5BRZD

Mage-a3 reactive tcr in complex with mage-a3 in hla-a1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
197
structure length
197
Chain Sequence
AQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLYVRPYQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRPGGAGPFFVVFGKGTKLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
total genus 31
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5brzD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5brzD02
2AJUH 2H6PA 4DGIH 3LKPB 3MTRA 5GGQL 1GCFA 1OGAA 1RZGA 2W1NA 3OPZH 2J88L 5KVFH 2FB4H 2CUMA 1XAUA 1FNFA 3PWJB 4XPHH 5T1MA 5SWSB 4D0CA 1G6RL 4Q9BA 2A6JB 3GBLA 1CIUA 5E6ID 2P1YA 1A6WH 3MBXH 5K59F 1R0AH 4CMMB 5DRNA 4NC0B 1T0NA 4YEEA 5IMLB 2MQCA 2Z92B 1FLRL 4PJIA 3ZE2E 4Z76A 2CRYA 4MCZA 2ZPKH 5CGMA 5DTFB 5GS0L 5FK9B 3OKMA 5I1JH 4H25A 4RGNB 4WUUA 1JMXA 4X5WB 5JQ6H 3BH8A 3ZYIA 4M8QB 4WWKA 3VI4F 3V6OC 4L4VA 4YGVB 3FONA 5DR5L 4PV9B 1RUAL 5C8JB 1CIDA 4JRXD 4M4RA 3ULVC 3DLQR 5T3ZL 4H5SB 3SKNA 2PW2B 3O9WB 4XVUC 4P4RA 4UTBH 1NCCH 2AVGA 4KHXH 3FB7A 1A7BA 4XHJD 5IVXB 3FB7B 4NHCH 4OCSH 1SBSL 2PYFA 3GBNH 5DMGD 3TA3D 5D93C 5B4MC 2RFXA 1S9KC 3ROLA 1ITCA 3TVMA 4PJXB 4NT6A 3CVHB 3RFZC 1U8OA 4M48H 1RQ5A 4IBLT 4DCQA 4U6YA 5IESL 1GAFL 4MAUH 5DEZA 2MCPH 3MLWH 4QRPE 2D0GA 3O41A 3HI6H 2F5AL 5F6IB 4NQDB 1LEGB 5HDOA 3D85B 1VACB 4XWGH 2X7LA 3QQ9C 3OAZK 3DMMD 4K3JH 1Q9OA 4MQ7A 5JNYA 5ITBL 2AJUL 3E2HB 3MOQA 4JFPB 3IU4H 3MGTA 3LDBB 3F58L 3SKOB 4YHPA 4EN3D 3UX9B 4ERSH 1XCQA 2EH8H 3BMVA 5BOZG 4K3HA 4CMHC 3WO4C 1TQCC 4XMPH 4MD4B 5JMOC 3SDXB 5B38B 4MWFB 1L4IA 3D0VA 4HDIA 3QUZD 3L6FB 2ZCKH 5I73B 3LVEA 1D5ZB 4P99A 3SDDA 2X4OA 5SV4A 4MNQE 2GJ6A 4LCWD 3RNQA 4Y7MA 3DSFL 1T66D 5GISL 3C5ZA 2DYPB 2VXTH 3GJFH 4ZSOB 4X6FA 5IKCB 3IFPB 1KJ3L 4Y89A 3Q6GH 5DT1H 3D18B 2DLTA 2X4TA 3KYAA 2JCCE 2XN9E 4CVZB 2UZXB 3BZ4B 1NFDE 4XPTL 2DQTL 4QHUA 1WJ3A 4HJ0C 3AFLA 1VADA 5ADOH 1XR9B 1EVTC 1RZJH 1FYTD 4JO4H 4M9PA 1XF4B 2IANA 4RFEA 2APFA 1BX2B 3WHE0 4YDKH 4QEGA 1TFHA 5E00A 3HE6A 3UTSA 5TPWH 1G7QB 4CDHA 4LDOB 4NHCL 3QG7H 2WUBH 1KLFA 2ZP0T 4KVNL 2HVKB 4LNVA 2OTWA 4XRCB 1NC4D 4WW2F 1OTUD 4NNYB 4D8PB 3MREB 3V5HB 3BPCA 4GAYB 1KPRA 5J8OA 5GRJH 3EYUH 3E1F1 2EC9T 3RX8A 2HKHL 2ICWA 2D4DA 4PJDE 3D48R 1JGLH 3U0TB 4WCYL 3MLWL 3C08H 1UWEL 1E28B 2AQ2A 3FO9A 2HWZL 1HKFA 1EA9C 2R2BB 4PJBA 3J7HA 5C0CE 5B39A 1IEBB 4HWEL 5DJCA 3MV8D 5AYQA 4YNYA 4XP4H 4G6MH 1A6VH 3GJFK 2V2XB 3DYOA 4U0RC 1E0OB 3QJFA 4M9OA 4WEBH 5KSAA 3QISA 4GJTB 1R3LA 1S7VA 3WE6A 1E27A 3VFVB 4WEUD 3TWCH 2ZJSH 1S8DA 3EYSH 1F58H 1ZHNA 1RURH 1T83C 2OL3L 3DHMA 3OKEB 3RNKB 5FYKE 3CVHH 1UB6B 3AXLB 4NWUH 3W9EB 4QNPE 2OX5A 5L7XL 1Z5LB 1X5IA 4QLRA 1RUKL 2JELH 3QDGD 3BDBA 3QXDB 1U8PA 3RWEA 4PG2C 1YEGL 3S4SG 3DX9B 4IDJL 1YMHA 3BDYL 4GAFB 1XZ0A 2FBOJ 5GGTA 1EAPA 3KG5A 5T1MB 3ES6A 4PJIF 5IBLC 5CMAA 3DETC 3BH9B 2R15A 4DZBB 1ZMYA 4GXUN 3IDIB 4NBXB 3F6LA 3QJHB 1P4LB 2IFGA 2F15A 3BSZL 5MERB 2Q87A 3G08A 5BCAA 4MJIE 4KDVA 4WU5A 3VD5A 1NLDL 3CVIH 1BJMA 2BSED 1WZ1L 1KIQB 4U33A 1OWRM 3EOTL 3RPKA 3PGDB 4DOHB 3PL6B 3QG7L 1L7TH 3O81A 4G43A 5E7FA 5HDQH 1QNZH 4MJIB 4QXGL 2MKWA 2PTTA 5IK3A 1FFPB 2VLLB 3N9GH 3T1FA 2C4FT 5IK3B 3SGEI 5GRJL 1YN7A 2VIRB 2FD6H 3F7RA 2FJGB 2R0WH 1S7WA 2BNQB 1NL0L 1YEDA 3GHBH 5L0QB 1FHGA 1IFHH 3QQ9D 4OZIF 4WHTA 1YEKH 4P5TD 2RCSL 3TP4A 5HHXH 1IGCH 4DEPB 1U0QA 2C3GA 2NW3A 1J9CT 4PUBL 4FS0A 4ZAKD 4M7LH 1PX4A 3QHFH 3VGHA 1NAML 1FFOA 3FO2A 1HILB 4KI5D 3MXWH 2M1KA 4P2RA 2Q86A 1V3KA 4OFYA 5CP7A 1IL1A 1UFUA 4JPIB 3QFDB 4RZCA 3NACL 2VLJA 5C0JA 4OZIB 1WAAE 2DDQH 3CK0H 5IMMA 4R8WH 2AEQL 5IB2A 3U6RA 1UWGL 4UT6L 4EJ1C 4KRLB 3MRCB 4ZUVB 4P5MB 1KLGA 2J6EL 4KXZH 5DA4A 3ZZ1A 1HCFX 4HZAA 5IF0A 4EN3C 1UA6L 4PB0H 2NY1C 5D5MA 2DBJA 1FL5A 1CXFA 4JPVH 1FCCA 1UCBL 4ISVB 5KJRH 4KKLC 1HHIA 4PJCF 1TZGH 3AY4C 2YD5A 3PIQB 3GSRB 4U1MB 3TBYB 5EA0L 3TO2A 2HJLA 5I19L 1AI1H 3THML 3G6JF 1XF3B 4K9EL 3WDHA 1T20B 1I3GL 1FYTA 2R2EA 4L3AA 4GLRI 3GBNL 4UU9B 2E6PA 1G7JA 2CLZA 3HLAB 4TVSa 4X4XA 3MRFA 2IALB 3VRLF 3VG9B 2F54E 2BVOA 3UJJH 2I9LB 4NFBA 1EXUA 4NGHH 5IB5A 4X4XB 1Q9OB 5IM7B 3WMSA 2HFTA 2W60B 4P2QE 1A9EB 1ZGLP 3GSQA 4MVBD 5IG7A 2EC9U 3HE6B 5J6HA 1WFNA 5CILL 2Z8SA 4JQVA 4GLRH 3O8XA 1CZ8H 3T2QA 5BQ7A 5AUMA 4HSQA 2NXYC 1G9MH 2PXYB 2VUYA 4LHJB 4BKLB 2NY4D 4U1SB 2BVQB 3P11L 1RV6X 4NYLB 1YEJH 4CVXA 3CFBB 3P4MB 3JTTA 1NAKL 3LKQA 1N7MH 2X70A 35C8H 2HJKA 4X9FA 3B2VH 5D7SH 1DBKL 1AD0B 2Q1EA 4OLEA 3U1SL 5BS0B 3SKNB 1NCBH 2WBJD 4QOKA 2VZTA 2RBLA 3IJSB 3QPQD 1A7QH 4BZ1L 1EGJH 4OM1L 2HT2D 3G6AA 4WW1B 1CL7L 3KJ4C 1MQKH 1NGWA 2PXYC 2Y9RT 3MV7D 4JPIA 1YNTB 2AJXL 4RRPG 2BCKB 1MVFA 5FYKU 3MJGX 1HHJA 4KHTL 5FOBB 4MA7L 4Y4HD 3AS2A 5DTFA 1QACA 3WYRA 2FJGA 2HP4A 2EYSB 4LLYA 4U6TA 1MJUL 2NYYD 3BP7A 1FAKT 4O9HL 4W6XB 2NLJA 5IWLC 2E9IA 1H3VA 4JFDE 1S5IH 3PGFL 3SEPA 1GOGA 1KCUH 2CK2A 3BPNC 4TOYH 1KPVB 1JTTA 1S3KL 5HVWA 5F88A 1ZHLB 4PRHE 5ISZA 4HFUH 3DX7B 4NZTL 1FL3B 3W2DL 3RY6C 4O4YL 4HC1L 1R3KA 1YN6A 3QH3B 4JFZL 2O26U 3TPUA 2BVOB 4NNXB 4WI5A 2A83A 1PSKL 1P4LA 1CVRA 4XNUL 4PLNC 5I71B 3RZCD 1QLRB 3HA0A 3IKCA 3PL6A 4HG4J 4J8RB 4W70A 1EEQA 1KXTB 3K7UA 1XF3A 3D25A 5J6GA 2ITDB 5DFVD 3MV7E 4WU5B 9CGTA 2NQCA 5CSGA 1L6XA 4X5LA 2LVCA 3QIWD 5K33A 1TJIL 1S7TB 2HJFA 1FFPA 3T1FB 2HLAB 2Z93A 1QP1A 3MV7B 3E6HA 3FQXB 2AK1H 3OKDB 1AGEA 2X4RA 4APQC 4G8IA 1JL8A 4L3ED 3DURB 3HZMB 1P2CB 1SYSA 5HD8C 3MLYH 2VQTA 4YWGL 2FLBT 2MHAA 4JRYE 5I8EA 1N5AA 4PJ7E 4HQQL 4YR6B 4APQA 5E2VL 4NQXA 1OAYH 3U4AA 3O4LD 1OM3H 2A77L 3QFDA 2ZOLB 4P2OB 1I8LA 5BMFH 4G8EA 4DEPC 4FOMA 2Y07H 2YC1B 2IBZY 5FYJD 2VDLH 4PRIE 1G7IA 3H6JA 1MFBH 2ZOLA 4P2OA 4OUUB 3KPLB 3ISWA 3BKML 4IEFB 2IPKB 3HRZB 4LSDA 3JXAA 2BNUA 3VWJB 2C4XA 4O9HH 1U8IB 1U8KA 4ZYKB 3EHBC 3K1DA 4OCYH 3A6OA 4OQTL 4NJ9L 1OPGL 2WBJA 1S7QB 3RY5A 1NCCL 3X12B 3QEQE 1YYLH 4M7ZB 1A3QA 2UVEA 1SBSH 4NQDE 3SDDC 3PL6C 4U1HA 3G5VA 1R3LB 5ISZE 3P9MA 4UDTB 1D9KD 5B21A 4NKMB 4LIQL 3UJIH 1CE1L 3TPUB 3KLDA 2XN9D 4DKEL 5SWZD 1N3NB 5IW6A 1WC7A 1MY5A 2YA0A 1KUMA 5ISZB 3K8MA 1J0IA 1WBXA 4HIJA 2OMNA 3WIHL 1NJ9B 2P47B 1EEZA 4KTEH 4JKPH 3O9WD 5GRVL 3ZMRA 2DWDA 3WN5C 1ROWA 4OD2A 4K3JL 3X17A 1OB1B 4HT1H 5MERA 3EDDA 4YFDB 2NY0B 3PE9A 1IGMH 3PP4H 5H2BA 5I76A 1XR9A 3SGEH 5CZXC 3QULB 4YH6A 2M8XA 1I1CA 3BVNB 2AXGB 2EDDA 1KNOA 3S37X 3ULUF 4QRTA 2P8MA 5F1SA 8FABA 3UC0H 4G6AC 3HI5H 1IC4H 2EO1A 4U05A 1MCCA 3GMMA 5DMKB 1BM3H 3LEVL 3TVMC 5I6XC 2PKDA 3SCMB 4MNHA 4TULH 4NQDD 4M8VA 4DK3A 1IAIL 3T4YA 1NEZB 5GJSL 1ED3A 4QXUH 3PQYB 3HZVA 3MUJA 1EH9A 1WFUA 2P45B 3OHXA 1I1AC 1EPFA 5HYEA 4HUVA 2X70B 3WO3B 4G9DB 4UT9H 5K93A 3P4MA 4OF7A 2QSCL 4BSWB 1J8HE 1QSEE 2A9MH 3MLZL 3S98A 5IQ9A 5E5UB 3QIUD 2XN9B 4PJHF 1T0MB 5LKNA 3KXFD 1IGYA 2D0HA 2CDEB 3ZHKA 5A3ID 2MFNA 1N6UA 2EE6A 3HS0A 5H94B 2H9GA 4JDTL 5F96H 4YAQB 2IWGA 3I50H 4F7EB 2VLKD 4CAGA 5I2IB 1YC8A 2YD4A 4M5YL 1G9NH 3TFKD 2AQ1A 3SDAA 4OIAA 1QEWB 3MREA 1M1SA 1RUMH 1F13A 1CT8A 1WBYA 4DKEH 2VRAA 3GSUB 2X4NA 1F97A 3O2VH 4FMKA 4HLJA 1S9XB 2XA3A 5T1DL 43C9B 5F8RC 1UZ6F 1IGFH 4I18A 4JFYA 3NH7H 4N0RA 1BFVH 1CZ8L 4OB5H 4G42A 5B4MD 2NY0C 4Z7QF 2HJLB 4FQXB 3WN5B 1HHHA 4DKFL 2WANA 3PQYD 2R4RH 3C2AH 1RJZB 1Y0LB 5IEKB 2BSTB 3ULVD 1NBQA 1RUQH 4WO4A 3NCMA 3DO7A 4RMRA 35C8L 5HPMA 1UENA 3RDTA 4L9LA 3RY4A 3BKCH 4HPOH 1A02N 3OAUH 5JXAH 1UH4A 1AHWA 1QTYT 4HS3B 3WD5L 3K4AA 2JELL 4Y5VA 3OF6A 5GJSH 4HFWA 1T21B 1IGTB 1FCGA 2VDML 1BMGA 3P4NB 4M7ZC 3TZVD 1KTDB 4MD4A 3NPSC 3TN0D 5LGKA 2ZUTA 1UT9A 3VH8G 1U8LA 2FO4B 1UXSB 4DOHE 4XNMA 1RU9H 1IAMA 5F6IC 5GIRB 2C7UB 1PKQA 5K9JL 4NQXB 1RZGB 1IC5H 1XIWB 1MCLA 2R0LL 2KL6A 4XXDA 1FVDB 3HPLB 2PR4H 3DUSB 2I07A 5I0DA 5MEOB 4Z7VF 4L3EE 2KUTA 3CVIL 3BHBA 2E7HA 3C09B 4Y4KB 4KKAD 5DRWB 4DVRH 4J3TA 3HAEG 5D93B 4JFOB 3K2MC 4M62L 4MB5A 4UV4H 4XT1C 4K3DL 4D0BB 5LXGH 3O9WC 3AB0B 3O2DH 4YX2H 2R0ZH 4WEMB 5IFHL 3L5WA 3MV9E 4JM2B 4XH2A 1SVCP 2P48B 2VL5A 1QLFA 1AY1L 1MFEH 5D7IF 4POZD 4JRXE 4X4ME 4LU5L 2FIKB 4FTVD 2VITA 2YEZB 1R3HA 3QQ3B 1KENH 1IGFL 1J1PH 5GSVA 4CW1B 1QLFB 1ORSB 3HG1A 3RI5F 4TYUA 4XGZA 5FGCB 3QPXH 4XTRC 3RIAF 3H3KA 1BQHB 5I30H 4P4KB 2GSGA 3V79C 4PJBF 2PTTB 4OFYD 2Z31D 2NMSA 1EEZB 5J13B 1F11A 4LNRA 3S7GA 5B3JF 4HIJB 3ARED 1I8KA 2BNRE 3RL1A 4ZG1A 3IDYB 4GKNA 2JJTA 4XP9L 2ZCLL 2WQ8A 3FFCB 1ZXQA 4FHBD 1G9NC 3MLVH 4LBEB 2J2ZA 4R8WL 1XGPA 4ZO7A 5JHDB 3MRPB 4N8CH 4M7JH 1V7NL 4NKOA 3VXUE 4DKDC 3KPPA 1Z6JT 1IM9B 2GJ6D 5BMFL 1KCSL 1A7RL 5GGRB 1E4JA 2AGJH 2BHYA 3VFVA 3QEHA 3OR7B 2HFGH 1A3RH 1JRHH 5C08A 5FUOH 1IGTA 4UV7H 4YNYB 4F9PA 1HKLL 5LBSH 4P2QA 3MLTB 4LCWA 4WY7H 4TUOA 5HYQA 2OR9H 1T22A 4MNQA 3MRLA 3MRHB 1KIPB 2VKWA 4LSUL 2BK8A 3KJ4B 1KELL 4W81A 5DEFB 1HH9B 5JIIA 1AE6L 5ESVA 3OWEA 1G0DA 3RZCB 3LB6C 4FQIL 4K3DH 4YXHL 1KPRB 4N0YL 3O2DL 4AEEA 1MCIA 1D5XA 1JZ4A 5FGRA 3GSNL 1PKOA 4I0PB 1LEIB 1DQJB 4ODSL 4LVOC 4X80L 1GXEA 5KS9E 3WIHH 2QKIB 4F15C 3O0RL 1UWEH 4XPBH 3LQAC 4KK6C 5DZNA 1C16B 3R06A 4ORGB 4PRDA 4RFEB 3IKCB 4PJIE 4CN6A 2P24A 3LH2L 1MRFH 3GSXA 3WUWA 1V5JA 2I9TB 1XF5B 5BRZE 1QPXA 1OY3B 4TNWK 4ZUWA 1BLNB 1EK3A 3CSYA 2R0KH 2YHGA 2FIKA 3H3PL 4HJ0D 5D70L 3VI3E 1VKXA 3CU7A 3OKYA 3VMPA 1BM3L 5CEZE 4KJYB 4S10A 2R2HA 5DD5L 1XH3B 2ED8A 4U2ZA 1QLEL 2I5YL 3VG9C 3ZKND 3VD4A 5DS8A 1LILA 5KANI 4L1DA 5GS0D 5FXCH 3BFOA 1UH3A 2A74A 3T0EE 5CEZL 3MC0A 1N4XL 1X4ZA 1G6RB 3VFOB 1P4BL 5TF1H 3GMNA 5HPMB 2X42A 4LSTH 4XVJH 1NBZA 4UT9L 5HYFA 5C0BA 4Y19E 2QV2A 2A9ML 3MLZH 4P57A 3QUZC 3EJYD 3GHEL 5EBWB 5C08E 2AJZA 2XY2A 4HH8A 5ID0B 2XQYK 2A6IA 3BSZH 5JNYB 2YD9A 4CUCA 3PUCA 1A6TA 3SCMA 4JDTH 5F96L 3QEGL 5TE6L 4EN3B 3P9WB 2VQ1A 1T7VA 1AP2B 2VXSL 2VO5A 5AYUH 5FO7A 5JDSA 1A14H 2P5EB 3MRKB 4GSDH 3BN9D 1IQWH 4KZDH 2HT4C 1KTDA 3ILQD 5GQBA 4C83A 1P84K 3GKZA 3CZFB 5EBMA 3SGKA 1A9BA 3NZHH 3MGTB 4LKXB 3HPJA 4ONFH 4QWWD 2VSDA 1OGAE 3GGWB 2YXFA 4O00A 5DF0A 1CGWA 4C54A 2VJXA 4OCRL 4QGTA 5I1IH 1F6FB 3LKOA 1DBJH 2F74A 4XMLL 1NSNH 3MJ9H 3GBML 3VE0B 3PXHA 4LQFH 4JG1H 2FGWH 3HC0B 4TTDC 3VRJA 3TBYA 4JRYB 3TO2B 4E41E 4Q9RH 5MENE 3GNMH 1KTKE 4R26H 4Y5YA 3REVB 1G7PA 2XZQH 3W0WA 3WNPA 2FEEL 3F7QA 4S1DC 5EFIA 5L0QC 2R9HD 3PWPE 5F9JB 3CSBA 1CK0H 1FL6B 3FMGH 2Q7YA 4TVPL 3T2PA 5D70H 3OZ9L 2GITB 3OKMB 5KANG 2X4NB 3MJ8A 2EKJA 3PHOB 3IJYA 1ZVSB 4YWGH 1BF2A 2I9LA 1NCUA 1JZ6A 1YQVL 1BPVA 4HQQH 5TE7L 3IAGC 3IF1B 2AV7A 3B83A 2GEEA 4BYHA 4FZEL 5MI0B 4EI5B 4QXWA 1Q9WB 4UQ3B 1BQSA 2WIMA 4AH2B 5EBLB 4NHUB 2NXZD 1IT9L 5E24E 4JO1H 4P9HH 4N8VB 4KU1A 4LSSH 4S1QH 1P9MA 4TQEL 1FNGA 4O51A 1VESA 1JPTL 4KROC 4N90D 4PJDA 5DC4B 4ZQKB 3WS6A 1QPPA 5TGBA 1NFDF 4BSWA 2DWDB 4OGAD 3IXTA 5DJXB 3MNWB 1IL1B 2A6KA 2LTQC 3EFDH 1BD2A 2MMXA 5TQ0H 2FJHB 1JF6A 4ZTPL 5TF0A 5BV7H 3OGCA 4RRPA 3FO2B 2PO6D 2R1WB 4X6EA 4P5TC 4Q97A 4OKDA 1CE1H 4GG8A 5CKGA 3HC4L 4XPGL 4ODTH 4E5XA 4XGZB 5CZXD 4RFOH 3FN0L 3KPSD 2ID5A 4U31A 1U9KA 1WZMA 2OR8A 2I60L 4FQXD 4TRPH 4JHWH 5LJYH 3QDGE 3MBED 4PJFB 5ESAA 1OGTA 4JM4H 5D6CA 3W39B 1WTGT 3MA7A 3PV6B 2Q3ZA 4KPHL 2CMRL 5FKAB 2OM5A 4QXTA 2ESVD 3CSGA 5ENWB 3EIFA 2CRIA 1RUPH 2GI7A 1OSPL 1MHHB 2F54D 1ZS8B 4QF1B 2V7HB 1EAPB 1ZHLA 3FMGL 2FBJL 1T89A 5EWIL 1ZTXL 3TCXA 5FYLE 4RX4D 4QT5B 1QUNA 4G8GB 3QZWG 4F7MB 4PD4J 1A7QL 3INUH 3MZGB 2DQCH 4PJ5D 4X7EC 25C8H 2Y6SC 1S9VA 4Y8DC 3FZUD 3JUZA 5CGYD 4OCWH 1J0KA 1YEGH 1S9YA 5KVGH 4N5ED 2X4QB 1U6AL 4X7TA 3BDYH 1LNUA 3HR5A 3VXPA 3PQYE 1HHJB 5DWUL 4NM8L 5GZOD 3AUVA 4KWUA 2YWYA 3U82B 2NX5E 2XZCL 1INQB 3IF1A 4FXGB 4AT6B 4BUGA 5LQBH 2O61A 3HAEH 5JO5B 1UEMA 3NFNB 5I8KL 2DQGH 1SJXA 3CLEL 3ECBB 3FL7A 1BGXL 4JFQA 3PHQB 2CKNA 4AH2A 3QCUH 3QHZH 2F9BT 3Q48A 4QYOB 3MRMB 1EUTA 1YC7A 1MAJA 2C1OA 5JHDA 5TGBB 1N5AB 2A83B 3HZYB 4Q6IA 1YEEL 2FO1A 1KCRH 3GMQB 3KS0J 5MHSD 4HMDA 5IV2B 2E7BA 1PJ9A 3MA9L 3S88L 2W0KA 4X98A 4DWHA 5L2KA 1TQCB 2R2BA 4NN6C 4PJBB 2RJMA 5TDPA 3BO8B 5I17B 2DTMH 2Y4SA 4NQDA 1F3JB 3UBXI 5T1DH 1GC1L 5E2JA 3LN4A 4ELMF 4HUXB 5JZ7C 1F4HA 2Z35B 3FOMA 3VFNA 2ARJQ 4JM4L 4QTIL 4F9LA 4AEIH 4F33A 1UQSA 1KG0A 5CSZA 1MIML 3OR6B 1MCRA 1UCTA 3PWUA 1NGPH 1IEHA 3GSOB 3VXQB 5INCB 4NZUL 3U2SA 3H3BC 3Q1SL 3TN0A 3GB7A 4JLRB 4QY8A 3BISA 1ZTXH 1U95A 1S7RA 3W82A 1GHFH 4MJ4A 5BXFB 4S0SD 3D2UA 5HSFA 4FTVE 5A2IH 4YHZH 4OSUH 2FX7L 4D9RE 4NZRH 1DQLH 2GJ6B 4WFFD 1UWGH 4UT6H 2DMCA 1KGCE 1IBGL 4MQXC 2VXTL 4NQEE 1QHPA 1OM3L 4P3WA 4NZDA 4FTVB 2F74B 1NMBL 1GC1C 1CU4H 4FP8H 1ZA3A 3HAEB 3F7VA 1IMHC 2VDNH 3DO3A 3V0AC 3B9KC 4NM4L 1IE5A 1MVUA 2V17L 4OLXH 4P4KD 5HYJE 1FV1A 1KIUA 4Q6IC 3O8XB 2UYLA 3GJFB 5IG7B 1K6QH 4LLVB 4OZ4A 3TZVB 4X0KB 4PRAB 4GSDL 3V95A 1J1OH 5DUML 2X41A 4F57H 2NTFB 1MCPL 4I9WE 3FFCD 2ATPA 1QR4A 3QIUA 4LHUD 5DRZB 4NNPH 3UBXG 2D0FA 4GRWF 2ZNXA 3EJZC 3L3DB 1CDUA 4QRQB 2WINA 3MA9H 4LSQL 3S88H 4LCUB 4N0CC 5C2BH 5HI5C 5D72L 2L7UA 4JDVA 4WHYG 1T1YA 1KN2H 1IAOB 1XR8B 3RTQD 5F72S 4YJZL 4MNQD 1TENA 2GCYA 1Q38A 4KTEL 4GMSH 2G5RA 1AJ7L 1MELA 3WHXA 3S9DB 3KPSA 1NFKA 4PJDF 3QEQA 3FRUB 4TPRL 3BEWA 4HWEH 2FRGP 5HI4D 3MJ6A 4R4NC 3QUYB 4Y1AE 5C0NC 2CDGB 2EDEA 3P9MB 5DURB 3TEUA 4PG9B 3WCYA 1MAML 3MCKB 1UG9A 3GB7B 3VGBA 5CHNA 3PWNA 3QUXB 5DHVA 2VNCA 4YHYB 5IR1B 1GZQB 2NXZC 3PWUB 3IU3A 1IAIH 5FM5M 3KPQB 4HKXB 1UQSB 4JFDD 4YHML 3UJTH 1U3HA 5C0CA 4ZXBD 2H45A 2JIXD 2EEDA 1QA9A 4KKLD 1FO0L 4XCCL 4KHTH 3S36H 3WFDL 2VZSA 3QHTC 1ETZB 2X1XR 4LHUB 3RGVA 3Q5YA 2Y1VA 1E6JH 1VCAA 5D1QD 4NJAL 5E94B 3RGHA 1A7NL 4IRZH 4ENED 1MF2H 3S5LG 1QRNA 1EX0A 1JNHB 4X5XB 3H9ZA 1EEYA 1OQXA 2NY3C 3N06B 4FQLL 3KPRE 4L9DA 1FZKB 4YDVB 5EU6B 3UTZB 4CMMA 4UTBL 2X9YA 1UXWA 4E0RB 1BREA 1S8DB 5BZDB 3BESR 3ZDZE 5I16B 3PGCB 3LRGA 2YPKB 5IWLA 1LD9A 4U1JA 3OKLA 1K4DB 5FUZH 1YNKH 1IILE 2X10A 4GFTB 5C6PB 3RX5A 1KTLA 3LPFA 4PJIB 4UNTA 5EZJB 1WWBX 4K7PY 1S7TA 4ZNEE 3K81A 4HUKB 1MCHA 2XZZA 4U1GC 3BOVA 3EFFA 4X6BA 3MUGB 3P4OB 2XPGA 1D5IL 2EDXA 5DA0B 3U9UA 2W9LA 4JQIL 4PJEE 4L4JA 3FT3A 4N5UA 2I60H 1K2DA 3G6DH 1WIUA 2KZ1B 1MHHA 4BQBA 2W07A 3EYQD 5HYJA 1HQRA 4XWOC 5HHQA 5ITBH 4D94A 4R97C 3MOAH 2BSRA 5IHZB 2BSRB 3RWJB 5ICYB 4GAYA 1KJ2H 3GSXB 1EHLL 1T3FB 4PJAE 3O3UN 3DPBA 1OSPH 3BP6A 2P7TA 2AK4B 4JRWA 4Y16C 2Q8AH 4D0DB 5BRZB 3L1OL 5CD3A 3OKKA 3BKCL 4UUJB 2LE9A 4F58L 4C56B 1J0ZA 5ACMA 3C6LC 3DRQA 3EO9H 2EIDA 1ORQB 1RD6A 4N1HB 3TVMD 4YHMH 4LGSB 1UACL 3G5VB 2BERA 4M6OH 4J4PC 1GZPA 5GS0C 4R0LA 2C3VB 2FO4A 2FECL 4GW1B 3MRHA 1BZ9A 1RFDH 4JZJA 5DSCB 4LEOA 1RU9L 1MFBL 5DO2C 3EO0A 4FFYH 2FCBA 4QCIB 4Y4FC 1E6JL 3ARTA 3DVGB 4XC1H 3T65A 1QFWH 1JNHA 1MWAH 4JO2L 2DJ4A 4OCYL 3LEYH 2WBWB 2XTJE 1ONQA 3SE4C 5C3LD 5I1HL 1OPGH 2VXSH 3QEHB 5E2WL 1YMME 4Y4FA 4YHLH 5HGHA 2DLIA 4LLAA 3S37H 2GAZB 3GK8H 4DVRL 5L6YL 2A6KB 2W59A 5B3JE 4D9RD 5JORB 4MLIA 1T2QL 5JUEL 3SKOA 4AG4H 4IOIA 4DTGL 1M05B 4H0GA 5F7UA 1IAKA 3SDCD 4ONFL 2DMKA 4AL8H 3BRGC 4I4WA 2D2OA 1J10A 3PWNB 4C59B 4IHOA 4IRSB 5T33L 1UXSA 2AEPL 4F3FA 4S1SL 1P9MC 3SE8L 3RIFK 3TGXA 1AGEB 2X4RB 5EIVA 5J89A 3VH8B 5C9JA 1VFOA 4WHDA 4Z0XB 1OP5K 3ROOA 1KN4H 4GKOA 3VXMB 1A5FH 2Z93B 5F6HJ 4BK5A 4BQ8A 3L3HB 2B4CC 2YZ1A 3I6LD 2ADIB 4JRYA 3FB6A 5F1NA 3CPLA 3LKRA 5CZKA 3HG1D 5MENA 1QO3A 5KSUB 4RCAA 4PRIB 1FVCA 1CF8L 2Q8AL 4Y4HB 3VXME 2IEPA 4Y88A 1J8HA 1QSEA 2K7PA 4GMTH 1X7QA 2DIAA 4YK4C 3UDWC 1NC2B 1DBKH 4BM7A 3OZ9H 1NC2A 1ND0A 3OJDB 5IKCA 4MNGA 4M93C 1TETL 4Y4HA 5I66A 1B9ZA 4EUPG 4HGWB 3TIEA 4QRUB 2BY0A 1HOCA 5B39G 2CDEA 3T8XB 4PGEB 3AMKA 3QCTH 5LGHL 1C1EH 1ZEAL 1V7NH 3QEQB 4ONGL 3KPSB 4LHQB 5DHVH 3D6GA 4RAVB 1U58B 4QRRD 2EE9A 2VISA 1H5BC 2SEBA 1MCBA 1S9XA 1KT2A 4B50A 1OWWA 5EIIA 2B4CL 2CO7B 5HTSA 3PDOB 5I1GL 5DD1H 3SDCB 3MMEB 3BKJL 4XI5C 4B41A 1TQBC 1OTTC 4JFXB 5EBMB 5EIIB 3TBTA 3MV8E 4UTAH 3V6FA 1HH6B 4F7TA 3KDMA 1I9IL 5KSAD 4ALAH 2GAZA 4K07A 3NBNA 1IZKA 4N0UE 5DQDL 1T6WA 5GRWA 2VLRD 1T2QH 1ZVYA 3UTPD 1N59B 5HDQL 1FFOB 3MV8B 3RNQB 1MCOL 4PYHA 4ZOCA 3QULA 4JCLA 1TNNA 4DAGL 3U0WL 4HS3A 3LCYA 4IJ3C 4CNIB 1YPZF 4X6DE 1OD7A 1U93B 4I5BA 2YK1L 4MAUL 5FF6B 1BIHA 5GGVL 3BPOC 1JHLL 3F6IA 5AEAA 5CINH 4LRIC 1KNOB 4OB5L 3SJVB 1MFNA 1MRDH 4NQUA 3QDGB 4GRWH 2I9TA 3D39B 1TJHL 3HMXH 1TJIH 4Z8FH 3D3VB 1RULL 3ZDXF 1UKQA 4WENB 4L4VB 1YEFH 4J3SA 5J9PA 3SJVE 2QQNH 4O2FB 3GSQB 1PZUB 1QKZH 4F3FB 4OI8A 3GMRB 5ETUB 1BZQK 3VXNA 2ZSWB 5KSBB 1B0WA 2IADA 1JGUH 5KS9A 4DUXA 4U4BA 4FNLH 5GS2H 4YDJA 1D5XB 4I18C 1XGRA 3T8XA 3HZYA 2W38A 5IEHA 3GMPA 1MHCB 2N7BA 1CGSH 3DSFH 2VDMH 2P5WE 3IDIA 3WXVL 4ZFOL 3MRMA 1N4XH 4MNGB 4MA8L 2BY1A 5H8DA 1F3JA 3A67H 3RA7H 5I74C 4PPTA 3WFDH 5ITFB 1UJ3A 4MAYB 5J11C 5AG8A 5TFSH 5DQ9A 3L95A 4NO5B 1L6ZA 4M3JA 4I0PA 1WBZA 1M7IA 2FATH 1AKJA 1SYVB 1QFOA 2OJZH 3IFOA 4NFCA 5E08H 3ARGC 3UTSD 3UTTA 3JVGA 5F7HA 1Z9MA 2HN7B 5GGTH 2WP3O 1A7PH 1UADC 5T1KD 1FO0B 2FL5A 1ZHNB 2CLVA 5KVMC 5TPWL 4G8IB 5IFJB 1WAAA 4KQ4L 4R0LB 2NY0D 4U3XA 5HI4C 1CLCA 2W92A 5E8OB 3C6SA 3ARFB 1HHKB 4G9FA 3PNWB 3G5XB 1HYSD 4ZFFB 2PF6A 1YEEH 5T3XD 1F4WH 1JNNH 5IBTH 3V52L 1A1OB 1R5IB 4Z7WE 3T2NH 5LVEA 3ZYZA 3DBXA 1E6OH 1YMMA 2VN4A 2OSLB 3WL9A 2VZOA 4WIQA 5GGVH 4HF5H 2I26N 1I8IB 2ADFL 3QBTB 4R4BB 5DJAB 4NRZA 4M5ZL 3MRDB 4NO0A 5EO9A 4NKOB 3VXSA 4Z7NE 4A6YB 3TYFA 1T6VN 1G0YR 4KUZH 1FNEA 3LRHA 1QFHA 5T1LD 4DQOL 1T4KB 5KVFL 5DJ8B 5H37H 4FG6C 1CQYA 4OIIL 5FV1L 3FQNA 3X3GH 4Z0BH 3QNYB 4P23B 3RAJH 1JTOA 4TULL 3VFRB 3VW3L 4OTXL 5IHUH 3D39A 5TE7H 5DUPH 1KJVA 1Q1JL 4KK9D 4R6UA 3DUUB 5HYJB 3T3ME 5T3XE 4M6OL 4JPKH 5GS0H 1A7OL 4PJ8A 1KCSH 5F7FA 1HQ4A 4S11A 1OQOA 2P43B 4WI2A 5JA9A 5I18H 5IBLD 5DLML 2VDQL 2H2PD 2XZAL 2H3NA 3I6LE 4JM2A 4TQEH 2FATL 5HGDB 4GRMA 4CNIA 2EDJA 4NM4H 5D96B 2AI0L 4WW2B 5FHBL 1CFSB 2LU7A 4JANB 4OUUA 3ULVL 3A6BL 4K3GA 3RGVB 1OAUH 4DUVA 4KY1H 3S37L 4YHLL 5CAYB 4KHXL 1E4XH 2IPUK 5L8KB 4TOYL 5BZDA 5I16A 3B9KA 1DVFB 1SEQL 1FZKA 1P1ZB 4YDVA 1ZWIB 5F9OH 2NY4B 1RZKH 1MVUB 1KBGL 4EDWH 4HEPG 7FABL 1ZT7B 3O6LH 1FNSH 1UB6A 1MIEH 4LOUC 1DTUA 4AQ1B 1HINL 4OZFB 1CVSC 1K4CB 4A6YH 2H2SD 1PY4A 4KJPD 1G0XA 1A6ZA 3BQUD 5JHDE 5BW7C 2HFFB 5AAMA 4XBEL 3NCJH 1OAXH 1UVQA 3MRQB 2VWEE 4K3EL 3T0AA 2B1AH 4ZOAA 4LLUA 2XQBL 5FEBA 5IB3A 3E8UL 1QSFE 3UAJD 3DJ9A 4BA8A 3AAZA 5ITFA 4KXZI 4UU9A 2PYFB 1MHEB 1F4XL 5F21B 3ORJA 3SPVB 1MCWW 3ARUA 3VFSB 1LO5A 4WJ5B 2EDKA 5KOVC 4WO4B 3ZL4H 3UTQB 2O5YL 2MOVA 4FQ2L 2YPLD 5EU3A 1RZKC 2G9HA 3JV4A 5HYSA 4LGPB 3WFEL 3FT2A 4KRPC 5K59E 3MFGB 3BUYA 2ZNWA 4WI3A 4F33B 2R1YB 4UAOB 4OV5A 1Y18A 4XCYB 3ARPA 3I3BA 2LABA 4X99B 3DXAA 3MR9B 3B5GA 3FFDB 3MRKA 4M1DH 2DLFH 4U2YA 5E4EB 1AP2A 4N9GB 3STZB 2IMNA 2CIIB 2DQFB 4P46B 4EXPX 2B4CH 4P49A 4H88H 5LQBL 5H37G 1BZ7A 4U1MA 4I13B 4Z7UB 1U8MB 5JOPD 5KS9F 12E8H 3IDMB 3CZFA 3LAFA 3V4UH 1FQ9C 4XCFL 4YDKL 2X4TB 3KVQA 1ZA3B 3HAEA 1M7DA 1AGDB 4FFZL 4XTRD 1E4XL 1T20A 1QSFD 1E4WL 1SJVA 2CKBB 4LMQI 3VXTA 4Z7UE 4RGND 3KWWB 4MSWA 1TPXB 4NOBA 15C8L 1B0RA 4PGJA 2OI9C 4GS7B 4LP5A 3SHSA 5LXGL 3EYOA 3NZHL 3EYOB 4BH8B 2NX5D 5D7LE 1KFAL 3HI1A 3KWWA 1ZLWK 3VD9A 4JY5H 1MIEL 1BVKA 4X8XA 1M71A 5HHMB 2D31B 3DV6B 4DUWA 5DEGB 1OVZA 1S7XA 3L3IA 4GOSA 4K71B 4PGBB 4WHCA 1KCVL 1R6VA 3KYNA 3BYTA 1ZT7A 5K9OB 3O2WH 2OK0L 1P4IH 1TJHH 3DVNA 2VLLA 1JZ5A 5AD0A 5HHNA 2F53D 1CFTB 4WWKD 3CC5B 4HV8B 2D7NA 3GSNB 1KYOK 3ZSSA 3VFUB 4OD1L 3HI5L 4ZD3L 2Q86B 3TF7C 2IG2L 3TCLA 4E9LA 1F58L 4H1LG 5D1XC 4OBSA 4X8JA 3CX5K 3U1SH 1AXIB 4RNRA 4HWNA 1I3VA 1ZE3C 4FQ2H 4GQ9H 4UMGA 2QHRL 4LEXH 5EORL 1EGJL 2CSPA 5H2BB 4DN4H 4NT6B 1RZFH 5FO8B 5DK0A 3RWDA 3PP3K 5DD0H 3D5OF 5I66B 2CGRH 5TDNA 1AO7E 4P9MH 3VFSA 2IH3B 1BQLH 3L7EB 4LKCA 1YECL 2FHCA 2VDRH 3SDYH 2DI9A 4OJFH 4U6VH 4JJHA 3VXMD 3M17B 4X98B 5L2KB 3NGBC 4D9LL 2A1WH 2W65A 1WC7B 1FGNH 4H88L 4P2CG 1JPTH 3ULUD 4HK3N 1CXKA 1HNFA 3SGDI 4XZUB 1U3ZA 1MSPA 4G9FB 1T7XA 3ROOB 1CS6A 2OR9L 3C5JA 3FT4A 3B3IA 4JZJC 1A6ZB 2LAGB 1EO8L 4NKDB 4ZO6A 3WS6C 4OI7A 1ZSDA 1K6QL 1XZ0B 3EOTH 4M5YH 4EDXA 4GH7B 4TTDD 1FRGH 2ESVE 3KYOA 4RISH 5KSVB 4QRRE 3BEVA 3G6JA 3KJ6L 5D7JC 3VD7A 3AS1A 1T04A 1QRNB 1N5YL 3QJHA 4H8WL 4LCIL 3QI9C 3LN5A 3WHE1 1AKJB 1SYVA 5FOJA 5C0ND 2M2DA 1KJMB 4ELME 3RBSA 5IFAL 3BKYH 5EOCL 3UPRA 2A6JA 5F9WC 1ZS8A 1LNUB 3KNBA 2A73B 4M5ZH 1DBAH 5E7BA 4YFLI 5F8QC 5ICZB 1S9YB 2AV7B 1CFSA 4JANA 4ELMB 5EDXA 2NZ9C 2GHWB 3BN9C 1GOFA 4I9WD 3IU4L 1INQA 4FXGA 4AT6A 3V5HA 2R23A 3C6LA 3CZJA 4N9OB 3MRRB 3KXFE 2RQ8A 2DJSA 3TYGL 1IGJA 5HPOA 3VFUA 5IB1A 5DVOA 2X4QA 1MJ8L 4CGTA 6FABH 1N26A 5DD5H 4LSVH 5I8CA 5JIPA 5AD0B 3RJDA 4HIHB 2R69H 4NNYA 3RBGA 1G7MB 3UDWA 4Z6AT 4G8GD 5B39B 1KF9B 3OB0H 1PG7X 4AEHH 1KJ3H 1BEYL 3S34H 43CAA 5TF1L 2MKLC 1U3HD 5C0CD 2VDLL 3IXTB 5D6DA 5I18L 3IRPX 4XVJL 3CMGA 4L8SA 2XZAH 1BVLB 1S78D 1VFMA 5ACZB 5DK0B 4TNWF 3GIZL 2ZCHL 4GRLB 1QBMH 3NTCL 5EA0H 3GSWB 3THMH 1IEAB 1EFXA 5D7JA 1ZLWH 3EOAB 2Q8BH 4MWFA 1XGYL 3QI9A 2EO9A 2XXCB 4U6XB 4K9EC 4JRYD 3I6KB 3OX8A 4MGXA 1YNKL 2V7NB 2NLJB 2CUIA 4HFWB 1J8KA 1L0XA 4N0UB 1X5GA 4ZFFA 3ILPA 2EYSA 1BZ7B 1CDHA 1AQDA 1NMAH 3L5IA 1TITA 2GK0B 4EDXB 3VXTB 4N9GA 2C3WA 1I4FB 3NGBB 2IFFL 1KENL 2H41A 4RDQG 2BSTA 1VEMA 4XMLH 4HCRL 4K23H 4X6FB 4HWZA 3T0ED 1NMCB 4PJ9C 3IETA 4X5XA 2E27H 2IQAB 1EHNA 4EI5D 4Y2DB 1EHLH 4O5LH 2FSEB 1JP5A 5C0RH 1II4E 2RHEA 4P23D 4NKIH 3QWOB 5FM4A 3TBVA 4KK8D 4L4VE 4XBPB 1RK0B 5ISZD 4M61A 1VKXB 1KOAA 1Q9WA 1MJ8H 1A6WL 3MBXL 5HHVL 3DXAB 1R0AL 4UIMA 2ZCLH 3NIGF 4R96B 5T3XH 5HYJD 2P8LB 4NYLA 1BF8A 2E3VA 3MLSL 3O2DA 3MMEA 2OTWB 4XRCA 3VXSD 2RFXB 3DTXB 3ZKMC 3VXNB 1KEML 4FRWA 1DP0A 5DJDB 3JV5A 1EFQA 3DI3B 1FORH 4XNXH 2ED9A 2AXHA 5JQ6L 4OZHB 4XNYL 3RTQB 4PJ8C 1WGOA 3RUGB 3HCVA 1RZ7L 4FFVC 1OGAD 5E08L 3GIZH 5T1LB 4NZJA 3F7PC 1DQDL 5TQ2H 4JVPA 2Z92A 5E0QA 3UAJC 3WHXB 4HMEA 3R4DA 1DEEA 1NLDH 3P4LA 4GS7C 1JPGA 3NFSH 3M1BB 4L4TE 5IVZB 1I1RA 3QIWC 1BBJA 3BE1H 5HYIA 5IMKA 4HC1H 3GEWB 5IB2B 2UWEA 1FJ1B 4N0YH 4U3HA 4I3RL 1AO7D 4J3VA 3GSRA 5JW4R 4HH9B 2R0WL 3L6FA 1NMAL 4KJYA 2AEIT 4Z7WB 3BQUB 4IIQA 4JFFA 2J1KA 1FYTE 1J11A 2B1HL 2P5EA 3O4LE 3SE8H 2RGSA 4LPCA 2CLRB 2FNBA 2VLKB 4K7PX 1CE6A 4LPUA 1FZOA 3LKNB 4JFEA 1BP3B 3RZWA 8CGTA 3LZFL 3IJHA 5EUOE 2W9EL 1X5KA 4XNQB 4JB9L 1U8MA 1AQDB 4Z5RB 4Z78A 2FGZA 2E27L 4HIIB 5EOCJ 4FMFA 4UAOC 5JPMB 2I25N 3C2AL 4RA0C 1FSKC 2AJ3B 2RR3A 5DZLA 4DZ8B 1MLBA 3X14B 1XF1A 3QSKB 4XXCC 4GMTL 4BQ6A 3LMJH 1EAJA 4XVTH 1TETH 2XFXA 1I7TB 2I5YH 5HHOE 4GQ9L 2NCMA 3BZFB 2VR5A 4Q74A 2XNAA 1GIGH 4HEME 5DHXB 2VYRE 3UTQA 5BOPA 4MX7A 3GJEA 1CGVA 4PJCA 3HC3H 5A43C 2W91A 4XC3H 4URTB 2O5XL 3IFLH 2J8UE 3Q3GA 4OKVB 1J5OH 4IM8A 2G5BA 4JPVL 4PRIA 1F45A 5EPMA 5SWSE 2BY3A 2R23B 3DUUA 4HK3J 2F58L 1G9MC 1UVQB 5CJ5A 1RZJL 5FYKD 5J1AA 4H0IA 4I0PD 1AD9B 2Y23A 4PP1C 5EZJA 4YHNB 1Z3GH 4MXWL 4JZOA 1CN4A 4BSVB 3G9AB 5E70A 4OZFG 3VI3F 5KAQF 3ZTNL 3T3MF 4XX1E 1KJMA 2FZ3B 4IS6B 4UBDC 2G60H 3MNVA 4FN0A 4WDIB 1T7WA 3LKSB 1FFNB 1RMFH 2HG5A 4MMXC 1MCOH 2JLLA 4XAWH 1NKOA 5GS1A 1KCRL 3BD4A 3RGVC 3HRZA 1FZMA 2V9RA 2VZVA 1N5YH 4A6YA 5JR1H 5FA4B 3UO1H 1WBZB 3HE7D 3IFOB 3H2WA 5D96C 5C0IB 1S7UA 3ARXA 4XCNB 3PDDA 1DUYB 4A6YL 1OP9A 1S7VB 3WE6B 4ODBD 4CN4A 3KS0H 1LWRA 1HSBA 1S7UB 3R0NA 4P46D 4L8DB 5ERWB 1TTUA 4ZDHA 3V9FA 4HH9A 1G9ML 2IBBA 1RZJC 5I30L 1DVFD 4DFIA 2DM4A 1W72H 3O6FD 1BD2D 1A6VL 2H1PH 4LL9A 1NGPL 1GGIL 1FLTX 1YEFL 4LGRB 4YHKH 5FKPA 3BP4B 3JWOC 3ULUC 5INDA 4I2XB 1YY9C 3ZHDA 1OLZA 4RIRA 3U48A 4BZ1H 2WWKO 1B88A 4LBEA 4G8GA 4N8PA 2DWEB 4TUKH 4ZUSB 2HH0H 5JW4M 1A6UH 2GJJA 4AYFA 5IB4A 2AS5M 4XPFH 4G6KH 5E00B 5DJ8A 4FFYL 2VL5B 1KYOJ 1MWAB 4WFED 4WTWA 1RUAH 4A2LA 4BJLA 2BMKA 4Q2ZB 1NGZB 5F89A 3RTQC 2DB8A 3DGGA 4AZ8A 3HG1B 3VI4E 3F8UB 2HVKA 4HUWA 1AXTL 1N64H 2AAVA 3E6FB 1FIGH 1WZ1H 1QHOA 4PRAA 2P5WA 2RIKA 4Y4KA 4H1LB 2Z4QA 1EHAA 3AU1B 2G60L 2KH2B 4FQHA 2EKSA 4EI6A 1RMFL 3HS0B 1YNLH 3TO4A 3SE9H 5HY9A 1W0VB 2IF7A 2JCCB 4M48L 4XCEB 3BEWB 1KCLA 2ENYA 4QOKB 1I7ZA 3UTSE 2HLFD 4I1NB 5D7LB 4BZ2H 3T3PE 1A1MB 3ARGB 5IESH 4C56E 1NBZB 1YEHH 5LG1A 5EOQL 2XI9A 4LRNH 3HI6L 5T5FH 4K7PL 5JZ7D 1U58A 5I74B 1FO0A 1CGYA 3C8KA 2J4WL 4PJ9B 2QQLL 1NMCC 3OL2A 3QNXB 2X9WA 3QXUA 3O2WL 3HNSL 4KPHH 3PDOA 2R4RL 3FKUS 2V5TA 3CFCH 1GGIH 3V8CA 5ALBH 5CCKH 1CE6B 4Z7OF 4I18B 4AMKL 1IC1A 5SWZB 3ZTJH 3X3GL 4JLRA 2YRZA 4QY8B 5BJTA 4EI5A 3BQUA 1H8OA 4EQ2A 5EZLB 3QDJE 1WIPA 3C60A 5CJOH 4O2EB 1CT8B 3PABB 3AC0A 1ITBB 3PJSA 3PJSB 5EORH 4ETQB 1J12A 2YSSB 1P7KA 2HTKD 4FQXA 1A6PA 4K55A 4QGYA 3SPVA 3MV11 3UTPE 5D2LA 3C60C 4LIQE 2N56A 3GMOA 3QDMD 3MRNA 3FN9A 4YBHA 3BPOB 2OBGA 4I4WB 4PGDB 4U6HA 2DWEA 1CLOH 4QRRB 2AJSL 1PG7H 2FSEA 2R1YA 2HT3C 2CQVA 3D39D 4GG6A 5EU5A 5FHBH 2G9HB 5HYSB 3V5DB 4N0FA 5GSRA 1JJUA 1AXTH 1N64L 3OJMB 4WUUB 2V5SA 3AM8C 3DTXA 4P5TA 3HZVB 4PJ9D 3MRLB 4JKMA 3T4YB 3I84A 1A9BB 1PAMA 2YPVL 1OARH 2R0ZL 5D1ZD 5F7EL 1OAZH 5D5MF 1BFTA 4MZ3A 3QIUB 3S3SA 3V7MA 4R96A 3U46B 2NX5A 3KXFB 2Z4QB 3U4EA 3UYPA 5IFAH 4M3KB 4OF6A 2JJSC 3VGAC 1G7IB 4Q6YA 4LLVA 3VXUD 4YLQT 3CSPA 3JUYA 4Y2DD 2FYYB 3O3DA 1XGUA 4YAQA 3UZVB 2GK0A 1V7MH 3H9HA 4GRLD 1GRWA 4G6ML 4JHAH 4CADB 1EZVY 5IMMB 5IMLA 1XGTA 4TSBH 2HG5B 3ARDA 5JOEA 2FB4L 1P1ZA 1T89C 5D9SA 2CD0A 2VLJB 3L1OH 1F4YL 2ZUSA 2BJMH 2E9WA 3AS0A 3HMWL 2FECI 3I2CH 2MSPA 3HFMH 3QI9B 2CKBL 2OTUB 3IDGA 4X9HA 5GZND 2V2TB 1JGUL 5D7JB 3HUJB 1D5MB 4P3DB 3MV9A 3LN9A 3BD5A 4PY7A 4Y4HC 4MHHI 3WFEH 3W9DA 3KPNA 1KJ2B 2EIZB 2VKXA 3U7YL 4U1HB 3I85A 4C4KO 4WI4A 1UM5L 1BZ9B 4JZJB 1GYAA 1JTPA 1D5BA 4ZUTB 3WFBL 5IIEA 2YKLH 1YY8A 4R90H 2EXYC 5ESQA 2D7TH 1PG7L 3BJLA 5FO8A 1PY9A 2DKSA 4X6DB 3RWJA 5ICYA 4Z95H 2APWA 4IRSD 1QG3A 2VR4A 1H3WM 1I75A 4F7MA 1I7TA 2YD3A 4NN7B 2E8YA 1I3RB 1HIMH 1MFDL 4G5ZL 1CICB 1FZJB 1KCUL 3G5ZA 3PGCA 3ZTNH 3FQNB 2CR6A 2NZ9D 2QR0A 2NXYD 5JIKA 1F90L 1SJHA 4ZPTA 1FGVH 1IAKB 4JFZH 1J05B 4RMVA 5C0BD 4F7CB 5CEXB 5KVDH 1F3RB 3QAZC 4YQXH 3VXSB 2VLJD 2EEAA 2C7UA 5FCSH 3IKKA 3LV3B 1NL0H 5D6DC 5DJ2B 3QG6A 1TVBB 5C7XH 1S7XB 5TE4H 3ES6B 3D87B 1HYSC 5FKPB 3LQAL 3MV7A 2JCCF 2N1KA 4LLQA 3TESA 4UINL 4JFHE 4F2MB 1R3JB 4LCCA 5EPMB 5E8DL 3OQ3B 2IAND 4HS8L 5HDLA 2BOBB 4HX1A 4A2MA 4PLJC 4HXAH 3EBAA 1U8HA 1OHQA 1WT5C 3T77A 4HPOL 3L7FA 2DTSA 1W0WA 1WSST 4YFEA 4WU7B 2XWTA 1FZMB 1TPXC 2QHRH 4WGVB 5E5MB 5DDHB 1JWMA 1I1AA 3SN6N 2JK5B 1C8PA 4WUKH 1KEMH 1HDMB 3FOLA 2W0PA 4JFYB 1G7QA 2EXYD 3CX5J 1UYWL 3MCKA 5AAWA 1WFTA 1TCRB 3DYMA 5E8PB 4WFGE 5KJRL 4V1DE 2ZUVA 3AROA 4P4KA 1CQKA 4Z78B 4K94L 5FUCE 4PJEF 3QH3A 3ULVH 1CFQB 1HIML 2IPTH 1P5VA 2EZ0C 3QUXA 5DHVB 1AFVL 2KQMA 4PP2B 1FYTB 3QDJD 3MGOA 2VDOH 3S35X 1MCWM 1TZIB 2LV4A 4KRPB 1UEYA 5IB3B 3I3EA 1YNLL 1VGEL 1DANT 2ZKHH 2JIXA 4HUUB 5DXWA 5EC1B 4PJHE 4WO4C 1UKSA 1YYML 4N0CD 5EZIH 2NY3B 1N59A 1C08A 4LCIH 3FRUA 4KZEL 4PJ9A 5I8OL 1LK2A 2D7OA 1DUZA 4X8JB 4JFDA 3ULUE 2BOCB 4OLVL 1C5DB 1E4XI 1UXWB 1WWCA 2XV6B 2YPLE 4PP1D 3G5YB 5D1ZA 3G6DL 3QXAB 5ANMB 1C12B 3WUZA 1NSNL 3MJ9L 3SKJH 2UY6A 4KJQD 3IXAB 4XMKL 4ZUVA 3VRIB 3WDIA 5IUSA 3R0MA 2GK2A 5EUOF 2G2RB 1RJLB 3FHAA 2G2RA 4PREB 5KSAC 1I8MB 4U7KA 4N0UA 1JGEB 3P11H 1EO7A 1R5VB 4KH2A 1P7QD 5D1ZC 2CXGA 3STZA 4NCC2 4JKKA 3UTTD 1AD0A 1T1XA 1F6AB 3LB6D 2WMPA 1F6AA 1UJTA 3QUXC 4YHYC 1MPAH 3CFEB 4P2QD 3LKQB 3MXVH 5JOPE 3CVHL 1X5LA 4X9IA 3S5LB 3TIDB 4ZS7L 3R8BB 2CJUH 5DUBB 1CTOA 2FEDC 5MEPA 4NZRL 5B22A 1DZBA 4ZTOL 2R69L 2UUDH 3WUWB 4MMZC 1OD9A 2NR6D 4NQEA 2PYEB 4LVNC 1G7JB 1MNUH 4AEHL 4KFZC 4MA8H 4TTGA 2DLFL 3VWKC 2Z8RA 3QXWA 4MS8D 2XXMB 2MCG1 5KSBF 5DK2A 1JWMB 3WNOA 1MCNA 3ARRA 4W6WB 3W0WE 1NUNB 3EUUA 2BY2A 4WRLA 4PGEA 4JO2H 5DS8B 2XWBA 3T2OA 2ILLA 5I8CB 2F8OA 3MYJA 4GW5B 4LAJH 4GKZB 4WWKB 4G43B 3PGFH 4GRWE 3VGGA 3MGOB 3C5ZC 2B39A 1OP5H 3FHQA 3V0VB 5JDJA 3O9WA 4YHIB 2IH1A 4EUPH 4YBQC 5FHAH 5FYLD 1QSFB 4OAWA 4OCXL 3O8XC 3QWRD 4Q6IB 1HNGA 4P23C 1BJ8A 3RWCB 4LARL 4XP6H 1KFAH 1AGBB 2ATPB 2ITCA 1BFOB 4X80H 5E8NB 2MCPL 3AMLA 3S97C 3O0RH 4OLZH 3HR6A 4EN3A 3CJJA 1EFXB 4QHKI 2P5WD 4PJXE 1DBBH 4LSPH 1LMKA 2A6IB 4C4KT 4GRLA 4F8QA 4RMTA 1RJLA 3CGTA 3U6RB 4KRMB 4M7KH 1WITA 3QHFL 5JOFA 1J87A 3IFNH 4L8SB 4C58B 4LEOB 5D5ME 2DLGA 3QRGH 3RNKA 1TVBA 5CJQL 2PETA 5DJ0B 5LWYL 1LP9B 3OKDA 3A6CL 2ZCKL 4MNQB 3FT4B 4OFKA 1U92A 2OMBA 5D1XA 4LF3B 3ILPB 3U9PL 2EC8A 5DQJA 3PV6A 4P3CL 4JAMA 4M6NL 3MA7B 4MA3B 4J6RH 5D71H 5JHLL 1ZEAH 4R0LC 3D2UB 2VDPH 3N50A 2QADB 2HH0L 5D1QA 3MRJB 3QFJB 3PDGA 2ITDA 2UV3A 2V7HA 4EKXA 4JZNA 2AK4A 4YIQB 2VDQH 3DOSA 4YEFA 2ARWA 4Z7VE 5MEND 3KPPB 1XF5A 1EO5A 4NN6B 1MF2L 3JTSA 5I75B 1JN6A 2AI0H 2JJTC 1DQDH 1YDPA 4MAYC 5CD5C 3TM6A 5KG9A 1OB1A 1AI1L 2WAHA 1T7ZA 2VAAB 2Z91B 2IAMA 3P9LA 1FIGL 4K9EH 4ALAL 5MEQA 3FN3A 1YEDB 1W8OA 5BS0D 3OG4B 1YEIL 1B4RA 4LFHD 4ZO8A 1OL0A 4OCXH 1KXQE 1H9VA 1TZHB 1U36A 4PJDB 5IFHH 5J56B 1XIWA 4YQXL 5K9OA 3C6SB 4Y0GA 5F7DB 4K8RL 3K2UL 1ORSA 5GRYA 1T03H 5C7XL 2Y36L 2DTML 1BVZA 4R4BA 1K2DB 3MRIB 3JV6A 3RL2B 3ULSA 1J1PL 3FB5A 1DBAL 2OSLA 3CFKA 4LQFL 1J1XL 2EDYA 2PCPA 4BFEA 5AG9A 3CAFA 3WNKA 4ZQKA 1FNEB 3G04A 5DJCB 2HVJA 2NTSP 2QADD 3RKDD 1IEBA 3IJSA 2ZUQC 4NQCB 4KVCH 4MAYA 2WWMC 3FO9B 3GFUA 1MCFA 3Q5TA 5F97E 1BBJB 5IROA 4FQ1H 4KDWA 5D7SL 2JF1A 5D1QC 1J88A 4UBDD 3ARGD 1JRHI 4OLYL 4XP9H 4OD3L 3VFGL 5C6WH 3V4VL 5D7IA 2Q7NA 5T5NG 2FX7H 3TT1L 3VD3A 3IU3B 4ZXBC 3MBEB 4J6RL 5D71L 1GZQA 3FRPA 4NO0D 3V0VA 3CIQA 2ESVB 1A7RH 5D2LB 3MROB 4GUPB 4NOFA 4KMLB 5F9DC 1I1AD 1AGBA 5FUOL 3QWQB 5FV2A 2AEWA 3NTCH 5IHLB 2R9HC 3HMXA 3BZ4A 2VDKL 5KSBA 1VSCA 5IVOA 1VENA 2EE3A 4CU8A 4OGYL 1JBJA 1UH2A 4ODUB 3N0PB 1M71B 1AE6H 4DFHA 1OF2A 3CNKA 5FGBA 4F7EA 1ULVA 1N6QH 3O6KH 3RKPA 3EYVB 2ERJC 3TNMA 15C8H 2NY5C 1VGEH 3D3VD 2ZKHL 1GJIA 1F4WL 4M93B 3WJLC 3CXDH 1EGJA 3GSNH 3EO1A 2DS4A 3FN0H 4ZAKC 5JA8B 1U41A 2DQIH 4Q9CA 2YD2A 1KXVC 1AXSB 1YEKL 1HH6A 1BFVL 1BX2A 3W0WD 5ECJE 1A5FL 1U3YA 3PQYA 3CMOH 3HUJE 1I9RH 5DGQA 1TJGH 5J12B 5KZCB 4JO3L 5EC2A 1A8JH 5C0FA 1PKQB 4CVUA 1O0VA 3RDTD 3VFPA 3DV4B 2FJFB 4OIIH 3MXWL 2ATKA 4RQQB 3AM8A 5FGSA 2DBLL 1IARB 2Q3AA 3NCBB 3JWDL 2IG2H 1A21A 1U93A 5E8EB 2VTFA 3MXVL 5AZEL 2WUCL 3QRFM 2AKRB 4XNZC 4BH8A 1HOCB 1IGYB 4RGOL 3W11D 4JFPA 4K8RD 4RWYH 1LQSR 1ADQA 1AHWB 1JYWA 4MJ5B 2APXA 1G84A 2DQJH 4ODVH 4L3CB 3WEXB 5JTWA 4G7VH 3H0TA 5KTEH 2XOTA 1C12A 3M1BA 1IKFH 3OG6B 4WNQB 4Z7OE 1A4KA 4XNYH 2VZ1A 4ZUWB 1SMAA 3P2TA 3S36L 3CDGA 3KR3H 5DLMH 1JK8B 4MCYA 3VDAA 5D2NB 4J7RA 1B3JA 5DMJB 3LEXB 2CIIA 4OQTH 3CX2A 2IAMD 4KRPD 3MROA 5BVPL 5DJZA 5IJVA 2DRUA 4ODUA 1N6VA 4NUJA 3T09A 4TNVK 4AM0A 4E41A 4BH7B 1CI5A 3U0PA 4ZUSA 1FVCB 4HS6B 4RISL 1F90H 3NCEB 5F9OL 2H8PA 4ETQA 1B4JH 5E4IA 1OCWL 3UJJL 1M05A 1T0NB 3N85L 3RIFF 4ELMA 4ZNEA 1A3LL 2J12B 1J0HA 1MWAA 1J0YA 3R06B 1DLFH 1B90A 1HINH 1T2XA 4Y16B 3BX7C 5I1AB 3IDXH 3MQIA 3T0EC 2NZIA 1LO3L 2HWZH 3KLAB 1JFQL 1BQHG 3GBMH 3MLRL 3X3FL 5DC0A 1V8HA 2HTLC 4LCWB 3O3AB 4AIOA 5JXEC 4LLQB 3TH4T 3E0GA 1IRAY 1RZIA 1MIMH 1WUNT 1CL7I 4PJ7A 2P8PA 2VXVL 4RAUB 5FO9A 4NRYA 4U1JB 1OTUC 3WFCH 4WWID 2R4SL 3U30C 4NWTL 3SGJC 1CDJA 1RURL 2OL3H 4HKZA 4YC2B 3RVVD 4HXBL 2PYED 4YHNA 5GZOC 1XGPB 4BQ9A 4KDTC 5K9QG 1ES0B 4RGOH 5IBUG 5EU4A 4X7SL 4N5EC 1A4JA 4X4YA 1IBGH 4QHLB 5EOTB 2PCPB 1CL7H 3MNVB 4WDIA 3HE7B 5J3HD 1H3UA 4PGZA 4G7VL 3B9VA 2P46B 1NGXA 1LEKB 2ZWLT 4RGMB 1I9JL 5CD3B 2FEDD 1CICA 3EOAA 2VXQL 3WLWD 1T5XA 1NLBH 3HRPA 3OTTA 3KYMA 5IQ7H 4XH2B 4LASH 4Y5XA 4LVOB 2BNRD 3QUXD 3UMTA 4M02A 4V1DB 4PJHB 2P24B 3NABH 3GRWL 4TSCL 4AK1A 1WQVT 3FTGA 1JYNA 3RZCC 2C3VA 2QQQA 5JPNB 1BD2E 4WTXA 1L9MA 1YEIH 4KQ3H 3W9DB 2CIKB 3C8DA 3QQ4B 1RUML 3N85H 3KPRA 4QRSB 1U42A 2FD6L 4UDTA 1OSZA 4JY5L 4PRBA 5INDB 1EBAA 4JZNB 1DQMH 3MACH 3SO3B 4DZ8A 4Y2OA 3O6ML 3NFPB 3AY4A 4J8RA 1NCAL 1RY7B 2XWJB 4JN2A 2ARJB 2YPLB 1W72B 3O11A 4MJ5A 1S78C 4HGMA 1LGVA 1PQZA 2VWEC 3KPRD 4Y5VB 2NY6C 4NNXA 4O5LL 3WUWG 5C07D 3MRDA 1KTLB 4GBXB 4U1LB 2ORBH 4GW4A 4M1CD 2OTUA 4XMPL 3BT2H 3HTLX 4OD1H 4NWTH 4ZD3H 4UQ3A 4H20L 1HSAB 3JTTB 2UYLB 2IQ9H 4RAHA 5T3XL 5KN5A 2VLME 1WWWX 2KZWA 4PJ7B 3Q0HA 3EFFB 4X6BB 2A6DB 1X9QA 2EYRA 2RAMA 2C4FU 4Y5XC 1ZOXA 3HN3A 3TZVC 4HKZB 4JM2D 4E41B 2J6EH 5D7LD 4MJ6B 1KACB 1PX3A 2HFEB 3Q6FB 3AVEA 2VDRL 3ARQA 4J12A 4CVWA 4EXKA 1QYGL 5CBAB 5C6TH 3I02B 1QBAA 4NJAH 3BKMH 2R39A 1UZ8A 1B2WL 4JM2C 4PRPE 1C5BL 4S1DD 2BVUA 3SDAB 5I8KH 2VDKH 4JHBA 3V8OA 1UWXK 3AB0C 3ESVF 1E28A 4WJ5A 1IAOA 1ND0B 1XR8A 3OJDA 2YEZA 4U7SA 1L9NA 4OGYH 5IVZA 2V6HA 4TSAH 3OBAA 3QHZL 4PRPB 3MFFB 2MPAL 2DD8L 1GGCL 2A38A 5FHAL 4Q9QL 3WS3A 3FCTB 5GXBB 3SE9L 4YGAB 1KG0B 4NGHL 1NFIB 2EIEA 3OB0K 5IR1A 3MGAA 4AM0B 3GO1H 5D5MB 5CSBA 2YK1H 5TE4L 4OZHA 4LRNL 4HLZH 5EUKB 2EYTA 5CINL 1FYHB 3GI8L 4MD5B 4PB9H 1HXMA 4KI5F 2J4WH 4TVPD 2VR9A 4HIIA 4LSRH 4M7KL 1KJ2L 3R1GH 2FWOA 4JR9L 5FYJE 2P42B 4CKVX 4LVHC 3E8UH 3DIFA 4NPYA 1GVIA 5LCVH 2JB6B 4RZCB 2R2EB 4Z7WF 2LFGA 5E95B 3JWDH 4I5BB 1QQDB 3ARBD 3MNZA 5I1EH 4L3CA 3WEXA 1DUZB 5AZEH 3TNNB 3TBVB 4HAGA 4LAQH 2AXGA 1IEAA 3MLVL 5DVLA 1FC2D 4RMSA 1DQLL 5IT2L 5L9DL 5ID0A 3NIGE 1MJ7H 1GIGL 4O58L 1EJOL 3AU1A 3I75A 4K7FB 5J06A 4IDJH 3GMMB 5DMKA 3CU1A 4X0KA 1MQ8A 1X5AA 2HJKB 4HUVB 1J8HB 1QSEB 5H35B 4QHNA 2GW5A 2HFGL 5E03A 4X7TB 2E6JA 4YHPB 1FV1B 2X44D 3RVWD 4B5EA 1CLOL 3LKRB 1ED3B 3FB6B 1E4KC 1QRND 1YN7B 4FXKA 3CLFL 1NH6A 4HIHA 3TO4B 3HCVB 1ZLSH 1NGYB 3SY0A 4XCFH 4OF8A 1BAFH 2F19H 3BJ91 4Z77B 4NO3B 2FLRT 4MQSB 4M4PA 3GK8L 2VDOL 4RAVA 4TSAL 4X7CC 1FBIL 5C0EB 2BVYA 3BP6B 4MA1B 5BRZA 4D0DA 1RSFA 1Q8MA 3MUY1 2DQHH 4OT1H 1XMWA 1T3FA 4UIKL 1GGBL 1J0JA 3TIEB 2IPKA 1EBPA 1DQQA 3WKMH 1MHPH 2EEBA 1R5WB 2WQRA 3ARBB 3ARVA 5B38G 2E5EA 4OZGF 2NY2D 2Q76A 2F53A 4XWGL 3DX8A 4BFIA 3FO0H 1D6VL 1I1AB 5JLZA 4LOUD 5A2LH 3FONB 2H1PL 3G5XA 4ZDHB 3AXLA 4WGWB 4NKIL 2YN3A 4UNUA 3GI9H 4Y19D 3MRIA 32C2B 1ZT1B 5FGBC 3SCMC 3WIFA 1DDHA 3BP4A 1DDHB 3CCHA 5D2LE 1X5YA 5J1SC 1I7UA 4FXLA 4JFQB 4DGVL 5HJ3B 4DJMA 4WVRA 2CJUL 3WD5H 5I1DB 1X5JA 1MLCB 1EEYB 2LQRA 3FAXA 4ZTOH 4G80B 3X11B 5DUPL 3FFCA 2J8HA 3T0BA 2LTQB 3SGKC 1Q0XL 3HB3C 3I6KA 2EICA 1SQ2N 2FH8A 3G5ZB 1F8TL 3MCG1 1L7IL 1RIVL 4DK6A 4QRTB 4NM8H 5C2UB 3P9LB 4L8BA 2BP3A 3EKCA 4CJ1A 1FNLA 4OZHF 2HTLD 3LV3A 4KROB 5T3ZE 3AREC 1ZAGA 1TZGL 2HJFB 5D8JH 5I1GH 4W4NA 3F62A 3P0YL 2GUOB 4O02L 5GHWH 4APQD 3LS5L 1Z5LA 1XGRB 4M00A 3ZYOA 5MP6L 3BEVB 3EO0B 3DI2B 1CFNA 4NJ9H 5DVKA 3DX7A 4EI5C 2Z31C 5MI0C 3DURA 3DROA 1A14L 3NFSL 1IGIL 4HMCA 3TT3H 4KZDL 3D0LA 1EJ6A 3P4OA 2WWKT 1CICD 2L0DA 1VGKA 3BGFB 4M6MH 3TJEL 2QLVB 1FN4B 4JM2F 4FXKB 1HHGB 1VA9A 3UYRH 3VRJB 1PKQE 5EN2B 4C56A 1RVFH 3OJVC 4IRJA 5FIEA 5DJXA 2D31A 3DV6A 4PJAF 1DBJL 1I7RB 1FPTL 5CJBA 3LPGA 1XGTB 4JG1L 4H26A 3DGCR 2EDOA 1CR9L 3MO1B 1YDPB 4P2OC 5EU7E 4P59H 3N1FC 2B1AL 3AREA 2E9BA 1IJ9A 3MV9B 5ALBL 1I1YB 1YEJL 2DLEA 1IQDA 3N1PC 3OXRB 2CK0L 3V4PL 1WEJL 4J4PD 3IT8D 2XYCA 1NAMA 1F42A 2I27N 1JYVA 5CJQH 4N90E 1EUUA 1CYGA 5LGJB 3GJFA 4HK0B 3TJHC 3OMZA 1C5CL 3TBTB 5FGCE 4APQB 1MEXH 5D2NE 1MLCA 3TN0C 5KW9H 4N8CL 4KV5F 5CKAA 4P57B 4WUUD 1DN0B 1MI5E 4YHIA 4C55A 5C0DB 1I7UB 1Q0XH 1FZOB 3LKNA 4FG6D 4JFEB 1H15B 1LEGA 3RDTB 3A67L 3QT2A 2NW2A 1ODAA 1DEEB 4U6YB 4OLUH 4S1QL 1G6RA 5TFSL 2W60A 3QUZB 4M6AA 4XC1L 5FAAA 4DN3H 1EXUB 1JHKH 1U8OB 1MWAL 1CCZA 3LEYL 5BQ7B 3M17A 3M8OH 2CLZB 3HLAA 3MJ8B 5BVPH 1LO5B 3SDXA 5B38A 1DEDA 5C92A 4QTHB 5JW4Q 4YO0B 4QTHA 5CEYB 3TT3L 1EZVX 4JY4B 3K4ZA 1GGCH 4ZODA 2IJ0C 3U7WL 5E1AA 5F1NB 2D3VA 1LDSA 4PJ5B 5DUBA 3UBXA 4YE4H 3HC0A 1MFCL 3UO1L 2IADB 2UVFA 4Z7UF 5KS9B 3CFEA 3VJ6A 1OT1A 4XB8A 3GMRA 1ZVHA 4PTTA 1KSRA 1KB5B 1LO3H 3QCVH 4F7PA 1Q0YH 2L7JA 1DQJA 4PB9L 1AJ7H 4YZFE 3T04D 1D9KA 2PYEA 4Y5YB 3REVA 4PUBH 1K8DA 2IQAA 2OK0H 2XN9A 3BMWA 5DD6B 5BS0E 4OZGA 1JV5A 1A2YB 1HWHB 2AK1L 1UWXH 3L7FB 1QR1A 1WEJH 4I0PC 3GDBA 4KMTH 1PEWA 4YUEH 1MY7A 2GTWB 2Y06H 3L5XH 2KQNA 4JGUA 4K7FA 4UDUB 3JVGC 5D7KE 3QWOA 3MRCA 5FB8A 3GIVA 1NUFA 1I1YA 5C86A 2NY1D 3TBWB 3OXSA 3GRWA 4KKBC 4OTXH 4DW2L 1RZ8B 2K3TA 3ZYJA 1XF2A 2O61B 1RZ8A 3IS0X 3GUTB 3MRQA 2ZUWA 4X9GA 5FB8B 1RHHB 4OCWL 2BHZA 4TUKL 2AJYH 1LO2H 5CD5D 5LGJA 1KIRB 2R2CA 4WHTB 4Y5YC 5DT1L 4OZ4B 3TZVA 1S5HB 3BZDA 3VU2A 3Q6FA 3BDXA 4OZFA 2VZ3A 4OLUL 3DV4A 3SJVD 4WFHE 4OFVA 2DQTH 2R56H 5EC2B 3C5SB 2AJZB 3K8LA 3EYFB 4PRHB 3LSOB 4OLWH 4L4VD 2C3HA 3D85A 4NC2B 3FQWA 4IMLA 1EO8H 1MFDH 2YRPA 1NJ9A 4M7LT 4POUB 4N1CA 5ICXA 3FFDA 4G6JH 1FBIH 1ACYL 4NCC1 2A2QT 3U83A 1C08B 4NUGH 1DJSA 3DNKA 2Q20A 1XGQB 4I0KA 1VEPA 1OGAB 4XXCA 3IDYC 2OXHA 4MJIA 1KBGH 3G9VA 3CXDL 3RZCA 1AR2A 1MHPL 1D5IH 1S7RB 1A64A 3D0LB 5IW1B 1AY1H 4NIKB 4HJJH 5J13C 4JEGB 2OR7A 3SKMB 3CH1B 5FCUL 1KIPA 1GC1H 2BOBA 4P4KC 1CFNB 1P53A 1YMMB 5MENB 3OR6A 1RK1B 4O2CB 3MOAL 3PP4L 3QXDA 4K3EH 4MJID 3HNSH 2W0FA 3NA9H 2CIKA 1EFXD 4DZBA 1ZV5A 3VXRD 1VGKB 4KDTA 1QFUH 1DFBL 4X5WA 3B2VL 4RGNE 1CK0L 2QKIA 3AS3A 4XHQA 5EZOL 2XICA 2QSQA 2BFVH 3ESUF 4FFVD 4HX1B 5D9SB 2ZG2A 1RAMA 5DDHA 5SX4H 3U9PH 5E5MA 5E99L 2IAMC 2VL4A 1KLUA 4P3CH 1I85A 5L8LB 4JVUA 4Y4KC 1TTGA 3C09C 4NDMA 1JWSB 3L95B 3S96A 2A0LC 4Y4KD 3P73B 4XNMB 1PGRB 2Y7QA 4M1DL 1IKFL 5C07B 2YBRA 4L8CA 4I3SL 5IVXE 1AR1C 3K8KA 3WLBA 4JO1L 3GSVA 1JRHL 2C1PB 5DK3A 3S96B 3TO4D 1R5WA 3VWKA 1XIWC 2ICWB 4U7MA 1PZ5B 5F7MC 1LE9A 5HD8D 1A4JB 3RWCA 3WSQL 2ZCHH 1FAIH 2NW3B 3BAEL 3TV3L 1A6AB 1E4KA 5TDOB 2MNUA 3CFKB 2VH5L 1I1FA 2PO6A 5E8OA 2ENSA 3NPSB 4GKNB 3BGFC 3RL1B 1MCDA 4FFZH 5GGRA 4LMQE 4OCSL 4NZTH 3O8XD 5TDNB 4JZOB 4BSVA 5JW3L 1QLRA 3SY0B 5E9DB 2Z31B 5CEXA 1G1CA 4JKLA 5DI8B 3UTTB 4R2GB 2B5IB 5AZ2L 1SJHB 4ZPTB 1JYXA 2XFXB 1JK8A 3K2UH 1CXLA 3MRNB 1J8HD 1QSED 3CH1A 2XTJD 1RI8A 3K1KC 1JFQH 2RCSH 1KN4L 4FQXC 5E2UL 2Y5TB 1DQTA 3HNTL 3TH3T 3O3BA 4KUZL 3QFJE 4LKXA 4P59L 4GG6F 4O2EA 4JREB 5C0RL 2OJEB 5FYKH 2VXVH 4WO4D 5IIEB 1CGXA 2CK0H 5CJ8A 4ZSOE 4JE4B 4UZGA 1F4YH 3JWOL 2R0KL 1WLHA 4X7DC 3I2CL 4PLKD 3MRJA 5HHVH 1R3IL 3OAUL 3KDMB 4IDLA 5ALCH 3CDFA 2ADJB 2AJ3A 4L4TD 3SDXE 2Y5EA 4G3YL 1U3HC 1FVDA 1K5NA 2OQJB 2HKFH 4D0BA 4U0RB 3SQOH 1JGDA 4LPYA 3QO1A 1CDIA 1T66C 3ZO0A 2COQA 1A6UL 4PJGB 3MNZB 5F7NC 3F7VB 3Q6GL 5KVEH 1U3JA 1JNLH 2SEBB 1UA6H 2CH8A 3G5YA 4PB0L 3QPQC 5DC9B 1SBBA 1A2YA 2QEJA 1QR1B 2DM7A 1LO4L 1JV5B 1JZ8A 4PJGA 1WZLA 2P8PB 3L9RA 3QYCA 3ARBC 3EO1B 5K9JH 1RHHA 1RZIB 3BKJH 4E42B 4B53A 5ID1A 1NFDB 3V6BR 5F7KC 3TBWA 5HDBF 2N4IA 1H5BA 1Q94B 3RTQA 1Q9KA 1Z2KA 5BRZD 2X1PA 5F6HI 2YOCA 5D7KD 5CIPH 4ACPA 5IMOB 2P5WB 3LQZA 4MA1C 5JMRA 2GIYA 3CSYB 1BFOA 1MFAL 1BWMA 2NX5B 3KXFA 3VJ6B 4M62H 4GQPH 1U3HB 5C0CB 3VFPB 3OAZH 2X4SA 1FGVL 4JQVC 5I6XB 4UIKH 2ADIA 2WWMD 5T1LA 2UWEE 3RP1A 3TVMB 5IBUB 2YXMA 4LARH 3WKML 4R4ND 3DUHA 4YHOH 1VACA 3MRGA 1C16A 3QI9D 2JB5L 1DQML 2VISB 4NRXA 5HHPA 4JREC 5HHPB 1OP3H 4Z77A 2Y72A 1KEGH 1G7HB 4KKCD 4I77L 1NKRA 4KROD 2H9GB 4X99A 4LPTA 2HRPH 3CMOL 4JB9H 4XHJC 5IV2A 1X5HA 5SWSD 1OAQL 3GMQA 3RWIB 3ARDD 4XPAL 1FVEB 1J86A 2B20A 5E8DH 5GRZA 1FL5B 4QRPA 1JZ2A 3GI9L 2ADGA 4P48A 4WNQA 2B5IC 3QDJA 4R2GC 4ZFOA 3BN3B 2XKUA 1S7QA 2PNDA 2AK4D 2EDNA 1F4AA 5EBGA 1ONQB 5TDOA 3HPJB 3WO4B 4CMHB 1UKTA 5SX5K 2FX8L 4NBYB 3LKPA 4LVHB 1NUDA 1Y6NR 3SDDB 3D9AH 3SQOL 4C56D 3T65B 3LDBC 3KLHD 1MCKA 3VFTA 1W72A 5JORA 5HHMD 1BEYH 5HVGB 5KVEL 4FP8L 5EO0B 1FP5A 1A3RL 1JUFB 5T5NF 3VWJC 1ADQL 2VDNL 5D7LA 5C0DA 4PRBB 4HW6A 3QO1B 3UZQA 4Z76B 1KC5L 2OLDA 1K5NB 3RVXD 1HXYB 5IROC 1YJDC 4XP5L 5A16B 4HUMB 2NY6D 1AFVH 2DOCA 2W9DH 5E6IA 3ULVE 1L7TL 2IAMB 2MPAH 1HI6B 4GBXA 1QNZL 4FQIH 4Q9QH 1NEZA 2GSGB 5HY9B 5DMYA 4MNHB 3SDAC 4CU6A 2GY5A 1RK1A 1RVFL 4PJAA 1F2QA 2YD6A 4HZLA 3CUPB 5IB1B 2ADFH 3E6FA 4XPBL 2IFFH 1LK3L 2ZUXA 1CG9B 2BZDA 5J7CC 1FPTH 3U9UB 4HZLB 1IM3A 1VPOL 1IGCL 4RGNC 4R4FL 2BNUB 1Z9LA 3VWJA 2GJZA 3ZT5A 4JRXB 4N1EA 4ZOEA 2BNRB 5EU4B 4Y19A 4X83A 4JHAL 4Y5XB 1IKNA 4V1DD 5B8CA 5EO9B 2FR4A 2Z31A 5ICZA 1W2KT 3VDBA 1OTTD 3WV0A 1DUYA 2R4SH 2GT9A 3BO8A 5GGRY 5I71C 1V3MA 3QO0A 3VXUB 1CLYL 4LLDB 4NKQB 4PFEA 4OFDA 5C0AB 4V1DA 5C0AA 3BGMB 1Q1JH 1LE9B 3BPNB 3U7YH 2NY6B 5KVGL 4I8DA 5GIRA 5CMAB 1BQLL 4UT7H 3B9DA 2YMXH 3X12A 2VLKA 5IFJA 3MV9D 1ZT1A 1S5HA 4G6KL 1U8QA 1JMZA 2PO6B 4D9LH 1QZ1A 1DBML 1LO0H 5ADOL 2HVJB 1NDGA 3DVIA 4LLMB 4JO4L 3SCMD 3RU8L 2XG5A 4L5FL 1ZLSL 2XWJA 4FQLH 4HGKC 4GAGH 5L2JA 2Y6SD 3VG0H 3D25B 5J6GB 5CZVH 3VRLE 3HR5B 3VXPB 3KPMB 2WUBL 5KZCD 4MX7B 1IAIM 5D2LF 2NY2C 5GSRB 2XNAB 1FVEA 4KQ3L 5DFVC 1SEBA 3EYUL 3C5ZD 3O3AA 2F54B 4KAQH 3PV7A 4U1NB 5HXMA 4PJ5E 1PLGH 2DF3A 1GPOH 5DHYB 5ACLA 1JHTA 1JHLH 4KJQC 4HV8A 1PG7W 3U0TA 1NCNA 5HHNB 2EDWA 4RGMC 2NXYB 3MLUL 4EZMA 4AEIL 4PRHD 2M26A 4R26L 2P49B 3RVTC 3HE6C 5CCKL 1NANI 4YIQA 5I1LB 3DRTB 1U2HA 3VMNA 1O7VA 2BCKA 4EEEA 3UC0L 4HIXH 1CLZL 1NGXB 3FAWA 4M03A 2ATKB 4LCUA 4PRPD 4PG9A 1AIFB 4XVTL 3U30B 4QHLA 3G6AB 2K1MA 1H8SA 4KKAC 2AV1B 4WW1A 5TH2B 5DJ6B 2EE2A 1XF2B 2HKFL 1M4KA 5HYSG 4U1IA 3QNXA 1CBVL 1CGSL 2AKRA 5F3BB 3HUJA 5BO1H 3VRIA 1MCEA 4JVWA 2V2TA 2AJYL 2CDFB 1Y6KR 1BD2B 1CD1A 5FM8A 2X89A 1A4KB 4F7TB 2H32B 4LSSL 4KTYA 4E41D 2ZUUA 4Z7WA 2NNAA 5EULV 4NC1E 5D8JL 4UV7L 5EG6C 4LLYB 1MJUH 3RUGF 3M07A 4WY7L 2BVTA 3ZE0E 4M1GH 3ALPA 2NY1B 1HXMB 1QFWM 1D5ZA 3RDTC 4MD5A 2R2HB 1U95B 1T83A 43C9A 5CZVL 1FE8H 4G6JL 3TN0B 5T1KB 2VABB 3VFTB 4R2GD 3DIFB 4NPYB 5IVNA 3BWAB 3NCFB 3QWRA 4M6ML 4DTGH 3FT2B 2WLZA 4HWBA 4PG2A 1JNNL 3MRFB 1CDGA 4XNUH 3EYVA 1ZANL 1ZVSA 2IGFH 4WFFE 1ZLVH 3GHBL 1GPOL 4ODSH 5D2NC 3LN4B 3O2VL 2BVPB 4M61B 1MHEA 2DQUH 2YA2A 4JHWL 4WI7A 4TUJA 4GG6E 5EO1B 1J1XH 3DECA 2XWBB 2NY7H 5EU5B 1P4IL 4JDZA 1HHIB 4XPAH 2MQ3A 3VXMA 3L9RB 2VZUA 1AGCB 5EU7C 1REIA 4LPXA 4XNZB 3BRFA 3KLHC 3UZEA