3TBYB

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (v3p, y4f)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system/agonist
total genus 13
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbyB00
5JR1L 5EO0B 3QXWA 1Q0XH 3RVXC 3UPCA 1HHGB 1YNTB 5D5MB 2F8VA 3OGCA 1AQDA 4Y16B 4F7PA 1YEFL 3MGOA 3C09B 1MI5E 1UEMA 3S96B 1LO5A 2DJSA 2ITCA 1MJJA 3U9UA 1CGSL 3TYGH 5GIRA 4U1IA 3B3IA 4AIZB 3QXAA 2CLRB 2ED8A 3BPOB 3ZDYF 4JGUA 3BH8B 3FFCA 3OJDA 4MLIA 1YNKL 4K3DH 2XG5A 1O7VA 4K7PY 3TT1L 3CFBA 3MBEB 3U9PL 3RWEA 1A47A 3TT3L 2V2WA 5MEND 4Z0XA 3I3DA 2VLKA 2DL9A 4YHOH 5EC1A 2D7TL 5H35B 3E0GA 3V52H 2UVFA 1MAML 4K3JL 4WWKB 4KQ4L 5TGBB 4OCWL 2OI9C 2XKSA 4R4BB 4Y5VC 5CJQL 4BZ2L 5DTFA 1J8HA 3NH7H 5D70L 1KLGA 4GS7C 2I9TB 1UCBH 3QIUD 4JN1H 3LZFH 5I74C 5CZVL 4B0MM 2D9CA 4W4OC 1QVOB 3VFVB 3TA3B 5DRWA 3P77A 3H9SB 4L1HA 2H41A 1YEHH 4JG0H 5FO7A 2AJXL 1M7DA 1Y6KR 2EH8L 4KJWC 5CZXD 2AJ3B 3MRRB 3GHEH 3P30H 3IXAA 3ZSTA 1RZ8B 5K9QI 5I1LB 1ACYL 4KKAC 4LLDB 4ONHA 4MZ3A 3T0EB 4M62L 4R7NB 4U7KA 5KANG 5GSVB 4L9LC 4ZUWB 5FYJL 2W92A 3HRZA 1E6OL 1TNNA 3SE3C 1D5BA 3MCKA 2DYPD 5KSBB 2AK4A 2BSSB 4KK8D 5F7HA 3BT2L 3QIWA 4XRCA 3DNKA 3LKSB 4AZ8A 4MJID 2WIIB 5HVHC 3G5YA 4G9FA 1FLRH 4I0KA 4D0CA 2VXTH 1XF4A 4FOMA 1DEEA 1I9JH 4X6CA 1QBLL 3V5DB 3HC0A 3TNNB 1ORQB 1IGMH 2PTTB 5C0JA 2B0SL 2BVOB 5BVJA 4JPVH 4WFEE 3WXWL 5LAXA 2AI0H 1YEEH 3MUY1 1C5BL 4Z7VF 2FO4A 3SPVB 3FN9A 1MCJA 1BVLA 4QNPF 1EAPB 2Y72A 3U0TA 4H26A 2CUHA 1U8PB 4MMXC 1QOKA 1WC7B 3G04A 3LN5A 3DI2B 1P7HL 4HFWB 4XCEB 2XQYG 1KCUL 3QCTL 1UQSA 2IANB 2VSDA 1S7TB 2XOTA 5JW4N 1FAIL 3H7LA 1A4JB 4OM0H 1L7IL 2VABA 4PJ9A 5HI3C 4NWTL 4GO6B 3AGVA 3H3KA 4NPYB 1NBVH 3O6KH 5DWUH 5DFTA 3B83A 1FL6B 4C56B 5F6IC 2YSSB 5IBTL 5D7JC 3EZJB 3MNVA 5KG9B 3X3FH 3HS0A 5IG7B 5JW4R 2VIRB 3SDAB 4ELMB 1H3XA 3QDJE 5F9DC 1FYTE 1VENA 1ZT7B 2IPTH 1F4HA 4YBQC 5B3NA 1K9TA 3T2NH 1PQZB 4ODHL 1FV1A 2YOCA 3EJYD 3F65A 2EDBA 4PJCB 3UBXB 2R4RH 4YAQB 5ALCL 5FGRA 3KJ6H 1AH1A 4ODBD 4P5TA 5IFAH 5MEOB 3HNVL 1LO3L 2C3WA 3CFCH 4GFTB 3V5KA 4QCIA 3G5VB 5D7KD 1WIOA 3DMMD 4UIMA 2NR6C 5E5UB 4GLRH 4RGNC 2HH0H 3PV6A 4KI5E 5ESAA 3TNMA 1HHKB 2H2SD 1OOAA 3FZUC 3RUGE 1K4CB 1OCWH 2QSVA 5CP7B 3RWHB 4O58L 3T0WA 3GMRA 4AQ1B 3LQAC 1NMAL 3O4LB 1NCAL 2IBZY 1CG9B 1I3VA 2X7LB 2J8UF 1AE6L 1P4BL 5B39A 2X44D 3Q6FA 1V3MA 4G8IA 5FV2A 1N6UA 2HFTA 4MDIB 5I6XB 3U0WH 3CFIC 1F4XL 4HIXL 3MRHB 2MKLC 3IKCB 2NY7H 1MCKA 3V0VB 4NQSA 3QWQB 5EN2B 2VWEC 4WUUA 3VWKC 4XT1C 4YBLC 2R0WH 3MMEB 4O2EB 3BEWA 4QRPA 5CBAA 3CX5K 2DDQL 1MCPH 3MNZB 3SGEI 3QO0B 1G7MB 3KLHD 2ICWI 4S2SB 3QULA 3DO3A 2VN7A 1A6ZA 2Z35A 5E99L 1BOYA 3ZYZA 1DP0A 3HI6L 3MJ9H 3DVNB 1YEDA 1Q9LA 1ZEAH 2HT3D 1UJ3C 2A9NL 3GMLA 4JO2L 5D1XC 3TO2B 4L29A 1QNZH 1AR2A 4ZMAT 1INEL 1YMMA 1E4XH 1J1OH 1OTUC 4LGSB 4ODWB 1JGEB 3LMJH 4JDVA 1ZT4B 2Z31C 4XH2B 3VFOB 1QBMH 2HWZH 4KKBD 4L8CB 2NY6D 1KC5H 4U6XB 3OJMB 5EB9A 1CGUA 4MAUL 4N8VG 2RGSA 5JHDE 4DW2H 4YX2L 1BQHA 3RNQA 4ZTOL 1CGVA 1I9IL 3E3QE 3IFLL 1XCQA 5GQBA 3RIAK 2AJZA 1WCQA 3PXJA 1HQRA 3GSRA 2R1WB 3BWAB 3OHXA 3MLRH 1IAII 5DLML 3QI9A 5GGRY 3VXPA 3V4PH 3ULVH 1YPZF 5F1NB 4BM7A 2DMCA 1MJ7H 3DYPA 2J6EA 1IC1A 4NRXA 2VDNL 2E6QA 3TLRA 5C0DB 1IAKA 2IAMB 1C16A 4NKOB 2ADFL 5HHVL 5IJVB 4PG9A 3VCLB 3UJJH 1J5OL 2OR7A 4DGYH 1I4FA 5D1QA 4YHKL 1X44A 4GKNB 5L2JA 5DQJA 4M5ZH 3DVGA 3T8XA 2R4SH 4KWUA 3O11B 1MNUL 4G6ML 1DVFC 1HILB 1PJ9A 3WLWD 5KS9A 3TC9A 3FO1B 3GKZA 1JGUL 3S4SB 1FC1A 5H37H 3SBWA 4EN3A 2BSED 5E8EA 4RMUA 3BUTA 5ALBH 2VLJD 5DEGA 2X89D 3VRLF 4XAKD 1Y6NR 2H32H 5DJYB 3CK0H 4LSPL 4NO0B 3FB7A 4ODTH 1EX0A 1EUUA 1AD9A 1CICA 4EUPH 2JB6B 3L5WA 1U8KB 1NANI 5DMGD 2IH3B 3P4NA 2FGWL 1JRHL 4MYWB 4APQD 3C8KA 2Q86B 3PQYA 5EU6D 1T83A 2OZ4L 3RU8H 3O6ML 3PIQA 3WIFB 3W0WA 3L9RA 4LFHD 3ARGB 3VWJC 4PS4H 2AXJA 1YQ2A 2EDFA 1AHWC 1NUNB 1EGJA 1GGIL 3O4OC 2VUYA 4L3CB 1UWGL 4Y19D 4A6YH 4LCUA 3VXSB 5CBEA 3E2HB 4OF6A 3RVVD 4YQXL 4ZTPH 3GRWH 5CEZD 5SWQA 3C9NA 4LOUD 1KNOA 3FT3B 4XCNA 3PHQA 3S36L 5J11B 1OQXA 5C07E 1Z2KA 3HHRB 5KN5B 4YGVA 1MIML 3FO9A 1CBVL 4MNQD 1K8DB 4H0HB 4TNWK 2D7PA 3ULUC 2FZ3A 3H7BA 2EDYA 2VYRE 3LCYA 2IFFL 2ZCKL 1YQVL 5DK0B 1MHEA 1FL3A 1GJIA 5GZND 1WZMA 5JUEL 1OAXH 3SCMA 5GS0C 3S3JA 5B8CA 1ZE3C 1KPVA 5JOPD 5DHVB 5AUMB 4H88H 4IIQA 4Z7NE 2VXVH 2WBJD 2A6JB 1WIPA 5F6HI 1A7PH 3BESR 5C0RL 1IQDA 4ENEC 4EJ1C 3NFNA 1XCTB 4OBRA 2FJGB 4OZGF 3MRQB 5F9OH 2QQNL 4IRZL 2MJWA 5MP6L 2I07A 2NY5C 3ARFB 2IEPA 3GSNB 2MFNA 3DRQB 4XPFL 2NY0C 4GQPH 5DI8A 1TPXB 5F1IB 3UP1A 4R97B 2EDOA 2IALA 3TIEA 3V0AC 4K7FB 2VQ1B 5C0CD 4U1HB 3BQUD 2R1YB 5DUBB 4XP9H 5EFIA 2DQFB 3N1GC 4ZXBC 4FQCL 3U36B 4OZIA 1AY1H 2NMSA 2B4CL 4PY7B 1T3FA 3BI9X 3UYOD 4I18B 4Y8DC 5J1AA 2W59A 4TVPL 4JRXD 2D31A 4BYHA 1NKOA 1RZFL 1NC2A 3LEVL 2Q3AA 4I2XA 4YNYB 1UGNA 2ZP0T 3GJFB 5D1ZA 4JFOA 1HKLL 2OTWA 1ORSA 1JWMB 3FFCE 5D7SH 2IPUG 3MO1A 5T33L 3JWOH 2RJMA 1KEMH 1AIFB 3QUXD 4FQPA 5I1IL 3O8XD 4X9HA 4NQCA 2VLKE 3IFNH 5KSVB 5HPMB 1FHGA 1IL1B 4RISH 5SWZB 4P5MA 4U1SA 5C0NC 3VJ6A 2P8PB 5HGDB 4P9MH 2YC1B 3V6FB 3C2SA 4TUKL 1WFNA 2V2XA 4TUOB 1JNNL 4G6KL 1C1EL 2EXWD 3OL2A 5GGSB 3LEYH 5DJAA 2GK0B 4GW5A 2JB5H 2R1XB 2HA1A 3MGAA 4N8VB 4R26H 1MOEA 1FZOB 2PN5A 3MSPA 2O5ZH 2F54A 3O3EA 2R39A 3DX9B 3A6OA 2Q76A 4O2FA 1Q9KB 5FCUH 1FIEA 1N64L 3RGVD 3GSQB 1A2YA 3LKNA 3MV01 5I73B 3GUTB 1H3PL 4P0DA 3W81A 3BRFA 6CGTA 2CJUL 3K4ZA 4DAGL 2F8OA 3QAZC 4NM8L 3C08L 4RIRA 3BKCL 4CVWA 4OLUH 3I6GB 3S34H 4H25B 4Y4FD 4PJDF 5LKNA 4X80L 4HULB 4JFXA 1LK3L 1FFNB 4N68A 4UV4H 2B8OT 4X98A 1LEGB 3VW3H 1GHFH 2F5BH 3L7FA 1OPGL 1VACB 1C12A 4N90D 4HLZG 2BNRA 3KXFA 4ALAL 4G9FE 4KC3B 3Q48A 2OJEA 3QIUC 5E8NA 1EEYB 3DX8A 4ZG1A 1I7RB 3GHBL 4X6CE 5CJOH 3OAZK 3GSUB 1T7XA 4KZDH 3DV6B 4M6NL 4PY8J 5DMIH 5BOZG 4XMPH 3D25A 3RWDB 3NABL 1JL8A 4ISVA 4OZHA 4K94H 4M03A 1JWSB 3NFSH 4Q97A 3QNYB 3S7GA 1TETL 1KV3A 2BY2A 1I1CA 1U8OB 5L0QC 1A1NA 3WD5L 1FNAA 1VFBB 2AXGB 1RUPL 2ITDB 4GW1A 4Q9RH 1AGEB 3A6CH 5C0BA 3JV4A 3ZO0A 1B3JA 5E1HB 4NN6B 4JFQA 1F4AA 3FCTB 3I84A 1P6FA 4XVSH 4Y89A 4F3FA 1DLFL 3M07A 4KHTH 2AJUL 4HIHA 2HG5A 2FX7H 5C0EA 2XWJA 4RAUB 4N9GA 5FA3B 1MAJA 2KQNA 1QR4A 4KK8C 3EYUH 1LWRA 4UT7L 3WE6A 2F15A 4JANB 4C54A 3BO8B 3RVUD 4XPBL 4FXGA 2DM2A 2XRAL 4OCRL 1PLGH 1BEYL 3OAZH 4TSAL 1XGTA 2AVGA 2OJZH 1BGXL 1NPUA 3TH3T 2HRPL 5GJTH 1NDMA 4BH8B 4CMHB 2XPGB 4LGRB 3TPKA 2BC4A 5HBBA 2QR0B 1N3NA 4JFFA 2ATKB 4RRPG 1Z3GH 5E0QA 3V6OA 3MCLL 3M17A 1U8MB 2YD6A 2APXA 3MTRA 4MQ7B 4WHDA 2AS5M 3D39B 1V3JA 1U8IA 5C08A 4PRID 3FB5B 1YZZA 3NCCB 1ZLUK 3I6LE 3IDGA 4MXQD 2ZNWA 2YPLA 2EEDA 1OP9A 1S7SB 5AG8A 4ERSL 5HSFA 2PO6D 1A4KA 2PYEB 4HKBB 3M8OL 4UNVA 1EHNA 1UM6L 3NPSB 1DQDH 2ZSWA 5FUZH 4PREB 4Y4HB 3UTSA 4LCIH 4NQDD 3QWOA 4PBXA 1B0WA 1I1FB 2IBGA 3NCJH 1PEWA 3GMPB 3G5XB 4HJGA 3TH2T 1J1PH 1E4WH 4JFPB 3IJSA 3UTQA 4HUKB 2R0LH 1GGBL 5B21A 4L3AA 5JQHC 1JP5A 3ZHLA 1VGKB 3EJYC 1T03L 1JYVA 2ZUYA 3RZCA 3N85H 2GYSA 2DIJA 4JFDB 4AEIL 4WUUE 3LQZA 1B4RA 1RPQA 2J6EH 1MCNA 1MVFA 3AS3A 1ZLUH 3ULVD 1HQ4A 1ZGLB 4QRPE 2FDBP 4S0SD 4I3RL 3VXNA 3QQ9C 1T80A 2FEEI 4O02L 4DKEL 3DMMC 3KPSA 4XC3L 3IDXL 1EJ6A 2VSCA 1G6RH 1HN1A 3DUSA 3PWNB 1QP1A 1H15B 1TZHB 3KDMA 4GT7A 3DTXA 1KT2A 1VERA 4HF5H 3E8UL 4D9QE 1AKJB 3ULVF 1IGTB 1EFXA 3L3GA 5JLZB 4WUKL 1QLEL 2HFEA 4LKXA 3SOBL 3NZHH 3KHQA 4NT6A 4GMTH 2Y6SD 3L95A 1PBYA 2QADD 2ARJA 5IR1B 2W60A 3HNSH 5TQ0L 1M71A 1YDPA 3T4YB 1DBBL 3EOAB 2AEWA 4K9EH 1TTGA 4UOJA 1PX3A 5IHBA 5LGJA 1O0VA 4O00A 5L88H 2VXUH 5F8QC 2OZ4A 3GO1L 4W68A 5ILTL 2YMXL 1CLOH 5IROA 5E9DA 3KLHC 2LU7A 3P73A 1RULH 3RIAF 3WUWA 3ZT6A 3LD8B 4DFIA 2P24B 4UNTA 5IVXF 4HKZA 4Q9BA 1JJUA 2HT3C 3KPLA 5TQ2L 5BMFL 3S5LA 2ADGB 1B4JH 1EGJH 1JHKH 2APWA 2GSGB 4ZQKA 2XT1B 3K1DA 5AZEH 5FAAA 1RURL 4PV9B 4JR9H 4GMSL 2FJFB 4JZJB 4PJXE 3RDTC 3KHOA 4KKBC 2NY6C 1E28B 4C59B 2NY3B 3PL6A 5KS9E 2X4NA 4UMGA 3AM8A 2AK1H 3OBAA 3FOLB 3AROA 4X5WB 1VPOL 3IDMA 1YEIH 1Q0YL 4HPYH 3LH2L 1UWXK 1G9NL 4X5XA 1T1XA 2QLVB 1R3HA 2KZWA 2YPVL 4JEGB 5I1HL 4I0PB 1PY9A 1BAFL 5B3JE 1DL7L 1FFPB 3TT1H 3NIDE 3X12B 2VOTA 4MJ6B 4G3YH 4MXVF 2J5LC 3QEHA 4S1RH 1WTGT 3LDBC 4LLAA 3IDIA 1MAMH 5DEZA 4DVBA 2D7OA 3W0WE 5CJQH 3P11H 4M7KL 4BZ2H 5EA0L 5ISZD 1BVZA 2O26U 2VLKD 2BOCB 2NPLX 5D70H 3S8WA 5CZVH 1NEZA 3VGFA 1CE1L 4P4KD 3WLWC 2YEZA 1X5JA 2YUWA 1NUGA 2AKRA 1J8HD 3OAYK 2VQUA 4JREC 1CIUA 1CN4A 4JDTL 2AJXH 4OF7A 1MVUB 1UWXH 2W0FB 3JWDL 2EH8H 4LLVA 4NZTH 1EEZB 2ADIA 3KAAA 1S9KC 1ZHBB 4JFEB 3VE0B 5L9DH 2EKJA 5IB5A 1WCBA 1RJZA 4MD4A 5D9SB 3RAJH 5F7WC 2KH2B 2XXMB 3ARBA 3VD7A 5DMGC 4HCRL 4K8RH 2K7QA 3WN5C 4APQC 1N4XL 3STZB 3OR6A 5HYFA 2EIZA 1CGYA 1VA9A 1T0PB 4HKXB 1N7ML 4PD4K 4QF1A 3Q2CA 4LCYB 4M1GH 1L0YA 3AU1A 3MOAL 3QUZA 1KENH 5I8KL 3KPMB 5HVFB 5F9JA 3A0OA 1U95A 2AK4D 1T4KA 3CSBA 2CLZB 1CFNB 3OAYH 1SHMA 5CJ8A 2FYYA 4JJ5A 3RVVC 2CIIA 5IB4A 3N06B 3ESUF 1U92A 1MY5A 3RWCB 1BECA 4G43B 1C5BH 2Y07L 4LOUC 3BIAX 4NZUL 1MRDL 4FTVE 5DFWH 3NBNA 1EAJA 5GGQL 4R8WL 3CDCA 2ZUXA 4LMQE 4ZO8A 1DQML 2GTZB 3G9VA 3EYFA 4Z77A 5CIPB 3QCTH 2DQGH 1DR9A 1FAIH 3IFPA 1WZKA 2E9IA 1L7IH 4U3CA 4NWTH 4X6CF 3B9VA 1J7VR 4S1SL 4OZIE 2L4OA 3VXMD 4QGTA 1CDHA 4UB0H 1P7KA 4P23D 5DVMA 5ERWA 3R8QA 4CKVX 3LQMA 4M6ML 4WHYH 4AENA 5DJ8A 3DYOA 5IBTH 2WZPD 3VMOA 1AXIB 2OP4L 5C8JB 3IDYC 2DL2A 3BP4B 1Y18B 3PGFL 4DQOL 1NAMA 1PSKL 4I2XE 1VFAA 4NN7C 1T5XA 3NN8B 3ZKMD 3STBA 1FORL 2ZSVA 1KLUB 4ODHH 4F9LC 3KPNB 3F7PC 3BW9A 1KEGL 2BP3A 1J0JA 2XY2A 3WNKA 1GXEA 2D03L 1Q38A 5ALCH 4LKCB 1HSBB 3MUHL 4X8XA 3ARWA 4H5SB 4XNMA 3I2CL 3O3BA 1CE6A 4GLRI 4HK0A 3ZHDA 1GC1L 1KPUA 5IB1B 1T66D 4PJ8A 4POZD 4DTGH 4LIQL 4DZBB 3BQUC 2DN7A 2VH5L 4P5TD 2GY5A 1I7UA 5F7LB 5IHLB 3VFSA 2A74B 1NMAH 3HC4L 1N6VA 1R5WA 5EC2A 5AYUL 4F58L 1MH5B 5EOCL 5IMOA 3OX8A 2BNQB 1UENA 2F54E 1NBZB 1AE6H 1P4BH 4QHNB 3X11B 3OJVC 3KYKH 2VZVA 4GG6B 4PJ5A 3EOYG 5C7XL 2PYFB 3QUXC 3HCVA 4D3CL 4BFEA 1IC4L 4ODSL 3RBGA 1X5XA 3BN9D 5TFSL 5D7LD 1OW0C 2UWEF 4JB9H 4WTWA 4OI7A 2C3VB 1JPTL 2WV3A 1JBJA 5E99H 3OPZH 1BZ9B 1LDSA 1OAQL 2DLTA 4ZFGL 4LSUH 2BNRE 3KXFE 1W8NA 4Y5XB 3UDWA 3JV0A 1FDLH 3VXRB 4U6YA 4QOKA 2HT4D 5KW9H 1E4XI 3S88H 5EOCJ 2P7TB 1YN7B 1NEUA 4ZPVA 2NY1C 2EXWC 3G6JB 5CCKL 1INEH 5TE7L 3OKKB 3NMEA 3TBYB 4OZHE 5GRXG 1T0MA 5ITFA 3CIQA 5E1AA 3V9FA 4E42A 1CDJA 4JQXA 3DROA 3VFMB 5E00A 5CEYB 2ICES 4TN9A 2EDDA 1YMMD 4M1DH 4AH2A 5C0BE 2VXQL 4YX2H 4PJEE 4ZTOH 2MHAA 3IFLH 3LRSB 5D2NC 3O41B 3I6KA 3FT2B 3SGKA 2BVPA 3GIZH 1BD2A 5EU3B 1YY8A 4JQIL 3OJ2C 2H6PA 3IT8D 3WO4B 2GJ6D 3WCYA 4UQ2B 5DLMH 5L7XH 4X7TB 5BW7A 5IKCA 2KQMA 4FNLL 1OSPL 1T0NA 4EQ2A 3F8UB 3F12B 4TSCL 2VDNH 3C6LD 3IGAB 2VLRA 5DVKA 1FNGA 4U1JB 3ZTNL 4PRHA 4P2RA 5HHVH 3MREB 3TN0C 2BOBB 1J5OH 4OT1L 1MFCH 3W39A 4HD9A 2FIKB 4JFFE 4PJFB 4G6MH 3V6OE 2DI7A 2X2YA 3D0LB 3LHPL 5C08E 4XP5L 3MLWL 1JUFB 4HS6A 2F9BT 4P4RB 5C09A 4NN5B 5DHYA 1MWAL 2YPLE 3CH1B 4C83A 4MNGB 3MRJA 1RUKH 1LE5B 1V7NH 3GIVB 4XAWL 1OF2B 3ROOA 1NGYA 4D9LL 4LSPH 4AG4L 3WS3A 4LAQH 4OCNC 3W2DL 2V7NB 4GBXD 4XXCA 3MLVL 2LVEA 2DMBA 5SWSB 1A0QL 2FGWH 3HZYB 4FFZL 3REWA 5IVZA 4WTXA 4RFOL 12E8H 2GTWA 4JGJA 4L8BB 5DD6A 1CICD 3O6MH 4WFFD 4ZYKB 4HEPG 3E6HB 1IILE 3F5WB 4XB7A 1EVTC 1DLHB 5HDLA 7FABL 3PQYD 4ELKB 3CUPA 4K2UL 1GGIH 3VRIA 1EBAA 5I8CB 1T89A 1UWGH 2Q8BL 1AO7A 2VDQL 4LSVL 4MXQC 2WP3T 3OKNA 4HLJA 4YQXH 2FX8L 1DUZA 4X0KA 3W9EA 1IM9A 3KPSE 4LVNB 5MEPB 3CVHB 3SGJA 4KROD 5EO0A 3S36H 3D9AL 1HHGA 1YNTA 5D5MA 4NQEB 1QSEB 5LGHL 4Y16A 1ZA6B 1MIMH 5KOMC 5C9KA 3S96A 1CBVH 1UYWL 1A7QH 3HNTL 1P9MC 1NMCC 2GJJA 2IFFH 3GJEA 2ZCKH 4AIZA 4ZUTB 1I9RL 3V7AG 3BH8A 4IMKA 4Q58C 4ZNEE 5JUEH 3MBEA 4OCMC 1GOHA 2R8SL 2DQEH 4XHJD 5JOEA 4LHUD 5DGRA 4P9HL 2IWGA 2ZUQB 4L4TD 1SYVB 1IAMA 3FN0H 5H35A 4WWKA 2VZUA 4LF3B 5TGBA 4HUUB 3SCMD 1BJ1H 5C0RH 3TIDB 2OCFD 1E6JL 4R4BA 3IU3B 4NRZB 2W9DH 1NUFA 5E6YA 2QQNH 5I71B 2I9TA 4C58B 5F97E 4WNQB 3ZT7A 2P42B 3ARUA 1EH9A 5ADOL 1MFAL 4XPFH 1I1AD 1QVOA 4OQ1A 3VFVA 5KVFH 5D6DC 3H9SA 3VH8G 1F11B 5TE4H 4J3SA 3ARDB 4Z8FL 3CD4A 2LU3A 4MAYC 4Y5YA 3GFUA 2V9QA 1QPXA 2AJ3A 2AEQH 2QQQA 2Y6SC 3MRRA 2QADC 5TE6H 4FQCH 2FR4B 1RZ8A 5I1LA 2B4CH 4LLDA 3T0EA 4R7NA 1LD9A 4HCRA 4LPTA 5GSVA 4ZUWA 4OKVB 3GBLA 1QSVA 4DN3L 1TMCB 4TVPH 2VNCA 1ULVA 1BQLL 5I0ZA 5KSBA 2R69L 1SBSH 3LEVH 3FOMB 2BSSA 5BV7C 5JXED 1CF8L 2XTLA 4R4FH 1HKLH 1HDMB 1BJ8A 3LKSA 4K8RD 3QXVA 1YJDL 2RAMA 2WIIA 1KB5L 5T33H 5DQ9B 5I1IH 3V5DA 1UA6L 1YNLH 5HD8D 1VCAA 3TNNA 4FS0A 1ORQA 5D1ZD 2V9RA 3C8DA 2BVOA 4NHUB 1CQYA 3BDYL 3OGOE 1X5LA 4OZIF 2FO1A 1QRKA 2ZCHL 4XNXL 5L2KE 4NQCD 4TPRH 5K9QG 5FOJA 5J1SC 5F96L 4DUXA 5CWSB 2NY4B 4KV5F 4C55A 1EAPA 4JVWA 5C70A 1U8PA 1WC7A 3HG1B 4HFWA 2R2CA 4XCEA 4R7DB 2FX9H 3TGXA 5J9PB 2IANA 3J8F7 1S7TA 1CYGA 3DI3B 4PJ7B 1A4JA 3SDDC 3FMGL 3VXTB 1JNLL 4NPYA 1F3JB 4HX1B 5KSAB 2VLME 3B9AA 2QSCL 1JK8A 3BH9B 1FL6A 4C56A 1MCSA 1TLKA 2CJUH 4TVPE 4DAGH 5KG9A 3C08H 1E4KC 1NDGB 3BKCH 5IG7A 3BP7B 2VIRA 3SDAA 4ELMA 1ZT7A 1RZIB 1U8HB 2VKWA 1LK3H 1PQZA 1NAMH 3CJJA 4W4NA 4PJCA 2R15A 3UBXA 4YAQA 1OPGH 3R06B 4ALAH 4FQ2L 3IXTB 3K8LA 3RVWD 5MEOA 4HPOL 5DC0A 4CMMB 4GAGL 4P4KC 3G5VA 4M6NH 4H0GA 4WJ5B 3D1MC 4WEMB 5I66B 2A6DB 2VL5B 4QRRD 1BFVH 1HHKA 1TETH 4OLVH 2HN7A 3LSOA 5CP7A 3RWHA 3WD5H 2OI9B 3JV5A 4HAFA 4IOIB 1GRWA 3T0BA 5JHDB 4S1QL 4EEEA 1CG9A 2VDOL 4GS7B 5GS3A 4M5YH 1VB9A 5I74B 1TTUA 2X7LA 3CGTA 1C08B 2CMRL 3SKNB 3PG2A 3VFTA 2H1PL 3GMOB 3R4DA 1C5DB 5CLTA 1TVDA 4MDIA 5I1JL 5FM4A 3MRHA 4X6BB 4WEBH 3WIIL 3IKCA 1DBKH 2WQ8A 3IFOB 3V0VA 4YR6B 5J0BA 5I16B 4XPBH 5EN2A 1N2RB 2WUCH 1KACB 5FGBC 2XRAH 4OCRH 4O2EA 3MMEA 3NCBB 1BEYH 4TSAH 4OZHF 3QHTC 5EO1B 1QFUH 4IRJD 2MQ0A 3QO0A 3VU2A 1LILA 2GITB 4S2SA 1RHHB 2HRPH 5CD3B 5I1CL 4NO5B 3LPFA 4HZAA 1P4IL 3DSNA 4L9LB 3DVNA 1IKFL 4LCCC 4WU5B 4HH8A 3MACL 2VXSL 3MOBL 3VFPB 3QG7L 2DQHL 3BVNB 4P46D 3TO2A 1G9NC 3ZKND 2EIBA 4MS8D 4DGIH 1DDHB 3DVFA 5DHXB 3SDXB 5HVHB 2LAGB 2DBLH 4ODWA 1JGEA 1Z9MA 3VFOA 3AMLA 4L8CA 1NFDE 4ERSH 1O5DT 2WM0A 1IC5L 4U6XA 3GBML 5IW1B 1TXKA 3FAWA 3SO3C 5E8OB 2CR6A 4XPGL 2P4AB 2JJTC 4P23C 1SY6L 2F19L 2GI7A 5HHQB 2R1WA 3BWAA 1Y0LB 2ICWJ 2FHBA 1N6QL 1BPVA 2Z8WC 3T65B 3UTSD 5F1NA 1GVIA 3ZKMC 1QACA 4JO1L 5DJ2B 4FZEL 3N1FC 4YUEH 4PJ5E 3ORJA 4OJFH 3OG6B 3QRGH 3NACL 3RI5F 5C0DA 5T1DL 2L7JA 2IAMA 4NKOA 1WT5C 4KMLB 5IJVA 3VCLA 4I3RH 5F6IB 5K9OB 3FQWB 2Y06L 1NCDH 1T66C 2N1KA 4GKNA 5D7JB 4O02H 4POZC 4DKEH 1F6LL 5DJDB 4XC3H 3VH8B 3O11A 2XNAB 4E41D 4L4VD 4Y4KD 1HILA 2XTJD 1KPRB 1WAAE 3FO1A 3BRGC 3S4SA 3OQ3B 3KPRD 3BWUC 5HYSB 3OSKA 2BRQA 2EECA 1FGVL 4UT6L 4WUKH 5DEFB 2Q7NA 3SOBH 5GS2H 1OHQA 5DJYA 4NNYB 4YDJB 1AXTH 2P5ED 4NO0A 2VE6B 2B39A 3QZWG 2VRAA 2Z91B 3BX7C 1MFBL 2JB6A 2YN5A 4LP5A 1U8KA 4RGNB 2OMNA 2IH3A 3SN6N 3WJLC 2Q86A 2V7HB 1BD2E 3BN9C 3WIFA 4RMVA 2BVUA 2NYYD 3BYTA 1NLBH 3ARGA 4U6HB 4F37K 4J3UA 2FJHB 4WFGD 1PKOA 3W11D 4DKFL 1Z5LB 3D85A 1BIHA 2VR9A 1RIVL 4L3CA 2X4SB 5E9DD 4DGVL 2JF1A 5TQ2H 3VXSA 2VLRE 5BMFH 2HT4C 4MHHG 3HE6D 3KLAA 8FABB 3FQNB 3VWKB 4YBLB 2MKWA 1JPFB 3FT3A 2E7HA 1T1ZB 3V6BR 3GB7B 3IVKB 1JGLL 2OR8A 4GMSH 5C2BL 5DRXB 5KN5A 1JPGB 4Y88A 5FYLH 4R90L 1OL0A 1JWUB 1K8DA 2J4WL 3T0XA 1INDH 5C09E 1VPOH 1JZ7A 1Q0YH 1BQUA 1FRGL 1UJ3B 4G6FD 5D1XB 5DK0A 2EDNA 3H9ZA 4F7TB 2NW3B 3PL6D 5I1HH 5CLWA 1GGUA 5EWIL 4HMEA 1GC1C 1Q8MA 2E8ZA 3LB6D 1CFQB 3QPXL 3IB4A 5DHVA 5AUMA 4DOHE 3MRDA 2IMMA 3HUJE 5F3BB 2A6JA 4W6YB 2YK1L 3C5ZD 4NO3B 3U0PB 4C57C 4RGMC 3C6LC 1FL5B 1XCTA 3QHFL 2FJGA 5ETUB 5EZIL 3MRQA 4KI1A 5CS7A 1UM5L 4U1KB 4CU8A 3H3BC 4M7KH 3AY4C 3ARFA 3GSNA 4ZSOB 2Z4QB 4HAGA 3ZKXC 5I17B 1KLGB 3DRQA 4JHZA 1CE1H 5A2LH 4LMQI 3I9GL 4WW2C 3C6SB 1AO7E 1KCSL 2VISB 4K7FA 2VQ1A 3DXAD 4U1HA 4JDTH 3U83A 2R1YA 5DUBA 5E8PB 1S3KL 1TJHL 5KOVC 3JWDH 2GKIA 2DQFA 3FAXA 3U36A 3REVB 1R3LB 4PY7A 3P40A 3RBSA 5D5ME 3SBWC 3GI8H 4I18A 2GFBB 3P0VL 3SE8L 2EO9A 4GBXC 4EQ3A 1DVFB 3OZ9L 2VLMD 3PP4H 4YNYA 1IFHL 4K9EC 3GJFA 1T21B 5GXBB 1JWMA 2A6KB 2G2RB 1N7MH 1BREA 4RGOL 3C60D 1WZLA 5HYJD 1AIFA 3MOAH 1F4YL 5CJXA 4J3OC 1XF4B 4JQVC 5KSVA 4KAQL 4MGXA 5HPMA 3MLXL 5KVMC 4L3EE 1IL1A 4QXUH 3FB6B 4MZ2A 3QNXB 1J1XL 2P8PA 3QUZD 5HGDA 4ORGB 2YC1A 3EDFA 3V6FA 1UACL 1A3QA 4KROC 4TUOA 5DJZB 4NZUH 2Z92B 2GCYB 1WFOA 1PZ5B 3O6FB 1CI5A 3VWJB 1R0AL 5GGSA 2GK0A 3H9SE 4R8WH 3WL9A 4OCXH 4N8VA 1X5ZA 1AHWB 1FZOA 5D7IB 3DX9A 4ZOEA 5JNYB 1Q9KA 3GSQA 3BPNC 3GUTA 1UXSA 5AD0B 1EBPA 2R56L 1NQBA 3CZFA 4XHJC 4M6MH 3T0EE 3RY6A 3U6RA 5BS0D 1RZJH 4H25A 3SDCD 1UZ8B 1FFNA 3PGFH 4HWUA 3SCMC 4DQOH 1PSKH 1LEGA 3TH4T 1VACA 2YD5A 4I77L 1FORH 1OGAD 3ZTJH 2ZUVA 4M00A 2VR5A 4Q6IC 1TQCC 3JV6B 5M95B 2DTML 1KEGH 4XX1E 2WWKT 2APVA 1EEYA 5T1KD 1I7RA 1XR8B 2JJUA 3GSUA 1LE9B 3DV6A 1I1AC 3I2CH 2X9WA 5DMJB 3RWDA 3V5KB 4RFEB 3AB0B 4ODVH 1JWSA 3GGWB 3QNYA 5HDQH 4X83A 2JJSA 4RWYL 3CPLB 3IAGC 2O61B 1U8OA 5F7DB 2AXGA 2VZSA 2ITDA 1GAFH 4M6OL 3ZMRA 2C1OB 1AGEA 1P6AB 3L5XL 4OCSL 1INQB 1P7QB 4M93C 3HC4H 5IGXH 4TYUA 5E5MB 4KUZL 2NY0B 1FH5L 5AYUH 4F58H 5EOCH 2IANE 4RAUA 1AQKL 1X4YA 5FA3A 3N1MC 4Z7QF 4KRPD 1AC0A 3JUYA 5JXEC 4JANA 3BO8A 3DYMA 3QO1B 2QQLH 3BMWA 4P2OC 5C7XH 2BSTB 4ZXBB 4D3CH 5HD8C 1IC4H 4ODSH 4ELME 2DQTH 2NX5D 5TFSH 1D9KC 4BH8A 3NGBC 2BRRL 5J6GB 3UZVB 2XPGA 5IMKB 5DT1L 2QR0A 4KHXL 4XPTL 3KVQA 4OGYL 2ATKA 3QPQC 1OAQH 4PJCE 4ZFGH 1HHJB 1ZOXA 4MQ7A 1Q9LB 3D39A 2Z0BA 3FB5A 4HJJH 5HDOA 1KXTB 3OAUH 1T22B 2Y7QB 4U3XA 4LIQE 5CCKH 3EZ8A 1S7SA 2NXZD 3FO2B 1ZS8A 4HH9B 4QOKD 4G5ZL 2CKBL 2E27H 2PYEA 2W1NA 3QUYD 4HKBA 4DKDC 3QIBD 1WBYB 4HJ0D 4PREA 4Y4HA 1SY6A 1DSFL 3MV7E 1I1FA 4OI9A 3GMPA 4GRLD 4PRDB 4DEPC 4LHQB 3GSRB 3HFMH 3QA3B 3OHXB 2RB8A 4JQIH 3QWRD 3TPUA 2AP2A 1VGKA 1PD6A 1EXUB 4JFDA 1HCFX 3ESVF 4JKMA 5IOPB 3W9DB 4ONGL 1H5BC 4AEHH 4TSCH 1ZGLA 4LEXH 3EOBB 3GI9L 3EO9H 3QAZB 4Z95H 2IQAA 4O5LH 1P4LB 5I75C 1FIGH 3QRFM 2APBA 1YC8A 4PJXB 5ADPL 2CQVA 3PWNA 5AZ2L 4PRHD 4P2RD 5I19H 1H15A 1TZHA 2W07A 5CGYC 3LHPH 4NUGL 2VKXA 4BSVB 1AKJA 3EJZD 1ITCA 1IGTA 2X40A 1SQ2N 5ESVB 5JLZA 4IDJL 3PP3K 4OM1H 3QIUB 5K9JL 5IR1A 1K6QH 4ZOCA 5IFHL 3T4YA 4XAWH 3EOAA 1NGQH 1FGNL 1RZKL 4Q0XL 4D9LH 4WI2A 4NM4L 4AG4H 5DD1L 1IT9L 1AD9B 1T2JA 3L6FB 3LOWA 2DKMA 2J1KA 3W2DH 1UFUA 3MLVH 5IT2H 5L0QB 1A0QH 4FMFA 4FFZH 1DFBL 4PG2C 4IRJC 4J3WA 4LGPB 4RFOH 4TRPH 1CD1B 4NC1C 1A9BB 4K71C 2EC9U 5EOQL 4X5LA 4HMCA 3TP4A 1RFDL 4N0UB 2OSLB 2P24A 2EE6A 3MLSH 3OKYA 4CJ0A 5FYKD 2DYPB 7FABH 4C4KO 4P46C 3TWCL 1QZ1A 2ADGA 3P9WB 4K2UH 3BPLC 3ZKNC 1SBBA 2RFXB 4MS8C 2GSGA 3G6AB 2Q8BH 5CBEB 3PP3H 2VDQH 4MJIB 5CKGA 5D8JL 2FX8H 1GIGL 5EU7E 4PV9A 1PKQB 1EEUA 2FJFA 4KU1A 5I18H 4JZJA 2DF3A 4LFHG 4NZRH 3CVHL 4M7JL 1E28A 4X6EB 2VUOA 4MQXD 1JGVH 2A77L 3FOLA 4X5WA 5JORB 4XNYL 2DI9A 3QEQD 4PTUB 1EUTA 3W82A 1UYWH 5IHZB 1DBMH 3HNTH 4XPHL 5FYLD 3HZMB 1CLCA 2GK2A 3KJ4C 1S5IL 3DGCR 4I0PA 5TPWH 1FFPA 4AIOA 1A1MA 2C4XA 4XTRD 3VG0L 3X12A 4N9OB 5B8CB 4X4MA 4HIEA 5T1LD 1PEZA 2IF7A 1I3GL 5DHVH 4P9HH 4Y0GA 4IIQB 4XPAL 2YS4A 2SEBB 3HR6A 2ZUTA 1R3IL 4QKXB 4ODXB 1OARL 4NUJB 3DHJA 4ZO7A 2OXHA 2GAZB 1J11A 3ETBF 4JY5H 4ZOBA 4OF0A 1XR9B 3P9LB 3O2VL 4D0DB 4KRLB 3CSGA 3T2PA 3BPCB 3Q1SL 2BOCA 2CR3A 4LPYA 3PHSA 4BKLB 4NGHL 4FTVB 2AJSL 3L7EB 4QHMB 4Y4KC 3HE7D 1JI2A 2E7CA 4LSSL 3GSNH 5ADOH 1KCVL 5DI8B 1MFAH 1RU9L 1FG2B 2AGJL 2ED9A 3D48R 3NIGE 3VXSE 2LV4A 1II4E 2BFVL 4PGEB 1VFUA 3BMVA 2P1YA 1MVUA 4Z8FH 3FTGB 4K55A 5FB8B 2W0FA 3H3PL 5DFVD 1X5AA 1VKXB 1EEZA 1QFPA 5AYQA 3TA3D 4L8DA 1ZHBA 5E8DL 3VE0A 2GIYA 2KL6A 2DICA 3DMMB 3IJHA 4U1MB 5D9SA 4PRBB 3L3HA 3MX0A 5BVPL 4DN3H 1BQLH 1T20B 3STZA 1NC2B 2R69H 2ZUWA 3ALPA 1I85C 4HKXA 4R3SB 4YXKH 3D3VD 2NYYC 3GJFH 4LCYA 1F58L 1YJDH 4UAOC 4Y2DD 1U3YA 3W11C 3KPMA 5J3HD 1U8LB 2MWCA 1CDGA 4ZFZB 3DIFB 2AQ1A 3CXHK 3S35H 2DIAA 4RRPA 5EIVA 2EDTA 1CFNA 1DJSA 3ZE0F 4ZD3L 1JZ2A 4NFCA 3HE6C 4AEEA 1FSKC 4ONOA 4YIQB 3P4LA 3QUKB 1MAKA 3RWCA 3T09A 4G43A 2ZCHH 4TULH 4XNXH 1TZGL 1S7RB 5F96H 4X9BA 1D7FA 3WFDH 5MHSD 1EJOH 5KSBF 1MFEL 1OD7A 2GTZA 5DS8B 4ZFFB 5CIPA 1UWEL 1GGCL 3N9GL 1TDQA 2WUBL 5I9QC 4YO0B 3RY4A 1MRFL 3BKML 1TZIB 2DLHA 1G9ML 4O2FB 1JNLH 1O7SA 2QSCH 4OB5L 2VDMH 3EKCA 4YFDB 1A2YB 4HC1L 3LB6C 4KVCH 5EO9B 3K8MA 4RIRB 3RDTB 5C8JA 5DRZB 1FZMB 2D0GA 3BP4A 3C5ZC 1Y18A 5D6CB 1B2WH 3WJJA 4JHWL 3NN8A 4JRYD 4C56D 4Q9CA 1KJ3L 3T3MF 4NFDA 1KLUA 3WHE0 3ZYOA 4F7EB 3WS6C 2LQRA 3OF6D 1C12B 2UUDK 1YEGL 3VI3F 4JG1L 5ABDE 5HGHB 4LKCA 1HSBA 4FQ2H 4H5SA 4D8PB 1MFDH 4HPOH 2B2XL 2P44B 4GAGH 1TENA 5IB1A 1K5NB 1U9KA 4HBCL 4Y1AD 5DR5L 2LTQC 3S37H 3UPRB 5GRWA 2J5LB 3K2MC 4LEOA 4DZBA 4HUVB 1N0XL 3LDBB 4AQOA 4PGJA 4LNRB 5BO1L 1QSFD 4ELMF 2A74A 3QSKB 4PGCB 3U4EB 3M1BB 4S1QH 4PJEB 4FQJL 1LP9F 1MH5A 3WFHB 2FRGP 3DARA 2X05A 1S9WB 1TVBB 2BNQA 2R29L 2UV3A 2CMRH 1NBZA 4QHNA 5E4IA 3O4LD 2GW5A 3X11A 4JFHD 1U3JA 4F15C 5I1JH 4JREB 5DQDL 4GG6A 2VQTA 1CFVH 3WIIH 3O6LL 3C60C 2PXYD 3VI4F 2VLJB 4ZFOB 3WFBH 3KYAA 3FFDB 5FO8B 3VG9C 1V3LA 2AAVA 2C3VA 2P8MB 1FBIL 4GAJL 4JM4L 5MERB 5I1CH 1WWCA 3SGEH 1BZ9A 1P4IH 4PFEA 5IUSA 2O5XL 1IKFH 3H0TA 2HFGH 4XNUH 3WN5B 3MACH 2VXSH 4CADB 4APQB 1CCZA 3MOBH 4CUCA 5GRJL 3QG7H 5BJTB 3VXRA 5EU6B 5JW4Q 4I9WD 3NIFE 5C08B 5FDWB 2P7TA 1YN7A 5CGMA 1BM3L 3G6JA 1PDKA 1FPTL 1WICA 3OKKA 1ZTXL 4QY8B 3TBYA 1K8IB 1MELA 4GRWF 2P5WA 2IQ9L 2UY6A 4OD3L 5CEYA 5T5FH 4EOWH 2CRZA 4Q6YA 3O41A 4XPGH 1QUNA 3FT2A 3MUJA 3VGGA 3VXUD 1SY6H 5JIIA 1Z6JT 2DBJA 4PJIF 5EU3A 4KVNH 3SDCC 5LVEA 4YXHL 1N6QH 3BYYA 4UQ2A 3IJSB 2YRPA 3MJ8B 4X7TA 4MNQB 1J88A 2N56A 3I75B 3F58L 1IC7L 2CRIA 4HZLB 2N7AA 4OZGB 5AAWA 3F12A 3O3UN 1RK0B 3IGAA 5EZJB 3DSFL 4X7EC 3B9KA 4U1JA 3MREA 2BOBA 2C7UB 2Y06H 1EO8H 4Z78B 3VXOB 2FIKA 3RP1A 2IAMD 4PJFA 5C71A 3IDYB 4XCFH 3MRCB 1QBAA 4NN7B 3D39E 3D0LA 1JHLL 3O9WC 3SDYH 2BSRB 4OI8A 2X1OA 2DQUL 2X4TB 3BKJL 4KQ3L 4UIKL 1NMBL 3CH1A 2HJLB 1FGVH 2OS7A 3EFFB 1KIUA 3FB8B 4MNGA 3KNBB 5HJ3B 4LKXB 3GIVA 1OF2A 4HWNA 2W60B 2PYEE 4HGMA 4KRPC 3VA6A 1F4WL 2V7NA 2AV1B 4WY7L 3SKOB 5SWSA 3BQUB 4U1LB 3O45B 3HZYA 3F6LA 2M26A 4CN1A 1T1YB 3DLQR 5F7UA 4L8BA 5I0DA 3RPIB 1Z0MA 5FKAB 4XXDB 1GCFA 3LQAL 1P84K 3AAZB 1X5KA 2X4UB 3E6HA 4ZYKA 5IQ7H 5H37G 1P2CB 1WITA 4F9PC 1KCRL 3F5WA 1DLHA 4U4BA 4DKFH 1MCOL 5ACMA 4ELKA 4JFDE 4MMZC 1RIVH 4RQQB 5I8CA 2E7LC 5FUOL 4DGVH 1UADC 3P0YH 4I1NB 2GJZA 2XA8H 4JRWA 3OKEB 4EUPG 3QUXB 1PZUB 2XZCH 1MIEH 3I85A 4DVRH 3UTTD 5MEPA 3CVHA 3UJTL 4WVRA 2Q8AL 5C2BH 1QLRB 4Z7WB 4FZ8L 5IBLD 3S35X 5KVDH 3QUYC 4NQEA 1QSEA 1ZA6A 4XC1H 4ZUUB 3QIBC 1MREH 4HJ0C 4WGWB 4R90H 2J4WH 4FFYL 5F7YC 2F53A 4GRLC 1WZ1L 3V4VL 4K7PL 1FRGH 1G7QB 5FKPB 4ZUTA 1YYLL 3FQTB 3FONB 2NY1B 3R1GL 5EULV 5EWIH 3LN9A 1FYHB 3QPXH 2ZG1A 1SYVA 4LRNL 2BVEA 4LF3A 4CVXA 4HUUA 4PJBF 4YXLH 3TIDA 3HPLB 5C2UB 4HLZH 4NRZA 3NOIA 2N7BA 1XH3B 2E7BA 4FQLL 5EZIH 2XN9E 3WIHL 1TQBC 4PJGF 5L2KB 5CGTA 4WNQA 1S7WB 1RSFA 3QEGL 3O2DL 5DURD 4KMTH 4HXAH 4PLKC 3EUUA 4HWEH 3I9GH 1MUJB 3ARDA 3QFJD 1Q72L 4BQCA 3EJZC 3BN3B 1TJIL 2DM7A 4H8WC 3U7YH 2PNDA 1SEQH 3NAAH 3PGCB 4GG8B 1K3ZA 2FR4A 2AV7B 3TN0B 2XFXB 3QR2A 1F6AB 4NQTA 1UZ6E 5DDHB 1XAUA 3S37X 3P0VH 2ZCLH 4OKVA 3SE8H 1DCLA 4IMLB 3ARBB 4BFGA 4ONFL 3OZ9H 4JPWL 3FOMA 3DHMA 2EDRA 3JWNC 1IFHH 4P59L 1HDMA 2BMKB 3V6ZB 4PUBL 1KJ2L 3ILPB 4J12A 4RGOH 4PJHE 5DQ9A 4DN4L 3UTZB 4X4ME 2V17L 1F4YH 3ZDXF 1IGCL 5F93C 4KAQH 5EZOL 3MLXH 4NHUA 3IAPA 5KVGL 3MLTB 1J1XH 1IKNA 1CLYL 2AERT 4WHTB 5CWSA 1A6AB 3U1SL 4XWOD 3UYRL 2EZ0D 5SWZD 3ZZ1A 1CQKA 4MQXC 3HG1A 4GKSB 4R7DA 4KMQA 5J9PA 4U0RC 2HT2C 2XQBL 3Q3GB 4PJ7A 5CIPH 4NKIH 1UH3A 3BP6B 4U6TA 3VXTA 2OR9L 1F3JA 4HX1A 5KSAA 3IFPB 4OTXL 1A6UL 1NAKL 3BH9A 3FRUB 5J13C 4XTRC 4XCCL 3RJDA 3KPOB 5HY9B 4DKAA 1NDGA 1MFNA 3BP7A 4OLEA 3HMWL 3G6DH 1I1YA 4K3GA 1RZIA 1U8HA 1DTUA 2MCPH 1T5XB 4J8RB 4NQDB 3OR7B 4ZUVB 3UBXI 2F74B 5I1DB 4XB8A 2QHLA 1NMCB 3BP5B 3R06A 1FQ9C 3IXTA 2DTMH 3MBXH 2X10A 4Y2OA 3HE7C 2D4FA 4M3JA 1A6WL 1XGQB 1IQWL 1RZKC 4WJ5A 5GS0L 1HI6B 4PJ8B 5I66A 4YH6A 1CDUA 1KXQE 2A6DA 2V5RA 2VL5A 4NC2B 5DFVC 1NFDB 2NXYD 3TA3C 2H2PD 1JI1A 1IAIL 2RBLA 4IOIA 4ZAKD 4M6OH 3D5OF 3L5XH 3TESA 1EZVY 3U30C 4LU5L 1KJMB 1B90A 1KN2L 2NY5L 5AWNL 1C08A 1I3RB 4KUZH 3SKNA 1FH5H 3IU4L 4W4OA 3GMOA 1C5DA 2BDNL 3GSOB 4HK3J 4LSTL 4X6BA 2C26A 1P5UA 3D0VB 3IFOA 4O4YL 3NIFF 4YR6A 5I16A 4KK9D 4MAYB 1N2RA 4X9FA 5DRNB 4Y2DC 2DTSA 1A6TB 3HR5B 4CL7A 4UU9B 2QADB 5EO1A 5I15L 3RA7L 3UXFA 1RHHA 5CD3A 4NO5A 1F6FB 2K7PA 4PP1D 2BRRH 4L9LA 1BBDH 3SGDI 5FDYA 2DLIA 1DE4B 2AABL 1NCBL 4PB0L 4WU5A 1D6VL 3EBAA 3SE3A 4XPTH 1TCRB 1Q9WB 1HNGA 1QSZA 3VFPA 1RV6X 2H8PA 3VD3A 4OLWL 3SJVA 3BVNA 4KK6C 1HWHB 1MJUH 4RFNC 5BV7B 1M4KA 4I4WB 5HHOE 1LEIB 4OLXL 2VDRL 4JO3L 1DDHA 4LVOC 3H9YA 3SDXA 5B39G 3RHWK 4ZPVB 3RIFF 2I27N 1WEJL 4TUJB 1JTPA 1LGVA 3D39D 2FATL 3VMPA 3QDGE 1CDYA 4G5ZH 1EHLL 5IW1A 5KAQF 2DWDA 4POUB 2JE8A 1MLCB 5JZ7D 3BE1L 3I3BA 5E8OA 1CTNA 5DD3L 4M7LL 5HHQA 35C8L 5ID1B 2A0LD 1Y0LA 4YZFE 2VLLB 1WWAX 3T65A 1IEHA 2DLFL 2EDKA 4HG4J 2CD0A 5DJ2A 3J7HA 3WFCL 4M02A 4EI5C 4GG6E 4Z9KB 2Y25A 1OAKL 4HUWA 4XVJH 3LAFA 2OK0H 4ETQB 3SDDB 1PAMA 1PG7L 4ONGH 2JCCF 3MODH 4QTHB 4YDVB 1J0KA 2ID5A 5KJRL 1G1YA 5HHXL 5K9OA 3FQWA 4JM2D 5D7JA 2Q20A 3GI9H 4PV8B 5DJDA 5DZLA 3NZ8B 4E0RB 5F1SA 3VH8A 5IJKC 4Q2ZB 2XNAA 2FH8A 1NFKA 5J06A 1WBZA 3G08B 4YDIL 1KPRA 3VXRE 5AZ2H 3FQXB 3VMNA 2YA1A 4LLUB 5HYSA 5ISZB 4NUGH 1NC4A 3G6JE 5FA4B 4IDJH 5DEFA 5KANI 4JM2F 1RUMH 4NNYA 5K9JH 2DB8A 4YDJA 2P5WE 4LCWD 2DAVA 2VE6A 3EO1B 3WNOA 2Z91A 4Q0XH 4CJ1A 1I7ZB 1R24B 4NM4H 2YA2A 2DWEB 5DD1H 1IT9H 3HUJB 4F8TA 1VESA 2JIXD 2PXYC 4PYHA 2V7HA 4XP6L 5HHNB 4X4ZA 3MRKB 3CC5B 5FECA 4D9RE 2ESVD 4U6HA 1RK1B 2KPNA 3OKLB 2FJHA 4OUUB 4PTTB 4MX7B 1Z5LA 3L3OB 4OIIH 2X4SA 4QEGA 3BXNB 1AJ7L 1FCCA 3FQNA 5HTSA 3DOSA 4DK3A 4LSQH 1IVLA 1NKRA 3CSPA 3VWKA 4YDKL 1JPFA 1P69B 3HI5H 1T1ZA 4QTIL 4YC2C 4O9HL 3IVKA 5E6IC 4PJFE 5DRXA 3CVHH 1JPGA 2W9EH 5HDBF 1KOAA 2A38A 4M7JH 4S10A 5LQBL 3JVGC 2YRZA 1DQLH 3KPQB 1CDIA 1JWUA 1I8LC 1SM3L 4LCCB 4Q7DA 1G0XA 4NO2B 3B9EA 4NBXB 2G5BB 4WDIB 1N26A 3CZJA 1GOFA 1UJ3A 2KZ1B 3TO4D 5D1XA 1RZ7H 4MD5B 4F7TA 1SJXA 3P3YA 2NW3A 4MNGE 2NY3D 1ZANL 2L7UA 3GJEB 3STLB 2BZDA 5I30L 4YHLH 4CBPA 1S5IH 2VN4A 1CFQA 2CUMA 3K46A 2Z31A 1WQVT 5F3BA 1Q94B 3KYOB 3GSVB 5SWSE 4NO3A 3U0PA 1U93B 2N4IA 1I3GH 4BQ6A 3MLYH 4XPAH 1FL5A 4DUVA 3CLFH 1R3IH 3A67L 4L3EB 5ETUA 1OARH 4N0YL 3VXMB 3SO3B 4U1KA 2HVJB 4MA7L 4P23B 1KELH 5GRUL 4IBLT 3QCUL 3QUMB 2Z4QA 4ZSOA 5I17A 5GGSY 4NGHH 5HYEA 4LSSH 3NA4A 1RUAL 1FO0B 1TFHA 1KCVH 1RU9H 4LHUG 2AGJH 4NIKB 1AC6A 3C6SA 2VISA 2QSQA 1N0LA 4Z7UF 2HTLD 5E8PA 4RMSA 4LQFL 4Y5YB 2WQRA 3K74B 3PJSB 3REVA 2HKFH 3WUZA 1R3LA 4NQEE 1QSEE 2GFBA 1JMXA 3X17A 2WNGA 4ACPA 3MQIA 1TJGL 1LD9B 1DVFA 3JTSB 4J23A 4Y7MA 3V2AR 4HWZA 5GGTH 2F53E 4JFED 4OGAD 1T21A 3I02B 1KJ2A 2A6KA 2G2RA 2UWEB 5CSZB 1F58H 2YXFA 1L6XA 2ZKHL 1KYOK 3ARED 3TJEH 4RDQF 5I1GL 2D0FA 3MV9D 1QRND 4ZD3H 3FB6A 5IESH 1A14H 3QNXA 2UYLB 1I7TB 1BMGA 5ANMB 1TVHB 1NCNA 2E9WA 1CXFA 4ORGA 3SQOL 4YHYC 4P48A 4FABL 4PBVC 5DJZA 5M94B 2Z92A 3VFNB 2GCYA 5D7LB 1HHHB 4KGLA 1G7LB 1ZGLM 4OZFB 1PZ5A 5IBLC 1I8KB 3O6FA 3VWJA 1W0WB 2DRUA 5CMAA 5JPMB 1MFEH 1MLBA 2B1AL 1AHWA 5HI4D 5D7IA 3V0WH 1MSPA 3UC0L 1UWEH 1GGCH 1DBJH 1CD8A 3ZDZE 5JNYA 2WUBH 2HJKB 1C7TA 2ATPB 2EKSB 3PNWB 4KPHL 5LG1A 1G9MH 3U82B 1PW3A 4NRYA 5AD0A 1JK8B 4OB5H 2IFGA 3VRJB 2X1PA 2CIKB 4HXBL 1UZ8A 3CDYA 1U6AL 1MHCB 4HUMB 4JHWH 1FCGA 4XWGL 2C3XA 3GM8A 5HYQB 5HHMD 1B0GB 3CMOH 5GS1C 2HKHL 2IADB 3JV6A 1QYGL 3HAEG 3BZ4B 4NP4L 2FLRT 1XR8A 2BJML 1LE9A 4JHAL 4WI8A 2EH7L 2RCSL 1LO4L 5IB2B 4RFEA 4NBYB 3BZFB 4HBCH 4QXTB 3GGWA 2Q3ZA 4O2CB 4PD4J 4UINL 3CPLA 2O61A 4RGMB 3C6LB 4L5FH 5F7DA 2AQ3A 1TPXC 2EDWA 3ZE2E 5D2LF 2HN7B 1U8QB 2C1OA 3LSOB 1EHXA 3MV8B 5I8EB 1INQA 1CK0L 3HLAB 1P7QA 3HG1E 1E27B 3HZKB 3MV7B 4U49A 4XNQB 4BQ8A 5E5MA 3ZKXB 3C5JB 1J0ZA 3ARXA 4QXGL 2X70B 2CDEB 2EIDA 2XWTB 1W72L 4PJ7E 3VFTB 4EDXB 3C2AL 1HOCB 4WW2B 3ULSB 1WWBX 43CAB 3WDJA 1A7OL 5FHAL 5DQDH 2VITB 3QO1A 5EUKB 3O6LH 2BSTA 2BNQD 5E2WL 4KK5D 2DQJH 4ZFOL 4ZXBA 1JPSL 2H3NB 4JVPA 1XZ0A 3IDJB 1NGWB 5C0AD 5GRZA 2GT9B 1BJMA 5J6GA 1X3DA 3QQ3B 5BRZD 4GAJH 2FEDD 5IMKA 4WCYH 4GBXB 4JM4H 4UOW1 2OTPA 2O5XH 4LK4A 1GOGA 3EHBD 1HHJA 3FRPA 5BCAA 1ZA3B 4OGXH 3HA0A 4XWOC 2EZ0C 5DMYA 3ROLB 1JF1A 1G7PB 4FQIL 1T22A 1MQKL 4CN6A 3TBSB 2Y7QA 4HFUL 1FPTH 4HV8B 1ZTXH 5T5NF 3WLBB 3FO2A 5EORL 4HH9A 3MNWB 3QJFB 3ARZA 2IQ9H 1FNSL 1A5FH 4OD3H 3RTQD 1WBYA 1NCUA 1J05B 4P2YA 4BQBA 5K59F 4IRSC 4PRDA 3FQRB 5CEZL 4KROB 3QA3A 1CR9L 2OTUB 3VGDA 2ERJB 4YXHH 2B5IB 3DGGB 1D5XA 1R3KB 5ICXB 5GHWL 1U8NA 5DD0H 3UZQA 4U0QB 3D2UD 1Q0XL 3F58H 1EXUA 1IC7H 1H3VA 1JCKA 5CD5D 1CFSB 3G6JF 4NC0B 1GGYA 3W9DA 5IOPA 3FT4B 1X5HA 4CU6A 5AG9A 1KG0B 3L1OL 5F7EL 3DSFH 3BPNB 5EH1A 1OQOA 1RVFL 1X4XA 2GQHA 2OQJB 3EOBA 3C5SB 1BIIB 5JW4M 4GXVL 1P4LA 4LHUB 4L4TB 1JZ5A 4BJLA 4ZDHB 4K3DL 4P3DB 4PJXA 4QHLB 3EOTL 3SJVE 2YWYA 3N50A 2NXYC 4HIJA 2H2PC 4OV5B 2DOCA 1JHLH 2YD2A 4ZS6D 4ZAKC 4BSVA 2XZAL 1MWAB 4Q6IB 1TQCB 5ESVA 3SDXE 1KTKE 3BKJH 4O51B 3V52L 4KQ3H 4UIKH 3QIUA 1NMBH 1W0VB 3WKML 4OLYL 5E2VL 3U2SB 4UBDD 1I1AB 1TNMA 5IW3A 1MI5D 2DKUA 4JZOB 3RHWF 4YFEA 2CDGB 1F4WH 3L6FA 4JN1L 1IGYB 3VDBA 2WBKA 3V7AE 4WY7H 4BK5A 3RWFB 2EYSB 4KTYA 1FE8H 3LPGA 1YEHL 4JG0L 5E03A 4IS6B 2V5SA 2VZOA 3LQAH 4M93B 1CD1A 1A9BA 3PHOA 4PP1C 2E8YA 4N0UA 2OSLA 4HMDA 3O3AA 3MLZH 3Q0HA 1KCRH 2M1KA 5CP3A 5E2JA 3MLPA 2DYPA 5J1TC 1MCOH 3D85B 5CINL 4W6XB 1QFWH 1WUNT 1M05B 5L6YH 2RFXA 3G6AA 5T3XH 1UXWB 3KLAB 4NQUA 4MJIA 4X9GA 4P2OB 3MOQA 4XVUD 2ZNXA 3TVMD 1PKQA 3QEUB 5ACLA 5BOPA 1ZV5A 1D9KB 4X6EA 3GKWL 3UJTH 3NGBB 3PWPE 4FZ8H 5I2IB 1FLRL 5JORA 3N1QC 2Y4SA 4NKQB 4PTUA 3M45A 5IHZA 4FFYH 4MXWL 4WV1C 4KZEH 1U3HD 3HZMA 3LS4L 4XBPB 3QXDB 5T3ZH 4R6UA 1A64A 1PY4A 1YYLH 4GH7B 3I3EA 4X9IA 4L8SC 4AL8H 4RGNE 4BH7B 1LEKB 1EERB 4J2XA 1KGCE 3MRDB 5DJ6B 3VFUB 3BEVB 2SEBA 1X6LA 2NLJB 4LRNH 5JIKA 4ODXA 4NUJA 1OAUL 2A6IB 2GAZA 3HAEB 4NQVB 3RKDD 1XR9A 3P9LA 4D0DA 3BPCA 4JM2C 2ED7A 4FQLH 3KR3H 4DWHA 5ICYB 2PW2B 4YLQT 1ROWA 4JVUA 4DEPB 3QQ4B 4BKLA 3E6FB 4FTVA 3L7EA 4QHMA 1NBVL 5HGBB 3QEGH 2X42A 1FG2A 4WFED 5T3XE 2P45B 4PGEA 3BUYB 4FQHB 2D3VA 3D18B 4GOSA 4ZO6A 1FJ1B 2BK8A 3FTGA 2VWEE 5FB8A 4HBQA 4G7YL 1H5BB 1UVQB 2IPTL 4OQTL 5I76B 1VKXA 2CDFB 4WO4D 3WKNA 4S1DD 4F33A 2PETA 4M7ZC 3DMMA 4U1MA 3HPJB 3KJ6L 4PRBA 4J4PC 5I75B 3RY5A 1BJ1J 2DQCL 4QRRB 4YFLI 5A3IC 4ONFH 4CDGC 4X99B 5T3ZE 1T20A 4JPWH 4FXKB 4R3SA 1F3RB 4P59H 1KB5B 4PUBH 1XT5A 4X8JB 3QQNA 5I1KL 4OIAA 1U8LA 3QDJD 4ZFZA 3DIFA 5J4MA 1FYTD 4DN4H 3O2WL 2V17H 3MYJB 3ZDZF 5EU5A 1S8DB 5EZOH 3T3PE 4BUGA 5KVGH 4YIQA 1IM3A 4NQXB 1NCCL 3C8HA 1XIWD 4KKLD 4GKZB 3QUKA 2R0ZH 1T6WA 1N5YH 4ZSOE 3UEZA 1DUYB 1S7RA 4MB3A 4IRJB 3UJIL 4JO4L 4MCYB 2NY2D 1QTYT 2NY7L 1DQJB 3V4UH 4MJ2A 5DS8A 4ZFFA 2R0WL 4KI5D 5E7BA 3WL9B 1MCPL 2NY4D 5IVOA 4P46B 3TO4C 2XQBH 4YO0A 4MSWB 1AI1L 3BPLB 1W2KT 2VDKH 1TZIA 2NY3C 2OR9H 3HG1D 4OTXH 5IMLB 1A6UH 5C0IB 1NAKH 4JFZL 1UXSB 5EO9A 4XCCH 2D2OA 1YPZA 3LY6A 4XP4H 3CZFB 3RDTA 3U6RB 5DRZA 4L4JA 1FZMA 5D6CA 4KJPD 1YECL 3HMWH 5DYOB 4KI5F 1J1OL 4U1NB 7CGTA 1CU4H 4LRIC 3RUGF 1SYSB 4F7EA 1JVKA 1QBML 2GY7B 3ZYJA 3ULUH 2HWZL 1EDQA 4NHCL 5HGHA 4M8QB 1KC5L 2BCKB 4Z0BL 5FCSH 2Z9TA 3KJ4B 4D8PA 2I25N 3WXVL 1K5NA 2V5TA 5GS0H 3UPRA 1OWWA 4UTBL 4HUVA 3INUL 2ZJSL 4LNRA 5CZXC 3V4PL 3ULVL 1ZLWK 4NOBA 1MJ7L 3CFJB 4HG4K 4H1LG 4PGCA 3U4EA 3M1BA 4PJEA 1R5IA 1BZQK 4LU5H 3WFHA 2ORBH 3WDIA 4E41B 2NY5H 1Z0NA 4L4VB 1U36A 4Y4KB 5AWNH 1S9WA 1TVBA 5D7IE 5DUML 3IU4H 4DGYL 4JPIB 5JO5B 2PCPA 5I8OH 1Q9OB 5JHDD 4M5ZL 3KPRB 4LSTH 1NGZB 3VGAC 5BQ7B 2QKIB 2VLJA 4ZFOA 4OFYD 2X89A 1UH4A 2OL3L 3FFDA 3ET9F 3AREC 1K2DB 5FO8A 5I15H 2P5EB 3RA7H 1H8SA 2P8MA 4D2NA 3SKJL 5CILH 5ALBL 5MERA 2VC2L 4KJWD 3ULUE 3O0RL 4LVHC 1IE5A 4G8GE 2AABH 3CK0L 3WN5A 4CADA 4APQA 5I1AB 5BJTA 1ZLWH 4OLWH 4HS8L 5EU6A 5CEXB 3UTPE 4QHKI 5TJWK 5BV7L 5FDWA 3T1FB 2W9LA 4I8DA 1ZHNB 1QHPA 3ARPA 4E5XB 4UAOB 1V8HA 4R0LB 4FP8L 4QY8A 3QDME 4JCMA 1K8IA 5DUPL 4LAJH 4GAYB 1MCWM 4V1DE 1YYMH 2CRYA 1ZS8B 4MA8L 3HE6B 2Y5TB 4FA8A 3G9AB 1FSKB 1YEJL 3BE1H 5F7MC 3MA7B 1IGIL 5DD3H 5CJ5A 3U4AA 1B0RB 5GZOD 3GRWL 3KPTA 3MJ8A 4MNQA 1T1WB 2DLFH 2W38A 3TPUB 3I75A 2OXGA 4HZLA 3WFCH 4OZGA 1A3RL 3SDXF 1PYWB 4LASL 1RK0A 3HI1B 3HKFA 5EZJA 3F62A 1HHIB 1PG7H 1WTLA 4FQXD 5KJRH 4RX4D 2C7UA 3ELAT 4Z78A 3ES6B 4WGVB 1CT8B 3VXOA 2IQAB 4KFZC 3MXVH 1OAXL 3MRCA 4H0IA 2H2SC 2MTPA 1ZGLP 2BSRA 2R0KH 1FNHA 4F9LA 2X4TA 4YHNB 1F2XK 2VXVL 1GGTA 4DZ8B 1A7PL 2HJLA 5JOFB 3EFFA 3FB8A 4JPKH 5HJ3A 5C07D 3KNBA 4AT6B 2FD6L 4ZNEA 5F70A 3K4AA 2MPAL 4PGDB 2LTQB 2P8LB 3GSXB 2AV1A 3SKOA 1N5AB 1SMOA 3DXAB 3BQUA 4U1LA 3O45A 3ZDYE 1A7BA 1PVHA 1F8TL 1T1YA 4F8QA 4KK5C 4OAWB 3RPIA 5FKAA 4XXDA 2NR6D 3AAZA 2XXCB 2X4UA 1P2CA 2XN9B 2FEDC 1A7RH 4XP9L 4P3WA 4FHBD 1I1RA 1FFRA 1WSST 1OAZL 4AYFA 4YWGL 1AY1L 2MQCA 3EHBC 1A7NL 4JFYB 5CP3H 2HYMA 4RQQA 4JY4B 3WDHA 3LKOB 4F15B 1AJ7H 5J57B 3OKEA 3TZVD 4IHOB 3ZLQC 4X4XB 5EG6C 3C60B 2JJVA 5HYJB 2IGFL 3QUXA 4X7SL 3TYFB 5MENE 2FHFA 3EGSB 4YDKH 4Y5XC 1V7MH 5DVNA 1NL0L 5T3XD 1OW0A 3VG9B 1KIPB 1QLRA 4Z7WA 5D7SL 2BY0A 4Z7NF 5JR1H 2VO5A 4ZUUA 1I8IB 3RTQC 3T08A 5LQBH 5AAMA 2KBGA 2IG2L 3IFNL 1SM3H 4CAGA 1YEFH 1T6VN 5CSBA 2YD7A 1MPAL 3K0WA 1G7QA 5FKPA 1KUMA 3S3PA 1CGSH 3FQTA 1T2QL 1LO0L 1ZANH 3BZEA 3FONA 4G6JL 5I30H 4P9ML 1YNKH 4GRMB 1A1MB 3WO3B 1BFOB 3U9PH 4PJHB 1U42A 3PWJB 4UT9L 3EW3B 2X4OB 3TT3H 4LBEB 1J86A 4HIEB 3B9DA 4V2BA 2D7TH 3FFCD 3HPLA 4K3JH 1OTUD 3A67H 4KQ4H 1XH3A 4N0YH 4R26L 5D2NA 4OCWH 3VFWB 4MA7H 2O5ZL 3IDNB 1MCHA 5BS0B 3QCUH 3THML 5L2KA 3T0DA 1S7WA 4N0UE 3QUML 5TDNB 5FCUL 1XF1A 3SDCB 4S11A 2EIEA 5CFHA 1E4JA 1YEKL 2K9UA 1RUAH 4Z7VE 1FO0L 5TDPB 3ZHKA 3BDXA 1K4DA 1MUJA 4ZS6C 2FWOB 1J87A 1OGAB 1CL7L 4MJIE 3S34L 4H1LB 4OQTA 5T1KB 3PGCA 4GG8A 5AEAA 1PKQE 5MI0C 1DQTA 4UBDC 1GHFL 4YEFA 2AV7A 4L8DB 3TN0A 2XFXA 2CKNA 1F6AA 3IJHB 5DDHA 1MJ8L 1ACYH 3MRIB 3V8OA 4IMLA 1TJGH 3L3HB 1G0DA 4M62H 4EXKA 1J0HA 5FYJH 2AQ2A 1E6OH 2Z8RA 3O9WB 4B53A 1KFAL 2VAJA 2BMKA 3AXLB 4FFWD 3V6ZA 4P2CG 3BT2H 5EBLB 3ILPA 1XFPA 4TNWF 4M4RA 3UTZA 1OAYL 2ZKHH 5F88B 4NJAL 1I8MB 2A73B 1QBLH 3WHXB 2HAZA 3QIWD 1ED3B 3QCVL 5I1GH 3MLTA 4GW4B 3BD4A 2B0SH 4KHTL 4G9FD 4XVUC 3WXWH 4XBGB 3SQOH 2FHCA 4WHTA 2E9BA 3TVMC 2CXGA 5KZCD 1A6AA 1IAOB 3BAEL 1H0DB 2VR4A 2NX5B 4RZCB 1HK6A 5IHUL 2YD1A 4LLYB 3MC0A 1T04B 3L5HA 4GKSA 3TV3L 4BSWB 4LVNC 1DN0A 4N0CD 1G7HB 5HVWA 3Q3GA 4MWFB 1FLTX 1KCUH 3LRHA 5K9KB 1U3HC 3BP6A 2C1PB 2BX5A 3DECA 3EDJA 3O6FD 2JKXA 5GZNC 3FRUA 4YGAB 5D7KE 1Z3GL 2OX5A 3KPOA 1GYAA 5HY9A 5JXAL 5HXMA 2OM5A 4KXZI 5FYJE 4F57L 2WBJC 3B43A 4HXBH 4PJ9D 3QUYB 1U6AH 3QIBB 1ADQL 3FN3A 3RKDC 4J8RA 1A02N 4NQDA 1ETZB 3OR7A 4ZUVA 4XWGH 2F74A 1P9MA 5I1DA 2MSPA 3BP5A 4GRLB 2HKHH 3QNZB 4NP4H 5HHOB 4I48B 3U4BL 2BJMH 3HNVH 1LO3H 4LCIL 1MCCA 1XGQA 1BX2B 2EH7H 3V95A 1HI6A 2RCSH 4B41A 5DJXB 2CGRL 1HYSD 1JZ4A 5T1MB 4LEOB 4WFHE 1QFWM 1NFDA 1L6ZA 3QDGB 4PP2B 2HLFD 4WO4C 3RZWA 3I6LD 5TF0A 3WMSA 3BJ91 3TBWB 4O58H 1BP3B 1P5VA 3Q6GL 5F3HB 1CK0H 1KJMA 1BOGB 3JSSA 1NCAH 2J6EL 32C2B 5BZDB 3ULUF 1I3RA 2FSEB 5GSRB 3UBXG 5D6DA 3GSOA 4JY6B 5IVNA 2XYCA 3D0VA 5E2UL 1A7OH 4MAYA 5FHAH 2OL3A 3MYZA 1F4XH 4HIXH 5DRNA 1DANT 1G6RL 1A6TA 3HR5A 1MHHB 1QR1B 4UU9A 5FEBA 5KTEL 4XP1L 1YPZE 3O8XC 1QFOA 4QLRA 4NKDA 2DDQH 5JDJA 1ACZA 2HFFB 2ARWA 2F8XC 2MOVA 3NZHL 4GMTL 5DF0A 1DE4A 4XVTL 2BERA 4KKLC 1XIWC 1TCRA 1Q9WA 4WUUD 3HI6H 3H0TB 4QRPD 4M7LT 4XHQA 2WMPA 4XGZB 4I4WA 1WAAA 1LEIA 4K9EL 3PUCA 4RMQA 2A9NH 1XGPB 4JO2H 2NY2C 2VL4A 4FQIH 2ZOLB 5L88L 1KIRB 4N1CA 4J1UB 4KI5C 3IS0X 4HFUH 4TUJA 2NY4C 5IF0B 3F7YB 1L0XA 5EORH 2P5WB 2CKBB 4HWBL 1RULL 3IETB 3ZE1E 3TCLB 3IYLW 5TDOB 1FNSH 4RA3A 4D9QD 1MLCA 4FFVD 3RGVC 5FM5O 5EBWB 4MAUH 5JMOC 2DLEA 2I60L 1F97A 4PJAB 1I9IH 3EFDL 3SE4C 1J0IA 2F58L 3PDGA 3RWJB 1EGJL 5CEZH 5ID1A 2VLLA 4KJPC 1CR9H 1WFUA 4Y4FC 5D93B 4NJ9L 4U0RB 3QEQB 1JTTA 5DJ0B 1KTDB 2OYPA 3BSZL 2VLJE 4ETQA 3SDDA 3QG6B 5INDB 1H9VA 1OTSD 4XAKE 4QTHA 4YDVA 2AK1L 3L1OH 5F7EH 3B9KB 3K8KA 3QI9D 2ADFH 1RVFH 5J13B 1YEIL 4HPYL 4PV8A 4GXVH 1X5FA 3PDOB 5LBSL 1DANU 3NZ8A 4E0RA 1E4KA 4YHKH 5A16B 1JZ6A 3PE9A 4HGKC 4Q2ZA 5T1LB 3SEPA 3PWVB 4PLJD 3G08A 4QRTB 1MNUH 3EOTH 1D5MB 5EU6E 4LL9A 4G3YL 3FQXA 1FN4B 4LLUA 5D1QD 5ISZA 1ZMYA 1JGUH 4KDVA 4S1RL 5FA4A 2XZAH 4EI6B 3ARTA 2YD3A 5INCB 4AJ0A 3WKMH 3HE7B 4OLYH 5E2VH 4P4KA 4D94A 3EO1A 4Y19E 3P11L 1MF2L 4BELD 1I7ZA 2NW2B 5JPNB 3E3QC 1R24A 5E70A 4EN3D 2DWEA 4LVEA 1WF5A 3HUJA 3RVUC 3QP3A 5CEZE 4K07A 5ID0B 1JRHH 3F7VB 5HHNA 3MRKA 3CC5A 4LP4A 4RMTA 5HYIA 2OZ4H 4PJXF 3U30B 1RK1A 1S9YB 1BF2A 3OKLA 1D3CA 4OUUA 4MNQE 5KS9F 4PTTA 4MX7A 4NZTL 3UZEA 3S4SG 1QFWI 1PGRB 3L3OA 2MCG1 3KYNB 1MRCL 4OZGE 5L9DL 3SO5A 4M8VA 3BXNA 5CINH 4AEFA 2NTFA 2NZIA 3RAJL 3W0WD 4A2MA 1ZSDB 3D3VB 2GJZB 2A83B 3DUUB 4DFHA 4K8RL 5FGBA 1C5CL 4Y2DB 2ZG2A 5B3JF 5JOPE 4U31A 3W5MA 1T5WB 1JGDB 3VD9A 4M9PA 2YA0A 3NIDF 2Z93B 4M1GL 3GKWH 4NNPL 1R5VB 2PO6C 3KPQA 4WI4A 1KENL 2JELL 2OBGA 3U48A 4LCCA 4NO2A 4NZJA 2FECL 2G5BA 4WDIA 4RFNB 3BRDA 4MD5A 4MXWH 2F53B 3B5TA 2MMXA 2ZUSA 3CAFA 3LS4H 3OWEA 3STLA 1IAIM 1YQVH 4NWUL 5GZOC 4LVOB 3GNML 1SJHB 1W8OA 2WINB 2EICA 4LARL 1Q94A 3KYOA 3GSVA 5C0CE 5H2BB 1U93A 3HN3A 4YK4C 4L3EA 1RIUL 4XMLL 3ULVC 1AGFB 4CVXB 5JW3L 3VXMA 1OAUH 4FQXC 2HVJA 2JJTA 4P23A 3DV4B 2DQGL 3K81A 3QFDB 3QUMA 4IRZH 2UVEA 4JRXE 4MD0B 1EHAA 5MP6H 5EU4B 5DZOA 1FO0A 4UB0L 4JRYB 4TTGA 2A2QT 4EI5B 2EYTB 3BGMB 1QEWB 5E7FA 3SE9L 1DQQB 4FTVD 3TBTB 1WT5A 4G7YH 5EOTB 4FG6D 3MXWL 4OQTH 3PJSA 5DVLA 1LP9B 5FK9B 1RI8A 4RNRB 4Z7WE 1GPOL 3K1KC 1N59B 4Y1AB 2AJYL 3JTSA 2BY3A 2DQCH 5IW6B 3QQ9D 1RZFH 3I02A 1QSFB 4DTGL 3RKPA 3O3DB 3WV0A 5ELIA 5FYJD 2UWEA 5CSZA 3DUHA 2VZ3A 1G7IB 3PXHA 4PJDE 4N8CL 2D7MA 5I1KH 2QEJA 1NC2D 4YHPB 4Q9QL 4UUJB 1D6EB 3O2WH 4KKCD 2UYLA 1I7TA 5ANMA 3TZVC 1TVHA 3RL1B 3D69B 5IWLC 3MRFB 2PXYB 5D2NE 3WJLA 3LEXB 1NCCH 1S9XB 4OFIA 3VFNA 1UKQA 1HHHA 5D7LA 1G7LA 3KYKL 4KDTA 4TUKH 4OZFA 3UJIH 4GRWB 4JO4H 1I8KA 4UDTB 4IM8A 1W0WA 5JPMA 1JNNH 3BGFC 4G6KH 1HINL 1C1EH 4WFHD 2FL5B 4N90E 4HDIB 2DM3A 4FQQA 4JB9L 4URTB 3FQUB 5FYJU 2HJKA 4DCQB 2ATPA 1AI1H 5EUOB 2EKSA 5H94B 1QQDB 3OPZL 3PNWA 3JZ7A 4PJIB 4MVBD 2EDEA 1VADB 1N64H 3VRJA 4LSUL 2G75B 1A9EB 4JFZH 4G9DB 4PRAB 1H3PH 4YC2B 1FDLL 2CIKA 5GGVL 1JZ8A 5E6IB 2FB4L 5KW9L 3K7UA 4NM8H 2F54D 3S88L 2FBJL 2IJ0C 1MHCA 1YECH 4MNHB 1ADQA 4ZNCD 1I1YB 1JV5B 4X80H 5HYQA 1B0GA 3V7MA 1NFIB 2IADA 3FO0L 4GSDL 3VXUB 5DA0B 4JLRB 4PR5B 3RDTD 3BZ4A 4NHCH 4Z0BH 2GJ6A 4M1DL 4JAMB 3GHBH 3WXVH 5IB2A 1TITA 3BZFA 5F71A 3MFFB 3GIZL 4FQ1L 4QXTA 4O2CA 2BNRD 3KXFD 3NABH 2IC2A 4UTBH 5CKAA 3C6LA 3I50L 3INUH 2ZJSH 1LNUB 5L7XL 4EDWL 1U8QA 1JPST 3CXHJ 3MV8A 1NGXA 3TCXA 4HUNB 4Y5VB 5F8RC 1RUPH 5I8EA 3HLAA 3AY4A 1UKTA 1E27A 3HZKA 3L5IA 3MV7A 4XNQA 3KWWB 1UJTA 3C5JA 4ZO9A 2X70A 1H8OA 2CDEA 2XWTA 1DLFH 2E5EA 4W70A 2AJUH 5DUMH 4EDXA 2BVTA 1MFCL 1MCIA 4PRIE 1HOCA 4WW2A 5C0BD 3ULSA 3HB3D 43CAA 4FFWC 1C7SA 1G6RA 2VITA 4UT7H 1G7JB 5EUKA 1NLDL 5GPRA 4M1CD 1RZGB 1WWWX 3OB8A 1YA5A 4MCZB 3MRNB 1J18A 2OL3H 4B7LA 3TBVA 2H3NA 2EXYD 2XICA 3IDJA 1NGWA 3GEWB 2XI9A 2GT9A 2D7NA 1HXMB 1BGXH 3QIWC 3JWOC 3QQ3A 3ZE1F 3LKQB 1K85A 3SKJH 4MHHI 4GBXA 1JN6A 2HVKB 4ODUB 2VC2H 4NQDE 1RUKL 1V7NL 3PWLB 5C0FB 3O0RH 4PJEF 1ZA3A 2H8PB 3MA9L 3SJVB 4HHAB 3KPPB 3MCLH 4HS8H 3ROLA 1EA9C 4LAQL 1G7PA 2E7MA 5BV7H 3TBSA 1ZK9A 2V5YA 4HV8A 2XWBB 4FP8H 4JFFD 4JQVA 12E8L 4N0CC 3WLBA 5DUPH 2QTEA 4HWBA 3MNWA 3QJFA 2OMBA 4IJ3C 1UH2A 2Q7YB 5C08D 3ULVE 1OWRM 4TSBL 4MA8H 3O6FC 5KAQG 1J05A 2DWDB 2YPLD 3M8OH 3OXRB 1UM6H 5D96C 3DBXB 4CVZB 1CVRA 4YHYB 1YEJH 4G8EB 4MJ5B 4OZ4B 3UTTB 1IGIH 3FQRA 1KN4L 5JIPA 2OTUA 5E5RB 4NZDA 4PJ9C 3S36X 3DGGA 1R3KA 5ICXA 1MCFA 1WFTA 1GGBH 4HUXA 4PJBB 3Q5TA 1FVEB 5C3TA 1CFSA 4M4PA 1A3RH 3FT4A 4HUWB 1T03H 4LASH 4K23L 1KG0A 2E6PA 2X4PB 4PJGB 4AEIH 2OQJA 4PB9L 3C5SA 1BIIA 1WISA 4KDWA 2ZZUT 1A7QL 5IVXE 4GKOA 5LGKA 1S7UB 4LHUA 2OLDA 4L4TA 1UB5B 3RZCD 3IDXH 1HYSC 4ZDHA 4P3DA 4QHLA 4PYGA 4P5TC 1EFQA 2J8OA 2HLFC 1WBZB 4OIBA 3BHBB 3PWPB 4OV5A 2DQEL 5GRVL 4K94C 5FIEA 3AB0C 4MDJB 1XF2B 5GS1B 3KPSD 5HPOA 3FN0L 1MWAA 4Q6IA 5F21B 3E8UH 1PX4A 4O51A 1NC4B 1M7IB 1W0VA 4HT1L 4KKNA 3U2SA 2YN3A 1QLEH 5DURB 1I1AA 2W9DL 2FD6H 1QO3B 4JZOA 5TQ0H 4EBQL 2CDGA 2MPAH 1DBBH 3QFJB 1IGYA 5CJBA 1IJ9A 1EFXD 3OXSB 3RWFA 2EYSA 1HXYB 3ARYA 3RNKB 1F8TH 5KVFL 3MROB 1K3IA 5TE4L 1EIBA 4IS6A 3GO1H 4MXVE 3UO1L 5LXGL 5ILTH 2YMXH 3JTTB 5FECB 5IP4A 1AGBB 2AEQL 4N5UA 2CXKA 1B6DA 4X6FB 5TE6L 4CVUA 5DJCB 1OAZH 4YWGH 4UNUA 2FCBA 5JA9A 1A7NH 4S0TD 5JXEA 43C9B 3CVIL 1M05A 1U41A 4B50A 1UXWA 4PRNB 4P2OA 3KG5A 1ZLVK 2IGFH 3A6BL 1SBSL 4X7SH 1OB1B 4HEME 3QEUA 4R4FL 4YE4L 1NL0H 1D9KA 1RURH 3VFRB 1AP2B 3BKYL 5I2IA 1OT1A 4FFVC 5FFLA 1YNLL 3CX2A 3ILQD 5ISZE 2E9JA 4X7CC 2IG2H 3EAKA 3RQ3A 4X6DB 4YDLC 4XBPA 1MPAH 3LH2H 3QXDA 2V9TA 2IPKA 1G9NH 1T2QH 1LO0H 2YPVH 2YRLA 4G6JH 4EVNB 4TPRL 1J8HE 1BAFH 1DL7H 5J89A 3RL2A 4BH7A