5BRZD

Mage-a3 reactive tcr in complex with mage-a3 in hla-a1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
197
structure length
197
Chain Sequence
AQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLYVRPYQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRPGGAGPFFVVFGKGTKLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5brzD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5brzD02
4HK0B 1PZ5B 5C70A 3I2CH 3N06B 4BSWA 3LVEA 3PDDA 3PP3K 3SE3C 1FNSH 4PJDA 3SDAC 2BCKB 5IQ7L 2COQA 3FONB 2QJDA 4AEFA 2X4RA 5C0FA 3CC5B 1HINL 2Q8BL 3HR5B 3IJYB 3RNKA 5JO5B 4PJIB 3TJEL 4GRLC 4U1MA 4YHLL 4GS7C 3OKEA 4R7DA 1HK6A 4GAJH 1FV1A 2IG2H 3X3FL 5BVJA 4N0UB 4UDTB 3SKOA 2OJZH 4GQPH 2AEPH 3VI3E 5I8EA 2VSDA 3OJDB 3ARBD 2C3HA 2GITA 4QYOA 3UJJH 5INDB 1A1NB 3RIFF 3PWJA 2Z8VC 2X4PB 1FZJA 4NOFA 5E9DA 5TDNA 5FCUH 3IFNL 2GIYA 3PHQB 2DL9A 1D5XB 5JIKA 2XRAL 1CLZH 4JGMA 1MFAH 1QFWH 1EHAA 2FZ3A 3U7WH 3WIHA 1KYOJ 1T3FB 3EFDL 3U48A 4PJ5E 4I0PD 5DC4B 1EJOL 4MLSA 3DXAA 1NFIA 4P23A 4YHKL 4NUJB 1UJ3A 5JOPD 3HB3D 2R0LH 3MJ6A 1SMOA 1P7HL 3TZVC 3QEGL 1OWRM 4XC1H 3VXSA 15C8L 2Z4QB 3NZHH 4OJFL 1UZ8B 2A83A 4H26B 4OZIE 1P4BL 1TJIH 1T66D 3R06B 3HG1E 4R97B 5C0DA 1AXSB 1Q9LB 1TPXB 2VR4A 1UCTA 2YD4A 2AI0H 1N0XH 1R3JB 3NPZB 3P9LA 3KWWA 1BM3L 1PX3A 1BREA 4KHXL 4U31A 1N0LA 4KVCL 3VRJB 2DRUA 1H5BA 2OZ4L 3P11L 4P0DA 1FL6A 1G7QA 4H0GA 5LKNA 2VC2H 1KJ3H 4WWKD 3RZCD 1MRFL 2FO1A 2W38A 1IC5L 1A7QL 2R4SL 4IIQA 4XCYB 4J7RA 4IMKC 3SGKA 2VDLH 1XAUA 3QRFM 4HBQA 2AXGA 3PWPD 3T2NL 5TF1L 3UYOD 4K94L 3MLWH 4ODUB 1RU9H 2HP4A 4YO0B 5DI8B 3IAQA 4NGHL 1MLBB 3QEQD 3P4MB 5JORA 3BD5A 1ED3A 4J3OC 4Y19D 1RZKH 5KG9B 1GSMA 4L4VE 3LOWA 1BF2A 2UZXB 4PY8I 2LU4A 4JFEB 3D3VE 2F19L 4Y5XB 1UWEL 4LCYA 3S35H 1CTNA 2VDRL 1QP1A 4HLZH 7FABL 5HGAA 5IB5A 2HG5A 1LMKA 3IDXL 1Q8MA 1JHTA 2A9NL 2D03H 4Y2DC 1QKZH 1VSCA 5DA0B 2FATH 4HLZG 4CADB 3IVKB 4C4KO 3SQBA 5SWSA 3CXHK 1JWUA 5IG7A 2QHRL 2UYLA 3B2UD 1KEGH 5F7EH 2DDQH 1IBGL 2EH7L 2C1PB 3BP6B 3H7BA 2RR3A 1FNGA 1MCBA 3T09A 4PRPB 5GS0L 1BVKB 5C0EB 3L7EB 1XGPB 3MRJA 1O5DT 4LLAA 3VH8A 3MLRL 4OLXL 1FBIL 4XC3H 3ZYIA 2J88L 3RHWK 1DTUA 1Q9OB 4OZ4A 4H0IA 1DSFH 3A6CH 1U3HD 1PD6A 5IJVB 3ZKXB 2F5AL 5BMFL 2OR9H 4FXLA 5GRWA 1FJ1B 3EYOB 4Z7NF 3T0BA 3BRFA 5EN2B 4MD0A 5IWLA 3KXFA 4KK9C 1M05B 1SY6A 4APQB 4ZSOB 5J3HC 5IMKB 4X4YB 4PRBB 3ULUH 4OBRA 4AEEA 1C12B 4LLDB 1LO2L 5I9QC 5I1LA 4QHUA 2C3WA 1ZHKB 5DMYA 3TESA 1XGYH 3RJDA 4XP5L 3VWKB 5K9OA 1AQDA 4L4TB 1PEZA 4JM2F 4C54A 5AG9A 4Q9RL 4NC2B 4UTBL 1DN2A 3CVHA 4H8WC 4P2QD 3GFUA 5EWIH 3KPQB 5J56B 1U8JB 4UOW1 4NOBA 4DVBB 2X5PA 5A40E 3PWUB 2XKSA 1Y18A 3WFCL 5IVZA 5KS9A 5GS0D 4FQ2L 5J13B 1B6DA 4P46B 3Q6GL 1YEJL 1C8PA 2BFVL 5L0QB 2ZG1A 4G7YH 1RJYB 3HRPA 4R8WL 3FB7A 3PQYE 2DKMA 4LIQL 3NAAH 1O7SA 4NJAH 4X9HA 2VJXA 3BHBA 3CVIH 4PG2C 1TIUA 3AC0A 4N90D 4HS8H 4M1DL 4PRIB 1VPOH 4KAQL 3MLUL 1DBBH 1EGJL 2QL1A 3HE6D 4UNTA 3DROB 3OG6B 2OCFD 5DZLA 1YEIL 1IEBB 1MCWM 2ZZUT 1JF5A 2Q7NA 5TGBB 5I8KL 4UINL 4ODBD 1EBAA 1GGBL 5TF0A 4D0CA 2UV3A 3ARBC 4HIHA 3VA6A 4KI5E 3TPUA 3KJ6L 2F54B 4OIIH 3WSQH 1E6OL 4MJ5A 1ZKAA 2J8HA 4KKCD 3L3OB 3VG9C 1QFUL 4K71B 4L8DA 3B9KA 1SM3H 4LL9A 2AJVL 1AIFA 5DXWA 4PLOB 1KENH 2PETA 2GCYA 3VFRA 3C6LC 3SDXA 5I66A 5I19H 5D6DC 3G9AB 4WDIA 2DQIH 4HKZB 2A74B 1B2WL 3OX8A 1D6EB 3PWNA 1FLTX 2QTEA 4I0PC 2ZUQB 2Q76B 3U83A 3HB3C 1WVZA 3ULSB 4Q0XL 4DGYL 3O8XD 1T04B 5SWZA 4QRUA 5DMIH 5JA9A 3S3JA 4QY8B 5D2NB 3BO8B 1HXMA 2X2YA 4P4KC 4L8SC 5FUOL 2GJ6D 4GBXD 1DQJB 4LCWA 5DJYB 4L9LC 4WFHD 1T66C 1U8IA 5MENE 4P2CG 4JFOB 4IMLA 4CN4A 1U8OB 1C1EL 4XP9H 1U8KB 3C5ZD 4Z7UF 3NCJH 1HZHH 4O2FA 1JHLH 4JG0L 2ERJC 3TO2B 3IU3A 4JPWL 3TVMA 1G84A 1U8MA 4G5ZH 5C0GA 2EDBA 4WWKC 3RZCC 1J05A 3H7LA 5HDQH 1R3LA 3DLQR 2WWKT 2DQEH 3SO3B 1YNLH 1NC4A 1PY9A 3OKMA 2QR0A 4KRLB 5J0BA 1CDGA 3PDGA 1QSVA 3TFKD 1ZHNB 2FLBT 1VGKA 4PRDB 4TVPE 5EORH 4Z6AT 1ITCA 1GZQA 1P4IH 5CZKA 5FUCE 2ZUWA 4WEUD 2G5BB 1DQLH 2NNAB 3ESVF 5DT1L 1UB5A 1NCBH 3CZFB 1JPTH 3WFZA 1ZV5A 1CIDA 4IOIA 4UT9L 4GRMA 3N9GL 5JXEA 3DGGB 1A6WL 4CGTA 1XGTB 5EC1B 1MFNA 4QHNB 4LCCC 1FORH 1OL0A 3IDIA 4YK4B 1U8NB 2IAMD 2Y6SD 4JO2H 1MHPL 3KPPA 4WEMB 2ITCB 3HNSH 5F7NC 5DJCA 1HHJA 2EYSA 3MNWA 3RUGB 5AEAA 1H0DA 5DTFA 3B2UC 1S9YB 4DGVH 5F6HJ 4LSTH 4YDKL 1CVRA 3TBSB 2PXYA 4LLUA 3FCTA 1RULH 1U93B 3DPBA 3HA0A 3MRNB 3QUKB 5DDHA 1T6VN 4U1SA 3ARGB 1YA5A 4PJ9B 5ID0B 3V5HB 1KTDB 3JXAA 3NFNB 4ZO8A 5DJAB 2BHZA 3TN0A 1U3HC 4RDQG 3FQRA 4U1NB 4DVRL 3FO9A 1LNUA 4P2RD 3WFDL 2V2TB 1A3LL 1S3KL 2X7LB 3LS5H 5C0ND 4KMTH 12E8L 2CRIA 2A0LD 1S7SB 1BQHB 4RMVA 4F37K 4L3EA 2YA0A 5DO2C 4WI5A 3VJ6A 1IQDB 1F4WL 3WN5C 4KJPD 3RDTD 3ILPA 1IC7H 3LPFA 5JIIA 4HAGA 3T2QA 3D87B 1JGEB 1EHLH 1QSEA 4A6YL 3CFJB 1E4WL 5KVEH 2EE6A 4PTUA 4N8VA 1QSFA 3M1BB 4NP4L 5IFJB 1BZ7B 4R4FH 3ZE0F 1LEIA 1YN6B 4I18B 2BMKA 3LKNA 3V4PH 4QTHB 4YPGB 4RX4A 4X6EA 5KW9L 4DW2L 1BF8A 1UACL 5GS0C 3AS3A 4ODHH 5F96L 3S88H 3WXWH 4Y4HA 5J8OA 2VISB 1ADQH 1NGZB 1A6AA 1F97A 4AK1A 4OLYH 5IJKA 1UQSB 1BIIA 5GGSY 4JRXE 1W8OA 3LKQA 3HE6C 3I9GL 3IF1B 2BY2A 5JTWA 1G7IA 4G3YH 1R3KA 3SKMB 1QLRB 1A7OL 3LEXA 4KHTL 5HY9B 4G6KL 1IKFL 4MAYD 2FB4L 3DX9B 2WK2A 3QAZC 4BFIA 2CKBB 2P48B 2K1MA 1Q0YL 4PJGE 4KXZH 1VEOA 5JHDD 4O9HL 4XPGL 1X7QA 3S4SA 2IBBA 4BZ2H 1PX4A 4KKCC 4MAUL 1IM9A 3SDDD 2O93L 3RVVD 1ACYH 4XPBH 3I3DA 3VE0B 3PHOB 1CG9A 1KGCD 3O2WH 4FABL 3L9RA 5C0JA 3MODH 1HSBB 5E8OB 3WNPA 3PL6B 2R15A 2X4SA 5MEQB 3I3EA 1IQWL 3PGFL 4X4XB 4F7MA 1NH6A 1K6QH 5IVNA 1D6VL 1MAKA 3J7HA 4HQQL 1WTLA 5T5FL 3O8XC 1LVEA 1QR1A 1QLFB 2NY7H 5FUZL 5E56A 2NX5A 2CMRL 2F8XC 4TSBH 1QFWI 3IXTB 4ZDHB 4GBXC 3ZT7A 4JZJA 5C9JA 4JRYD 5C0CA 2GT9B 1J87A 4TOYL 4FQ1L 2J2ZA 2L7UA 3WKMH 3EO1A 3QUYC 3C5ZC 3ZKQD 3ZHLA 3UBXI 2FYYA 4R4BA 5GGSA 2NX5E 2DMKA 3CFEB 3NIFF 2YUZA 2QKIA 4GT7A 4XWOD 5IQ7H 3NA9L 2Z93A 5GS1A 4OT1L 1A4KB 5JA8B 5C0CE 1HINH 2Q8BH 5IIEB 3D25A 3TJEH 1IZJA 1NPUA 1MWAA 4XXDA 4YHLH 4HD9A 4G8EB 1OGAE 3X3FH 4OFVA 3TFKC 4Z5RB 3A6OA 3VCLA 4LVNB 2OM5A 5E2VL 5EPMB 5C2BL 5DK2B 2N56A 3FT4A 4Z0BL 1K8DA 4Z7VB 1FZOB 5FV1L 4J3XA 4C59B 4JKPL 1N3NA 3FFCE 1KPVA 1Q0XL 4HF5L 2RQ8A 3NFPA 5IB2A 4HKJB 1IILE 4X5WB 3BIBX 3QFJD 3IFNH 5D9SB 4YAQA 5IEKA 5IROC 1R3IL 2XRAH 4C83B 3QISA 4X9IA 3WNNA 5A2JH 2YRLA 1HILB 2ITDA 2QLVB 5KSBF 5IKCA 3QEUB 3O2DL 1L6XA 3EFDH 1TETL 5CJXA 2Y6SC 1SYVB 1LP9E 3EOAA 4QHKI 1EJOH 1GPOL 3AVEA 4YHKH 3KPSD 4OZHB 5D2LF 4F9LC 3CFKB 1ZVSB 1LDSA 3IS0X 4MQ7B 3QEGH 4U4BA 4F3FB 4O2CA 5FO9A 3O4LE 3VXMB 15C8H 4OJFH 3MRBA 4AEIL 2G9HB 1KXTB 3S9DB 3KYOA 4V1DA 5I17A 4Y2OA 5E95B 2VLJB 1ZGLP 4K7PX 4JY4B 5KANG 4GOSA 3WUWA 2YMXL 4HS6A 5FM5M 4JJ5A 1BM3H 4Y1AE 3FMGL 2R4RL 4KVCH 1G7LB 4PS4L 3HI1A 2OZ4H 3P11H 2AKRB 3IJHA 2J4WL 5F7LB 3EGSB 2FJHB 2F53D 1H3WM 2XT1B 4X4MA 3MV8E 1MRFH 3WE6A 5C0NC 1NBQA 4LEXL 1KJMB 1A7QH 2R4SH 2VDQL 4PGCA 3EYFA 2XN9B 5T1MB 5MEOB 2DM7A 5IBTL 5F89B 3T2NH 3MO1B 5TF1H 1TCRB 3D5OF 4DQOL 3WHXB 5EBMB 4K94H 4KQ3L 4J2XA 4KJPC 4PD4K 3RDTC 4EI5A 4CVWA 4NGHH 3BW9B 1MCDA 5A3ID 3NN8B 4LNRB 4Q9BA 5T1LB 2IH1B 1YZZA 4NZTL 1M7IA 3D6GA 4ORGB 3P0YL 2F19H 3O41B 1UWEH 1UZ6F 1QQDA 3QFDB 4D9LL 3H8NA 3QHZL 4R90H 2VDRH 7FABH 4U7KA 5F8RC 3RWGA 3VI3F 1A6VL 3EDFA 4PJDF 3O4OC 3IDXH 1DVFA 5JW5B 1GGIL 4RFNB 1AR2A 4HLJA 3NCFB 4KMQA 4MNHA 1OCWL 5I1IL 2A9NH 4GXVL 4TVSa 2ZG2A 3TNMB 1AHWA 3UTSB 3SE8L 1I9JH 1G7JB 3P9MA 3RQ3A 2QHRH 2EECA 1V5JA 4OUOA 1ETZB 1KIRA 1YECL 1S7QB 1IBGH 2OBGA 4NWTL 4QF1B 2XYCA 3HRZA 5E6IA 4D9QD 5A16B 4D94A 1KCRL 4QOKA 1FN4A 5GS0H 4M8VA 3VI4F 5KOMC 1GHFL 5HGBB 3HPJB 4MAYC 1RZIB 3MLRH 4OLXH 1FBIH 1SHMA 1JPST 1WWBX 4DN4H 2J88H 4WTZA 4BSVA 1Z2KA 2VIRB 2YPKB 1DEEA 4ELMB 4CBPA 2F5AH 5BMFH 2WUBL 1XH3B 5HHOE 2AQ2A 3O11A 4BQ9A 1FVDA 3JWOL 1D5BA 1PKQA 3G6JB 3QT2A 3WYRA 4LRNL 4QRPE 3T04D 1IGYB 1CICB 1UJTA 4N1HB 3ME0A 3WFEL 4J1UA 1HCVA 5E08L 3V5DA 5IW1A 3MV9D 3KYMB 5EBGA 5HVWA 2R56L 4MNQB 1LO2H 3WS3A 4ZPTA 1KB9K 5EUOA 5E2WL 4X98B 5T1KB 3TF7C 3ARDA 2MCPL 3JSSA 4XP5H 4YHYC 5E5MA 5DD3L 2F74B 2H32B 4ZNCD 1U8QB 1I8MB 4HW6A 3ALXA 4Q9RH 2CK0L 4F15B 4UTBH 1NUGA 1REIA 4WY7L 1YDPB 2WBJB 2VO5A 3G5YB 3FT3B 2IMMA 1WFUA 3WFCH 5EUOE 1J0KA 1QBAA 5F88A 4XNQA 4FQ2H 1ZLUH 3Q6GH 4OKVA 1YEJH 2H8PB 4L1DA 4W68A 2BFVH 4C4KT 3VXUB 3F7PC 2K3TA 4R8WH 5D7JD 3K3QA 4RGND 4LIQH 2RCSL 3FN0L 3AU1A 1MCNA 4XWOC 1DZBA 1F3RB 1RUML 2VLRA 4M1DH 3MLUH 3CNKA 2OMNA 1EGJH 3WL9A 3GMRB 5E94B 2Y5TA 2APXA 5CWSB 1YEIH 1HDMA 3K2UL 4XMLL 1AH1A 1J0IA 3IFOA 3LKPB 4B0MM 1JFQL 5L2JA 4WI2A 5I8KH 4UINH 4MB4A 1FC1A 1GGBH 3T4AA 4KUCF 3WNKA 3MZGB 2B39A 2JB6B 32C2B 3KJ6H 5E6ZA 4QHMA 3CCHA 1E6OH 3LIZL 4EUPB 1I1YB 5HGDB 2VLKD 3BEVA 1KLUA 2W92A 3QIWA 2AJVH 3N50A 4YUEL 2C4XA 5D1QD 4GXUM 2BSRB 3H9SD 4P4RB 2EDLA 5BS0A 1NFDE 4DGIL 5DK3A 2APFA 3K0WA 1V3JA 1B2WH 3EYUL 3RKPA 4PRHD 2H6PB 1ODAA 4MQTB 4ZUUB 4MA3A 3JUZA 2I9LB 5IHZA 2IBZX 4XNYL 3ULVF 5LXGL 4Q0XH 1JVKA 2VXQL 4HXBL 4KPHL 4JM2D 1G9EA 3FHAA 3QIUB 2A6KB 4YGVA 1C7SA 5FUOH 4K9EL 3P0GB 1IAMA 1XFPA 5CSBA 1KPRB 1A6ZA 1NDMB 4HH9B 2FIRT 3HCVB 2N7AA 1P53A 3PWLB 3MJ7A 1JYNA 1C1EH 1Q1JL 2HJLB 4GKSB 4HK0A 5BRZD 3N1GC 1PZ5A 2P8PB 2A73B 5E8PB 4S11A 3OKNB 1MQKL 1U0QA 2DD8L 3QB7C 3TH2T 1UH3A 4JG0H 1CLOL 3TO4D 2LFGA 4JPWH 2O5ZH 2UVFA 2V17L 3TEUA 3FONA 2WINB 3CC5A 4GAFB 3A6BL 2AK1L 5JO5A 3DOSA 4PJIA 1UA6L 4CN1A 1I4FB 2Y1VA 4PGZA 2P5WE 3QDJD 4UDTA 4FTVE 4YBHA 1HKLL 4HKXA 3L5IA 1K4CA 2P24B 2EEAA 5ISZB 1NMCB 2C26A 5INDA 1K8IA 1T83C 1A1NA 5A3IC 4JHWL 5DT1H 3W0WB 3I85A 4BZYA 3LPGA 4XPTL 4RIRA 3VFWA 3KJ4C 4LU5L 4JN2B 2JJTA 4UT9H 1T7ZA 1NJ9B 1YEEL 3N9GH 3ZKSD 1D5XA 3DX7B 4N0UE 1A6WH 1SJHA 4HMEA 2ZCHL 3MJ9L 1T3FA 1NCDL 4UAOC 1IKNC 2ADJB 3SJVD 1FYTB 4MGXA 1EEYA 1EJ6A 1RJLA 2GFBB 1MHPH 4D0BB 2EH8L 2KZ1B 4NUJA 5GGUA 1TQCB 2X40A 4C57C 4UILL 1AGBB 1KT2A 1S7XB 5JDJA 1JN6B 1I7TB 1P7KB 1B88A 1NUDA 2Z4QA 1WF5A 4JAMB 5I16B 3FT2B 3VRIB 1CFNA 1UZ8A 4YDKH 3REVB 2EYTB 4R4ND 1EAJA 3U36A 4HGWB 1AXSA 3OL2A 5F9AC 1JWMA 1R3JA 2W1NA 3FB8B 3WO4B 2CLZA 4TPRL 5FA3B 3RAJL 3VRJA 4UDUB 3SDXF 1EEZA 1J12A 4NRXB 1FP5A 2PF6A 4DVRH 1T1XB 2VTFA 3QUML 3I3BA 4ALAL 1A3LH 1P6AB 1S3KH 1U3ZA 1MCPL 4XCYA 5GSRA 4LGRB 2CDEB 12E8H 5CP3A 5BJTB 1XF5B 1PJ9A 1KBGL 4KXZI 4MD5B 3T3PE 2ICWJ 1JPFA 4GQ9L 3UBXB 1H3PL 1F4WH 3DSFL 1W72B 3TA3D 2ZSWB 2BNRD 4XTRC 3KG5A 1SJEB 1NGQL 3R0NA 3MXWL 1IGCL 3S3SA 3EOTL 4FG6D 3MC0A 4Q6IA 4X7CC 2NY6B 4A6YH 3GRWL 1WGOA 1E4WH 4JFEA 4Y5XA 2YBRB 3D2UD 1XZ0B 3DO3A 4E42B 3T0XA 1WZMA 4NP4H 3TIDA 4WUKL 2ZJSL 4I77L 8CGTA 2ZUSA 5AZ2L 2LABA 4M4RA 4GW1B 3ARFB 1HHHB 4Y4KB 5KW9H 2HFTA 1UACH 4CADA 5HHQB 2MPAH 5F96H 3UDWA 3MV7E 1D5MB 4G6JL 2AJUL 1NAML 5B3JF 5D7JC 4RGNC 2E9BA 4MXVF 4YZFE 4Y4FD 5HYSB 2OQJA 4JDVA 5D1ZD 2C1PA 3BP6A 3SE3A 3KLAA 4L29A 4PRPA 3I9GH 4ZS6D 1BVKA 1MI5B 4IDJL 2Q7YB 5C0EA 3JWOC 3L7EA 1XGPA 1NBYB 1A7OH 1UCBL 4KHTH 4G6KH 1IKFH 2FB4H 2VDKL 1F11B 3GHEL 2HLFD 1Q0YH 1QBLL 1I7RB 1KXQE 3FZUD 2VDPL 5F3BB 2W9EH 2OL3H 4OF8A 4MAUH 4QNPE 3QDMD 3QI9B 4JJHA 4QTIH 5HTSA 3S3PA 4OUUA 4FABH 3VXTB 2CDFB 5EN2A 1UWXH 4P3WA 4XZUA 1S7TA 5D1QC 1RK0B 1M05A 1RHHB 1IQWH 4X4YA 4PRBA 4HG4J 4QGYA 4LLDA 3PGFH 1YY9D 1BFTA 2AK4B 5FEBA 3IXAA 1D6VH 2R2CA 4P2OD 2HVKB 3V2AR 4Z7WB 1CQYA 5DRNB 4HQQH 3VWKA 5T5FH 2EEBA 4JM2C 4OM0L 4ZNEE 5FUZH 3O81A 2CMRH 1Z9SA 4ZSOE 1TZHA 3QDGD 4MCZA 1HSAB 1KYOK 4PGEA 1FZMB 3V0WL 1ORQB 4DVBA 5EO1B 1Q38A 3SGJC 3IRZA 4FQ1H 1MAMH 5EU6D 4P46A 3T08A 2HN7B 3MV11 5A2FA 1OM3L 1EBPA 2I24N 4OBSA 1FNFA 1GRWA 1TVBB 3KR3L 4L4TE 2EDKA 2P5EB 1RZ7L 3SCMB 4LLYB 4PRIA 5J9PB 3NA9H 1SVCP 5AUMB 4OT1H 4J8RB 3UJTL 4YX2L 4UZGA 1IEBA 3S5LB 5CIPH 4RWYL 5TGBA 4C58B 4YWGL 5ANMA 4IMKA 5LVEA 4NJ9L 2FHCA 5E7BA 4OF5A 2NR6D 2DQFB 6CGTA 3I6GB 1BP3B 5E2VH 5C2BH 1MFCL 4Z0BH 4LSVL 5C0RL 1VEPA 2F54A 4JKPH 1M1SA 3L3OA 1Q0XH 2BVQB 3CFDB 1V7NL 2ZKHL 2DYPB 3EBAA 3ZDYF 5FCSH 3GSQB 4PJXB 1R3IH 1WK0A 4K9EC 4PJGF 2PCPB 3RVTD 4HKZA 2A74A 4HUNB 3LN4B 5DR5L 1D6EA 1BD2D 3O2DH 1WBZA 1TETH 4HCRA 3AROA 4QRQA 2XQBH 4OLWL 1GPOH 2Q76A 1UEMA 1MCCA 1FHGA 1JZ4A 5FDWB 3ULSA 5L2KB 1NCCH 1NUNB 4Y2DA 3VA2C 5F9WB 4G8IA 3SKNA 5D2NA 1TMCB 3BGMB 4OQTL 2E27L 4XH2B 1DLHA 4YIQB 1SBSL 4U2YA 1G0DA 4AEIH 4IRSD 1NDGB 4NNPL 8FABB 4GLRH 4R4NC 1G7PB 1JZ5A 4G8GB 4AT6B 1E28B 5A2KH 5JMRA 1J0JA 3D39D 5H35B 2CRZA 3CXDL 2YMXH 4LKCB 3FQNB 2DICA 2M26A 1MELA 5DMKB 5IB1B 4Y8AA 3V7AG 3FMGH 3HTLX 3I6LD 2R4RH 3TO2A 4BM7A 5CLTA 1ZXQA 3L3GA 1S7VB 2ED8A 4JO3L 1CXIA 2ENSA 1NCTA 1YMHB 1AE6L 1IVLA 2PTVA 1IAII 1HQRB 4LEXH 5D7IA 4YHIB 2LAGB 5IBTH 5KVMC 3MLPA 1KSRA 4DQOH 4PRDA 3HFML 4KQ3H 4XNXL 1KIQB 1MHHA 5JQHC 3TA3C 1X5ZA 1MCHA 3EZJB 5CSZB 5HHPB 1JYVA 2NNAA 3B8SA 3L7FA 4AZ8A 1TQBB 3CUPB 3BT2L 1KTKE 4RQQB 2APWA 4FG6C 3EJJX 1U36A 4NZTH 4XNUL 4YNYB 3WIIL 3P0YH 3VXRD 2XQYG 5J12B 3DGGA 4D9LH 1M7DA 3QHZH 3WFHA 1K5NB 1BQSA 3GSWB 1XGTA 3N1PC 4K3GA 1A6VH 2YD6A 5ESAB 1GGIH 2FIKA 3F5WA 5EBWB 2YRPA 1KEML 5EU5A 2GKIA 1ZS8A 3RGVD 4GXVH 4HWBL 4OZGE 1GOHA 5E8EB 4CMMB 1WAAE 1I1AD 3MYJA 3DHMA 4MQXC 2IAND 3MRPB 3SE8H 5CJ8A 3RUGA 5EU3B 3GEWB 1S9YA 1T0PB 2EZ0D 1AC0A 1F4XL 4Y4FC 4AG4L 4NO2A 1YECH 5D1ZC 2E8ZA 3VGAB 4NWTH 2Z31D 3TBSA 4PBWD 1U93A 1KCRH 4ZS6C 2GTWA 1NGXA 1LP9F 4R0LC 3QUKA 5DRXB 5HPMB 2BNQE 1GHFH 3U9UA 3NH7H 4PJ9A 1EV2E 5I71C 1WZKA 5ID0A 1WSST 4BQ8A 3V5HA 5IHLB 3NFNA 4J6RL 2BJML 2DQHH 1CDYA 3E2HB 2HLFC 5DJAA 4CVZB 3MFFB 3CDGB 3FZUC 1QHPA 4MNGE 5EU7C 1QPXA 3GM0A 5KSAD 1YPZA 3NCMA 2QSQA 4KUZL 4OCNC 5DC9B 1EA9C 2WUBH 4AY0A 2LTQC 4RRPA 3JTSB 3JWOH 2WP3O 1AI1H 4CVUA 1F2QA 4LHUB 4LRNH 5D7KD 1S7SA 1BQHA 1JE6A 5F8QC 1UH2A 1PKOA 3WFEH 2FLRT 2VQUA 5F9JB 3AUVA 2EDQA 5CJOL 5BZDB 2R56H 4XRCA 2DQGL 3C6LA 5MP6L 1YY9C 5C3TA 3M17A 1XIWA 4KU1A 3WIHL 4P2OC 3FO2B 5A1AA 1JCKA 1YMMB 1JGEA 2MCPH 3QO0B 3NIGE 4I0PA 5DD3H 3CFJA 3GSNH 2NY4B 4YR6B 4JCMA 5KSVA 3X13B 2CK0H 5IFJA 1BZ7A 1LEKA 4I18A 1OF2B 4S2SB 4P4KA 4QTHA 2EICA 2NY0D 4YPGA 4HIIA 4QHLA 4ZQKA 3GKWL 3DYPA 5ACMA 1L7IL 3HUJB 2NZ9D 4IS6A 1QFOA 4L9LA 1UB6A 2WM0A 3IT8D 5D93C 3MUJA 2VISA 1NGZA 2BVTA 3D0LA 4FRWA 3DBXB 4FQHA 1KCUL 2R0KL 2RCSH 3FN0H 1OHQA 3WNLA 3DSNA 1RUMH 5FO7B 2C4FT 1RZ8B 4U3XA 3IF1A 3K2UH 4XMLH 2PN5A 1PYWB 4KTDL 5HY9A 1QNZL 3QUXB 4LLVA 4LPCA 4ZFOA 1JFQH 3DUSA 4U0QB 2CKBA 4M7ZC 5E9DD 3U2SA 3AFLA 3GGWB 2AW2A 4ISVA 5I1CH 2BOBA 3MROB 1A7PL 4Z7QE 3ARQA 1R5IB 3UTQA 2OJEA 2M8XA 3ZL4L 3LIZH 3HC0B 3VE0A 4KRPD 4UQ2B 2XPGB 1MIEL 1CL7I 1JMXA 4P23D 5E8OA 3PL6A 3VFMB 4YUEH 2HJFA 3ESUF 2EDTA 5MEQA 4DZ8B 4M6OL 4P5MB 4DTGL 2EXWD 3DTXB 4ZOCA 1FGNL 5ICXA 4DGIH 3RVTC 3VXSD 3BISA 5FGBA 2E7LC 1KACB 3E6FB 3EYUH 1RK1B 5D72L 4PR5B 1I1RA 4OFYD 5EFIB 2CR3A 2B1AL 4XNYH 5LXGH 1QLFA 4HXBH 2VXQH 4KPHH 4EIGB 3ISWA 3CDFA 3IXTA 5CBAB 4K9EH 3TIEA 1OAKL 1NEUA 1PY4A 4IRSC 4YFLI 5CZXD 2Y7QA 4Y5VC 4HUMB 5C0BE 5IQ9B 1KCVL 2FBOJ 4MMZC 4X7TB 1R24B 3ULVL 5E70A 4NRYA 4L4VD 1Q1JH 2MHAB 2VLLA 3C08L 1MQKH 5E1AB 2DD8H 1RQ5A 1CLOH 4I3SL 5H2BB 1I1FB 2V17H 2MJWA 5I1HL 3EKCA 1A4KA 1U8PB 5IIEA 2G2RA 3A6BH 4RA0C 2AK1H 5KBNC 1KF9B 5BV7L 1UA6H 5EUOF 2HRPL 3CLFL 4E0RB 2R1WB 1CI5A 4Z5RA 1N26A 1SY6L 4ZS7L 4ZPVB 4NFBA 1HKLH 4LF3A 5DK2A 4NQDB 3W5MA 4Z7VA 1FZOA 3VD5A 1Q94A 3VFNB 3OKKB 3MRCA 4NRZB 5JPMA 1G9ML 1BQUA 3WN5A 3RBGA 3ROOB 4HKJA 4NN5C 3RL2B 4YDIL 4X5WA 4K8RL 4HGMA 1KJ2A 5D9SA 1YEEH 3BWAB 5DUBA 5SWSD 4C83A 4S0TD 4S0SD 1KELL 2ZCHH 4L8SB 3MJ9H 1HILA 3CVHL 4I2XB 3QEUA 1NCDH 1WICA 1IL1A 1SYVA 3ZZ1A 4NQEE 3RGVC 2IPTH 3HI6L 4XI5D 2EH8H 2AGJL 4D8PB 1LK3L 2XTLA 3L5WB 3ULVD 4JFPB 4OZHA 1I1AC 4ZO7A 4FXKA 4UILH 3CFKA 5IESL 1ZVSA 5KN5A 1TCMA 3NMEA 2Q20A 4F3FA 4ZTOL 2EZ0C 3VXMA 1NMAL 5IBUB 2ERJB 1NFDF 4OGYL 2Z31C 4H1LH 4MDIB 1W8NA 2G9HA 4FQIL 4JFDE 1A1MA 2Y5EA 1HOCB 1ZLSL 4WWKB 5F9OL 3RZCB 2ORBL 4EZMA 2MOVA 4JY4A 1JUFB 4S1QL 4OZHE 4B5EA 1WFNA 4H1LG 1NCAL 3KXFD 4WU7A 3BPLC 3FRPG 4TPRH 3RAJH 4ESKA 1NC2D 5E5RB 4JZNB 5KSAC 3EGSA 2FJHA 3QUMH 3GSVB 1BOGB 1MUJB 3V0AC 4ALAH 3MPCA 1JWSB 5ALCL 3NFSL 1MCPH 3AB0B 1XGQA 3F6LA 2VLJE 5MEOA 4YDJB 5F89A 1KBGH 4RSVA 1X5LA 1MHCA 1W0WA 2WWMD 1TCRA 2IQ9L 3WHXA 5EBMA 4NDMB 2ZNXA 1PFCA 1H3PH 3PJSB 3DSFH 4HSQA 4LCCB 1CR9L 2ZCLL 3QG6B 4HWUA 4KROD 5DURB 3NN8A 4LNRA 1NGQH 1AGDB 2IH1A 3MXWH 1IGCH 3CLEL 3EOTH 2BVOB 1A14L 3QXAB 3A0OA 2XN9E 4R2GB 3GRWH 3O41A 1AD0B 3QFDA 4XNZC 2VL5B 5E4EB 5KZCD 4LVOB 4WUKH 5FECA 5HI3D 2ZJSH 4I77H 5A43C 5AZ2H 5DLML 1YC7A 1FNHA 3DYMA 2NY0C 2C3VB 4YEEA 2NZ9C 3C9NB 1B6UA 3RY6A 1P7QB 5H37G 4PJIF 3TNMA 5HYQB 1ZK9A 1MCKA 1ZLUK 2BOCB 4G6JH 2AJUH 3NA4A 3T3ME 1X5FA 3QUYA 2GJZB 2DAVA 4HUWB 5DWUL 1S7QA 5CGTA 4QF1A 1U3HB 4LK4A 2VYRE 5H8DA 2UVEA 1HH9A 3VGEA 3MA9L 1OP3H 5F44A 4IDJH 2F15A 1BQLL 3B9KD 4TUOA 5BOPA 5HGBA 1FVCA 3HPJA 3UTSE 1RZIA 5T33H 5GHWL 2ADFL 1BZQK 2AEQL 3GHEH 4MDJB 1FC2D 3GSRB 3V9FA 4LQ1A 2VIRA 1Q9WB 4ODXA 4MCYA 1MLCB 2VDPH 2YPKA 4PBXA 2XWJB 1BJMA 3UTZB 1IAKB 3EYSL 3ARXA 1XH3A 3BAEL 1TNNA 4RA3A 1S9XB 4KRPC 1Y0LB 1XF2A 3B2VL 5FXCH 3G6JA 1INEL 1UGNA 4I5BB 4P23C 3VDBA 2BC4B 1GOFA 1UJ3C 1IGYA 1CICA 4KGLA 4XXCA 3KPOA 4X9BA 1TNMA 2EXWC 5SWZD 5B38B 5ERWB 4U33A 1EK3A 5F7DA 1T7XA 4MNQA 4G6FD 1H3GA 3T0EB 43C9B 5JIPA 4RWHA 4LCWD 2C7UA 4ELME 4X98A 5T1KA 1S9WB 1LE9B 2XWBB 3G6JE 2F74A 3W2DL 3QR2A 2AJSL 4LVHC 1OTSD 2OLDA 4XMPL 3MRFA 2VUOA 2WBJA 5CZXC 3TVMD 3V0WH 2VZVA 4KWUA 4MA8L 3V5KA 1CXLA 1S8DB 4PP2A 2H8PA 4IIQC 3AS0A 5SWQA 2J8UA 1OGTA 2AJ3B 3NABL 1T80A 1Y6MR 2PR4L 3KR3H 4YBLC 5DQJB 3VXUA 5FKAA 4XPAL 1K2DA 5D7LB 3LSOB 1FNEB 4DWHA 1RZ7H 1S9VB 3CK0H 1UXWA 5GGRB 4HJGA 3O45B 1F2XK 3SGEI 3GMOB 3RGHA 3UJTH 2XY2A 4YX2H 5E94A 2VWEC 2FECL 4I3RL 4JPVL 3ILQD 4RWYH 3LKPA 4GH7B 5D1XB 4HUUB 5JR1L 4YWGH 1MIML 3GBNL 3JV4B 4NJ9H 5JXED 5D5MA 4YZFF 1MFCH 4LSVH 5C0RH 32C2A 1RV6X 1EX0A 1WBYB 4EUPA 5I1DB 1WTGT 3FQUA 3IB4A 1V7NH 5H94A 2ZKHH 3STZA 3WXVL 2W0KA 1KC5L 4Q58C 3EOYG 4LGSB 3O8XB 2BSRA 4ZYKB 4NBXB 4N9OB 4Q2ZB 2WAHA 2AV1B 1QRNB 1MF2L 5K59E 4GBXB 2Y06L 1IC1A 4C56E 2Z92A 5DR5H 3GBLA 4JFQA 3LRHA 2I9LA 2PXYD 3P73B 4XI5C 4OLWH 3K80A 3ULVC 4G6AD 4E41E 3LQMA 4ELKA 1YQ2A 3EOBA 3QCVL 4BH8B 3QIUA 2A6KA 4OQTH 4U1KB 2E27H 1N64H 4U2ZA 3TN0D 2YZ1A 1NDMA 4NNPH 1K4DB 1FFOB 4Y16B 3MRIA 3OKLB 5BV7C 1E4XH 3HCVA 5GS3A 1CT8B 3PWLA 3CXDH 4PJ5B 4TNVF 2A73A 5E8PA 1XGRB 3RIAK 3HLAB 3KPNB 1F4HA 4MAYA 2J3SA 4L3ED 2DIAA 1AGCA 3EAKA 2WINA 4W4OC 2ICEB 4JO3H 5JHDA 1X5AA 2HFFB 1AE6H 1G9MC 4K7FA 2ZUTA 1JGDA 4OZIB 2YUVA 5FFLA 4NN6C 3HG1B 1J1OL 1YEFL 4M7JL 5KVGL 2WWMC 1QSED 4HJ0D 2X41A 4EXKA 1F58L 3MLSH 5J1AB 2P24A 1ZLVH 2BNUB 3CSBA 3HFMH 3LD8B 4XNXH 4JO1L 5ISZA 4PJ7B 4KROC 2IAMB 4Y8DC 4RX4D 1TJHL 4JFHE 3BT2H 4XNUH 4MJ6B 4OF7A 3WIIH 5FYLE 5C0AB 1NJ9A 1A3QA 1JP5A 3DX7A 4PJEE 4D0DB 1B3JA 1RD6A 4JY6B 2WQRA 5HI3C 3SHSA 4JLRA 5GIRA 3HZMB 5LQBL 2ADJA 3FN3A 1FYTA 1S5HB 1KEMH 1F02I 2GFBA 3DUUB 5CEYB 3VFOB 3W0WE 4HWBH 2R29L 1AGBA 1S7XA 1XF4A 5DGQA 1JN6A 2EKSB 1P7KA 1F4XH 4AG4H 3FT2A 5FHAL 1F00I 3VRIA 4G42B 1A6TB 3REVA 3LRSA 2EYTA 3RWFB 4XT1C 2R2HB 4HGWA 1WEJL 1DP0A 1IM9D 1ZT1A 5K33A 3BIAX 5I1AB 5BXFA 3B9KC 3K7UA 3ZYOA 1MWAL 4GJTB 1MCWW 1V7ML 5DSCB 2BJMH 1U6AL 4P9HH 5FA3A 4NQXB 1HIML 1DCLA 3U7AA 4QRRB 4NRXA 5MEPA 1NKRA 1T1XA 1ZT7B 4KUZH 3HZKB 1FSKB 2O61A 4POUB 3D69A 1OW0C 3SKUD 3SPVB 3DI3B 4JRWA 4X6CA 2DM4A 5ICZB 2ATKA 2R69L 3BH8B 1CLYL 4X6DA 3K8KA 5FF6B 1UWXK 3B5GA 3ET9F 5CHNB 4XNMB 2NX5D 5CJOH 2WUCL 2DQGH 5MP6H 2R8SL 5I74C 3O4OB 1W72A 3F6IA 3LQZA 3WIHH 2HVJB 1HHKB 3O2VL 5DMGD 3VFUA 5C0CD 1SJEA 2PUQT 5IMOB 5EULV 1ONQA 3RWDA 3EDKA 1WJ3A 2YBRA 3KPSA 1XZ0A 2HAZA 1OTSC 1TITA 5HGHB 3F7YB 2PKDA 3UTOA 2DQCL 4G7VL 5GGTA 3W82A 3BSZL 4GG6E 2MQ0A 3TVMC 4Y0GA 4J12A 3T1FB 5AYUL 5E0QA 5HHXL 3QO1B 1J8HB 4Y4KA 3GKWH 4PGDB 1L7IH 2AJXL 5FOJA 3UJIL 1BLNB 4PLNC 4Z95L 4PJHA 4O02H 2YPLB 2IPUK 2VXVH 3VFTB 5I75C 1KCUH 4DAGL 4TNWK 5HYSA 1EXUB 4PPTA 5AD0B 2X4TB 1CD1B 1N8ZB 4Z7OE 3FRUA 3SDDB 5FV2A 5J11B 1S5IL 2BHYA 3AAZA 4NQVB 1PG7X 4KTDH 3ILQC 1QNZH 1AO7B 4HPYL 4JFZH 4A6YB 1I8LA 1F11A 5E2JA 4P3DB 3VRLE 2XTJB 3O4LD 5JXEC 4TSAL 4JFFE 4OZFG 4EN3B 5F3BA 1A7PH 4XAKE 3QHFL 3PQYB 1UADC 3LH2L 4YC2C 2C4FU 3V4VL 3QI9A 1IEAB 1BHGA 3OR7B 1OWWA 4OV6F 4QRTA 4HUVB 1MI5E 2YPVL 1MIEH 3VXTA 2CDFA 1RSFA 2WP3T 4YHYB 1PG7L 1VADA 1DUYA 1CTOA 1RK0A 4YGAB 4EI6B 3P0VL 5FYJL 1RHHA 4M6OH 4DTGH 4HEPG 3RUGF 5E00B 4OLVL 1FGNH 1C08A 4M93B 3U0PA 3DVFA 1RUKL 5D72H 3MX0A 2PXYC 2HVKA 4MJIE 3MGTA 4Z7WA 4G6AC 4U1HB 4X7FC 2VAAB 5DRNA 3RIFK 2J7LA 1AXTL 1EVUA 2B1AH 4NFDA 3OKDB 1BWMA 5D6CB 4LDEB 1DLFH 1T1YA 2Q6WB 4NYLB 5ABDE 3HZVB 4X5XB 1HSAA 1OAKH 3RVXD 4GKZB 3TN0C 1FZMA 3SY0B 2OL3B 2X89D 1RVFL 2AK4E 5EO1A 4MZ3A 4GSDL 4Z7WE 3ULVH 2HN7A 5TPWL 4DUXA 4CJ1A 3NIGF 2XOTA 4BFGA 3C08H 1IZKA 3LN9A 4PGBB 2CQVA 1S7RB 3BVNA 2J6EA 1PQZB 1A64A 4I3SH 3SCMA 2N4IA 5J9PA 3INUH 5I1HH 4NNXB 5HYFA 1XR9A 4J8RA 4U6TA 4EI5D 3K74B 4ZG1A 2IALB 2P45B 5BV7H 4XCNA 3L6FA 2HRPH 3P30L 3S5LA 3CLFH 1CDUA 1HNGA 2BRRL 4PV9B 2X4QB 3QA3B 3MRQB 1T7WA 1DDHA 4KGJA 5FYJD 1J9CT 4HJ0C 5C08B 1SY6H 1T2XA 4ZS7H 2DQFA 2P5EE 4IRJB 3RWIA 3T0WA 3ULUE 2R39A 3REWB 2KUTA 1RIVL 2HT4D 3MV9A 5KVFL 1I3VA 3Q3GB 1DVFD 2H2PD 2BVQA 2XQYK 3CFDA 5IT2L 4YDIH 2DYPA 2JJWA 4K8RH 4HZLA 3GSQA 4PJXA 2BY3A 3U0TA 4L3AA 3EUUA 4CKVX 5F7HA 3QQ3B 3LN4A 3CVHH 2W65A 4BUGA 3C60D 3UROR 1X5YA 3BIKB 4MXWL 2AAVA 1L9NA 3MRKB 2QSCL 4MSWA 5E6ID 4M1CC 1A3RL 2A6DB 5HHOD 4QOKD 1WBXB 4DUVA 2AGJH 1LK3H 5CIPB 4QRPD 5DD5L 1HWGB 5IESH 1FO0B 1R5WA 3BGMA 1NBVH 2IADB 4XH2A 3AM8A 3ZYJA 4ZO9A 1T21B 4AYFA 4OGYH 5L8JB 1U41A 8FABA 2AJYL 2HFGL 1G7PA 2ATPB 1OPGL 3MBEB 4FQIH 1KXVC 2F53B 3JV5A 4G8GA 1E28A 1ZLSH 4ZTPH 5F9OH 5ITFB 1OSZB 3GB7A 4S1QH 3ROLB 5L2KE 3FQNA 3DVNB 1FPTL 4M6NL 1NCAH 5DMKA 5IB1A 3OXRB 4U3HA 1P1ZA 4OV5A 3TBVA 3WHE1 2DWDB 4PBVC 1S7VA 4IHOB 1YMHA 5FA4B 3JV6A 5CILL 1C16B 5ALCH 3NFSH 1HQRA 1FVEB 3H0TB 4W4NA 3ARDD 3KJ4B 4HX1B 2Z8RA 5I8CB 1HNFA 4MHHI 3O3EB 2A2QT 3BZ4A 2IQ9H 3IETB 1N59A 1TVHB 4W70A 3H9SA 1KIQA 4JZJC 4RFOL 3CX2A 5CSZA 5HHPA 5HVHC 1CR9H 2ZCLH 4RNRB 5DMGC 4PREB 2VRAA 3CUPA 4RQQA 5DQ9B 4D2NA 2W0LA 1A14H 4GG8B 4UV4H 4YNYA 3ZDZE 1LEGB 1U3YA 3SDCA 4HG4K 5L7XL 1K5NA 3L3HB 3PGDB 4JHZA 3GSWA 4M7LL 4BH7B 4ZFFB 1EFXB 2HJKB 3HE7B 2VQ1A 4X7DC 4BZ1L 5ESAA 5DLMH 2DLIA 3O6FB 3HAEG 4K3DL 3CPLB 5EBWA 2VLRD 4FQXB 5GS1C 2J5LB 4QCIA 3RWJB 5DF0A 2AEIT 4CMMA 1CD8A 3SGJA 3CMGA 3C8KB 5EU3A 4NQSB 4OLUL 5IW6B 3G08B 5DWUH 1G1YA 2YD8A 4NBZB 3S35X 4FQJL 1IGML 3DO7B 4JDTL 4YQXL 1YEDB 4Z7VF 3MA9H 5HPMA 1BQLH 5C8JB 4JGUA 3IDMA 3PNWA 3QIWD 2RBLA 2VDNL 5GHWH 2ADFH 2YA2A 3CDGA 3MFFA 5C09E 4WNQA 3EYSH 1I9RL 3BAEH 1OT2A 5CJXC 3JTSA 1I75A 4P57B 3B2VH 4Q9CA 3FB6A 3G5XA 1INEH 1IC4L 1BWWA 1Z9LA 4OZHF 3V6ZB 1E4KA 1CLCA 1RHFA 5F9JA 3KNBB 5BZDA 3P4NB 2YWYA 3FQTB 3PV6B 5CKGA 4ZXBB 4EVNA 1PVHA 1DQDH 2WLZA 4YFEA 1T2QL 4LASL 4XBGB 4WW1B 5CCKL 2QSVA 2WW8A 4LP4A 4U1IB 1U92B 5AAWA 5E4IA 2JIXB 3GMMB 4JN1L 4YR6A 4N5UA 3X13A 4XMPH 4ZFGH 4RGNB 3VFSB 5GJSL 2V7HB 5DHVB 3RVXC 4S2SA 3HS0A 4OI8A 1VESA 5F1SA 4HWEL 4LSUL 1DBKL 3F7RA 1LD9B 1YMME 3ECBB 3QZWB 3RU8L 2CRMA 3EFFB 3MRRB 1ZTXL 1IM3B 2PYEE 3NABH 3WIFA 2PR4H 3BP5B 3UTTA 3PP4L 4XPAH 3DBXA 2DLFL 4MD4B 3WLWD 3BKYH 4DK3A 4OCXL 4TUJB 3EJYD 3L5XL 4XX1G 5GJTL 1AKJB 5FO7A 1B90A 4NZDA 4YHZL 4DZBB 1E4XI 4EI5C 5EH1A 1XGUB 1OD7A 3LQAL 3HUJE 3WNOA 3MCKB 3BOVA 4ENED 3RP1A 3B9EA 4JPVH 3FKUS 3F12A 2VUYA 3GSNB 1EZVY 3GBNH 1IRAY 1PSKL 2XV6B 3T3MF 3GGWA 3GMLB 2BSTA 3MA7B 4PJBE 2HT4C 1CZ8L 2XG4A 1R5IA 3VMOA 4JANB 2H2PC 4M9OA 5DYOB 1U8LA 1ES0B 3B4NA 4JKMA 3TA3A 3KPLB 3WXVH 1GXEA 1KC5H 1NL0H 5I6XB 4WFGE 1AHWC 1KLGB 1UXSB 4P5MA 4DZ8A 2XZCL 3OHXB 3IGAA 1MF2H 1MJJB 1CXHA 4FZ8L 1CDCA 1OGAB 1GCFA 4WV1C 1OTUD 2Y06H 3C60C 1FL3A 3E6FA 1RK1A 5IMMA 4PUBL 5E6IC 4Z76B 2Q86B 2FR4B 2JELL 4NO3A 4JVPA 1R3HA 4N8VG 4S1RL 3FFCB 3FRPA 3S96B 5BQ7B 5DVLA 3IDYC 1KCKA 3O6ML 2WWKO 1OOAA 2OTPA 4KDVA 3QCVH 2EIZA 3T77B 1JGLL 3TJHC 1ZGLB 1WCQA 5CBAA 2KDGA 2F5BL 3TO4B 4AEHL 2VDML 3BX7C 5D1ZA 1YNTA 3MJGX 4ELMF 1N6QL 4PP1D 1TZGL 4X7TA 3IU4L 1MCRA 3STLA 4LSRL 2A6IB 3G6JF 3NPSC 2Q1EA 3MCLH 2ESVE 4R0LA 3GIVA 5EZLB 3D18B 1VFAA 2UWEE 3H3PL 5H2BA 3T1WA 5GGQL 3V52L 1OD9A 1NGYB 4NBYB 2NXYB 4HC1A 4ODWB 4BFEA 1RUQH 4QO1A 3KGRA 2Y07L 2PNDA 3ARDC 4G8FB 3QDMA 2V9RA 3ARZA 1J1OH 1YEFH 5DEFA 2R1WA 4M7JH 5JUEL 4E0RA 3S4SG 4JFED 2AERT 1KPUB 1F58H 2Z35B 2DWEB 3MOAL 2JJUA 4JO1H 3TT1L 2BDNL 5IUSA 3BD3A 2PYFB 2DJUA 3OKKA 3FFDA 5HYJA 4U6VL 5F71A 3ROOA 1TJHH 3CFCL 2NXZB 3AY4C 1F6AB 2JCCB 4N0FB 2SEBA 4GW4B 3GZKA 3IDNB 1GL4B 1A1OB 2AJZB 1HHGB 3MV8B 4NC1E 5FGSA 3OAUL 4LSPH 1VACB 4U0RC 4LP5A 4WJ5B 1NAMA 3CX5J 5E8NB 4BK5A 4CNIA 4NQDE 3QDGA 3U4EB 3C87A 5LQBH 3VXPB 1CE6B 4PRPD 3F58L 3L5WA 2R29H 4JFPA 5FKPB 3GDBA 1TDQA 1YEKL 5JLZB 1XCQB 1TZIB 2RAMA 5CEZL 4HFWB 1KB5B 1PW3A 4X6FB 2BSSB 3IFPA 1IMHC 2J8OA 5FHAH 4NPYB 5DJ2A 5K59F 4MDIA 3MNZB 3VWJA 4I2XE 5D5MF 3RNQA 1ZT4A 3OAZH 1A7NL 1HOCA 1WEJH 4P5TC 4KK6D 4UNVA 5FOBB 4ONOA 3DX6B 3L95B 1OP3K 3PF2A 4WVRA 1MWAH 3QIWC 5CSGA 1MREL 2BRQA 1V7MH 4FP8L 1BBJA 1U6AH 3LKOB 5L9DL 1FYHB 3KPRA 4U6YB 4APQD 4K55A 3IDUA 2G75B 3QBTB 3GSUB 4QXGL 2QQLL 5CKAA 2AXHA 2V5TA 2EDJA 3GSVA 1BOGA 1MUJA 4RAVB 3CGTA 3LS4L 4DJMA 3DYOA 2VN4A 5CJBA 2NPLX 5TE6L 3VWKD 2R69H 1I1CA 1CLYH 5LCVL 3PWPE 1YEHL 4GAGL 3QCUL 2P44B 3BZDA 2WUCH 3M45A 2R8SH 2DQJL 3O2VH 4HCRL 3QEQE 5CJQL 2BVOA 4IJ3B 4Y19E 4P46D 2HA1A 1B0WA 1RZGA 3RI5F 5CEZD 2PW1B 2DQCH 4M5YL 3OR6B 4G7VH 4R3SB 1VKXA 3BSZH 4LDOB 5DQDL 2YOCA 5AYUH 1I7UA 4PRID 5HHXH 5JW4N 3MBXL 1T4KB 2EDHA 3C9NA 2AJXH 5DC0A 3UJIH 1P7QA 3OWEA 1FAKT 1WZLA 4Z95H 4J3UA 4XPHL 4NO0B 2BOCA 2IQAA 2JJSA 3B3IB 3CIQA 1AJ7L 4BYHA 3WLWC 2GJZA 4HUWA 4DAGH 3EJYC 4HWZB 5EU4B 5GGRY 2F54D 2GYSA 1S5IH 4ENEC 1T2JA 4O5LL 2YEZB 4HPYH 2YSSA 4F2MB 2FEEL 3L3DA 2FGWL 2JJTC 3HI5L 5I1JH 4MDJA 1GJIA 1KJVB 1J8KA 4G9FA 1MLCA 4TSAH 3S8WA 5DUPH 2D7PA 3QHFH 3UTZA 1IAKA 3LH2H 3QCTL 1N5AB 2IWGA 3X3GL 3BD4A 3V4VH 2KZWA 1Y0LA 3BI9X 2HWZL 2ZPKL 3KYNB 4I5BA 2P46B 4KV5E 4PJCA 1PG7H 4ZO6A 2APBA 3P0VH 5FYJH 5B38A 5HJ3B 4KH2A 1VFBB 4OLVH 2F8VA 1OTUC 4DCQA 2I27N 3T0EA 1RUKH 5HDBE 1H3TA 2KQMA 1JF1B 4NO5B 5TQ0L 3AS2A 4H8WL 4MWFB 4R97C 3L3KA 1A0QL 5HVFB 1S9WA 1NMBL 1TPXC 3V7MA 4RFEA 5ILTL 3ES6A 3LKSB 5TE4H 4FFYL 1NEZB 1H9VA 1X5XA 1I1AA 2IANA 3AXLB 1BAFL 2XZZA 4J3SA 4P2QE 5EO9B 1RVFH 1W0YT 3U82B 2AXJA 4PP1C 4Z77A 4NT6B 1M7XA 4GSDH 3UTPD 1FIGL 1S8DA 5TPWH 5I2IB 4ERSL 2CLRA 2VLMD 1MCIA 5DQJA 3UZEA 1UM4L 4RISL 3KLDA 3P4OB 2LE9A 4XBPB 5D7LA 3GO1L 1HEZA 3DV6A 1S9VA 2R1YA 1JZ3A 2DQTL 1G6VK 5GGRA 3X11A 5C07A 4I0CC 3O45A 1DEDA 4N90E 2LV4A 4HMCA 1NGPL 5LWYL 4RAHA 3Q6FB 2WSKA 4L5FH 3P30H 3PWVB 4MZ2A 1I8KB 3V6FB 4YXHL 4WTZG 4YHOL 2QADB 2BRRH 5D96C 2JE8A 5E2UL 4Q6IC 3EO0B 4Y5XC 3I02B 1D9KB 3OTTA 2CUIA 1Q9KB 1RIVH 5KVFH 1CFSB 1ZLVK 1BD2B 1FNLA 2YR3A 1WBYA 4Z7OF 2IGFL 5IT2H 5B22A 3QNYB 4GW5A 3UDWC 4ZYKA 2NY1D 4HT1L 2VR5A 2AV1A 1CGYA 4DEPC 5HYEA 1OAYL 4BA8A 2Z91B 3GI9L 4FTVB 4HUXA 4IRSB 4MXWH 1CK0L 3P73A 2QSCH 5AAMA 1A3RH 2B0SL 1H15A 2VZOA 2CPCA 3GK8L 5DD5H 3ARGD 3N85L 3WLBB 4PJ9D 5EZOL 5F70A 4BH8A 5C71A 3THML 3GBML 1GC1L 4U1KA 1QRNE 1MCQA 3G04B 4LIQE 2B5IB 3PABA 2GJ6E 1WFTA 4OF6A 5ADPL 2AJYH 1K4DA 1FFOA 4Y16A 2HFGH 1OPGH 3ZKXC 4WFHE 4F7EA 4KK6C 1HXYB 3AREA 3RTQB 4PJ5A 1TXKA 3FQWA 2OP4L 5GRZA 1XGRA 4M6NH 1FPTH 4MA1C 5AWNL 3KPNA 4ZFOL 2EYRB 1LK2A 2CKBL 4APQC 2ZUVA 5IF0B 1KTLA 1IGJB 1NEZG 3FJTA 2ICEA 3C6LD 2EDNA 4NKQB 4JDZA 2NYYD 1XIWD 5CILH 5C7XH 5DEGB 3MLTB 4LAQH 4LQFL 3DUHA 4OZIA 1HQ4B 5TJWK 4WO4B 1J5OL 4Z7WF 3HG1A 3ZSSA 3VWKC 1Q72L 5DD0L 5DZOA 4H20L 4LSSL 1A4JB 4Y5YB 3ZTJG 3GJFA 2D9QB 4PJ7A 4RFOH 3TYGH 1EMTL 1HHIB 1O0VA 4M02A 4P4KD 4U1GB 2VOTA 2HFEB 4OFYA 3QNXA 2Y23A 4P46C 4MJ6A 4PJ8B 5L0QC 5B8CA 5K9KA 5L7XH 4MA7L 4M7LH 5MI0B 3ULUF 1ND0A 4BZ1H 2CJUH 3HZMA 4K3DH 5B39B 4PJ7E 3NOIA 5CEYA 3VFOA 5A2IH 3VD7A 5MERB 4OZFA 2GEEA 4KVNH 3PE9A 5DJXB 4LMQE 5C0AE 3TNNB 5CZVL 4L4VA 2EKSA 4TSCL 5TH2B 5FB8A 3D3VA 1U9KA 4PJFE 4G42A 1A6TA 4FQJH 4BQCA 1IGMH 4I9WD 4PLKD 2C5DC 4JDTH 4YQXH 3RWFA 2R2HA 1VFUA 4I4WB 3W39B 4K71C 1OSPL 1LE5B 3I6KB 4KQ4L 5DSCA 2VDNH 3PL6D 4UU9B 4AMKL 1BFVL 2D9CA 3OKYA 4OLZL 1JNLL 4GUPA 3MV7B 4PJXF 1ULVA 3SKJL 4QRRA 1CYGA 3OXSA 2GK0B 4ODVL 2X4OB 5T5NF 5HD8D 1I9RH 3K4AA 5IM7B 3HZKA 3QUZB 2FECI 4P2RE 5LGKA 5K9QI 4HIEB 3IKCB 4FA8A 2ZUQC 2VITB 3SPVA 2XWTA 5FF6A 1IC4H 3U9PH 1M71A 1KJ2L 5GZOD 5CHNA 4PLJD 2XKNB 2QEJA 5D2NC 2OR8A 3MOQA 3QIBB 2X4NB 2YN5A 3MJ8B 1FCGA 4QRRE 5LGHL 2J12B 5GRVL 5CS7A 2HVJA 3NBNA 1HHKA 1T2QH 5C0FB 4LASH 4RAUA 4TN9A 5CCKH 1WV7T 4JN1H 3OKEB 3B9VA 2IMNA 5HGHA 1FV1B 3F7YA 1ZA3B 3T2PA 1GAFL 5GJSH 3ZTNL 1PEWA 5I8EB 2AQ3A 1X6LA 3T1FA 1MEXL 1J8HA 2QQKL 5TDOB 4PGDA 3BQUB 4LSUH 1DBKH 3BKCL 2AXFB 2LVEA 2NY2B 1JGVL 4JVWA 1G9NC 3SO3C 1ZTXH 3PP4H 3VGDA 3O3BA 2DLFH 2YD7A 3BE1L 4JO4L 3GNML 4OCXH 1F4AA 1P2CA 5DD1L 3L5XH 5GJTH 1WC7A 2X4TA 2D7QA 2FZ3B 2H9GB 4V2CB 4YHZH 2VZTA 1NC2A 4OGZA 5DO2D 1T03L 1J8HE 2ZOLB 3LQAH 4W4OA 4NQVA 3DXAB 1NFIB 4LRIA 3BWUC 2YPLE 4XCFL 4M61B 3STBA 4RZCB 2XACC 2ZSVA 4EN3A 4PB0L 1CZ8H 2MKWA 2OTWA 3PQYA 4X8XA 2A83B 4NCDA 1IEAA 3OR7A 4YK4C 4OTXL 1FNAA 1DR9A 5DJ6B 3FN9A 4YXLL 1KGCE 1NBZA 4XP1L 1AO7E 2NY1C 4EI6A 1D5IL 1DFBL 4LFHD 3ABZA 4LVHB 3KWWB 5E00A 4FZ8H 2XTJE 1CFVL 2XNAB 3VXMD 1HE7A 1B4RA 4WU5B 5FGCE 3DIFA 1RMFL 2BZDA 1H5BB 4EQ2A 4PUBH 4LARL 2JELH 5I30L 1ZWIA 4R26L 3OKDA 4DUWA 3ARGC 5I73C 5D6CA 3O6MH 4PJ9C 5KOVC 2Q6WA 5GGVY 2FD6L 1C5BL 2JTDA 3X12A 4WFED 4WW2B 2F5BH 5TFSL 2BVPB 4NZRH 2VDMH 1B0GA 4XHJD 3QWRA 2Q8AL 4JRYE 4XP4L 1N6QH 1TZGH 2XG5A 4Y88A 3IU4H 4V2BA 4LPXA 2LAAA 2OXHA 2FHBA 3KYKL 4LSRH 4PGBA 1A9BA 4U7MA 1S7RA 2A77H 3B6SB 2E7CA 4QXUL 1PQZA 2VXTL 3H3PH 5JW4R 5HGAB 2H41A 4NNXA 5GGQH 5IB5B 2HG5B 3FB5A 2NYYC 1XIWC 2IALA 2KBGA 4EIZC 3W9EB 1V05A 4X0KB 1UM6L 5CLWA 1OW0A 2X4QA 3QA3A 5JUEH 5MENA 3MRQA 3HAEA 4XCCL 1JWUB 1AY1L 7CGTA 3REWA 5I18L 1P5UA 4I18C 3B9AA 1RUAL 3TT1H 2BDNH 3Q3GA 1NSNL 1NCNA 3H7BB 1EHXA 3CFCH 3SQOL 3G9VA 3HUJF 5DMJB 3V6BR 3MMEB 1JPGB 2ICES 1FFPB 2NW3B 4NHUA 3UTSD 3MRJB 3QFJE 5DS8A 3OAUH 1GC1C 3O3AB 3VH8B 5C08E 4U7SA 3QUYD 1W0VB 4G43B 3BIKA 2E9WA 4L8CB 3MRKA 5INCA 1LO5A 2A6DA 5L6YL 1QVOB 3F58H 1GIGL 4M7KL 3F65A 1T0MA 3NIDF 2VR9A 4JR9L 1FO0A 5M7QA 4WIQA 4MD0B 2L7JA 3AS1A 3N0PB 3KXFB 5DRZA 1KCLA 3DGCR 1FRGH 4K7PY 5CEZH 2X70A 4GMSL 2XA8L 2HTLD 2FNBA 2R23A 3B5HA 4PLKC 1ZOXA 2UZYB 1T1ZB 5EIIA 3MBEA 3ARSA 2AV7A 4KFZC 3NVQA 4ZFZB 25C8L 3ROLA 1MREH 3QNZA 4FP8H 3PL6C 5EIVA 1AQDB 3IDGA 4OZGB 1CICD 4JREB 4BJLA 3TBWB 5L9DH 3GUTA 2WQ8A 3FO1A 4QXGH 2QQLH 2RHEA 1N5YH 4MNQD 3P9WB 4JQXC 3R8QA 4IHOA 5HD8C 5FGBC 2EC8A 1A9EA 1C16A 2F53E 4HKBA 4XMKL 3LS4H 1FVEA 3H0TA 5ELIA 5T1KD 2ZG3A 5IVZB 5ESQB 5KS9B 3OGCB 5TE6H 5TDPB 5GZOC 4PLJC 5LCVH 3O3EA 2QQNL 1YEHH 2FCBA 2BNQB 2NY3B 3IETA 4GAGH 1TVHA 1I9EA 2IFFL 2DQJH 3U6RB 4UQ3A 2WBJD 4YH6A 4RNRA 4PREA 1DQQA 4MNGB 4HCRH 3JWDC 5CJQH 1XF3B 3S97C 5IB4A 4KDTA 3VXUD 4JY5H 4LBEA 4ZFFA 3GMNB 4BH7A 1EFXA 4M5YH 3HE7A 1T0NA 1C5DA 3HNVL 5FYKL 4HIHB 5DJDA 2GY7B 3O6FA 5DQDH 3SE4C 3CPLA 4PY8J 1QR4A 4YJZL 1EDQA 2YC1B 3GHBL 3LCYA 3OPZL 3RWJA 3V7AE 4H5SA 4MJ5B 2NZIA 3LV3A 2YHGA 4WEBH 4XPHH 3C8KA 3FOLA 5FO8B 3MR9B 1AJ7H 4JVUA 2IF7A 5IW6A 3G08A 2GCYB 4PB9L 3VFRB 3L3JB 4PG9B 4LVNC 5I66B 3HMXA 4JCLA 2YK1H 3U30B 2H45A 4WDIB 2I60L 2W9DL 3TH3T 3TYFB 3DO7A 1YEDA 2YD3A 4ZUTB 4HIXL 1ZLWH 4D9QE 5CINL 1JTTA 4HJJL 4R96B 1N2RA 4O5LH 5FYLL 3CDCA 1H3XA 3B5TA 3BN9D 3HI5H 4MLIA 2ADGA 2VDOL 1RIUL 4ACPA 1HXMB 4JFXA 1Z0NA 1QYGL 1IGTA 4YXKL 3RA7L 3QCTH 1DUZB 1FFNA 4JRXA 5DVNA 1CGWA 2HWZH 2ZPKH 3MREB 1U8IB 3MRGB 5HDOA 4BK4A 3VGHA 4IMLB 2CIKA 1X44A 5DK0B 2Z8SA 3I2CL 3QIUD 3P4NA 3FQTA 4ZXBA 5SX4H 4PJGA 5FYKD 1X3DA 5TQ0H 1PBYA 4H8WH 4LLWB 4WW1A 1NMBH 4KY1L 4U1IA 1WFOA 1U92A 1J05B 4NWUL 1R3LB 5ILTH 2JIXA 3GMMA 2LU3A 1EEUA 3QH3A 1NC4B 1CXKA 1HCFX 2QBWA 4FFYH 3RWEA 5GPRA 1CXEA 3VFSA 4HFUL 5DHVA 2XXMB 1BAFH 4ZOAA 5I1KL 2VZUA 4XHJC 3BPOB 2YA1A 1N7ML 3UJJL 5KJRL 1LD9A 1J18A 1SEQL 2OTUB 3ECBA 3QZWA 4X9GA 4JFHD 5IVXB 3EFFA 5IP4A 3MRRA 4UTAL 4ERSH 3DX8B 5FYLD 1UM4H 3BP5A 4B7LA 4RISH 4IOIB 3GO1H 3K2MC 4I3GA 4RGNE 2DQTH 1QEWB 1AKJA 4HPOL 3RWHB 5ISZD 3PGCA 1NGPH 1X5KA 4P5KB 4WHTA 5LWYH 2X9WA 4TTDD 2V7NB 2MQCA 3MCKA 3W0WD 5ITBL 5C0BB 3KPPB 4YXHH 4YHOH 5E2UH 3GSNA 2EYSB 1EO5A 3MNWB 5SV4A 3WV0A 1H0DB 1X5JA 1DE4A 4RRPG 1BECA 3BPNB 4JANA 4RFNC 5DYOA 1W72L 4F7PA 1BQHG 1ES0A 2PXYB 3FCTB 3BUYA 1FYTD 1DN0B 1TJIL 2IGFH 3RY6C 3KPLA 4Z7NE 2VLKE 4U1SB 4YDVB 1UXSA 3X17A 2IBZY 1MJJA 1QOKA 2ZOKA 2Y9RT 3HN3A 1OGAA 5IB3B 1OAYH 2EDFA 4FQCL 5GGTL 3GI9H 2RJMA 4CUCA 1LGVA 4PRHE 2FX7L 1CK0H 3CH1B 2CO7B 2Q86A 2FR4A 3FO9B 3DRTA 1LNUB 4ZD3L 3FFCA 3HKFA 1TTUA 4KV5F 3IAGC 3GK8H 2VDLL 2O5XL 3N85H 2NTFB 5EZOH 3THMH 3GBMH 1ZGLA 1GC1H 2HTLC 1A5FL 1U58B 4L3EB 3SBWA 2DN7A 3VJ6B 5ADPH 4POYA 3ZT6A 3OKOA 3ILPB 3OAZK 5HHVL 3BMWA 2YKLL 5ID1A 1LP9A 4NQEB 1V3LA 4PJCF 2OP4H 4XXCC 1CICC 5BRZE 1WQVT 1QSEB 5EZLA 5AWNH 2CKBH 1CGUA 4F8QA 5E6YA 1QSFB 1KUMA 3I75A 4LEOB 3O4LA 2RFXB 4QLRA 1NGYA 2BMKB 3LKNB 1NLBL 4GKNA 4KRNA 4LQFH 2QV2A 4X6EB 2P1YA 3QQ9D 2D03L 4EJ1C 1QKZL 3LDBC 3C5JB 5EOTA 4L4JA 4G8FA 4JFDB 1NAKL 1Q72H 5DD0H 1OP9A 1KN4L 2NY6D 3QDJE 4H20H 4Y4HB 2P4AB 4LSSH 1A6AB 4F15C 1I3RA 2DWEA 2A6JA 1KCSL 2X4UA 4Y1AA 4H25B 2WBJC 1EMTH 1BIIB 4M5ZL 2EXYD 2P8MB 4WWID 3ARFD 4Y4KD 1ZSDB 1A6PA 1P4BH 5CD5D 3FO0L 3IDNA 1A1OA 1EAPA 1HHGA 2AJZA 3MV8A 5B3NA 5F7KC 1R3KB 5IHUL 4HIJB 3GI8L 3ZE1F 1VACA 2WNGA 4MA7H 4XC3L 1BEYL 4WJ5A 5E8NA 5ACZB 1N4XL 1YY8B 1DSFL 3U4EA 3QP3A 4KHXH 3VXPA 1CE6A 5JPNA 1UEYA 4URTB 2X89A 4RMQA 3VGBA 1MI5D 2JCCE 1XCQA 4POZD 3L9RB 1YC8A 4OAWA 4RCAA 4LPUA 4HFWA 1IC5H 3G5ZA 5CZVH 1KB5A 4I48A 2BSSA 4TSCH 2X4SB 4PY7B 2J6EL 4YHPA 4BKLB 3MNZA 1JK8B 3ZMRA 2O5YL 1QPPA 2VKXA 3CSYA 5FOBA 3DX6A 3L95A 3QI9D 5HI5D 3WD5L 5C0IA 1EH9A 4KQ4H 3LEYL 1RFDL 3BN9C 4Z78B 4Z7UE 5D8JL 4AMKH 1Z9MA 3LKOA 1BFVH 2R0ZL 4U6YA 1JNNL 4OLZH 1JNLH 3SKJH 3GSUA 4R7NA 3TPKA 2MNUA 4ODVH 1UH4A 5C9JB 2AK4D 2RB8A 4MX7A 2CD0A 4CMHB 1CGVA 4P9ML 4TQEL 5ECJE 2P43B 2CLVB 1NANH 3BH9B 4N0RA 4UUJB 1KJ2H 2DTML 4O51A 3J8F7 3MRMB 4WUUB 5ADOL 3QIUC 2FYYB 1AGEB 4O4YL 2CGRL 4R4BB 4LCIL 5HHMB 5LGHH 1G6RB 5K9JL 2QKIB 1CN4A 4WV1A 1YQVL 2E7MA 3C60A 4NM4L 2XI9A 2EH7H 3G6AA 3EYVA 5HHOA 3PXJA 1MWAB 1MVFA 4P3CL 4F7CA 4QRPA 4AIOA 1GAFH 1Z5LA 3ZTNH 2D31A 4R3SA 3VCLB 3SCMD 2DI9A 5FHBL 1MEXH 4N8CL 4KKLD 3FT4B 4ONGL 1K8DB 5DD6B 1T4KA 4LFHG 3NTCL 1N3NB 3BKCH 3IDJB 1KPVB 5BZWB 1JGVH 3AMLA 4OZIF 5IB2B 4NO0A 2R2EB 3C2AL 3B3IA 3UMTA 3TCLA 4I0KA 4JO4H 2W91A 5FYKU 3GNMH 2V5YA 5DD1H 3LN5A 4CJ0A 1U2HA 3NCYP 3VD4A 2ITDB 5IKCB 4NCC1 1SEBB 4HWZA 4PJ7F 1T03H 4U3CA 4TTDC 2KL6A 3CSGA 3EOAB 5GS2D 3A67L 2YEZA 4F2MA 1VHPA 1T89A 2DYPD 4XTRD 4ZAKB 4XCFH 3QPQC 3ZSTA 1UKSA 1JGUL 4O2CB 4PB0H 4XVSL 1ORSB 4CW1B 2DM2A 1CGXA 5EU7E 4YDLB 1N5AA 1P5VA 4S10A 2IJ0C 4V1DB 4OTXH 3KYNA 4YXLH 1TQCC 1XR8A 4PRNA 4BELD 4XP1H 3AY4A 3UO1L 1DFBH 3WUWB 4JJ5B 4EOWL 4LHJB 3ZO0A 1OB1A 2X1XR 1CFVH 5D71L 4G9DB 3LKRB 1RMFH 3HI1B 4E9LA 1JF1A 4LARH 1RZJL 4G8GD 5I30H 4KAQH 4R26H 3WE6B 2OI9C 5BO1L 5IEHA 1HH6B 3WO4C 1NEZA 5C6PB 3E8UL 3E3QC 2FD6H 1J0YA 1VDGA 1C5BH 2EE9A 3BXNB 3V95A 2GSIB 3CX5K 5DJ8B 3ZE0E 1A2YB 5TFSH 2AEWA 4ETYA 1IFHL 2Q8AH 1NFDA 3WJLA 4U1LB 4XP4H 2I5YL 4C56B 4EI5B 4NT6A 3PDOA 5DEZA 5EU6E 5I2IA 4ETQB 3KYKH 4YFLF 4OI7A 1NCBL 4P5TA 2R1XB 1M7IB 1QFUH 3P4OA 4XBPA 2FJGB 4E41B 3TBYB 3GMPB 3R1GL 4QXUH 1QQDB 2VXTH 1T1WB 4AQ1B 5C9KA 1DVFB 4M00A 4PTTA 5E2TL 5KAQF 4MJ2A 2Z9TA 3Q6FA 3QQ9C 5CFHA 1I8KA 4ZODA 3DVGA 2JB5L 2E5EA 1UM6H 3JWNC 3HNSL 3EO0A 2NY6C 1MNUL 3I02A 1AHWB 1DBML 3P9MB 4RBPH 4XCCH 3SDCD 3QWQB 1AY1H 5ESVB 4DGYH 2CXKA 4OD2B 3HNTL 5I18H 1QFPA 1KIRB 1RUAH 1UM5L 3CZJA 2EXYC 3ARFC 1NSNH 3MLVL 4Y4KC 1RULL 1VEMA 3SQOH 5CD5C 3QNYA 3L5JA 1QBML 4LNVA 3IDYB 4HXAL 2DKUA 3OG4B 3DMMA 3BZEB 4U6HA 4N9GA 2P5WA 1CBVL 2FX9L 2Z91A 4FTVA 1BD2E 5EDXA 2DL2A 1DEEB 5F1NB 2BCKA 1T7VA 5L6YH 4AIXA 3O11B 4M7KH 2EKJA 4POZC 3IJYA 3HR5A 1RZKC 2DQDL 4JR9H 3WLBA 1I8LC 3QQNA 4GMSH 3MGOB 3V5DB 2XA8H 1RAMA 1BVLB 2QHLA 5HVGB 4N0UA 4PJEB 3Q48A 3WS3B 3OJDA 3DVIA 4ZPTB 1HXYA 1IC7L 5IVOA 3QI9C 3RTQA 5HI5C 1OVZA 3D39E 25C8H 5GRUL 4JZOB 4DKEL 2X4PA 3ZKMD 4M6AA 4KK8D 3NIFE 1IGJA 3PHQA 3P40A 4OM1L 3GSXB 5DEGA 4XMKH 4DN3L 1HQ4A 3NGBB 4EUPH 4WO4A 2FEEI 4KI5F 4XNQB 4ODHL 4HH8A 4OKVB 2NY4D 2QQNH 1A4JA 4W6YB 4Y5YA 4U0RB 1DBAL 4OLYL 4EUPG 4FMKA 2VQTA 4WFFE 2VLRB 2HFEA 3WL9B 4H26A 4M8QB 4HAFA 5F1IB 3S98A 2Y5TB 5DRWB 1U95B 3R06A 4PJ8A 1Q9LA 1URLA 1JNHB 3UTTD 3VXRE 1CQKA 3SCMC 3T4AB 3HNVH 5FYKH 2OSLB 4KKLC 4GRWH 3RWCB 3GHBH 1IARB 3CCHB 2ADIB 1YNKL 1EZVX 1I3UA 5D2LE 3WFDH 5MERA 3QUXD 2B1HL 5EBLB 3D85B 4PB9H 5BS0B 4LGPB 5T3XL 2VL4A 3TM6A 2W9DH 2EE3A 3W39A 1F5WA 4GG6B 4ODUA 1D5ZB 2XZAL 4HJJH 4MA3B 4X7EC 4HC1L 1LE5A 4YO0A 5DI8A 3I6KA 1MLBA 2I25N 3P4MA 4WI7A 2BVEA 2NY7L 2K9UA 5KG9A 2VDOH 1RIUH 3MV7A 4TSBL 4QRSB 2ENYA 5F6IB 3L3IB 2X4OA 1QYGH 4YXKH 5EB9A 3RA7H 2X09A 3QUZA 1R0AL 1A6ZB 5DJZB 3HC4L 4MB5A 2D7OA 2VITA 4Z0XB 4YBQD 3K1KC 3WKML 4DW2H 3W5NA 2XKNA 5F9WC 3VU2A 1GZPB 5EIQA 5C2UB 3IVKA 3QIBA 2X4NA 3MJ8A 4MQXD 3AM8C 4AH2B 4LDLB 4JFFB 1CCZA 1NQBA 4KJQD 4KY1H 2VABB 4JQVC 4NWUH 3HZYB 3K1DA 1UZ6E 3V6OA 1ZA3A 2W9LA 2Q3ZA 2M2DA 4HFUH 3ZHKA 5I1KH 4LKXB 5DFTA 5T3XD 4HKXB 4PJDE 1FFQA 1K4CB 3BGFC 1Q9OA 5TDOA 2PO6B 3BQUA 4O9HH 2AXFA 4XPGH 1N7MH 1K8IB 5KJRH 1SEQH 1OLLA 3I50L 2UY7A 5IJVA 4UTAH 4MJIB 1FJ1A 3EYOA 4RIRB 3VFWB 4M62L 3V6OE 4ZNEA 1G0XA 1DL7L 1SJHB 4APQA 4ZSOA 4HPOH 2KH2B 2H9GA 4NQDD 5IMKA 2I9TB 1C12A 4ONFL 1HI6B 2ZOLA 5HYJD 1EEYB 1RJLB 3VI4E 5ITBH 3LAFA 1TQBC 5L88L 4X80L 4EEEA 5GGUB 1ZHKA 3IYLW 4TNVK 4M61A 1K3ZA 1KT2B 3SDCC 4RZCA 5E9DE 5J12C 4L4TA 4BQBA 3O0RL 3SDYL 3VGFA 5C3LD 1CFNB 1W72H 5DJ6A 1RZJC 1TTFA 4KJWD 3KPQA 2FWOB 1SJVA 3U36B 1KFAL 1U8JA 3ELAT 3DXAE 3PWUA 1JWMB 4TOYH 3UBXG 5F21B 2VH5L 5CJ5A 1MFBL 2CLZB 2XNAA 4YE4L 4WU5A 4FQCH 1RJYA 5GGTH 3VXSE 5KANI 3VGAC 1EEZB 5I1EL 4XVUD 3VWJD 2FX7H 1E0OB 4UIKL 5J7CC 2DKSA 4ZD3H 3UX9B 5GSRB 3DROA 2N7BA 2O5XH 4RGMC 5C86A 3O9WB 5F6HI 3E2HC 4CRPA 1FG2B 4BFBD 4WW2A 2YD1A 3BP4B 3KPRD 3H2WA 1A5FH 5JQ6L 3JV0A 1JPFB 2BVPA 4LLQB 5BVPL 1LILA 1UVQB 3MNVB 5HHVH 2YKLH 2QQQA 5HYSG 5I0ZA 5D96B 4Q6IB 2LQRA 4HF5H 5CGYD 1E4KC 3ZKMC 2GK2A 3B6SA 3MZTA 1RY7B 4R90L 4K3JL 4KK8C 3TIDB 2NLJB 2CO6B 1L0QA 4GAYB 3VXOB 1NLBH 1MJ8L 4PJAB 5HGGS 1KTRL 3W9EA 4X0KA 5DURD 5F3HB 4F9PC 1NAKH 2VWEE 4KZDL 2N1KA 1I9JL 1KN4H 2NY4C 4R2GD 5EG6C 1CXFA 4Q97A 4GMTL 1JMZA 3LRGA 5T3ZL 1T04A 4DEPB 1KCSH 4QY8A 2E6JA 3BO8A 3UZVB 5KSUB 2OQJB 4JDVB 4M5ZH 1MSPA 3NCBB 1IT9L 4UV7L 1NANI 1K3IA 2D7NA 1MCLA 1DQJA 3SDAB 5DJYA 5F1KC 3KLAB 4L29B 5GQBA 1FDLL 3MMEA 3FO0H 3MSPA 1P7QD 1JPGA 1FFPA 5EZIL 2NW3A 5IHUH 1IAIL 3GI8H 4JFOA 2B8OT 3O3AA 2HMID 5SWSE 4GRLB 4DN4L 1U8OA 1BEYH 4GS7B 1U8KA 3FL7A 1W0VA 4G43A 5E1HB 4CAGA 1N4XH 4EBQL 4L8CA 2X1OA 4PS4H 4IEFB 1QVOA 2BVUA 4AM0B 2J4WH 4OUUB 4L1HA 3ULVE 3HC3L 5K93A 5IR1B 4OD3L 3QUXC 2X1PA 4XZUB 1QLEL 3TV3L 1S7TB 4MA1B 4E5XB 3E0GA 2VDQH 1UG9A 3UZQA 3ARVA 2J6EH 2D3VA 2ZNWA 4G9FD 1ZHNA 1HYRC 1T1ZA 2O5YH 3IXAB 2R9HD 1ZLWK 4ZFZA 2G5BA 1MAJA 3WD5H 1X5HA 1O7VA 3LEYH 1RFDH 4OZGA 5D8JH 3TBWA 3CZFA 1WAAA 2R0ZH 3KXFE 1JNNH 3LHPL 5T3ZD 3VD9A 1TZHB 4FN0A 4KZEL 2BP3A 3TZVB 4MCZB 4OIBA 3RY5A 3S5LG 3T0ED 4LLMB 4PGEB 2EO1A 5JNYB 3OAYH 5EC1A 4P9MH 4TQEH 4QHNA 5GS2H 4YPJA 4YBQC 5ESQA 2HH0L 3OGCA 2YN3A 3ZLQC 4TTGA 1GGTA 5TDPA 4HV8B 1OCWH 2D4DA 5I1IH 1U8NA 2DTMH 2ITCA 2BNQA 5ADOH 2BSED 4O4YH 2CGRH 2DBLL 3FTGB 4GO6B 4LCIH 3CDYA 5GRJL 5C09B 3U6RA 5K9JH 1HYSD 4MNGA 1YQVH 5IGXL 4KJQC 4NM4H 1XF3A 5KS9E 3OF6A 5T5NG 4P3CH 3H9YA 5EZJB 1WUNT 3MRNA 3ARGA 5ANMB 3GMNA 5D7LD 4ZUVB 3DARA 1KTDA 4K2UL 5B21A 5FHBH 4ONGH 4N8CH 5C07D 2YC1A 1FL5B 5IFAL 5J6HB 1I85A 3NTCH 1S9KC 4U1NA 2OX5A 1T22B 1MY5A 2V2TA 2YXMA 5FO8A 2KPNA 4AL8L 3C2AH 2X7LA 4NC1C 3MR9A 1Z9OA 5D1XD 1JZ7A 4D3CL 1RPQA 3CFIC 3L3JA 2GTZB 4HBCL 4PG9A 1RZFL 3TYFA 5E08H 3UYPA 4ZUTA 3LY6A 3N1FC 1IQDA 1WBZB 4R96A 4QRQB 3A67H 2JCCF 5E2WH 2FEDD 4HULB 3UPAA 4Y2DB 4G8IB 2PYEB 3SKNB 1QRND 1JGUH 2FRGP 3RFZC 1E4JA 4XVSH 3SDXE 1AC6A 1DLHB 1BGXL 1A8JH 1RURL 1DUZA 3M1BA 4KMLB 5I76B 1YN6A 4KJWC 3Q5YA 4WY7H 2IH3B 3MREA 1BFSA 4O2EB 3MRGA 3GM8A 2ARJB 5DK0A 2P7TB 2VZ1A 3UO1H 1F3DJ 3IJSB 3ORJA 1E6JL 5SWZE 4EOWH 3VFGL 3OZ9L 1JL8A 5D71H 5KVDL 2O5ZL 4XVUC 3VWJC 4LCWE 2B2XL 4PJBB 3L3GB 1WWCA 4Y16D 4LLWA 1UQSA 1RZJH 3SO5A 3ARPA 3ARED 5BO1H 5D7IB 4PJ5D 4LMQI 3E8UH 2MKLC 1CL7L 5JMOC 3SKMA 1QLRA 4CU8A 4OF3A 4KDWA 3DX9A 3EW3B 1IFHH 1MHHB 1SYSB 3GMQB 2I5YH 2OTUA 2EO9A 5IVXA 3L7FB 2GI7A 3AB0C 5I9QB 1ZHLB 3DX8A 3HG1D 1SVZA 3PHOA 5CGYC 5B3JE 4X9FA 3R1GH 1HSBA 4MXVE 3BKJL 3GSOB 3UAJD 1M7DB 3WFHB 1QEWA 5IK3B 6FABL 3RWHA 5FM5O 4P5KA 2VZSA 4NKMB 2FIKB 5E2TH 4X4XA 2V7NA 3F5WB 4JQXA 4NQCB 5C0BA 5EU5B 5IVXE 1ZS8B 2JB5H 2G60L 1MCEA 3UPRB 4R2GC 1MNUH 3MYJB 2NY1B 5C0AD 1DBMH 4YHNB 5E4EC 2ESVB 4LVOC 3HNTH 3BEWB 5FIEA 4NSKB 4EQ3A 3JVGA 4NO2B 1UM5H 3IFLL 4JG1L 2UWEB 4ZDHA 4LHUG 1OQXA 1IGFL 3MLVH 4ONHB 1FLRL 3UCRA 1DN0A 1X5GA 2Y72A 4S1DD 2GTWB 1NGXB 2GT9A 2HKFL 3WMSA 1QBMH 2X10A 1AFVL