1AXIB

Structural plasticity at the hgh:hghbp interface
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
205
structure length
191
Chain Sequence
b'EPKFTKCRSPERETFSCHWTDEGPIQLFYTRRNEWKECPDYVSAGENSCYFNSSFTSIAIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH HORMONE
publication title Structural plasticity in a remodeled protein-protein interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (hormone/receptor)
total genus 37
structure length 191
sequence length 205
ec nomenclature
pdb deposition date 1997-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
B PF09067 EpoR_lig-bind Erythropoietin receptor, ligand binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1axiB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1axiB01
1UEYA 4JREC 3ARQA 2BVOB 3QFJD 5E1AA 5E6ZA 1A2YB 4PGBA 5HJ3B 5CD3A 4JO4H 2OJZL 4CBPA 4P4KA 2A9NH 4O4YL 1F3JA 4QTIL 1R3HB 4PJCE 5CBEB 2BC4B 5JHDD 1Q9OB 4D8PB 3IAQA 4N8VB 2P5WB 4OCXL 3VXTB 1A7OH 4HCRH 4OGAC 1NKOA 3DMMB 2WWKO 3B2UD 4PS4H 5EB9A 3MLVH 2XWJB 4S1QL 2Y23A 3PDOB 3GO1L 3S4SB 3U1SL 3NCYP 2I26N 2O5ZL 5D7KD 5L9DH 3NACL 3V2AR 4CJ1A 4PJHE 1KXQE 2I9LB 1G0DA 4OKDA 2H2PD 5J1SC 5CBAA 3I6LD 1B0GB 1T7XA 2YXFA 3MLWH 1DSFL 3K81A 5FYKL 2XQYG 4NSKA 3RVWD 2Z4QB 1BJ1J 1JK8A 3RI5K 1ZHNA 3BPOB 3VRIA 1B3JA 4EVNB 1MEXH 1RHHB 1KTDB 4P2RD 1UG9A 4OQTH 5LBSL 5H37G 4OI8A 3SGDI 4PP2A 1C12A 3DV4A 5F3HB 1A3RL 5DMJB 3GMPA 5FHAL 3WNPA 4N9GB 5HD8D 3O6LH 5ANME 1T89A 3GMOA 5GS1C 4BZYA 2BFVL 1CZ8H 2CR6A 5CEZE 3QJHA 3QR2A 3O2WL 3CSPA 3QZWG 4OCWL 5HGDB 1TJHL 1XGUB 2IADA 1IRAY 2OTUA 5KSVA 1WEJH 1A4JB 1P4BL 2FJHB 4UIMB 4V1DA 4ZTPL 3GSRA 4XTRC 3O2DL 5EO1B 5E4EB 2ITDA 3MV01 5DI8A 5C0BD 4NRYB 3VFPA 4F9LC 5E5UB 2X10A 5DA0B 3ZT6A 4LMQE 5C0GB 1FL3A 1N6QH 1HHIB 5I75B 1ZGLP 1U8PA 5F3BA 5JPNA 1IGIL 2CDEB 4NNPL 3MXWH 3VG0L 1JRHL 3P9LA 4N1HB 4RAUA 1HINL 4P5TA 1SJHB 1INEH 3CDGB 1MHEB 3S3JA 2NX5D 1CI5A 1H3PH 2XRAL 4JFEE 3QCTH 5GZNC 4CN4A 4JFQA 1YEIH 5T1MB 1AXTH 1EZVX 3RL1B 1R3KB 4AQOA 4X80H 5DJDA 4GAJH 3K4DA 5IQ9A 4L29A 3BGMB 1MRCL 1IC4H 4Y0GA 2A6IB 3G5ZB 5EPMB 2P47B 2W9EL 2A73A 3DUUB 4BZ2L 3VXPB 1L7IL 5MI0B 4EDXA 2B1AH 1I1AA 1IEAB 2Z92B 1RZ8B 5IB3B 1IFHL 1JNNH 3C60A 1GGCL 1ZTXL 4FFYL 1GIGH 3NH7L 1RULL 3QWOB 4OIIH 3EBAA 3HZMA 3N0PB 3WDHA 2JTDA 4HZLA 4P2CG 1RUMH 4ODUA 4ZYKA 5ID0A 5E2JA 4NZUL 1DBJL 5BXFB 4WHTB 5BZDA 4X6FB 5FKAB 2F53B 4P3DB 1TVHA 2X9YA 4QTHA 2BNUB 5ITBH 1P4LA 1P1ZA 5GGTH 2OX5A 1TMCB 4YDVB 2G2RA 4WGVB 5DVMA 5F72S 2MTPA 3TYGH 5D1QA 4RX4D 1XGPB 2GJ6A 2DDQL 2FX8H 2ADIB 2JIXD 2ZUXA 1CT8A 3KNBB 3OR6B 1RFDH 5GIRA 5J12C 4MQXC 1NCCL 3RRQA 2NXYC 3UYPA 3HHRB 3B6SB 1C08B 1H3GA 2IQAA 3NIDF 4G5ZL 4W6XB 3W0WE 1MFNA 3ARXA 5HVHB 4XPBH 2MJWA 2ERJB 5H37H 4P3WA 3I6KB 3EYSL 5GJSL 2F58H 1XMWA 4PP1D 1XH3B 3BRGC 1GGBH 5DRZA 2DQHH 3JWOL 3ZKMD 1QSFA 2VN7A 5EZOL 1LWRA 3MV9E 2CO7B 4TULH 3W2DH 1BWMA 2XN9D 5LQBL 4LVNB 2HTKC 1JGEB 4RWHA 2HJLB 2J6EL 2X1PA 1R3HA 1F6AA 4XVJH 1Q9OA 1F42A 4D8PA 4N8VA 4PRPA 2APTA 2P5WA 3VDCA 3PWLB 4MQTB 1XCTB 3VXTA 4JQIH 3V4UL 3WJLA 3DMMA 1ZEAH 3JVGC 3WLWC 4F9PC 2B20A 2XWJA 5MENB 3PDOA 3S4SA 3V0WH 4TVPD 2NY0D 3FOLB 1U8NB 4NN6C 5D6DC 3AUVA 4JDTL 4KTYA 5FDWB 2K9UA 3N1QC 2QL1A 2I9LA 2BRRH 2VXQH 5E2VH 3BP5B 3TWCH 5GS2D 3CC5A 4S1SL 5DEFB 5FK9B 2F8XC 1A64A 3VI4F 3M1BB 4CU6A 3MO1B 2Z4QA 2W9DH 4HS6B 3OHXB 2H9GB 1CTOA 4EVNA 5GS0L 4GW4B 4HT1H 1RHHA 2Q8BH 4PJBF 1EBPA 5KG9B 5F3HA 4RCAA 3ULVF 4IBLT 1CBVH 2J8UB 2VDRH 5FIEA 1EZVY 2IBZX 5C07E 2YN5A 3WS6C 3D85A 4GG6B 1R0AH 1AIFB 3RP1A 5HGDA 1XGUA 3CFJB 5B4MC 3MUGB 1A4JA 4NO2B 1MOEA 2FJHA 4UIMA 4YHZL 4U7MA 3SOBH 3C5ZC 2B4CH 3F58H 3HE7C 5ELIA 2V9RA 3NFPB 3VXUE 5C6WH 1S9VA 2FDBP 1J9CT 5C0GA 2CUIA 1LDPH 4YAQB 3PWUA 4BFIA 1HHIA 4KROB 3VCLB 5J56B 3SGKC 2DM2A 3NAAH 5SV4A 5EZJB 4KRPB 4QKXB 2BJML 3ARFA 4TUKH 1JYXA 5DQDL 4FXKB 1W8NA 4Z7WB 1SJHA 4KI5C 3CDGA 1MFAH 4OQ1A 1IC7L 4Z7UF 1MHEA 4K9EH 4UIKL 1X7QA 3O3EB 4ZAKD 5C09A 4DTGL 3ZE2E 3V6OE 2ZSVB 3KPLA 3ZTNH 4NO0A 5D72H 5T1MA 4HJ0D 5EU6D 1YMHB 5ID1A 2OCFD 4N1EA 4HKXB 3C9NB 3UO1H 3BGMA 3DIFB 5ADPL 4XMKH 4JQVA 2A6IA 2HLAB 3G5ZA 5EPMA 3E6FB 1ZAGA 4Y8DC 4P59L 4P2OD 2DLTA 3DUUA 1YEGH 3NGBC 1EIBA 3VXPA 3T09A 3OMZA 2EYTB 2FB4L 5DLML 4BSJA 3DO7B 1IEAA 2Z92A 4QXUH 5IB3A 1FFNA 3OG4B 1EA9C 3CIQA 4RIRB 2HRPL 3UZQA 4XVUC 4M62H 1NC2B 3OPZL 2LV4A 3DI2B 1CXHA 5J1AB 2NY6D 3CFCL 1QVOA 5FKPB 3T0ED 1DVFC 4GRWH 4KAQL 5BXFA 4WHTA 1WGOA 3GK8H 3CXHJ 3KJ4C 4WGWB 5FKAA 2F53A 3ARED 3MLUL 2Z31B 4O5LH 1YJDH 4HK0B 1PDKA 3TBVB 1FAIL 4CU8A 2EDRA 4YDVA 3WUWB 3EYUH 4PJXE 4L8CB 3TO2A 1XGPA 3KNBA 3LN5B 1CGSL 4UMGA 4AMKL 3DXAE 2DQGH 3SDCB 3X3FH 3BO8B 3ILQD 4LCYB 4NYLB 3BGFC 4MXWL 4Y1AD 4ENEC 3FO2B 3ARDC 2KL6A 1FL5B 2R56H 5EA0L 2HFGH 1B90A 2JJSA 2DB8A 4P4KD 3E6HB 2P24B 1XH3A 5ACZB 4FFVC 1G7LB 1UENA 4JM4H 3WBDA 4HMEA 1ORSA 2VKXA 4KQ3L 4XRCB 1NBZA 5HSFA 4MJ2A 1L0XA 1QPXA 2IBZY 4MA3B 4J6RH 4ZUUB 3WIHH 2G75B 5C0AB 3REWB 5IOPB 2D2OA 3IU4L 3PWLA 5GXBB 8CGTA 4FZEH 4EI5C 4EUPH 4PJGE 3P4MB 5MENA 2JCCF 3ZE0E 1JTPA 4R3SB 1QNZL 3FOLA 1U8NA 4BELD 3VXRB 5KN5B 2AI0L 25C8L 1LO3H 4FNLL 3B9KC 5FDWA 4UTBL 2L7JA 3MBXH 3BP5A 1LK2B 1BQLH 4ALAL 4NQED 5BV7L 2EDFA 3MO1A 4NDMB 5HDQH 4NZRL 3H2WA 4HHAB 3IDGA 2JB5H 1I1FB 4HS6A 3LKNA 3OHXA 5KVFH 3ESVF 4G6ML 5D7LB 5BRZA 5CSGA 5LCVH 3TPUB 5KG9A 2FD6H 4QEGA 4JDZB 3RIAF 1HCFX 3FB5B 4R9HA 1MI5E 5HDLA 1PY9A 4GT7A 4LNVA 4NJAL 4MLIA 4W6WB 3UTTD 4V1DD 2J8UA 2WANA 2YOCA 3CJJA 1KEGL 4HJJH 1F4WL 4GG6A 2UYLA 3E2HC 1AIFA 3CFJA 2A9NL 3MUGA 1LQSR 1VFBB 4NO2A 1XFPA 4K94C 4MB5A 5BOZG 3ARBA 1A7OL 1J1PH 4OD1L 5JQ6L 5IW1A 1RZKC 4NO3B 1XF3A 4OF0A 3NFPA 4OZFB 2VZ1A 1BJ1H 4WDIB 3QQ3B 2OK0L 3QIWC 1CIDA 1OHQA 4YAQA 2V17H 4P5TD 3LS4H 4X4XA 3L5XL 4TOYH 2X6MA 3BPNB 5ESAA 5HI3C 3VCLA 2Y07L 2PNDA 1A6TB 3OTTA 1IGCH 2AXJA 2DM3A 1CQKA 1S5IL 1F6FB 2WUCH 4JFDB 3SDXE 4HWBA 5F7HA 5EZJA 1NEUA 3QEHB 4TUJB 4FXKA 2OXGA 3ZKNC 3N9GL 1MEXL 2EDBA 1F4YH 3IS1X 4JFHD 1RJCA 2ZSVA 1NGXB 3F7QA 5BMFH 4XVSH 1FZKB 5E8PA 5D1ZD 2FEEL 1TVBB 5FYLD 4L4TB 4MJIB 3C9NA 1CZ8L 1I1AD 3IXTB 1LO2H 2HLAA 4JY6B 3HB3D 3E6FA 2NYYD 1PW3A 4PG9B 4LPCA 3O45A 2I24N 5DUMH 2W92A 4OFYA 2QADC 1DL7H 3K7UA 4XNYH 2EYTA 3DO7A 5HY9A 5C0IB 1RQ5A 4RIRA 4WI5A 1O0VA 4ZPTB 4NP4L 4JO3H 5J1AA 2HTLD 4YGVB 5D2NC 5FKPA 3ZT7A 5D1QD 4KMQA 5TDPA 2GJ6D 2Z93A 3CFBB 4LDOB 4DAGH 2R1WB 3HMXH 2XZAH 1P9MA 2Z31A 1JWSB 3TBVA 1WZKA 4R96B 3WUWA 4L8CA 4B50A 4B7LA 3WFHA 3QZWB 2FLRT 3LN5A 5CJOL 4LIQE 3U36B 1NBYB 4U1JB 3SDCA 1F97A 4Q6IC 1AXTL 1QSFD 4NYLA 2OQJA 4X80L 4GAJL 1J18A 1M6OB 3CFDB 4M00A 3CXDL 3FO2A 1KPUA 5BW7C 4UDTB 4Y16C 5EU5B 1YECL 3E6HA 4K2UL 2XICA 5HDBF 3WFEH 2WINB 1G7LA 4W81A 5EBWA 2N56A 4PRPD 2P5WD 1UB6A 4P23C 4OZ4A 4HS3B 3BSZH 2B1AL 3DMMD 1BD2E 1JNNL 4XRCA 3BMVA 3QEQA 1UB5B 5DT1H 4LARH 4X9BA 2BX5A 3HE6B 1RV6X 4ZUUA 2G75A 3DROB 3REWA 5IOPA 3MRRB 4W4OC 1UYWH 1RUML 1UKSA 2NY1D 1JPGB 4QRRB 4Y5XA 4OZHF 1RSFA 5LJYH 4AEIH 3I9GH 1UH3A 3WHXB 3P4MA 4ZPVB 4MVBD 4OQTA 5HTSA 5ITBL 5I0ZA 1EO5A 3VXRA 1P53A 2PW2B 4ELKB 3L3GB 3GB7A 5FO9B 2VISB 1LP9F 1WWBX 1LK2A 1RFDL 3DRTB 5IROC 5EZIL 4FG6D 1IZKA 2F54B 3HA0A 4XWOD 5MEQB 3N1FC 4NDMA 3G6DH 4HHAA 2R15A 1I1FA 3TN0B 4X9IA 5D7LA 5EUOF 4NQCB 4Y4KB 2XQBH 2H1PL 1SYVA 3TPUA 3D85D 1CS6A 5D7IF 3QNZB 4JDZA 2HG5B 2F58L 5CJQH 3FB5A 1BZ7B 1GGBL 1M4KA 2DQHL 1I7ZB 1MJ7L 3BW9B 4AIXA 4NM4L 1W0YT 2AJVH 2WQRA 4ONGH 4ZXBC 2GYSA 1QHPA 2RJMA 4TULL 4NBZB 1BFSA 4RSVA 5A2JH 1T1WB 4QWWD 5M95B 1R3IL 4KKAC 4OJFH 1RI8A 4HUMB 5KOVC 1VFBA 1ZK9A 3CVHH 2EZ0C 5F88B 3BN9C 4XVJL 4OI7A 3BVNA 2OXHA 3Q6FB 1NGYB 4JQIL 1FYHB 4LLAA 1ZEAL 4NO3A 3BYYA 1T22B 3G5YB 5J6HB 4OZFA 3JV6B 3V0WL 3ARFD 4WDIA 4PRBB 3QQ3A 5HYJE 4TSAH 1JGDB 2UWEB 4XP5H 5GZOC 4FQHB 5C8JB 3VD5A 1AQKL 4C4KO 1PY4A 2IMMA 2BRRL 5E2VL 3TWCL 1A6TA 4U1IA 4NUGH 5C09D 4JFDA 4URTB 4NO0D 4NKIL 1T7WA 4LPWA 3V4VH 2W9DL 3QEHA 4TUJA 5I73B 5KZCB 4P5MB 3O4LB 3QDGB 2DQCH 1AJ7H 3KPSE 4U49A 2EIZB 1YUHB 3RDTB 5F6IC 5DRXB 3BRDA 3H6JA 1FDLH 3SJVA 3K4AA 2F5BL 3MRBB 4G9FB 4ZS7H 3EJJX 1NGXA 1FZKA 4KWUA 2I5YH 1TVBA 2YBRB 3NCYS 2VDRL 4MJIA 5IK3B 1G1YA 9CGTA 4TSBH 2I60L 4GRWB 3EGSB 2AK4E 3IXTA 1C16B 3SQBA 4JY6A 4KKCC 4ZSOB 3TBTB 1R0AL 4PJEB 4PG9A 1FGVH 2AEWA 2JLLA 2AERT 2PO6C 4YDJB 3MTRA 5GGTA 3PL6B 5EN2A 4KV5F 2B4CL 3W5NA 2F53D 5C0IA 4PJCA 2FHCA 2X4QB 3WKML 3QUMH 4ZPTA 4BQCA 1J0IA 4WCYL 1LDPL 3ESUF 3OX8B 1U36A 4TVPL 3J8F7 2E5EA 1UM4H 4HS8H 3CFBA 3TF7C 5F44A 3NAAL 4YDLB 1GXEA 4OM0H 4JREB 1UCBH 5AWNH 4TUKL 5D7SH 3TJHC 4RGNB 5D5ME 4X0KB 1MRDH 1WICA 4R96A 2DLFH 4BFEA 5GGRY 4WWKC 4K9EL 4F8TA 3QZWA 2JJUA 2EXWC 1HK6A 2GITB 5EO0B 4U6YB 2O61B 3U36A 1NBYA 4NHUB 4U1JA 3ZTNL 4CVWA 5D72L 4DVRL 4NJ9H 1JHKH 4DGVH 1VHPA 4ZS6C 3QI9C 5DZLA 4XNXH 1M6OA 3LQZB 4PRNA 3CFDA 4D94A 4WW2B 4XBPB 5JHLH 1YY9D 4HLJA 5HHXH 4G8FA 2C5DC 2AV1B 2XKSA 1IM3B 4XCNB 5EU5A 2CSPA 4JZJC 3FN9A 4UQ3B 1N4XL 1K6QH 2VE6A 3ARGD 1AC0A 3WV0A 1YEGL 4QRPE 2WINA 5EBLB 1IKNC 4HS3A 4X99A 3O6ML 4QXUL 4CADB 4LP5A 1N8ZB 1NC4D 3STBA 1T6WA 4EIZC 3STLB 3DROA 1I7RB 4OLYL 2Y4SA 3GBNH 1JPGA 4QRRA 1OL0A 4S11A 1DQTA 3QUZC 1A1NB 5DJ2B 3WHXA 1ND0B 3TGXA 1CL7I 1JGVH 4ZPVA 1A9BA 4O5LL 4PJFE 4Y2DC 2BERA 5CP3H 2BSTB 2Y5TB 1IAMA 4TQEH 1J87A 1MJUH 3SCMC 3L3GA 5BRZD 3EYUL 1PZ5B 4DK6A 2WUBH 2VISA 1ACZA 1F58L 2V7NA 3EUUA 5C0JB 3TH3T 1JYWA 3RBGA 5I71B 3S35X 5IUSA 2DQGL 1BAFL 5IB1B 5MEQA 3ZE1E 5DMGD 3X3FL 4A6YB 4KZEH 3BMWA 3TN0A 3ZDZF 3G5VB 4GO6B 4JFEA 1A14H 4NQCA 4Y4KA 3QHZL 1BOYA 5FM4A 2FEDC 3DSFH 3BHBB 2R56L 2HFGL 3A0OA 2DLIA 3UTZB 5C6PB 3PXJA 4H1LG 1QHOA 1I7ZA 3BW9A 1RUPH 2V2WB 5FA4A 4JM4L 1OAYH 3LH2L 2R0WH 4GQ9L 3ARBD 4F8QA 4K94H 4L8SB 2KQNA 1T1WA 3FZUD 2P5EB 3FQRB 1RZIB 1EJ6A 2D9CA 4J6RL 1RZKH 3WIHL 2MHAA 5C2BH 5F88A 1GZPB 2X4NB 2HKFL 1D9KC 4Y4HC 1ZLWK 5JOPE 5SWQB 5FYJE 1NGYA 4M93B 1LEGB 4KK8D 4PREB 3MRKB 4KROD 4JZOB 2K7QA 4R0LC 1T22A 4HBCH 2PXYA 3G5YA 1S78D 5J6HA 3LPGA 3JV6A 5L2JB 4ODSH 1F02I 4PRBA 1AP2A 1LO3L 4G8IB 1JGDA 2VZUA 2UWEA 1WFUA 2DMKA 1YEFH 3HI6L 4FQHA 1ADQA 2VZTA 5C8JA 4OCMC 2CRYA 2EDXA 3FTGB 1TQCC 4Z77B 3QULB 1BQLL 2A0LC 2XA8H 3FFCD 2JB5L 3QUYB 2OYPA 5KVFL 4P5MA 3O4LA 3QDGA 4DUWA 2VO5A 4N5ED 5LCVL 2EIZA 4IHOA 3WS3B 4MA7L 1MCPH 1YUHA 2FATH 3RDTA 2OI9C 2MNUA 4G9FA 5IMMB 3W0WA 1NCWL 4CN6A 3BD3A 2J8HA 2EO9A 3BGAA 3IAPA 4HK3J 4OCLC 4YZFF 4HG4K 4Y4FC 4PBVC 2YBRA 5IK3A 3VD3A 2W91A 1DEDA 1A6PA 1HILB 4NWUL 3VG9C 4GRLB 4ZSOA 3TBTA 5IFJA 3BISA 4PJEA 2W07A 2GY7B 5HHNB 1NCUA 4YDJA 2NXYB 2P44B 1REIA 3BPCB 3MA7B 3PL6A 1E0OB 4HIIB 5KVDL 4L1HA 2Z31D 2X4QA 5IB5B 3QXVA 5D1XA 3RVUC 5GRWA 3TVMC 1MF2L 4XVTH 3RUGB 3OX8A 5DVOA 1BEYL 2V17L 4IRSB 5KSBB 3D48R 4TOYL 4JANB 5DJCA 2V5YA 3DGCR 3OB8A 1IGCL 3FRPA 5AZ2L 2WUCL 4JPKH 3SDCD 5HI5C 3ZHLA 4X7FC 3TBSB 5I66B 5ICXA 5L88L 1JI1A 4NFBA 4DWHA 5FO7B 2AK1H 4LDEB 2A83B 2EKJA 1NMAH 4C56E 2GITA 1BF2A 5EO0A 2O61A 2COQA 3AXLB 3IRPX 4NHUA 5BMFL 4XVSL 4XCYA 4HWEH 1GH7A 2VB5A 3SGJC 3LQZA 3IYLW 4WW2A 4XBPA 4YHNA 5AYQA 1F4AA 4MNQE 2XTJC 3QEQD 2AV1A 1IM3A 4XCNA 2W60B 2IH3B 3MV11 4UQ3A 3O3DB 5CILH 5DUML 5DC0A 5C07A 5EBLA 3SE3A 5I30H 1B0WA 4AQ1B 4UINH 1AGCA 4CADA 4QY8B 1N8ZA 5T5FH 1IAOA 1MCHA 5HVGB 5DJ0B 1V5JA 3N50A 4PJIE 3HRZB 3SKNB 4Y19E 3DVGB 3STLA 1I7RA 4JO3L 4IMLB 1LNUB 4LLDB 1YC7A 4UAOC 3VXUA 1A1NA 5DJ2A 4DAGL 3HMXL 5C92A 1ZLVH 1WC7B 4Z7NF 2Y5TA 3WJJA 4L3CB 3NA9L 3CX5J 4K3EL 2BDNH 3N1PC 2HFEB 3BKCL 1JMXA 4LAQL 3AU1A 5IB1A 4PUBH 1GYAA 4L4VE 4NCC1 4A6YA 3CVHB 5C0CE 3E8UH 3G5VA 5D93C 1NSNL 1R3JB 5CUSH 5KSAD 5JW3H 3DRQB 1P2CB 2W65B 5CZXC 3BHBA 2E8ZA 2GSIB 3UTZA 4KK6C 3FB7B 2W0PA 2FSEA 3VFTB 5DURD 3JWNC 3CPLB 3WFEL 4JG0L 4XP4H 2V2WA 3ZSSA 1K5NA 4E41B 4ONFH 3BSZL 1FZOB 5F7FA 1T5WA 5F96H 5DTFB 4L8SA 1IILE 3MCKA 3FQRA 5DT1L 1RZIA 2YHGA 1OP3K 4U1NB 1CICD 5SWZB 3W9EB 1GPOL 1GZPA 2X4NA 5SWQA 4XAKE 3NZ8A 3MRKA 4PREA 2IANB 1Z0MA 4JZOA 1FFOB 1RK1B 3VWKC 3I9GL 1NKRA 4TTGA 2R9HC 2AQ3A 5E6YA 4JFDD 5LGJB 4GMSH 5GHWL 5L2JA 2RHEA 3D3VE 2F9BT 3NGBB 2ZG1A 4KU1A 3FTGA 3SJVD 5IV2A 1KCRH 4W4NA 4Z77A 3QULA 3W39B 2VITB 1O7SA 3G6DL 1PKOA 1KG0B 1FORL 2ZUYA 3QUYA 3EOBB 4LP4A 4MJID 3MCG1 3N1MC 4KKLC 4K8RD 4IMKC 2CJUH 1DVFB 1KB9K 5CJQL 4YO0B 4NN7C 3QUMB 3KJ4B 1WCBB 2QSCH 5H2BA 3GI9H 2NW3B 3DLQR 3A6BL 1XGRB 4UB0H 4GRLA 3F7VB 1A5FH 3NPZB 1KPRB 5BS0B 4R4BB 3BPCA 4EN3C 3P77B 4ZQKB 5J9PB 1GHFL 4HIIA 4OTXL 5IHLB 2EDEA 5IB5A 2CDFB 1N64H 1UM6L 3HUJE 3WXVL 4K3JL 3RUGA 4XP5L 2HT4D 4IRSA 5KSBA 5BJTB 5I1IH 4JANA 3GSNH 1VFAA 4YC2C 3SBWA 2C7UB 1QQDB 4NUGL 5E8DL 2HMID 3S97C 3TBSA 3V4VL 4MMZC 2OL3B 5DJXA 2D9QB 1RIUH 5FO7A 2DOCA 4I0CC 2I07B 2A83A 3GSXB 1AJ7L 5IR1B 3SKUD 2E3VA 1P7QB 4R4NC 3V0VB 4L1DA 5B3JE 4KK9D 5JXEA 4H5SB 1U8OB 5F7DB 4ZS7L 3AXLA 1JHTB 3TCXA 2HAZA 2H2SD 3EHBC 1OD7A 3MROA 5CEZD 4Z7VB 4XPTH 5E5RB 3DX8B 4ODHH 3OJDB 4TSBL 1MI5A 5EU3B 1OTTD 3B9KB 4FQQB 2W60A 1FGVL 4ODTL 2IH3A 3O3DA 5EUKB 1IAKB 4FOMA 5DD5L 1ITBB 4P46C 1DQJA 1L7TH 3BXNB 4PV8B 4QRRD 2CGRH 4QY8A 5T3ZE 1WISA 3RGVA 4IM8A 1Y6MR 4PYHA 5CJXC 5DJ0A 2XPGB 3HRZA 3SKNA 3DVGA 3X14B 3JZ7A 4OF3A 1LNUA 4MDIB 4L3EB 1LEKA 2V9QA 4LLDA 1NGZB 1UM4L 4M7JH 4GXUN 4X6DB 3RKPA 3TCLB 1FO0H 3OQ3B 3TYFB 4Z5RA 4OM0L 5AWNL 1UCBL 1WC7A 1BPVA 1INDL 1NUNB 4YUEH 3NPSC 4L3CA 4Q7DA 2BHYA 1MRDL 3TN0D 5FV2A 1NANH 4JFED 1MFCH 3VWJB 4NQCD 3O81A 4K71C 1UADC 4FTVB 4NQXA 4G3YH 3DECA 5TF1L 4XC3L 2FCBA 3MLXH 2YC1B 4JR9H 2J8UF 3CVHA 4DGVL 1KXVC 4XNMB 3RL2B 4XNXL 3IDMB 1R3JA 4GG6F 3DRQA 4P3CH 1VSCA 5JZ7D 2W65A 1CDGA 3TO4D 2GSIA 3QIWB 5I1KH 4HUKB 3L6FA 2BNRB 3FB7A 2Z8VC 3QO0B 4KDVA 3VFTA 5BZWB 1K6QL 3CPLA 4G8EA 1I9IH 1ZLWH 4Y2OA 4CVXA 4CNIB 3SGKA 4YHYC 3SKJH 5I1AB 1YY8A 2VDQH 1G7IB 4E41A 5KAQG 1FZOA 3P11H 4J8RB 4I3RH 2PXYD 5B39G 3T3PF 2C1OB 1FNFA 3ZYZA 4NOBA 4U1NA 5SWZA 1KTRL 3W9EA 4POUB 2FIRT 2ATPA 4P57B 1IEBB 1WZMA 3GBNL 1KGCE 1FFOA 3TFKD 1YPZE 1I8IA 4J3VA 3O0RH 5IQ7L 3QDJE 3HNVL 1JGVL 5LGJA 4QO1A 1IZJA 1PG7H 3ECBA 3T77B 3UPAA 1MJUL 3V6FB 5KZCD 1ZT1B 2P4AB 5J0BA 3O4LD 3QDGD 3EO9H 4KJPC 2K3TA 3RDTD 4Y5VC 3L1OH 3DYMA 3KLAA 4G9FD 2YRPA 3W0WD 3W39A 2VITA 5D6CA 3UX9B 3WNLA 1KG0A 4IRJB 4KZEL 4JJHA 3EOBA 1A14L 4G6FB 4IS6B 3DSFL 5DJ6B 3JTTA 2MPAH 5CMAB 2VDPL 5EIQA 1JNHA 2CKBL 4YO0A 4MJ5B 2RIKA 4X7SH 3S37H 1WCBA 3MV9D 1RUPL 3PL6D 5DO2C 2R0WL 2ZNWA 4NN5B 2NW3A 1OLLA 2EXYD 4O2FB 3VXSE 1UA6L 1XGRA 2IFFH 4PJBE 5I16B 4FQXC 2PYEE 3F7VA 3UJTH 5FOBB 4Z7OE 1OW0C 3FONB 1KPRA 2HN7B 5D1XD 5C2BL 4R4BA 3ULVE 4JKMA 4BM7A 4I2XB 5T1KB 3P77A 4ONHB 4ZQKA 1AGBB 5HHOB 1VKXA 3GDBA 4HBCL 4NZTL 4RFNC 5HYEA 3L3DB 4NKQB 2CDFA 3JSSA 4RGND 4ACPA 3DVNB 4Y16B 5E08H 3KLDA 5E2WL 5LAXA 5C7XL 1YEFL 4R7DB 2C7UA 1QQDA 3TLRA 5KANI 3U4BH 4P23B 4H1LB 4XMPL 5L0QC 4LFHG 2XA8L 5AAMA 1ZA6B 2OL3A 5IW6A 3DETC 3GSXA 4P2QE 4DOHE 1FH5H 2KBGA 2FATL 4H5SA 1U8OA 5F7DA 3T4AB 3FQXB 3D69B 4K7FB 1JHTA 3ZKQD 3WIIH 3FOMB 1M05B 5C07D 1VADB 3F62A 4YJZL 3PP3K 4Z7VA 4Q9QH 1X4YA 1NBQA 3OJDA 1ZS8B 1CK0H 5F9WC 2ED7A 3S36H 5JDJA 2PW1B 2OR7A 5DQJA 5EU3A 3B9KA 1K9TA 4FQQA 4FXLA 5EUKA 1IAKA 4WV1B 3UTSE 2F8OA 1BGXH 4XPFH 3BXNA 2IBGA 3VXUD 4GG8B 4NQDE 1AD9B 2MFNA 4RMSA 3RFZC 5DJ8B 4HV8A 2IPTH 1JV5B 3KXFE 2XPGA 3AS2A 1YN7B 3X14A 4MDIA 4L3EA 1RIHL 2OM5A 3OXSB 1HHKB 1NGZA 2E27H 2NNAB 4X6DA 1R5VB 4CAGA 3TCLA 4ZXBB 4DW2H 3TYFA 4JPKL 5C9KA 5IIEB 1LO0H 2D7QA 1A6ZA 2AK1L 5HHVH 5EULV 4MA1B 2FO4B 3VWJA 3AC0A 3V6ZB 4WNQB 2XZZA 1E4XI 1MCFA 2X89D 1NMAL 4FTVA 3ZMRA 3CU7A 5T5NG 4N68A 3RX8A 2BSED 4FQ2L 4JFZH 1H8OA 3IDMA 3ULUE 3JTSB 2V6HA 2ADFL 5TH2B 2BNRA 5AG9A 3QO0A 5BZWA 1OQOA 5CILL 3IDIB 3ZSTA 4CNIA 3RWIB 2AK4A 3LIZL 2NZ9C 4M4RA 2XWBB 4NPYA 1K8DB 2YZ8A 3HR6A 4JFYB 5I30L 2D31B 3QDMB 4UINL 4J8RA 4DEPC 1KIQB 5T5FL 1OGTA 2C1OA 4JN1H 2LAAA 3GBMH 3HR5B 5F6IB 3DYOA 5T1DH 4N1CA 2DMBA 3B3IB 1IEBA 4NQSB 3UPCA 2YKLH 5DK0B 5ICYA 4LQ1A 3RKDD 2P8LB 3RWCA 4Z95H 4FFWC 3SDAC 2BY0A 1TTFA 4F80A 3T77A 4WFHE 3P0YH 3QUYD 1ACYH 1ZT1A 3DXAD 2BDNL 2IGFH 2A77L 3QEUB 1I1CA 4AG4H 4OGYH 1L6XA 4WO4B 2Z9TA 1PLGH 1KNOA 2MQCA 3L5JA 3OXRB 2JCCE 3PF2A 4IRJA 1P5VA 5JW5A 3CVIH 5D7KE 4RGOH 3E8UL 3R8QA 5CUSL 4IS6A 2AGJH 4ZOBA 4P9HC 4G9DB 5DJ6A 4GRLD 4NQTA 2WNGA 3MPCA 1U3JA 3D2UB 3IXAB 4MJ5A 4YK4C 2ENSA 4NM8H 4XP4L 1VA9A 4PLJD 1BFVL 3MV8B 4PJCF 4P2RE 1TTUA 3GSNB 3BQUB 2N7AA 2DTSA 3FT2B 5I16A 1NDGB 4KC3B 4WWKB 5FOBA 3JV5A 2R0ZH 1X5JA 2HN7A 1WWAX 3FONA 1HH6B 3DTXB 2VZOA 2VR4A 4IRSD 1FPTL 3SKMA 4X5WB 2DLHA 5T1KA 4ONHA 5HHOA 2DQTH 2IPUK 3QI9B 1QD0A 4GMSL 4PJHF 5J11C 3FRUB 2ITCB 3L3DA 4Y89A 1NGPH 5ICZA 1T21B 1P6FA 1KENH 4Y16A 4JZJB 3CK0H 4R7DA 4XGZB 2O93L 2YZ1A 3TBYB 5JXED 4KXZH 1KCRL 2XI9A 4P23A 4H1LA 4YHOH 3FQWB 2AP2A 3IFPA 1ZA6A 1A22B 3P3YA 5MEPB 1WAAA 4BJLA 5C0EB 4FQCL 1WV7T 4XPHL 4L8DB 1RZJH 1MI5D 3VFSB 2N7BA 5HHMB 1G0XA 3QCUH 3UBXG 4X6BB 4U2ZA 2YPLE 3T4AA 3DBXB 1J86A 3HLAB 4JDVB 3V7AE 3EFFB 4K7FA 1BHGA 1SQ2N 1MUJA 3QUZB 1WWWX 1M05A 3S34H 1VADA 5EWIL 1YC8A 3GI9L 1T20B 1ZS8A 4H8WH 1S9KC 2NX5E 4I0PD 4PJ9C 3SCMB 2PW1A 2XOTA 5DZOA 3RGVD 4UB0L 4LPYA 1FO0B 2BHZA 4ETYA 3BIAX 4WV1A 3GHBL 2YD6A 1FIEA 3RWJB 5IROA 3LQAC 5E7BA 2E7BA 3WSQH 1JTTA 4GG8A 1AD9A 5DFVC 2ZUQC 4DN3L 5MHSD 3DHJA 1Q38A 4IIQC 1II4E 5DJ8A 1D7FA 1JV5A 4NRXB 5JR1H 1N64L 2DM7A 3O8XB 1TFHA 3O9WB 5DC9B 3F7PC 3NBNA 1U8KA 5I1IL 1HHKA 1X5AA 4IOFD 3VW3L 1NBVH 1R5VA 2YUWA 2AEPH 5I1HL 4ZFOB 3QUXD 1WIOA 5EIVA 1BQHG 2D7TL 1XIWA 3RAJH 1RIUL 1QBLL 2DTMH 2FO4A 3V6ZA 2NY4C 4WNQA 2EECA 3H8NA 2QR0B 3MC0A 1D9KB 2VLJE 4Y4HB 1QFHA 3JV0A 4I8DA 1BREA 2P7TB 5JMOC 2Y06L 5A2KH 4K8RL 4R0LB 3SE9L 5DRNB 4MA8L 4XPTL 6FABH 2W59A 2GFBB 4XXDB 4E41D 3BP7B 2FZ3A 1Q9WB 3E3QE 3LN9A 2DD8H 5TH2A 1H0DB 3VGDA 5JDSB 5SWZD 4CW1B 3IDIA 1FVCB 3RWIA 2R2BB 1TQCB 4ORZC 1L7TL 5DUPH 5FYJU 3P9WB 3MFGB 1OTSC 1VGEL 2XWBA 3I6GA 3VMNA 4JFYA 2CGRL 4MXQC 3IKKA 1Q72H 1KIQA 4AYFA 1AR1C 1E27B 2RGSA 3RTQB 2UWEF 1CDYA 4U6HB 5CCKH 4PLKD 4X6CB 2OI9B 3B3IA 2X4TB 3RNQB 5FA3A 3NFNB 4L9LC 4M7JL 3QRFM 4NQSA 4PFEA 3SO5A 5DK0A 4Y4FB 1CE1H 1FO0L 2P8LA 3ZLQC 2BSSB 3FB6B 4X7EC 4ONOA 4ZFGH 1UT9A 1MFCL 4BFGA 5AUMB 2QJDA 1U0QA 1UWGL 4OZHE 4G3YL 3QHTC 4U6TA 4WO4A 3B5TA 5E95B 3W5MA 1BWWA 4JR9L 4FMKA 1DBBH 3I85A 3GI8L 2VWEE 5I8KH 1I1YB 4WEBH 4P3CL 5CEZL 1NPUA 3HMWH 4HGKC 1OAKH 4R26H 3ZDXE 5I1KL 3PE9A 5EBGA 3IXAA 5E1HB 4I48B 4RBPK 1I9IL 4HXAL 5E99H 1ORQB 1G6RH 4JRXE 2XZCH 3MV8A 5EUOE 3GSNA 3P11L 3BQUA 2XFXB 4I3RL 2QSTA 1NDGA 1KB5L 4WWKA 5D7IE 4U0RC 3T0BA 4DN4H 2VABA 5T3XE 5JQHC 1HH6A 5HXMA 3DTXA 4P99A 2YD3A 2EO1A 5E56A 4H20H 3BWAB 3Q48A 4X5WA 4HUVA 3MV7E 5TE4H 1FV1B 2EKSB 4PJDB 1ONQB 5H35B 5DD1L 3O0RL 3FRUA 1PG7L 2ITCA 4OZGB 2YN3A 3I3EA 2CQVA 2XTJB 2VQTA 1S7WB 5CINH 5LXGL 3EO9L 4OT1H 2G9HB 4LHUA 2AJZB 4MAUL 3TBYA 1IKNA 3IDJB 4KVCH 3NCMA 4QYOB 4LBEB 3ORJA 5C3TA 4F57H 3FQWA 3UJIH 1N5YH 2IWGA 3PP3H 1PSKL 4YGAB 3WE6B 3PGFH 5MEPA 3TA3B 1NUDA 5A3ID 1QRNB 1SY6H 5C0EA 5CGYC 1MY7A 5HI4D 4XH2B 2WM0A 1W8OA 4L8DA 5B39B 2MPAL 3VFSA 4X6BA 1MWAH 2ZP0T 3LEXA 4JDVA 3HLAA 4R2GB 1QLRA 4NNXB 4X7SL 3QUZA 4WTZG 2LFGA 4O58H 5I8OL 1T5XB 1T20A 3VD7A 2IFFL 3H9HB 3UJTL 1NGQH 4OLVL 2K1MA 3CFKB 1QP1A 1KYOJ 3U9UB 4JN2A 3RWJA 3PP4L 4L3ED 3T0XA 4RFEB 1RK0B 3BESR 4NRXA 5D93B 3HNTH 3EJZC 2N1KA 2P46B 3MX0A 3O8XA 5E6IB 3O9WA 5E08L 2VYRE 1FLTX 2FX7H 5EOTB 3TPKA 3VWJD 4F7PB 3QSKB 2ZKHL 2WWMD 4KV5E 2GTZB 1ODAA 4FTVD 3ARYA 5HBBA 4ZFOA 4LVOC 2VR5A 1UH2A 1TJIH 3ZE2F 1CGXA 3A6CH 3B9DA 4D2NA 3T0EE 1TZGH 4I13B 2CMRH 3QQ9D 1V7MH 1D9KA 1FG9C 2HKHH 5GRVL 4QHNB 1FSKC 2P7TA 1QG3A 5ADOH 3VWKB 1DANU 5DRNA 3KPTA 1L0QA 4XPGL 2AK4D 4XXDA 2GFBA 3TJEH 3D25B 4Q9QL 1JVKA 4KJQD 3BP7A 4Q9CA 2FHFA 1Q9WA 4CUCA 1DN2A 1TPXB 1K4CA 2RB8A 1ZT4B 3HC0B 3W81A 5JDSA 5DC4B 3MLSL 4CW1A 1FVCA 1Z0NA 2R2BA 1N59A 4J3TA 1SEBB 1XR8A 1RJLB 2JELH 4Z76B 3WFCL 5KVMC 1B9ZA 1RIVH 3RPIB 2C3GA 4LLMB 4AENA 3H3KA 5E9DB 2A6JB 3KYNB 3RTQA 5HVWA 4OB5L 5AYUH 3U2SA 4U6HA 4NZJA 5D2LB 4MAYC 4X6CA 2EDQA 3T2QA 1FG2B 3RNQA 1S9YB 3QXDB 3NFNA 5IW3A 4RZCB 4PJXF 5FUOH 2BSSA 3HUJA 3QPQC 3FB6A 5FECB 4O2CB 4IRJD 4KK5D 1LO0L 5ESQB 1G7PB 5HHVL 4F7CB 2WP3O 1AI1L 3KYKH 5AUMA 1OGAB 3U7AA 4WU7B 1F4XH 2VXUH 1CR9H 3N85L 1NANI 4EN3B 4P9HH 1A6AB 4B7IA 3G6JB 3H42H 5BQ7B 3RJQB 1I1YA 2EYSB 1KJ3H 2C4FT 2BRQA 4FQLL 3PV7A 4LKXB 1KCKA 2OMNA 4TTDD 5C0NC 1BQUA 1UWEH 5IMOB 4YC2B 4I48A 5E24E 4JCMA 1A0QL 5IBTH 1ORQA 4NOFA 4DUXA 3K8LA 3QNXB 1LILA 1V3KA 2P43B 1X5XA 2UY6A 1XGQA 5JIIA 1T83C 5HHOD 3V5KA 4TYUA 3OF6A 2XFXA 1I3VA 3SQOH 3C8DA 4JKLA 3MOBH 3IDUA 4JN1L 1PD6A 5ERWB 3QIBC 1IC5H 3GBML 2WBJC 3L3KA 4XHJD 5KSBF 1PEWA 5T1DL 4V1DE 3ILPB 3MRNB 2FJGB 3ZE0F 3BWAA 3JWOC 1CFBA 1OQXA 1P4IH 2VDML 2YKLL 1FV1A 2EKSA 5H35A 4Z95L 2FWOA 4J3WA 2WIIB 3BUTA 2EYRB 3P0YL 2HFTA 1Q9KA 1EUUA 2NY2B 1BM3H 3BAEH 1ACYL 4PJ7B 3PWVB 4K3DL 3L9RB 3BD4A 3IDJA 4HGMA 4PB9H 5GRZA 1JIBA 1FN4A 2OS7A 3SGEH 1PLGL 4JY4A 4NNYA 3WE6A 3EOYG 2FJFB 4RGOL 3TA3A 1A1OA 1FRGH 5C3LD 4KVNH 1QRNA 2FHBA 4DZ8B 4XH2A 3GMRB 3THMH 4OV6F 3EFDH 3S35L 4JPIB 4FQIH 4EDWH 1S7RA 1F00I 4N5UA 1OT1A 2NMSA 3DYPA 4NNXA 4CMHB 4NM8L 1LK3H 1OM3H 1T5XA 3P0VH 1A7QL 1FC1A 2GCYB 5DYOB 1FBIL 5GS0C 4LOUC 1T03H 1IC1A 3LQAH 1KLUB 4JFHE 1JPSH 3C6LC 5FYJD 2R0ZL 3CFKA 1M1SA 1V05A 5FYLE 3BIKB 3L5WA 5BVJB 1BFOB 4UT6L 4OCYH 1DBAH 4RFEA 2DQTL 5IFAH 2X40A 2OTPA 5C6TL 1BJ8A 5B38G 1FVDB 1NGPL 4F2MB 1XIWD 3K0WA 1KENL 5E6IA 4KUZH 1J5OH 3SDXF 3CK0L 4XNQB 2V2XB 5CKGA 2XG5A 1KIUA 2GTZA 4X8JB 4X4YB 3FL7A 4AL8L 43C9B 5FF6B 3PNWA 1NMBH 4M48H 1F8TH 2VIRB 5DUBB 1RZJL 1XZ0B 3QP3A 2MCG1 1U6AH 2QQNH 2FYYB 1HHHA 3MGTB 3O6FA 5J06A 2C26A 3JWDC 4PY8I 4K7PH 1AHWC 2JKXA 3D25A 4ODXB 4PRIB 4H8WL 3F8UB 1LVEA 4IOIB 3SDYH 1ZT4A 3MSPA 3HC0A 1KN4H 1CCZA 1IAIH 4PG2A 4UBDC 2DRUA 1QSFE 3VXSA 2E9BA 1DQDH 2HWZH 1JP5A 1EBAA 1RJLA 4JRYB 4Z76A 5EOCJ 3RPIA 1JHLL 4RFOH 4LLMA 1DR9A 5JR1L 5E9DA 2A6JA 3GJFH 3KYNA 3G04A 5GRUH 3NA4A 4HULB 4KKCD 1Q9LA 5D2LA 3T1FA 5IESH 1G1CA 2P5WE 2YXMA 1KJ2L 1S9YA 3QXDA 3LEVH 1IGYB 1NBVL 3UBXB 2VKWA 4RZCA 1NDMB 3S3SA 1HNGA 2AEPL 2VLRB 4WO4D 1VFMA 1CYGA 5GPRA 3OR7B 4RRPG 5FECA 4O2CA 5ESQA 1G7PA 2X4OB 3UYOD 1G6RB 4IOSD 2Q86B 1YNTB 4KI1A 1OGAA 1DEEB 3T2PA 4JFFB 3RZCC 4KPHH 3LD8B 5GGVY 3FQUA 4RBPH 4P2QA 4HUNB 1KCVL 1A6AA 1ERNA 4LSUH 3G6JA 5BQ7A 1NQBA 4HUUA 6FABL 3U30B 1KFAH 2DQIH 2EYSA 3MV8D 4HC1A 3NVQA 3K8KA 4WFGD 1MCKA 1DP0A 1S7VB 3BQUD 5IP4A 2EDTA 3CH1B 5DEGB 3GMNB 5IMOA 1KF9B 5KSUB 1J05A 1DDHB 5DUPL 5F7EH 3QNXA 5JIKA 1EEYB 2YUVA 4BUGA 4EBQH 2UVEA 3KPMA 1P5UA 3BP6B 1OT2A 3ULVC 4Y5YC 3UTSA 2IAMB 5ERWA 1BQHB 4HFUH 4HKZB 1MFDH 3ILPA 3MRNA 2FJGA 2C3WA 2ESVB 1A3QA 4P0DA 1U3HD 4LHUD 4KKBD 1X9QA 4JHZA 4O4YH 4JM2B 4QTIH 1CE1L 2QQQA 4LF3A 1UEMA 1MWAB 2EC9T 5A43C 1QSVA 2WIIA 2EYRA 3QAZC 4LCUB 1T80A 3PWVA 5D7JB 5I1JL 3L9RA 1WWCA 3CLEH 4ZDHB 4L4VD 3C8KB 2O5ZH 2PTTB 2HT3D 4DCQA 2NQCA 4Z7VF 3D18B 2NTFB 4M1CC 2VQUA 2XT1B 2B7DT 2RCSL 5I8KL 5CJXA 2FBJL 4ZUWB 4LRIC 3GMRA 4K55A 1OAKL 2B5IC 2P48B 1FIGL 1V3MA 4JPIA 3LZFH 3T08A 2E7LA 3D1MC 5HPMB 3S9DB 5E99L 4POZC 3IDYB 5DD3L 1MREH 3QISA 2EIDA 2GCYA 5DYOA 2A1WL 5FHAH 1UACL 1A3RH 5C9JB 3O3BB 1KLUA 1A47A 3Q5YA 4MD0B 3G5XB 1CDUA 1AQDB 4XAKD 5ALBH 3O8XD 3O9WD 4QT5B 1IE5A 4H20L 3GUTA 4X6DF 4E9LA 3BIKA 5BVJA 1BFOA 1FYTB 2CLVB 3BZ4B 5M7QA 5TE4L 2NR6D 1P4BH 1SVZA 1E6OL 4GSDL 1FVDA 4F2MA 4M5YL 1G9EA 4FQ1H 4LLWB 4XNQA 2V2XA 4YBQD 3EDJA 5DRWB 1E4KA 2J8OA 4LU5H 2F53E 3MRJB 3UEZA 4KVCL 5TDNA 5CSBA 3AMLA 4PJ8B 4F57L 1WTGT 1N5YL 4RDQF 4DEPB 5FF6A 1R5WB 1FL6A 3GIVB 3PGFL 3EDKA 5CSZB 1MJ8H 2XIDA 2VIRA 4CMMB 5DUBA 5CJ8A 3BH9A 3KPNA 3VG0H 1XZ0A 4OLXH 4KMLB 4YEFA 2FYYA 1NCBH 1ZMYA 4YBLC 5JXAL 3MGTA 3W9DB 1KPVB 3V6BR 4OCNC 4C83B 4O58L 2XRAH 3SDAB 4ODXA 4F15C 12E8L 1XR9B 2FL5A 2ZSWB 3QNYB 2Y6SD 4KDTA 4IOIA 3LB6D 3MNVB 4JFOB 2L4OA 4HXBH 3RTQD 1NGQL 3C87A 2NW2B 3QFDB 5F6HJ 2Y5EA 3KYOB 4JRYA 1MELA 3QQNA 4U7KA 1LMKA 2H32A 4BZ2H 1X5YA 3HNTL 3CFIC 3LCYA 1EV2E 1IFHH 5DQ9B 3IETB 2FX7L 3QEGH 3V9FA 5E8NB 1IGYA 1S7QB 4YK4B 3UBXA 1NDMA 5MENE 3MJ9A 4U1SB 4M8VA 3VRLE 4XXCA 1T66D 2VLRA 2E7HA 4U6VL 3OR7A 4NZUH 3UJJL 3B2UC 1TJIL 3A6CL 4S0SD 3NCFB 3BIBX 1TZGL 2Q86A 3IGAB 3K2UL 1R3LB 5GRJH 4JFFA 1V7ML 4GBXB 3ZL4H 4I18B 5JA8B 1MCIA 3MACH 4P4RB 1NMCC 2JB6A 3H9YA 2V7HB 2H2PC 2YD9A 4QHKI 5E4IA 4NQVA 1MFEH 1QUNA 1YA5A 2YPLA 3B83A 3OF6D 1S7VA 4NBYB 3RVWC 1I8MB 3CH1A 5DEGA 2ZOKB 4U1GB 1TQBC 3C09C 5KSUA 5F71A 3WHE0 1DDHA 4AIZB 2J8UE 4X7CC 1EEYA 4R7NB 4ZFZB 1K8IB 3OB0K 4EOWL 4GG6E 5HYSB 5HD8C 4LCCC 3JWOH 5FEBA 3O4OC 2IAMA 3KYMB 3GSWB 3MNZB 3MZGB 5E5MB 4K07A 3U0PB 4HKZA 1RJZB 3EYOB 1XT5A 4PJFF 5LQBH 1EFXD 5I1CH 3RWFB 5FV1L 3C08H 2F15A 3DX9B 4JM2A 5FUOL 2C4FU 4PJ9B 4OGXH 3FN3A 4LCUA 4YFLI 3TA3D 4GQPH 1S7SB 4DFHA 5CD5D 2D03L 5B3NA 5D7JA 3ZE1F 3KYKL 1JTOA 2ICES 4ZDHA 1F4XL 2VXUL 3MRDB 1KLGB 4FA8A 1FCCA 4RA0C 2E6QA 2PTTA 4R2GD 3RZWA 3D18A 4UI2A 2NTFA 4IIQB 2BOCA 4PV9B 3C5JB 1YEDB 2VLJA 4S1SH 4Z7WE 2R4SL 4ZUWA 1I8KB 1RD6A 3MRQB 3BJ91 4Q6YA 3SDDD 5GS0H 5HPMA 3R1GH 3UBXI 5IBTL 1OARL 5T3ZH 1UJ3C 5L8LB 3SQOL 4MD0A 4E5XA 3MOBL 2NY4B 3KG5A 2FIKB 5B8CB 1AQDA 1U8IB 5E6ID 4QT5A 3MLPA 1MLCB 3ZYJA 3BZ4A 3BZFB 1T0MB 3R06B 4TRPH 4YHZH 1T0NB 4K3GA 2W0LA 3BAEL 2ICWB 2E7CA 4LLWA 3TNMB 5DRWA 1JCKA 4PB9L 3MRJA 4L4JA 4PJ8A 3O6FD 1L6ZA 2IALB 4V2CB 1R5WA 1FRGL 5CSZA 4KVNL 1QFPA 2XYCA 4CMMA 3IF1A 3JWDH 3THML 5K9KB 1ZANL 5DQDH 4EDWL 2R39A 4HH8A 1KJMB 3GRWH 4L9LB 4A2LA 4MB3A 3W9DA 2YR3A 1KPVA 4UIKH 3E3QC 1LK3L 3VXSD 2HYMA 4CVZB 4D9QD 1XR9A 2ZSWA 3ZKXB 3QNYA 1T03L 3LQAL 4JFOA 4LK4A 4OD3L 2NW2A 4KGLA 1CE6A 5ADPH 5DD0H 3QFDA 3P4OB 2DQEL 3VMOA 2DJ4A 2YPVL 3KYOA 1DBAL 1BOGB 2PCPB 4G7YH 2GSGB 5IFAL 1P84J 3ZKMC 3CDFA 5L8JB 3L7EB 2VAJA 1T3FB 5C0AE 2EDJA 4AEHH 5DQ9A 3IETA 4KUZL 1J5OL 4ZD3L 5E8NA 2HRPH 1C5CH 1NJ9B 1OGAD 1S7QA 3OKOB 1X44A 5B22A 3WDIA 3OPZH 4R90L 4U1SA 1QEWB 4X98B 1D6EB 2EC8A 4JJ5B 4P2QD 5C71A 3CSBA 3VXRE 2MQ3A 4UT7H 1NMBL 4M48L 3VJ6A 1F8TL 3MUHL 3IGAA 4UT9H 2EDNA 1R3LA 2NY0C 5SWSB 3BZEB 1Y6KR 4GBXA 2QQNL 4I18A 2FH6A 1RPQA 4P4RA 4KH2A 4O02H 2V7HA 3GHEH 4XBGB 4F7TB 4MDJB 5D7LE 4CJ0A 3H9SB 2UUDK 4MXVE 1WT5C 2DI9A 5I8CA 4U7SA 2VTFA 5EOCH 5TQ2L 4OFPA 3LKPB 3SDYL 3UTSD 2ZOKA 4OFIA 5B38B 3SY0B 3MZTA 3VFWB 3EYVA 3ULVH 1WIUA 1YEKH 5FYJL 4WHDA 5TQ0L 2R0KH 5F70A 4ZFZA 1K8IA 1ETZB 5I2IA 5H8DA 5HYSA 1RHFA 1M71A 1C5DA 2DI8A 3QIUB 3KYMA 4JB9H 3MNZA 4KQ3H 1EXUB 2NY2D 4IDJL 1RJZA 1MVUB 1TZHB 3LEVL 3AM8A 3RWFA 3DX9A 5C0FB 3CD4A 4PJ9A 3ZYIA 3MRMB 3TZVD 1S7SA 4HK3N 2F19L 1QNZH 1UH4A 4HKBB 3MRDA 1KLGA 4E42B 5F93C 4FNLH 4JFDE 4NRZB 4HDIB 3O3UN 5DWUH 3ULUD 4IIQA 4YE4L 4PV9A 3C5JA 3HC4L 1YEDA 5EORH 2DQIL 2EDWA 4ZO8A 1X5KA 1I8KA 3MRQA 4NZRH 2ORBH 5ALCL 1UZ6E 5J8OA 1CLZH 2IQ9H 2YS4A 1EEZA 4L4TE 3K80A 3KLHD 4MJIE 1N2RA 4JQXC 3P30L 4EBQL 2EC9U 4TSCH 4NO5B 1DQLH 2B0SL 3OV6A 4HJ0C 3CDCA 4XI5D 2B2XH 2FIKA 5B8CA 4HFUL 1KEGH 1U8IA 4LKCA 4XC1H 4U05A 1F4WH 4FS0A 4Z0BH 1FNGB 1MFDL 1NAMA 1FSKB 2XKNA 4HUWA 5GSRA 2KPNA 4P2OC 4G6KL 4KRMB 3BZFA 1T0MA 2DYPA 4WFHD 1U9KA 1CDJA 5C70A 1T0NA 2KZ1B 4OD1H 2YPKB 2AJSL 5JQ6H 5DVLA 2ICWA 1QSEB 1A7PH 3CLEL 1PAMA 2OK0H 2NY6C 1NUFA 3Q3GA 2D7PA 4MCZA 3T0EC 3L5XH 2ZUWA 1RVFL 1CGWA 2IALA 2Y07H 4AIOA 3AREC 4BUHA 2MCPH 1S5IH 3BKYH 2W1NA 2J7LA 1PGRB 3GM8A 1MPAH 1CFTB 3LZFL 3X3GL 3N9GH 1W0WB 1WF5A 1XF5A 4CVZA 5H94B 1HH9B 1MREL 4JRYD 5J7CC 1KCLA 1QR4A 1S9WB 4LPUA 4Q9RL 1Z9SA 3ILQC 2ED9A 4M43H 4LGSB 5ALBL 2Z8SA 4OBRA 3P4OA 5DSCB 1J0KA 4P4KC 4AY0A 1BOGA 3HUJF 5IEKB 2PCPA 3CLFH 1D5MA 1CU4H 2F5AH 2VLRD 2XKUA 2P49B 3L7EA 2LQRA 1T3FA 3FQNA 4OFVA 3OKKA 3QWRA 5F8RC 1AGEB 4FQ1L 3RWHA 5JW4M 4QRRE 1NJ9A 3OKOA 4ODVH 4LU5L 4JFFD 4NP4H 5IT2H 5EU4B 3RHWK 1K2DB 4X98A 1IQWH 4LSRL 1D6EA 4FABL 3MJ7B 4JJ5A 3MA9H 2AJ3B 5B3JF 1OSZB 2VR9A 3TH4T 3T2OA 2Q7NA 4M8QB 4XAWH 1QFWI 1MJ8L 2YPLD 5E00B 3BZEA 5SWSA 2VQ1B 2A2QT 4OLXL 1PBYA 4DGIH 1NCBL 2F54E 1AY1L 1GGYA 1B2WL 4AJ0A 1SEQH 4XBGA 3FQTB 5CJOH 4F7TA 4YXKL 1EO7A 3OB0H 4NQCE 1U42A 3RIFK 1OF2B 2ICWI 4J3UA 2IAMD 3JUZA 5B38A 1VEMA 4HXBL 3QG6B 3VFWA 3CXDH 4RQQB 1Y6NR 4PRHB 4N0UB 1XCQB 2Y36H 5DGQA 2OJEA 2DL2A 4UNVA 4JY5L 1YECH 3MLYH 2OZ4H 1IAII 3EJYD 1ETZA 4GKSB 4K2UH 2QV2A 4JM2D 3WNKA 4HIHA 1P7KB 3QIUA 4GAFB 4C57C 1SBSL 3S96B 1EXUA 2YD8A 4ZOEA 3QEGL 2BVPB 1TZHA 2XXCB 5D7JD 4Z6AT 3FN0H 4PRAA 1IMHC 3DOSA 4NT6B 2VZVA 1SJVA 3EYQD 2IBBA 1E28B 5C0FA 1LD9B 1HYRC 3B9EA 3MRMA 5J3HD 5KAQF 2WP3T 4NFDA 2UWEE 2VLJD 1AD0B 5KOMC 1MIML 5GRJL 1HOCA 4WI9A 3HC3L 2DN7A 5D71H 3ZL4L 4E42A 4NRZA 5KJRL 4HDIA 3MACL 4P5TC 2BOBB 1U92B 1S7XB 5TE7H 1CFVL 3O4LE 3GZKA 3QDGE 4YIQB 1MFEL 4UOW0 5EZIH 1JUFB 4KTDH 3VRJB 4ZNEA 2J2ZA 4ZUTB 4G9FE 4QHMB 1D5BB 1YQVH 3O2DA 4OF5A 1GSMA 2H1PH 4BK5A 3H3PH 5EBMB 4GRWE 4NO5A 2Y25A 5D1ZC 4ZSOE 4D3CH 1MJ7H 2BXZA 4PJEE 4NM4H 1BQSA 3LQMA 1NFDB 4RRPA 3FO1A 3LMJL 1I1AC 5KVGH 1YPZF 1WBZB 2BVOA 1FNGA 1A2YA 3HB3C 4R97C 5HJ3A 1R3IH 2NYYC 3OAZH 5I1CL 3C08L 2BHUA 5CBEA 1HYSD 2H8PB 1ZGLB 2BC4A 1JFQH 2VXVL 4PJ8D 1F3DJ 4QLRA 2QKIB 1CIUA 4OGXL 1DZBA 1TTGA 2A6DB 1QSEA 1AR2A 3PV6B 4GLRH 4I5BB 1VPOH 4IEFB 5CP7B 1EFQA 2HTLC 4MB4A 1KTLB 5D1QC 4G8GB 1AQKH 4RGNE 4UUJB 3O2VL 3PQYB 1A9EB 1B0GA 1WBXB 5I76B 1JWMB 4NKIH 4D9RE 2NY3D 1CFTA 2D4FA 1DBKL 4JRXD 3R1GL 1KTDA 3ARTA 4XX1G 1J8KA 3GMQB 3PHOB 2F5BH 4Z7OF 3V8CA 3PWPB 4D0DB 5T3ZL 5IVNA 5T3XD 4N9GA 1BZQK 1BMGA 3FT4B 5D2LF 3RY5A 5A2IH 3OJ2C 2I60H 3RZCB 3MV7D 4MZ2A 3WL9B 5HGHB 1DBML 2D7NA 5I0DA 5DHVH 4U1LB 3T0WA 5IEKA 3QWQB 1RJYB 2UVFA 5J4MA 4JPWH 4TRPL 5EO1A 4ZFFB 3WJLC 1KXTB 4WTXA 1AGEA 4DKEL 1WTLA 2X1WL 2C3XA 4NRYA 3WKMH 4EUPG 3H7LA 1N7ML 4WCYH 5EU4A 1K2DA 2LVEA 4GBXD 4U33A 2ZPKH 1Z3GH 3SE8H 2QQKH 2NY1C 1T83A 1UGNA 3G6JF 3MJ7A 4TVPH 4YQXL 3RU8H 2AJ3A 2UUDH 1OSZA 5FGCB 5EC2B 4M8QA 4LPVA 4MVBC 2CDEA 2R0LH 5E00A 3Q5OA 3JWDL 5GS2H 2VQ1A 1EGJH 1KEMH 3GRWL 2R29L 5LWYL 4FQPA 5J57B 1JRHI 3FQTA 1K3IA 4M6NH 1OF2A 4FG6C 4XWOC 3QAZB 2J6EA 4P9MH 3RL1A 4DVRH 1R3KA 4M5ZH 3QG6A 1F6LL 3DHMA 4GW1B 4PRHA 4RQQA 3UROR 4HJGB 1XCQA 4JHWH 5DD0L 4M3JA 3BUYB 4CRPA 3OKDB 2F74B 2YD4A 1N4XH 4GKSA 5T5NF 4G7YL 1VGKB 3UPRB 2LABA 5E4EC 3VD4A 3S96A 2XY2A 2B5IB 3O6MH 1RZ8A 1H9VA 3NN8B 4AEHL 4QWWC 2DKSA 2BVPA 3QWOA 1C5CL 5IBLD 1I7UB 4Z7UB 4NT6A 5BV7B 1E28A 4OLYH 3SPVB 3BX7C 4F33B 5I75C 4X6FA 2MWCA 2X05A 2YWYA 4UT7L 1AD0A 4P3DA 1HEZB 1AKJB 4QOKB 4UT9L 3RVTD 3R0NA 1H15B 2BNUA 3ARFC 3MNWB 2WLYA 3TIDB 1OAUL 5T1LB 3ULUF 2OTWB 3OKYA 1U92A 3F65A 4O02L 1F58H 2VDOH 3GHEL 1MQ8A 2ADIA 3OR6A 2WBKA 4UILL 5EOCL 3B6SA 1C08A 1BAFH 1JUFA 3VRJA 2YMXL 4ZUTA 5D96B 5HGAB 4MD5B 4MZ3A 5DZNA 3QHZH 1BJMA 3ULVL 3K4ZA 4JQVC 1SMOA 1YEKL 3I6KA 5EBMA 2R0KL 5DJZB 2DYPD 4S1DD 1OCWH 1CLYL 5MI0C 3CZJA 4JB9L 3LH2H 1NFDA 4GQ9H 3V7MA 2FR4B 3U83A 1WBZA 3MXVH 4P49A 1J1OH 1QFUH 4YBLB 3KWWB 2BMKB 2JJTC 1JGEA 1RUKH 2HJLA 4U1KB 1ZGLA 2HKFH 5AEAA 4F15B 1XCTA 4HX1B 5L2KB 2QKIA 2X4RB 3CXHK 3RUGE 4HKJB 5KSBE 2A6DA 1ZSDB 1K85A 3PV6A 4I5BA 1W72H 1HDMB 5CP7A 2WV3A 5C08B 1FZJB 5DWUL 3HI6H 3PXHA 4G8GA 2YRLA 3NFSH 4UUJA 1GJIA 5EORL 3PQYA 5DEFA 4WHCA 5FK9A 3M1BA 4XP6H 1WBXA 4YEEA 5I76A 3QFJB 4YFLF 1JWMA 4B0MM 3ARZA 5SX5H 2ORBL 4QRUB 3TC9A 3S88H 2H9GA 5HVHC 1CLZL 2IQ9L 3T3ME 4GW4A 3UMTA 3ZT5A 4EXKA 5JHDB 4MA7H 3GMQA 3PHOA 4UV4H 4TSCL 3GSOB 3PWPA 1DQLL 1NCWH 4M6AA 4D0DA 3MRCB 2AEQL 3P9MB 1X5FA 2B2XL 3FT4A 1ZVSB 4N0YL 4NWUH 3FAXA 3QWRD 4XC1L 3RZCA 3WL9A 4Z0BL 1F2XK 4LVNC 5HGHA 1DE4B 4U1LA 2CR3A 2VDNH 5D8JH 3ARGC 2D0HA 4OV5B 3AS0A 3KPOB 1RJYA 4I3GA 3VD9A 3ALWA 4ZFFA 2R2HB 3LKRB 2GI7A 3GNMH 5KVDH 1N3NB 1N0LA 1TQBB 1ZE3C 5MP6L 1A7PL 4S10A 5MHSE 5SWSD 1I85C 1MF2H 4H0HB 1BEYH 4WUUB 4BQ8A 1B4RA 2NXZB 2UZXB 3O4OB 5AZ2H 3ULUL 2MCPL 3BKYL 1OAZL 5L88H 1MPAL 3QXWA 3AGVA 2DIJA 4Z7WA 4Z8FL 4BQ6A 4BZ1H 1GVIA 3O3EA 4MCYB 1TCRB 1CGUA 1H8SA 1HWHB 3LPWA 3MBEB 5C0BB 5DMGC 3TT1H 2IF7A 1WIPA 1JWUB 2B39A 1YMHA 4JKPH 3QIUD 3IVKB 4HKXA 4M43L 3IJHB 4GJTB 3DIFA 3C60D 4HJGA 4KTEH 3EDEA 4E41E 3BUYA 5SX4I 3OKDA 4JM2F 2F74A 2PF6A 3KR3H 3MRHB 5IB2B 1VGKA 3CLFL 5FYKD 1CU4L 4KI5E 3UPRA 4HWNA 2F5AL 2VC2H 3ARBC 3H9ZA 1EHAA 5SWZE 3WXWL 1CQYA 3BRFA 5BOPA 3NN8A 3FZUC 3HAEG 2YA0A 2NY5C 2IANE 4MNHB 2X2YA 4LLQB 4ODVL 5IT2L 4NC2B 1NC2A 3U4EB 1MCWW 1IQWL 3SPVA 4KK8C 4KROC 1UJ3B 1I3GH 3MA9L 2OR8A 1D5ZB 4XAWL 4BSVB 1S78C 1AKJA 4QOKA 4F58H 1S7TB 4HK0A 1H15A 3HI1B 4PJAB 1CFQB 3MNWA 4LVEA 5BVPL 2AABL 3NA9H 2CXGA 1FVEB 1UZ8B 2OTWA 2IMNA 4DGIL 2V5RA 3LY6A 4K3EH 1GGIL 1Q8MA 5LGKA 1SEQL 3FKUS 2D7MA 3BKCH 4LAQH 1KIRB 5FO8B 1KELH 3BO8A 4LCYA 4MD5A 5HGAA 1NSNH 1SJXA 3FCTB 4N5EC 4HCRA 4JKWA 4WFEE 5FYLH 1QLEH 1FL5A 1MCJA 2Y36L 2HT2D 2KKQA 4EZMA 3MLYL 2OZ4L 5DJZA 2P24A 1QZ1A 4YXLH 5ACZA 4OFKA 5I1EH 4JG0H 3CSGA 3GEWB 1UXSB 3GMLB 1YQ2A 2FR4A 3HG1B 5BS0E 1PEZA 5HDOA 1QSED 2N4IA 2BMKA 4ZO9A 1A6UH 3FN0L 4MA3A 2JIXB 4U1KA 4KJWD 5C0AA 1YNKL 1GPOH 1GRWA 5L2KA 4XHQA 3L3HB 5EU7E 2X4RA 4UDUB 4PBWD 4HKJA 1P9MC 4QXTB 2Z31C 3RY6A 1ZSDA 3EIFA 2OMBA 5JLZB 4R3SA 1CVSC 1HDMA 5GHWH 5KN5A 5D71L 4YPGB 3C6SB 4RAHA 5C08A 1FZJA 3D6GA 3ZDXF 2IH1B 2AQ1A 5TE7L 1UVQB 2BY2A 4YHIB 5CZKA 1DFBL 1HCVA 2W0FB 3OJMB 3SDCC 1INQB 3TIEB 5DHVB 1ZLVK 3QFJA 4AEEA 3INUH 2ZUTA 4KTDL 2XN9B 1FORH 1G9NL 4QRUA 5T33H 1YQVL 2EH8H 3SO3B 2R69H 5I15H 2AW2A 4Z7VE 3HZKB 3WNOA 3H3PL 1W0VB 1SYSB 4WVRA 5HHPB 4P2YA 2AKRB 3MRCA 3CSYB 4OLEA 4D3CL 4HWZB 3ME0A 1X5ZA 3S5LG 5ITFB 1ZVSA 2NY0B 5KVGL 1VENA 3A6BH 1I8LA 4PTTB 2WIMA 1HSBB 1DE4A 2GJZB 1OD9A 2DI7A 1XF2B 4WHYH 4OV5A 1LP9B 4LVHC 1JFQL 3MCLH 2EH7H 2RBLA 2R2HA 3LKRA 4Y5XC 3NMEA 3HAEH 1GHFH 2FRGP 4OTXH 1DCLA 1N3NA 2FBOJ 1YZZA 1E4JA 4L3EE 4X6DE 1VPOL 3VI3E 3BDYL 1UM6H 4J2XA 3WXVH 2EE3A 4K3JH 1Y0LB 4QNPF 1SM3H 4WUUA 3V79C 4FRWA 4LPXA 2VAAB 2DBJA 1MQKH 5E8DH 1ZHLB 4FTVE 3U6RB 1J0YA 4TPRL 4PLOB 1L0YA 1AC6A 1YMMB 4PRHD 1U8HB 4MCYA 1TCRA 4S0TD 5FUZL 5I74C 1V7NH 3MBEA 4N90D 3LRHA 1R5IB 2BNRE 3L95B 3PHSA 4ZOAA 4L4TA 3HPJB 5KSAC 4OAWB 2ADGB 3UTQB 3IJHA 2FEEI 1B6DA 4G6AD 2J88H 3D9AH 3KGRA 4ODTH 5FGBA 5ISZB 4YDKH 3MRHA 5IB2A 2UY7A 5DD5H 4LLYB 5I19L 4JPWL 3ISWA 3FT3B 2APFA 1EPFA 1ZLSH 5TE6H 1UCTA 4OCSH 4MNHA 5JUEH 2D0FA 3BD5A 4E0RB 2OSLB 2H45A 4R8WL 1CICC 4JZNB 3D39B 3U4EA 1MCWM 3ZYOA 2ZPKL 4YGVA 2X5PA 1BP3B 1Z3GL 3SE8L 2QQKL 3JV4B 3RU8L 5EU6B 4KZDH 4M7ZC 1CLCA 4PY7B 5ILTH 2R1WA 5KS9B 2R0LL 1JWSA 1WBYB 2EDHA 4N8CH 3HI1A 4PJAA 1CFQA 1FJ1B 1INDH 1EGJL 4JFPB 4LGPB 3UTOA 1JZ3A 1UZ8A 1KEML 2DICA 1VEPA 2RFXB 4G43B 2HP4A 4M6NL 5EOQH 4JVPA 1S3KH 4JAMB 5TF1H 4WI4A 1KIRA 4XC3H 3RVVD 2GK2A 2M1KA 1G0YR 2H3NB 4MX7B 4P9ML 3OKLB 1U8MB 4M5ZL 2X4SB 35C8H 5T3XL 3FCTA 1L9NA 2OLDA 1RAMA 4JHWL 4K8RC 3JXAA 4UDTA 3T65B 4EUPB 1UKTA 3I75B 4JO1H 2WBWB 4L5FL 5AG8A 1XF1A 2EDKA 4LSVL 1UXSA 3GMLA 2X1XR 3WIFB 1EVUA 3HG1A 4PB0H 2ZUVA 4I2XE 4JLRB 5MEND 1UB5A 5HHOE 4RX4A 1A6VH 3HE6A 2YK1L 3MRRA 1JL8A 5BCAA 4U1HB 3L3HA 1EUTA 4Y1AB 4UDUA 3PQYD 4LHQB 5IQ7H 4QXTA 5GS1B 3HNVH 1YN6B 5JLZA 4YPGA 2GTWB 3C6SA 3ET9F 4OZIB 2BVYA 2PW2A 4ELKA 2HT4C 1MVFA 2IG2H 3UC0H 5FO9A 4KFZC 2VDOL 2IH1A 3LEYH 1WAAE 1UVQA 3DRTA 4IRZH 2W0FA 2HMIC 3PWPD 3TIEA 3BEVB 5DHVA 2F54A 2GT9B 1D6VH 2XN9A 3T04D 4K23H 3WUZA 3FJTA 2CXKA 3PGDB 3VH8G 3UAJD 2VDPH 4KK9C 4ODWB 4DKAA 1LE5B 1UXWB 1W0VA 1SYSA 3QNZA 2HG5A 2CKBH 3HI5L 5HHPA 2AKRA 2H2SC 1BZ7A 4LQFH 1OCWL 4U4BA 4HWZA 3K8MA 1NCDH 3G08B 4JFXB 4HSQA 1JK8B 3MXVL 1GGUA 2LAGB 4PTTA 1UA6H 1J1OL 1QFUL 1OTTC 4JVUA 1HSBA 2GJZA 1UM5L 1P7HL 1RUKL 2GHWB 1KC5H 3RVXD 1H3XA 1NLDH 1I3RB 1LP9A 1HHGB 3LKOB 4NQEB 3FMGL 3OZ9H 3Q6FA 3DV4B 3F7YB 3GMPB 3VDAA 4RA3A 2E7MA 3VE0B 3GMOB 4NZTH 2CLRB 4XMLH 4KRPD 3UP1A 4APQC 1W72L 2UZIH 5EH1A 3AY4C 3NCBB 5E2WH 4F37K 1Y0LA 5C7XH 2YD2A 1QKZH 4JG1L 1DN0B 3NFSL 3UTTB 2VAAA 3M17B 3GSRB 5F7LB 1NCTA 4XP6L 4XMPH 1J8HB 4F3FB 1ZHLA 3U6RA 3TN0C 3S88L 1A21A 2L0DA 4PJ5B 4XZUB 4KHTH 1YMMA 3VFPB 1CD8A 1AE6H 3QCVL 1U8HA 5DRXA 4UV4L 3MRBA 4LSSH 4WENB 1TNMA 4OFYD 1R5IA 4XWGL 4JRWA 2G60H 5IG7B 3HPJA 4OAWA 3ABZA 5TF0A 2ADGA 5JZ7C 3UTQA 3EGSA 3TO4C 1KIPB 1C16A 4RAUB 4ELMB 1BVKB 3VGEA 2VDNL 2BVUA 5D8JL 3VFNB 3QDME 4WI8A 5ISZA 4LCWB 1NC2D 4KQ4H 4YPJA 5J12B 2NY5H 4OKVB 4GAGH 3FT3A 1IQDB 2YUZA 3QHFL 2OP4H 3GNML 4LSPL 2PXYC 3BDBA 4QOKD 3EKCA 3NABH 4I9WD 3GKZA 2OSLA 2LVCA 4JZNA 3S6CA 2VLME 3B5GA 3D39A 4HWBH 4MQSB 1JYVA 1MHPL 1RIHH 3CU1A 5D1ZB 5KBNC 3EDFA 3JV4A 3TFKC 3EZJB 5KS9A 5JIPA 4WIQA 4RMWA 1FJ1A 3GBLA 4R97B 4X0KA 1Z9LA 3MQIA 4D0CB 5JIHA 1IGJB 3HPLB 1DQML 2C3HA 3HZMB 4BZ1L 2RFXA 4L9DA 3RDTC 4G43A 2EIEA 3DVFA 1MAMH 1NCNA 2LU7A 4U6YA 4ZYKB 5ID0B 5FFLA 4JAMA 5BZDB 1EHNA 3TT1L 3TT3H 2H3NA 4MX7A 3OKLA 3WIHA 1U8MA 4FQ2H 4JKPL 5FB8B 2X4SA 1P4LB 1ED3B 2BXYA 1MCOH 5IHUH 4NN6B 1CDCA 4KTEL 2ADFH 4EUPA 3MV8E 4WFGE 2GJ6B 5GRVK 3KR3L 5C0AD 3LIZH 1A7BA 3PL6C 2VC2L 1EEQA 3WIFA 2EXYC 1IT9H 3T4YB 3BDXA 3LKQB 3CMGA 5D1XC 3VXRD 5C08D 2M26A 4U1HA 1I3GL 4UNUA 5E7FA 1BVZA 4HBQA 1HZHH 4F58L 1ND0A 5GS1A 1YN6A 2BSTA 4RGNC 3U9PH 3Q5TA 4OZIA 1QOKA 2GTWA 5GJTL 5D7LD 4XPAL 1PZ5A 3QH3B 3VGHA 1OOAA 1F6AB 5C0JA 2A77H 4PRPB 2LU4A 5DMIH 1T6VN 3BEVA 3GKWH 3C5ZB 2GT9A 1KELL 5HHME 3HE7B 2X42A 1NL0L 2APBA 1QBMH 1KLFA 1LHZA 3PGDA 4WW2C 5FYLL 3PHQB 3HAEB 1QLEL 4F9LA 4ODWA 1LE5A 1UXWA 3ZKSD 2NY1B 1K4DB 4YXLL 3CC5B 1UKQA 5M94B 5I1EL 2Z8WC 3X17A 3G08A 3SE3C 1BFVH 4JFXA 3W11D 1PQZB 1C5BH 1R24B 2P5EA 4QGTA 1A6UL 1I3RA 1BECA 2I25N 1HHGA 2QHRH 3LKOA 2NLJB 4NQEA 5EC1B 1FPTH 3F7YA 5GSVB 3A6OA 1LEGA 4JVWA 4WUUD 1CGTA 2NXZD 3VE0A 2CLRA 5DR5H 3D85B 3WJJC 1XAUA 1EHXA 3CX5K 4G8IA 2VLKB 4ERSL 4ESKA 4GS7C 1NLBH 1DN0A 3UTTA 3PWNB 3OKEB 4Z78B 5I71C 3M17A 3MBED 1J8HA 4F3FA 3INUL 3O41B 1YYLL 4L4TD 4YHLL 5T33L 4FQCH 1S9VB 2EH8L 4PJ5A 4XZUA 3V6OC 2R69L 3QT2A 4XPHH 5I15L 1H8NA 1A7NL 3WS3A 3PWUB 4BFIB 4U3CA 5IMMA 4YH6A 1EMTH 1ULVA 2VUOA 2X70B 5J89A 1FC2D 3BN3B 1UJTA 5EWIH 1UFUA 5IG7A 5I6XC 3ARFB 5E8OB 1HILA 4YXHH 1KIPA 4L8SC 2RQ8A 5F7UA 4ELMA 1BVKA 4BSWB 3OBAA 3HMXA 3VFNA 3OKNB 5HHNA 1X7QB 4LCWA 1DLFL 5C09B 3GHBH 4OZFH 4OKVA 3MCLL 3KPLB 3MA7A 4BQ9A 1CGYA 2EH7L 3CMOL 4M93C 4NO0B 1IQDA 4DN3H 1I9EA 5ID1B 3KHQA 4X6CE 2VH5H 3BGFB 3OG6B 4FXGB 1LO5B 4EKXA 3ARDB 2DBLL 1CXIA 3K1KC 1CG9B 1S7UB 4RWYH 1AO7B 5K33A 1SM3L 1WZ1H 5D1ZA 5F9AC 3VW3H 3H0TB 3RKDC 2A74B 1MQKL 1OLZA 5I1HH 2G5BB 1TXKA 1FFNB 3QUYC 5I66A 3S5LB 2D7TH 4D0CA 1QBLH 1IGJA 3HPLA 5I18H 1AFVH 3LDBC 1QVOB 4YLQT 1CL7H 2QLVB 1O7VA 1V7NL 2Y06H 3RPKA 1CDIA 2Q76B 4K8RH 4EI5B 3JVGA 3SE9H 4N0CD 1NFDF 4F9PA 1RZJC 2KQMA 1JPFB 4MA8H 3V4PL 5FB8A 4I4WB 1JPTL 1ED3A 3HG1D 2XZQL 3R4DA 1FNLA 5D6DA 4GRLC 5DK3A 2VSDA 3TO2B 1ZLUK 2J88L 3D9AL 1EVTC 3HE6D 3ARRA 4YDKL 4H8WC 4XCCH 1WFTA 4PLJC 4MNGB 1VGEH 1G6VK 3VRLF 1ZLSL 5J6GB 2BY3A 4NUJB 3T4YA 5TE6L 4OCSL 3HKFA 5JUEL 3LKQA 4PJDE 4LCIL 1A6WL 2P42B 4IMLA 4IRSC 4OZGE 5TPWH 3MOAH 3SBWC 2XTJE 4KZDL 3U7WL 5ILTL 1EO8H 1ORSB 3QG7H 2AS5M 1YDPB 2F54D 2CKBB 4N8CL 1NBZB 5GQBA 3WS6A 3E2HB 2DF3A 4QF1B 5HYIA 5L7XH 2VJXA 2CO6B 3ZDYF 3ARGB 3QH3A 4Y4KD 5DHYB 2X44D 2HFEA 1G7HB 2BNQB 2CRIA 3U0WH 2CKNA 5EOQL 1UWGH 5JXEC 3MRGB 1QRNE 4X4MA 1S3KL 3WFDL 2Q3ZA 3C5ZA 1IGFH 3HE7A 2LTQC 1NC4B 1QACA 3GI8H 5K59F 35C8L 5CEZH 1P2CA 2E6JA 4EXPX 3VFMB 3PHQA 3HAEA 3WFBH 3MREB 5F21B 2ZUSA 3G9VA 3F5WB 4JO1L 1E6JL 1K4DA 4HXAH 2HLFD 1MCRA 4WW1B 3WDJA 3VA2C 4ZG1A 3ULSB 1PQZA 15C8L 4I0PC 3IDGB 4PB0L 1R24A 5DTFA 3LKNB 3RGVC 1RU9H 3A67L 4CDHA 5BRZB 1IGMH 1KB5H 4AM0B 1A6VL 3KJ6L 1D5XB 3V0AC 3FRPG 2NLJA 5EC1A 4Z7QE 5GSVA 3E0GA 2IANA 1RK1A 3VGBA 5DD1H 1FZMB 2KUTA 2Y72A 2VXTH 2PETA 2UYLB 1JGLH 1EX0A 4P48A 4Z7WF 2CPCA 2IG2L 2VLKA 5EG6C 3UC0L 5LXGH 3DURB 1OTUD 3BKMH 1YMMD 4IOFC 2QADB 3LEYL 3OKEA 3PWNA 4MAUH 5DS8B 5E0QA 4U6XB 4Z78A 1QSZA 3L3JB 3ARBB 4IRZL 4QRSB 3QUXC 5HPOA 5IW1B 4OBSA 5CZVL 3O41A 3T0AA 2EDYA 1XF3B 1D6VL 1XGTB 4M03A 1PSKH 1MY5A 2AQ2A 4K23L 2CK0L 2YA2A 4PGCB 1E4WH 5C0RH 1MJJB 5D2NB 4X4XB 1DVFA 5ESAB 1ZVYA 5ISZD 2R1XB 4GMTL 3OAYH 3QUMA 4LQFL 2X70A 4XBEH 5DF0A 5I8OH 1NCDL 4CGTA 5E8OA 2X09A 4OD2B 1QLFB 2A38A 3LS5L 4D9QE 1I75A 4BSWA 1KC5L 3OKNA 5FOJA 1NLDL 3HNSH 4OLVH 3D39D 4M1DH 5BS0A 5E9DE 4G42B 2Q20A 3OZ9L 3PP4H 4C58B 5E8PB 4Q6IB 3FFCB 5D2LE 5J9PA 2VZ3A 1ADQH 4LSTH 4FXGA 3V5DB 4XMLL 1LO5A 6CGTA 3ARDA 5C2UB 2UZIL 4PLKC 1CG9A 1S7UA 3O45B 3VH8B 1MFBL 1A3LH 1QKZL 1AO7A 5BJTA 2BP3A 2XY1A 1MH5B 2ZKHH 4KY1H 3H0TA 2A74A 4D9RD 1OGAE 2ZZUT 4OGAD 5HY9B 1PKQB 2G5BA 1QFWM 3OJVC 3S5LA 3EO0B 2JJTA 2I07A 2GAZB 4KHTL 5IR1A 1TETL 1AE6L 3G6JE 1P7QA 3V0VA 2DQUL 4LSSL 5TDPB 2Z93B 4EI5A 2Q76A 2EDDA 5DHXB 4XPGH 2G60L 4J12A 1JPFA 2AV7B 3DX8A 3KAAA 4I4WA 4XNUH 3IFNH 2W9LA 3UTPD 1TCMA 2EDOA 1U2CA 2VUYA 3WFHB 4XT1C 5CP3A 3MLSH 4KQ4L 4UZGA 1IAIM 2NY5L 4MNGA 1V8HA 4PTUB 4GAGL 3QDAA 1C7SA 4M6MH 1B6UA 4PV8A 5FXCH 1DANT 2NCMA 1DUYB 2OP4L 2OQJB 3VA6A 3WFCH 2CLZB 5J6GA 5F1OB 4NUJA 5TJWK 3L5IA 1BVLB 1NEZG 1HQRB 3NABL 1KPUB 1X5IA 4OB5H 5JO5B 5EU7C 3ARPA 4HWBL 3ETBF 3P4NB 4CVUA 4DVBB 3WD5H 4LDLB 5EBWB 3BKJL 5EO9B 1UB6B 1LDSA 1CGVA 4PJ7E 4OZ4B 2FO1A 4XTRD 2CUHA 1EH9A 2D0GA 1YDPA 4ZOCA 2CKBA 2QQLH 4YDIL 3QEQB 4MXVF 4GKNB 4QF1A 3ARGA 1AI1H 5DHYA 2ZWLT 1G7HA 2BNQA 4LVHB 1MAML 3MRGA 3N85H 1EERB 4NBXB 1F2QA 4Q58C 1WQVT 4Y5XB 1DJSA 2YC1A 3TT3L 1NC4A 4FHBD 4XNMA 3RL2A 5A3IC 4Q0XH 5HI4C 4FQLH 3TP4A 1I85A 1MCOL 3VFMA 5IHUL 2P8PB 3QIWA 3MREA 2R4RL 5GGQL 5GGUB 2P5ED 5A16B 3GB7B 4CU7A 3F5WA 3M8OL 3C2AH 3RWDB 4NIKB 5F9OH 1A0QH 4WW1A 3NZHL 5GZND 5I1AA 1X3DA 5I17B 1G7IA 3ULSA 1WLHA 4YFEA 2ZCHL 1IT9L 5IVXB 1LEIB 5LG1A 1SYVB 4AM0A 1I4FB 2Z8RA 3IDNB 1D5XA 3KYAA 4N0FB 4WEUD 2CH8A 3KDMB 1NCAL 5I74B 4P57A 4NZDA 2D3VA 2VDMH 4AH2B 4LAJH 1MCLA 4I77L 4G6JH 1HZHL 5KSAB