5BRZD

Mage-a3 reactive tcr in complex with mage-a3 in hla-a1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
197
structure length
197
Chain Sequence
AQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLYVRPYQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRPGGAGPFFVVFGKGTKLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5brzD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5brzD02
5T5FH 5SWZD 1F4WH 1PKQB 3LCYA 4JKPL 3AM8C 3PQYD 4IM8A 5I17B 1XZ0A 4G6KH 3QO0B 1B4JH 1KC5L 2YHGA 4ODSH 3DARA 5D5MA 3BEVA 1FZOA 4JN2B 1FNSL 4MJ5B 4NM4L 1XGTB 4RGNC 1MELA 5IB2B 4X83A 4YHYC 1BFTA 2NNAA 3FFDB 2MQCA 3HG1D 3O6LH 3IU3B 5I1LB 5D7JC 5FA3A 5D7LE 5D7LA 3BE1L 4Y4FC 4AH2B 1OTSC 4JM2B 2XQYG 1KTRL 3HUJE 3HUJA 4NHUB 2ZSVB 5GS0L 4P4KD 3T0EC 3KJ6L 3UDWA 4ZPVB 3DUHA 5H35A 3GI8H 2HRLA 2G2RB 5I1JL 3HA0A 4ZAKD 4OGXL 3RVWD 2UVEA 3IFLL 3TEUA 3QUXA 2V17H 4QXGL 3VXUE 3VXUA 3UBXB 1ZT4A 4LLAA 4PS4H 2D7QA 2IBZX 4HGWB 1FLRL 4AL8L 5D1ZD 2E7BA 3DVIA 2AJYL 5JR1L 1MCWM 3QI9D 4L8DB 2N4IA 3LN4A 1FYTB 2EDWA 4P2YA 2Q76B 4OFKA 4HF5L 4O02L 3JV4A 1NGPL 3UC0L 1Q1JL 2AEPL 2FJHB 1S7QA 2Z8RA 4N5UA 2K7PA 1KT2A 3LSOB 1DN2A 4JQXC 5J13C 5FF6A 1WWBX 3IDYC 1RJLB 4JFFD 5E8DH 2QSQA 2R0ZH 4P4KC 4CN4A 5ADOH 1WFTA 4YUEL 2ADGB 3MV11 3SDCD 3MRGA 2DQIH 3HZKA 4QT5B 5EDXA 4AG4H 4OAWA 5KTEL 5IQ9A 1EHAA 4KPHL 4ZAKC 1GC1H 3RVWC 2XFXB 3PHQB 3HN3A 5A2LH 3VGBA 2XACC 2JJSA 3VCLB 4PP2A 3VXTA 4L3CA 1A6ZA 3AVEA 3LN5A 5JZ7D 3E6HB 1KFAH 5D1ZC 1G7MB 4LPWA 5HI4D 5GISL 2QADD 1RV6X 3QI9C 3VFTB 4F9PC 4P9HL 5ENWA 4RQQA 1MRFH 4QRPE 4QRPA 4I2XA 1WZMA 2WQRA 2GY7B 4YHYB 5FK9A 1HHHA 4MAYD 5MHSD 5D7JB 3QEGH 3FOLB 2XQBL 1U3HD 5FYJE 4Y4FB 3QUYD 4AEIL 4YHOH 4PRDA 3ULUE 4HD9A 4NWTH 5DJYA 2YD2A 4N0FB 3SDCC 4TNVK 3T0EB 2NY5C 2A83A 1HYSD 3MV8D 1G9EA 1P7QB 2VLRE 5CEZE 2VLRA 3BXNB 1IARB 3BUYB 4FXLA 3RWDA 4M48L 3ILQD 5SWZB 1F6LL 3VRLF 4OQTA 3PQYB 4WU5B 1QFUL 2AEWA 4RZCB 4FFYL 3SE9H 5BVPL 1KB5A 5JZ7C 2ZUSA 4OLXH 5DSCB 2ATPB 5HI4C 4JFQB 2YKLL 3SJVA 2QADC 3SJVE 3G5ZB 4QRUB 1YEFL 3MRCA 4ZDHB 4LLWB 4HH9B 3LH2H 1JWMB 1CFTB 3MRJB 1ZLVH 2O5XH 2C4FT 3CLFH 1XIWD 2NW2A 3HG1B 5BXFB 1OGTB 2FH6A 4LPXA 1PG7X 4MAYC 3E6FA 2HVJA 1DE4B 1U3HC 1JVKA 3HE6A 3QUYC 2A0LD 4XPTH 5J13B 1VCAA 3UPRB 1A5FH 4JHWH 2AV1B 5TDNB 1OAKH 5F7WC 5I74C 3MYJA 1HYSC 3GSRB 4U6TA 1WWWX 2EE9A 4N8VA 2J4WL 4PJAE 4OCWL 4PJAA 4K3JH 5GSVB 3ILQC 3VFPA 4FMFA 2VDPH 3O41B 5FV2A 4ZAKB 4QRRE 1INEH 4WFHE 4J2XA 2EIBA 4X7SH 4UQ2B 5I18H 1YQVL 4PRNB 1JGDA 2DL2A 3DVGA 3KPQA 5D1ZB 4X4YA 4OSUL 4OB5L 2BXYA 3DSFH 4LEXH 1UWXK 3QI9B 1I9EA 3GRWH 4PRIE 4PRIA 5TE7L 3P4NB 4MB3A 1AKJB 2SEBA 1A2YA 5KN5A 1MJUL 4HKJB 4JM4H 1XIWC 5JIPA 1U3YA 1CU4L 4M1CD 1EFXD 4PV8A 3A67L 3FOMA 1ZANH 1QHPA 1ZWIB 2A0LC 4NQED 4N90D 3VG0L 5DS8A 4JFFB 4J1UA 1MCRA 4H5SA 1YMHB 4UNVA 4HUUA 5B8CC 1LP9B 5EUOB 1T22A 4JY4A 3SY0B 4JHAH 1P84K 4IIQC 2JJVA 3WFCH 1LEIB 2XZAL 1GOGA 3SDCB 3CFJB 2GTZA 1WBZB 4R3SA 4RMWA 15C8L 5HYFA 5I8KL 1XF5B 4E0RB 2MCG1 3FONA 3GHBH 2ARJB 1JPFA 1N0XL 3GMPB 1H15A 3LZFL 1NCDL 3G5XB 1RD6A 4N1CA 3JVGC 4KY1L 3H9HB 3GSXA 2QADB 4KKCD 3R06A 3V5HB 3L3HA 4JR9H 3U0TA 3ZDZF 4WVRA 1QACA 4MNHA 1OF2B 4XWOD 1R5VB 2BMKA 1DQMH 4M1CC 5D1XB 5A2IH 5D7KE 5JNYA 3C9NB 4Z7NE 4MJIE 4MAYB 1SHMA 4MJIA 4JANB 1U3HB 3MLRH 5D9SB 5F3BB 3K8KA 5ANME 3LN9A 1W72L 1UJ3C 4K94L 5DRXB 3M17B 3MGOB 3BYYA 3K2MC 3VGDA 5I74B 1A22B 1PQZA 1WICA 3MV7E 3MV7A 3BZFA 2P7TB 3MV8B 2OXHA 1RUQH 4XNUL 5C0JA 5I73C 1UC6A 4E9LA 2FO4A 4Q2ZB 3RGHA 3ULSA 1J05B 4D0CA 4Z78B 1WISA 4PJHE 4PJHA 3PWVB 4GLRH 1IM9D 3QP3A 4NYLB 2PYED 4NUJB 2RIKA 2BXZA 3T4AB 4LCCC 1HQ4B 4KKCC 2WNGA 2Y1VA 1DQTA 3HS0B 1P6FA 3FT3A 1NCWL 4UILL 1HH6A 5I8CB 2R23A 4QHUB 4XWOC 3P11L 1NMCC 3HZMA 1QFOA 4FQHB 1XIWB 4I5BB 3I2CH 1CXEA 3IXTB 2AJSH 4JCLA 4UIMA 2QJDA 5KSVB 3O0RH 2WIIB 3IAQA 5B8CB 1JZ2A 1CD0A 1NCCH 2EXWD 4EXKA 1IQDB 1F58H 1UJTA 4IIQB 5HYSB 3RZWA 1QSEE 1QSEA 3N85L 1ADQL 2HFFA 4NQCD 3SDXB 4NKQB 5JOEA 2H26A 3HC3H 4GAGL 2X1QA 2R15A 4JN1H 4OF5A 4WHCA 4FABL 2P4AB 3RWIB 3QWOB 2VWEE 3W0WD 3GSOB 4EEEA 3G08B 2A9NL 3O2DH 4I3RH 3WD5H 2AXGA 3RTQA 3OX8A 5LGJA 4ZFGL 2CXGA 2V2WA 4YDIL 4WEMB 2XN9D 1F11A 4LSUL 1ZLUK 2R0KL 5I9QC 1N64H 1DVFA 1TZGL 1EFXB 2GSGA 1JPTL 4Y2OA 4NQEB 5KJRH 1RUKH 1QFWM 4FQQA 5SV4A 1MFBH 1DBAH 5E6YA 4DVRL 3JWOH 2EXWC 3WXVL 1Q8MA 1UJ3B 3O3UN 4XXDA 4HUMB 3QG6A 1EGJA 3EOBA 3LEVL 4QF1B 4P23B 1Z9OA 1UYWH 4KUCF 5I73B 3KR3H 3KDMB 4MA7H 3S96B 3PE9A 1MHHB 1ZLWH 4L29B 2I24N 5KSAB 5FM5M 4BH8B 5C1MB 1M71B 3GMQA 1YQ2A 2FD6L 4LCCB 1LE9B 1M05A 3U7AA 3MLYH 1HHKA 4UNTA 4QCIB 3LKRA 4ZS6D 1TVBB 5IB3A 3EFFA 4EVNB 1HXYA 5HGHB 2NY2D 2VR9A 3EAKA 4JKLA 2PYFA 2MNUA 4FQLH 1WV7T 1A14H 5GHWH 5K9QG 5HYJD 4OKVB 3D87B 5JW4N 1GGUA 2BOBB 2DQCH 3KPMB 3VFUA 5E00B 1MCBA 4N0YH 3PXHA 3T0WA 4KK9D 4WFFD 2W38A 5DEZA 3TBYA 1RZIB 3TJEH 1PY9A 2GJ6D 4X80L 4XPFH 5K59E 4K23L 2D7TH 1IM9B 2PYEB 1SJVA 5IVZA 3ARTA 3GSWA 1KJ2B 4JQIH 1XGRA 4YPGA 4NQSA 2ZUWA 4LHUD 4YWGL 1P53A 1KG0A 4QXUL 5C6WH 4ZS6C 4HEME 3R1GL 2MOVA 2FCBA 2F54D 3ET9F 3S34H 1Q0XH 2NY2C 1ETZA 4DUVA 3ZHLA 1KCUH 1CVSC 4NBYB 5I9QB 5CZVL 2BDNL 1TJGL 1TJHL 4OBRA 3C09B 4K7PL 5JOFB 3KWWB 4NQCB 3CUPA 3S35X 4C83B 4KK9C 4G8EA 4O9HH 4PJ5E 4PJ5A 5GRUL 5IBTL 5FO8B 2VDLH 2WWKO 4NO2A 1ZHNB 3LD8C 5J11C 4H26B 1GGBL 4XPBH 4AIZA 5AUMB 3OKYA 1I9RH 1UM6L 2XZQH 4LAQL 5KVEH 4Y2DD 1JTTA 1DLFH 2MCPH 2XN9B 3EYOA 3FT4B 1ERNA 4XMKL 5AYUH 4LVEA 5F9WC 2DKSA 1BZ7B 3SGKA 1DUYA 1J88A 2GCYB 3JTSB 3GK8L 4OCXH 1RVFH 2ZOKB 4MQXD 5ICXA 1A9EA 1NFIA 1MJ7L 1IFHH 2D0HA 1XR9A 1SEQH 1K6QL 2J88L 4HIXL 4ONFH 2D2OA 2YA0A 3VI3F 4X9IA 1AGCB 5DD5L 3IYLW 3JV0A 5F1OB 1A1MB 1WTLA 4YFLI 1RJCA 3WNKA 4EOWL 1FNLA 2Z35B 5CWSA 1PG7W 5IMKA 1IILE 2M26A 4JHZA 4YHKL 1BM3L 2W60A 4EQ2A 3HMWL 3Q6FA 5IB4B 1W72A 4Y19D 2F9BT 3KPOA 2NLJB 3TESA 1A02N 5KS9B 1J0HA 2ZOLA 4TUJA 4OLYH 3SEPA 4B53A 2AKRB 2H9GB 1EAPB 5T3ZD 4Y2DC 3RU8L 1GIGL 2ENYA 2H32B 2DWDA 4ZXBD 2K7QA 1CFVH 4JKKA 1UXSB 5EU5B 2NY2B 3PNWB 3MMEB 2WWKT 3BW9B 1G7LB 4EBQH 5JW4Q 3L7FB 4LLQB 1C5DB 4WNQB 3HNSL 5KZCB 2JK5B 2IG2L 3D9AL 4MQXC 4ONOA 3V6ZA 3BH8B 1HILA 5HYJB 5DJCA 3MUY1 3CDCA 4TPRL 4JAMB 2A6DA 4PPTA 4LKXA 3TH4T 3MLXH 3SQOH 3F8UB 2DQGL 1U91B 1CBVH 3BSZL 4QYOA 3LPGA 5FCSH 5C0AD 3X14B 2N56A 5EH1A 3B4NA 2GJ6B 3LD8B 1M7IB 4MNQE 4MNQA 5J06A 5DGQA 3VFRB 2OQJA 3IDJA 4FOMA 3O11A 5GPRA 1OGAD 4FMKA 3OXRB 3PIQA 1NMAL 4M02A 4XAWH 2AI0L 5HDQL 4LHUB 3MLZL 4ZXBC 2IC2A 1JMZA 4MD5A 3HB3D 1A3QA 1A47A 2F54B 4XCNA 5DJ8A 1MCFA 4V1DE 4V1DA 1NH6A 4K8RH 1KTKE 3SKOA 5F9WB 5EA0L 5CGTA 1HH9B 3MFGB 4UQ3B 2MFNA 1KXQE 3VG9C 5INCB 2IFFH 1LO4L 1RHHA 1KJVA 3H3PL 4OZFB 2X7LA 5EFIB 4HWZA 4D9QE 2VR5A 2VSCA 4DTGL 3PGDB 1R5WA 1VFBB 3AS2A 3H0TA 3U36A 4PJGE 3MROA 4PJGA 3PF2A 1P6AB 3SQBA 1LK2A 1FNEB 5K93A 4J23A 2VH5L 4JG0L 4GKOA 4DZ8B 2FIKA 2J8UB 2IQAA 1NKOA 3O3EB 3FO9A 5E5MA 3UXFA 5DJ2A 5A16A 2XRAL 3RPKA 5E1AB 4L8SB 1OM3H 1I1YB 2R39A 3GI9H 3UYPA 1V8HA 3L1OH 3V0WH 1OSZB 3HB3C 5GGUA 3CVHB 3ZYZA 1GOHA 1PKQE 2J8UF 1PKQA 3MREB 4S11A 3VFNB 3BJ91 5I17A 1NCAL 1UKSA 3T0BA 1F6FB 3MODL 4RBPK 5IMLB 5I1HL 5E5RB 1S7UB 1NCNA 3F6LA 4PR5B 2A9ML 1NMBH 2HWZH 1Z0MA 4MJ4A 1PEZA 3CXHK 2LVEA 5LXGL 4JN2A 3JZ7A 3P4LA 2FX8H 4MJ5A 1XGTA 2VLMD 3FO0L 2EYRB 1AD0B 4PB9L 3FFDA 5IGXL 3IU3A 5I1LA 2F19H 1RK1B 3FRUB 3K81A 5EZIH 6FABH 1YJDH 4AH2A 3Q5YA 1OSPL 3N1MC 1IZJA 4Y19B 4JM2A 3WO3B 4NHUA 1E6JL 3MCG1 1U3JA 5GRJL 4BQCA 5AZEL 3WS6A 2BP3A 5JW3L 4ZXBB 4IRZL 4ZPVA 3TBSB 1D5ZB 3QJFB 2G2RA 4OBSA 4RGOL 3EDKA 3KYMB 3UMTA 2B1AH 4M43H 3UBXA 4DWHA 5HYIA 4HGWA 4TVPH 5I1EL 1L6XA 2R8SL 5MP6L 3QNYB 4R90L 3INUH 4L8DA 1FYTE 1FYTA 2HG5A 2YXFA 2Q76A 4ZOCA 3DHJA 1T80A 5C0AB 3MCLL 1IT9L 1RZFH 2FJHA 5J9PB 3HNVH 4YQXH 3LSOA 2R0LH 3GUTB 2YK1H 3EYUL 4YHZH 4GUPB 5C08D 1RJLA 3BKCL 3V8OA 5GJSL 3GMRB 1OGAB 5EIIB 5FUZH 5E2WH 1TQBB 4GW5B 5E08H 2ADGA 4FG6D 5DZLA 4XBEH 4NSKB 4UV7H 3FQWB 3WIHH 4OFVA 3IRZA 3NA9L 5EWIH 2XFXA 3PHQA 4ZO9A 4KHXL 4LU5L 3AM8A 5LG1A 3VCLA 2Z31D 3U4AA 2VXVL 4Z7VF 3E6HA 5EU6D 1G7MA 4ALAH 3WUWB 2DJUA 1KLFA 5KAQG 5ITBL 3QQ4B 3VFTA 4OGZA 1G6RB 4Y5YC 2UWEB 1I9IH 2V5SA 5JHLH 1IGIH 2DIBA 1REIA 3QZWG 5E7BA 2B7DT 1MCDA 1BQLL 3GDBA 1ZHLB 3LKOB 5D7JA 3B9VA 3FB6B 3FOLA 5FEBA 5L7XH 4Y4FA 2C1OB 3VRLE 1J7VR 2HAZA 2Y36H 4XCFL 4Q0XH 1IQWL 4N0FA 2YD6A 4FG6C 1UQSB 1MHPL 3DVFA 3T0EE 3T0EA 3HZYA 1P7QA 3QCUH 3QA3B 1DR9A 3P40A 3BXNA 2VRAA 3HI5H 3BUYA 4LRIC 5SWZE 5SWZA 2Q8AL 1FBIL 4P59L 1S9XB 4ZSOB 2BVOB 3PQYE 3PQYA 3PGCB 3QQ9D 4WU5A 3JTTB 4RZCA 1H3PL 1F2XK 2Z31C 2ZUTA 4OIIL 5DSCA 1FRGL 2ATPA 3HRZB 4JFQA 3G5ZA 2OJEB 3PUCA 3AFLA 4QRUA 5LCVL 2AEQH 2CIKB 4ZDHA 1NGWB 4LLWA 4HH9A 5L8JB 1JWMA 1CFTA 1XR8B 3MRJA 4UIKH 2DLEA 4K7PY 4JB9H 3VD7A 4RDQG 2VSDA 3NACL 5E8NB 4LHJB 1JRHL 4S1RL 4U1HB 4HJGB 3TGXA 5IF0B 2VJXA 3HG1E 3HG1A 3TZVD 5BXFA 1OGTA 4YHML 1WZLA 4NT6B 4Z7QF 1IE5A 1DE4A 2E6JA 4RAUB 5MENE 4JQXA 3UPRA 1IAII 2L4OA 1YEJH 4BSVB 2AV1A 5C2BL 5TDNA 3MOAH 1P5VA 3CDGB 4X6DB 5CILH 3PDGA 1L0YA 4LLYB 1YDPB 3GSRA 5C07D 2XG4A 4E5XB 1I3GH 3GSQB 3KPSD 5GSVA 5BV7H 3ZKXC 3O41A 4ZAKA 3QQ9C 1MCSA 2GI7A 1KB9K 2NTFB 3MXWH 4UQ2A 4K9EC 2J7LA 4PRNA 5D1ZA 2E3VA 3MLVL 1PX4A 4U6YB 5FOBB 3QI9A 5D6DC 4J3TA 5E2TL 3P4NA 4F9PA 4IMLB 1LD9B 2VAAB 1AKJA 4Y5YB 1MQKL 4HKJA 3TZVC 2X05A 4PY8I 1JGUL 1ZWIA 1CGWA 2VZOA 5C08B 4H1LB 4JFFA 1YMHA 5IEKB 1LP9E 3BUTA 1LP9A 5M7QA 4WDIB 3SY0A 2HKHH 5D2LB 3BKYL 4W6YB 3GMOB 1VPOH 1LEIA 5DD1H 3CFJA 3GJFB 1TPXC 1WBZA 4J6RL 4Z7WB 4XP4L 4F57H 1CTNA 3LEYH 1IGFH 5HGBB 1XF5A 4E0RA 3VGEA 3GZKA 2ARJA 3GMPA 4ZUSB 3C5SB 1U2HA 5HDOA 3NIFF 2Z31B 1RPQA 2EH7L 3G5XA 5EU6B 3VXOB 1XMWA 3H9HA 4OFYD 2HFGH 3A0OA 1I7UB 1IBGH 3V5HA 2YPLD 4I3SH 1QZ1A 4G6JH 5ERWB 4ZUVB 2BHYA 2ZCKL 1OF2A 1R5VA 1UM4L 4OV5B 4L1DA 2XWJB 4W4NA 5HI3D 5D1XA 3C9NA 1O0VA 5FDYA 4MAYA 5MHSE 1HN1A 4JANA 1NGZB 1U3HA 5D9SA 5F3BA 1JYXA 5DRXA 5C0BE 5F6HI 3U2SB 3M17A 5TQ0L 3MGOA 4NHCL 3TNNB 1UM5L 3WKNA 1YNLL 4MB5A 3GIZL 3MV8E 2P7TA 3MV8A 5TFSH 4LCIL 4B0MM 2VR4A 1C5BH 5HPMB 1SYSB 3QXAB 3ZKXB 3A6CL 4KQ3H 3LKSB 4Q2ZA 1F90L 1MPAH 1J05A 4Z78A 1MHCB 1WBYB 2RBLA 3PWVA 4UT7H 2D03H 4HFUL 4JDZB 5DTFB 4NYLA 4NUJA 3B5TA 3QIUD 1FLTX 3T4AA 1MCKA 1HQ4A 2BVPB 3NFNB 3HS0A 2RCSL 5I8CA 4QHUA 3IU4H 4H88L 5IKCB 5HI3C 3VGAC 4FQHA 1XIWA 4I5BA 3TZVB 4D9LL 3RPIB 3IXTA 4N8VG 1I8LC 2R4RH 4AEFA 2ZUUA 3WFEH 3BT2H 2AVGA 5KSVA 2AERT 2WIIA 2M1KA 5B8CA 5CGMA 1IQDA 3THML 4IIQA 3HMXA 5HJ3B 5HYSA 1KCVH 1OAUH 5C07B 3CDFA 5F1IB 1J5OL 4Z8FL 3KPSB 3O9WD 3SDXA 1T2JA 5I76B 4LSRL 3HE7D 1QLFB 1T2XA 4ZFOL 2YD1A 1E4XH 3RWIA 3QIUC 3QRGL 3QWOA 4I77L 4NWUH 3GSOA 3DETD 3JVGA 3G08A 1UH3A 2ITCB 1DLHB 2ID5A 2WUCH 4R4FL 3BFOA 4PJ7F 5DQDH 4TQEH 5FHAH 1S7TB 2UUDK 3OKOB 7FABL 5BZDB 4H8WH 1ZEAL 1EUTA 1DTUA 1JF6A 1EFXA 4JFZH 4JFXB 4NQEE 4NQEA 4N90E 3QULB 3OTTA 1UJ3A 2AABL 1Z9MA 4IOIB 4M5YH 5IHZB 5J6GB 1H8OA 1EO8L 4QF1A 2JJWA 4P23A 2MMXA 3E1F1 4MAUL 1RIHL 1VADB 3O9WC 1FO0H 3ARDD 1A3RH 3CVHL 3KDMA 4P3CL 3HE7C 3S96A 1MHHA 3A6BH 4L29A 4LSQL 5KSAA 4ONGL 5DEGB 4XCCL 1P7HL 3DETC 4BH8A 4PRAB 1M71A 4LCCA 2JB5H 3W39B 1LE9A 5IFAL 3RWHB 5FYLH 3MUGB 4Q97A 3U7YL 4QCIA 4YO0B 1TVBA 4ZD3H 1EMTL 4EVNA 3MACH 3P9WB 5HGHA 4DKFH 1L9MA 2CR6A 2XY2A 1KJ3L 1X5XA 3D18B 2K9UA 1MCCA 3KPRD 4ZUTB 3S36L 3BGMB 4OKVA 2FBJL 4OF7A 4W68A 3N0PB 4EJ1C 1HWHB 2D4FA 1WSST 2BOBA 5KSBB 1T20B 1RULH 3KPMA 5E00A 5T3ZL 2FB4H 3ARDC 3CFCL 4HPOH 4YFDB 2MTPA 1OP5K 1B2WL 4NJ9L 4XHJD 1RZIA 2Z9TA 2VXUL 5GRVL 4JPKL 3L3DB 4FQJH 1IM9A 2PYEE 2PYEA 2P48B 3QIUB 3U4EB 4RMVA 5FDWB 1KJ2A 3OWEA 4C55A 3AY4C 4X0KB 1NCUA 2BJML 1TFHA 5E6ID 4LARH 1JBJA 2AQ1A 2YD4A 1YPZB 5HHXH 2ILLA 4ZUUB 3GNML 2HTLD 1AR1D 2MPAL 3RIAK 1OAQH 5JOFA 1H0DB 5C0RH 3V8CA 2YSSB 5IMMB 1V7ML 4NQCE 3KWWA 3O9WB 4NQCA 4C83A 5E2JA 1YPZF 2NY4B 3UTOA 3C5ZB 1BBJB 3MRQB 4XHJC 4L9LC 5FO8A 5HI5D 3HE7B 1ZHNA 2B1HH 4HCRA 3N06B 4ODHL 5I2IB 1I9JH 2JKXA 4H26A 4K3DL 1VFMA 1N6QL 1W0WB 4CVXB 5AUMA 5BO1L 5TE6L 3PDOB 2E9IA 1BGXL 3C2AL 5DF0A 5FYKD 4DN4L 2VKWA 3QAZC 1S7RA 2IEPA 5CSGA 2HJFB 2XN9E 2XN9A 5E6IC 1LE5B 3ARFD 3VWJD 2ZG2A 4UTAH 5IVXB 1BZ7A 1JPSH 2R2HB 2RQ8A 2GCYA 4GSDL 1LNUB 3JTSA 1CXFA 4JZNB 2ADJB 2HTLC 2ZOKA 2OR7A 1AR1C 4GQPH 5F9AC 4HBQA 1F6AB 1QYGH 1RURL 3VD3A 2YA1A 3C08L 4D0BB 3BWUC 4K7PX 3UJIH 4Y4HB 1VDGA 2X1WL 1AGCA 1UEMA 3VH8B 3VA2C 1L4IA 4WGWB 3MRKB 1A1MA 1BEYL 4XVSL 5F9OH 5HI5C 2Z35A 1K3ZA 5DC0A 1EUUA 2IPTL 4JDTH 2QQNH 2H2SD 5IB4A 1T3FB 3TYGH 1BIIA 1GH7A 4KRLB 2NLJA 1A7QH 3CMOH 4GG8B 5KS9A 2DM4A 5KS9E 3MSPA 3V6BR 4JPVH 3OZ9H 2N7BA 3ZTNH 1QD0A 2AKRA 1X4XA 2H9GA 2FR4B 3DYMA 1EVUA 1EAPA 4OD2B 4QHNB 3NFSL 5F21B 2CMRH 5KVFL 2H32A 1UXSA 5EU5A 3ARFC 1F2QA 4WI3A 3VWJC 3PNWA 5KG9B 3MMEA 3BW9A 1G7LA 3MC0A 4M7LH 1CDGA 3L7FA 4LLQA 5FHBL 4PUBL 1C5DA 2OL3B 4WNQA 3CC5A 2JK5A 1XF1A 2ICES 5IB1A 3BH8A 4XP9H 4ZYKB 5HYJE 5HYJA 4ZMAT 3LKQB 1IGJB 4JAMA 1EIBA 4XNYL 3TO2B 2W0LA 4NOFA 2FGWH 1U91A 4PGJA 4YBQD 3UYRH 3HNTL 3X14A 1FL3B 4AIXA 4L9LB 5E4EC 2H2SC 3ZHDA 2GJ6A 4GMTH 4YX2H 1M7IA 3KXFD 3BDYH 3VFRA 1NBVH 1UZ6E 5IBUG 4R6UA 1KN4H 3OXRA 1S7VB 3BZ4B 4LHUA 5ID1B 3QAZB 1H3VA 5BOZG 5B22A 7CGTA 3FCTB 2F54E 2NYYD 2F54A 3M07A 3O45B 5I71C 1U0QA 1BZQK 3IETB 1HH9A 3OAYK 4U0RC 4UQ3A 2PCPB 4FZ8H 4CDGC 5INCA 4JRYD 4AEHH 1TTGA 3CSPA 3B8SA 1CL7L 3ULVL 2QSTA 5EFIA 4PD4J 1T04B 4MD0B 3AU1B 1F3DJ 3GFUA 1T6WA 3PGDA 5CJ8A 4YBQC 1F4AA 4IOFD 1ZMYA 1QRKA 2XG5A 3NGBC 1FNEA 1HKLL 4Q9CA 5DT1L 4XNXH 4DZ8A 3NTCL 2J8UE 4F7EB 2J8UA 1W8OA 4MNGB 1JHTB 3O3EA 3MUJA 2I07B 1E6OH 4CNIB 1CCZA 3K4AA 3S4SB 3VXRD 3LQZB 4L4JA 5E1AA 2F58H 1WAAF 4L8SA 2QLVB 1I1YA 1KENH 2EKSB 5CEXB 1YN7B 2JF1A 1OSZA 2NYYC 3CVHA 5DA4A 1CIUA 2DBLH 2PR4L 3MREA 3ARFB 3VWJB 5HPOA 5KOMC 4LPTA 1Q94B 1D5XB 4EDXA 4JVWA 5IMLA 1E4WL 5EOTB 1S7UA 3S35H 2CUHA 4PR5A 5JW4R 2XTJD 3FT2B 2XA8L 1JZ4A 1SEBB 1OP9A 3O2WL 4IOFC 4LIQE 2EYRA 4MA3A 1AD0A 4F7MB 2R4SH 4O51B 1P4BL 3M1BB 3QISA 5D71H 1WTGT 3RX7A 1RK1A 3FRUA 3I9GH 2Z8SA 5E4EB 1VEOA 1YYMH 1I8KB 4Y19E 4Y19A 4WHYG 4KTDH 1AC0A 4F15C 1RIUL 3K3QA 4LK4A 5DJDB 5B21A 1OTTD 5T3ZE 1U42A 3WEXB 4PLJD 5AAWA 3GM0A 4ZXBA 3TBSA 1D5ZA 5DQ9B 1IC7H 1P69B 3QJFA 1QNZH 3MLUH 5I71B 1RUAH 5D7SH 3ZE0F 3KYMA 4U0RB 3QUMH 4WIQA 1DQQB 2YD3A 4F8QA 4OM0L 4JG1H 2XTJC 4CADB 3QPQD 1OAXH 4P46D 3TP4A 4F7TB 3VXMD 3FN0H 4LBEA 3QNYA 5ALBH 3U46B 1JV5B 1I8IB 2OX5A 4QHKJ 4UINL 4DN3H 5C0AE 5EIVA 3NGBB 5C0AA 2Z0BA 5J9PA 2MWCA 1B0GB 2QSCL 3VDCA 3GUTA 3KXFB 4GUPA 1OARL 1OGAE 3GMRA 1IAOB 1OGAA 5EIIA 1LEKB 1OTTC 4GXVL 4GW5A 4Z7VE 4X9FA 4NSKA 3FQWA 4PLJC 2A77L 5E70A 12E8H 3FQRB 1I1AD 4NJAL 4WI2A 3U6RB 5FV1L 5FYJH 3S88L 4KXZH 4WW2F 4TYUA 8FABB 5CP7B 1G9NC 3QPQC 4YJZL 4P46C 3H6JA 3WUWA 1HWGB 3MRLB 3D2UD 3BEWB 4HAGA 2FZ3B 1UCTA 3QQ4A 1G6RA 3U1SL 3TNMB 1IAMA 2UWEA 1B90A 3QWRD 4PJCF 4HPYL 2HLAB 5GJTH 4G7YH 1ZHLA 5D72H 3LKOA 3FB6A 2DQJL 1RZJH 3BDXA 4Q9RH 1PBYA 2C1OA 3NH7L 1WK0A 4XC3H 3DECA 5JXAH 3WIIH 3AMKA 1UQSA 1GOFA 2ZCHL 3QA3A 2DLGA 1I1AC 4ENED 5E8OB 4ESKA 1A0QL 4M6ML 5ACMA 2Y5TB 1IGTB 4ZSOE 1S9XA 3EFDH 2BVOA 4LVHC 1CGSL 3PGCA 4ZSOA 3WDIA 3JTTA 1CICD 2AJXH 4JO1H 3HRZA 5FGBC 5DK0B 1KPRB 4Z7QE 2XTJB 4JFDE 1DL7H 4GAJL 4KQ4H 2CIKA 5DWUH 1ZSDB 2QQKH 5DUML 1NGWA 1XR8A 3G04B 2VLME 5E8NA 25C8L 3REVB 4LQFH 4U1HA 1MCOH 4HJGA 1YEKL 4MJ6B 5D4QA 5D7IF 3QWQB 1LO3H 5IF0A 4WRLA 4NT6A 1FNAA 2DRUA 4RAUA 4M1GH 3RDTD 3BKMH 3RVXD 4ZTPL 1NLDL 4BSVA 2J6EL 2F5BH 5DJ6B 43CAB 4FQCL 2AJVH 4X6DE 2Q6WB 3CDGA 4X6DA 2CXKA 2QR0B 3UBXG 1KBGL 4LLYA 1YDPA 5FUOL 3IFNH 3FO1B 4E5XA 4HSQA 4ENEC 3GSQA 1XCTB 4WFGD 2E6PA 3P9MB 1N4XL 2VC2H 3CZJA 4XI5D 5CZXD 2HT2D 4L8CB 1CICC 4DKEL 2X4RB 1JZ5A 4PRPE 1NSNH 2NTFA 5BMFH 4XNMB 1CT8B 1N7MH 4P46B 3RL2B 4Z7OF 1HXMB 3VXMB 1DQJB 1KGCD 4U6YA 5FOBA 1H5BB 2L7UA 1S5IH 3ZKSD 1EX0A 4IMLA 1LD9A 2VAAA 5EC1B 1YA5A 3L3OB 4Y5YA 3SPVB 4N1EA 2P44B 1SM3H 4ODBD 1CE1L 2D7PA 5DDHB 2KZ1B 3IXAB 4FNLL 4R0LC 3RDTC 1VFUA 4H1LA 3RVXC 4NZDA 5LGHH 2ZWLT 2NY7H 5IEKA 1LO0L 4MLSA 2XXMB 1I7TB 4WDIA 3S7GA 5D2LE 5D2LA 3GMOA 4NQTA 1JYNA 1BZ9B 1LDPL 4UDTB 3GJFA 4JKPH 5DFTA 3WO4C 5ID0B 4RMSA 1T83C 4LKCB 2CH8A 4Z7WE 3LAFA 4Z7WA 4XI5C 5CZXC 1JNNL 4LRIA 4F58L 5HGBA 1KC5H 2HT2C 1VFOA 1ZT7B 2VDRL 4LVHB 4ZUSA 2VUYA 3C5SA 1WT5C 5GGSY 2Z31A 5T1KD 1SVZA 5EU6A 1FNSH 1KXVC 4NM4H 3VXOA 4QO1A 1HK6A 1I7UA 3D2UB 5DMYA 4QEGA 1CYGA 3P77B 4MXWL 4J3UA 5ERWA 4ZUVA 4NZRL 1R3HB 2BOCB 3CU7A 4KMQA 1YEEL 3BE1H 4OV5A 2XWJA 3T8XB 1A4KB 4IMKA 1BBDL 3B9KB 4U31A 5GS0H 2CD0A 2IQ9L 1HI6B 3E3QC 1NGZA 3KJ6H 2BY3A 3DUUB 3CFIC 4RA0C 3U2SA 3M45A 4F9LC 3TNNA 2Q7YB 5I1JH 4OGXH 3IFLH 4QXGH 1SJEB 3I02B 4K55A 5HPMA 1SYSA 2F8XC 3QXAA 5GGTA 1FLRH 2FX7L 3LKSA 4LEOB 4AL8H 5INDB 1MHCA 1WBYA 4FQ2L 2AJYH 3QQNA 1CICB 1U93B 3UTQB 4JDZA 5JR1H 5DTFA 2EDJA 5JOPD 3K74B 5HHVL 3VFWB 3QNZB 2BVPA 2LU4A 3NFNA 1TTFA 1HE7A 4XBGA 4HF5H 3BWAB 4O02H 1NGPH 4GLRI 1Q1JH 5D6DA 3UC0H 4YFEA 2AEPH 5IKCA 5IROC 3RPIA 3QXDB 4YUEH 2KUTA 2WLYA 4R0LB 3RDTB 1HINL 3BIKB 1LWRA 1RZGB 4LSTL 1M6OB 1RFDL 5KTEH 2VDOL 5HJ3A 4KPHH 5DQJB 2EKJA 1AH1A 5C07E 5T5NF 5C07A 5F1IA 3WO4B 2YBRB 1EJOL 3KPSA 1MRCL 5KW9L 5I76A 1ZTXL 3E2HC 4WI9A 2GKIA 1QLFA 5GISH 5TDPB 1JGEB 4JY5L 4P9HH 5JMOC 1GSMA 4PJFB 3U0WL 4HKZB 4PYGA 1BD2E 1BD2A 3O6KL 2ITCA 3NZHL 5A3ID 1UKTA 4JGMA 1JI1A 1VA9A 1DLHA 2AK1L 1MVFA 2XQBH 1S7TA 3OKOA 5BZDA 3BPLC 4HAFA 4AEIH 2HH0L 3D0LB 3Q0HA 1C1EL 4HUKB 1NC2D 4JFXA 5E99L 1KULA 3QULA 2FIRT 4IOIA 4M7KL 5IHZA 5J6GA 4M48H 3T0XA 5FYKL 2HFEB 1VADA 5J57B 3W82A 1QFUH 4FFYH 2QSVA 3BD3A 5BVPH 2YKLH 4X8JA 2WBKA 1CQYA 1YEFH 4PJEB 2I60L 5DEGA 5T1KB 4A6YL 4TOYL 1EZVY 1NAMB 4CU8A 1A6VL 4OFYA 4PRAA 4QWWD 3W39A 5A3IC 3RWHA 3MUGA 4KGLA 4YO0A 4PGZA 4Z76A 4WWID 1NCBL 3D18A 2YZ8A 1I8LA 4OI9A 4ZUTA 2X5PA 1UA6L 3BGMA 2WSKA 2NQCA 2J4WH 2EIDA 5C0FB 4OCWH 4W6WB 5KSBA 1T20A 2LE9A 1ZKAA 4G9FD 3WXWL 4KV5E 5C0ND 5EO9B 3TWCL 1MNUL 1VHPA 3V4VL 5IFHL 1YQVH 3CH1B 5HHNB 1QOKA 2P47B 3L3DA 4OSUH 5C2UB 4P99A 4OB5H 1JTOA 3S8WA 4BSWB 3QIUA 5TE7H 3U4EA 5CP3A 4QWWC 1EA9C 5FDWA 2GSIB 2BRRL 2DAVA 5I1KL 1MJUH 3B43A 1CU4H 1YUHB 1G7HB 3A67H 1EH9A 4X7DC 4X0KA 3VG0H 3BPLB 4UT6L 4UZGA 2D7MA 1QLEL 1E28B 1YPZE 3QUZD 1YPZA 4N5ED 2BVQB 5FXCH 2XZAH 4ZUUA 15C8H 4LF3B 2V7NB 3S36X 1PX3A 1OPGL 1H0DA 2NY0D 4MMZC 5DJ0B 5I8KH 2YSSA 5IMMA 1TVHB 2ZP0T 1N0XH 4X7CC 4S1QL 3O9WA 4D3CL 5BS0D 4D9RE 5C0NC 3LZFH 1GGCL 1NCDH 1P9MC 3C5ZA 3LS4L 1BBJA 2VYRE 3MRQA 2EH8L 2J2ZA 1BWWA 2DMKA 3HE7A 4KY1H 5F7DB 4CJ0A 3I50L 5I2IA 3K46A 2IAND 2CRMA 4RGMC 1W0WA 4CVXA 1GPOL 1L7TL 2B4CC 3PDOA 3PWNB 1RZ8A 1ROWA 3OGCB 1HHJB 4U7KA 2HJFA 1TDQA 3GHEL 4JRXD 2CJUL 1MOEA 1CGUA 1LE5A 1KCSL 1W72H 4K94H 5IVXE 1AHWC 1NFDB 2APBA 2HVKB 1RIVL 4G42B 3SE3C 5IVXA 1NC2B 2R2HA 3QUZC 4N5EC 5LWYL 1LNUA 5HHMD 1P1ZB 4JZNA 2ADJA 3MPCA 3WFHB 4ZTOL 1F6AA 4XCYB 2DM2A 4MCZB 2NY0C 2W9EL 4XNUH 3ZDXF 1VB9A 4D0BA 1YC7A 3UTSD 4EN3A 3WS3B 4Y4HA 4R7DB 3VH8A 1NFDF 2GTWB 4F3FB 4YGVB 1U8KB 3MRKA 4FTVD 5E9DD 3O8XD 1JIBA 5L2KD 5F88B 3CAFA 3MOBL 1NCWH 4UILH 4GG8A 4YZFE 1G84A 3P11H 4N8PA 5IJKC 2FECL 4HWBL 4GS7C 2FR4A 4XBPB 1O5DT 4OD2A 4QHNA 1AC6A 4GRWF 4NDMB 3G6JF 1QFPA 3AY4A 4JJ5B 3T1FB 5KG9A 3EOTL 1FFRA 4LVOC 2OL3A 1Y18B 3PWPD 4ZYKA 2BERA 3LKQA 1IGJA 4PRHD 3W5MA 3N85H 1ADQH 1CQKA 4P57B 2PUQT 4GAGH 3DX9B 3TO2A 3NAAL 3V0AC 3WFZA 4G9FB 1GGIL 5DI8B 4FABH 3O8XC 4TUKL 1FL3A 4ZO8A 2APTA 4L9LA 4MMXC 1D5BB 2FHCA 2A9NH 2FYYB 2O61B 3W9DB 4NO0D 4ZFGH 4NO5B 1AR2A 4NRYB 4AQOA 1T2QL 4CVWA 4YDIH 1S7VA 3BZ4A 4LSUH 2R0KH 4XMPL 3WJJC 1TZGH 5ID1A 2BVEA 2BNQD 1F3RB 1JPTH 3FCTA 3KPNB 1GZPB 3O45A 5T33L 3CX5K 4DVRH 4HUWB 3IETA 3WXVH 4CU7A 1AHWB 2PCPA 5HDBE 1T0PB 1JNHB 3ABZA 3QUZB 2F53D 1S7WB 3LEVH 4OLVL 3QXTA 1T04A 3BPCB 4U7MA 2NY0B 4MD0A 3AU1A 4D8PB 4YC2C 2R1XB 2X40A 4ZOBA 3KLAB 5BS0B 1F4YL 1ONQB 3VA6A 2MJWA 4HT1L 4M62H 4PJXB 3NPZB 2A38A 2FD6H 5K9JL 5E94A 4J12A 4F7EA 2IANB 4MNGE 4MNGA 1JHTA 4KI5D 3BYTA 4Y8AA 2I07A 4CNIA 1T89C 3S4SA 1JF1B 4Z77B 3LQZA 4HG4J 5TDOB 5HVFB 4GS7B 2EKSA 4M93C 5CEXA 4PBVC 5L8LB 1YN7A 4PJXF 4WTXA 3HKFA 2VIRB 1T0NB 4JRXB 3SE8L 4AENB 4J3VA 3MTRA 5DZOA 4YAQB 3ARFA 3VWJA 3BISA 4LVOB 1TLKA 1Q94A 1D5XA 3ULVF 3MJGX 3QO1B 2RFXB 4QXTB 3FT2A 2EDRA 3WYRA 1NAKL 3UTSB 3NCYS 1SEBA 4X80H 2FWOB 4F7MA 4FTVB 4K23H 4O51A 5E9DB 3O8XB 3M1BA 5I6XC 5L2KB 2IALB 1DQDL 4HV8B 3BMWA 4ISVB 5L8KB 1I8KA 4KI5C 4YWGH 4QXUH 2NR6D 4QOKD 3ZE0E 5T1MB 1EEYB 3R1GH 3RP1A 2CDEB 2Y4SA 4U1JB 3Q6GL 3WEXA 3Q5TA 5CZVH 5DQ9A 2BDNH 1TJGH 1YECL 2QQLL 1TJHH 2VKXA 5L2JB 3WL9B 4K7PH 2OJZL 1SMOA 3PWPB 1DQQA 4PRHB 4JVUA 4CADA 5C6TL 4F7TA 4FQXC 5GRUH 5IBTH 5F7HA 4WI5A 4YC2B 3U46A 1JV5A 3TH3T 1I8IA 2P5WE 1GGBH 1CLCA 4LHUG 1AO7D 3GO1L 1B0GA 2V2TB 3KXFE 3KXFA 1V3KA 3EYQD 4X6BB 1UM6H 4Z7UF 2NR6C 1T1XB 4NO0B 2D31B 4QRPD 4LAQH 1G1CA 1IAOA 1LEKA 4B50A 5HTSA 3ZTJG 4XMKH 4OZFG 4M93B 2BNQB 2VDNL 5HYQB 3OKMB 3FQRA 2FDBP 3GK8H 4ZFZB 3ULUD 2P1YA 3U6RA 2W07A 3BP5B 3Q1SL 5CBEB 1MJ7H 8FABA 4U6XB 1K6QH 2F53B 2J88H 1EZVX 4HIXH 5CP7A 2VLRD 2D3VA 3W5NA 3R8QA 2PTVA 5DD5H 3MRLA 3BEWA 3P9LB 2FZ3A 4EOWH 1UWGL 3BN9D 1G7QB 3ROLB 3TNMA 4YHKH 1BM3H 3HMWH 2DKUA 3I85A 3BIBX 3SJVD 2HLAA 5I6XB 1ED3B 3D5OF 3TV3L 1DUZB 5ICZB 4WUKL 3EYQC 5FM5O 5DD0L 2MKWA 1YNKL 3BRDA 3RU8H 1JPGB 1GIGH 2F8VA 5C71A 2KH2B 2DLIA 5IT2L 1GGYA 3NIGF 4OCSL 2F15A 3DXAD 3N9GL 5E8OA 2IG2H 3ULUC 4DAGL 3D9AH 1J1PL 2A74B 2Y5TA 1CGTA 1IGTA 2KKQA 5TF0A 4YHLL 2XI9A 4TPRH 1QLRB 2A6IB 4S1DD 1KCKA 1FNFA 1PGRB 2LU7A 1T03L 1ZGLA 5DK0A 1KPRA 2DQGH 2XTJE 4HJ0D 1J10A 3DX7B 3BSZH 4QRRD 1R5IB 1ZSDA 4GG6B 4FQXB 5HHPB 3BN9C 3G04A 4N9OB 3T09A 1X5JA 3UTZB 2YWZA 3REVA 4OF8A 4MJ6A 4PFEA 2UV3A 2ZSWA 4JPWL 3WHXB 1NMAH 4GG6F 4NN7C 2AI0H 5HDQH 3JWOC 4QOKB 4M03A 3MLZH 3QHFL 3K4ZA 1M7DB 5DJ6A 43CAA 4WW1A 2Q6WA 4L4TD 3TCLB 4S0SD 4UI2A 2AP2A 2QR0A 4OCMC 3LRGA 5EA0H 3FO1A 4Z7OE 1DDHB 1X9QA 1XCTA 1LO4H 2D9CA 4KDTC 3P9MA 3V79C 3H3PH 4MXVF 4S1DC 4L8CA 5CUSL 2DM7A 2X4RA 4LSPL 5HYEA 4DTGH 1R3KB 4XNMA 1CT8A 2GITB 4HJ0C 4P46A 3RL2A 5I0DA 3VXME 2KBGA 1HXMA 3VXMA 1DQJA 1H5BA 3LMJL 4WENB 1QEWB 2OTWB 4HUVB 1A6WL 2VH5H 5EC1A 3L3OA 4JG0H 3SPVA 5DDHA 1T7XA 1A6UL 1AO7B 1Q9LB 1RUML 1ZXQA 3IXAA 2XRAH 5H8DA 1T5WB 5ENWB 2V5RA 3G5VB 2E7MA 1I7TA 5DMKB 1BZ9A 3OKNB 4UDTA 5ID0A 1NCAH 4HHAB 3WUWG 3MODH 5I1HH 4JDVB 4OZIB 1U8IB 2A9MH 3VI4F 3QDHA 3UCRA 5LXGH 2XNAB 5DLML 3WNNA 5FGBA 4FXGB 3AAZB 1XGUB 3FO0H 3QHZL 3D2UA 4PB9H 4OZIF 5IGXH 3P77A 3U9UB 1R3HA 5B38A 2BOCA 3WFBL 3QWRA 1OSPH 2A1WL 2VLLB 1IKFL 5HDLA 3T8XA 1A4KA 4H25B 3CSGA 3B9KA 5K9QI 2EE6A 1E6JH 1HI6A 4FHBD 5GRJH 5AZEH 4NQVB 4NN7B 3DUUA 3VD4A 5JW3H 1RUPL 4PJIB 5FM4A 2GK2A 4IRZH 4C4KT 2Q7YA 3ARGD 5MEQB 4RGOH 1KPVB 3DXAB 2WANA 3TF7C 1SJEA 3I02A 4XP1L 5HGDB 5CIPB 4LEOA 5I1EH 5INDA 3VMNA 2R8SH 5MP6H 1CICA 1U93A 2ZKHL 2YD9A 3GMNB 4R90H 4OD1L 3VFWA 4HWNA 3QNZA 4QRRB 3BWAA 3MCLH 1FVCB 1IT9H 1PSKL 4XAKE 4HUXB 5C8JB 3EYUH 1RJZB 3BKCH 5GJSH 2BFVL 3EJJX 3QXDA 4R0LA 3RDTA 2GYSA 1QBBA 3BIKA 1RZGA 5A2JH 1M6OA 4ODVL 1HIML 4POYA 4L4TB 3BRFA 3ARGC 3DO3A 4JCMA 5DQJA 3NA9H 3HHRB 2B4CL 4KHXH 4LU5H 2YBRA 4M5ZL 3AC0A 1T83A 4WFGE 2QTEA 5LGKA 2NW3B 2VXVH 4KWUA 5LBSL 5B3NA 1J8HD 4YPJA 4UT9L 4JE4B 4UOW1 5TDPA 4PJ8D 1JGEA 3BJLA 5ITBH 1WT5A 2X42A 1JJUA 4PJFE 4PJFA 3RWEB 2YD5A 3T2OA 4HKZA 1KGCE 1CDCA 1ES0B 3OKEB 1E4XI 1IAKB 4DQOL 4H1LG 2HKFL 1BQLH 3EGSB 4OCYL 4LMQI 4CMMB 1FGNL 5HSFA 2X4SB 1HSBB 3FFCE 1ACZA 4K8RD 1HSAB 4XCFH 1IQWH 2IH1B 1MHPH 2WAHA 4BZ2L 4YNYB 4P3WA 1DBBL 2PXYB 4F9LA 2Q8AH 3LQAL 1FBIH 4P59H 1X5HA 2HFEA 4G5ZL 5ANMB 1H3PH 5B39B 3ZDYF 5CJXA 5JDJA 1KIPB 4OIIH 3RVVD 1FRGH 4PJ8C 3KLHD 3OKDB 5LCVH 4PJEE 1QO3B 2KPNA 4PJEA 4KKNA 4WU7B 5HY9B 1NAMA 3CJJA 4RWHA 4AEEA 3NACH 1JRHH 2W59A 4S1RH 3GBNL 3ZE2F 4Y7MA 4HBCL 4YHMH 5CD5D 1OQOA 1QKZL 2WM0A 4GXUN 4XP6L 5DUPL 5IROA 4K8RC 5T1LD 3PV6B 2EYTB 2FJGB 1FG9C 4U6VL 5C2BH 2GW5A 5DD6B 3CIQA 5IFJB 3QDMD 3U7WL 4K3GA 4Q9QL 1TVDA 1AD9B 2WUBL 3AMLA 3JWDC 1CFNB 3FKUS 5C0FA 4X4ZA 1MJ8L 3WHE1 5FAAA 2V5MA 3ARGB 2WINB 4DGIL 1JZ3A 3L6FB 2AJZB 1X5AA 1ZVSB 4K7FB 3L5WB 3Q5OA 4G8GE 4G8GA 2B2XL 1P84J 4LQ1A 5EO9A 2B8OT 4B7LA 3RVVC 3FJTA 3CH1A 5HHNA 1U92B 1MCIA 3KLHC 3MLVH 3ARWA 1T21B 3PP3H 1CXHA 4BSWA 3HR5B 5E2TH 3P0YL 4PJ5D 2GSIA 1MQKH 1S7XB 2I25N 5CD5C 1YUHA 4X4ME 1G7HA 2IADB 4X4MA 1JGUH 3MJ9L 4KTEL 3GSVB 3H8NA 3LV3B 1CWVA 3CLEL 5ECJE 4HIEB 2IBZY 5CEYB 2CDGB 4YXHL 2OZ4A 3U9PL 1P2CB 1E28A 3BKYH 3ZYJA 5ETUB 2BVQA 5L9DL 3QEUB 2V7NA 4YIQB 3OB8A 4LCYB 4J6RH 1VKXB 4XP4H 3BKJL 5DJ0A 1I8MB 3KJ4C 3TYFB 4KHTL 3W9EB 1TVHA 4U1MB 3KYKL 4NKIL 2EH7H 1J8HB 5F7DA 1UFUA 4KK6D 4PJ8B 3E0GA 3MJ7B 1FDLL 1SY6L 4BH7B 2PKDA 2ZCKH 1UM4H 3PWNA 3OGCA 3MR9B 4H0HB 1HHJA 1MEXL 3ZDXE 4R9HA 2DTML 2KQNA 4MVBD 1TZHB 1NFDE 1NFDA 2HVKA 5TF1L 5TQ0H 1NC2A 4NHCH 4Z0BL 3OB0H 1UM5H 1P1ZA 1YNLH 2CKBB 4U49A 3GIZH 2XZCL 5IUSA 3WFHA 5ESAB 1AGFB 4LCIH 4XCYA 4MCZA 2OM5A 2H32H 2CUMA 3CPLB 3WS3A 4EXPX 4R7DA 4NBZB 3A6CH 1CR9L 1OQXA 4XGZB 2GTWA 1F90H 2X4OB 4HLZH 1AI1L 4F3FA 4YGVA 1U8KA 4HFUH 1UVQB 2APVA 5ITFB 4NN5C 1LK3L 1OP3H 4KK6C 5F88A 1BQSA 2E9JA 3RIFF 1LDSA 3G6JE 3WHE0 5T3XD 2RCSH 1CD8A 1NUDA 4H88H 4OLWL 3GKZA 4M9PA 4XBPA 4D9LH 5C0DB 1CD1B 2B5IC 4M9OA 4G3YL 4MNQD 5FKPB 1D5MB 4NDMA 4JJ5A 3T1FA 4MVBC 5T1LB 1WBXB 3QDMB 3FRPG 1Y18A 3THMH 5JPNB 2IBBA 5HD8D 1J5OH 4Z8FH 4P57A 4V1DD 4QXWA 4OF6A 3DX9A 3KJ4B 5IW1B 3GEWB 4LSRH 4G9FE 3LPFA 4G9FA 5DI8A 3KG5A 2J8HA 3P73B 3QRGH 4I77H 1ZLVK 3ZTJH 1H8NA 4N1HB 4OCLC 1LO5B 4OZFH 1D5BA 1JHKL 3CD4A 1D5IL 2FYYA 4PBXA 2O61A 3W9DA 1N3NB 4R4FH 4NO5A 4NRYA 2G60L 1CLZL 2H1PL 5DVLA 1N6UA 7FABH 1T6VN 1ZEAH 5IESL 3L7EB 2Q1EA 4IHOB 3KHOA 3KPNA 1GZPA 4PY7B 4HUWA 2AABH 1AHWA 1ZA3B 3BP6B 4KKAD 4PJBF 2QHRL 1JNHA 3QUZA 1S7WA 1EO8H 3ZT5A 3D1MC 3JV5A 5HD8C 4MAUH 1RIHH 3BPCA 1LGVA 3DSNA 3T3PE 4D8PA 5EOQL 2R1XA 3CVHH 4P3CH 3KLAA 2AW2A 4DEPC 4LSQH 5BS0E 5BS0A 1ONQA 4ONGH 4KK8D 4XCCH 4NN5B 3QH3B 3ULUL 4PJXE 4PJXA 4LASL 4YR6B 1A7RL 5IFAH 3IDIB 4OKDA 3QFJE 3NABL 2IANA 5CEZL 3U7YH 2ICWB 4KVCL 4ZFFB 5D1QD 1OCWL 1JMXA 4Z77A 1JF1A 1EMTH 5TDOA 5IJKA 4OQTL 1KJ3H 5DRNB 2VIRA 1T0NA 4JRXA 1KB5L 1HOCB 4JRXE 4AENA 4NIKB 3S36H 4YAQA 1JI2A 4G6AD 4ODUB 3FHAA 3VH8G 2FBJH 4KKAC 4NCC2 4LPCA 4ODWB 4NC2B 3QO1A 5DMJB 1ZVYA 2Y72A 3H9YA 2ICCA 1CDJA 2RFXA 2ITDB 5T3ZH 3Q3GB 4QXTA 3CFCH 1FNHA 2E7CA 3UTSE 3UTSA 5HHQB 1B2WH 4NJ9H 3EYVB 4J3SA 2VXUH 3HPLA 4YGAB 4JPKH 4KK8C 2EDTA 3Q2CA 2FWOA 4FTVE 5E9DE 4FTVA 5E9DA 3O8XA 3D25B 1QFHA 5L2KE 2VMFA 5D8JL 2IALA 5L2KA 4HV8A 4FFWD 2FGZA 1R24B 4LLMB 4KRNA 4ISVA 5D1QC 3TCXA 5T1MA 3MLPA 4PB0L 1OD9A 2XZZA 3NVQA 2CDEA 2DYPD 2BJMH 2H45A 4U1JA 4XVTL 3WJJA 3PP4L 1VESA 4G6AC 3O2VL 3GNMH 2MPAH 4HFWB 5L2JA 4OM1L 3C6LD 4W6XB 5JIIA 3PWPE 3LY6A 3PWPA 5ISZD 5GGVL 3HI6L 4PRHE 4PRHA 3CVIL 1V7MH 2LQRA 2RB8A 3D6GA 4Y5XC 1DFBL 3NA4A 1HDMB 3WUZA 3QT2A 1XH3B 2D0GA 3MJ9A 4BFIB 4DEPB 4ODHH 1QSVA 4EIGB 1OWRM 1MRDL 4K3DH 4N0UB 3LHPL 4FFWC 1N6QH 2EDBA 5H37G 3RJQB 5BO1H 5TE6H 2V2TA 1BGXH 3C2AH 4ORZC 4DN4H 4X6BA 3F7RA 3CCHB 1T1XA 1U8LB 4NO0A 1PYWB 4H20L 4P5KB 5KOVC 2Z8WC 4U0QB 1T89A 4GRWH 5D6CB 3SDYL 2BNQE 2BNQA 1AFVL 4GSDH 3OKMA 4OFDA 4ZFZA 1XGYL 3BP5A 5CBEA 3C6LC 1RURH 4U6XA 2F53E 1SY6A 2F53A 3C08H 1P7QD 1PJ9A 4KI1A 3TBTB 4OGAD 3MLWL 4TULL 3P9LA 1BEYH 4XVSH 2PW2B 1G7QA 3ROLA 1IEBB 3GMMB 3HLAB 2IPTH 3BP7B 2BY0A 1ED3A 3L95B 5SX4H 1MAJA 3NIGE 1DUZA 5ICZA 2DIJA 1CFBA 3F7PC 4BQ6A 5FFLA 1ITCA 4KKLD 1E4KC 1NUGA 4KI5E 3NFSH 1JPGA 5D1QB 3V7AE 5KVFH 4GQ9L 2R56L 3HC0B 5A43C 5MEND 2X4NB 5FHBH 4PUBH 4WHTA 2FEEI 1UACL 2A74A 3AROA 4LSSL 1DANU 5E24E 1QLRA 1A7BA 2A6IA 2PNDA 4OGAC 4XNYH 1ZLWK 5ABDE 3PL6D 3A6OA 4HMCA 3DX7A 4GG6E 1R5IA 3HNTH 3MCKB 4Y5XB 4FQXA 4GG6A 3ES6B 5HHPA 1ZAGA 5FYLD 3UTZA 1M7XA 4H8WC 3N1GC 2UZXB 4JHBA 2FATL 3RA7L 3WHXA 1Y6MR 4KKLC 1AKJD 4QOKE 2HG5B 4QOKA 3MBXL 2V5YA 1M7DA 4Y4KD 3TCLA 4R7NB 2DYPB 1DDHA 3BP4B 2X41A 3KYAA 1CL7H 4DFHA 3ULVH 4H1LH 1BREA 1MWAB 1J9CT 3C6LB 4RMTA 1R3JB 2WLZA 3PXJA 3RVUD 5CJOL 5ISZB 3PL6C 1R3KA 4LPYA 2V2XB 2GITA 1BMGA 3KNBB 3GJFH 1FPTL 5GRWA 1QEWA 1HKLH 2OTWA 5DT1H 4HUVA 2EYSB 2EE2A 5CJBA 5EZOL 3K2UL 4D94A 3DRTB 3NTCH 3CXHJ 3MNZB 4AMKL 1AO7E 1AO7A 1Q9LA 2VDQL 1EGJL 4JGUA 5F44A 1T5WA 1QQDB 4OJFL 4EI6B 3G5VA 2XXCB 4Y4KC 3QBTB 5DMKA 1S7SB 5D1XD 3IAPA 2PR4H 3OKNA 1ZOXA 4HHAA 1H3WM 5ILTL 5IK3B 5C0BD 1E4WH 4JDVA 3X3FL 3QPXL 4OZIA 4OZIE 4HXBL 1J0YA 4APQD 1U8IA 1A6PA 3RVUC 2EO1A 3I6LE 2XA8H 2W92A 4WGVB 3EZJB 3HZYB 1CGYA 2XNAA 2CKBL 3JXAA 2M2DA 4FXGA 3AAZA 3ORJA 1XGUA 3O2WH 5C3TA 3EYSL 3JWDL 3O2DA 1P4BH 3EDDA 2E8ZA 3U9UA 1TZIB 4M7ZC 3AS0A 4MSWB 2VLLA 4GFTB 1Y6NR 3RGVD 1JNJA 4H25A 3OHXB 1Q0YL 4IDJL 1RIUH 2IPKB 4NQVA 2W0FB 3UYOD 1ODAA 4OIBA 1Q9OB 4PJIE 4PJIA 1MY5A 2R2CA 5D1XC 2EEBA 5CD3A 5E95B 4Z5RB 1B0RB 5FB8B 5MENB 5MEQA 3F7YB 4UDUB 1EBAA 1KPVA 3DXAA 3DXAE 1FO0B 5HGDA 1I7ZB 1WQVT 4CAGA 5CIPA 5EORL 4KDTA 4APQC 3T0VA 2XQYK 3CSYB 4OM0H 3FAXA 3DO7B 5A1AA 1CZ8L 3ARZA 2WBJD 1NC4D 4JO4L 3GMNA 3PL6B 2E5EA 4ZO6A 1X44A 4OIAA 4YBHA 4QRRA 4UINH 1FVCA 1WCBB 2JJTC 4TSAL 1Z0NA 3IS1X 2B20A 4HUXA 5C8JA 2QSCH 1N5AB 1RJZA 3RGVC 3MFFB 1OARH 3B3IB 5IR1B 1MVUB 5LQBL 4ODTL 4GXVH 5M94B 3C2SA 4P2OD 4Z18A 2A77H 4Y4KB 5DHVH 4L4TE 4L4TA 1GXEA 4NJAH 4KUCD 4XNQB 4KZDL 3S88H 3FQTB 2AS5M 2H3NB 3GKWL 1JNLL 4OLZL 3S3SA 4B41A 2NW3A 4FFZL 1NKRA 2R2BB 2LFGA 2WBJC 1GL4B 3KLDA 4P23D 4EUPH 2X89A 4U1IB 3RWEA 3U1SH 3OKEA 1ES0A 1IAKA 4HPYH 5KSAD 3EGSA 4CMMA 5AYQA 2NY6D 1KYOJ 2DQJH 3AS1A 2X4SA 1HSBA 4ONHB 1IRAY 4M7ZB 3NH7H 4HLJA 4R96B 1HSAA 4RMUA 1JGVL 2IH1A 1NBYB 4P2OC 2ZCHH 4YNYA 1NGQL 1WFOA 2PXYA 1A0QH 2OI9C 5I1CL 4BZYA 4M6MH 3RIFK 3C5JB 1CGSH 3IS0X 4X5LA 5ANMA 4UV7L 1NANH 3F58L 4MX7B 4P0DA 2XYCA 5B39A 5C0BB 1K9TA 1KIPA 4APQB 4KRMB 4P23C 4M4RA 2VNCA 1G1YA 3OKDA 4GAJH 4O4YL 1QO3A 5DUMH 3H42L 1JWUB 4WU7A 5HY9A 4HK3J 5DJAB 4MQTB 2P5ED 2BHUA 25C8H 4PGCB 4LGRB 1YEKH 5KSAC 3R0NA 4PLKD 5F7LB 4NFDA 1MSPA 2NY6C 4GO6B 1T0MB 4I48B 4NBXB 3RGVB 3PV6A 4ZTPH 1NLDH 2EYTA 2FJGA 2J6EH 5DD6A 5BZWA 5IFJA 4FQCH 2YPKB 1KBGH 1AD9A 5T3XL 1INDL 4O58L 5FUOH 1CFNA 4YHIB 1CK0L 3D85B 1N4XH 3ARGA 2WINA 1TCMA 4XX1E 2AJZA 3L6FA 1ZVSA 4K7FA 3L5WA 5K9KB 1CS6A 4ELMB 4DKEH 3S37L 2EZ0C 3RWGB 1EHLL 2NZIA 4K07A 1U92A 4WCYL 1K2DB 1NC4B 2WBJB 4UV4L 4FA8A 3JSSA 1T21A 1WZKA 3HR5A 1TNMA 2V9RA 2YRPA 4ELMF 1X6LA 1S7XA 1PD6A 4M61B 4P48A 4PLKC 2IADA 4N0CD 1KTLB 3GSVA 3LV3A 4PREB 2CDFB 3RUGB 4FNLH 4HIEA 4PLOB 5CEYA 2APFA 4JZOB 2CDGA 3MJ6A 1BWMA 1LO0H 1WLHA 2H6PB 1P2CA 4I9WE 2X1PA 3CFEB 5ETUA 2EEDA 3QEUA 1LDPH 2CGRL 4LDEB 4P2OB 3DURB 3P4MB 2R9HD 4YIQA 4LCYA 4BYHA 1VKXA 3RUGF 1JNNH 4F58H 1I8MA 3TYFA 2VDML 2OI9B 3W9EA 3BQUD 4U1MA 4F7PB 2VDRH 1CDYA 3C09C 5ELIA 3GB7B 1G0XA 4IJ3C 1J8HE 5LAXB 1J8HA 3FB8B 1FJ1B 3CZFB 4PJ8A 3C60B 3MJ7A 4AT6B 4A2LA 1HYRC 4BH7A 4MXWH 4NZRH 3VFVB 2DN7A 1YEEH 1NQBA 1U8NB 5C0EB 3MR9A 5EBMB 4N0CC 4XTRD 1BBDH 2VXSL 5LJYH 2IQ9H 2NY6B 4Y0GA 1TZHA 3TPUB 2CKBA 1J11A 4XPHL 5ESAA 1AGFA 2R9HC 3NOIA 4HMEA 3V9FA 5KBNC 1JWSB 5F9JB 3BQUC 3CPLA 5KAQF 1QSZA 2FX7H 5KZCD 4XGZA 2X4OA 2V9TA 5L88L 4FQ2H 3FL7A 3DTXB 1U8MB 1UVQA 5ITFA 1KCLA 4Y1AD 2E7LC 5HHVH 4NPYA 5CSBA 2RR3A 2P5EB 5DK2B 2CRYA 5F7KC 1Z2KA 4XTRC 2ZZUT 5C0DA 1CD1A 3IKCB 4WUUD 5FKPA 1D5MA 3RL1B 1QFWL 4BQ8A 3B2UD 3G6DL 5T1LA 1HINH 1WBXA 5D5MF 4LSTH 4JY6B 2EC9T 3QDME 1RFDH 3QDMA 2VDOH 5D70L 5JPNA 2P45B 2A6JB 3RAJL 5SV3A 1EFQA 1P4LB 2O5YL 1FG2B 3IDUA 1EJOH 2IF7A 5H37H 1MRCH 5C0CE 5KW9H 3QRFM 1O7SA 3GIVB 5IW1A 1ZTXH 4HS6B 4Z6AT 3S97C 5KVGL 4JY5H 4RDQF 4BZ1L 2XWTB 3P73A 4MXQD 3DJ9A 2FSEB 4ACPA 4IJ3B 4V2CB 5SX5H 1LO5A 3U0WH 1MWAL 1U8QB 3NZHH 3O6KH 2CPCA 1N3NA 2AK1H 3K80A 1IC1A 4M6AA 1D3CA 4JEGB 2HH0H 2X4QB 3L7EA 1C1EH 2VZTA 3B2UC 4IHOA 4PY7A 4P2QD 5K9OB 5E99H 4L4VD 8CGTA 1ZA3A 3BP6A 2X4TB 4M7KH 2DBJA 1S7RB 1S9WB 3MNVB 4NQXB 5FYKH 1A1OB 4TVPE 4P3DB 1JUFB 4KTYA 3RY4A 3WV0A 3DPBA 3WIFB 1X4YA 3BQUB 4KMTL 2AJUL 2BX5A 2MHAB 1ZHBB 4MXQC 2I60H 2HLFD 4A6YH 5F1SA 4TOYH 1YEIL 3QH3A 3BPOC 4X98B 2VOTA 3KVQA 2IAMD 1A6VH 1U36A 1K5NB 4YR6A 3U30C 1F3DH 3IDIA 5E5UB 1N2RB 4YE4L 2ICWA 3D69B 4GRMB 1FH5L 4ZFFA 3EDFA 5HXMA 4UAOC 4UOJA 1NCBH 1I3UA 2LAGB 4TNWF 4DKAA 1CLYL 4WWKD 5DMIL 1PG7L 5DRNA 5DMGD 1YNTB 3WIHA 1BIIB 1HOCA 4NUGL 3QIWD 4ODUA 1UA6H 1ORSB 1HHIB 3DV6B 4L8SC 1HCFX 4ODWA 1OD7A 5B3JE 2I27N 4R97C 2ITDA 3Q3GA 3WXWH 3TWCH 2F5AL 4M4PA 1MNUH 4W81A 5HHQA 3CC5B 4QTIL 3EYVA 3V4VH 5IFHH 5IB1B 3RHWF 5FGRA 2HLFC 3V6FB 1C8PA 3FTGB 3D25A 2IAMC 4Y1AB 1OAYL 1R24A 2BRRH 4LLMA 3VE0B 5I1KH 4JRWA 4BFBD 1R0AL 5T3XE 1GHFL 1BQHG 3QG7L 1RQ5A 4KJQD 1S9YB 4GT7A 1AQDB 5DO2D 3DRQB 4XNZC 3ARRA 4FP8L 3K7UA 4WWKC 3EW3B 4UT6H 5DMGC 3CFDB 1QLEH 4WUUB 2E7HA 4N8CL 1MREL 4GRLD 3QIWC 3MRPB 5J7CC 1XGQB 4HFWA 4N0RA 3N1FC 3TIDB 1OPGH 4M1DL 4CJ1A 4KROB 5GRYA 4S1QH 4K3EL 4D3CH 1HDMA 4YEFA 1GGCH 5F96L 3LS4H 1XH3A 2EH8H 2L0DA 3ESUF 3BMVA 1EJ6A 4BFIA 1K3IA 3I50H 4N0UE 4N0UA 3C8HA 3OAUL 2I5YL 3BPOB 3MGTB 1GPOH 1L7TH 2BNUB 5ESVB 3OJMB 3U30B 3CCHA 4KJQC 2NY5L 1U8LA 1PYWA 5DO2C 2W91A 4P5KA 4D2NA 4BELD 3GHEH 2CJUH 3I84A 4CL7A 4UAOB 2VL4A 1YEDB 1KCSH 1U8OB 5D6CA 4YDKL 1RIVH 5LWYH 3QXWA 4GRLC 4ELKB 4P2QB 3MA9L 3OGOE 3DVNB 4ZTOH 1TQBC 4L4VB 2W9EH 3M8OL 3TBTA 2AXJA 4TTGA 3UZVB 4R97B 4GKSB 2GEEA 4X9HA 3T2QA 4MQ7B 4WI6A 2PW2A 2C4FU 4EDXB 3WJLA 4WTWA 2X1XR 1IEBA 3GMMA 3HLAA 3BP7A 2AAVA 1BPVA 3WFDL 2Z91B 3L3KB 1KUMA 3MOBH 3L95A 2AJ3B 4JFDD 1SQ2N 1AP2A 2IAMB 4HWBH 4QHMB 4LPUA 2CUIA 4MA3B 5D1QA 1NBQA 4XNZB 3TH2T 5I1IL 3HC0A 4L9DA 1L0XA 3EOTH 4WWKB 1KELL 2ZNWA 2X4NA 5K33A 2WIMA 3QIWB 1UH4A 1KCRL 1I85C 35C8L 5IW3A 3CK0L 4RWYL 2Q8BL 2AXFB 4P9HC 3NAAH 4FN0A 1GGIH 5IHLB 3MCKA 4Y5XA 4Z7NF 3DHMA 4TUKH 4NM8L 3ES6A 2ZUYA 4JO3L 4KZEL 4S0TD 3SGDH 2QBWA 4PRPD 1FSKC 1KTDB 3UTPD 3RZCD 3OPZL 2J3SA 2GJJA 3B2VL 4LBEB 3HMXL 1T2QH 1URLA 4LSVL 4XMPH 3T65B 2YPVL 4R7NA 3GJEB 4F8TA 2DYPA 5T33H 4PJHF 3MJ8B 3BP4A 1IM3B 5GGRY 3UP1A 3WLBB 4GRLB 4OLVH 5JO5B 1MWAA 3C87A 3C6LA 1R3JA 4Z7VB 1A7OL 4DW2L 1KEGL 5ISZE 4YH6A 5ISZA 5F1KC 1AGEB 2V2XA 3WMSA 4NP4L 3KNBA 2AXHA 1F4YH 4U1LB 5C92A 1G7PB 1JFQL 3F6IA 1D6VL 4HT1H 3QR2A 2EYSA 2YA2A 3MRMB 1PFCA 3RZCC 5K9JH 3DRTA 3MNZA 3V4UL 4C57C 2AGJL 2R69L 4YHNB 3ALPA 1QQDA 2ORBL 4EI6A 2OMNA 1E4KA 5JHDB 3HCVB 1S7SA 2DDQL 1MI5D 3SE8H 4LRNL 3H9ZA 1RZKC 2Y07L 1DEEB 1GRWA 1HZHL 5IK3A 5BJTB 1VGKB 3WBDA 1NAKH 2P24B 2DMCA 2XWBB 2CIIB 1UB5B 1BIHA 4LMQE 1BJ8A 1DQDH 5I19L 1T7VA 3QDAA 1TZIA 4OZ4B 3V7AG 1FSKB 2X44D 4MSWA 4FZEL 1FC1A 1YYLL 4JFDB 3OHXA 5GGQL 2OR8A 2IPKA 1FFQA 4M6OL 5E0QA 2W0FA 4I4WB 3Q6GH 1Q9OA 3QJHB 4P5MB 4IMKC 5EC2B 1RSFA 2QQLH 1YECH 3NCBB 1MF2L 5IHUL 1BJ1J 4Z5RA 1B0RA 5FB8A 5MENA 3F7YA 4UDUA 2OJZH 3S3JA 3ARBD 1FO0A 1I7ZA 3L5IA 2VN7A 3CSYA 4J3WA 2ZJSL 1KJ2L 5C6TH 3DO7A 4LVNC 1DQLL 4EZMA 5FOJA 3PL6A 2YS4A 4Z95L 4I18C 4DGYL 3B8YA 5FCUL 5I1DB 2R2EB 4PTTB 5FYLE 1WCBA 3GO1H 4PRPB 2H2PD 1SMAA 4XVJL 3RZCB 1N5AA 4WY7L 3MFFA 4K94C 3B3IA 4HG4K 5IR1A 1MVUA 1BD2D 3MQIA 3OV6A 1M4KA 3BZEB 5MERA 1A8JH 3FN3A 2VDNH 4Y4KA 4BSJA 2EICA 4XNQA 3Q1SH 4HCRL 2XTLA 3FQTA 3PV7A 3ARBC 4BUGA 1FAIL 1MFDL 2EEAA 2H3NA 2PTTB 1G9MC 5F7EL 1XAUA 4U7SA 4IDLA 2R2BA 2D7NA 3QEHB 2UY7A 3DYPA 2VLKD 2DLFL 1U6AL 4U1IA 4HMDA 1UWGH 3ZDZE 2Y23A 4AYFA 3TV3H 3MRDB 3BHBB 4LNVA 3T2PA 2H2PC 4WUKH 2I26N 1CGXA 4ONHA 3SKJH 2X9YA 5DD0H 5HVHC 1YNKH 1A9BB 4R96A 3VRJB 2IMNA 4GMSL 1EXUB 1NBYA 2FJFB 5IT2H 2G5BB 4P2CG 2I9TB 4OCSH 1MI5B 3N9GH 4DAGH 1J1PH 1FGVL 1OOAA 1PLGL 2YZ1A 4YHLH 3C5JA 2W65B 4MX7A 5C0BA 1T03H 4APQA 1Z3GL 1OB1B 4LVNB 3RNKB 2VB5A 1JWUA 2BVUA 5DJAA 1B0WA 4DOHE 3E8UL 1DCLA 4Q6IB 3SDAD 4PGCA 4I18B 1ZLSL 3QEQD 4I0KA 3UJJL 1J0ZA 2ZG3A 4X6EB 3SN6N 4UU9B 4ERSL 2JJTA 2ED8A 1MFCL 1L6ZA 1BFSA 1TENA 4JPWH 1JRHI 3T3MF 1T0MA 4I48A 1G6VK 3RGVA 1E4JA 4XBGB 3G9AB 2BSSB 2VZ1A 3QHFH 5EZLB 1NEZB 4XB7A 1RZ7L 2YPKA 4Q9BA 4WEBL 2IMMA 4YHIA 3D85A 5IQ7L 1UWEL 4PBWD 3DYOA 2EC8A 3J8F7 5K9KA 4ELME 4ELMA 5CUSH 3ARBB 4LSPH 3RWGA 2R29L 3L3JB 2OYPA 4MA1B 5L0QC 2EDNA 1QHOA 1K2DA 1NC4A 2WBJA 3LMJH 2DB8A 1CDIA 1HQRB 3CH8A 1MFAL 4D9RD 1LMKA 3QUKB 4BK5A 4PGBB 1ZE3C 1A6WH 3SDAC 2NY4D 3C5ZD 1D6EA 4PJ7B 4M61A 1D9KD 1A6UH 1RUMH 1KTLA 4PREA 3RUGE 2CDFA 3OF6D 3RUGA 2XICA 5HVHB 4JZOA 3AUVA 1Y6KR 1BD2B 2H6PA 2DI7A 3CFEA 1C7SA 2O5ZL 2EIEA 3QB7C 2X10A 1MIEL 2I9LB 5J1AB 2LTQC 1RMFL 4P2OA 3DURA 3P4MA 4NKOB 5EB9A 1N8ZB 4F7PA 1XFPA 1V5JA 3VDAA 1BECA 3GB7A 5LAXA 1SBSL 5DLMH 3S37X 3FB8A 2IBGA 2JB6B 4EN3D 1FJ1A 3CZFA 2DQEL 3QHZH 4XXCC 4Y4HD 4TNWK 2JE8A 2VLKB 3C60A 1PDKA 1F42A 3TVMD 4AT6A 2NY4C 4OFIA 3C5ZC 1FL6B 3MZGB 1DEDA 3VFVA 3WFBH 1D9KC 1U8NA 2A1WH 2VZUA 5C0EA 1IKFH 4X8JB 5EBMA 4YXKL 1YEHL 1MCLA 4IRSD 4NKDB 3H9SD 4PLNC 1J0IA 3DV4B 1AJ7L 1RUPH 3TPUA 2NXZD 4PJGF 4Z76B 5MI0C 3QZWA 3RHWK 4LIQL 4MQSB 1CXLA 4XP1H 1JWSA 5F9JA 5C3LD 4J3XA 3MRNB 4YEEA 5DJZB 1YMMD 5GGRB 4YXLL 3DGCR 4RAVB 3DTXA 2ZKHH 1U8MA 4OD1H 3TO4C 3L5HA 4EN3C 4Y4HC 5L0QB 1JTPA 4L8BB 4ZS7L 3TVMC 3EJYD 1JK8B 1Z5LB 5D5ME 1PSKH 1IGYB 4QGTA 2P5EE 1RU9L 2P5EA 5DK2A 3SDAB 2J8OA 3U0PB 3QEQB 4N68A 3TN0A 1CVRA 3IKCA 3SKMB 2BFVH 3ZSSA 4IRSC 3RL1A 3ZLQC 4NN6C 1EK3A 2BSRB 2DTSA 2GFBB 4OZGB 1R3IL 4XX1G 4JY6A 4ODVH 4ZNCD 1HIMH 2A6JA 2NXZC 2B4CH 1P4LA 4M5ZH 2LTQB 3L3GB 1FG2A 4G8FB 4M6NL 3GIVA 4OZGF 5LBSH 4HS6A 3VWKB 1TJIL 1IC4L 4JM2F 4UT9H 5I30L 5IWLA 3OL2A 3D3VD 2XWTA 1FV1B 1KF9B 2FSEA 2OP4L 3BH9B 5EOCJ 5F7MC 1MCEA 1U8QA 2VZVA 3V52L 1UZ8B 2MSPA 5DRWB 3EJYC 4DQOH 2C4XA 1N6VA 2HKFH 1NGYA 4OCYH 3G6AB 1FGNH 5LKNA 1IGCL 1D9KB 3U4BL 3VFSB 1F5WA 2X4QA 5FYKU 2X1OA 5K9OA 4U3CA 3S5LB 4BZ2H 5AG8A 1RZ8B 1C16B 1DBBH 2X4TA 3QCTL 5HHOD 3RVTD 1DBML 1UKQA 4CMHC 3QUMA 2GJZB 4YBLC 1S9WA 3LQAH 1G6RL 3MNVA 1A1OA 1OAZL 4NQXA 4P3DA 1JUFA 2X6MA 5MI0B 4G5ZH 3VI3E 4AQ1B 2BNRD 3TJHD 3T1WA 3WIFA 3BQUA 4A2MA 3MXVL 4Z9KB 5DD3L 3U48A 2AQ2A 2MHAA 1ZHBA 1MFEL 2P8LB 3TO4B 1XF4B 4X98A 3STBA 1CDBA 2E7LA 4EN3B 1K5NA 4ZQKB 1AE6L 3PHOB 3X13B 1N2RA 3GBNH 3TVMB 1QUNA 4HBCH 2DLHA 3D69A 4GRMA 5KVDL 1QKZH 4XP6H 1H3TA 4RGNB 4I2XE 5DUPH 1AQKL 4U6VH 3QDJD 1YNTA 3MRFB 3U7WH 4IRSB 4Q9QH 4NN6B 3CFKB 1ORQB 4K3HA 4QGYA 1WEJH 3H9SB 4FRWA 4TSBL 1ORSA 3BVNB 2WUBH 1HHIA 3DV6A 3RVTC 1H3GA 1MJ8H 1DP0A 2YRLA 2Y9RT 2NXZB 3UEZA 1N0LA 1T5XB 4DGIH 1MCWW 3L9RB 4JQVC 2ZPKL 3TJHC 2B2XH 1IC5L 1FIEA 1YMMB 5JUEL 5ACLA 1I3RB 3BX7C 2DMBA 3V6FA 3FTGA 3RY5A 3S98A 2E8YA 4Y1AE 4Y1AA 5FGCB 3P0YH 2VXTL 3VE0A 1DSFL 4DGVL 2KZWA 2P5WD 1S9YA 1AQDA 4DJMA 1CLOL 3DRQA 2FBOJ 3MJ9H 4KTEH 4RX4D 1CXIA 3CLEH 4YXHH 3CFDA 4WUUE 4WUUA 5EU4B 3U9PH 4DUWA 5L9DH 3MRPA 5D96C 3JWNC 1XGQA 1A7NL 3IDYB 4FQIL 3TIDA 4CMHB 4WFED 3GBML 4YBLB 3BKJH 3HRPA 3RWJA 2COQA 4KHTH 4P4KB 2ADFL 4WJ5B 3KYKH 4NKIH 2CLRB 4RSVA 2ED7A 5DHYB 4MGXA 1Q72L 3EBAA 5EG6C 3ECBB 1JE6A 1RZKL 2O26U 3D3VB 1FDLH 1SY6H 1QPXA 1FL5A 3MGTA 4HIJB 4PGDB 2BNUA 5ESVA 4JO2L 1MCPL 3OJVC 3WNLA 1MEXH 5I1GL 2DTMH 1YEDA 1VFAB 4XPAL 1U8OA 3GSNB 2C9AA 5TF1H 5E94B 4Z0BH 4ELKA 4WW2C 4P2QE 4P2QA 5DVKA 5GZND 2XZCH 3EZ8A 4POUB 3DVNA 6CGTA 2DJSA 4L4VE 4L4VA 2CLVB 1K4DB 1ZK9A 5HHOB 1NLBL 5GIRB 5F9DC 1CGVA 1CR9H 1FFNB 4GKSA 1AI1H 2BNRB 2W1NA 4MQ7A 3O6FD 1LK3H 4NNYB 4IEFB 1JZ7A 2D4DA 1LP9F 5EUOF 3V6OC 5ALCL 2Z92B 1S5HB 1T1WB 2Z91A 3L3KA 2OS7A 4X7EC 2AJ3A 5GS2H 2VQUA 4HXAL 4LGSB 3V4PL 2IAMA 4OLWH 3J7HA 4NC1C 5HGAB 2PW1B 5EZJB 4CU6A 4BFEA 4QHMA 1QP1A 2XV6B 5SX4I 4G3YH 3NFPB 5GGTL 3I6KB 1BVKB 4WWKA 3RBGA 4JPIB 3QDJB 4KGJA 3VMPA 5DVMA 3O3AB 4RFNC 5GZNC 4K9EL 3BPNC 3QIWA 5D96B 3ARQA 3QUYB 4UB0L 5A2KH 4KMLB 3DGGB 1DJSA 3KPTA 3I6GB 2AXFA 3CX5J 3VU2A 3VD5A 4U2YA 3NCMA 4JFHE 3O6FC 2F74B 3IJSB 4OGYL 3QXUA 3R4DA 2G5RA 3BN3B 1KTDA 4LFHD 2VXQL 1JHKH 1D5IH 2CR3A 3SOBL 4RCAA 1O7VA 3L5XL 4G7VL 4K2UL 1G9ML 1WWCA 2G60H 1CLZH 1F4XL 5SWSD 2H1PH 5IESH 2P5WB 4PY8J 4HZLB 3T65A 4TRPL 3GJEA 2IGFL 3MJ8A 2ZUQC 2LVCA 1JZ8A 3IDGB 3I3DA 1IM3A 3OAZH 3WLBA 2DICA 2QHRH 3X17A 4GRLA 5EPMB 2IPUK 4WW2B 5AZ2L 5JO5A 4CN6A 3CDYA 1BFOB 3MBED 4PIRF 4Z7VA 5EOQH 2EDLA 1CL7I 1AGEA 4D0DB 2Y25A 4OLUL 4XMLL 4U1LA 1G7PA 5EBWB 3ULUH 4PJCB 5IHBA 1F8TL 2ENSA 3MRMA 4HQQL 4LASH 1QG3A 2YUZA 1A7RH 1PW3A 3NABH 3IDXL 1H5BC 3R8BB 5CEZH 4L5FL 2X09A 4KVCH 3ZT6A 1OCWH 4HC1L 4YHNA 3SDXF 5I8OL 2VDKL 4OQTH 4M3JA 1OHQA 1XT5A 5E1HB 5JHDE 5JHDA 3HCVA 1KB5H 3LKNB 3WE6B 3F7VB 3B9KD 5F6HJ 3ARXA 4NRXB 5CLWA 1DEEA 3MLSL 1Q9WB 4P9ML 4RFNB 5BJTA 5AEAA 3BPNB 3MBEC 3K8MA 1VGKA 2FRGP 1ACYL 1NGXB 5FA4B 1I85A 2B0SL 3VMOA 1FFOB 4Z0XB 5EU3B 2P24A 2XWBA 3V5KB 2CIIA 3TT1L 1UB5A 1F97A 1T1YB 3DIFB 4OQ1A 3O6FB 1MIML 5D8JH 5CIPH 5FO9B 1ZGLB 5D7IB 4OZ4A 3DX6B 4GW4B 2RJMA 3SE4C 1BQUA 1UADC 4PG9B 4JFDA 2BC4B 3KS0J 2HRPL 4JKWA 4PB0H 4M62L 4XAKD 4I4WA 4XVTH 3VXPB 2YC1B 3PP4H 3QJHA 4P5MA 5EC2A 5I8EB 3B9KC 5GZOD 2ZSWB 3O2VH 2CRIA 1NMCB 4OM1H 2ZUQB 4KJWD 1BFVL 1UG9A 1U8PB 5GGVH 2ZCLL 3HI6H 4WW1B 3CVIH 2CQVA 4ZNEE 4ZNEA 1DFBH 2P46B 4ZOAA 4NNPL 3UTTE 3UTTA 4O00A 3TM6A 1KLGB 1DN0B 3NZ8B 1MRDH 5I1DA 2R2EA 4PTTA 2FEDD 3LHPH 4PRPA 1JHLL 3OG6B 4P49A 3UTPE 3L5JA 9CGTA 3V0VB 3RZCA 4R26L 1A7PL 4IBLT 1JGLL 4LLDB 2YD7A 3C8DA 4H20H 5SWSB 3RWFB 1YY9D 5KANI 3MNWB 2ZUXA 5FUCE 4XH2B 2CRZA 3BO8B 3BZEA 3SDYH 2MQ3A 1AFVH 3FFCD 5GZOC 2Q3ZA 2Z93B 3LEXB 2X9XA 4NOBA 1XGYH 4KJWC 4WO4D