5BRZD

Mage-a3 reactive tcr in complex with mage-a3 in hla-a1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
197
structure length
197
Chain Sequence
AQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLYVRPYQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRPGGAGPFFVVFGKGTKLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Direct molecular mimicry enables off-target cardiovascular toxicity by an enhanced affinity TCR designed for cancer immunotherapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5brzD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5brzD02
1NEUA 2G9HB 4L9LC 4NDMB 1Q38A 4EIGB 1Z9MA 4HZLA 2CUIA 1WC7A 2XYCA 1ERNA 1R5WA 3MJ8A 3RDTC 5F9AC 1IGCL 4I0PD 3WUZA 1A2YB 3P0VL 4J4PA 4TULH 3WFBH 4BYHA 3NIGF 4E41E 2NZ9D 4AL8H 2FH6A 3A6BH 3CH8A 5CLTA 4KZEH 1I4FB 4L3CB 2YD4A 1F2XK 3I2CH 4POZC 1QUNA 1MEXL 2PXYA 2R1WA 2DLHA 4LIQL 4ZOBA 1I3UA 4OM0L 5L0QB 1IJ9A 1DBML 3RUGE 2ZP0T 3TLRA 1DBMH 3U7AA 5D1QC 3MGOB 4S1RL 3BP6A 1D6EA 2FHFA 3VXOA 5EBLB 4MVBC 3FQRB 1AXSA 4XCEB 2VZ3A 1S7WA 1BQSA 1WCBA 3IFNH 2XA8L 1MIML 2H26A 2X1OA 3CGTA 1NL0H 3GMRB 3PNWA 3QPXH 3OKKB 2VL4A 4U1SA 2ZNWA 4OAWA 4PRHD 5DO2C 4Z7NF 5DEFB 4JFHD 3PXHA 4KDTA 4Z0BL 1U8PB 5FKAA 3HUJE 5EC2B 1IGML 3C6LA 1J0KA 4ZSOA 2NX5E 1JF5A 3Q5TA 4FMKA 1WBYB 3VFWB 4FZ8L 4FZEH 1ZLUH 3ZDZF 2V2TB 4LSRH 3MACH 5SX5H 3FB7B 3QA3A 4G9FE 4YBQD 2ATKB 4DWHA 1GOFA 4OCXL 1MRCL 3WS3A 3ZHDA 3FFCD 3O6LH 4ZG1A 1R5IB 3OKYA 1J5OH 5DYOB 3OV6A 1FZOA 35C8H 3K3QA 3KLAB 3MLSH 2HA1A 4I13B 1NDMA 4I0PA 3EJZD 2OMBA 1CFSA 1N4XH 1OT1A 4OD2B 5D6CA 4YHYB 3KNBB 4LP5A 4N5UA 1O0VA 4BFBD 5HYJE 2W0FB 4KJWD 1NDMB 4PJEF 2LTQC 2E27H 3MRPB 3ES6A 1PLGH 5HDBF 1KENH 3HNSL 3QFJE 3T2QA 2DKSA 5I16A 4JDZB 1WZKA 5IOPA 5CKAA 2W65A 1T80A 4LPXA 3TPUA 3X17A 1FNLA 4S1QH 1Z2KA 5EN2A 3H0TA 1I8LC 4ZD3L 3JTTA 5AYQA 4PGDB 2D9CA 3V6OE 4XBEL 4LCCB 1RIUL 4M1GH 5LCVL 1RIUH 5LCVH 3O2VL 1RHHB 1XCQB 2XIDA 3O2VH 3PG2A 4AYFA 4DCQB 4PRHA 3OXSA 4R8WL 3T65A 1NFKA 4OF6A 3H0TB 4XX1G 2CKBB 4JM2D 4QGTA 5GRVL 5DD3H 3FZUC 1HEZB 2AK4E 3KPQB 5GGTA 4H0IA 2FATH 4XP4L 4ODSL 3AROA 4XP4H 4ODSH 4XMLL 2F8VA 4Q6IA 5L7XL 1QLEH 2CIIA 4OLUH 4C56D 3VH8A 4MD0A 3PXJA 1T2XA 1A7PL 4GSDH 3RVXC 1NFDE 3FFCA 5LGJB 4NO0D 3RRQA 2F9BT 4HMCA 4RBPH 3M8OL 3RQ3A 4LRIC 3S35L 3SDDB 3OXRB 2YBRB 3VH8B 4LSSL 4FQXC 5MENB 2WIIB 4NO2B 1WEJH 3C5SB 3ULVF 3O6FD 4U1IB 4FXGA 4FFWC 4O02L 3R8QA 5DJ6A 4E9LA 1VERA 4QRRD 4AH2A 4TVPH 3BJLA 4PJEB 1UG9A 3OZ9L 5EOTB 4P2OC 4JPIA 1DBBH 1IEAA 1IILE 2DMKA 3ZYOA 3IFPA 2VKXA 3O6KL 5KANG 3KPPA 2CKNA 3RKDC 2XV6B 2FO4A 4K3DL 3DVGB 3T77A 3QUML 3D3VB 1JNNL 1UJ3B 4IS6A 2VLRB 4UNUA 3BE1H 1A64A 4GXUM 5JXED 1EVUA 5ITFB 2VZUA 4WCYL 4X7SH 1EO8H 1EIBA 4XPFL 4R4NC 1A6WL 3F5WB 2BNUA 4IM8A 3NTCL 4JFQB 1FJ1B 5CZKA 4MJ6B 2CO6B 5IHUH 3SKNB 3THMH 4M7LT 4J6RL 5TF1H 1ZLVH 5F8RC 4NQDB 5BVJA 4M7LH 5T5NF 4F7TA 3RX7A 4LIQE 2AJSH 3PWPD 3QUZD 4HUMB 5FK9A 1NGYB 4GMSL 3TJHD 3NMEA 2CMRL 2D7TH 2ZCHL 3GIVA 2ZCHH 4WWKD 1KTKE 3C8KB 1FNSH 4JM2A 4TSCH 2WBJB 3EGSA 3MRDB 3QEUA 5TDOA 4WW2B 4IDJL 3UJIL 3BVNB 3FRUA 2VAAA 2NXZC 3PV6B 1FDLH 4HS8L 4HS8H 1MVFA 4JJHA 2BMKB 3DPBA 3K2MC 1LK3H 3BMVA 4F15B 3RWJA 1GPOH 5F1NB 4C56A 1K8IA 3LH2L 5F9WB 3LH2H 5FGCE 5ITBH 4JQXC 2AQ2A 2IJ0C 1P9MC 4YZFE 1BBJA 2P43B 2XA3A 1YA5A 4YX2L 3KPLB 1SJHB 4YX2H 3G9VA 2Q20A 4M62L 3CVHA 3V7AG 3ZT7A 1JHLL 2JB6B 4M62H 1NFIA 5HHOB 4NQUA 4Z7VF 5HI4C 4KRPB 1JN6B 3Q3GA 3O6FA 4NFCA 5CEZD 3STBA 5IBTH 3EO0A 4QHUA 3CC5A 2DQFB 3X11B 4TQEL 4PJ5D 4MCYA 3HI6H 5ALCL 3CFKB 4OFVA 3ILPB 4HGWA 3STLB 2R56H 1X5XA 5E56A 1E28A 2Z8VC 4JRYB 1VACB 3UTOA 4OFPA 1I7TA 2A6IA 2NY6C 5EA0H 4HWBA 4Y1AB 5IMKA 1OHQA 4HAGA 3O3EA 3QIUD 4ZXBD 5JXEA 5F3BA 2NY3C 4OFDA 4CDGC 4AEFA 3VWJB 4ZOCA 4NKOB 3KPMA 4OCLC 1QBBA 4JHWL 5EO1A 3DXAE 2EE6A 1I8IB 1E28B 4JHWH 1V05A 4DZ8A 3ZTNL 1W0WA 3N1PC 3QXUA 5IB1B 2A6IB 3BP5B 3J8F7 3CFDA 2I60H 3PWPA 2C7UB 3QUZA 2ZOKA 4JZJB 4YJZL 4MAYC 1IC1A 5I17B 3GB7B 5IQ7L 1P6AB 8CGTA 2ZJSL 4DKDC 3JTSA 3CXDH 1A0QL 3TBWB 1VGEL 2A73B 1A0QH 4R3SA 4DZ8B 3BZEA 3KPRB 3FCTB 1C5CL 5GGSB 4EOWL 4KK5C 2ED8A 4AM0B 2KL6A 4QHNB 3ZYZA 2OZ4A 5SWZE 2OL3A 1LO5B 4U33A 5GGVY 3IRZA 1K3ZA 2G60L 1LVEA 3O41A 2G60H 3C6SA 5IT2L 1TJIL 4WJ5A 1TJIH 2OTWB 1FSKC 3MQIA 3ZYJA 4EN3C 3QXDB 1DQQA 3QCTL 2DN7A 4Z7VB 2IQAB 4U49A 3BWAB 3FO0H 3KG5A 3ULSB 3VXQA 3TIEA 3ZLQC 3PP3H 4H1LH 4FQIH 3G6JB 3DURA 4FOMA 4ZDHB 43CAB 5BZDA 2XXMB 3VRJA 4GAJH 1W72B 5ADOH 4WI5A 1IGYA 3B43A 4M8QA 1TZGL 4PJ5A 5ICXB 2EEAA 4X6DE 3DUHA 3W0WE 3MLTA 3CK0L 5T1MB 1KIRA 4JRXD 4G6ML 4R0LA 1EGJA 2FX7L 2XWJB 3KPNA 3QIUA 3QHFL 5J1AA 3MV11 1JPSL 5IESH 4Q9BA 4NNPH 3U36A 1G7PA 1JPSH 1SJEA 1AQKL 1KB5A 1H15A 5FA3B 4CAGA 2QADB 2ADFH 3BQUD 1DQLL 4MDIA 5IM7B 5D70L 1FO0L 1NAML 1UH4A 3BIBX 2AJXL 2PTTB 1NAMH 3T2NL 4Y19D 2AJXH 4EQ3A 2M1KA 5ACZB 5JLZA 1A14H 5KSBA 1G7PB 4YE4H 3QEQB 4ODWA 2XQBL 4LPWA 5I9QB 4P4RB 4NM8L 1N5AB 1ES0B 1FE8H 3FQUB 4H88H 3N50A 5FV2A 3S4SA 4IRSD 4DTGH 3V6FB 5JPNB 6FABL 2P45B 1HQ4B 3MUGB 2F5AL 1CIUA 2NW3A 3UTTD 3BN3B 3FT2A 5DMGD 1G6RL 1CGSH 3MFFB 2ICES 2ZCLH 4X9HA 4J8RB 1AIFB 1I1AB 1NLBL 4P5MB 5KSAC 2GSGA 4P46C 5IJKC 1GAFH 1EHLL 2EYSA 1HOCA 4JHAL 1RZ7L 5CJQH 4OT1L 4JHAH 3DROA 5F97E 2ESVD 4QRPD 4EUPG 2XI9A 4XC1H 3QWRA 2E6PA 4XHQA 3PGDA 3JWDH 3IGAA 4GQ9H 1RULL 2PO6C 5JIHA 3V7AE 3QG7L 3WFHA 1S7UB 4NZTH 3NPSB 4PD4J 32C2A 5J13C 1VA9A 3OAYK 1U6AL 1BD2B 4MXQD 2EDBA 5SWSB 4POZD 3U83A 4NKDA 2PW1A 4GS7C 3BYTA 4YHIA 5I1EL 4RFEA 3WJLC 1U8QB 5C7XH 3OKOB 1BP3B 4MNGE 4JRXA 4RMSA 5DVMA 5HDLA 4I48B 1KJ2A 2UUDK 5D1QD 5FYJH 1ZEAH 3WBDA 3V4UH 4NO3A 4RDQG 1JGVL 5FFLA 4UT9H 1DR9A 4UV4H 4YHIB 1D9KB 1CE6B 4XMKH 5T3XH 5KBNC 3F6LA 2FJHA 3BQUA 4X99B 4LSVH 3RUGA 4E41B 4YO0B 5M95B 4OCRH 4XB8A 4Y19A 4B7LA 2N1KA 5C9JA 5DO2D 1G6VK 4YR6B 1BIIA 1KJVB 1N3NA 1IQDA 1BZ9B 1JGLH 3VGGA 4MX7B 2RB8A 4BH7A 5DJYA 3LIZL 2R1YB 4QTHA 3LS4H 1ROWA 4WHCA 3OWEA 5DJXB 4IRSA 1OSPH 4N0YL 2MHAA 1Z9OA 3HZKA 1A7QH 3OG6B 5DQDL 2JIXD 3NFPB 4FQPA 1S7TA 1I9JH 3UTTA 1OARH 5TE7L 3GO1H 5TDPA 1JTPA 3ZHKA 3UZEA 2P8PB 4L9LA 4Y5YA 4PJDA 1T03L 3KYAA 5J11C 5JR1H 1FZKB 1N8ZA 3LKNB 4G9FA 3S36X 4HEPG 1YYMH 3L3OA 1CDCA 2ESVA 3HUJB 4QRPA 4U3CA 5F7DB 4LRNL 2NX5B 1RIVH 4AZ8A 3OAUH 2V5MA 1QBML 3NZ8A 3OJMB 1UQSA 2IFFH 1TETL 4HT1H 3JUYA 4OJFH 1N8ZB 5FDWB 2VXTH 1ACYH 1Q8MA 4L4JA 1PJ9A 3RPKA 4XCCL 3TNNB 2DBLH 1JHKL 3MR9A 1W0VB 5I0ZA 1P5UA 4QXTB 1AQDA 4KAQL 2X4SB 1YEGH 2DQJL 4HUVA 4D9RD 2HFGH 2X4OA 3GSWA 1E4KA 2A6DA 3GSVB 1DQDH 5HYJA 1H3VA 2UYLA 4WHYG 1NCDL 3LN4A 1A6TA 3ALWA 4XNQB 3SPVA 3IDIA 5E5RB 1YECL 1JPFA 4DVBB 4LASL 4LASH 2DTML 3GSWB 4WU5B 2GITA 4Z76A 3GRWL 3UYRL 3MJ9A 1CT8A 3UYRH 1RUMH 4OZHE 1QEWA 4I5BB 1G0XA 5M94B 5DGQA 4U1GB 2YEZB 3ROLA 2J8UE 3QFJB 4PIRF 4K3GA 1PBYA 2EYTB 2VWEC 1WIPA 3LAFA 2J5LC 5D2NE 1FVCB 4Z76B 5FV1L 3QDJB 5IVNA 1WITA 3SKMB 5LG1A 3UTZA 2MCG1 4OGYL 4HQQL 1AGCA 4GT7A 3RVTC 2BSRA 4HK0A 4NQTA 4PJXE 5AAWA 1PYWB 1IGTA 3O8XB 1HILB 1GZPA 1SBSH 1YNTB 1ZE3C 3VGDA 2GCYA 1AH1A 4LBEA 1QRND 1ZLWH 5DQ9B 5IHZB 1WCQA 2NXYC 1OTSD 4G6JL 4YDLB 3RGVC 3MX0A 2I24N 2DMBA 3RVWC 1FFRA 4HPYL 2AK4B 2YK1H 4FFWD 5C0EA 1T0MB 3IDMA 3IT8D 4ZAKA 5JW3H 1KLUB 1GSMA 4U1HB 1OTTD 3W5NA 2Z31D 3UZVB 4P2OD 2J88L 4HWEL 5K9OB 4P99A 4XPBL 3B9KD 4PJIF 4EVNA 1NFDB 1E4WL 3QCVH 1L9NA 4WY7H 1EHXA 1NBZA 1E4WH 1MJ8L 1H9VA 1OPGL 4HFUL 1PEZA 4P4KC 3ESVF 3W9DB 3MLYH 2I9TA 4NPYA 3IDYB 3LSOB 4GRWE 2VL5B 3U9UB 2A77H 4HFWB 3V8CA 2EH8L 5J0BA 1B0RB 1X7QA 5FAAA 1U8LB 1XIWD 3H9YA 4M4RA 4HSQA 3L3HA 4KKLD 2FJFA 2QR0A 4NQXB 3HCVA 3MOBL 3QI9C 3QO0B 3RI5F 3MOBH 4M6ML 1H0DB 1L6ZA 3BH9A 3B3IA 3TO4C 5GRYA 4YAQB 2Q1EA 1TPXB 3WNKA 1TJHL 1U3YA 1TJHH 3HCVB 2F53D 4ONHB 5E0QA 4D3CL 4CGTA 1MLBA 2VDOL 1MHCB 1YEHL 5LGKA 2HFTA 1PY4A 4D9QD 3D9AL 1BX2B 4MJ5B 4PJ8B 4BM7A 1IM3B 4NRZA 3KJ4C 1IARB 3KLDA 4KTDL 2VLJE 4L8BA 4OZFG 5LXGL 4LPTA 4X6FA 5HYQB 4P3WA 3LEVH 5DSCA 3CFBA 3U6RB 1D3CA 2R0ZL 3MBEB 3QIBD 2R0ZH 4PPTA 5DRNB 3VD4A 4X6BB 1M4KA 2QQKH 1CICD 1QRNA 4XTRD 4DKEL 3O2DL 4YHZL 4X6FB 4BH8A 1JYXA 3VI3F 3CFBB 2ZG2A 5HI4D 5C0CD 2NY2C 1ZOXA 3OKMA 4DOHE 3HE6C 4JN1H 3TH3T 2Z31A 2GK2A 3HI5H 4P2OA 1ED3B 4Z8FH 1CN4A 1C7SA 4R4BA 2Q76B 3B9KA 5FGCB 1YEDA 5GRUH 4YFLI 2NY6D 1EEQA 4P5TB 1OTUC 1FCGA 2ZSVB 1AO7E 4Y88A 3RX5A 1CR9L 5IW1A 1FIGH 3VFPB 1T89A 1BJ1J 4OD1H 2IAND 4NGHH 2X4QB 5D6DA 4R4BB 3JV4A 1XIWA 2FJGB 1UKSA 3V5KA 2LE9A 3GMNB 4JFOB 1YEDB 4CMMA 5I74C 4JO4L 4CVZB 2IMMA 1CS6A 4DGYH 4JO4H 4TVPD 3AAZB 5IW1B 1HIML 2OQJB 5GSVB 1IC4L 2DWDB 3MROB 5ESQB 5I1HL 1IC4H 1IM9B 4MAYD 2EZ0C 2CJUH 2X6MA 4LSQL 1QO3B 3C5JA 1I1FA 2VXQL 2A9NH 5FUZH 3IJSA 3GSUB 4M9PA 4NQED 3RJDA 4WTWA 4X6DF 2F53A 2QHRH 3GJEB 5F1IA 4ENEC 3ARFB 4HIIA 4F33B 5E2TH 3OKDA 4JM4L 7FABL 4G5ZH 3DXAB 1OW0C 1AC0A 4GRMB 4P9MH 3WN5A 3AM8A 4U2YA 1AGDA 2JELH 2PF6A 4XP6L 1F3JA 3P77B 5FOBA 1KELL 3QIBA 5L88L 4LOUD 1RMFL 3TZVB 1RMFH 5HBBA 4F3FB 3QH3A 1N26A 2P48B 2COQA 2H45A 1QQDB 1CICA 2VXSH 1A3QA 3M1BB 2VDQL 4MXWL 5GRJH 2VDQH 5BV7B 4MXWH 4JFPA 1P1ZA 4LDOB 3C2AL 4FABL 5C0CA 3LKPB 3MLWH 4F37K 3GI9H 3L7FB 1R3IH 3BKYL 1QR1A 1G7IA 2QSQA 4BQ8A 5SWZB 1M7IA 5FXCH 3QNXA 2VAJA 1MF2L 3B5GA 4FN0A 3HI1A 3MLZL 2X4RA 4JY4A 1S7RA 4LVHB 4S1SL 3UYPA 3I85A 1Y0LB 4NZRH 1HHHB 2NNAB 2LU4A 3C9NA 4JG1H 2IANA 1LO2H 2MNUA 2VDNL 3TFKC 1AJ7L 4QHLB 4TSBH 4PRNA 2VLMD 1XR9B 5DXWA 4YHOL 2YKLH 4YHOH 3EZJB 4NKMB 3TT3H 1UB6B 3HNVL 3V6ZB 2BVUA 4HKJA 4MAYA 4MSWA 1BM3L 2Q8AH 4U1KA 4ELME 4X6DB 2OXGA 3MFGB 3W0WB 3ULUC 3GHEL 3LD8B 1LK2B 1MAKA 2PCPB 5HGBA 3QUMA 3IU4L 3ARSA 4NQEA 5I15L 3C60B 3U9PL 2O61A 4PRBA 3H42L 5FUOH 2HN7A 2M2DA 3H42H 5DJAA 1OT2A 1JNJA 4X4ME 5KVMC 4BK4A 2YOCA 2HT3D 4MNQE 1JE6A 3NCFB 5TE6H 1RY7B 1YMHB 4JO1L 4YQXL 5I18H 1G7HB 4YQXH 1H3PH 1HNGA 3VMPA 4FG6D 5FCSH 5T1LB 2A38A 3SGJC 1P4IL 1K8DB 3SKOA 1SQ2N 1P4IH 4R9HA 4M9OA 4X8JB 5FF6A 1U95B 4U0RC 3MV7B 4MJIE 3MRGA 2A74A 1RPQA 4NQSB 2W9EH 3H9SE 4KK9C 4UV7H 2PO6D 4ZFFA 3QNYB 3TCLA 4PRPE 3L3IB 4R7DB 4Z18A 1U92A 3LKSB 5A1AA 1IAKB 4JPWH 5C0RH 1F4XL 3VGHA 1HINH 3NCJL 1E27A 5C71A 3BKJL 3NCJH 3Q6FA 2Y07L 3AVEA 3BKJH 2XNAB 2OTUB 2UY6A 4O9HH 5GJTL 1WBZB 5D7LD 4HK3N 3BP7B 4G3YH 4OV6F 4R96A 4YHNA 1KC5H 4CVWA 3UBXB 1LNUB 1YYLH 1I1YA 1AD0B 1JGEA 4X9GA 3TN0C 4WV1C 1KG0A 4MNGA 2ED7A 3VWKB 3W5MA 4HXBH 2NLJB 4YPGB 2UZYB 4NJAH 1QBLH 1LO3L 2C3VA 3H3PH 3LN5A 4QY8B 2HRPL 4LVOB 3GM8A 1FIEA 1G7QA 5CGYD 5EZOH 2VIRA 4MCZB 3F7YA 5F1OB 3VMOA 1NUGA 1CGXA 3IDUA 3IVKB 3BJ91 4L4VE 4GAGL 2OBGA 4BKLB 1JCKA 3OB0K 4KMLB 4L4TD 3L95B 3IETA 2IEPA 4ZUVB 1RJZB 5CILH 5B3JF 2NY7L 1C7TA 4YBLB 2NY7H 4X4ZA 1PD6A 1TITA 5IVZB 3RIFF 4LNRA 1T0NA 2AXFA 4RGNE 3VA6A 4U1MA 5IJKA 5AZ2L 1OM3H 4OM1L 3M45A 1U8OA 4OM1H 4HF5L 2Y6SD 5B3NA 1A22B 4XZUA 5MP6H 1ZT4A 2NTFA 3TNMA 3IJHA 5FUCC 2ERJB 3GEWB 4G8GE 2CRIA 1NC2D 2FD6H 5JW4M 1A6UL 5EU4A 2X7LA 4JKWA 4U1MB 3UAJD 3RIAK 3WFDH 1QZ1A 2PO6A 3FN3A 3OQ3B 4NQVB 1XF2B 1ZS8B 3PV7A 3VFMA 1DANU 4NFBA 1J86A 5I71B 1UEYA 3D39D 2C4FU 4PY8I 4OCSL 5BJTA 3SDXA 3DV4A 4MB5A 4P23B 5DUPL 5EU4B 5D7IE 2XRAL 2IAMC 4TPRL 3V95A 2VB5A 5D7LA 3BSZH 2NTSP 4D0BB 2YZ1A 2AEQL 2DWEB 2IMNA 3O3DB 4Q2ZB 4OCMC 5E6ZA 5EU5B 1F4YL 1GZQA 3GBLA 3NCEB 1NAKL 1MWAL 1NAKH 1MWAH 1VFBB 3LKRA 3RNKB 1IQWH 5KTEH 2Q7YB 2BY3A 3D0VB 2A83A 3JV6B 3OJ2C 3OTTA 4PJ7A 2BHZA 3VFNA 1XH3B 3KPOA 1LE5B 2BCKA 4LMQI 3VGFA 1KGCD 4NM4H 4PBXA 4BZYA 2IWGA 5FYJD 5D96B 3RI5K 1FVEB 3VGEA 3PHSA 1JPTL 3IU3A 4UI2A 1IL1B 1F11A 1I7UA 1KTDB 4N68A 5D1XB 2V7NB 1OP9A 1U93A 4L4TA 2NY5L 5GGRA 4HUKB 5T3XD 3KPOB 1A02N 3RWIA 1K4DB 1A7NH 3PGFH 4ODBD 4PGEA 2CUMA 2Y7QA 4UINH 1NAMA 5D2NA 3KPSD 4IRJD 5HHMD 2CLVA 4WW1A 3OR6B 4O00A 1T22B 4M6OH 1KLGB 4OZHB 1II4E 4ODXB 1F11B 5KAQF 3QYCA 1U93B 1N0XH 2J8UB 3RGVD 3VDCA 5JORB 5DWUL 1SEBA 1EK3A 1FO0B 1KF9B 1IE5A 4WUUE 2AQ1A 2VOTA 1KSRA 4K55A 3ARBD 5FO8A 4HIHB 5CGMA 4JFZH 2GKIA 4W81A 3TV3L 3LQZB 2NMSA 2HP4A 4PJXB 3D39A 1G6RA 4WEUD 1NMBL 1NMBH 2X1QA 4R4FH 5E4EC 3UO1L 2LFGA 4XMPH 4WHDA 3OAZK 4P4KD 1J8HE 4EUPA 2LU3A 3NFSL 3VFRA 3WIFA 5DURD 4X80H 1CE1H 4X98A 4QNPE 1BOYA 4IIQA 2BXYA 1T4KA 4JREB 1AKJB 4OZ4B 5GS1B 2H9GA 5IMOB 5IBLC 3JWOC 2CK0L 1FNHA 1SEQH 3VRLF 3TO4D 5EO0B 1U8KA 5GRVK 5IVXA 3VXSE 1VEOA 4UUJA 5EG6C 2DQHL 5GHWH 2DQHH 4LNVA 3K0WA 3TM6A 4NWUL 2WWKT 4W4NA 3PJSA 4XNUL 5IR1A 3STZB 3PWNA 4GRWB 5JHDE 3GJFH 4LEXL 4LEXH 4XVSL 1IT9L 1GC1L 1XZ0A 2Y06L 1GL4B 3ZKMC 1NEZG 3MRRA 4OB5H 1CGTA 4OCWL 1FORL 2HLFD 4QKXB 4OD3H 1XMWA 4YGVA 1OL0A 2O5XL 1R3HB 3QZWG 3C5ZB 3CLFH 1BZQK 1JMXA 3BD5A 1F6LL 1TXKA 1B88A 2QQLH 3T0EE 3I6KB 3KPSA 4IRJA 5HYSB 5D7KE 2PW2B 2YPLB 1KEGL 2AJZA 2AJUH 5JW5A 1KEGH 4LHUB 5DD5L 4X7TB 2HFEA 2HMIC 3LVEA 1FFNA 1PAMA 2BDNL 3MBXL 1FC1A 2ICCA 2F58H 1IGIH 1A4KA 3RGVA 3RVUC 2MQ0A 2NY2D 5B4MC 4IMKA 2BVTA 1P2CB 3HE6D 4X6EB 3SO5A 1MCKA 3ARBA 4Z7QE 3VXNA 2VLJB 4XPHH 1BOGB 2EIBA 3O4OB 4UTAL 3I50H 4JPVL 4JZOA 4XWGH 4YUEH 5D2LA 1OTUD 1VDGA 4P4KA 4HKBB 3FJTA 2E7MA 2CDFA 5B8CB 1HH6B 5JMOC 2A1WH 4M02A 3LOWA 5IEKB 2R23B 4TNVF 1OP5H 1TTUA 3MRJB 3HTLX 1Q9WB 1AO7A 3WUWG 4OGAC 4MA7H 3SGEI 4DOHB 1SYVA 4FQCL 2OJEB 2YD1A 3WJJA 3SY0A 4MA8H 2EZ0D 3TO4A 1J1PL 5E9DE 2BJML 2BJMH 4Y2DA 4PP2A 4JLRB 2QEJA 1AO7B 3PDDA 4HCRL 2AI0H 1INDH 2DD8L 4Y16C 4ENED 3EOYG 3VXTB 4YHKL 4YHKH 5JIIA 4K3JH 5HPMB 4QF1B 4Z7UE 2K9UA 3NZHL 4Y4FB 3CUPA 4WIQA 2MFNA 1OGTB 1NUNB 2GSIB 1DQTA 4GXVH 5HVGB 3MOAH 1VESA 1NMAH 2X1PA 2V2XB 3PWJB 4MQXC 4JR9H 4NN6C 3HZYA 3GRWA 4Y4HB 5C09D 5DJ0B 5IQ9A 4K7PX 3JWNC 3SOBL 3CUPB 5HGHB 3GIZH 5DEGB 2P5WD 1FN4A 3SE3A 2DQDH 2XWBB 2WSKA 4BFIB 3V5HB 2FGWL 4LSUH 3RKPA 1UWEL 4HJJL 2RCSH 4KJQC 1ADQL 3WKMH 1JZ3A 1B9ZA 2O5ZL 3HE6A 2C26A 5D72H 2LVEA 2ORBH 5IB5B 3BPOC 4B41A 1F58L 1WBXB 2ID5A 4XGZB 3WL9B 5M7QA 4WHTB 1F8TH 1ONQA 1PG7H 1URLA 1UWGL 3HN3A 1UC6A 4HUXB 3V5DB 1MHEB 2P42B 2B1AL 2VUYA 1NUFA 5TFSL 3MLPA 4ODVL 4ODUA 3OPZH 1DE4B 3RAJH 2NY1C 5IFAL 5E2VL 2E7LA 1FZMA 3X12B 2AAVA 2R2EA 4PREB 1RZKH 3ET9F 5DRXA 2W0KA 2V5YA 3IF1B 4M3JA 4Z6AT 1UA6L 4GBXA 3WHE1 4HDIB 1A9BA 3LPWA 4N1HB 5FO9B 1GHFL 4A6YB 1OD9A 1GHFH 3QDGD 3SDCB 5DK0A 2H1PH 4ZFZA 3G5VA 3F7RA 5C0FA 2OS7A 5JQ6H 3C8HA 4GKZB 1T1YA 3QJFA 4UT6L 4KC3B 4S1DC 4GBXB 2WMPA 4OZGA 5MEQA 3TBSA 5ESVA 1LEGB 2P5EE 2W92A 5T3ZL 3K4ZA 3G5VB 5T3ZH 1A6AA 3MCKA 4LLUA 3V8OA 1W2KT 3P11L 1AGFA 3BP4B 3B83A 3NA9L 5FKPB 4XPGL 1Q9OA 3NA9H 4FTVD 4L5FL 4PV8B 1ORQB 4ZFOB 2SEBA 5DLMH 4ELMB 2OK0L 1Q0YL 4HX1B 5CHNA 1Q0YH 5EU3A 5C09A 4KI5D 3TT1H 2PETA 3PL6C 2P5WA 4WI6A 3L3DB 4GKOA 4B0MM 3GMLB 5TH2B 4KK9D 2DDQH 3CMOL 4TUOB 5DDHA 3RIFK 4OZFA 1BECA 4KUZH 4CMHB 5F70A 4F8TA 2Z93A 3HB3D 43C9B 4MNQB 2Y5TA 4NZUL 3FB6A 4U6XB 4WWKB 1ZGLP 2HJFA 5DHXB 3F58H 4JY6A 3WNPA 4NHCH 1Q9KB 4X0KB 5DRWB 3U7WH 1GOGA 1WSST 5GZNC 2D3VA 4AEEA 5FCUH 1LEIA 5DT1H 4M5ZH 5EBMB 3U0WL 1KIPA 4LL9A 1YNKH 4TTGA 4NN7B 4O2EB 4JO3H 3O2DA 4MJIB 1JNHB 4XVTL 5F72S 1KCUL 5JQHC 1KCUH 3H3KA 3H9SB 2FRGP 1KFAL 1YQ2A 4RFOH 5BRZE 4PRPB 1DVFC 1UACL 4DZBA 4WU7A 4QRUA 5AEAA 2EYRB 2RHEA 3ARGD 5F6IC 2DQTH 3QDGA 4IJ3B 3SE4A 3MCLL 1PFCA 4IOIB 4MD5B 4HIEB 4JZNB 4HAFA 4JCLA 3EDFA 5HVFB 2DJ4A 4N0UA 1AHWA 4HWZB 4KTYA 4N8VG 2X4NA 4HUWA 3SBWC 1I8MA 4K94H 1RZKC 1MVUA 2JCCE 4IRZL 4G8FA 1IEBB 3MRQB 1JGDB 2DS4A 1ORSA 3GSXA 2AEPH 4XNZC 2DTSA 4FTVA 5EUOE 4ZXBB 1QFPA 2FX8L 5KZCD 2ZNXA 3BPLB 2FSEA 4LSPL 5GSRB 1U8HA 4KVNL 1GOHA 2ITCA 1QSFE 4RWYH 1RZGB 5CMAB 4M93B 4L4VB 2Z91B 1FL6B 3BAEH 4HWNA 4BZ2H 5JTWA 1MFAL 1EO5A 3MLRH 2CDEA 3BGFB 4XP5L 1KBGL 4Y4KB 3EBAA 1UENA 1WZ1L 2GJ6E 5F89A 2EECA 3ZKQD 3LB6C 1HNFA 4RGNB 2V9RA 2HFFB 1UKQA 1NBVL 2IAMD 5IP4A 1XGUA 5F1KC 1NBVH 1FYTD 1TQCB 2VR4A 1JHTB 3QT2A 5DC9B 1MJJA 2APBA 4EBQL 5F89B 1BAFL 5BCAA 1C5DA 1FL3A 4G8GB 2M26A 3MA7A 4OQ1A 4GKSB 4J3TA 2OSLB 1FFQA 3CFJB 2IBBA 3MUJA 2AABL 4M7KL 2WZPD 5KG9A 4YPJA 1KTRL 3P40A 4Y5XB 1V7NH 3QPQC 3CZJA 3DX6A 5GJSL 3ARGA 3RZCB 3E0GA 4G8EA 5GJSH 4P2RD 3QUYD 3PHQA 4PJGE 3GSRB 5F88A 3ZDYF 5D7IB 5CEXB 2X9YA 2ITDA 5CZXC 2IG2H 2CIKA 5C70A 3SDAC 3DX8B 2GTZA 5DTFB 5IK3A 4C59B 5FHBL 3CU1A 3HZVB 1YMMD 5E6IB 5BVPL 5J8OA 1CLOL 1S5HA 1CLOH 4ERSH 2ZPKH 5MEOB 3BPNB 2V7HB 5HPOA 1LDSA 5DD0H 5F7KC 1AFVL 1PQZA 2FIKA 4PJ9C 4I2XA 1AFVH 1K9TA 5B38B 4CBPA 2X05A 4Y5VC 3G6AB 1VFUA 3DI3B 4LEOA 1F02I 3EYVA 2IQ9L 2AGJL 3C09C 3QXAB 4M1CD 3O45A 5I2IA 4IMLA 1ZT7B 5C1MB 3O4LE 2FIKB 3VW3H 1J0HA 4K94C 2RFXA 1N64H 4OKVB 4KGLA 2D31B 3UX9B 1CK0H 3ETBF 5T1DH 4K23H 3HMXL 5CSGA 4Z7WF 2IAMA 2H2PD 1VPOL 4I18A 3FO2A 5BW7C 3IKCB 1FGVH 4RMRA 4X9FA 5IIEA 5BMFL 1M7DA 5IGXL 5J12C 2BNQD 2HVKB 1F45A 5IBLD 2D0GA 4YXKL 4WUUB 1J8HA 1ZA6B 4XI5C 5A43C 4LVEA 3SQOL 3FB5B 3LS5H 3SQOH 3V7MA 1H5BC 1REIA 5EDXA 3FB8A 3RDTB 3N85L 5DJZB 1UB5B 5FM5M 4P2RA 4LCUA 3QUYA 5EU7C 5IKCB 3V0WH 2B4CH 1J8HB 4OGZA 4DQOH 1CFVH 8FABB 1MI5D 1A3LH 1I7RB 3L6FA 4JFXB 5EIQA 3WEXA 1XGTA 4U1LB 2BRQA 5LVEA 4LQFL 1DBJH 2E9JA 3VXME 4LQFH 3T3ME 5IWLC 2XFXA 3X13B 5CBAA 3MNZA 4X7FC 1MFCH 4G42B 1WAAA 4GG6E 3GSOA 3LHPL 2F54D 1IZKA 5D1QB 4IDLA 3CU7A 4M1DL 3VXSB 1IC7L 2GFBB 4PLOB 2KBGA 5C08D 1IC7H 2J12B 2HMID 1CLYH 3U7YL 1E6OH 3U7YH 5EOCL 1GJIA 2KZ1B 1BVKA 4E0RA 1FAIH 1IGFL 5JHDB 1GCFA 1K5NB 2Y36L 4GRLB 3GSOB 2Y36H 1K4CA 1S7QB 5B4MD 4EDWL 5GISL 4EDWH 3CSYA 3FQWB 5J3HC 3QUXD 2OJZL 4OIBA 4QGYA 4XNYH 2OJZH 3QIWD 1PZ5B 3FMGH 4Z7WB 1BPVA 5CWSB 1YEKH 3T4YA 1ZSDA 3T0EB 1GGCH 2IH1A 4R2GB 4PJCA 4ZS6C 1TZIA 2VQUA 2JIXB 2PR4L 5I1DB 5D9SA 5JW4Q 4F7EB 3BEVA 4ONGL 1P4BH 5ALBH 4WFED 4G8IB 1P7HL 2VE6A 3GZKA 4C54A 5D8JL 3ZYIA 3EDDA 5F7YC 4U6VL 3IDNB 2YS4A 4LLVA 1MFBL 3T0AA 3ZKND 1MFBH 3UDWA 2YA1A 3MRNB 3RL1B 4CU6A 1G1CA 4JKLA 1JK8A 1FZJA 1S8DB 4K9EL 2R29L 4NCC1 2RQ8A 1RJLA 1Q1JH 3FHAA 4Y16D 5DJCB 2C1PB 1MI5A 1QRKA 4LCWE 5T5FH 2VO5A 4CADB 3KLSA 5EOQH 1XF3A 1IGJB 3B2UD 4F7MB 3DUUA 2LTQB 3RWCA 1ZGLA 2IFGA 4NUJB 3F6IA 4GUPA 1MWAA 1MCRA 4ELKA 3S98A 5CZVL 2R0KH 4QHMB 2VWEE 5CZVH 1HHIA 1AE6H 1MUJB 5EUKB 5E9DB 2F54A 2LVCA 2B20A 3K2UL 5E8NA 5FEBA 4UDTB 3K2UH 5I1CH 5C08A 5ANME 4YXHL 1NCWL 5D93C 5LWYL 2NR6C 4M7ZC 5DD1L 5T1KA 4JJ5A 1CLZL 4GUPB 3SCMB 4M61A 1CLZH 2FH8A 1BBDL 1KTLB 5ETUB 2OR7A 3A0OA 2E5EA 5ICZB 4Z7UB 1ITCA 5E8NB 3QUXA 5F96H 3QIWA 2XXCB 3ME0A 5EO9B 5T1KB 1J0ZA 3RA7L 2VC2H 2OTPA 3G5YA 3GK8L 3MODL 1N6QH 3B9EA 2KQNA 5JXAL 3IAQA 4LCYB 3NABH 5DVLA 4Z5RA 3DO7A 3L7EA 3PP4L 4I0KA 2F8OA 3A67H 4PLJD 4Q9QH 4XT1C 1FYHB 1WZLA 4LF3A 4LLWB 4RMWA 3BMWA 1FRGL 3V0VB 4DN3L 5FGBC 1FRGH 5L6YL 1OOAA 1B2WH 2UWEE 1KEML 5FB8B 4ALAL 3FFDA 2V17H 3IDJB 4JY5H 2BRRL 1BEYH 2K7QA 3FTGB 3MRIA 4FQXB 4PJFA 3VFUA 5DHVA 5JA8B 3EFFA 4FXKA 3MLXL 3DHJA 3OL2A 4S1DD 3BDBA 4Y16A 4S2SB 5AG8A 3BDYH 5D7JC 1OAYH 2IBZX 2E6QA 5FECA 1R24B 2AKRB 5KSUB 4LGRB 3T0BA 5D1ZC 1Q9LA 3O6MH 1A1MA 5E00A 3PDOB 2G5BA 2VJXA 2XKNB 1D5ZA 4ISVB 3T1FA 4ETQA 3W11D 2J3SA 3RTQD 4Z95L 4LHJB 3T0WA 2P5EA 1IKNC 3O9WB 1FPTL 1P7QB 4DVRL 3FQXA 3QG6B 1YUHB 3QWOB 4DAGH 1DFBL 5CSBA 1RZFL 3QUKB 4X5XA 1NEZA 4QRTA 1RZ8B 1NCUA 3GJFA 3V2AR 1S3KH 2H8PB 3MV9D 1HKFA 1FFPA 2P4AB 2P5EB 4QTIL 2QLVB 4JN2B 2W91A 4TUJA 1BLNB 1JWMB 4PLNC 4NOBA 1KNOB 2N56A 2JJSA 3WFCH 2NY0C 2JLLA 1M05B 4M5YH 5F7LB 1G9MH 1DUZA 1NEZB 1LO0H 5GZND 2NXZB 3EYUL 3CFCL 1M6OA 3SJVD 1MRDH 4DEPC 3CFCH 1KN2L 1HK6A 2LAAA 3QZWB 1FHGA 3BKML 2W60A 5AYUL 2W1NA 3ZKSD 5DC4B 1YDPA 4BUGA 2A6JA 4LKCA 5FM4A 1DP0A 4Q0XL 3QBTB 4Q0XH 2VTFA 1DVFD 5DQJB 4EI6A 2YR3A 1AY1L 4M6NL 4LMQE 2HJLA 1LP9E 4YXLL 3TP4A 1PW3A 4H26A 2YRPA 1JF1A 1N5YH 2VLLA 2GTWB 5LBSH 2Z4QA 3ZE2F 3ECBA 1SYSB 5BRZA 3KLHC 3WUWA 4EDXB 2EIEA 5DFTA 4D9LL 1LDPL 1R6VA 2ARJA 4GW5A 4UILL 4L8CB 3MNVA 1WFTA 2R0WH 5BRZB 1M7XA 5JNYA 2NY6B 2Q8BL 1OAKL 4NRXB 2Q8BH 3HG1E 1OAKH 1JZ4A 2AV7B 3GSNL 1FFOB 1QA9B 3GSNH 2EDOA 3RTQA 2NY3B 1OVZA 4M00A 1E6JH 2F8XC 2CDGA 1PDKA 5IMLA 1G0DA 2W0PA 2VXUL 4X6CA 2VXUH 2XWTB 1DBKL 3DBXA 2PYEE 4HCRA 5ESAA 5EUOA 1G9NL 5EFIA 5IW6A 1N6UA 4BSJA 7CGTA 5IG7A 2YD7A 1MY7A 3G04A 2JCCB 1AGBB 2CDGB 1KPRA 4K8RH 4F7PA 5T3ZD 4LPVA 1EFXD 4OF5A 4OLWL 1MCOL 1I3GH 1R0AL 3LB6D 4J23A 4ZO7A 4GG8A 2D7PA 5CCKL 5EORH 3RNQA 5EUOB 1BZ7A 3MRFB 1D7FA 5MEPA 5SWQA 3RP1A 3SJVA 1F00I 3L3KB 1KCRH 1QSFB 3J7HA 2RR3A 2ZOLB 5J6HA 3UMTA 3QQ4A 2ICWI 5MEPB 1DVFA 1A6ZB 1ADQA 4R90H 5IEHB 4EN3B 4P2CG 2YPVL 1RAMA 4MGXA 2YC1B 2GJ6B 1DN0A 1TNNA 2HJKB 2FO1A 1G9MC 4NN5B 4TUKL 5ILTH 5ERWA 3MREB 2ICEA 2VSDA 4G7VH 4ZS7H 2IGFL 3REWA 2APWA 3LQAL 1CIDA 3ARDC 3LQAH 3PIQA 2QKIB 1QSEE 5FO7B 4DN4H 3N1MC 3P9WB 4PJGA 4I77H 2WP3O 3ULUE 1OAUH 2P24B 3RL2B 4APQC 3GKZA 5IB2B 4PJ9D 4X7CC 3REWB 1UXWA 3FO1A 3MXWH 1DSFL 3QEHB 1DSFH 3TA3C 1SY6L 3NIDE 1J9CT 2PN5A 1TQBC 2AJVH 1QPPA 3OJDA 4PJGB 3BT2L 2EDXA 3BT2H 5F8QC 1UZ6E 2FBJH 5GGQH 5CP3A 9CGTA 1FH5L 5IUSA 1NUDA 3WYRA 3DJ9A 1UXWB 3MRHB 1BQUA 5A3IC 3OHXB 2MKLC 3E6HB 3KYKL 3DMMC 3B4NA 1EFXA 5HHVH 3WLWC 1DDHB 5EPMB 1Y18B 3D18B 2OLDA 4PJ7F 4UT7L 4P2YA 5BO1H 1MCQA 4EI5A 1DUYA 3INUL 4GG6F 2C9AA 1JNLL 3I75A 4JB9L 5C8JA 1ZANL 3MRKB 4YIQB 3OX8A 3GUTB 3F7VA 5BS0E 1OCWH 5E5MA 2FYYA 3ZDXF 2OR9H 5ENWA 4Z77A 5IFJA 3O4LB 4EI5B 5KSAB 1CG9B 5KN5B 4P46B 5AG9A 3BPCA 2VISA 3JVGC 3HE7D 2APTA 4K8RC 1QLRA 3RBGA 5C0BD 3HAEG 4KU1A 2EDEA 5E08L 5I1KL 1F3DH 2Q3ZA 1U36A 1B0GA 3DVNB 3MJGX 1NSNH 4GMTH 3UXFA 2C5DC 1K2DA 1MQKH 4JDVB 2YA2A 3CFIC 2NYYD 2Z35A 1LEKB 2XN9D 1I9IH 4FHBD 1AD9A 3IAGC 4GKNA 4XAKD 2GT9B 3O2WH 1DCLA 2HTKC 4GS7B 2Q7NA 4ZTOH 2NPLX 5MERA 2FB4L 1Z3GL 2DLFH 3K4AA 2FB4H 1LMKA 5EOCJ 5L8JB 3TYGL 3UP1A 1ZTXH 4PJ9A 5J4MA 1SHMA 1KXTB 1X6NA 2NY4B 2CKBH 4Y5VA 4H1LB 2YMXH 4J4PC 5HJ3A 1F42A 1SM3H 5L0QC 4N8VA 3LPGA 4NO5A 2MWCA 5SX5K 1T7YA 2R4RL 4O2FB 5F71A 1UEMA 3QCUH 1UT9A 2HT4D 1XGRB 1WFUA 5C0GB 5E95B 3VXMB 4ZUUB 1WQVT 4UDUA 4HKZB 1NDGB 2IBGA 5HJ3B 3RWHA 4ZUWA 1YJDC 3LRGA 1NANH 3FOMA 4GG6B 1CGVA 4ZS6D 1JPGA 1JI1A 1YN7A 5I8CB 5HHQB 3GMPB 4RDQF 4XCNA 5F44A 4UQ3B 4RSVA 2UUDH 2GJJA 1CDHA 4OZIE 1IKFH 4U1JB 1JGUL 5D5ME 1QLFB 2DQUH 5JZ7C 3X3FL 5IB3A 4QOKE 4LFHG 4U7KA 4D0CB 4JKPL 3VXPB 2FL5A 2R2HA 3HR5B 4KDTC 5J11B 4JKPH 2YD2A 3HE7A 5HVHC 1F90H 4HUUB 1Q94A 1EFQA 5C0BA 3ROOB 4WO4D 1D5BB 4LCIL 3C6LC 1HXYA 1HSAA 2HH0H 1T2QH 4KUCF 2EXWC 4GW1B 4HW6A 2DLEA 1OQXA 1NC2B 1NCCL 4H20H 3TWCH 3NAAL 3NAAH 2FECL 2BOBA 4FFVD 1RK1A 5IBUB 2XN9A 3QB7C 4GOSA 2Q86B 1HXYB 3NCYS 3RZWA 4N9GB 2JJUA 4YDIL 4AENA 1UM5H 5FDYA 4MB4A 3BKCL 4KVCH 2JK5A 5D2LF 4I0PC 1QVOA 4HKXB 5AAMA 2UWEF 3IJYA 2GI7A 1UM4H 5CAYB 4XVJH 2OI9C 1Q72L 1INEL 1KPUA 4LCWB 2PTUA 3I6LD 1INEH 1N59B 5ID0B 4PRAB 5JHLH 5DMIL 3ZE0E 3GKWH 4UIKL 3U30B 5DMIH 5TJWK 4UIKH 2VH5L 4CUCA 2XG5A 5DZLA 3EOBA 3KYOB 3S34L 2EH7L 1T1WA 4KGJA 4PUBL 4HBQA 4NQCD 4N0FA 3TIDB 3E6FB 1YNLH 3UTPD 2R2BB 2J5LB 4JDTL 5CEYA 3ULVL 5EC1A 4P48A 3DUSA 1YY8A 5ANMB 5HHPA 4HJGB 4Q9RL 2VQTA 5BZWA 5ISZD 2EEBA 2DLTA 4I3GA 2AXGB 5DJ2A 5E8PB 5CUSL 2MCPL 1MREL 4N0FB 3DX9B 1MREH 1UM6H 3PWUB 3LPFA 4X4XA 1DLHA 4NC0B 1D6VH 4ESKA 2ZCKH 5FM8A 1SMOA 1DBAH 4JKKA 3B8SA 2NXYB 4DGVL 1KV3A 3NIGE 4WO4A 2VDLL 1EDQA 3MRLB 1DEEB 4JFFD 3VXUD 1IAOB 1DLHB 4Q6IC 2FLRT 5DVOA 1BVZA 1A6PA 1T20B 3SDDC 1ZLVK 4WUKH 4HPOH 1R3KA 4YBQC 4ODHH 4PJAF 2AK1L 2AK1H 1I3RB 5GGVL 2X4TB 1LE9A 5GGVH 1ND0B 2MMXA 5C0AD 2BOCA 1IC5L 3T09A 1MHPL 4X5WA 1MHPH 3EYFA 3KXFE 2XQYK 1YZZA 3K81A 4L3AA 3IB4A 5DI8A 2MQCA 2UWEB 4PR5B 1YEJL 1Z0MA 5FYLH 1J1OL 1RK0A 25C8H 3AS0A 4YDJA 3EJZC 4AIZB 3QQ3A 2DL2A 3EYOB 1KT2B 1LP9F 4QYOB 3MJ7A 4FNLH 4Z7NE 3QI9B 3EYFB 2BK8A 4YNYA 5KVEL 3WHXB 3D2UD 2IPKB 3DOSA 4KKNA 2GK0A 1U8JA 5HDQL 1JJUA 3TBTA 3UPRA 1U3HD 2PNDA 2C1OA 2WAHA 4AEHL 4NQCA 3ZDZE 3FQTB 5E1HB 5INCA 1S7VA 3HLAA 5KW9H 2EIZA 4KWUA 5C0DB 4ORZC 4ZTPH 5A2KH 3FOLB 4MWFB 3KJ4B 2R4SH 2OZ4H 3OKEA 2MPAL 3NH7H 4OZGF 5EZJA 4D0DB 4WW2C 1UKTA 5H2BA 5ISZA 2VZOA 1QNZH 3EJYC 2XY1A 4OV5B 4V1DD 3CZFA 3VG0H 1CBVL 1W72L 5A2IH 3UTSD 1S7VB 4KHTH 1U8NA 1C12B 3QR2A 5KJRL 1NGWB 2I07B 4F15C 4E42A 3R06A 4MZ3A 1WICA 3TBVB 3GMMA 4JM2C 5JO5A 4NHUB 1TLKA 4X9BA 1NC4B 3V52H 1A3RH 1QFWL 3VXRE 2OM5A 4KJYB 5H8DA 4JFFA 3EDEA 4PJAB 3VXUA 3KLHD 4MA3B 3H9HA 5HDBE 4YC2C 5AUMB 4XBGB 2AV1B 1C16A 4KRPC 4JFDD 5EU6E 1ETZA 5C0AA 4JQIL 4FQQA 1EGJH 2ZG3A 4YEEA 5KVDH 3HPLB 1EEZA 3VGAC 4L1HA 1LP9B 3SO3B 1RUKH 2Z92A 4N1EA 3VFTB 1F3RB 4PRIE 4XNMA 5JDSA 4OTXL 2R69L 3TYFA 5I1IL 1OAZL 5C0JB 2D7QA 1QFOA 5DK2A 5I8OL 3VWJC 2JKXA 3D2UA 3MV8E 2RAMA 1NGZB 3QQNA 4N90D 5K9QI 5TQ0H 3L5HA 5ADPH 5DC0A 3DETD 3OKLB 1U3HA 1CD1B 4XNMB 5JDSB 4FXLA 1YEFH 1ZV5A 5C07E 5EBWA 2HG5B 2X4UA 4OLZH 1MIEL 3HG1B 1MIEH 5D7SL 1G7MB 2HTLC 1ZHKB 1YN6B 4XP9L 5F7WC 1FL5B 1T1XA 4H8WL 2KDGA 5F6HI 3RWFA 5AD0A 5J9PA 3K74B 4HXAL 1DLFL 3MMEB 2V9TA 1BVLA 1BF8A 2PYEB 1PKQA 3NIDF 5EBWB 4TRPL 1XCTA 5CBEB 1MFDH 4V1DA 3QUZC 4PGBB 2A6KB 3RPIB 3UTSA 4OF7A 1RJCA 1ZVSB 3TJHC 1OSZB 3U1SL 5BQ7A 1KPVB 1C5BL 1C5BH 5HI5C 3ULVE 1ZWIB 3CPLB 3QULA 4R97C 4WFGD 4NNXB 2VDKL 4KI5F 5H94B 2VDKH 4CVUA 1RZJL 2P8MA 1RZJH 1CGYA 5LAXB 3RWDA 3ARDD 1TVHA 3VFGH 1EJ6A 4F58L 4NYLB 4Q97A 4WFHE 4AEIL 1X5YA 3MJ6A 4JFDA 2VQ1A 4FQ2H 5A16B 2DQIH 2KH2B 1P69B 5TGBA 3P4MA 1NLDL 4P3CL 4APQD 4PRDB 2Q87A 5ICYA 4MNHB 1I75A 2G2RA 5E8OA 1CXEA 2DYPD 1JRHL 3LV3B 5GGUA 1QSEA 1F4WH 1JUFB 2W9LA 1HKLH 1YQVL 2XPGB 3HRZA 3OR7A 1YQVH 4YEFA 4X83A 3MRMA 1QKZH 3M17A 4OQTH 4Q74A 1RJYA 5CSZB 4X4YB 5A3ID 5I30H 1MFEH 3ZSSA 5BOPA 5L2KD 5FM5O 1QFHA 2W9DL 4BZ1H 3DMMD 1E4XL 3W9EB 2W9DH 3ZKXC 3WLWD 4JHBA 4B7IA 1UYWL 2BNRD 3O3AB 2BVOB 5K9KB 4P9HL 3MGTB 1H8SA 4R0LC 2F5BH 4I9WD 3WIIH 4KDWA 3QIUC 2VITA 1FNFA 1M71A 3L3GA 2GJZA 3ZL4H 1VEPA 3UJTL 1WZMA 4HD9A 5I73C 1D5XB 5F21B 4PS4H 1VADB 2VSCA 1ZHNB 3CDYA 4HG4K 3QJHA 3VJ6A 4MHHI 4PG2A 3L3GB 3DGCR 5I8EA 1CFTB 1XF1A 2IADB 3KYMA 5TQ2L 1KOAA 4NJ9L 3WXWL 4K8RD 2XZQH 1VGKA 1HHJB 3TO2A 5L9DL 1DQMH 3QDME 2WIMA 3I3EA 3B6SA 3DGGA 4U0RB 3WDJA 5KVGH 5F3HA 1FG2B 2P47B 5HVWA 4IHOB 4S11A 1X5JA 2VR9A 1HYRC 3KYNB 1R5VB 1NBQA 3H3BC 3ARDA 5BS0B 4FP8L 5FHAL 3WXVL 4MA1C 5CIPB 5D71H 3T8XA 3PWLA 1FLTX 4L3EE 4W6YB 3SKJH 5I6XC 3DX7A 1OF2A 5IF0B 1U58B 5T33H 4PTTB 2DQEH 2JB5H 1NANI 3P0GB 4HS6A 3IDGB 4R7NA 1JYVA 3BW9B 2Z8RA 3TN0B 4WV1B 1MH5B 3P4OB 3PHOB 2VLKE 4UTBH 1KN4H 1AI1H 2DLIA 4O51A 3VDAA 1G9EA 3CVIH 3LKQA 1RVFL 5L2KA 1RVFH 1OD7A 3BUYA 4NRYA 1TCRB 3QRGL 1OGAE 3DMMA 2BNRA 2WK2A 3F8UB 3WSQL 4PB9L 2I9LA 1G7JA 3GSNA 2IH3A 5E2UH 4UOW0 1A6VL 1S7SB 2FEEL 5J6GB 4NUGL 1PSKH 1A6VH 2R15A 3QXTA 1EA9C 5IVOA 3BQUC 1D5MB 1T04B 1XGQB 2BSTB 1D5IH 2D2OA 4KDVA 4KQ4L 4PJBF 5E8EB 5DJ8B 4KQ4H 3VFSB 3VD5A 1EPFA 2I9LB 1G7JB 3VMNA 4LLAA 5CJOH 4ODTL 3N9GH 3PQYE 5JA9A 1HQRA 1GRWA 1WAAF 1TJGH 1MOEA 3NFNB 1MLCA 5D5MA 3L3JA 3NCBB 2G9HA 3LMJH 3PF2A 4NDMA 4D94A 2EXWD 4IRSC 1CXFA 4LSTH 2DQGL 4BQ6A 2YSSB 4TTDC 3BGAA 3QSKB 1OAQL 1CF8L 1OAQH 5DMGC 4OZIB 1A2YA 1FVDB 3P4NB 5SWSE 1XF5B 5D5MB 4NP4L 3OB0H 4NP4H 4O4YH 2HLAA 4I3SL 4QOKB 5AWNL 4Y5YC 1A9EB 3ALPA 4NC2B 1I4FA 1IGCH 4L3CA 1CCZA 1OAXL 3H7LA 1OAXH 3BISA 2HKHL 3P73B 3P0VH 5IV2B 2HLAB 1FV1B 1S7XB 2QQQA 4KTEL 3F62A 3MGOA 1ACZA 5F7HA 2EDNA 5EBLA 1L9MA 3FQRA 4MXQC 4XCEA 4O2CA 1W8OA 1MEXH 1N7ML 2I26N 4LIQH 4OM0H 1JTTA 1RUAL 2APXA 1ZLWK 3GMRA 1E4KC 1RUAH 3S96B 3OKKA 3DRQB 4MZ2A 4S1RH 2VUOA 5DEFA 1F6AB 4F57L 1YMMB 4PJBB 4O2CB 4U1GC 1U8PA 3X14B 1PKOA 5EC2A 2XA8H 1MIMH 2Z8WC 3MXVL 2HWZL 4MMZC 5DD6B 1WBYA 3VFWA 2V2TA 4BFEA 1WF5A 3FB7A 4GAYA 1S9YB 1Z9LA 4JRWA 2ATKA 1NGPL 1INQB 4L8SA 2XACC 3V6OC 1RUQL 4Z0BH 1H3GA 5I8KL 4HMEA 1J1XL 2ZUUA 5I8KH 1MCEA 1IGMH 4P49A 5C92A 5MHSE 1R5IA 1K6QL 3KDMA 4FZ8H 4H5SB 4C83B 1MAML 5DYOA 3KLAA 4GAYB 3SDDD 3MLVL 4KKBD 4G6KL 1CDIA 4L8SB 1PG7X 2WINA 4YDLC 5MEND 4OCXH 1MRCH 3KJ6L 2EC8A 2XTJE 3LN9A 2XY2A 3MTRA 3O0RL 3S5LG 4RGOL 5HHNB 3LY6A 5E4EB 4OD2A 1MCSA 5EU7E 1CD8A 1HI6B 1MJ7L 3KNBA 3KDMB 1MJ7H 2W0FA 4MDJB 2WINB 4WDIA 1F4HA 2VDRL 3D3VD 3MRPA 2VLRD 3QAZC 4ZAKC 4JGUA 3D48R 4U1NB 3W2DL 2ZKHL 4ZUTA 3HAEB 2ZKHH 1CDUA 4JDZA 3BESR 4AT6B 2HKFL 1X5AA 5EZLB 1W0YT 2HKFH 4WDIB 5I1GL 1NQBA 5HY9B 4OGXL 4MQ7B 4PGDA 3IDXL 1S9VB 2WBKA 4NQDD 4PJHE 3HNSH 3KXFB 4RZCA 5C86A 4LCCA 4ZUTB 3A6CL 1ZHBB 3A6CH 1T7VA 2H32B 3GMQB 2G75B 1RHHA 2VABB 4PJFF 1XCQA 2AJ3A 3QDJE 4QXGL 5E5UB 4CNIB 4QXGH 1GH7A 4DCQA 3OAZH 1TPXC 1BWMA 4U05A 2CXGA 2FZ3B 2CKBA 4ZD3H 5HSFA 4D2NA 2WBJD 5BV7L 2XTLA 5BV7H 1FNGB 3EJYD 1HEZA 4RZCB 1DQJB 2OMNA 4XBEH 1FLRL 2BVPB 3KPQA 4OUUB 4MD4B 2AJ3B 2AS5M 4G6FB 4WENB 4P2QE 1EHNA 3AMLA 4R8WH 2BHUA 1KJ3L 1G7LB 5ABDE 4PB0L 2RBLA 1BMGA 3MBEC 3BX7C 4JPKL 2B2XL 5LGJA 1KCVL 5CLWA 3WNLA 2NQCA 1A47A 4XMLH 2XZAL 3SDDA 3OXRA 5L7XH 5HHOD 2YBRA 2Q6WB 4L29B 2DI9A 3S36L 5B39G 1A7PH 5MENA 2WIIA 4NO2A 3C5SA 4KRPD 4ACPA 4U1IA 2R2CA 1JWUB 1KIQB 5DUBB 4PJEA 5EOTA 3M8OH 2ADIB 3ZO0A 3S35H 4DKAA 2WM0A 3NBNA 4HH8A 2X9XA 4ZUSB 4KMTL 1OTSC 3H7BB 3DVGA 4KMTH 2PKDA 4LSSH 3D3VA 4HEME 1GGBL 4JRYD 3VXRB 1UJ3A 4UQ2B 4ZPVB 3ZTJH 4P5TC 4P59L 2VLRA 3EOTL 4Y1AD 1P4LB 4RRPG 4P59H 3WNMA 4O02H 3FONB 4HHAB 1OTTC 5ITFA 2Z31C 3FN0L 1LO4L 3OZ9H 3VRIB 3VWJD 3ZTJG 3BIKB 3F5WA 1SVCP 3O6KH 4JFQA 1FJ1A 4PGCB 3T4AB 4J12A 4MJ6A 3B9KC 4JFEE 4K3DH 4KROB 3SKNA 1T21B 5EU6B 4OF0A 3QUMH 4WFFD 4NQDA 1JNNH 1RHFA 1L7IL 3VFOB 1T89C 2OP4L 4WCYH 3NGBC 1NGYA 3EO9L 5DS8B 2HTLD 1YPZF 4HUNB 4XPFH 5EIIB 1A6WH 3FT3B 3NCMA 5FYLD 5D6DC 3HC4L 5I76B 5H35B 1XIWC 3GHBL 3NTCH 4V2CB 4PRIB 3IXTB 3C8KA 2O93L 4KY1L 4KKLC 3KPRD 1JWSB 2WBJA 3MRDA 4J6RH 3MRCB 4WW2A 4RMUA 3BVNA 1J0IA 1XGPB 4MAUL 3PV6A 2QSCL 3ARFC 3MV8B 1O5DT 4OLYL 2BMKA 4GMSH 5CD3B 3QQ9C 4KKCD 2CMRH 5HI5D 5F1NA 5C07B 4IDJH 3UJIH 4H25B 3V6BR 2J4WL 1FBIL 3KPLA 3QHTC 5DMKB 1SJHA 2J4WH 4PJIE 4S0TD 1WJ3A 3MNWB 3OGCB 4LLYB 2D0HA 2JB6A 3VD7A 3WN5C 3AM8C 5HHOA 3VD9A 3HS0B 4OBRA 3UBXG 2C3GA 3QIBC 1JN6A 3TH2T 5SV4A 2CO7B 1CICC 2DQFA 2CD0A 3X11A 5GS0L 3U0TB 5C0NC 4XTRC 3QHZL 3CFKA 2EO1A 3ILPA 2NY1B 1JHLH 2E6JA 3STLA 4OLEA 1IBGL 3FT4A 1J88A 2DMCA 4RCAA 2QTEA 4LVHC 4TSAL 4JRYA 1VACA 3CCHB 3AS2A 1QFWM 2MJWA 4Z78B 4Y1AA 3FO9A 1MCPL 3S97C 3PGCB 3Q5OA 5IROC 1S9XB 4IOSD 4YK4C 3VWJA 2P8LB 4TQEH 4NKOA 4CRPA 2WUBL 5ALCH 3FT4B 2QADD 2VKWA 5KSVB 1I8IA 4JVUA 5IB1A 3DIFB 4K71C 1YPZB 3BP5A 2X1XR 1BQHB 3FO9B 4G43B 4G80B 2C7UA 3QEQD 4I4WB 4JZJA 5C2BL 2YD5A 1VFOA 5I17A 3GB7A 4LARL 3EYSL 4LARH 5CGTA 2VDML 3LD8C 2VDMH 2A73A 3TBWA 2ZSWB 3EO1B 3KPRA 1BJ1H 3ZTNH 3FCTA 5C6TL 3WS6A 2WV3A 4XPAL 5C6TH 3U4AA 5JDJA 3ALXA 5GGSA 1R3LB 3BZ4B 2B8OT 4AM0A 3MPCA 4QHNA 3VI3E 5IQ7H 2XKSA 2ZJSH 1AXIB 5HXMA 1LO5A 1VGEH 3PL6B 1I1AD 1C5CH 3B9VA 5DUML 2OTWA 1DJSA 5DUMH 4EOWH 4QRQB 1CXHA 3QXDA 4LKXB 2IQAA 1BF2A 5C0IB 4Z7VA 4POYA 3VE0B 2J6EL 3BWAA 3ULSA 1KJMB 3P9MB 3G6JA 4ZDHA 43CAA 2JJTA 4LOUC 3WLBB 5IT2H 3I9GL 4GW4B 2OXHA 4K3EL 2DJUA 1W72A 3DYOA 4C57C 4Y2OA 3GMOB 3QCTH 1BD2D 2AW2A 5KS9E 3QDMB 1CU4L 1A7RL 3QWRD 5ICXA 5T1MA 1P5VA 1I9RL 5IMMB 1JFQL 2PYFB 3WFZA 2XWJA 5GGSY 1MCIA 2B39A 3P3YA 4OIAA 5E94B 4WI2A 2GAZB 2FWOB 3HPJB 1TZGH 4J3UA 4KQ3L 1D9KD 4XBPB 5FA3A 3AREB 1X5LA 2XZCL 3CK0H 5IM7A 1MSPA 4PG9B 4E41D 4L3EB 3VWKC 2PTTA 4G6MH 4QHKJ 1BGXL 1JPST 2FX7H 5ACZA 1T5WB 4DGIL 3QHFH 3QEQA 1FNEA 1AQKH 4I3RL 1ODAA 2FNBA 4I3RH 4XRCB 4YFEA 4TNWF 4P4RA 1N5AA 1ES0A 2ZUVA 5CINL 3FQUA 1DQLH 5IJVB 2VLKB 5D70H 1FO0H 5IFHL 3T2NH 4B5EA 3V6FA 5JPNA 1CWVA 4O5LL 1HQ4A 2X42A 3MUGA 3OB8A 1FNEB 1HYSC 1T3FB 4FQ1L 2XQBH 1OGAB 3MFFA 1EEYB 4NM8H 2V5SA 5ELIA 3MV7E 3VG9C 1UVQB 4J8RA 2ADJA 1AIFA 1I1AA 4P5MA 4PBVC 1AGEB 4TTDD 6FABH 2GUOB 2CLRB 3LEYL 2F5AH 4WGWB 2HT3C 3BXNB 3MRBB 2ZWLT 1N2RB 3D85B 4Q58C 3G5ZB 2NX5D 1G6RH 4HS3A 2ADJB 1JBJA 4P5KB 1NLBH 2X70B 4EUPH 4DUXA 4FG6C 3WDHA 3DTXB 4G9FD 1EHLH 3PQYB 4RAVB 1MHHB 4OF8A 1RZ7H 1S7UA 4OT1H 4E5XB 1AP2B 3RJQB 4KK8C 2HVJB 1BD2A 1CFNB 5SWSA 2H2SC 1RU9L 1WGOA 1MCFA 4HS3B 1U8QA 3OKOA 1WFOA 2BFVL 2BFVH 3FKUS 1RULH 3NN8B 4GRWH 4Q6YA 4I48A 3P2TA 3QG7H 5FYKE 4C4KO 4LLDB 3RU8L 1U6AH 1RD6A 1D9KA 3DSFL 1CE6A 4QWWC 5I1EH 2VDPL 1FGNL 4KHXL 4X99A 1WIOA 1X6LA 4YO0A 4BUHA 4E41A 5HYJD 1BREA 1J05B 1X5KA 3SDAB 1XF4B 3DV6B 2CH8A 4YR6A 3ZSTA 5KAQG 5DZOA 1KJVA 1JGVH 5HYSG 3MC0A 1BZ9A 3QFJD 1IVLA 4LHUG 4CVXB 4MX7A 4J7RA 2R1YA 5J57B 5D96C 5DJXA 4EZMA 4OQTA 1ZLSL 5JOPE 3RWEB 3NFPA 4UIMB 2X41A 1U8MB 2YUXA 5CGYC 2P8PA 3LIZH 3C09B 5GGTL 3P9LB 4YH6A 2AERT 5EIVA 2B0SL 4PJHF 3UTQB 4N0YH 3KHQA 4R26L 1FZKA 1T83A 1HN1A 3LKNA 1NGQL 5DQDH 5I1JL 1NGQH 4DW2L 2FX9L 3HUJA 5F7DA 4HIJB 4XCYA 3ARVA 1WTGT 4N8CL 2AK4D 2DL9A 5TE7H 4N8CH 2NX5A 2WP3T 4EXPX 2QSVA 3ARZA 5D2NC 3TVMA 1IAIL 1OQOA 1IFHL 3U79A 2QJDA 1T03H 3OG4B 5FDWA 4MS8C 2Y6SC 2KKQA 1CFQB 3TNNA 1MNUL 3WDIA 4XCYB 1MNUH 1W0VA 1YEEL 1ZHLB 4HJ0C 4UMGA 4QXTA 4LRNH 3E2HC 3UJJL 4ZAKD 4YBHA 2X4SA 5FA4B 3TVMB 5J12B 1QBMH 3UAJC 3KR3L 1TETH 3GSVA 3KR3H 1H5BB 5E8DL 1S5IL 4XCCH 4XNQA 3WO4C 1JHKH 2XTJB 4Z0XB 4DVBA 3QEGL 3BWUC 5JIPA 1DL7L 5GIRB 4KAQH 5JUEL 5JW4R 4WHYH 2DQJH 4P57B 3L5WB 4WU5A 1T6WA 3QFDB 4F9LC 4IIQC 5B3JE 1U8IB 1NCDH 1CL7L 4I5BA 3QO1B 3KS0J 4HC1L 2YEZA 3JWDC 3QFJA 1YECH 5A40E 2BERA 2EYTA 3O11B 2X4PB 2V2WB 2DTMH 1FVCA 1X9QA 3QDJA 3SKMA 4BQBA 1N6VA 3GRWH 3WFEL 1VFAB 2WANA 4Q7DA 1U2HA 2ZUQC 4QO1A 4X9IA 1MCWM 3V6OA 4PJHB 3VI4F 3CD4A 3MBED 1PYWA 3O8XA 4NT6B 1HILA 1YNTA 4HV8B 1T5XB 1K85A 5CP7B 1J0JA 5DQ9A 5GS3A 5IHZA 3TPKA 3WIHL 2ICWB 4OGYH 4HQQH 5KANI 3WIHH 1EAPB 2AK4A 5I66B 2IPTL 1T0MA 1VKXB 4ZSOE 1KLUA 4IRJC 4U1HA 4JAMB 6CGTA 5JMRA 4P2QB 4A6YL 1HH9B 5K9OA 4FS0A 2Z0BA 1A7OL 1DANT 1JL8A 3RY6A 1A7OH 4G6JH 1NFDA 5FYKU 2C4FT 2WW8A 4HPYH 4P5TD 3GBNL 4EXKA 3GBNH 1Z6JT 4IMKC 3W9DA 3MLUL 1ITBB 3ARBC 3LSOA 5A2LH 4RIRB 2VL5A 3U9UA 4HFWA 2J88H 3IFLL 1B0RA 4HWEH 1U8LA 1UH2A 4XPBH 2YN3A 4NKIL 4Z7OF 4NQXA 4NC1E 1VENA 3QO0A 1MJ8H 1A1OB 1OPGH 3PABB 4HFUH 4FQLL 2VN4A 1EMTL 1H0DA 4ZFOL 1IM9D 4BSWB 1I7ZB 4YAQA 2MKWA 2EH8H 3RGHA 1MCLA 1E4JA 4Z9KB 2EDHA 1RURL 4JQVA 2DQCL 4ONHA 3DECA 3LZFL 4LU5L 3WJJC 3BGMB 1PG7W 1MHCA 4M6MH 4WNQB 3ARFD 1EHAA 1BX2A 5CJ8A 4MJ5A 4PJ8A 2YPLE 1IM3A 2NW2A 3QQ9D 4I1NB 2FR4B 4LPCA 3DXAD 4JFEB 5HYQA 3MA9L 4Y2DC 5TF0A 2A9ML 1R3JB 2A9MH 3U6RA 4D3CH 3MBEA 4XNXL 4M7ZB 3TZVD 3K8MA 2VDOH 1HE7A 15C8L 4OZFH 1YEHH 5DRNA 4FMFA 4X6BA 1BFOB 1QPXA 3D9AH 2NW2B 4PRHE 3GFUA 2EO9A 3MZTA 2HLFC 4KTDH 4JFHE 4ORGB 1MRFL 5LXGH 2OL3L 4RFNC 2EE3A 4F2MB 1U3JA 5E1AB 3L5XL 4XPTL 2V6HA 3CDGB 3LDBC 4QCIB 2UVFA 3BZFB 3D25A 2F74B 1ED3A 2UY7A 1ULVA 1RQ5A 5C0ND 5SWZD 2AEIT 4ZOEA 5CD5D 4DKEH 3SE3C 3O2DH 4YHZH 2H3NB 2Q76A 1A5FL 1JV5A 3EYQD 3VRLE 4KKAD 4P5TA 2ZSVA 1WV7T 3B5TA 2YUZA 2D9QB 1TIUA 3FFCE 3BEWB 3NCYP 3VFPA 2BY1A 3D25B 4PJIB 5HGGS 3X3GL 1EJOL 1EERB 2O5YL 3U4EB 1A4JB 1I8KB 2X4QA 2FJGA 3BHBB 2BSSB 3GMNA 3S9DB 1JV5B 4JFOA 3IXAB 2MQ3A 1WWBX 4CVZA 5GRWA 4BSVB 1C08B 3AAZA 3I02B 1CR9H 2OQJA 5GSVA 2Y5EA 4QXUL 3MROA 2DWDA 5ESQA 1IM9A 2E7LC 2H6PB 1KB5L 5D7JB 3S5LB 4P3DB 3TJEL 4ETYA 2YN5A 3TJEH 3W0WD 1QO3A 2IALB 4WEBL 4XXCC 5KS9F 5D1ZB 3GSUA 1ZT1B 3C60D 3GJEA 3ZT5A 5F1SA 4GBXC 1HIMH 3ARFA 4F33A 1RZIB 5I1HH 2ATPB 3EFDL 1HZHL 4LSQH 1L0XA 3DXAA 2BVQB 4GRMA 2R1XB 2VXQH 4ZO9A 4KZDL 4L8DB 4K7FB 3S3SA 3P77A 3TZVA 1WFNA 5T1LD 1Z0NA 4F3FA 3DNKA 1EAJA 4JM4H 1QQDA 2X5PA 3O3BB 4H0GA 7FABH 3ILQC 4PYHA 3M1BA 2NY0B 3WE6B 2P49B 4OIIL 4XP6H 5I1LB 3LKPA 1KELH 4OIIH 5L88H 3L7FA 3MYJB 1NCAL 5K9JL 4CMHC 3BRGC 5J1TC 5GXBB 4DEPB 5SWZA 3BH8B 3EIFA 4C56E 1CTOA 4M43L 3GGWB 4CJ1A 4M43H 4NSKB 3C2AH 4FQHB 4YHPB 5K93A 4FABH 2ZUWA 5I1AB 1Y0LA 5DHYB 1JMZA 3ISWA 1HHHA 1LD9B 2NNAA 5B39A 3IRPX 5IROA 2ADGB 4NN7C 3BKYH 5F9JB 1UXSB 4QHLA 1MF2H 4RQQB 3PUCA 1XR9A 3MLZH 3VWKD 3P4LA 4S1SH 3TC9A 4U6YB 4NKMA 2A0LC 1KJ2L 2EDYA 1QSVA 5B39B 1UB6A 4QRRE 3V6ZA 5KS9B 5F7MC 4PGJA 4RRPA 4X6DA 2VDNH 3W0WA 2FEDD 3OSKA 3WD5L 3HMWL 4CW1B 4PTUB 1L6XA 1CXKA 2DKMA 1LK2A 1AJ7H 2PCPA 3IFOB 4KPHL 5B38G 1GVIA 4KPHH 3VA2C 3KHOA 3KWWB 3C60A 1H8OA 4U6HB 3HNVH 1HYSD 2VXVL 1BM3H 3SE4C 3SKUD 1FG9C 5LKNA 1FCCA 3GHEH 4JG0L 3IU4H 1YMHA 3G9AB 1G7HA 1AHWC 3HNTL 3U0PB 3AMKA 3OMZA 5I15H 3U9PH 5T1LA 4OLVL 1L7TL 3BPLC 3I6GB 3PWPE 1K8DA 4LLQB 5SX4H 3PWVB 1P6FA 1P84K 2YPKB 3R4DA 3LRSB 1MAJA 2CLZB 4X8JA 1U95A 3L5JA 2D7MA 3MV7A 4K7PL 3D0LB 3AS3A 3F12B 1NBYB 3DO3A 4NQSA 4JO1H 5I19L 4NNYB 3QNYA 5JOFB 3N1GC 3L3IA 4R7DA 4J1UB 5MI0B 4CU7A 3LKSA 4KK8D 4NWTL 4KMQA 1IAKA 4KI5C 3REVB 3V4VL 2H2SD 4YWGL 3MUHL 4P23D 3U46B 1S9WB 2VZTA 2EKSA 2OTUA 2XNAA 1JZ7A 5L8KB 3VD3A 1WBZA 1T2JA 3BP7A 4ZNEE 3CLEL 3UBXA 1LNUA 3CLEH 1AD0A 3HB3C 4UAOB 5E2WL 1XGYL 5HD8D 2EDKA 4ONFL 1XGYH 3CH1B 1F4XH 3NPZB 2FIRT 3G08B 4QWWD 3GSQB 3FQNB 2EKSB 2Y07H 3EOAB 5DVKA 4K2UL 5GJTH 3VWKA 4XCFL 3S37X 4XCFH 2NLJA 4PY7B 4YPGA 5CEZE 3CSGA 5FGSA 1NGXB 4JANB 1MQ8A 4QY8A 1XR8B 3G6DL 3G6DH 4PJ5E 3SE8L 2P46B 4PV9B 4MCZA 1PY9A 2J2ZA 4RISL 4RISH 3IVKA 3MCG1 4APQB 1X5GA 5D1XD 4BKLA 1LO3H 2CGRL 4YDVB 4ZQKB 3ARGC 3L95A 2HRPH 4ZUVA 1Q0XL 2DYPB 4XAWL 3TA3B 1RJZA 2OYPA 3MO1B 2B5IC 3BPNC 5IVZA 1KB9K 1HHKB 5FGRA 3AXLA 4ZYKB 1MPAL 3OKNA 4GAGH 5KSBE 4HBCL 4UB0L 3QNZB 2AJYL 2VR5A 3T0DA 5GRZA 4F7CA 3LKOB 2LAGB 4LK4A 3AXLB 4EJ1C 3D69B 1XF2A 4NQVA 1ZS8A 5AZ2H 3OKNB 3U2SB 4MS8D 1F97A 4HF5H 1HSBB 2AP2A 1Y6KR 1RIHL 1AC6A 4HJ0D 4RAUB 5HYIA 1MCWW 3B2VL 1IEHA 4F7CB 1VHPA 5DRZB 5IB4B 4P23A 5LQBL 5LQBH 4D8PB 1A6UH 1J12A 4OSUL 3HC0B 5DVNA 1QHPA 4OSUH 4D0BA 1AKJD 2J6EA 2DWEA 3I3DA 3O3DA 4Q2ZA 4OCSH 5EU5A 3GNML 1ZXQA 4J3WA 2EC9U 3GNMH 5DUPH 3UPAA 3UCRA 1SJVA 1VFBA 3RNKA 2XRAH 4I18C 4TPRH 2Q7YA 3D0VA 3JV6A 4UU9B 2AEQH 3BUTA 1XH3A 3SHSA 1LE5A 3E8UL 1F4YH 3E8UH 4TULL 3WFBL 2DAVA 4HZLB 1WC7B 4JRXE 4AL8L 1FVEA 3A6BL 1R5WB 3I84A 3MJ8B 4KZEL 1IL1A 1KTDA 5D1XA 1LHZA 5CJXA 3I2CL 2V7NA 3QUYC 4KH2A 3C5ZD 1K4DA 4W4OA 2ENYA 2EDQA 2YPLD 3VU2A 1OWWA 3OR6A 1T22A 1KLGA 4LHUD 4Y19E 4OZHA 4ODXA 1JPTH 5GS2H 2W07A 2J8UA 2NY5H 3IFNL 2PXYB 5JORA 2R1WB 4QLRA 4AIXA 1FO0A 1NL0L 4GRLC 3QPXL 3BP6B 1D6EB 2VLJD 4HIHA 3VXOB 2XKUA 2BVYA 3LQZA 2ENSA 1AXSB 2DIBA 1WWWX 1S7WB 4PJXA 3K1KC 1WCBB 3UTTE 5DWUH 2BSED 4M1CC 1IRAY 1GGTA 2H26B 5B21A 3T0EC 4R2GC 3FN9A 3PNWB 4FZEL 4KV5F 5DK3A 4U1SB 4LSRL 3MACL 4OAWB 5HI3C 4PJDE 1BFTA 3TV3H 5K59F 5HVHB 1AKJA 3ZDYE 4OZ4A 5FKAB 5GS1A 2ESVE 3EW3B 4QRPE 5IMOA 3C6LB 4ZSOB 5DHVH 3O6LL 3UO1H 3R0NA 4IOFD 3NFSH 4PLKD 1J5OL 1IAIM 2H2PC 35C8L 5EO0A 4F9LA 5J56B 3MLSL 3QA3B 2C3WA 2JF1A 4CJ0A 5I75B 1U91A 1N4XL 3WS3B 1AO7D 3STZA 4K3HA 2CK0H 1I85A 1J10A 2GYSA 3T2PA 3JUZA 1Y6NR 5E2JA 2FGZA 1FZOB 3CSBA 4Y4FD 4BA8A 3UDWC 5AZEL 1EO7A 4I0PB 1L0YA 4MJ4A 2E27L 3NIFE 5AZEH 1U91B 4U2ZA 4Y2DD 1PLGL 3HRPA 1A21A 1KENL 1CFSB 4NWUH 1R3HA 2JJVA 2E7BA 3C5ZA 3LCYA 4XNUH 2OI9B 1ZVYA 4AMKL 2UVEA 5HYSA 3I6KA 3ABZA 4AMKH 5D6CB 2PW2A 2YPLA 3SGDH 4Y4HD 4XVSH 1IT9H 1GC1H 4LHUA 2Y06H 4S1QL 4X7TA 2WLZA 4OCWH 1FORH 3SGKA 1LWRA 3ES6B 4JGJA 4Z7WE 2O5XH 2ZUSA 3SCMC 4M1GL 5I16B 1P2CA 4X6EA 5IOPB 2N7AA 2W65B 5JW4N 2CSPA 3TPUB 5DD5H 2VLJA 1BOGA 5EN2B 3JZ7A 5GQBA 3JTTB 2BDNH 3MBXH 2VERN 5DD3L 1U41A 3O81A 1MCCA 1M1SA 4OI8A 2FATL 4HKBA 5E70A 2R9HD 4WW2F 4PRHB 1Z5LA 3QUXC 1QLEL 3OXSB 1NMCC 3T65B 4OLUL 5B8CA 1HH6A 2NY5C 4J3SA 3QIWC 1HDMA 4AY0A 5IEKA 4GSDL 2R23A 1MCBA 3MRJA 4UTAH 4JPVH 1GIGL 2P44B 1Q9WA 2Y25A 2BHYA 1GIGH 3WNOA 2OJEA 4JM2F 5DF0A 4J3OC 1Z5LB 4Q6IB 4ZO8A 3SDCD 2CIIB 1HDMB 3BZDA 1T7WA 4MD0B 2JJWA 1WEJL 2X10A 4JLRA 3FFCB 4M03A 1CGUA 4GBXD 4FQCH 4TVPL 3VXTA 1KULA 3HFML 5BOZG 1DBBL 3HFMH 4D9RE 2IPUK 5HPMA 1J1PH 4QF1A 3RHWF 3ZKNC 4Y4FA 1Z9SA 1OGTA 2GSIA 3K80A 4FXGB 3CIQA 3BE1L 4HCRH 5DJ6B 3IKKA 2V2XA 4X7SL 2DD8H 3PWJA 4AH2B 1EO8L 4JPIB 4LHQB 1IEAB 4Y4HA 3IFPB 3O9WC 3CX2A 5DJ0A 3JBG7 3KPPB 3ORJA 3ILQD 3NZHH 2FO4B 5IHUL 5HGHA 3T77B 5I0DA 3B2UC 2CRZA 3THML 5TF1L 5DEGA 4HC1A 2HAZA 2XWBA 1V3KA 4M7LL 3QXVA 4IS6B 4BFIA 3V5HA 2MOVA 2AJSL 2YD8A 5B22A 2BNUB 4KRLB 4X5LA 5ACLA 2D7TL 4MNQD 5IB5A 4R6UA 2I5YL 4U4BA 1WBXA 3SOBH 1FNSL 2I5YH 1TMCB 2MTPA 4TSCL 4XGZA 3WL9A 4WHTA 4POUB 4RGMC 5BVJB 2XQYG 4F7TB 4HUXA 2FGWH 3V5DA 1MHEA 1FDLL 1UWEH 4F9PA 4HJJH 5FK9B 1GC1C 1ADQH 1DE4A 2O5ZH 1SBBA 3X12A 1LK3L 3GIVB 2JJSC 3JV0A 1O7VA 1GPOL 4MJID 1QRNE 4PREA 3WIHA 3WNNA 1F58H 1O7SA 4JM2B 1TZHA 3EGSB 3QEUB 2WLYA 3H9SD 5TDOB 3FRUB 5ITBL 2VAAB 5DMYA 4QT5A 1UWGH 5ID1A 3IF1A 2A0LD 4PRPD 2B1AH 5TFSH 4ODVH 4NO0A 4HDIA 4U31A 4XB7A 5FO9A 4A6YA 5IFAH 5E2VH 3SDCA 3RWJB 4YC2B 4C56B 1TZHB 4XXCA 1K8IB 4GKZA 4PLJC 4QT5B 5SX4I 5ID1B 4LVNC 5IBTL 3ZT6A 4NO0B 1BBJB 3G6JF 1UA6H 4WI7A 4QRRA 1E0OB 3C2SA 3HI6L 1LEGA 1S78C 3CVHB 3VGAB 1NFIB 2R56L 2VMFA 1U42A 4HULB 4J3XA 2CXKA 5DEZA 3F65A 4OLXL 5EA0L 3BP4A 3O6FB 3Q3GB 4OLXH 4UT6H 3WO3B 5FKPA 5CP3H 3EO0B 4QHUB 2EXYD 3CC5B 4PV8A 4ZNCD 1ORQA 4QRRB 4ZFOA 4ELMA 4HX1A 4MCYB 2GQHA 4HGWB 1T0PB 3L3DA 3GMLA 2I60L 3P11H 1I7TB 3ARRA 1UGNA 5TH2A 5IMKB 2F53E 4L4VD 2YD6A 4TUOA 4XPGH 3O3EB 3W11C 5FOJA 3RTQC 4L5FH 4X4MA 5F3BB 1WTLA 4Y4KD 4D9QE 2OK0H 3KPMB 43C9A 3CXDL 4MNQA 5EO1B 1XAUA 5C3TA 4U6XA 4WWKA 4N1CA 2JTDA 3CDCA 1W0WB 4RGND 3AY4A 1C8PA 2PTVA 1JZ5A 3CFDB 1Q9KA 4X0KA 5DRWA 1GGYA 1T66C 3AB0C 3CMOH 4XX1E 4XVUD 1VB9A 4UNTA 3PWPB 3QUZB 2ZOKB 4LGSB 5EBMA 3JTSB 4O2EA 4MJIA 5KSBF 4NZUH 1JNHA 4G8GD 4GAFB 4M7JL 3DVIA 3BZEB 4R3SB 4M7JH 3H9SA 4NFDA 4TOYL 4R97B 4TOYH 5C0CE 4ZNEA 4PRPA 1V3JA 2EYRA 3U0WH 3FO0L 4RAHA 3RZCD 4FQIL 3U48A 2OL3B 4QRSA 2DIAA 4IOIA 4NN5C 4XVTH 4MD5A 4HIEA 1QR4A 3O41B 4JZNA 3C6SB 4GAJL 1DEDA 4WJ5B 5C3LD 5ADOL 4H1LG 1KFAH 4HWZA 1UACH 1DQQB 5E6ID 5INDA 2BZDA 3ZE1F 2IANE 3TIEB 3VXQB 4QRSB 3AS1A 3MCLH 1IEBA 4JFYA 3DURB 3MRQA 1TFHA 1JGDA 1CDJA 2EICA 5BZDB 3VRJB 5IESL 4ZXBA 4NNPL 4TVPE