The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
210
|
sequence length |
668
|
structure length |
668
|
Chain Sequence |
EFKTTPVDAAFVEKQKKILSLFYNVNEISYEAEYYKVAQDFNIEASKDCYTNMKAYENFMMMYKVGFLPKNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQGMFLYAYYIAIIQRSDTASFVLPAPYEAYPQYFVNMEVKNKMDYVKMMDGCLDEKICYNYGIIKENEQFVMYANYSNSLTYPNNEDRIAYLTEDVGLNAYYYYFHSHLPFWWNSGKYGAFKERRGEIYFFFYQQLLARYYMERLTNGLGKIPEFSWYSPLRTGYLPPFNSFYYPFAQRSNDYELHTEKNYEEIRFLDIYEKTFFQYLQQGHFKAFDKKIDLHSSKAVNFVGNYWQTNADLFEEDFLQFYQRSYEVNARRVLGAAPKPFNQYTFIPSALDFYQTSARDPAFYQLYKRIVQYIIEFKQYQVPYTQEALHFVGLKISDVKVDKMVTFFDHFDFDAFNTVYFSKEELKSSPHGYKVRQPRLNHKPFTVTIDIKSDVATNAVVKMFLGPKYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKEDSLPMAEIYKLLDQGKIPTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKAVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGELFPYLFNIPH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Oxygen transport
|
publication title |
Crystal structure of Bombyx mori arylphorins reveals a 3:3 heterohexamer with multiple papain cleavage sites
pubmed doi rcsb |
molecule keywords |
Arylphorin
|
total genus |
210
|
structure length |
668
|
sequence length |
668
|
chains with identical sequence |
C, D
|
ec nomenclature | |
pdb deposition date | 2013-10-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF00372 | Hemocyanin_M | Hemocyanin, copper containing domain |
B | PF03722 | Hemocyanin_N | Hemocyanin, all-alpha domain |
B | PF03723 | Hemocyanin_C | Hemocyanin, ig-like domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | di-copper center containing domain from catechol oxidase | Di-copper center containing domain from catechol oxidase | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Hemocyanin, C-terminal domain |