3TBYB

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (v3p, y4f)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system/agonist
total genus 13
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbyB00
1CYGA 1UKTA 1MLCA 2E3VA 2QR0B 1M7DA 3MJ9H 3VRLF 2W9DH 2Z4QA 3EO0A 4P46C 1AI1L 1AQKL 5LBSL 4H88H 5D7JC 4CMMA 5CSZA 1Q9OB 1XH3B 1DANU 3W39B 5HYQA 3L3GB 4MVBC 3IFLL 3O2DA 4FQXB 4M3KB 1BX2A 1S7TA 4MXQD 4LU5H 3JV6B 2K9UA 4NBZB 4Y5VA 4HWUA 3PGFH 2E9WA 1WF5A 4NKIL 1JVKA 3RL2A 4XP5L 5K9QG 1XR8A 4KGLA 3GGWB 1IL1B 4TUOB 5SX5K 1NMAH 4FZEL 4NQUA 1YYLH 4ZUVA 4PJ5D 2XXMB 4OF6A 4TNWK 4PJIF 4KUCD 1T89C 1YQVH 3HMXL 5FEBA 1M1SA 3ARTA 4EUPA 3OPZL 1NCBL 3TWCL 3IKCA 1MUJA 4YFLF 2MPAL 2QQKH 3EOYG 4R97B 4MQ7B 5ERWB 3DYOA 5EBLA 1HSAB 3C87A 1I8MA 3MLSH 1T7WA 2VLRA 5F9WC 4F37F 1J0JA 4L3EB 4QWWC 3VFWA 4ZFOA 2GK2A 5D71H 4HH9A 4J23A 1AFVL 1P5UA 4P5TA 4QRTB 3AS2A 4AEIL 3RWCA 4DKDC 1KBGL 4XGZA 4BFIB 1ITBB 5C0BB 1AHWA 3O2WH 1FNLA 2G5RA 2H32H 3GSQA 4HULB 3ULUC 1CVSC 2JJUA 3S34L 2CDGA 3P4MA 4PREB 5CD5C 4MCYA 3HAEH 4CAGA 1YJDC 4L8DB 2Z8WC 1ODAA 2G9HB 3CCHA 1D6VL 3S3JA 4E42B 2IJ0C 1QNZL 4FQIH 2LABA 2DKSA 3DJ9A 1NCWL 4L9LB 4JFFE 4ODTL 2Z9TA 3QWQB 4HCRH 1RUQL 4HGKC 1KUMA 15C8L 3C8DA 5CKGA 1RFDL 3UJTH 3IGAB 2KZWA 1S7RA 3O0RH 4LLMB 1E28B 4JZNA 3A0OA 5BZDA 1CL7L 4P23C 1KJVB 1QSEE 5EU7C 2GQHA 5J3HC 2BNRE 1G7PA 3MLUL 2AJSH 3SOBL 1IFHH 4KV5F 5I9QB 1CVRA 4PJ9B 5CKAA 5I1HL 3LKNA 5D1ZB 3X3GL 1G6RA 4BK4A 3ZT6A 4ZO7A 3REWB 1RURL 3WUZA 3SDXE 3BRGC 3QFJB 2CD0A 2UYLB 3DURA 1IC7H 1I9EA 4Z7QF 5I8EA 1A6TA 4Y0GA 3RIAF 4DQOH 4RAVB 1TQCC 1DTUA 1LK2A 2NW3B 1NAKL 1MCHA 1U2HA 4K07A 1IGYA 2P45B 4LIQL 4OT1L 4XP6H 1BJ1H 3DETC 4J2XA 1MCQA 1YY9C 2ATKA 1KTLB 3PV6B 3P0YH 4LSVL 2ZUXA 3ZL4H 4PJIB 3QG7L 1OSPL 1Q0YH 1N0XH 4FQJH 2RHEA 1TZIB 3HAEB 5HYJB 1Z5LA 3S7GA 1EA9C 3RZWA 4HF5L 5C3TA 1EDQA 5FO9A 4U1NB 5DJ0A 3VMOA 4ELKA 5SWSA 2W60A 2ZPKH 3QDGD 5EBMA 2JJVA 2OXGA 2R4SH 4IRSC 4LDEB 3EFDH 4UDUA 4ZNEE 3ARFD 1UJ3B 4HWEH 1E27B 4U0QB 1K6QL 2H26B 4HKZA 2VLKD 2L4OA 3BP7A 4LLAA 2BVQA 3MCKB 1LE9B 1YEFL 3GB7B 4WI7A 4IRJC 5KW9H 5J12C 3VDAA 3KLAA 2P5WB 4JM4L 1DANT 4YIQB 1XR9A 5EORL 5ESAA 3VJ6A 4R90H 1U8QB 4NQDE 4UAOC 3MTRA 3QUXB 4G9FE 2G60L 1LO2L 4YAQB 2DWEB 3GHBH 3NVQA 5CP7A 4EI6A 1C5DB 2V5RA 3SDDB 1P6AB 2XTJC 1RMFL 4LLYB 1UQSB 3EYFA 1ZV5A 5HI5C 4G7YL 1GOGA 3IJSA 3W0WE 3WFCL 2Y7QB 1K2DA 2O93L 4KTEH 2YK1L 1P4BH 1F4XL 5DURB 4D0DB 5F7WC 1QEWA 5EFIB 1QFWI 4JN2A 5FHBL 1YEHH 4GRMB 3EFFA 3O3DB 4R2GB 4QTIL 1ZLUH 2PXYB 5C0IB 3QI9B 4G42A 3JWNC 3VD5A 3FZUD 1MIEL 4L3AA 4F9PC 2QV2A 4HS8H 3VGFA 1F8TH 5I1AA 3QPQC 1NC2B 5IQ9B 1SY6L 3O3AB 4L4VA 4PJ7B 1HI6B 1BZ9A 3PHOB 4LSUL 4NPYA 1WWBX 4XHJC 5C0AD 5ENWA 4UQ2A 2F74B 3ZE1F 2IALB 4ZAKB 1FNSL 4NM4H 2P5EE 5BCAA 2V5SA 1JV5A 3LRHA 3LDBB 3L7FA 4RISH 2B0SL 4XI5D 5MENE 4OD1L 1OARL 3CX5K 1P5VA 2K7PA 1P7KA 2A6JA 1FYTE 1NFDE 1D9KD 4WRLA 5HGHA 2P42B 3MROB 2SEBA 4WNQB 2OS7A 1YMHA 3RL1A 2E6QA 3H7BA 4RFOL 5AWNL 5L8LB 4PS4L 1T83C 5F97E 4XNZB 5CJQH 4DGIL 4N0RA 4NNXB 1HDMA 4J1UA 3VXUE 1U95B 1X5ZA 4DUWA 3SKNB 4HX1B 5IW1A 5BW7C 4H8WC 2J6EH 3RVVD 3BSZH 1O5DT 4JDVA 4F37K 5DI8A 1WFOA 1NH6A 1A6WL 1UXWA 4ZSOA 1BD2B 3QCUL 3RX8A 1FIEA 3B4NA 3F12B 4C56D 2HJLB 1A6AA 3FB7A 3QZWA 4JRXE 4JKLA 3MR9B 1L7TL 3T8XA 5T1DH 2DL9A 3CZFB 1R5IA 3PIQB 3U7YL 5K9QI 4M6ML 4QTHA 2WWKT 5GJSL 1S9XB 4IJ3B 2HVKA 3LV3B 3K74B 1QFWH 3TPKA 3BPLB 3MODH 1TCMA 4U1IB 1GGUA 4R7DB 5T1LA 1T4KB 1BHGA 1AI1H 3QHTC 1AQKH 5LBSH 4G80A 2E8ZA 2HJKA 4JO3H 2DD8L 3EZ8A 1VFBB 5EULV 3IFLH 1Y18B 2FH8A 2DWDB 4IDJH 4HV8B 4YUEL 3MRBB 4C59B 4OV6F 4P9MH 4EXPX 3QAZB 1I9RH 2YUXA 4V1DE 1G1YA 3BPOC 4KY1L 4CVXB 5BRZE 3VXME 3AY4C 1P4IH 1HQ4B 5EPMB 4YDJB 1TZGH 5CWSB 2ED7A 4M3JA 1JHLH 2BSRB 3R8BB 1PX3A 4YXHL 3MOAL 3IAGC 4NRZA 3QXVA 5M94B 4R4NC 3V5HA 1DZBA 2IBZY 2HT4C 2X6MA 1KLGB 4GLRH 4LHUB 3HLAB 1OF2A 3NFPB 1J10A 1A8JH 3BMWA 4RNRB 3ZDYF 1MFDL 1DVFD 1NCBH 3P73A 4FP8H 3TWCH 3FFDA 3FHQA 3LSOB 4NHUB 3PHQB 1HXYA 3IYLW 1F3JB 1PDKA 4GXVH 1ZSDA 2YD3A 2N7AA 2NNAB 3OJ2C 4NKDB 3VFUA 3RIAK 1G6VK 5CILL 1MHCA 3VD4A 5CZXC 4QCIA 2VYRE 3MMEA 5DJ6B 3D25B 5CGYD 3PWNA 3F65A 1KCUL 3TIEA 1KBGH 5J0BA 4DUXA 3H9SD 3UTTA 2C1OB 4PRAB 4I5BA 1WSST 4HUUB 3C09C 1FP5A 5JDSB 2ZSWA 5C0DA 3RQ3A 3S34H 5DD0L 3IVKA 3B6SB 5IBLC 4RIRB 3ILQC 1QQDB 5I18L 5CGMA 1YDPB 2OP4H 4XMKL 8FABB 4PD4J 3KPLA 4F7EB 1S7VB 1AGCA 4PTTB 3MOBL 1QSEB 4U49A 2NW2B 1I1FB 4JY6A 1FPTH 15C8H 5J89A 1URLA 5F96H 2OTUA 4HWBL 1RFDH 2EDJA 5CJBA 3QXAA 5JW4M 1VADA 1A6PA 1MIMH 3S96B 3BO8B 4Q6YA 1ZLUK 3EO1A 1CL7H 1XT5A 1JYXA 4L5FH 3JWOL 2PN5A 4G7VL 3MLUH 5H2BB 1H5BA 3K80A 3SOBH 1JPFB 2HKFL 3SDXB 2V2TA 3CGTA 4CN6A 2ADJB 1UM6H 3GSXB 2QHRL 1A4KA 1A7QH 1YEGH 1NFDF 3SDAC 5EO9B 5I1HH 5ESQB 5CCKL 3X3GH 3WHE0 1PY4A 3BHBB 5JPMA 2A9NL 3UBXI 4XAKD 1RURH 2WUBH 4FTVE 5GGSB 4G8GA 3FB6A 4NZTH 5ISZA 5IB5B 1CFNB 4PRIE 1KENH 2ZOKB 4OLXL 1MVUA 3F58L 1X5LA 2OK0L 4M7ZB 5B38A 3KPTA 1ZVSA 4OT1H 3U30C 1DQTA 1Z9MA 4MXWL 4GAGL 1V3KA 3FT2A 5IW6A 1E6JH 2HG5A 4YR6B 3U1SH 4HWZB 4LSVH 5C07A 1AD9B 1FCGA 2AJVL 4X8JA 3VWJA 1ZHBA 1OSPH 3MUZ1 2PTUA 5DK0A 5F1OB 4EDWH 4KI5D 4HF5H 4D9RD 3TZVB 4KJPD 3S5LG 3P9WB 4P9HC 4WU5A 4DGYL 4WUUD 3PL6B 4EN3A 4M62L 1YNTA 1BECA 1LO5A 1OT2A 5J1AA 3WFDH 1RULH 2VJXA 1KCKA 1OHQA 4GRLC 3O9WC 2AXFA 3RY5A 4NQDB 1VFAA 4G9FB 3S97C 4E9LA 5HBBA 1CTNA 2VLRE 2ZSVA 5I74C 3X3FL 1DBAL 5T3ZE 1YEFH 2UVEA 4RMUA 2VH5H 3HI5H 3HHRB 4XXCC 5IVNA 4JM4H 5HYSA 1KCSH 3SJVD 5EORH 4OGXL 3U4EA 4OF5A 1NLDH 5D2LA 5FO7A 1MCBA 3HNSH 1FNEB 1ED3B 1L0YA 4U33A 5HDQL 2AK4A 3W0WB 2GTZA 1MWAL 4GBXD 4JPKH 2FX9L 2X4QA 3V6FA 4OGAC 5B3JF 4M43H 4XPTH 1MPAL 4XCEB 2ZWLT 2VNCA 1RMFH 4F7TA 3DTXA 3FB5B 4ZS6C 2R29H 5GS1B 3FT3A 1MHEB 5GS3A 3U83A 4OD2A 2YPKB 4S1QH 5DHYB 4G7YH 1MRDL 5IVZA 3S9DB 4I2XE 4N9GB 4W4OC 1RJZB 2XQBH 1T6WA 1F4XH 5I8CA 1WAAA 3V0VA 3AUVA 1JNLH 3QDMD 2AV1A 5ALBH 5FHBH 2I27N 2OBGA 4ONGH 1II4E 2P8MB 4NKMB 1S9YB 3P4NA 4JHWL 4QTIH 3G6AB 5D8JH 1H3PL 4P46D 4XH2A 1MIEH 4DGVH 4NUGH 43C9A 5D7JD 2P5EB 5MENB 1X3DA 4OCXH 1FYTB 1NFDB 4WHTB 1XF5B 4LSUH 4QNPE 4Q7DA 3RPKA 4U2YA 4MSWB 5DJAA 1D5BA 4EQ2A 1YEDA 4JFXB 2C3GA 2YD4A 3JWDL 1FZJA 2B2XL 1C12B 5D6DC 4XMLL 3TVMB 1OARH 5EZIL 1BAFL 3MRHB 3VXUB 1SJEA 3MLPA 4OUUA 2XG5A 2R0WL 5EU5B 3RZCB 3VXSD 2GKIA 5IEKB 4MMZC 1JWMB 2NX5E 3BUTA 2IAMB 2Y5TA 3CFIC 3NACH 4BH7B 3MGOB 1P1ZB 4JO1L 5HY9A 4JRXB 4QHLB 1QR4A 1QYGL 2PO6C 5JUEH 3MJ7B 2FSEA 2Y07L 1A6WH 4PJAA 4WWKA 3KYMB 5A3IC 3QCUH 4MB5A 4EQ3A 2EDHA 3BUYB 1BVLB 3DV6B 3ROOB 3K2MC 4D3CH 3S4SA 3ZHKA 1U9KA 5D6CA 1N64H 1MI5A 4Y19D 2R2EB 3BRFA 2NY0C 4AL8L 4M6MH 3NA9H 4C55A 4L4TE 1S7XB 3T0EA 5IFAL 5DEFA 1G9MH 1RPQA 3CDGB 3LH2L 4QKXB 3MV9A 3MCLH 2FX8L 4PJDA 4MDJA 3IFPA 3CFJA 4V1DB 3ARGC 5JPNA 2Y25A 4B53A 1JNHB 5BRZB 4IMKC 4OIBA 3BI9X 4N1CA 4AIZA 3EYVB 1MAML 3SKOA 5K33A 2R1XB 2CIKB 5DVNA 5DSCB 2BVTA 5DJDB 1P6FA 3GJEA 3VH8G 2I9LB 4G6KH 4KY1H 4QRPE 4I18A 4S1SL 1T7YA 5D1XC 2PW1B 5E2WH 3R06B 3S3PA 1S5IL 5K59F 3CDFA 5E5UB 3MOAH 1RIVL 1U8NB 5J3HD 5EIVA 3WIFA 3TYGL 1QOKA 3HUJA 4EXKA 1UH3A 5JHDD 2H3NB 4OB5L 2LQRA 1I9JL 1HNFA 1ZANH 4UTBH 2VL4A 5CFHA 4AG4L 3O2DH 3FTGB 1VHPA 4NIKB 2CLZA 3B9VA 4KJYA 3NPSB 3LAFA 4O2EB 1W0VA 3HCVA 4XXDB 4Y16A 1I85A 4FFWD 4FQ2L 2A38A 1ZT1A 1DLFL 5FFLA 5GGRY 2GSGA 5T1KD 1KCUH 4N0UE 2ICES 5KBNC 4B50A 2AABL 1T5WB 4HFWA 1CXIA 1QRND 3O6FB 2HMIC 1NBYB 2CGRL 35C8L 4MAYA 5DD0H 3HMXA 4OZGF 2ITDA 3WJJC 5C86A 5I18H 3QIWA 1QFUL 3RNQB 1QBMH 5T3ZH 4OIIL 3DGGB 4MNHA 3TPUA 4Y4FD 4ZOAA 3MOBH 4QGTA 2ED8A 1QHPA 1EZVX 5CLWA 1X9QA 1JI1A 3FCTB 4IRSD 5ESVA 4HWBH 5I8KL 3RWDB 1LNUB 5L2KE 1XGTB 4S11A 4UMGA 1CE6B 2J88H 5ADPL 5FOBA 1ZGLA 4QNPF 3UJJH 2F8XC 1VACA 3OKKB 4IRJD 4PV8B 3BYTA 2HT3D 1MLCB 4G7VH 1D6EA 4JG1L 1NBVL 2XZAL 4JHBA 2Z4QB 3EO0B 3SKJH 3FFCA 5GGUB 3MRDA 5GIRB 5CSZB 1T04A 4G6JL 4N9OB 5LCVH 4PRIB 4PJFA 2F5AH 1K3IA 3WHE1 4BFEA 3MV8A 3U2SA 4CNIB 5CCKH 5IB1B 5LGKA 5DFTA 1T7XA 4PJ5E 1Q72H 3RI5F 1BX2B 1S7TB 1RZKC 2XTJD 4Y5VB 1MREL 1SJXA 2FO1A 4PJBE 1INEL 5HI5D 1UM4L 5IK3B 2ESVA 4Q6IC 5H94A 3RX5A 1T66C 4IOIA 4F8QA 5C09E 2OK0H 3VXOA 2ARJA 3K8MA 3NCYP 4J6RL 3GMNB 4NO5A 5KVDL 2PKDA 4MXWH 3SE8L 4OV5A 1WFNA 5D7LD 3MRLA 4Z0XB 2XTLA 1CGWA 2NY5H 3RDTC 5JOEA 4EUPB 2Z8VC 4TSCH 3WUWG 1DN0A 3HRZB 1ND0A 3IKCB 4JFPA 3CX5J 1KJ3H 3QPQD 4JFDA 5T3XE 2JIXD 3I2CH 5EBLB 2H1PL 3BKYH 3QB7C 5JW3H 4Y8AA 4Z7VE 2VLRB 3ARDA 3ARRA 3O2VL 4LDLB 4AMKH 5EU4B 3EOTH 3SCMA 1OCWH 4NO2B 2Y4SA 3QEGH 4HH9B 1ZGLP 3BP6B 3EOAB 3GBNL 1CFTB 4P5TB 1OD9A 1MFCL 1A7NH 3MYZA 3RWCB 4OTXH 1VKXA 5ICZA 3BZEB 4ALAL 1AHWC 2XKUA 2AVGA 1Q94A 4P59L 3QNXA 4OGXH 3MLYH 4AM0A 3CVIL 1GHFH 1ZOXA 3O4OC 3JV4A 2EICA 1UM5L 5AUMB 2ZUTA 1X5YA 2YD5A 4KJQC 2YA1A 4P2RD 2JELL 1MWAH 2Y23A 4I2XB 4PUBL 2D7TL 4AT6A 1B6DA 3V6OE 1WIPA 1WZMA 1YEIL 2XFXB 4IMLA 4J3SA 1JIBA 2MSPA 1HHJB 4IHOA 4U1MA 3CUPB 3V6ZA 3ARZA 1MRDH 2LAAA 3M17A 3FMGH 3C8KB 1HEZB 4PJCA 1EIBA 5L9DL 3VGAC 1JPGA 2VKXA 2DQDL 3TBVB 4M61B 3MZTA 2FRGP 3MUY1 3Q5YA 1XF1A 3LN9A 3TLRA 3NTCL 1I4FB 2ZCKL 1MCKA 1BJ1J 4Y4KC 3LKNB 1RUKL 5F6HI 4RQQB 1WEJL 1J7VR 1ZEAH 2J5LC 4NCDA 4N90D 3G9AB 4PGZA 4U0RB 3SQOH 2NX5B 3DURB 3JWDH 2IPKB 2B2XH 1A21A 1MELA 4XMLH 1A6TB 4YHZL 4MNQA 3QO0A 3QUZC 1BAFH 4OF3A 5HVHB 1TQBC 5IB4B 3ULVE 4HT1H 2JK5A 1CGYA 2AJXH 3ALWA 3ZSSA 4YHYB 2ATKB 4R4ND 4O5LL 3MV11 3U4BL 2DQGH 3UC0H 3VFGL 3G5VB 5JXAH 2HT4D 1JBJA 2E7LA 4LK4A 5F9JA 4G43B 4A6YL 3LRSB 1VB9A 2AERT 2HWZL 2VWEE 1NDMB 1QYGH 4JQVC 1Z5LB 4LFHG 1NPUA 2DQEL 2Y07H 4R0LB 5L0QC 5D93B 2I25N 4L4TB 1WISA 4LQ1A 4UILL 4K3JL 1SY6A 1TVHB 4PB0L 5BV7H 3AFLA 3EUUA 5JORB 1OGAD 5CZXD 1B4JL 5GS0D 5KVFH 1I1CA 4R26L 3FAXA 3QIBA 4PY7B 4KMTL 2MMXA 4IS6B 3GMOA 4HKZB 1KLUA 2BVQB 4KTYA 5A1AA 4KUCF 4Z77A 3WS6A 1WBZA 3G08B 2FX8H 4PJBF 1XR9B 5ESAB 3V0AC 3BGFB 4G8IB 4X7DC 3MNWA 3AAZB 1AR1C 4NBYB 5TE4L 1S9WA 2D3VA 4QRPB 2W0KA 1X7QA 3ILQD 3LEYL 5C6TH 3HE7A 4KRPB 2VZTA 4G5ZL 2EYSB 4UOJA 2QBWA 3EYFB 3NCBB 1IRAY 1K2DB 4JJ5A 2CDFB 4PRDB 2RJMA 5CSBA 3PDOA 1QEWB 1B90A 1T21B 3EIFA 5BZWB 3U46A 5HGDA 2VZVA 4Z7VF 3STBA 5DDHA 1RJLB 2F19L 5KSBA 3F62A 4Y8DC 3I6GB 3CFDA 5TGBB 2Y36H 3E8UL 5I1AB 3RI5K 5HYIA 2ARJQ 1JPTL 2BX5A 2XKNA 5J6GB 1BZ9B 4UBDC 4LVOB 5HGAB 4I77H 1Z9SA 1OM3H 4MJIE 1V5JA 4N0UB 3M07A 5ANME 1RIHL 3ZKND 2GJZB 1FNGA 3QIUA 2QADB 4Y4HD 5CIPA 4MD4A 5BV7B 2HLFC 2QTEA 3OF6D 3QCVL 3T1FA 4OCWL 4FQ2H 5ID1A 2A6JB 2IG2L 5E6IB 3HZYB 4KQ4L 2SEBB 1GOHA 4KVCL 2J8UA 3PWJB 3H7BB 2AABH 3MUHL 5HI4C 5HHVL 5H35A 2VLMD 2Z31C 4K23L 4L8BB 1DUYA 2L0DA 1U0QA 1HDMB 4GSDL 3R0MA 1QLFA 1Q8MA 5BQ7A 3LEXA 4FXKA 1PX4A 1XF2A 3L95A 1QFUH 1S78C 1UXWB 4HG4K 1R5VA 3T4AB 3HPLB 3OG6B 1T0MA 5FA3A 4LL9A 4AEEA 1HILA 2DIAA 1OB1B 2EO1A 2MQ3A 1CWVA 1FRGL 3RWGA 1E0OB 4AQOA 3O9WD 4NQCA 4X6DA 1UGNA 4MXVE 5DJ2A 4PJAE 2XN9E 4QTHB 3QQ4B 3VRIB 4NRYB 4TTGA 4LSPH 4PJEA 2HVKB 1FYHB 4LBEA 5D2NA 3WKMH 4KPHH 3DRQB 5DJXB 3EKCA 5TDOB 1Q1JL 4I48A 4PJBB 1RUML 1SEQL 2ZG2A 2F53A 3T0EE 4M8QB 4HD9A 1A7BA 3ULVF 4S10A 3T2NH 4PB9L 2XWJA 3TT3L 5AYQA 4R97C 5E8DL 4PJDE 1LE5B 1IVLA 1HCFX 2ADGB 2VXQH 1RSFA 4ZS6D 1MREH 1SJVA 4MB4A 4TULH 1INEH 1JWUA 4GJTB 1IAKA 1NUGA 3VFOA 1HHGB 3VH8B 2AGJH 4F58L 1EEZA 1UB5A 4K71C 4JCMA 4NRZB 3K0WA 3WSQH 3KLDA 5TPWH 3SHSA 5JA8B 4Z7VB 3QUMA 5IHLB 4TVSa 1AP2A 3VXQA 3P73B 1TJIH 1KCRL 4DN4L 2YPLD 3O45A 5F7KC 2VLJE 2Q7YA 5E2UH 3ULVH 5DK3A 5JW4R 2CR6A 3RA7L 2H1PH 2F9BT 1BFOB 3ZYIA 5HTSA 4L9LC 5MEOA 4PJXA 3TBWA 3O8XA 2X4TA 5IMLA 3CPLA 2DQCL 4F15B 4DOHE 3IDXH 2Q87A 5IEHA 4YK4C 1GZPB 2VL5A 2DAVA 3BH9A 3GMRA 3ARYA 3TA3A 1EXUA 3UTTB 5E00A 4I5BB 3KR3H 5GGSY 4ZNCD 3OKDB 4HH8A 4PYGA 1ZHNB 2ZJSL 4U6VH 5E94A 2YBRA 3CVIH 1M7IB 1XGQA 1UM5H 5I9QC 4PJ9C 2VQUA 3WLWC 5I17B 3KHQA 1F6AA 1NL0L 1SVZA 5FO8A 1G7HB 4WV1B 2JELH 4PUBH 3OKEA 2D7TH 1HK6A 2DI8A 2VR9A 1PSKL 4JFEA 4JY6B 3P11H 5HD8D 1I7UA 4L29B 4GS7B 1JMXA 3CSPA 2VUYA 5B39G 3RGVB 4OJFH 1F4WL 2B4CC 4ZD3L 3QXAB 3BE1H 1XIWB 3IDIA 1VADB 3RY6C 3ILPB 1BQUA 4JRYD 4ZTOL 3DO7A 2Q8AH 2X89D 2Z0BA 3EO1B 4K7PL 2WM0A 5CD3A 5L9DH 1DQDL 4C4KO 2FLRT 4AENA 1DQMH 1PZUB 5KZCB 1DEEA 2PTTA 3RUGA 5KSAA 2X1WL 4N68A 4BQBA 3E0GA 1S3KL 1BP3B 1E4WL 5DJYB 2B8OT 2ZCKH 3REVB 3W11D 1FVEB 2VC2L 5E1AB 5EOCL 2XZCL 5EUKA 1AQDB 1ZA3A 3HZKA 3M1BB 4N8VG 5J9PB 4G8GB 5JR1L 3D2UA 2HTLC 5TDPB 1SEBA 4MNGA 4QHMA 3BD4A 5ISZB 1X5KA 4JQXA 5D1XD 4YHZH 1MVUB 1B0WA 4OAWA 3QCTL 2VO5A 5E4IA 4ODVL 3W5MA 4RFNB 3FT2B 2BY1A 4OI9A 4O5LH 3L5IA 5DA0B 2ESVE 2W0FB 5F71A 3VE0A 4KVNL 3MPCA 1BFVH 2HWZH 5JHLH 1ZHBB 3VWJC 2LTQB 3QUXC 4MXVF 4NO3A 5BO1L 1I7RB 2R8SL 4FQLH 1FFPB 3TIDB 2ITCB 4PJ8A 4GW1B 4ZUUB 1FLTX 3KPQA 1VEPA 1UT9A 3WUWB 4JFYB 3ZKXC 5EDXA 4UILH 4U3CA 3SDDC 4EN3C 3IKKA 3CMOL 1LO5B 3O41A 3SDCA 1BZQK 5I1CL 5KN5A 3H0TA 2FWOB 4R96B 3THMH 5DUPH 4M7LL 2WV3A 5GRJL 3OXRA 3OKLA 2EKJA 3OXSA 2R2HB 4GO6B 3MGTA 4MQSB 4O2CB 5F1NA 2HMID 1N26A 4QT5A 1H3GA 4R2GC 4LCYA 1LEGA 1YJDL 4OCLC 3HZMB 5T1MA 3QXWA 2PXYC 1PFCA 1PZ5A 1VEMA 4LCWE 4D9QD 4RRPA 3LEYH 2BY3A 1KPRA 4PR5B 5ITFA 1EAPA 4OFYD 4UT6L 4G5ZH 1J5OH 1R5WB 5CINL 2DI7A 1Q9WB 1WV7T 4J12A 2F54D 5K9KB 4ZAKC 1MF2L 1U8HA 3V95A 5IVZB 1N3NA 3UCRA 4AIXA 2ZOLB 3HE6D 3EYUL 4MQTB 5I8CB 3RKDC 2YD9A 5BS0D 4M1DL 4KDTA 2CKBH 2C4FU 3TCXA 1QLRA 4G6AC 4MJIB 1MFNA 3EGSA 2F19H 5ANMB 3VFRA 1ZT7A 43C9B 1CI5A 1A0QL 2GFBA 1JPTH 4DZBA 1I3RB 5DO2D 3ROLA 2X4SA 4FQ1L 4PJGE 2OJEB 1U3HA 4S2SA 3BXNA 5DJAB 2A6KA 4PLJD 3RJQB 1A6ZB 5AEAA 3OBAA 3F7PC 3G5YA 4G8EA 3QCVH 2P48B 3HFMH 1A02N 1T66D 1CFSB 2IG2H 1SJEB 2VZOA 4OUUB 5IIEA 1RUPL 1P7QD 1EFQA 4FG6C 2ID5A 1BLNA 5HHVH 4PJHA 3A6BL 3VG0H 2B1HL 2Y5TB 2DDQH 2WSKA 4K23H 4WUKH 3ULSB 1A5FL 3LKPB 3RDTD 3NMEA 4GSDH 4CMHB 2OQJA 4FFZL 2A0LC 3MRCB 1OAYL 2CJUH 2FGZA 3VI4E 1VPOH 3V7AE 3B5HA 1RZIB 4WWKB 4J3OC 2XN9B 4PJAB 3DROA 1S5HA 5DC9B 3MRRA 4KUZL 4XC3L 2R0LL 1FN4A 3DX7B 4GMSL 2IH1A 4TUKH 4OI7A 3O6ML 5GRVK 3S4SB 1I8IA 3QEQE 3IJYA 4KK5D 1LK3L 1FRGH 1MI5B 5D96B 2P8PA 4OLWL 3DX8A 3DUUA 3T0EB 2XWBB 4ZOEA 3K3QA 2R0ZH 4XCYA 3WDHA 1LD9A 4PJDB 4LKXA 2CKBB 3H42H 3FL7A 1D5MB 5MP6L 3CFJB 3MRIB 3QJFA 3V4PL 2P7TA 5JPNB 1RUMH 2FJGA 1I1AB 4KJQD 4AIZB 1JPSL 1R3HB 5IMOB 1L6ZA 5E8DH 1NCCL 1MJJA 4HKBB 1W72A 4LRIC 2X7LB 1JNNL 1AD0B 4YLQT 2VDMH 5CP3A 1PD6A 3FQUA 4DTGL 1EJOL 4ODWA 3AC0A 2FEEI 3I50H 3HB3C 2ZG1A 3QQ3A 2HRPH 1UZ8B 1KJ2H 2Q3ZA 4L8SB 4N8PA 1JGLL 3OZ9H 5ADOH 3NN8B 5BJTA 3V5KB 3OR6B 1RZ8A 5GSRA 1J1PL 4N8CH 1T20A 4I3RL 1B9ZA 1YN6B 3DI3B 1KCRH 3HZVB 1R3IH 4NDMB 4DN4H 4QHUB 4HPOL 3CVHL 1JF1A 1LMKA 1NC4D 3C60B 4UOW0 5DZOA 5FKPA 4DOHB 1BEYL 2D0HA 4M1GL 3D39D 1W0VB 3U9PL 4EKXA 1V8HA 3GO1H 4Y16B 3B9DA 1LDPL 4U2ZA 4U05A 4OSUH 5E2VL 2DQCH 4IIQA 2FO4A 3OKOA 4X4ME 5LGJA 3QUZD 3QNYA 4XBGA 1NMCB 3CFEA 5I1EL 5E8NA 4BUHA 1NFIA 1QUNA 4HIHA 3RTQA 5DUBA 4U31A 3NH7H 3TESA 3RWHA 5GQBA 2ZJSH 4MAYC 4EOWH 3D48R 3QIWB 4XBEL 3BOVA 5C9JB 2VDKL 4PLKD 1RU9L 3RVXC 3BDXA 4MNHB 3BKML 3WN5A 3D0LA 4YDVB 1BMGA 5ESVB 3ARVA 3QH3B 2XG4A 3QDGA 5FM5M 4G6ML 4ZD3H 1PBYA 3BP4A 3I6LE 4EI5B 4ZTOH 2EH7L 3ARFA 5FOBB 3TFKD 3GKWL 3MJ8A 2M1KA 4K7PH 1JZ5A 1VACB 5DRZB 2VLKA 1GGTA 4PJGF 3VFMB 1KJ2B 1BPVA 2R23A 5ICYB 3QNZA 3U6RA 2KPNA 3TNNB 4WW2A 1AR1D 3WYRA 2DQUL 3BEVA 4OCYH 2WWKO 2Q6WA 3MV8B 3WFEH 4PJEE 5EOCH 4POUB 2XZCH 2FYYA 3WDIA 4P2OB 3MA7A 5E1HB 4NZJA 2H2SD 3OHXA 3PL6C 5JR1H 5BVPL 2OM5A 1DUZB 3DVGB 1Z3GH 5FHAL 4BZ1H 2ESVB 4UNTA 4PG9A 3V4VL 2X4UB 3JXAA 4IOIB 5F3BB 5KOMC 3QCTH 3VXOB 1KTDA 3C2SA 3FT4B 3VI4F 4CJ0A 3ZE2E 2OL3H 4ODVH 1HNGA 4XP1H 1KNOA 5F7LB 3MRLB 3LKRB 5C08E 4XNUH 3MLWL 2DL2A 2DJUA 4UV7H 5E24E 4KVNH 1DN0B 1FH5H 2LFGA 1K85A 2XRAL 5BO1H 2R8SH 1I3GL 3WNMA 4CADA 5IHUL 1KGCE 1KN2H 4EDXA 1IZKA 3GMMA 3ARDB 1G84A 5D1QD 5C0AA 5GS0L 4RDQG 3SCMB 4WFEE 2EIEA 4W4NA 1ORSA 2HLFD 3WO4B 4P2QA 3IF1A 2BXYA 2VXSH 3CDYA 3TN0D 3UAJC 1VKXB 4I3GA 1D9KA 3LZFL 4LCWB 5ICZB 5GGVL 2LV4A 5GRJH 1OT1A 4O58H 4PJXE 5HI4D 2YUZA 4HG4J 1YNLH 4HC1A 1Q94B 1A1NA 2Z31D 3UYPA 1UENA 3W5NA 1X5GA 3ARQA 4WW1B 1NQBA 2BC4A 4L3CA 4N0FB 4MA1B 4A6YA 3QQ9C 4XNMA 1ZS8B 4E0RB 5DHXB 1S78D 2VAAA 4AT6B 1NANI 1WJ3A 1YEJH 2WBJB 4B5EA 5CINH 3V5DB 4FQXD 2V2WA 5FGBA 2FDBP 2AP2A 4IMLB 4O2FA 4UINL 4C56A 1TETL 4IRZL 3TVMC 1MEXH 2VZ1A 3AB0B 5FYJD 1CR9H 1WC7A 3B9KC 4I9WD 5B39B 2HTKC 3QO1A 2NXYC 3FRUB 4ZFGL 4M1DH 4ZFFA 4X80H 1Z2KA 5MI0B 4GAJH 4K3EH 2IFFL 1PGRB 2OL3B 4OKVA 2ICEA 4Y5YB 4D2NA 4UTAH 4AH2B 4NZDA 4PBVC 2HVJB 1HHHB 4WFFE 1A1MA 1I3VA 3UJIL 3WE6A 1YY8B 4LAJH 3DGCR 2G75A 5L2JA 1MCCA 4FQ1H 3G5XA 3RPIB 2P43B 1AC0A 5M95B 3RBGA 4JDZB 4DN3H 2FECI 5DHVH 4YC2B 4N8VB 1DBML 1F97A 1OAQL 4TN9A 1MCIA 4J3TA 2JK5B 2D0FA 2D03L 1D7FA 2DTMH 5DYOA 2VISA 3A6BH 4HZAA 1FVCA 5TF1H 1MHHA 1U6AL 3L7EB 4W68A 1BIHA 1K3ZA 1CFQA 5GXBB 1FZMB 1K8IA 1VFUA 1OAYH 5FGCE 4YWGL 1DVFA 3QEQB 1JNJA 3L5XL 1F02I 3LVEA 4P9HL 1FFNB 1KT2A 4UIMA 2WNGA 4YX2H 4Z18A 1S7WA 4I0PA 2R0LH 4QY8A 5DT1H 2H45A 5K9OB 1NANH 4XVJH 4RCAA 1ROWA 3FAWA 2BY0A 4C57C 3IDNB 4OF8A 5IFHL 3QIBB 1YEEL 2X41A 3AS1A 4S0TD 4I0KA 1T3FA 1OWWA 3OAUL 5F6HJ 4F9LC 3MRMB 1KLUB 4K2UH 4GKOA 4P48A 1BQHG 2LAGB 4Z0BH 1C7TA 2KL6A 1GZQA 4XNYH 5E99L 4UB0L 3H9SA 4ETQB 3F7YB 3MNWB 4XVTL 1WCQA 1SQ2N 4DJMA 3V4PH 4NNPH 4PJ9D 1I7TA 3WLWD 5D1ZD 5FGRA 3L3HA 3ZE2F 1HOCB 5E9DA 3G6JA 3NPSC 1FLRL 1G7LA 4DCQB 1LQSR 3ISWA 1G7IA 3QFJD 4LARH 1MFBH 1RUAL 3FN0L 1PJ9A 5F1SA 2J8OA 1XGRA 4DTGH 1WT5C 1KIPA 1N7MH 5DHVB 3TJHC 4EIGB 2FIRT 5E8EA 3K81A 1H9VA 4KZEH 5AG8A 5ID0B 4M8VA 1G9MC 4LSQL 5H8DA 3RBSA 4LSTH 3L3IA 3QPXH 4LCCB 5C7XH 2CUHA 1YYML 4HPOH 3HC4L 3FOMA 5IJVB 3B2VL 4UOW1 1L0QA 4UDTA 5T5FH 5HYJD 3VGGA 3DVNB 1OQXA 4M1GH 1FSKB 4MLSA 3D85D 4Y5XA 4U7KA 1FNGB 1IAIL 1CFVL 1F42A 1MLBB 2HTLD 1JHKH 3QIUB 4M48L 1LDPH 4RMWA 2XXCB 5ECJE 5IBUB 1Y6NR 3T1FB 1MRFH 3BN9C 4DK3A 2E6PA 1T1YB 3SDYH 4O02H 3OKNA 2CRIA 5EIIA 1B88A 3LPGA 3OB0H 4MDIB 5DVOA 3E2HB 1S9VB 4ZOBA 2HH0L 3ZTJG 3QUMH 3T0AA 3NZ8B 2P5WD 2ENSA 1VERA 2KQNA 3VXRE 1U3JA 3QUXD 1XF3A 1XF2B 3L95B 1ZA6A 4H26B 1JCKA 3U0PB 3DMMC 1NEUA 1MH5A 3WJLC 3BKMH 3SDDD 2R2BB 3TBTB 3IDGA 4WUUA 1A9EB 5E95B 1ZLVK 1EO8H 1GGBH 4KJWC 4D9LH 1I8LC 1IAOA 2YXMA 4WY7H 3RWGB 5IF0B 1EGJL 4Z5RB 1T1WA 2IH3A 1V05A 1AO7E 4YEEA 2JJSA 3BISA 5GGTA 5DURD 1OAKL 4OZIE 2DM3A 1R3JA 3JVGA 3NCMA 4PJEB 3I3BA 4ELMA 4Q9QL 2DRUA 2X44D 4HBCL 4LBEB 5GGQL 3WHXB 1A7OL 3H3BC 4R2GD 4PIRF 3V0WH 4R3SA 4I48B 2PXYD 1A2YB 3SJVA 4HUWB 3IFNL 5GZNC 4HFUL 5HJ3A 3LQMA 4RFEA 5KG9A 1AGEB 5LKNA 4Y7MA 2HN7B 4GBXA 4NBXB 1EEUA 4OLYL 2Q8BH 4LMQE 5JXEC 5DD3L 4ZAKD 2HYMA 5DJCA 2XWTA 7FABL 5F6IB 5FHAH 1PAMA 2FD6L 5C08B 3S35L 1K9TA 3NIGE 1IKNA 3E6HB 5AYUH 3RKDD 4TUJA 3RWIB 2XPGA 3IXTA 3ECBB 5EO0A 3L3KB 4YHIB 1U92B 5SWZE 2FJHB 2Q1EA 3QDMA 4G6AD 3Q2CA 3QUMB 2I5YL 3JWOC 4LF3B 3VXQB 5M7QA 3WFHA 4P46A 4GQPH 2Q7YB 2XRAH 5D7JA 2PW2B 2YSSA 5I6XB 1TJGH 4XWOC 4QRSB 1BD2D 5MEOB 4PJXB 4ZUTA 3TBWB 5GS0H 3ZHDA 1A4JB 4XPGH 4RDQF 4BZ2L 3I3DA 5DFVD 4E41A 4PP1C 4DZ8A 2VL5B 3FQXB 5DUMH 1DJSA 1I1YB 3BH9B 3GMRB 1W0WB 3TA3C 1RHFA 3KYNB 1DSFH 2AJZA 5E94B 1T89A 2NY5C 2C7UA 1I8KA 4OD3L 3BW9B 4KU1A 4Y2DB 3P77A 2GK0A 1VGEL 3HMWL 4JFEB 4CRPA 3H8NA 1IQWH 4HIEB 1DCLA 4U0RC 4DKEL 4K7PX 3WL9B 5KVEL 1UWEL 3SO3C 4IOSD 4IRZH 4BM7A 4X6CE 5HVHC 3DO7B 3C6LB 3F8UB 1BF8A 4Y19A 5CD3B 4HXBL 4ZFGH 4U6YA 5EC1A 3VFTA 4YHYC 1QPPA 5C0RL 3L6FB 2PTTB 4NWTL 4YBLB 1MJUL 4LHUD 5KSAC 4KDVA 3QSKB 4X7TA 1GJIA 3MLTA 5CSGA 4RWHA 3ARBC 4BELD 2IPTH 2WK2A 1NJ9A 3MBEB 1AGDA 5FDWB 1DDHA 1WZ1H 1KIRA 1RZKL 3BKJH 5FV2A 3HZKB 4R0LC 5LXGL 5EIQA 2HRLA 5D93C 3OTTA 2DM4A 3D2UB 3BX7C 2F5BL 4I0CC 1SEBB 3OB0K 3MV7E 2EE2A 5FV1L 4PGDA 4OAWB 4RGMB 4CW1A 1DBMH 5L7XL 1DQQB 2COQA 2FIKA 5FGCB 4PRPE 2RIKA 5C0EA 1U8JB 4LLVA 1UA6H 5IJKC 4LNRA 4U1JA 3KVQA 3BZ4B 4HIIA 1U6AH 1CTOA 1QBLL 1FFOA 1YPZA 4XVUC 5FYJU 4PRHE 3NGBC 3BGFC 4JFFD 3DIFB 5JHDA 1UACL 3U9UB 3V4UL 4NO3B 4YWGH 3L5XH 4BJLA 2C3WA 4X5LA 1FL6B 4OZIF 4PP2A 2GTWA 2AJYH 1CE1L 4KRPC 1OVZA 3MXWH 1Q0XH 3AREB 1U8OB 3PNWA 2VXUH 2IADA 1J0IA 4OFKA 4WTZG 1QSED 3O41B 3PWVA 3SDCC 3AXLB 2BNRD 3H0TB 3V52L 2CIIB 2BVPA 1EEQA 3F7VB 3VWKB 3JWDC 3ARXA 1G9NL 4LSRL 3OXRB 4YE4H 1NEZG 5T1KA 2BSTA 5HHXH 5D7KE 3MGTB 2OSLB 2LU4A 5E99H 4UB0H 1QRNA 4P2QE 3O3EB 3KPRA 1PZ5B 5FIEA 4NN6C 3NIGF 5GISH 4OGYL 3NPZB 1OW0C 5MERA 2ATPB 4LVNC 1I75A 3RVXD 5TQ0L 4RX4D 3RHWF 1KB5L 3WDJA 4LVOC 1YECH 3C5SA 2ILLA 1FHGA 3B5TA 3HN3A 1EUTA 4JFHE 5DVLA 5CEXA 4WEBH 3IJHA 5ICXB 1RUAH 3FN0H 3CFCH 3FONA 2DI9A 1HQRB 2XZQL 3G5ZA 2HFFB 5BV7C 4IRSA 1UKSA 5E6IC 2GEEA 3MLVL 4KDTC 5EUOA 1PY9A 1A3RL 4JEGB 1QLRB 4IRJA 4YQXH 2DMBA 4OF7A 2C4XA 3GM0A 3EGSB 2E27L 2EDNA 3MRFA 1M05A 3HRPA 4I3SH 2FATH 5IP4A 2CMRL 1KB9K 1YYMH 2E7CA 4XBPA 5D70H 3TP4A 1X4YA 2X4SB 3UYOD 1U8IA 2CK0L 2ZCLL 3TZVD 1U3HB 3UTQA 4S2SB 3BXNB 1KYOJ 2A6KB 3T3ME 3PL6D 5JQ6L 2BNQA 5C8JA 4CU6A 4M48H 3K2UL 3G5YB 4G8EB 4MZ3A 2VR4A 1MFEL 4YNYB 1NFKA 4QXGH 4P0DA 5IIEB 2A9ML 4NQDD 1IM9B 4G9FD 8CGTA 2R15A 3GIVB 3VA2C 1RZFH 2BDNH 4BH8A 4PJHB 4OFVA 4LPVA 5D7LA 2OQJB 3FQTA 4P2CG 1AY1H 3Q3GA 1R0AL 2GUOB 4X6CF 3S98A 4F9PA 1KEGL 4LLWB 4M03A 1JGEA 3W0WD 1A9BB 4WFGE 3WEXB 1D5ZB 1AO7B 2JIXA 3CVHA 1FN4B 3T0VA 2Y1VA 5IHBA 2UWEE 1BZ7B 2IH1B 3HG1E 1IGTA 4JDTL 3B83A 3IJYB 3EDKA 3FO0H 1L9MA 3QULA 5KANG 2R2CA 2FZ3A 3PWPE 4NC2B 2DQHL 4FS0A 4RAHA 4KWUA 3UAJD 1CICB 4U1SA 3L1OH 3N85L 2GT9A 1R3KB 4H5SB 4MJ5B 5EOTB 4F33B 2EDRA 4Q9QH 4HBCH 1CDHA 4LKXB 5GRZA 3ZTJH 4D0CA 2VDNL 4FOMA 3QEHA 1BQHB 3QJFB 4L1HA 2FJGB 1BM3H 4HZLA 2P5ED 3QQ9D 5D4QA 3DOSA 3T4YA 2L7JA 5MEND 4P2RA 1FYTD 5C6PB 3IAPA 3SKMA 2EDYA 1IC1A 1W72B 2HLAB 5IOPB 4Y89A 4P3CL 4LVEA 5SWZB 4O51B 3Q6FB 2C3VB 1EERB 2FD6H 4NJAL 4P5KA 3TVMD 3JTSA 4MX7A 4ODWB 3VXUD 5E9DE 4JPWL 3B9KD 3G6JE 3QQ3B 4Z76A 1F13A 3RZCD 3VXNB 4TPRL 1HKFA 5BJTB 1WZLA 2YS4A 4CDHA 1CD0A 4WCYL 5GSRB 1S9KC 2IAMD 4JLRA 3V6OC 1CLYH 1UEMA 4XC1L 3EYQC 2QJDA 4OZFG 3BMVA 4JRXD 4HQQH 5B8CC 4XNXH 1FDLH 3QUYB 5FKPB 3LN4B 4WV1C 3KJ6L 1A47A 1N5AB 1RZJL 4AEFA 4MWFB 1U41A 3DUSA 4Q2ZA 5HSFA 4WVRA 5E5RB 5KS9A 3FRPG 5I1KH 2DBLL 2Z91B 4GS7C 1Q9LB 2GITA 5IHZB 1C16A 4WWID 3OKOB 2OR9L 5LGJB 1LO0L 4IIQC 1XIWC 3AY4A 5IMMA 3AU1B 3BWAA 5I16B 3MRPA 3KPNA 1Q9KB 1XAUA 1IC4H 1G0DA 1NFIB 5JMRA 5F7DB 1FBIH 4HIHB 3RTQB 5DUBB 2EE9A 4NQTA 1K4DA 2ZUYA 3O3UN 3EZJB 4NSKA 4POYA 3CH1A 4V1DD 4ZXBB 4QRQB 5BRZD 3VXMD 1G9EA 3ULVC 5A43C 2H9GA 1CF8H 3WN5C 1CD1A 5SWQB 4DKEH 4QRRE 4JY4A 2EDWA 3EDDA 5KVEH 2X5PA 1OGAA 1O7SA 4ONFH 5FYJL 4QXUH 3W9DB 2EIDA 4UT7L 3ZE0F 3MJ8B 4ZMAT 3WIHH 3B8SA 1KPUA 1HYRC 1QVOA 4G9DB 3HNTH 5DEGA 1TIUA 4A2MA 3QFDB 3T3MF 5C0RH 4JY5H 4ENEC 2YZ8A 1UZ6E 4NWTH 5I1GH 4ONOA 1IGIH 3RHWK 3MV7B 4ORGA 4QXTA 3NABH 2FYYB 2H6PA 1JTOA 3EJYD 3MA7B 1OAUH 5LXGH 5DVMA 32C2B 4Z7WE 3PXJA 2F5BH 3I02A 1U93B 2A73B 1MCRA 4AQ1B 4XMPH 1G7MB 4GW4B 4PG9B 5GRUL 3BEWA 1CDBA 3P9LA 4PRHB 5L7XH 4GG6A 2G2RA 1BOGA 1YEKL 1N5YH 2H8PB 3QEUA 2MWCA 3GK8L 4K3DL 2AK1L 3GSUB 2UWEF 1LEIB 4J8RA 3CXDL 1MCSA 5HHNA 3MJ9L 4RBPH 2ZKHH 2NR6C 3IU3A 5DWUH 1T1ZA 2G5BA 2ERJB 3A67H 4X4XA 5JOFA 1AC6A 3O3BA 4P5MA 5I1IL 5CHNB 4LU5L 2IWGA 1GH7A 5INDA 2OZ4H 3BN9D 3PGFL 4P2QB 1TTFA 2I07A 4U6TA 3IS1X 4QEGA 4RMRA 1IE5A 4N0YL 3IDJA 3I75B 4LRNH 1D9KC 1G9NH 4LSRH 4FXGA 4DVBA 5FB8B 4Z95L 4H0IA 1NMAL 1YYLL 1FO0A 5FYLE 3D18B 3TH4T 4EVNA 1YQVL 1BVKA 4E41E 2K1MA 3OJMB 4FTVD 2QEJA 1DLHB 4ERSH 2BC4B 1QSZA 4KROB 4OGYH 2DN7A 1T5XB 3VGEA 2E7HA 3PHSA 4PRID 2QQKL 1CLOH 4GUPB 5TQ0H 3UO1H 3RVVC 4NNYB 1KB5H 4XVSH 4XTRC 2V2WB 1B0GB 3DVFA 4KMLB 2V2XB 3MLSL 2EYRB 4O2FB 4UUJA 3VW3H 3JUYA 3CFBA 3RAJH 3FHAA 4GW5A 3BPCA 1WCBA 2EC8A 4YGVB 4OCRH 1P4LA 4PGJA 3O9WA 3QO1B 4RWYH 4ZFFB 3VFPB 4BSWA 1NGPH 3NZHH 3VFVB 2EKSA 3VCLB 2ICEB 3RWFA 1MOEA 5F44A 4L3EE 3WV0A 4XXCA 4FNLL 4X9GA 4U6HB 4BFBD 4X7SH 4JZOA 4RGNE 3WE6B 4ZO9A 5C0BE 5F9OL 5L2JB 3I9GH 3SE9H 1NMBL 4LGRB 3PWUA 3ULUE 5DLMH 2VLRD 5JXED 5JQ6H 4GRWE 5T3ZD 5C0CE 1GRWA 4HCRL 4KKBC 1TZHA 3KPSE 3CNKA 5KANI 3IRPX 3B3IB 1Z0MA 4CVZA 1MSPA 4DFIA 5D96C 3K1DA 1EBPA 5IUSA 3O0RL 1KJMA 4W4OA 3O6LH 4OZHA 2IMMA 5IB2A 3BP5A 5T33L 3UDWC 2GCYA 3NCYS 5DD5L 2VISB 4WO4B 4WDIB 4I8DA 1MHHB 4NQVA 4U1LB 1CFQB 2AJSL 2UWEB 3MCG1 1C5CH 1XZ0B 4WJ5A 4Z7OE 3ARPA 4ZUWB 1KEGH 1I1AC 3C9NA 5E8PA 1Z0NA 1JGDB 3PWPB 1B0RA 1T1XA 4XWOD 1TMCB 4LHQB 2ZP0T 3MUGA 4I0PB 4J4PC 1AGFB 2BRQA 4NT6B 3N1FC 5EZOL 4JGUA 1JZ2A 3KXFE 4JDTH 2Z93B 3HPJA 4PGBA 1IC7L 1QR1B 3IDUA 4ODUA 3GJFH 5D6DA 1T3FB 2XT1B 2CDEB 1WBXA 2NY3B 5CGYC 1H0DB 4DQOL 3N85H 4LPCA 3WS3A 2CRZA 4PRNB 3E3QE 4L8SC 4QHNA 1WBYB 4KI1A 4Z7WF 3H9SB 2CXGA 2W0PA 5L8KB 4JRWA 4Q9CA 2J3SA 4ZFZA 3P0YL 1EAJA 3MA9H 1I7TB 1F3RB 2GJ6E 2VZ3A 3DVIA 2VAJA 3ZDXE 5BMFL 1N0XL 2PO6A 4FQJL 3GSVA 2A1WL 3AS0A 3C60C 4B41A 3VFNB 5E9DB 3G6JB 5C6WH 2C1PB 3TT1L 1G7LB 4MQXD 3AM8C 3IAQA 4TVPE 3KPRE 1G7IB 4JREB 2NX5D 2DM2A 2ZPKL 1LP9A 1S7QA 1XGRB 2R4SL 2MKLC 4NJAH 5HGBA 1E4JA 1NKRA 4PGCA 4NQSA 5E7FA 5D7SH 2P24B 2EDFA 4JPWH 4HWEL 1EGJA 3DRTA 2FR4A 2NXZC 2YC1A 4PD4K 2HJFB 2X89A 4RBPK 3GRWL 2B7DT 3IFOA 4EBQH 3WKNA 5KW9L 4WCYH 3LKQA 5HHPB 3CX2A 3QDAA 3MFFB 1IGJB 4LPXA 3E6FA 4R90L 4KZDL 3ARGA 4X6EA 4IMKA 5DK2A 4GAFB 3KJ6H 5FDYA 1RZJH 3L3OA 4L4TD 4RZCA 3GMPA 2UUDH 2ARWA 3T2OA 1BBDL 3K4DA 4KXZI 1J0HA 3OX8B 4P57A 3EO9L 1FGNH 2OR9H 4P4RB 1LO0H 5I30H 5D1XA 3GJFB 5I1DA 2BNQE 4X7EC 3DHMA 1MAKA 2EECA 1RZGA 3L3DB 2EDBA 4QRRB 2IANE 1QSVA 4QRPD 5FK9B 1F8TL 5MEPB 4ODXA 4OZFH 1EVTC 4NZUH 4KRPD 1CLZL 4MA8H 4WUUB 2BOBA 5FYLH 2X4NB 2NTFA 4LKCA 1IAOB 4NM4L 1PKOA 2JF1A 1CXLA 4RISL 2IH3B 5FYJH 5GPRA 1IAMA 3T77B 4UT7H 5GJTL 5ABDE 1UH4A 3NCEB 1U8MA 2X40A 4ZG1A 4GRWF 2X1QA 4K3GA 5CJQL 5HI3C 4Z7WB 3OB8A 3V9FA 5IKCB 43CAB 2X42A 5HJ3B 1U8KA 1INQB 2JKXA 1C5BH 4RFEB 3MNVA 5KG9B 3H3PL 1AXSA 4W70A 3WJJA 2J6EL 4TRPH 2OR8A 3GUTA 4GBXC 5FUOH 2VQTA 1JGVL 2ENYA 2F54A 4ZYKA 2QADD 3ZHLA 4FQQB 4G3YH 1ZTXL 3TH2T 3WO4C 5T1DL 1OWRM 1RVFH 5E6ID 1IKNC 3DX6A 3STZB 3HE6A 4KXZH 4IOFD 3CFKB 3IXTB 4MJ6B 5EO0B 5BS0A 4MD5B 2AK1H 2VQ1A 4JZJB 1NGYB 4HEME 4GRWH 3CXDH 3GSOA 1P69B 4K7FB 4OCSH 3WFHB 1QFWL 4NKOB 1P9MA 2IBZX 3MODL 3ZT5A 3DO3A 1SJHA 1RK0B 5A40E 2ORBL 5CBAA 3NFNA 4JG0H 4JO3L 5L2KD 1WFUA 5DRWA 5GGRB 1JHTB 1R24A 1T0NA 1ADQH 1H3TA 4OZFB 5D7IA 1RQ5A 1SHMA 3FQWA 4IDJL 4DWHA 3SE4C 5I1IH 1SYSA 3GJFK 3L9RA 5BVJB 5SX4I 2XYCA 2Z92B 4P9ML 1JF5A 1I9RL 2VIRA 3U36B 4DKFH 1JN6A 1OSZA 1P4IL 2X70A 4E41B 3ZDXF 4Q6IA 4Q0XH 1TZGL 2R56L 3E1F1 1WTGT 4N0YH 5CMAA 3AB0C 1JHLL 1MRCL 3ETBF 5J6HB 3RNKA 4XPHH 1P7QA 1OOAA 2D7PA 1IEAB 2X4PB 4Z95H 3PWLB 3VDBA 4YHNB 4HLZG 5GRXG 2AJZB 4X98A 1JJUA 4NHCL 1JE6A 3RDTA 3BH8B 5JDJA 2PCPA 1PG7W 1T22B 1ZHKA 4FP8L 5I1LB 5JW5B 1F4AA 5J7CC 5C09D 5JO5A 25C8H 4GXVL 3HS0A 1DBBH 3O4LE 1XGPA 4LSSH 5IR1B 2D7QA 4R9HA 5F7FA 4XCCH 4ZUSA 5F1IB 3CU7A 4GAYA 4YC2C 5EU3A 5BOZG 5C0JA 1G7QB 2YUWA 2NMSA 3QG6A 2AW2A 5T3XD 4RGNB 1KG0B 1CBVH 4JPIA 1HE7A 2VZUA 1IT9L 4TVPH 4KK8C 2IQ9H 1B2WH 1P2CA 4D0BA 4GRWB 2APXA 3TBYA 5C0CB 4X7TB 4FNLH 4LLQA 3QRFM 4R7NA 4YXLL 3KPSB 2EDQA 3S88H 5TE7L 3ARSA 1AGDB 3KYKH 4K9EL 3UTSE 2UUDK 1J9CT 2OP4L 5F9OH 3F6LA 1NMBH 3S37H 2ED9A 3BPNB 4HK0B 2BSSB 4FQCH 1LEKA 1A1OA 1BIIA 1RJYA 4B7IA 1FPTL 2R4RH 4PGDB 5F96L 4KKNA 4CW1B 3MV01 3D69B 4H1LG 4TSBL 3C2AH 5EA0H 2DKUA 4WTZA 4P3DA 4L9DA 4LLVB 1MIML 1ORQA 1D3CA 3EDFA 3FN9A 5T33H 4P23B 4HAFA 5DD5H 5HVFB 4L5FL 4HIIB 1F4YL 3C6SA 5LGHH 4F7CA 4FABH 2VABB 4UV4L 1ACYL 1NEZA 5AZ2L 3EYQD 5IB3A 3KXFB 1UM6L 2DYPB 3KAAA 4HGWB 1A7QL 1YEGL 3WIIL 1S7UA 4PJ7F 3QP3A 4Y4KA 4JKMA 4OQTH 2GTWB 3HR5A 1EJ6A 1NC4A 5FF6B 5GZOC 4M93B 2VR5A 4R4BB 1PKQE 2IADB 3QDJE 4I4WB 1TCRB 5EZOH 2WUBL 3D39A 3PWVB 5I76A 4HS3B 2V5MA 3D3VE 1GGIL 1QO3A 5TE6H 3RGVD 4NZTL 1QA9B 4PV9A 4M5ZL 1HWHB 2WIMA 5DTFA 1XIWD 4FFWC 3JV5A 1KENL 3QUZA 5EH1A 1TQCB 4NGHH 2GJ6B 5DFWH 5LQBH 2YD7A 4IM8A 1KIUA 5AD0A 2XICA 4GKSA 5FA4B 1E6JL 1HH6B 4X6BA 3U1SL 5ACLA 5KZCD 4L8CB 3HA0A 3KPRB 1B3JA 4LCCC 2QSTA 2EIZA 3KWWA 5MERB 5BMFH 2K7QA 1DFBH 5JLZB 4JQVA 2BSED 3MRNA 2A1WH 4EDWL 4HXAL 3C5SB 3ULVD 3TT1H 2JCCA 1F45A 4BK5A 3UBXG 5IMKB 4Y4FC 5J1SC 4L4JA 2A74A 5FM5O 2Z35A 3WFDL 2DF3A 1RULL 5HVGB 1MCJA 3DSFH 2OJZH 5LWYL 5E03A 2Y9RT 4NM8H 3TV3H 4V2BA 3GRWH 2X10A 3OJDA 1WVZA 4X0KB 1J0ZA 4ENED 2HT3C 2NZ9C 2VH5L 3HI5L 5FXCH 3STLA 3VXPB 1M05B 1KCSL 1WLHA 3BQUB 2GIYA 3X11A 3CSYB 1UVQA 1NLDL 4H8WH 4W6YB 4AZ8A 4KZDH 2W65A 3DHJA 3N06B 4H0GA 2IBBA 3HNSL 3UZQA 5KTEH 3RX7A 4X6FA 5DC4B 4GKZA 5HYEA 4AJ0A 1Z6JT 4JPKL 3GBMH 4M43L 4XPTL 3BGMB 4P4KB 2BNQB 4X5WA 3C5JA 2KZ1B 2R29L 3EYSH 4Z7UE 2VDPL 1BBDH 3OKMB 4S1QL 3EO9H 1QSFE 5E6ZA 1S7SA 5E4EC 5IFJA 1JZ7A 6FABL 3TO2A 2IANB 2XQBL 5MHSE 1CT8A 4RMQA 4CDGC 5EBWB 5ACZB 1FNAA 1I1RA 1JNLL 4J3XA 5ALBL 3T0DA 3WNLA 3KDMB 4ONGL 1K4CA 5D9SA 3TBSA 1FGVL 5KSUA 2YD8A 2ZUSA 2I60L 5D8JL 1NAMA 5EOQH 2NR6D 2BERA 4DGVL 2YRLA 3UX9B 4NUGL 3FB8B 4XRCB 5J11C 5DS8A 4OZ4B 4OCXL 4OQ1A 1Y0LB 1CLZH 4U1HB 2IQAB 5C0GB 2AQ3A 3KLSA 5DRNB 3IDMA 4U1SB 5CAYB 1MY7A 3K7UA 5GJTH 3PGCB 3PQYE 5DMKA 4PY8J 5FKAA 5FM8A 4WIQA 5JA9A 1NGXA 5EZJB 2YOCA 3P0VL 2Z31A 3NACL 4JGMA 4MJID 4D0CB 4U6XB 2Q76B 4HKJA 3MRJA 2QR0A 5E08H 4HPYH 4PBWD 2YEZB 1JL8A 3EDEA 5MEQB 4M6AA 3IETA 3T4YB 1H8OA 3H3PH 2XV6B 5JUEL 4P2RB 1CS6A 1Q9OA 5J13B 1IM3A 1XH3A 5I6XC 3W39A 4XTRD 3L3GA 1F6LL 1JGVH 3JV6A 3UTZB 3ZMRA 4D3CL 1OPGH 3MXVH 1E4XI 2UV3A 1ZTXH 4P5KB 5F72S 4ISVB 1EK3A 4Q97A 1N64L 3EYOA 2B1AH 2O26U 3GSNA 3PABB 3NA9L 4JAMB 4X5XB 1VEOA 4HK3N 3GGWA 1IL1A 3D9AL 1G9ML 4TUOA 3T65B 4JM2F 4MYWB 4FMKA 3SDXF 3MCLL 4QOKE 4NQEE 5F21B 4M5YL 4FHBD 1QHOA 4KHXL 2ORBH 5DQ9B 4Y2DC 1VFOA 3HI6L 4XAWH 4WWKD 3DUSB 2XN9D 2EYTB 3NFSH 5DQDH 1X5JA 5ERWA 4JKWA 1HSAA 2P46B 3UPCA 1OAXH 4LFHD 4KKBD 4WU7B 1C16B 3BPOB 4G6KL 1L7IL 3NIDE 1MI5D 1N8ZA 2UZXB 2R56H 5E2WL 4NO0A 4MA3B 1MRCH 3T0ED 2NY6C 4QRTA 1NBZB 5KVGL 4EUPG 2KBGA 2MCPH 2JJTC 3BIAX 1CIDA 4JFZL 1TNNA 1K4DB 3OJVC 1HKLH 3O4LB 4NHCH 1HHIB 5KAQG 3BVNA 4NC0B 4HBQA 2FX7H 4YFEA 3FO1A 4PYHA 5EO1A 2WAHA 1ZANL 1I1AD 3MJ9A 4UTBL 4C58B 3H9YA 3MBEC 3O2DL 4L8DA 2PYEE 1UG9A 3SGJC 4E42A 2H9GB 4J4PD 3ABZA 1CD1B 1UXSB 2D9CA 4HW6A 3TO4C 3NCFB 3OMZA 3QJHA 4OM0H 3GSRB 4L9LA 2WW8A 4JQIL 3EBAA 1OGAB 1N4XL 1ES0A 5GS0C 3H6JA 1ZT4A 3P3YA 4OFIA 3IGAA 1E4XH 3I3EA 2VLJD 4LLMA 2CH8A 5DEGB 3U7WL 5D5MA 5LAXB 3UTSB 1KJVA 1U58B 1IT9H 3JV0A 4ONHB 3FOLA 4Z7UF 4HLZH 2FHBA 1NCAH 2W9LA 4QXTB 3HTLX 4YXLH 4PJ9A 5TE7H 4K9EH 4QRUA 3C60D 2BFVL 3C5ZB 1QBML 2J8HA 5T3ZL 4QO1A 2AQ2A 2XNAA 3AREC 1YZZA 3I02B 3REWA 1AKJA 4Y16D 3N1GC 4LASH 3QFJA 5IVXE 2WIIA 2V7HB 5FYKE 4TSBH 4NRXB 3RY6A 1X6LA 2G2RB 3VWKC 1BOGB 3G6DH 2EEAA 3DXAA 4JB9H 4RAVA 2J88L 2NXZD 2P47B 4PFEA 2NW3A 3GHEH 4WFHE 3UJJL 2JLLA 3A6CL 4NQXA 1F4YH 2EC9U 5HHNB 1PKQB 1KTLA 3QDJB 4JVPA 3PV6A 4JM2B 4UV4H 1ACYH 5AZ2H 1CGVA 3SKJL 4F3FA 3IU3B 5F7MC 2H32A 4PTUB 3D3VB 1H15B 4PJIA 3VXTB 4NZRL 5A2IH 3SDAB 3WIIH 3QIWD 5LCVL 2F5AL 3JZ7A 3U0TA 3HAEA 5HYJA 3INUH 4P5MB 1Q72L 3RVTD 1EMTH 4ZS7L 1CDUA 4U1NA 3GNML 3KYOA 3D85A 5INDB 3ZKNC 1GGIH 2VZSA 4Y4HC 2I07B 3P4OA 4M5ZH 3TM6A 4HCRA 1UWXK 3EOBA 4DEPC 3SGDI 3IDJB 3V79C 1V3JA 3SGKC 4EI5D 4NN7B 4FXGB 4DVBB 4YHLL 3JBG7 4H1LH 1UJ3A 5HPMA 1DBJL 1E27A 2RQ8A 3X14A 4ODSH 1LE9A 1KXVC 3MCKA 4F7PB 1FO0B 3GB7A 5F89A 1MCWW 2NY5L 2VRAA 1DQLH 5LJYH 2P5WA 3U0WH 5E2TH 1OP5K 4YIQA 1NGQH 3W9EB 4TSCL 1G6RL 3QUXA 1H8SA 1KJ3L 3LS5L 4YAQA 1VGKB 4IBLT 4HJJH 1T2JA 4HXAH 3I2CL 4P2OD 2DWEA 3H9ZA 4EEEA 4HSQA 1EEYA 3BKYL 4KK6C 3VMNA 3D5OF 5JW3L 1C5DA 1F4HA 2W9EH 3SDDA 2JB5H 4AMKL 2O5YH 3CFBB 3EOTL 3LEVL 1OCWL 5HVWA 1UQSA 3BPCB 4NYLB 2ESVD 3QEGL 1WCBB 1I9IH 2V9RA 3HC0A 1KC5H 4GRLB 1EO7A 1A7NL 4Q9RH 5LWYH 2MHAB 4OTXL 4D0DA 5I74B 2EKSB 5EFIA 1L6XA 4HAGA 5HI3D 3NIDF 4APQB 2ZUVA 3O3DA 3S37X 4ZQKB 3MLYL 1EHXA 1GHFL 2NY4C 3Q1SL 2PXYA 4JFQB 4Z7UB 5C0IA 1ZKAA 3KJ4B 1ZE3C 1UYWH 3QA3B 4K94L 3CU1A 1QSFB 2YN5A 5EWIL 2QQNL 3OWEA 2R1YB 1ZHLA 4F57H 5IQ9A 3O3AA 5EG6C 3ARDD 1HI6A 3EJZC 3PHOA 3QUKB 4G8FA 3SCMD 3DX9B 2VDPH 4ZAKA 1EVUA 3V8OA 5FCSH 3FMGL 1CICC 6FABH 2BNUB 4LCWD 2W07A 4FQHA 1TENA 1HZHH 3MROA 4WNQA 2RCSL 1FNFA 1V7NH 4H1LB 3KS0J 1FVDB 5C0FB 5BXFB 1FGVH 4YPGA 4WJ5B 4PLOB 5C70A 2I60H 4MMXC 3CK0L 4NNXA 1SMAA 1U95A 1CIUA 4HX1A 4U1GC 1DE4B 1T1XB 1ZEAL 2WBJD 1WWAX 3MACH 1DQJB 5I73B 1QFOA 2PR4H 3PQYB 3V2AR 3MLRH 5CEYB 1BD2A 2P8LB 3O6KL 5D72L 3QHFH 3SQOL 2BOCB 3HPJB 2VDOH 3C8HA 1NDGB 3LKOA 2EDTA 4NFCA 4YO0B 1BQLL 4X4ZA 2UVFA 1BFTA 2X9YA 1FORH 5HHOA 3CZFA 3PIQA 4HT1L 1A14L 5DMIH 4QHNB 2AJXL 1D5IH 5IESH 1ONQB 1S9XA 3UC0L 5JXAL 2DQGL 4WI5A 3P0VH 5INCB 5IVXF 4JFOB 3VU2A 1C1EH 4KKCC 3QBTB 4U1IA 1LVEA 2H2PC 2PO6B 4X4YB 3QUYC 3QZWG 3O11A 2J7LA 1HYSD 3TJEH 1TPXC 3ARUA 1Y18A 4M4RA 2DWDA 4HDIB 4NCC2 2V9QA 4LVHB 3MRBA 4UIKH 5BV7L 4S1DD 5HD8C 3IU4H 5KVFL 5HGBB 4CVXA 4RMTA 4HKXA 4QOKB 4NQEB 1CQKA 3LHPH 4WHDA 3UBXB 4F7MB 1HQ4A 2EC9T 5EPMA 2NY0B 2JCCE 5CWSA 2BSRA 5SWSE 1Z9OA 3D9AH 5IWLC 4N0CD 3LKQB 3FO2B 4KK8D 1HHKB 1FE8H 5HDBE 2BXZA 4LHUA 3HLAA 3NFPA 3MLZL 2AI0H 5FYKH 4M5YH 4RNRA 3ARGB 3LY6A 4ZXBC 4KHXH 3QEQD 4BYHA 3W11C 4NHUA 2CUIA 3PHQA 4KDWA 3J7HA 5C6TL 4XCNA 3ZT7A 3HI6H 1F3JA 1JWSA 4RZCB 5C9KA 1A64A 2J6EA 3X12B 3R1GH 3GMPB 2NNAA 4ZTPH 5HHQA 4BQCA 4OLEA 4LRIA 4HS6A 1L7IH 1BGXH 3QIBD 1AGBB 5DJ6A 4PRBA 5HYFA 5I1DB 3D25A 3X13B 5KVGH 4H20H 2PYEB 1KEML 4JFZH 1I7ZA 1YC8A 5F7EL 5IGXH 2C1OA 4YHKL 3ZKMD 4PRAA 4HUVB 1FL5B 3U79A 2AV7A 2NLJB 5FUCC 4JFFA 2Y36L 5KAQF 1NGZB 3QXUA 2IEPA 4ODXB 1R3LB 4QHKI 1AJ7L 1QP1A 3B6SA 3MNZA 1QQDA 3SKUD 3OR7B 1YDPA 5GZOD 1OM3L 4I77L 8FABA 1X6NA 2BOBB 1S7VA 4LKCB 4PTTA 3VFSA 1QSEA 4JQIH 2NW2A 1I1FA 5TDNA 1N4XH 3SQBA 2BNRA 2OI9B 4L4VE 3BAEH 5T3XL 4QF1B 2ZUWA 3MJGX 4LCIH 4V2CB 3U7WH 1KCVL 3BO8A 2M8XA 4EUPH 4CVUA 1MQKL 1JPFA 4A2LA 1U8KB 2ADJA 5J56B 5IVXB 3L5WA 3GSXA 5EO9A 3RU8L 1XF4B 5ESQA 1SYVB 2BFVH 4YHOH 3MUJA 1NSNH 1WICA 3BHBA 5DD1L 4ZYKB 3LQZB 1MCDA 1KTRL 3QIUD 4ZDHB 4NFBA 3VD7A 3DX6B 1CFNA 2EH8H 5I75B 3HE6C 3L3JB 4OLUH 4HJGB 3LS4L 4ZSOE 3OGCB 2VQ1B 3VGDA 1IZJA 3BZFA 3F5WB 4LSPL 2VLLA 3A6CH 2NZ9D 5C0ND 1QZ1A 1M7DB 4YXKL 2WWMC 2OR7A 4XX1G 4X8XA 4YR6A 3WKML 1P9MC 4KPHL 5CJOH 1SJHB 2ZUUA 4ORZC 4CMMB 4KROC 4NZRH 3MC0A 2HT2C 3T2NL 3VI3E 5DO2C 3GI9H 3I6LD 4JR9H 3P0GB 5D7IB 3MOQA 3NCCB 4ZNEA 5HDOA 4ZS7H 3ZYOA 3GNMH 2VXQL 1IC5L 3GFUA 4MA7H 3PL6A 4PLJC 2VIRB 4TULL 5B38G 1OSZB 1MCPL 2PTVA 2X70B 1F00I 1LWRA 4Q6IB 3UTPE 2UZIH 3KNBA 4JKPL 5CMAB 3RL2B 1XR8B 1OP3K 2AGJL 4YHLH 4NQDA 1DBJH 4G9FA 4M7KH 3A6OA 5TJWK 5K9JL 4ZUVB 3WSQL 3NAAH 5TPWL 1OL0A 3RDTB 3JSSA 1HSBA 1J1XH 3RP1A 1MHPH 1TJIL 5GHWL 1G6RH 1MUJB 2E6JA 2MNUA 2X9XA 3LS5H 1FNEA 5E2UL 1ED3A 3ULVL 2YMXH 3EJJX 3HS0B 1IBGL 3N0PB 1XGPB 4HUXA 1I8MB 3M45A 1F90H 3VD9A 5HDBF 3RVWC 2UY7A 3LEVH 3VFWB 1MHEA 1GSMA 4ZFOB 5C08D 2UY6A 1SM3H 5SV4A 5EU3B 2YPKA 4KK5C 2FJFA 3QG6B 2H41A 3IDXL 1NLBH 5HYSG 1RJZA 2WQ8A 3S36L 2YPVH 4FRWA 4XGZB 5HPOA 1AHWB 4JPIB 1G9NC 1KGCD 1YUHA 2WMPA 4NCC1 3GSQB 3KR3L 1P2CB 4CUCA 2P8MA 4NKMA 1S9YA 4U6VL 2CDGB 2J1KA 3P4MB 3O4OB 1A7PL 1OTUD 3OKYA 2QSVA 3G6AA 3Q1SH 4J7RA 1MCWM 4LLQB 4MCYB 4WFED 2P49B 4NP4H 4K94H 4M9OA 4Z7NE 3CCHB 5EWIH 2QQNH 3UTTE 3OAZH 2C26A 5MENA 4HK3J 4C83A 3QT2A 1FYTA 1NFDA 4WHTA 1XF5A 2I24N 1A3QA 4CKVX 1LEKB 3DUHA 1A1OB 3P11L 4WENB 1MNUL 3TYFA 4YEFA 4OJFL 3VRLE 4JFXA 3BE1L 1S7RB 3TVMA 3SN6N 4M7JH 2NY3C 3VXUA 3ME0A 3MRHA 4JZNB 5GRVL 3B9KA 2Q8AL 5BZDB 5EU5A 3VGAB 1H3WM 2IGFH 5CJXA 2RCSH 5IEKA 1JWMA 1G7PB 5DJZA 3CMGA 1BBJA 1DQML 2NZIA 2BY2A 2W91A 2NYYC 2IAMA 1UEYA 4BH7A 5IB3B 5CEZE 1P1ZA 3CK0H 3DXAE 5ILTH 4M1CC 1S7UB 4Y4KB 4JRXA 4CN1A 4Y2DD 4QHLA 4BSVA 1G6RB 3V6BR 1N6QH 2NQCA 3MJ7A 1FNHA 1UWGL 5I76B 3JUZA 1PW3A 3KYMA 1J1OH 3O6KH 5D72H 2ZCHH 1JRHI 2CSPA 2D31A 1BVLA 3BUYA 3M8OH 3DV6A 3ROOA 1BQLH 5I8EB 4XX1E 1PG7H 3VGHA 5DJ8A 3QUZB 5CJ8A 1TQBB 3C6LD 5E7BA 1LK2B 1A14H 2NY6D 2R2EA 2O5ZH 1IGYB 3B8YA 1S7XA 5DR5H 4WFFD 4G8GE 4ZO8A 2GSIA 5ISZE 1VDGA 1BFVL 5JHLL 1T7ZA 1KPVA 4BUGA 3QXDA 4V1DA 3MBED 4FQLL 2Q86A 5BRZA 1TXKA 2WBWB 3VXMA 3EYVA 3S4SG 4X9BA 3MZGB 4PLKC 1ZGLM 3K4AA 2R1XA 5FO9B 2JCCB 3LB6C 3LPWA 5DJ0B 5L0QB 4ELKB 1HWGB 5DSCA 1GL4B 3TO4D 5SWSB 2W60B 3DLQR 5C07E 5DJDA 5EU6A 2M26A 2A74B 2ICWA 5EBMB 2Z35B 3MRQA 1MJ8L 2AEQH 2XA8H 1JZ4A 4DVRH 4UDUB 1FJ1A 5LG1A 3THML 2PW1A 3MRKA 5DUPL 1U2CA 3LIZH 3VI3F 1M6OA 4Q58C 4F9LA 2I9TA 3BP7B 2FBJH 3TFKC 4O9HH 1MCLA 5F7HA 1UJTA 4NJ9L 3KLAB 3VG9C 3PE9A 3VJ6B 3WNOA 3UMTA 3MLZH 2B5IC 2W65B 4OGZA 4Q74A 2ZUQC 4LLDA 5DZLA 5CP7B 2FHCA 4EI6B 1J5OL 5IQ7H 1EFXD 3ARED 4ZO6A 2H2SC 5D2LE 3WFZA 5ETUA 2A77L 4WEUD 4POZD 2EDXA 1EV2E 3IJSB 2AK4E 1L9NA 1IARB 2LVEA 1WT5A 1JRHH 3VWKD 5IFJB 3TO2B 3BIKA 1FAIH 1CT8B 2YRZA 3KPPA 4MZ2A 4JN2B 1KEMH 2CKBL 5JIHA 5CZVH 3EFFB 5F7EH 3ZSTA 1K4CB 5D9SB 4YHKH 4YDKH 1NBYA 2NY2B 1NAMB 4G42B 1CD8A 3N1MC 3LMJL 4URTB 1WAAE 5DS8B 1AJ7H 2E9IA 4L4VB 2VE6A 2BJML 2B39A 3RNQA 4NPYB 4GMTH 5ENWB 4UQ2B 3T0BA 4KQ3H 3DGGA 1RZJC 5D1QC 3ALXA 4LAQH 2Y6SC 5KVMC 1JV5B 2VDLH 3L7FB 3N1PC 3RWDA 4TNVF 3HFML 1LNUA 1P7KB 2YA2A 1XGTA 5T3XH 5HGHB 4XPFH 3TN0C 2ADFH 2M2DA 5DMKB 1YMHB 1CE6A 3RL1B 1KCVH 4J3VA 1LGVA 1CZ8H 4JZJC 3VG0L 2Z31B 2DDQL 4HKJB 4WUKL 3MRJB 3LKSA 1MQKH 3OAZK 4J1UB 5HHOE 4Y1AA 4YFLI 1F11A 3IETB 4FTVA 5GGUA 5IW1B 5GIRA 2CJUL 1IM3B 3RU8H 1VPOL 2ZZUT 4JDVB 4PRIA 4CNIA 5DI8B 5IB1A 1DBKL 4KK6D 3DMMA 4ZSOB 4KTDH 1U3HD 3WJLA 4FQXC 5DD1H 2EZ0C 2WP3T 3BIBX 4TUKL 1A6AB 2DQTH 1J8HA 3BZDA 3FB7B 3QZWB 4C54A 1GPOH 3T8XB 1I8LA 3EYOB 1R5IB 3GSNB 2DQJH 5IK3A 4UZGA 2CK2A 3VXRD 5GRYA 5DXWA 1HIMH 3LS4H 1IM9D 4E5XA 2IMNA 3L5JA 1JYNA 2KKQA 3GMNA 4CL7A 1YMMA 2XKSA 2R0ZL 2QQQA 5C2UB 4YXKH 4Z0XA 3H42L 1MI5E 5T1LB 2NY4D 1B6UA 4G80B 2HJKB 1ZLSL 3HRZA 1UFUA 3B2UD 2J4WL 3MV9E 4NOFA 1WITA 3W2DH 1AO7D 4AEHL 5I1JH 4OCMC 5GGVY 5C2BL 3EJZD 2YXFA 2B4CH 4R8WH 5DGRA 5JXEA 1IC5H 3GI8L 4NKQB 5EU4A 1MCPH 5CEZH 2VDML 4NO2A 1N8ZB 3PUCA 1W8OA 2GYSA 3BP6A 1OGTA 3EOAA 4JKPH 4NO0B 1CICD 1CFTA 4HWBA 3I50L 5IROC 4K71B 2HRPL 4F80A 1KJ2L 3OZ9L 4RGNC 5ADOL 4MAUH 5K9JH 3BZEA 3V5HB 4HMDA 3BVNB 4N8CL 1UCBH 4YBQC 3ZE1E 1OF2B 4TSAH 1IEHA 3FO1B 5EO1B 4X9FA 2XOTA 5GHWH 1R3IL 3FFDB 3IT8D 1FFQA 1HXYB 5AUMA 4XP4H 4I2XA 1IBGH 1ZSDB 3HUJE 1KFAL 4OZGA 4OM1H 3QJHB 1WWWX 3GO1L 1CLCA 3BPNC 4GG8A 3VFUB 5HHME 1F6FB 2XFXA 5SWZD 1MHCB 3EDJA 4JO4H 1ES0B 4QCIB 1HHJA 1ZT4B 3GMLA 4OSUL 3MMEB 3CUPA 3WFBH 3DV4A 1XCTA 2KUTA 3PWNB 2XIDA 3I85A 4YK4B 3TIEB 3C8KA 1HEZA 5D5MB 3S36H 3AROA 3FQNA 3TBVA 4M61A 2ADIA 3FOLB 5D2LF 4XT1C 2ZSWB 3NH7L 5C0DB 4KKCD 4Y88A 1A7PH 4EOWL 2H2PD 3WXVH 3IVKB 1MCOL 1I4FA 4QRUB 3DI2B 3QUYD 3CDCA 5D1ZC 5DQJA 5IBTH 3C08H 4CVWA 2RFXA 4RQQA 3KPLB 4M93C 2XNAB 1AGCB 2AJUL 1AKJB 3E3QC 1MNUH 4H25A 2NX5A 4XWGH 2OTUB 2WIIB 1N6UA 1WAAF 2IPKA 1KN4L 3DXAB 4YJZL 5IB4A 4M6NH 3UYRH 4NQXB 3ZDZE 2FEEL 4S1RH 3RTQD 4CU8A 1H5BB 2OCFD 3G5VA 2V2TB 4F3FB 2H32B 4G43A 3LRSA 4ZXBD 1A4KB 2EE6A 3ARBA 1NDMA 4OCYL 3U0TB 3WFEL 3IDYB 1RIUH 5JPMB 4R0LA 1VSCA 1UWGH 3KYOB 1MWAA 4L4TA 3U7AA 3WLBA 3D85B 3FFCE 1TVHA 3FB6B 4YDIH 3P4OB 4BZ1L 1Z3GL 5JORA 4MHHI 5EBGA 3EOBB 4PJFE 5HXMA 1FV1A 3MV8E 3ZDYE 3V7AG 3S5LA 4PY7A 2DLIA 2GJJA 3QR2A 5HPMB 1UJ3C 2QQLH 1U8PA 3P4LA 3X14B 5B38B 4IS6A 1ZVSB 2OL3L 3MX0A 1MCNA 3B43A 4XP1L 5JZ7C 5IJKA 5F89B 5IW6B 2VDRH 2HG5B 4MS8C 5TFSL 1P7HL 1X5FA 4XNUL 3G08A 4OBSA 4UV7L 1EX0A 3BQUC 1FH5L 4G8IA 5C07B 4X8JB 3VWJB 3AAZA 1MFAL 3MV7D 5DK0B 4PJAF 3SPVA 4QRPA 3MSPA 4O00A 1EEYB 1KN2L 2A6IA 3ZKXB 4PRPD 4WU5B 1Y6KR 5DD6A 4TNVK 4EN3B 4P4KC 2EYSA 5I19H 1YNTB 2X1XR 5I8OL 5J1AB 3P40A 4JFDE 1MJ8H 1TITA 3HC0B 5ITBH 4PRHD 2AXFB 1AR2A 2VXSL 2CDFA 1VFAB 4PRDA 1IGML 4ZODA 2ZSVB 3CD4A 1T21A 4O58L 4PJDF 5BZWA 2FNBA 3K8KA 1YNLL 4NJ9H 2MCG1 2Y06H 5HYSB 4JPVH 1BF2A 3WNNA 3CLEH 3U4EB 1RJLA 5F7NC 5D2LB 1QRKA 3QI9C 5FO7B 3I6GA 1CU4L 5TGBA 3TF7C 3PJSA 4NWUL 1EBAA 2AK4B 1OW0A 2GTZB 1ZHLB 4KC3B 2D9QB 3UEZA 2X4QB 3V6FB 4K8RL 2EDLA 4LIQE 1YEJL 5J6GA 5HGAA 1C7SA 4G8FB 1BFSA 1N6VA 4N0UA 3DTXB 5D7KD 4F7TB 5JOPE 3FT3B 4OD2B 2GJZA 3BESR 2A77H 4P2QD 3CSGA 3VGBA 3LDBC 1MEXL 1OLLA 1ZAGA 4GQ9H 2MTPA 3BJ91 2YN3A 1GAFH 5E6IA 1CR9L 3HZYA 4FQHB 4I1NB 3HUJF 3V0VB 1AIFA 4X80L 1A7RL 3PWJA 4GAJL 2AV1B 3KPOA 4GLRI 4K3EL 4X7FC 1X4XA 2APBA 4YPGB 3P4NB 2WWMD 4XNZC 4L8BA 4UTAL 1BWMA 4XPBH 4JFHD 4XZUA 1UC6A 1V3MA 2FB4L 4XH2B 3SBWC 4PJCE 4LCUA 3LMJH 4KROD 5I0ZA 2HT2D 5LVEA 5J13C 5L2KA 1G0XA 1PG7X 2BJMH 5IBUG 2APFA 1J12A 3T4AA 3HPLA 3LKOB 1D5BB 1GOFA 4DN3L 1YEDB 1YQ2A 1OB1A 1FZJB 3TNMA 5HHOB 2A6DA 5DFVC 1PEZA 5F3HA 1TJHL 3QQ4A 2AXJA 4ZOCA 2DTML 3VRIA 4IJ3C 4NRYA 5TF1L 4LLUA 4PJ5A 4MNQE 2KH2B 5DJXA 3BPLC 3DRQA 5TDOA 5HY9B 4QYOA 4PJBA 4M8QA 3O11B 2FSEB 5AAMA 1DBKH 4LHJB 4OKDA 4YX2L 5C09A 3ZDZF 1LE5A 5DT1L 4TQEL 4XVJL 2ADGA 3RVWD 1F3DJ 2CR3A 3QAZC 1EHNA 2APWA 2N56A 4HKXB 5D6CB 4U1KA 1N2RA 3EAKA 1CL7I 1HHGA 4NKIH 4RMSA 2O61A 4XP5H 4K2UL 2VTFA 3HI1A 3VH8A 3B9EA 5DEFB 5EU6E 4WFGD 4Z0BL 5B3JE 3MV9B 4FZEH 4WO4D 4XNYL 2HAZA 3UZVB 1J11A 3HMXH 4XPAL 4MDJB 3IFPB 4Z7VA 2IPUG 5GRWA 4PJFF