 3TT3L 2B9AA 1PNDA 4QEGA 4Y9EA 2OSXA 1A64A 4PRPE 2X7LA 3QUYC 4QCIB 5KG9B 5L4FA 5L2KE 1YC7A 1LP9E 1ZGLP 5FA3A 4N9OB 1HX0A 1TMQA 5E2WL 1E28B 3L16A 5DHDA 3SD5A 4DP1X 5IGXH 2R2EA 1NINA 4WK0B 1UOVA 2Z31C 3O3EA 2YN3A 1ES0A 3D0VA 4PJ7A 3WHXB 5A6LA 4PGDA 2EE3A 2VXQA 3EJTA 1WAPA 1PS3A 2FB4H 5DC4B 1DQIA 5BJTA 4IGBD 5EG6C 1G5AA 3MLXL 4J3VA 3NH7H 1BOYA 3GXMA 3I6GB 1R19A 1HS6A 3KNBB 2DWYA 5AVYB 2X6AA 4FQXD 2BWIA 2WMPB 1MIML 4OB5H 1IL1A 3QJQB 2AQTA 2HMIC 2A4EA 3K5RA 1CR9H 2V7HA 1X6LA 4PJCF 4MJJA 2NX5B 4Z7WF 2LFGA 4GBXB 2CNYA 3KCPA 4C55A 3FPXA 5G5DA 3CZFA 3IJEB 1A6PA 2R23A 4PY8J 4ANXA 2C3VB 1RUAH 1FNSL 1VZGA 3PWLA 4QRSA 5DDHB 1RKRA 3QS3A 2O6DA 4JFFB 2Z31A 3IJEA 3ZTNL 4KROC 4ZMVA 1S5HB 4LSPL 1BM3H 1ZS2A 3VCLB 3VGDA 2QADB 5JO5B 4FQXB 2B7DT 3L45A 2PR4L 1UQSB 4XB3A 2ODHA 3BPNC 1CFMA 3QHZH 3L3JB 3DURB 3NFPA 2Z34A 4MD5A 1TCRA 3QE5A 3VXSD 3II3A 2VDMH 4MAYC 7CGTA 5IWLA 4CN1A 1F97A 4PCSA 3ARRA 3UX9B 2X40A 3MOAH 3S35H 1NKGA 2NY4C 5CP3A 1BUGA 4GRMB 3ALXA 3MRCA 5FUOL 3ZYZA 1M05B 5IMLB 2FRGP 3GS4A 5K9KB 2W59A 5A2IH 2ENQA 5IJBC 3WNMA 1HJCA 4X6FA 1NOLA 3MJ9A 2VLLB 3PP4L 1WRFA 3FTSA 3LKOB 1I1AD 4Z3GA 5MEOB 3HUJA 1ZA3B 1LP9B 3PWJA 4H2CA 5CP7B 3RHWK 4L4TD 3E3QE 3FQRA 3JTSB 1E6JH 3MNWB 5D1ZA 1IEAB 3RPIA 5IGXL 2VN4A 4GOSA 4G8IB 4G83A 4F7MB 3BWZA 5MI0C 3RJDA 1OANA 3L5XL 2WN2A 1T5KA 5HDWA 3DTXA 1GGCL 2YD4A 4E9VA 5ES4B 4KMTL 1HK6A 1ZLUH 1F13A 4N8VB 4JPQA 1KXTB 2ADJB 4CL7A 2DBLL 1XB6A 1DBKL 3EDKA 4U1IB 3UGUA 1GGCH 1Z9MA 1SFDA 4CILA 4NN6B 1EZSA 4PRHB 4M03A 3BT0A 5EOCJ 4P6RA 5AW8B 4P3DB 4D8PB 1CPUA 1GZHA 3BSHA 4R83A 5E8PA 2BHFA 4TNVF 3TCLB 3U9UA 1MHEA 3W11D 3CDGA 5T33L 1QUPA 1SFHA 4H8PA 1FNAA 1OO2A 1T6VN 3ZX1A 3ESMA 3MRMB 2ZUUA 5EWIH 3TNMA 1WV7T 4AQAB 1KUMA 5SWZB 5FEBA 2MPAH 1BCIA 4ONOA 4HKBA 3MRBA 5EZPA 4ZFOA 1T21B 1G6VK 3D52A 2B1HH 3IRZA 4HUWA 4Y2DB 4AC4A 4R97C 3KDMB 5KW9L 3OC8A 5E08H 1BMZA 4DNLA 2F54A 2XQYK 5TGBA 3V4PB 2FHFA 2ZXAA 5K59E 4X4MA 4FG6D 4L29A 4X98B 5GRVL 3VI3B 2F54B 4NC0B 5T1JA 3C5ZA 5L9DL 1T03H 4X5RA 5T5FL 3QEUB 4JY6B 3GJEA 1BGXH 1CE6A 3K6IA 4N87A 3POCA 4XZUA 3FRPA 3V9EA 3HUJF 4WTQA 3OZKA 2DLGA 3NCBB 5FA3B 1A4AA 1MDAA 4Y2DC 2FEEI 1MJJB 2OMVA 3FHEA 1J5IA 3WTXA 4O5LH 1XCQA 3BQUD 1P9MC 2BVQA 1V7NH 3JWNG 3LKSA 5EFIB 5GRWA 2Y23A 4MXWH 5LUMA 2BVQB 5EIQA 3P4NA 2P8LB 2NY5C 4RGND 4Z7UE 1RZJC 5E9DB 4E0RB 3FUKA 4GRLA 4UWQB 4JO1L 2X6MA 3CVIH 1FSKB 1XZ0A 5ILTL 4F57H 1MCEA 2EP6A 3LTVA 2Q8AH 3GFUA 4P2OC 1AKJD 5TQ0L 3F7LA 2AEPL 2CBOA 3EYSH 3RYMA 4WW1B 1HNGA 1NDMA 4AG4L 1OQXA 3OMAB 4JZOA 4U3XA 2LOEA 4UQEA 5LQBL 4FNLH 5I1LB 2JI2A 1HEJC 1QO3A 3O6LH 1KBKA 5C09B 3F7VB 2YKKA 4NCDA 3PWLB 4QRSB 2QGDA 2LU7A 1NFDE 4QGYA 4L18A 3NA9H 4F7TB 2EXSA 2VUOA 3HG1D 3QDME 1UENA 3IU4L 3QT2A 4MA7L 3FO0H 1X5YA 4G3YH 4Y4KB 1NC4B 3VGGA 4X6CB 1FBIH 3G6AA 4UQBA 4E68A 4M7ZB 2ITEA 4PY8I 5J5EA 5CZRA 5HGHB 5FHAH 4UB0L 1FV1B 3INOA 1U8HB 1AKJB 4K5LA 1LTXA 3CHQA 5E5LA 3BD4A 5I19H 1YUKB 1H19A 1WHOA 3AG3B 3TFKC 3WN5A 5KBPA 3HMWL 1WFTA 4YN3A 1YJDH 1J9RA 1GS7A 1VDGA 1TPXB 5E9NA 1MSPA 4L3EE 1L9MA 3B9EA 4FTVD 2ENPA 2EILB 1E30A 3OXRB 1IAIL 4JB9L 2XY1A 2EUZA 2EKJA 2B8OT 5FR3A 2P1YA 1A7QL 2WLIB 2HA1A 4DPAX 2W60B 3P9MA 2ZNXA 2QV2A 1KYAA 3L4WA 2W9EL 5CM1A 3QXWA 1WD9A 3UDWC 1LP9A 3PWJB 3AWYA 2WBJB 4R5XA 3IN0A 4HG4K 4DKEH 1KIPA 3CVDA 4OH2A 4WWKC 3W1ZA 1D5MB 1K4CA 3PWPA 1N4XL 4JO3L 1DO6A 1E65A 3F7YA 4G3YL 4LQFH 5ENWA 1DN2A 1AXIB 4GLRI 1FLTX 5ACZB 5JW4N 2OK0L 4OLYL 4ZJ9A 5E8DL 4KDVA 2JJSA 3WFZA 4CKVX 1UT1A 1NCDH 3VFGL 1UXLA 4G9FD 3KJ4B 3PGFH 2G0KA 1E42A 5G55A 1JGLL 1HILB 4GLRH 4DUVA 3MJGX 3CDFA 2A0LC 1NBYB 2YEZA 4PHZA 2HLFD 1WDAA 4J8QA 3S36H 3A21A 4L8DA 4MTMA 3QQDB 4N20A 4X8GA 1XCXA 3QBTB 4HAKA 5DO2C 3S5LA 3BX7C 3GRGA 3EYVA 1Z3GL 4P6TA 5KVFH 5DMIL 3D07A 3ZE0B 5DA0B 1DBMH 4HH8A 3D34A 1CG9B 3ETBJ 2JXMA 5GZOD 1FNSH 4IHBA 2IH3B 5TE4L 3CDCA 5DQJB 4G7VH 4N2OA 1OSZA 4K5OA 5DFVC 2G9KA 2XHNA 3H85A 4XXDA 3C2AL 1H9DA 3VI3A 2UXGA 1TEGA 5C7XL 1F6AA 4U1KA 4X5PA 1KTDB 4P2RD 3QNXA 1FO0A 3ZPDA 2UY6A 1HZHL 1OGAB 1QUNB 3ECUA 2CR3A 3ARGD 4BRVA 4PS7A 4B96A 3NQIA 2H6PB 2J8OA 1F4WH 1MCNA 1LEKB 5EBWB 2WXJA 1QAWA 4S1DC 4I77H 4NM8L 3ZE2E 12E8H 2WC7A 1PLAA 2QPFA 1ND0A 1P7KB 1F4XH 2WCPA 1LO2H 3OKEB 4XMPL 1AR1B 3QEHA 1K6QL 2FX7H 2X0UA 1ZHBA 2W81C 2VL5A 4EKXA 1L6PA 2MPAL 3P02A 4HGMA 3EYQD 3ZZ1A 1HIML 1KC5H 2B1AH 2IPKB 3MOBL 2DDQL 2F15A 4XP5L 1TMCB 2Q76B 2IAMC 1L3NA 4MAUL 4KKPA 5AAWA 3MBEA 2YPKA 4PGEB 4EN3C 1JHKH 2Q7AA 5F6IB 5T3ZL 3C5ZC 1U9KA 5LVEA 1JMZA 1YEWA 3IM1A 1FGVL 3HKZA 4YSDA 3EDDA 4Z95L 3ARBB 4M6NL 2A9NH 2UWEF 3GBML 4NQDB 2FYYB 4DN3L 3V5HA 3MUGA 4XOBA 3HAEB 1I8IA 4MCZA 1H3PH 1I9RH 3I84A 3ILPB 1FJ1B 2YD9A 3E2HC 2MCG1 2Q6WB 4N3UA 2RQEA 3BP4B 4Q56A 4WKZA 4EN3B 4CVWA 2ZWFA 3BDYH 2JELH 3S48A 4KRNA 5IHZB 4HIQA 1KGCE 4NCC1 2E9GA 2XBZA 4WO4C 5J12B 5J6SA 1HHIA 4K73A 3VW3L 5IB3A 4GRLC 1B90A 2ZCHH 3AXHA 4ZYKB 3VGFA 1FC1A 2ED8A 5H8DA 3OMZA 3WN5B 3DV4A 1FNGA 2BZ7A 3GI9H 4E9RA 1URIA 2PPDA 3IDXH 4OGAC 4PVLA 1WBXB 1CDGA 3ROLB 4NS0A 5HHNB 4X6DB 5E99L 1RZJH 2PABA 2H32B 2HP4A 4LBAA 1XXDC 1UA6L 3PJSA 1BZ7A 4JN2A 5KSBA 2CU9A 1ZLVK 1YN7A 2PO6B 4HUNB 3VFWB 5EZJA 3GHEH 5LAXB 2FJHA 1Q9KB 4HXAL 5F7KC 4LVNC 2KERA 2FTAA 4JRLA 3DXAB 4HSAC 3EBAA 1FFRA 1OSYA 1S7WA 4NWUH 3ZE2B 3FRUB 4ABVA 3GZKA 3PWNA 5FFGA 2A73B 1ZK9A 2YPVL 1TOXA 4BK5A 4G6FD 1BOGA 1A0QH 4HFUH 4QLRA 1LE5A 4QRAA 3QFJB 4ZUUA 4HC1L 1MH5A 3QZBA 4JKPL 3T3MB 5E00A 1RPUA 4W4NA 1I1FB 3QORB 2A7BA 3MMEA 4PS4H 5CD5C 1G94A 4H88L 4O2EB 2IH8A 2GJPA 2OMNA 4ZMTA 5DVLA 4EDWH 1E8ZA 1U6AH 1UA3A 3VRJA 1JF5A 3KPQB 1BQRA 1SDDA 1RIHL 3OAUL 3KLHD 3DMMC 5IJVB 5IR1A 1S7SB 2DKSA 5HHXH 2R51A 3GQFA 4LSQL 4E5XB 3BPCB 1MVUA 2ZKHH 4OZFG 1MAML 3LHPH 3NJMA 5CEZE 1HWWA 1NGPH 1CXHA 1ONQB 1KLUA 4J8RB 4ZXBA 4A39A 1JI1A 4Y5YA 5IW1A 1NGYA 1VEOA 2Q7NA 4K8RH 1MELA 3CC5A 5ITBH 5I8OH 4ONGL 2GUYA 4WWKA 2YA1A 4MBRA 5FGBC 5I2IA 1FGNL 4LSVH 1J05A 1FO0H 4PRPA 4RQQB 5HJGA 1CBVH 4D8PA 1K8DA 3RGVD 1WFUA 4QJ3B 5F89B 3P2TA 3C6LD 3UO1H 1Z9PA 32C2B 4PJIB 1C16A 4YHNB 4K3HA 1EZUA 1UA7A 1PSKL 1ZSDB 1Q1PA 1OP5K 4QOKB 3T0BA 4BA0A 3DDGA 3NEXA 5GZNA 4QHUA 4B5ZA 1HKLL 2AZAA 3UZVA 4FD0A 4JM2D 2Y24A 2VWEC 1R24A 1WZKA 4BQ8A 5HTSA 4CADB 5EA0L 4PJGA 3Q05A 1K2DB 1NPJA 1KYUA 1YEFL 2OMUA 4I87A 3ZXAC 3M6DA 1NIDA 3CNKA 2L8AA 3H53A 3L4TA 1K2DA 3KPLB 1CLCA 3Q5TA 3DMMD 1C5DA 2G5UA 1ZLUK 4F2MB 1CICC 2N1TE 5DRWB 2J1XA 1SHSA 5IROA 4NZTL 5DHEA 1WD8A 3NSCA 1INEH 1JZDC 3D12B 2PLTA 4IKJA 5EF2A 3TBYB 4WEBL 3ECBA 1GC1L 5FO8A 3R06A 2CO6B 3F6IA 2P4AB 5F0JB 3VXUB 2ZG2A 3NSYA 3LIZA 1T2QH 1B4TA 1FL3A 2JVUA 3ATEA 2Q9OA 1IM9A 1SXSA 2BW5A 4D8OA 4ENED 5C0CA 2JFCA 5F7AA 2OR9L 1FVEA 4FFZH 4UOZA 4PJIF 3I74A 5C3LD 3EH1A 3WTUA 1OCCB 1XH3A 5EBMA 1EJOL 2VITB 2TRYA 3RIAF 1HSBA 2DWEB 3LKRA 1L7TL 5CGYD 4B5EA 1WS7A 1XH3B 3CVCA 2YQ2A 4WENB 3V7AG 4LVNB 2XTJE 1F6LL 2P5EA 2CA4A 3AW5A 3QFJE 3NSXA 5DUPL 1U8NA 3N1PC 4WW2A 5D1XA 1MFEL 3M8OL 1A2YB 2DQUH 3MCKA 5LDUA 3FO9B 3BDYL 4G8GE 2BERA 3B5TA 4C83A 3OKKA 1UXMA 4AVIA 4LCUB 4M5YH 5F1NA 4LCCC 5DUBB 3DRTA 2ESVB 1X7QB 2E9WA 4ZFGL 4ZAKD 3MLTB 2YO3A 5DZNA 1O6TA 3GMRB 1C7SA 4DOHB 1E7UA 4P05A 3VMOA 3I75B 3QWRA 4M7LH 5TDOB 3DSFL 1CTNA 3GK8H 2QQQA 4LLYA 4M6OL 4ZO7A 1F58L 2VDPB 2E46A 3BRFA 4KAQL 1EGJA 1SPDA 4H1LH 2LV4A 3LNEA 2M83A 2C4FT 3DURA 3HBZA 4QYAA 1A6AA 2H45A 2GSIB 2ZSWA 4JM0A 1FORH 3LRKA 2EO7A 4U6XA 1SOXA 3CDZA 4PJDF 3WIIL 3C09C 3QFJA 3QHFL 1VA9A 3ULUF 3IDYC 3HRZA 4GI9A 5CEXB 3UC0H 4ERSL 5E0QA 1MAJA 3O0RL 3PGCA 4DPRA 2Q3AA 2IAMD 2JCCF 4LSVL 5F3FA 1TR7A 3IE9A 4BWTA 2X4RA 2YLHA 4UT7L 3QQ4A 2XT1B 3HNSH 4IJ3C 3S5ZA 3SJVE 3TT1H 4CC0A 4DTGH 5F7EL 1F8TH 3ECWA 3K6FA 4EVNB 1MJ8H 5C0FA 4OQ1A 4RZCB 1DJGA 1KT2B 4BDVA 1HZHH 1KGWA 1RULL 3KNBA 1RUKL 3GB7B 4WV1C 4B9KC 4EVNA 3FTGA 1IVTA 2ZAIA 4LU5H 1NL0L 4KY1H 1GAFH 3IXTB 4P2QB 3N1MC 4RISH 2FR4A 3M1CA 4KRPC 3QZLA 2JB5L 4TLSA 5E6YA 1XGPB 3N55A 4KPHL 5EO9A 2FECI 2GSGA 2IBBA 2XFGB 3M1BA 3RY6A 1BXXA 3NJFA 4XNUL 4LLDA 1KXQE 1DJWA 4IOSA 4X7CC 2DKMA 3BSZL 2GEEA 5IEKB 1XO8A 1Q38A 5HJ3B 2ADIB 3HCVB 4HMEA 1FRGL 4WNSA 1JWMA 4XCEB 3GS0A 5IHUL 4YLQT 4TF4A 3LD8C 3VM7A 1I8UA 2NUPB 5MEPA 3V10A 1ZAGA 2YD1A 4JHAH 2X6UA 5DLMH 3OKMB 2P8MB 2WYHA 3ESOA 4OT1L 2JTDA 3BCFA 4N0CD 4WI6A 4K3JH 3L95B 4PJEF 1QR1A 2C3HA 5FYKD 1SVCP 4MJIA 1MCCA 2OP4L 3WMSA 1YNLH 3LN5B 3MZTA 1K4DB 5FUCC 2MKLC 5ERWB 5HI4C 4MB1A 3TJHC 3TS8A 1JGLH 2VDOB 2BP8B 4MJIB 5EUOF 5B3JE 1OSZB 1PEWA 1SJVA 1W0VA 3ZKQD 5KSAA 3IDIA 4FZEL 4Y5YC 3V52L 3ZDXF 5JA8B 3MV8E 1AGCB 3WLBA 1CDJA 5MERB 1A7NH 4PTUB 3KBFA 3GXPA 4RH4A 4G6KH 4MQXD 4BZ1L 2EH7L 1IBBA 3GUFA 4LRNL 5CIPA 1JNNH 1PZAA 4A7GA 4XBMA 1IBGL 4XNQA 3MXVH 3WSQH 5F6HI 5IJDC 1IEBA 4NDMB 1MWAB 4PLNC 4P2OB 5D2LF 1X4ZA 4MMYB 4NQSA 3U1SH 3MUJA 4JY5L 1JMXA 2XJLA 3OX8B 2A6KA 4RSVA 3DJRA 5EFIA 1I9JH 4K3DH 4DIXA 4JFPA 4ZPTA 1GS8A 3MAWA 5H37A 5HHPA 3WIAA 1ETA1 3X1NA 4FTVB 2Y1YA 5DA4A 3GPSA 4HIHA 3AWSA 1J1PL 3O2DL 1BQSA 3K2IA 1CU4H 3SOBH 1NBCA 1KPVB 5LN8A 4AKQA 4IBLT 1R5IB 4Z3JA 5HI5C 3PIQB 2QADD 2XIDA 3BMWA 4GKZA 4DGIH 3L3DB 4WGWB 2BIIA 2ZX7A 1KYOJ 1SJHA 1HKFA 1ZLWK 3OXSB 3M17B 3QPKA 2ZMZA 1B0RA 1JVKA 4KDTC 3CFDB 4BZ1H 4U3SA 2XZZA 4ZRGA 4NO3B 4EUPH 1X5FA 2E7CA 1UKQA 2AQSA 4A2LA 5A43C 2DQFB 5D2NC 3BFQG 4KUZL 4GW5B 1CICA 3X14B 4NQXB 4PRDB 3NZ8B 3US1A 2BO0A 4Y19A 2YD2A 1EMTH 1BFSA 1S8DB 3OHXB 2NY4B 2P24B 1AGDB 4X5QA 4GAYA 2FJUB 1SRDA 5M94B 1BHGA 4AOFA 3MRMA 3OHXA 3O3AA 4N6QA 4NAMA 1CD1B 4M43L 4GY4A 4M8QB 4ECNA 1HYSD 1QKZL 5DWUL 5E2JA 4AIEA 4OLYH 2EDJA 1I1RA 2ZXDA 3FT1A 2VABA 1A9BB 1IC0A 3MA9L 5DD6B 1Q1JH 3MYJA 2EABA 1Q0XH 1DUYA 2JJVA 2QKSA 4G82A 5E7BA 5F70A 1U3HD 2Y72A 1YUHB 1ID5I 4WGVB 1A3RH 4FFWC 6FABL 2WY3B 4Z78B 4XC1H 5I17A 3W37A 3FC8A 4XNZC 5TQ2L 1F11A 5D7IB 4IMLB 3M1OA 5F9JA 1AHMA 1EVUA 2D3LA 1WEJL 3HKFA 4PBVC 2XKSA 1D6VH 2AKRA 4F8TA 1ETB1 1VENA 3WSQL 1IV8A 1MOEA 1PX4A 5JQHC 1TUPA 5IQ7H 4G7SB 1BZQK 4DHLA 3RPIB 5E2TH 1GGIL 2MSPA 1WUZA 2WQXA 4KHXL 2RBLA 5CEYA 4IIQB 1E7VA 5C0AA 4BE6A 1EAQA 1NIBA 1BZDA 1KCVL 1MH5B 4E9XA 2D8KA 3IB4A 4Y2DD 4QXWA 3ORJA 4QO1A 2V8MA 2V2TA 1RJYB 4IU2B 3AWVA 4O2EA 1LM8V 2KZ1B 4QTIH 6PCYA 3VFGH 4G72B 4M62H 3UTTE 4GG6F 1OPGH 3PWVA 4OFVA 4HYTB 1GGUA 1GJIA 4UF7C 1EA9C 1PX3A 4XODA 2XXFA 1I7TA 3H56A 4IIQC 1JWMB 4Y4FB 2XWTB 2ZXEB 5K9OB 3C8KB 2FEDD 5KN5A 5IUCA 4G8GA 3RI5F 1J5CA 4MHHI 1FWXA 1HL9A 4TXVB 1FL5B 1ZE3C 1AR2A 1SOSA 5T33H 2Q86B 1AR1D 5FW7A 1QNZH 4YLBA 4ZTPL 3P0VH 4WI0A 4FCAA 4R9HA 4W81A 4KZDL 3ZMEA 1MFDH 2JCCA 2WNGA 4UQDA 3PAVA 4RA3A 1DSFL 1QYGL 3DHPA 3LEVL 4ZOCA 3TPUB 4HS3B 1YDPB 3UP6A 3DROB 4UMGA 3MODH 2YS4A 4C4KO 4DZBB 2VZ1A 1OP5H 1BAFH 4KJYB 4UUJA 2ID5A 3V4PH 1JZ2A 2WIIB 1E27B 2FIKB 5D7SL 3HE7D 4GEJA 4FQHB 1A6ZA 1WAEA 1Z5LA 4AYEC 2AW2A 5JHDD 4WFED 3RY6C 2IAMA 5E8EB 4ETQB 4HD9A 2NW2B 3MUUA 3ZKSD 2CHWA 2YSSA 5L8LB 3QA3A 4QHLB 1QRNE 3MRJA 4DQOL 4GFTB 2PPFA 4LKXA 4I3SL 4YHIA 4F2EA 3EJJX 5HDQL 5IQOA 1H8NA 1NCOA 1T04B 2BRRH 4N6RB 5EDXA 3UPRB 1TG8A 3LN9A 3PP3K 3QDGA 4WEMB 4XRCA 4CADA 3HLAA 3SGJA 4KUCF 3TZVC 1NTDA 3LKPA 4JPVH 5EU3B 3UABA 5IUSA 4OLZH 4DJMA 4MFHA 5AW2B 4UCFA 1I7RB 2V7NB 3ZY7A 3WL9B 4B7LA 2YRPA 4NZUH 2EINB 3VYOA 1DQMH 4AEHH 4P5TA 4K2UL 4B7IA 4QOKE 1QPPA 3VDBA 3FCUB 1DVTA 4X4XB 4OZIA 4M93B 2P9RA 2EDTA 2JKJA 4NQXA 5KVGL 3CZGA 2YPKB 2YJLA 4TQPA 1YY9C 3NP3A 3NJIA 1X5IA 1XSKA 3N9GL 3UOAB 4GAYB 4K3GA 4CJ1A 2DH2A 1J8HE 1RURL 1TVDA 4WO0A 3BZDA 3IN2A 3EGDB 4JMXA 4JZJB 3RL2A 3Q1EA 1VKXB 1TETL 1V54B 5B1KA 3MGAA 3NIDE 1IKNA 4F24A 1KXQA 3H0TB 1L0PA 4TNWK 3VTTA 1XV8A 1ZV9A 4L3FA 4LIQE 5CSBA 4OCWH 3AWUA 3N2JA 4KROD 5H4ZA 1X5ZA 3L3IB 3OLDA 5F1OB 5JW5A 2R1XA 4OUUB 4WWPA 5AZEH 4BZ2H 2A83A 2NCMA 2XU9A 5B38B 1YPZB 2ZZUT 5FF6B 4E41A 5DQDL 4ZO6A 4IRSB 5JDJA 2QHRL 5JW3L 2LU4A 4N1HB 4FE9A 4PG9B 2VQ1A 3OKNA 3MV9A 1SDYA 4FC3E 5IOPA 4JN1H 3V7MA 3PAZA 4EI5B 4IRSA 3IDNA 5AL0A 5JQ6L 3FRPB 1E4XI 4OUAB 2BSEA 4EN3D 3LDBB 4F7PA 3STZB 5HSFA 2F9BT 4RGNB 5E9DD 4Y7MA 1LDPL 4PSRA 3VFWA 2E6QA 3MKGA 4Z7OB 3LRHA 1XTLA 1Z2KA 1D9KB 1INDH 1P1ZA 3DUHA 2WXGA 3IBOA 4EZKA 1TNNA 2EICA 1E9OB 4WY7L 3ZN6A 3PU7A 5EU5B 2BVTA 1I9IL 3WXVL 1OY3B 3O3DA 4ZD3H 1H3UA 5EEYA 1XZ0B 3C6SA 3ARGA 2PW2A 1P4IL 5C0IB 3FQXA 3MNDA 4PRBB 4LNRA 2WTRA 5LXVA 3ISRA 1EQWA 4RGMB 3IJ7A 4UNTA 2CKBB 3K71A 5CKAA 4W9HC 1ZVNA 3MV9E 1KLGA 4L8SC 3AGVA 2AK4B 3EFFA 3FN0L 2YXVA 2DQEH 2D03H 2D7PA 3RX5A 4LSDA 2C5DC 1ECYA 4JAMA 5E4OA 1A6WH 3BGMA 5IW1B 4B9CA 3S5LB 3P4LA 3AWZA 1FJ1A 1SN2A 3QWNA 1CR9L 3LPGA 3L9YA 4MZ3A 3IFLL 1BYNA 3CH8A 4MHHG 1U4FA 2B20A 2BPBA 1J8HB 2Z35A 3B9KC 3DGDA 4M02A 4E9WA 2VDQH 4O51A 3PV7A 3EZJB 2V3DA 4JFEE 1OGTB 4PJFB 3GPEA 4BSWB 2NYYD 1DEEB 4XPBH 2AJ3A 5KVDL 1CFTA 2PF6A 3REWB 1I4FA 1PAZA 3G5YB 1E8YA 4X9HA 4KI5E 1GC1C 4N9GB 2NQDA 5CAYB 4P46A 3C2AH 1FPTH 4ZZFA 5CF3A 1BVZA 7PAZA 4I48B 3JWDH 5FGCE 4EQ3A 5HYSG 5DJXA 2VISA 3IF1B 3F84A 1ZPLA 4A67A 4BUHA 2EE0A 1W72L 4OQTA 3GMMB 4N2CA 3DXAA 5DEFB 5GRJL 4DFHA 5DMIH 1KN2H 2UWEE 5TE7L 1T7VA 3UTTA 5IVZA 3UBXA 4FAAB 3CN3A 3Q13A 3W6QA 5MERA 4FRWA 1JK8A 3R1GL 4LHUB 1XIWC 2IANE 1E90A 1MRDL 4FMFA 2VDKB 3ECQA 2FHBA 4N2GA 2DDQH 3EH5B 4CVXA 4NFCA 1F3JA 2D4DA 4XGZA 1KN4H 3MRPB 1XGUA 1MVFA 4HALA 4LL9A 3ZT5A 4AQEA 3F58H 3HG5A 3N0AA 4YGVB 4JFFD 3LAFA 1KB9K 3SCMC 3LS4H 3ECBB 4OB5L 1LYQA 1T3FB 4WTWA 3TEZA 2J6EH 5F88B 2YPVA 1AI1L 2B5IB 1HU8A 3O6LL 2X53A 2ZXGA 3EG9A 4JRXD 5AOZA 1RJZB 2BLFA 5EN2B 2CXKA 2EO1A 2BIPA 2ADGA 2YK1L 1RIUL 3SO3C 1AKPA 1JXDA 2HFGH 2UWEA 3R0MA 1VFUA 5CHNA 4EI0A 2ODIA 4LVEA 3H6JA 2XN1A 2DB8A 4MNHA 2JE8A 2WQVA 2OI9B 3HE6B 3TGXA 3RY4A 1ZT1B 3TL5A 1QI5A 3P4MA 2EXYC 3B5HA 2YMOA 4H26B 4POYA 4W9GC 4APXA 4MCMA 1XGQB 3WFHB 1YPZA 2CKNA 4BHUA 4YNYA 3FB7A 4JL1A 3TA3A 4ONHA 3WNPA 1G87A 4I88A 4APXB 3HRZC 2PR4H 3UBXG 3NG5A 3B2DC 3RZCD 1TTUA 3D3VB 2GUOA 3WO4C 2JCCE 4HV8A 2R83A 3J7HA 4FQ2H 3H4HA 3PE9A 2NZ9C 5DO8A 2IPUK 4ZUTB 3QI9A 5GGSA 4YDIH 1WZAA 4ILDA 2PKDA 1NLDH 4NKIL 2WZAA 4YC2B 3GBNL 2XV0A 4TUJB 3D85A 2PTTA 4MA7H 2AV7B 4HHAB 4GKNB 5F7MC 3KXFE 4GUPB 2G4GA 3WO4B 1ACYL 1K8IB 1VPOH 2WWKO 2X3BA 5DS8B 5MENE 1MN4A 4R84A 1B4JH 4YDJB 2GFBA 3RWJA 4AH2B 5EF3A 5B7EA 1CLOH 3HOGA 3TONA 1S7QB 1PNCA 4LNRB 2IWFA 3ISYA 1KEML 5HHOD 5CP7A 5FWQA 3RB7A 5CCGE 2QR0A 1BJ1H 1B2WH 1QP1A 4YHPB 4TQHA 3RVWD 4N8CH 5E8OB 1MF2H 2XTLA 4AZ8A 2E7LA 3DTXB 5TTRA 4ELKA 1HQRA 1KBBA 3WKML 3L1EA 1KCBA 4HHWA 1ONQA 4J8RA 5EBMB 4ZXBB 2BSTA 1WBZB 2QQNL 3EDFA 2IG2L 5GZOA 4HAFA 2MJWA 4PLJD 4IS6B 1ZTXE 5ICYB 4KHTL 5EEXA 4JG1L 3V4VH 1KJ2A 2MTPA 1EEQA 2EDLA 4QO1B 4QMEA 2V2TB 2NY3C 2DI8A 1P1VA 1RMFH 1Y18A 3GSQA 1CL7I 4XVJH 3S4SA 3QFDA 5IMKB 2XZAL 4LARH 2IGLA 4LHQB 1Q94B 2IVFC 1IC4H 2AXWA 3MLSL 1WG3A 4XMLL 4AGLA 2XWTA 1QVOA 1GTNA 2J4WL 3A6BL 3FTUA 2IAAC 2WLLB 3NJNA 4ZUSA 3DX1A 3SJVD 4TTDD 3ULVC 2Y1ZA 3HAEG 1BZ7B 4JN2B 1JHLL 5DC2A 4HJEA 1QRKA 2VLME 2D2OA 3CBKB 4G43A 3OF6D 2JCWA 4TQEH 5AZ2L 2G2RA 4LK4A 3CAFA 3LN5A 1TJIH 3UTTB 3QZNA 1IMHC 4KC3B 3S37H 4BCXA 2UZIL 3FT2B 2G60H 3PDOB 4DZ8B 3WFEL 5AENA 4KXZH 4D87A 4FLSA 4WEUD 4I3SH 5HDQH 1SN5A 1GYVA 1BT2A 1RJCA 3WDHA 3FCGA 2O6EA 1E5CA 1KCLA 3VI3F 3MRPA 4PJHB 4P06A 2W94A 5JHMA 3RURA 1PVHA 5IQ7L 5HD8D 5HYSA 1EEYA 3ALPA 3JWNE 4KX9A 2ITCB 2NXZC 4MXWL 2XWBA 5D2NB 3AWXA 3BZFB 4HUVA 4GQ9H 5KJRH 2BNRE 4DP7X 2XZQL 4MJIE 5DZLA 5EU3A 5KSVB 4RA0C 4FKEA 1PKQB 3W5MA 2DIAA 3DX6A 1JRHL 3CK0L 4TN9A 3ZR6A 2WYIA 4B9JA 1NCBL 3ARTA 4IOIA 3DX7B 3BZEA 2AV1B 2MOGA 3R8BB 2FE0A 4X4ME 4W6XB 3UROR 4O02B 1GIGL 5F7LB 2AV1A 5KBNC 1G7LA 2AI0L 1UJ3B 2DJMA 3V6OE 1AC6A 3CC5B 4GBXA 4UTCA 5DU7A 4Z0BL 4U3SB 1OPOA 4QUOA 5BO0D 1EFQA 1U33A 4PJ5E 2Z8VC 1IB5A 3RTQB 5D1QA 1PMYA 1IQDA 1BX2A 1VF5C 1CD1A 1UH2A 3ATAA 1XSIA 2EDHA 2I60H 2KDYA 3O2VH 4X7EC 4TNVK 3GUTB 1YG9A 2W1NA 4PG2A 4MWFB 5E2WH </