3TBYB

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (v3p, y4f)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system/agonist
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 13
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbyB00
2R4SL 1UH4A 4L8SA 1MHEB 5FHBL 1MQ8A 5I1DB 4LGPB 3WKNA 2IAMD 3UC0L 1QO3B 2K3TA 2WP3T 4P5KB 3MLVH 4CDHA 1B4JH 3ME0A 1A22B 3OR7A 4UNTA 1LMKA 5E2WH 4MA3A 2XQBL 2BY2A 3KJ4C 2Y5EA 4GRMA 3DROB 3O41B 2ICEB 3GMLA 4RGMC 4JANA 5K9QI 3KPOA 1LE5B 1FYTA 1N8ZA 1EVUA 4AIOA 4GXVH 4WFGE 3HUJA 3QDME 1MCWW 5L6YH 2FWOA 4H0GA 1FNHA 5EC2A 3CVIL 1FL6A 5DVLA 2CDEA 4GRWH 1BX2A 5GS0H 4ZODA 5BV7B 4GMTL 4DW2H 2E7BA 3CZJA 4N8PA 2BNUB 1T1XA 3MRDB 3ZKMD 1ZGLA 4YHKL 4JFPA 1F4XL 4OF0A 1QSED 1XIWC 4HJ0D 4R26L 1FC2D 2QTEA 3BP5B 3SDCA 3PHOB 3QBTB 4XPBH 5FF6B 2CLRA 1NLBL 4Z18A 3V79C 1NAML 1FYTD 1FFRA 5C3LD 5F96L 4GW4A 3WBDA 2P49B 1YYMH 4LPUA 4A2LA 3O3BA 4GW5A 3MRHA 2AK4A 2YD9A 3OMZA 2PCPA 1G9NL 4MA7H 4U49A 1SBSH 4OFVA 3EJZD 2YN3A 4HWZB 1QR4A 2YPLB 3GBLA 1A21A 5BRZA 1RK1B 3F62A 1SYVA 3HZKA 4G5ZL 4X6DB 4NRXB 2IADB 2J8UB 2YUWA 4LSSL 2FEDD 4U1HA 1G7PA 4XGZB 2G60L 3RWHB 3EFFB 2ITCA 5HGGS 4U1LB 1P69B 4LHJB 5ITBH 5DUPL 3ILQC 5F1OB 5DJXB 5JXAH 5HHME 1CICC 1RZFH 2ZPKH 1CD9B 3KPPB 4QLRA 4RGOL 3BO8B 3MRRA 1K8DA 1GGIH 4X7TA 4N90D 4LGSB 1JWMA 4YK4C 3AY4A 5CZVH 2OI9B 1FGVL 2QSCH 2WNGA 3K2UL 4FQ1L 4UZGA 2JELL 3JV5A 4MD5A 4HFUL 4BYHA 3P11L 2EC8A 4LVOC 1ZLSL 3OKNB 1B4JL 5HYSA 2BVPA 2R9HD 4U1NA 5EULV 4A6YB 1DCLA 4UTAL 4MA1B 1UM4H 4RGNB 4M6OH 1YA5A 5ECJE 1MHCA 1J8KA 2DQTH 2PW1B 4D9QE 4M6ML 1EEUA 2LVEA 2YK1L 5BZDA 2ARWA 3H9SD 4N90E 1IQWL 3PNWB 1D9KB 1LDSA 1TIUA 1CQYA 3VDBA 1QG3A 3CCHB 1U41A 1UZ8B 3VU2A 5IK3B 3QUMA 1DQTA 2NR6C 1MJUH 1HQRA 2QQKH 1HWHB 2EE2A 2ZUSA 2XN9D 3BP4A 3VRJB 5AEAA 4JQIH 1GYAA 3RZCB 2WSKA 5D9SB 4QGTA 1EGJA 3HNTH 3I50L 1HIML 3VFRA 2AEWA 3K46A 4M03A 5J9PA 1CDBA 1MFDH 3T2NH 3UEZA 3G6JA 2HJFB 1BGXH 4MA8H 5GQBA 4RRPA 3GBNL 2R2HA 3FO2A 1WV7T 4I48A 1CCZA 4KHTL 5JR1H 1EMTL 3KXFA 3QISA 1AFVL 3VMNA 5JLZA 5DVOA 5TE4L 1XF3B 1KBGL 4AT6A 2IBZX 4HT1H 5J1AB 1R5IA 3LKOB 2VABA 2BSTA 3EHBC 3RWCB 3CFEB 2F54D 1X4ZA 1IQWH 2DIAA 3JSSA 3I9GH 3T77B 3LQMA 2IANA 4G8FB 4PJGF 2YN5A 3WFDH 3WUZA 3OB8A 4O51B 1TVBA 1PGRB 5SX4H 1IEHA 4FMFA 4M7LT 3X14A 3BPOC 4J12A 3GIZH 1NGXB 4PJCA 4JFYB 1OAZL 3FQXB 5TDOA 4ZFGL 4OZ4A 1H3WM 1DQMH 1G0XA 1OTUD 5GGVY 2DWEB 1Z2KA 1ZLUH 1R3HB 4X9FA 4D9LH 12E8H 4Z5RB 2VMFA 1CU4H 4OSUL 5F9DC 3STLB 5HYQB 3OG6B 3KLDA 4L8DB 5CZVL 4UAOC 5J13C 1GGIL 2CRMA 4KI1A 4PS4L 3QYCA 4MCZB 4N8CH 5C71A 5JA8B 2YD6A 1IAIM 4M62H 4N9GB 4X5XA 4QRRA 2DQEH 2Y36L 3CDFA 3VFOA 2X44D 3RKDD 1BBJA 1LO0H 3GMLB 3FT4B 1JZ8A 3MRGA 3ARRA 4QCIB 4R9HA 1NGQL 3CH1B 1BBDH 2J8HA 5SWZD 1JTOA 2JJSA 1BVKA 1I1FA 4JFQB 4KDTA 5GPRA 4KJYA 4Z7VE 3WN5A 4XP6H 3TFKC 2KDGA 3ALXA 1CFNB 5HYQA 4ZTPL 2J8UE 3ILQD 4L9LA 1RMFL 4W4NA 2YOCA 1NBVL 2NYYD 1UM4L 2HT3D 2WLYA 4DOHE 4I0KA 5EO0B 4PJ7B 3KPNA 4F58H 4FFWD 4QHMB 5DJ2B 2IPKB 3GGWB 4K55A 5BMFH 4HMCA 2CGRH 3BKCH 4JDTH 5CBAA 1JPSH 3FQTA 2HVKA 1HN1A 1EHNA 5DVKA 1I7UA 1KEGH 4P4KC 3FO9B 3CMGA 3HE6D 5SWZA 1Q9OB 4TNWK 5CWSA 1J05B 3DI3B 2AV7B 2VDRL 3WFCH 4KRLB 3UYPA 3VE0A 3QRGL 3EO0B 4FTVD 5J56B 5IVNA 3V7AE 1OP3H 5DSCB 3OR6A 4U2YA 2X89D 4QY8A 5IM7B 4RGNC 2B8OT 1DQQA 1NC4D 1YDPB 5FOBA 4NUGL 4NQUA 4U3XA 2XT1B 4BSWB 3UDWA 1LVEA 3EDEA 4OCYH 3WEXA 2HTLC 4XPHH 5DEFB 4AEFA 3DETC 3MYJA 3MFFB 3Q6FB 2X41A 3FN3A 4NQCB 4XP4H 1S9WB 2ZPKL 3IDGA 1X3DA 2AS5M 4X80H 1G7IB 4FZEH 1O5DT 5K9OB 3MLRL 3TA3D 5KAQG 3K74B 3VRLF 1PLGL 4K3JL 1K3IA 5EO9A 3RGVA 3QIBD 4C56A 5TDNB 3EO0A 1I8MA 4XBEL 3HG1D 3ARFD 1YEDB 4DJMA 4KQ4L 4K23H 4YFLF 5K9OA 1NC4A 4UQ3B 5DGQA 2EH8H 4IRSD 4JO2H 1PJ9A 2NLJB 4FG6D 4ZPTB 3NCYP 2OL3H 3T2OA 4CRPA 1NEZA 1LHZA 1QPXA 2NY2B 1WCQA 3P0YL 5H35B 3VGAC 3ARDD 2NY0D 4PGZA 4LCWA 5I9QC 2BC4B 1NCCH 2Q1EA 4X98A 3ARUA 3RTQB 1XF4B 1ES0A 3GSWB 4DWHA 1JGUH 2HG5B 4HS3A 3U4EA 3CFCH 4ODHH 3QIBB 1VFBB 4P2YA 3IDNB 1U93B 1MCOH 2E7MA 2WZPD 3E8UH 3K8KA 3A0OA 4L8BB 5GGTL 2Z35B 1EBAA 4CW1A 5CWSB 3H3KA 1PQZA 3DPBA 3QNXA 4LLDB 4LHUG 1SQ2N 1UENA 1MFCL 1VFOA 1TQCC 2F58H 1MIEL 3P9MB 2WP3O 4LIQE 5F3HA 4UIMB 1EO7A 1W8NA 4XWGH 1CE6B 2RJMA 4RISH 1WCBA 4ZDHB 1V3KA 5HHVL 5KVMC 1DJSA 2F5BH 3DRTB 3MREA 2VERN 3C2AL 3EYQD 1GGCH 4YO0B 1SYVB 2FECI 32C2B 4JLRA 3VFPA 1UQSB 4I77L 5EU5A 5A43C 3RWGA 3O6KL 4XT1C 2C1OB 4LCYA 4QXUL 1EPFA 1ZHLB 1A0QH 3F8UB 4HWZA 4Y4HD 4WEUD 4ZOCA 3CH1A 3TH2T 4LCCA 5I1JH 3EZ8A 1KLGB 1N59B 3OJMB 5GGQH 2P8PA 1YPZA 3NFNB 3CPLB 4M9PA 5DJYB 3EGSB 5FUOH 4JVWA 5I16B 3X3FH 3EDJA 2IQAA 5DFVC 3MV9B 4OLXL 3U7YH 1BF8A 4PG2A 3PHOA 1RAMA 5ANME 2YBRA 2GIYA 3L5XH 5FYLL 5C08D 4YFEA 1BFOB 2F54A 3OKOB 4JJHA 4FXGB 4LCUA 1JNLL 4RZCA 1OARL 2HTKC 4DAGL 1U3HB 4E42A 5SV3A 4BA8A 3L6FA 4NQEA 3MRNA 2VKXA 1FPTH 4LCWB 1CLZL 1M71B 2V9QA 1MCKA 3VXQB 4DKEL 3EYFA 1KSRA 4PGCB 1UH2A 3NABH 3V4VL 2BSSA 2D7MA 5DUBB 4O00A 4H20H 3EDDA 4WWKC 4MJIE 3UZQA 3VFTA 3KPLA 1LO2L 3DVNA 4ZD3L 2OM5A 3CFEA 4G9DA 5T33H 5EFIA 1RHFA 2BDNL 3NCJL 5F7WC 2ADFH 3RTQD 4H25A 1G9MC 3PP4H 4ELMF 5HHOB 1D9KA 3QIWA 2E5EA 3ISWA 4YHML 5F3BA 1NMAH 4ZO8A 4GBXB 2X89A 2R8SH 4P4RA 4KDTC 1CDIA 1KNOB 2IPTL 1S7WB 5SWSA 3KHQA 1BHGA 4WFGD 1K8IA 3UPCA 1I9JH 3G08A 4AL8H 3LD8B 3EOYG 4JM2D 2OS7A 5LGHL 1A6ZA 3MLRH 3THMH 1DVFD 1E4XI 2J6EH 5AYQA 2V5SA 5T5FL 4NO0B 5IMLA 2VQ1B 2NY2C 2W9EH 1KB5H 4Z0BH 1GL4B 1MAMH 2F53B 3LKRB 2ZKHH 5TF1L 2VL5B 1FGVH 4X7EC 3UTQA 3FOLA 3L3KB 3D9AL 3DV6B 4BUGA 4QEGA 1FNGB 3NIDF 3VFGL 5F1NA 3CZFA 1MCNA 2ZOKB 5F89B 2XTJE 4IMKC 2VDOL 5BXFB 4ZFOL 1PYWA 2QADB 1IC1A 3RVUD 1CLCA 4OZHB 4F7TA 1NEZB 1LGVA 2B20A 3TBSB 5A1AA 5ESAA 4GMSH 4GKNA 2NLJA 4NZUH 3RWHA 3VFNB 4GRWF 1U6AL 3L3DB 4R7NA 4JZOB 4L3EA 4CVWA 3JTSA 2QLVB 3BESR 1L7IH 4L1HA 4L9LB 5ISZB 2F19L 1MUJB 1CFTA 4NC0B 4ISVA 4MWFB 1FH5H 2OZ4L 4JFHE 3V5KB 4XNMB 1CXHA 2ICWB 3OGCA 43C9B 2JIXB 5TPWL 5DJZA 3KPRE 2GY7B 2PCPB 4YAQB 5DLML 4ZS7L 3BKYL 5AAWA 3NZ8A 1B3JA 4JQVA 3RVXC 1PX3A 1S7QA 2V17L 3ZTNH 1K4CB 4MB4A 5IMKB 5L9DL 1A1OA 1A02N 4A2MA 4YXHH 1LD9A 4PRID 1JGEA 2R1WA 3T0WA 4G9FD 5I0DA 5HYJE 5F72S 2OJZH 3GEWB 1A2YA 3V0WL 1HEZA 3TIDA 1KPUB 4Z5RA 4Z7NF 5IM7A 4V2BA 3BHBB 3RWDB 3RVXD 5F7DB 3G9AB 5ICXB 3U83A 3O2VH 2FECL 5DRWA 1TJHL 1T83A 1KIRB 2P4AB 4LSRL 1KJ3L 1SMOA 4HUUA 2X7LA 4Y19E 3BQUA 3CLEH 2OR9H 3SKUD 3ARGB 1P84J 3MCG1 2V7NA 1KIQB 4GKOA 3X3GH 4YDLC 1WLHA 2YD5A 2MHAB 4F7EB 4YHMH 5AZEL 1HQ4B 2F74A 3RL2A 4F7MA 2YA1A 5CBAB 5I1AA 4ZS7H 1CI5A 3KWWA 4F58L 5GISH 1OB1B 1ZHLA 4PTUB 5I74C 1EGJL 4RFOH 4XVSH 2ERJB 4PGDB 2A77L 2YPLD 5FEBA 3S34L 1KTLA 3KDMB 4WI9A 3WIIH 4PB0H 2Y06L 5EWIL 1KPVB 1I7RA 4LAJH 2C3WA 4UIMA 4Y4HC 1RJLB 1IL1A 4NO5A 2EYSA 5BV7H 1SMAA 1SJEB 1CFSB 3FT2A 3T0EC 3IXAB 1G7JB 3HE7A 1FYTB 3CFIC 4G43B 3T4YB 1UZ6F 1A3RL 3RIAK 5GS1A 4G8EA 3BDBA 4ZD3H 4LF3B 5EO1A 3FJTA 2D03L 4MA8L 2VB5A 2HT4D 1S3KH 4MXQD 1U93A 3N1QC 3QQ3A 1F90L 4K7PY 2V2XA 4JZJC 2GTZA 4JKLA 3PWJB 3B6SB 1V7MH 4HWBA 2FD6L 4UT6H 4O2EB 1JMXA 1R3HA 3QEQB 2VLLA 4QKXB 5CZXC 2X4OB 2J6EL 4PJ7F 3V0VB 3M1BB 4PRDB 5C09D 1QFWH 4OBSA 1OTSD 4KRPC 1ZTXH 1N2RA 3MLYL 3MUGB 1T3FB 1I8IB 3DHMA 1U3HD 4X7CC 4I3RH 5CGMA 3WIIL 1V5JA 5GHWL 4B7IA 1FE8L 5JPNA 3RWCA 3BMWA 3NCJH 2APBA 4ODVL 1Z9OA 2XG5A 1AFVH 2ORBL 2R56H 1EMTH 2BVQB 5MEQA 5DMKA 4G42B 5C6TH 5MI0C 3HUJE 5IT2L 1W72A 3OSKA 3KVQA 4LNVA 2R0WH 4LLQA 4BZ1H 4PV9A 4FNLL 4L4VB 4BZYA 4XPFH 1G9NC 3ARZA 4P2RD 3VG9B 4OD2B 1ZEAL 2APWA 3CVHH 3HMWH 4Y4HB 2HJLB 4QXTB 3BWAA 2YPVL 3GI9L 3ULVD 4IRZH 3WIFA 2HFFA 5D6DA 4YX2L 1DBJH 5C07B 2J4WL 3EJJX 3QAZC 2DI8A 1RUPH 2VLKA 1U92A 4Y1AA 4NZDA 5BVJA 2NTSP 2VQTA 1RFDH 4LLVB 4K7PH 3A6BH 3VXUA 3MRHB 4LLMB 4CVZA 1VFUA 5GRJH 4GRLC 2UUDK 1Z5LB 2AJYH 4YXHL 2OJZL 2ED8A 5CUSH 5BJTB 1IC4L 2O61B 3WD5H 2CLRB 2QSVA 4NOBA 3N9GL 3IXTA 3I6KB 4JRXA 1G9NH 4U05A 3UXFA 3NA9L 1JGDB 4MX7A 3U6RA 5F6HI 1FNEB 2BHUA 3VFVA 1KIUA 3CVHA 4W4OA 4WFFE 1E27A 5DJ8A 5C0AA 2J7LA 5JOFB 3BJLA 3TV3L 4FQPA 1RIUH 2H2SD 5DMYA 1S7XB 5FB8A 2F8XC 4OCYL 2BHZA 3CFKB 4KTYA 1FZMB 4U33A 4BQBA 1J9CT 3QXAA 4KY1H 2K1MA 1ZS8A 1U3JA 1FFQA 4HUMB 4UINH 2ICEA 5INCA 5DD0L 1Q1JL 4GRMB 4MCZA 4OF6A 3SQOL 3T8XB 3A67H 3RIFF 3GMQA 2EKJA 2XA8L 4NN7B 4NRZB 2BNQE 3ARPA 3VXSB 5FXCH 3ARFB 2NTFB 5MHSD 4U1HB 1ZKAA 2GTWA 2VDRH 2P5EA 3STLA 5DJAA 5GJSL 2L7UA 2V7HB 3H9HB 4XX1G 1DTUA 2VISB 2JK5B 3UTTD 1XH3B 4PR5A 4CVXA 3GMNB 2NR6D 2PXYC 4YXKL 4M61A 3PWUA 3ZKXB 4OZ4B 2YMXH 4R2GB 3PGFH 5GRZA 4BFIB 3EO9L 3HAEG 3GJEB 3TYFB 3DMMC 1WK0A 3MJ7A 4JDZA 2AW2A 2R56L 4BH7B 3TYGL 4MD4A 1D5BB 3KPSD 4JFFA 3LS4H 4MAYD 3PWPA 4KXZI 5KS9B 1AO7A 2Q7YA 2VWEE 1P4BH 5DHYB 3WNKA 4YQXL 5CLWA 1F58H 3MBXL 5T33L 4ZG1A 1CDJA 5GGSB 1U8MA 1PLGH 1HSAB 4XTRC 4TVPE 4LAQL 4DN4L 4RMQA 4LPWA 3TT1H 4KKAC 3SJVB 5JTWA 1H8NA 3PWLA 2WLZA 2HJFA 5ADOH 1VESA 3W9EA 2FWOB 4EOWL 3FFDA 2YA0A 1L0QA 4YHLH 4Q7DA 3GJFH 3E6FB 1JF5A 2FJFA 4Y16B 2CO7B 1FP5A 4N68A 5GRJL 3ULUC 1TTFA 2ZNWA 5F7NC 3DUSB 1CLZH 1M05A 5J12B 2FO4A 1FO0L 1QBML 2IMNA 1IARB 2X4RA 3C08H 4YR6B 3SQBA 4UV4L 3IFOA 1HXYA 5FUZL 3VFSB 1G0YR 2AJXH 2BOCB 1CE1H 1K85A 2P47B 3K4ZA 2XY2A 1EX0A 2DQGL 5FA4B 4OLXH 3U7YL 1S8DB 4PJCE 4HJGA 3VFSA 4KUZL 1MHCB 4MVBC 3F7VB 3VJ6B 5EZOH 1IAKA 4YR6A 2AEQH 5CCKH 4PJ7E 4KJWC 4OKVB 3PWVB 4X5WB 5D6CB 1UH3A 3SGKA 3V52H 3LKQB 4S2SA 1J7VR 1BMGA 3MJ9L 3C5SB 5T1DH 3FQRA 1R0AL 4ZFGH 2VXSL 3P77A 3D18A 1KT2B 4LDOB 1RMFH 4AIZA 4GS7C 4GLRI 3QXDB 3C5ZD 3GIZL 3RWFB 4RMVA 4GAJH 1AY1L 1TZIB 1JWMB 4X6CE 1LEIB 3TF7C 5I1LB 1WTLA 2DLTA 4QRPE 3RUGA 3NCYS 2PTTA 4V1DD 4YDKH 2NY6B 4EN3B 1L7TL 4PJ8C 1A7QH 2HLFD 4YEFA 5DQJB 2A74B 4H0IA 5JW4Q 5F6IC 5I1HH 5EUOF 3LEXA 4CN6A 4G6AD 5D1XD 1TVHA 4YWGH 3UTPE 1AR2A 2Y72A 3HTLX 4R8WL 4Z7QF 1R3KA 1OAXH 1K4DB 1EAJA 3MLXH 1JPFA 5KSBE 3T0EE 5GSVA 3V95A 5ICZA 3QIWD 4FQIH 5GIRA 1BJ1H 4ZPVA 1I3UA 1JIBA 5IJKC 2OSLA 3MRJB 4JFDB 4PRDA 3S35H 3RHWK 5GRUH 5E2UH 4BQ9A 2VJXA 2EDBA 3BI9X 5JQHC 1DQML 1ETZB 3U0TA 4YHOH 2PF6A 1PEWA 1MHHA 1HI6B 3T1FB 2GI7A 3B2VH 5C0ND 5SWZE 4XPAH 1AD0A 5J4MA 1V3LA 3KHOA 2DWDB 4JPVH 4EEEA 3MLWL 2NY3B 2VN4A 1Q9LA 4MJ5B 5HI3C 4GAYB 1QSEE 1ZLWK 2DD8L 3GMQB 5JIHA 3AC0A 2FB4L 4JFPB 2Y5TB 3ORJA 4HC1H 4KWUA 4KMTH 1AXTL 1D5IH 4KJQD 2BNUA 2Z91B 3GDBA 3HCVB 5EUOB 3WS6A 2VDNH 3GI8H 4LSQH 4M6NH 4LU5H 1BX2B 2H1PL 1EZVX 3U79A 1JPGB 5KVFL 5CGTA 2AKRA 3VFGH 4P2CG 3JTTA 4KK8D 5DEGA 4ZYKA 3KDMA 1S78D 1EEZA 4P2QB 2Z91A 1JGDA 4MX7B 1MWAB 1QSFB 4PTUA 2YD7A 1CGVA 2CK0H 4XTRD 4D0BA 4HLZH 5IP4A 2D2OA 4C56E 1TJGL 4H1LG 1FIGH 4JRYE 4JRWA 3F65A 1T6VN 3G5ZB 4QNPF 3QO1B 2YKLH 4U1KA 1UEMA 4N8VB 5D1QC 3PXJA 1BFVH 5JORA 3TYFA 3U0TB 2CIKB 1L0XA 1U8JB 3H7BA 1ORSA 3BGAA 3W9DA 5E6ZA 4WHCA 1NGZA 4D3CL 1NDMB 2L0DA 3CX5K 4RGNE 3WSQH 5F7DA 3WS6C 5FYKE 1Y6MR 1A7PL 1ADQA 4OZFA 1BLNA 3BWAB 3HI6L 3RKDC 1AQKL 3KNBB 5IB5A 3VH8A 4ERSL 3IU4H 1V7NL 1T1ZB 1F4YL 4Q6IB 1KC5H 5FECB 4OGXL 3VD4A 2XZCH 3MBEA 1T22A 4HHAB 2F19H 5C6PB 1ONQB 1MSPA 3VRIB 2GJJA 1HDMB 5GSRA 1ZVSB 1JI1A 1I1AA 2YUXA 2YEZB 4O2CB 2DKSA 4YHKH 3KPSA 3UTSA 2F5AH 2ADJB 3ULVF 2N56A 3C6LB 3QXDA 5CJ8A 1DBBH 1OP9A 3P77B 2CO6B 4PBWD 3F7RA 2APTA 2I26N 4XVUC 1PAMA 5C0IA 1BWWA 1I8IA 1JWUA 2C9AA 2GY5A 4DZ8A 4R7NB 4U0RB 5F7KC 5D6CA 5FUCE 3IS1X 1MFEH 3CFBB 1OP5H 3U1SL 1S7VB 1WVZA 1BD2D 2BSRA 4TSCL 1TZGL 2H41A 3BP7B 1EA9C 3T2PA 4IM8A 4DGVH 4P3WA 4OM0H 2VXQH 3F7VA 3TIEB 4Y2OA 3CAFA 4ONGH 4YIQA 1HYSC 1DN0A 1R3LA 1MVUB 2GFBA 1SM3L 1I1AB 2ZOKA 4ZUSA 1YMHA 5F6HJ 3VRIA 4M6NL 3QUXC 2JJTC 5L2KA 4UIKH 1G9MH 3WJJA 3B5HA 1U58A 2MKLC 3RIAF 5BW7C 2YHGA 3O6KH 2GSIA 1HZHH 3JWNC 4AM0A 4JFZL 1A8JH 5DT1H 3VXOB 4M6MH 2J2ZA 4PG2C 3FO0L 3RRQA 1I7TB 3DGCR 3H3PH 2QL1A 4HZLA 2Q3AA 1A6WL 3C5ZA 4XWGL 3I9GL 3X13A 1D9KD 3N06B 5F71A 2JJUA 4LLWB 1WGOA 4NQEE 4P2OB 4G7YL 5JO5B 4N0CC 5IW6B 5KTEL 2PN5A 4ACPA 5SWSD 1D6EA 2RCSH 3IDIA 3RZCC 1KPVA 1TENA 3W2DL 1HHKA 4JPIB 1A0QL 4RMRA 1JE6A 1FHGA 1T0MB 2YD4A 4KTEL 4N8VA 4Z7UB 5KW9L 3TJHD 5DDHA 2WBJD 3PWNA 3TN0A 4RSVA 5I66A 5KSAB 1QFWM 3BPOB 5JHDB 4MB5A 4NM4H 1T66D 1H3PH 4YUEL 1AO7B 5HGAA 1MWAA 4WUKL 1S9KC 2F58L 1UACL 1BM3L 2ADIA 3FAXA 4WHTB 5IQ9B 1KFAL 4UOJA 5FYJL 3JTTB 1EHLL 3EO1A 2DMKA 3ROOA 3TNNA 2AKRB 3T09A 5SWSE 2MKWA 5CEXA 2R15A 4HUKB 1DBKL 2UY6A 4JN1L 2X2YA 4ZFZA 4XI5C 3C8DA 4NQEB 3C5ZC 3DX8A 4S1DC 3GMNA 3AFLA 2VE6B 4HIHA 3UTOA 3HNSL 5IGXL 1WC7A 3O3DB 5AYUL 2X40A 4NZTH 5FK9A 4P5TB 1P53A 4ZO6A 3TNMA 2D0FA 4QHUA 1AGCB 1HILB 2A0LC 3NFPA 3HR5B 3A6CH 3GMOA 1FCCA 1FVEB 5JA9A 2HFGH 4YHYC 2DQHL 2ZUTA 5EO1B 4UT9H 1A7RL 1WC7B 3QDMD 2HKHH 4KTDH 3N1MC 1B4RA 2ADGA 4U1SB 1N3NB 2MCPH 3OKLB 1NL0L 2EKSA 4YHPA 3HMXL 4JHWL 3MMEB 3PUCA 5TE7L 3MOAH 4PLKD 5GS0C 1Z9SA 3BP6A 2VNCA 3QHTC 1FCGA 1ZOXA 2C1OA 4NQVA 3U4AA 5FO8A 4N0FB 4XPGL 5IFAL 5KBNC 3BYYA 1N5AB 2WQRA 1ZV5A 5IIEA 5L8LB 4Y89A 3ARBC 3FHQA 3QUYD 3JV6A 3U46A 4GXUN 1CZ8L 3GSNB 2DQFB 5IVXA 4PJHF 4CDGC 4ETQA 1AGFA 3GMMB 4PD4J 4X7DC 4U3HA 4UDTB 2XRAH 2NZ9C 2YUZA 4U31A 4X7SH 3ZE1E 4BKLB 4C58B 3QG7L 4DGIL 3FOLB 3L3KA 3VXRD 4R7DB 2FJGB 3MRCB 1E28B 3FRUA 3PG2A 2EO1A 2Q8AL 1KCVH 5HYJA 4NBYB 4CGTA 4UU9A 1FG2A 4LLUA 4BFGA 3VXNB 1JTTA 4GRWB 4G6KH 3IAPA 1QBBA 1INQA 1NLBH 2DD8H 2J8UF 4XP9H 5C0CE 5BS0A 4R0LB 3VG0H 1R24A 2ENYA 3C6SA 4NHCH 3PP4L 2CGRL 3B8YA 1DEDA 2IG2L 2OTWB 2BDNH 4OZFG 4HBCL 3QPQD 3U0WL 3DUUA 4X5LA 3GNML 3B2UC 1HHGA 2PYED 4HKJA 5K33A 3BUYB 4Z7OE 1KN2L 4XVTH 3TIEA 2Q6WB 1ZEAH 3H0TB 5T1LA 2X1WL 5HVWA 3BP7A 5L2KD 5EZIH 4BSVB 1J11A 3D85B 2YD8A 3LZFL 1UYWH 3SDDA 1BQHA 5EU6E 5KSBF 5J3HC 1XIWB 2NQCA 2XYCA 2B1HH 2W0KA 4X6FA 3VWJC 5K9KA 1NANH 2JTDA 3QWRA 1UWGH 1RZGB 4HEPG 1MPAH 3T3MF 5EU4B 2H2PC 2PYEE 3BD3A 1HYSD 4FRWA 4D8PA 5I30H 2UZIH 5EUOE 2X1OA 5CZXD 2NXYC 3MA9L 3FQWA 3PV6A 1GC1L 4JQXC 5D7LA 3V8CA 4PJ5E 4AENA 2KUTA 1JPSL 4LLUB 1AY1H 3FQNB 4G80A 1QSFD 1BF2A 4WEBH 1X44A 3RL1B 4KKBC 2VZ1A 4R4FH 3F7YB 4Q0XL 1FVCB 1KEML 3AROA 1OAZH 5GRUL 3LKSB 4BH7A 5TH2B 4IOFD 1EHAA 5TDPA 5C0JA 2PYEB 5ADPL 3RFZC 3V6OE 1JV5A 2HVKB 3AXLA 4LCCB 4HPYH 5HYFA 5A2KH 4BQ8A 4OCSH 2YD3A 1K5NB 4KUZH 4UV7L 5ELIA 4HW6A 3ES6B 1EAPB 2LE9A 4CVXB 3MROA 4UB0L 1UQSA 5EU5B 3BSZL 2MQCA 1KPRA 5EU6B 4PUBH 1QLEH 3U36A 1SVZA 4WO4D 2AJSL 3BPCB 1O7SA 3AAZB 1AGDA 1Z6JT 3WN5B 4DEPB 4ZDHA 1NLDH 4I3SL 3RKPA 1EZVY 2AJVL 3QDHA 1B90A 5K9JH 2EKSB 1BIIA 1YPZF 2F8OA 4CJ0A 1CU4L 1ERNA 3S36X 5DD3H 3CUPB 4GG6E 4LBEB 5I18H 2PNDA 1ORQB 2EZ0C 3NZHL 2Q76A 1H3TA 3IVKA 1MCLA 4K94H 3VXQA 3CFJB 3QJFA 5DWUH 1JPGA 4U7SA 4MD0B 5I1IL 5J6HA 2DLGA 1AGCA 4H1LB 4F7PB 5D2NB 4PJ9C 2H32H 4XRCB 5D7JC 5DA4A 1OAYL 4WTWA 2PTUA 1RUQL 1A7NL 3MGOA 3ZKXC 1HHJA 1HEZB 4OQTH 5HSFA 5KSUB 3GMRB 4PY8J 1T89C 4JO4L 1Z9MA 5T5NF 3FO0H 3I6KA 4JRXB 2APVA 1AP2B 3KPMB 5DJ6A 4AEIL 2FIKA 4KDVA 1T21A 3HNVL 3O2DA 1I3RB 2QQLH 4YH6A 4ZS6D 2DI7A 1LNUA 4EBQH 4C55A 1QBLH 4LBEA 4PYGA 2DBLL 4WHTA 1RUMH 2YKLL 4HH9A 4MB3A 3WLWD 4HX1A 2AEIT 4NKDA 2JIXA 4KV5F 5T3XD 3V5KA 1OTTD 2QKIA 3HNTL 3LVEA 4PREB 4I18A 3E0GA 3N85H 3H42L 4XH2A 3RBSA 3W11D 4IRJC 3F58L 5ETUB 3JTSB 3RPIB 5CBEA 2V9RA 1JRHL 3O6FB 3IDIB 1FJ1A 3PABB 4KV5E 1T6WA 3IJYB 5JHLL 3BGMB 4JY5L 1AXTH 5ACLA 5F89A 1B6UA 5BZWB 1AGEB 5ESVA 1KCSL 1AC6A 5F1NB 2PTTB 1EEQA 1J10A 1CLOL 3G5XA 5E9DE 1LDPL 3R06B 3U4BL 4YXLL 1JZ4A 3K81A 4NZUL 4NN6B 5T3XE 1Q72H 1P7KA 2VL5A 1F4YH 1QHPA 5HHXH 1TPXC 2BY1A 5SWQA 5C07D 4ODUB 1F11B 4LSPH 5D2LF 2P5EE 4M1GL 3TC9A 5EDXA 3VXPB 3SE9H 1LWRA 2H2PD 3QIUB 3GSXA 4LKCB 5B8CA 1GC1C 4YBLB 4YIQB 1ZE3C 3UJTH 5F21B 3RA7L 1CGXA 4JY6A 3SCMA 1S7WA 5DD3L 5SWSB 3NFSH 3UJIL 1A9BB 3QULB 1C5CL 4JFOB 3RWEB 4JFFE 3EOAB 4TVSa 2PW2A 4BH8A 4JRYD 4CMMA 4R8WH 4XBGA 5FYJH 2DMCA 1AO7E 4EZMA 1J1OL 2JCCF 4IMKA 5EOCH 3RGVB 3B9DA 3SDDD 4G8GD 1XCQB 4JB9H 5HDBE 2FATH 1IEBB 3C09C 1J8HB 4UB0H 15C8L 4YUEH 3CVHL 1SEBB 3HMWL 4CKVX 3UPRB 1X5FA 1CGSH 1X6LA 1G7JA 2FR4B 1IT9L 3LH2L 2HRLA 4J6RL 4K7FB 5J3HD 1EUTA 4MYWB 4QT5A 4M5ZL 3OJDA 3IJYA 1I1AD 3FB5B 4J23A 3LEVH 1YQVL 3C6SB 3SGKC 2GJ6A 5TF0A 1BQHG 2VXTL 4NGHH 2ICWI 5E2VH 4PBXA 1HSBB 4LHUA 1RUML 5D5MB 3MRKA 1YDPA 2AABH 5EBMB 1MY7A 1JZ6A 3T04D 1PY4A 1FLRH 4Y4KB 1MFBH 1A6AA 2XWBB 4ZXBD 3B2UD 4G8GA 1OB1A 3WE6A 1IC4H 5IBTH 4ZUUB 2DLFL 2YBRB 4I13B 3WFEH 1GHFL 1NFIA 3FAWA 2IQAB 2XZZA 3PHSA 4YHYB 5HY9A 1M7XA 3QHZH 5F9AC 3TBWA 2PETA 5LBSL 5IR1B 3SDXE 3O3BB 3KR3H 3LQZA 4PJEA 4EDXA 3KYNB 1KLGA 4YE4H 3DYMA 2FGZA 1LILA 1V8HA 5I1EH 3SKOB 2ZUXA 4XCCH 43CAB 4X6CF 3W0WE 2ZP0T 4J3OC 5D93C 2HWZL 4ZUTA 2VABB 1XH3A 4PR5B 4PJ7A 2DYPD 3ET9F 1A6AB 2HKFL 2W59A 3MRDA 3OTTA 3NIFF 4G6AC 5D1XC 1OSPL 3TESA 3LAFA 4YDIH 5DEGB 4LNRB 1VSCA 3FB8A 3OX8A 4H1LA 3ZSTA 2Y23A 1WAAA 2R1WB 3QUKA 1J5OH 1CE6A 5F7LB 4ODWA 4Y4FB 5I2IA 1QLFA 5EC2B 4X6CA 3B8SA 1VGKA 3T65A 2G9HA 4N5ED 2QV2A 1E4XH 2AJSH 1IBGH 3OKLA 4Z78A 3HCVA 2EH7L 1OAUL 3QXAB 3QFJA 4GQ9L 2BNRA 3O9WD 1UM6L 3MGAA 5MERB 1HHIB 1P4LA 4ZAKC 2ADFL 4RFNC 4QTIL 1NGPH 2XA3A 1MCEA 1BREA 4BH8B 1MUJA 4Z8FH 3LS4L 3RWEA 5C92A 3VFNA 5KSBA 3S37L 3E3QC 2C3GA 3DVGB 4K3DH 2P45B 5E1HB 4U4BA 5GS1C 4PP2A 4NUJB 2YMXL 1NSNH 4BZ2L 3HAEB 3ARWA 4TUKH 4LOUD 2EXWD 5BXFA 4M3KB 5FM5M 2AXJA 4M4RA 2NPLX 1U2HA 1YY8A 3SGJC 1KJ2L 4CU7A 5DJCA 1FRGH 4CMHB 4WU5A 5FUZH 3S97C 3WLWC 2B0SL 3VGHA 3T0DA 4F9LA 3VFMB 1CE1L 4KKAD 4X8XA 4N9OB 1JL8A 2R29L 1ITBB 2GJZA 4J1UA 2JCCA 1T2XA 2E3VA 4RMWA 5JHDA 2BVOA 3Q1SH 2D7PA 6FABL 5HI5D 2X9XA 4CNIB 2E6QA 2O93L 5JMOC 3WFEL 4EI6A 5DS8A 3KXFB 1IM3A 3LZFH 3VXUD 4FQHA 2DLFH 3RUGB 5F9JA 5C0BE 1R3IH 5FO9B 3M8OL 4KVNH 4TQEL 4M7ZB 3QEQD 4YHIA 5H37H 4XAKE 1BVLB 1F6AB 5DEZA 4XVTL 4BSWA 4AIZB 1A7RH 2FJHA 3EYSL 4M7KH 3KLHD 4TUJA 5DMKB 4GBXA 5D7SL 4JE4B 1F4WL 4DVRH 3DXAD 4EI6B 3TO4B 2XG4A 3QIWB 2ZJSL 1J0IA 4I18B 5FKPB 4AJ0A 3BIKB 5JW3L 3DGGB 5JUEL 1IT9H 3LH2H 1FBIL 4L4JA 4GFTB 4XBPA 4JRYA 5T1MB 2DTMH 4F37K 4UNUA 4JG0L 3WKMH 1UT9A 3BUYA 4PYHA 4XCFL 2OYPA 5DJCB 5HDQH 4OTXH 5F7HA 1I7UB 5HXMA 2Z92B 3X11A 5HGHB 1P1ZA 1JFQH 3E2HB 3TVMB 1MVFA 4V1DB 3CFDB 4Y19B 4JFDE 2LAAA 4PRHE 1OOAA 2XKNB 4GBXD 3UBXI 4JN2A 4M7LL 3FQUA 1OT1A 4Z7OF 1S9YA 3HS0B 4OF3A 2ILLA 1NFDA 2GKIA 5HYJD 2YPVH 4KK6D 1H3PL 1I1CA 3O8XC 2V2XB 3QEUA 5FO7B 3MNWB 3DVIA 1E0OB 1ZK9A 3WNMA 4EI5A 1N7MH 1EFXD 3CNKA 2CH8A 3SDYH 1GGUA 4GBXC 5KANG 1BVKB 1MCHA 3VMPA 2ID5A 5A2IH 4QOKE 3LQAC 3VFWB 4KI5F 1K8DB 4ZQKB 4O2CA 4CU8A 2FH6A 2YRPA 1ORQA 3F12B 5ESVB 4EVNA 3ARGD 3HZYB 1ZVSA 4U6XB 2R69L 2ZCHL 2VL4A 4N9GA 1A4KA 1FG9C 1NUNB 4KRMB 1FL3A 3UTSE 3KPSE 5T3ZE 1A14H 1DQDH 3MYZA 1RIVH 3GKWL 3RY4A 5GZOD 2E6JA 5ALCH 1L7IL 2J5LB 3GSNA 1PSKL 3BPCA 3PWPB 5ISZE 3U36B 1CD0A 1QO3A 2NY5L 2XXMB 1QRNE 5FYKL 4L29A 5DK0A 3DRTA 4HIIB 3D25B 4NQVB 2HFGL 2R29H 3MV9D 2CKBL 2X1PA 4LVEA 5FYJU 3KWWB 1U3HC 3BRFA 3HUJF 4XCYB 5C7XL 1U8JA 3H7BB 3T4AA 1XGRB 5JORB 1L9MA 2AJYL 4ODBD 5E99H 1U8LA 2A2QT 5FGRA 1N64L 3OXRA 8CGTA 5CUSL 3TBWB 1H3VA 3QO1A 1PKOA 5T1KD 3G5ZA 5L2KE 2WMPA 4U6HB 1VGEL 4WY7H 3WIHA 3PGCA 3GMOB 1CL7L 4PRPA 5D7LD 2FYYA 4JJ5B 3QUXA 1IVLA 1RZ7L 4K3DL 3HZMA 3B9KB 1QSFA 3WJJC 4AT6B 4O58H 4KK8C 4AEIH 2VDPL 3AS0A 2ESVA 5ID1B 1FRGL 4QYOA 2FL5A 2UY7A 4TYUA 4D8PB 1KIPB 1FZMA 4ZOEA 1NMBH 4ZFZB 1I4FA 1F3DH 4WV1A 3ZE2F 1D5XB 3S5LB 3WFZA 2R0WL 5TE4H 4NN5B 4C4KT 2HLFC 4JANB 5HHOE 4FQXA 1FNEA 3GSUB 4HXAL 1PG7W 5DHVH 3RVTC 1X6NA 1KJMA 4PJ8B 3BE1L 4ZSOA 1DVFC 1HH9B 5E2TL 4ZAKD 3WIHL 3S36H 1RD6A 4R97B 2Q8BH 3PDGA 3M07A 2R23A 1DVFB 4HWEH 5JMRA 4HKJB 2Y7QA 3WXVH 3PQYE 3S3PA 5CS7A 1H5BA 5CHNA 1FVDB 4PJGA 1UZ6E 2M8XA 2W0FB 4JFZH 4HLZG 5BOPA 1F4AA 2A6DA 4YHNB 1EK3A 5HVHB 5E1AB 5LXGH 4PRAB 3QIBC 2WUCH 5J57B 4N8CL 4UIKL 5I15H 4PLOB 1OM3L 2NY4B 1KN4H 1QBMH 2DOCA 5F88B 5HHOD 4UQ2A 1D6VH 1RZKC 4PGBB 2BFVL 2DICA 1IAOB 2MMXA 3ETBF 3DOSA 1DDHA 3G5VA 1GCFA 4LCIL 5B3JF 4ONGL 3UCRA 2F9BT 1WSST 4UMGA 1PDKA 2FD6H 2ITDA 2BNQB 1J18A 3TA3B 4OLVH 4R3SA 3WV0A 1NFKA 3PL6C 3G9VA 4WEMB 2C3HA 4NCC2 2Z4QB 1VFAB 4C57C 5DLMH 3FMGL 5EZLA 1EEYA 3PV6B 2WINA 3TPUB 1JN6A 1A1NB 2AV1A 1WEJL 5CD3B 3A67L 3MCKA 3AS3A 5B21A 1DN0B 1R3LB 2UWEB 1ZANL 3QHFH 3OBAA 1T1WB 3QH3A 4ONOA 4YQXH 1DSFL 1NUFA 4K8RC 3CSGA 3CDGA 3IETA 3O6FA 5FYJD 4M02A 3KPNB 2NX5D 3LPWA 3T08A 1H5BC 3C60C 5I6XB 1T4KB 1W8OA 3WS3A 2CDGA 2XFXA 2H3NB 4NRXA 2HAZA 4L8CA 4FTVB 3BD4A 5E95B 5JPMB 5D1ZC 1YECL 3NACH 4OB5H 3IDXL 5MP6L 3SO3B 1F4HA 1DBML 4NNXB 3UYOD 3M1BA 1WBYB 5BS0D 1S9VA 4PJFF 2MNUA 3ULUE 1P5VA 2Z8SA 3JBG7 2C7UA 5GXBB 4GW5B 1JHTB 4MQ7B 3D3VB 1C5DA 2O5ZH 3P0GB 5CEZH 1I1YB 2CXKA 1MIMH 3S35X 1Q0XH 4QHNB 2MQ3A 1CXLA 1S7TA 4FHBD 4Q6IA 5CJ5A 4PJFA 3BP5A 3SDCB 3KPMA 3MV7D 3NPSC 3EYOB 1LEKA 1KXVC 3SE9L 4DZBB 1RURL 5IMMB 1QBLL 4QGYA 5E8PB 4MAYB 1BOGA 5I1KH 3QRFM 3ZDYF 3N0PB 2R0KL 3FT2B 4TOYL 4XP9L 4G3YL 3QCTL 1AKJA 1NGZB 2VDQH 4L4VE 4C83A 2ARJB 2N7BA 4E0RB 4K23L 2NY7L 4PLJC 4WW1A 3W81A 1ZAGA 4TTGA 4Y5XA 3FONB 5D2LE 4TULH 1LP9E 1ZLUK 2OQJB 2L4OA 4YFDB 2F8VA 2FCBA 5CSBA 5ID0B 4PJXA 3IDXH 3HRZB 4LSQL 5J7CC 4XAWL 4AG4H 5L6YL 1FNFA 3QEGH 2QSCL 2JJSC 5DFTA 3UP1A 3KAAA 3CXDL 5EU6A 3B43A 1SJHA 5B38B 3ZO0A 3V6ZB 4NPYA 4KJWD 1I9RH 1U8HB 1T0MA 4N0FA 1AKJD 3L9RB 2ZUQC 4PGJA 5EZOL 1WCBB 3TJHC 1IAIH 4OCXL 3G6JB 4XC1H 3P4NB 4DAGH 3S3SA 1ZHNA 5DRWB 3QCUL 3GRWA 5EUOA 4OGAC 5E8PA 2VISA 3OHXA 4P49A 5DJAB 1NDGB 3QT2A 3NH7H 4CW1B 5JZ7C 4W6YB 4QRQA 5JQ6L 4WO4A 3N85L 3QQNA 2GSIB 4OJFL 1XF5A 2H6PA 4ALAL 2Q8BL 4TRPL 4ONHA 1VEOA 1ZT4B 3TZVC 2BFVH 4DN3H 5E5RB 2VE6A 3QAZB 5GS2D 1ETZA 3GSNL 4XWOD 4EUPB 5I15L 3NPZB 4JFEE 5DJZB 1R6VA 3D48R 4J7RA 3HC3L 1MJ7H 5D96C 4ZPVB 1SYSB 5IGXH 3I2CH 4X6FB 4N5UA 1F13A 3RZCD 3GMPA 2YSSB 1N6VA 2BVPB 4P46A 3HAEH 3OB0K 2H9GB 4P9HC 1P4BL 3ROLA 5I17A 5MI0B 5A16A 1OAYH 1WUNT 3IKKA 3HE6C 3C6LA 3CSYB 5F9WB 2Y4SA 1OAUH 1HCFX 4NHUA 4EQ2A 3DHJA 2KQNA 2NW3A 2EDOA 4HXAH 4LPXA 4RBPK 3FB6B 1UVQA 4RFNB 4K8RD 3M17A 3IDJB 5EIQA 1ADQL 3FO1B 4WJ5A 3S96B 3BKMH 5LCVH 4QRSA 1X7QB 1QYGL 2B2XL 4POZD 1D6EB 3TN0D 4RAUB 1RULH 4RMUA 3LKRA 1R24B 4U1LA 5DHXB 4HIEA 1FAIH 5FM5O 1U91A 4S1DD 1G9EA 1GXEA 1F8TL 5I8EA 4BM7A 1OARH 5I1GL 4Y4FC 1JYNA 3SPVB 5IFJA 2PXYD 2DQUL 1X5KA 5DD6B 3RU8H 4PRHB 5ERWB 5CD5C 4Z7WF 3GO1H 3FKUS 2EEDA 3ZKQD 5TQ0L 4NYLB 2WAHA 4KKLD 1KNOA 4QRSB 4MHHI 3WKML 3FOMB 1H8SA 3FO1A 3S96A 2Y7QB 1XGUA 2UUDH 4B7LA 3ILPA 1RU9L 4CAGA 5A2JH 1H3XA 2BOBB 2IPKA 3GGWA 4FG6C 3SDDC 1P7HL 1FNLA 2CKBH 1P2CB 4NM8L 1KTRL 2DQFA 3BDXA 4D0BB 5IV2A 4NDMB 1S7VA 2QQNL 2OQJA 2WM0A 5C2BH 3L5WB 3NA9H 1X5ZA 1BGXL 4PB9H 3MUGA 2NXYD 2EDRA 3E1F1 2K7PA 1IEAA 4TULL 4WU7B 1GJIA 2WV3A 3ARBD 4JHAL 1MFDL 3WNLA 1Q0YH 1TZGH 4KZEL 3SCMC 5IB1B 4OJFH 5GS3A 2F5BL 3SY0A 3ULVL 5H2BA 3VD9A 4JQXA 5DJDB 4MNGB 1MCJA 3L6FB 4WIQA 2X10A 5ACMA 2M2DA 1TJHH 1PY9A 3BKJL 3X17A 2ESVB 5I1EL 1MF2L 5AUMA 5DUMH 3BXNA 5E9DA 3WNNA 4ZXBC 3BQUC 1NC2D 2BHYA 1BFOA 2MJWA 3DXAA 4F15B 5CAYB 2VDMH 3FRPG 1ZSDB 4PRPB 1MEXL 2GHWB 3HA0A 1YNKH 3KNBA 4NKIH 1S7TB 4PV8A 4Y4KD 1LE9B 3OPZH 2HMIC 1MHPL 4HV8A 2X9YA 2XI9A 1AD0B 4G8EB 2FX7L 1QRKA 1MWAH 5JW3H 4WI4A 2HTKD 3ULUF 4FS0A 4WCYH 1MJ8H 3P30L 5FCUH 1MNUH 4KUCF 4NO5B 5AWNH 4F33A 1YEIH 1HH6B 1UJ3C 3L3JB 4I4WA 1JGVH 1A7PH 4XXDB 2CIKA 2FHCA 1KXTB 4GKSB 4PRHD 1JPFB 4OV6F 4WUUD 5LQBH 2XFXB 1YNLL 1FN4A 4M1CD 1UKQA 2IPUG 1KB9J 3D2UB 3H8NA 4MJ4A 4P4KA 1G7LB 1GZQA 4PV8B 5E8NB 2AJ3B 4PY7A 4J3VA 1RJZA 4XCEB 1TTUA 1N6QL 3P9MA 3H9SB 2DQEL 2LU7A 5C08B 4RGMB 3LKNB 4PRIB 4JY5H 1LO0L 2B5IC 1IGJB 5E4EC 2VAJA 3T1WA 3NAAH 5HHMB 1UACH 3IJHB 1JRHH 4ZQKA 1K2DB 4P0DA 1G0DA 1M7IA 3ARGA 2EYTA 5H8DA 5FB8B 2P43B 4BSJA 2GT9B 3C60B 2HN7A 2DL2A 4KVCH 4NWTL 5ICXA 1I8LC 5D2NC 3V4UL 1DDHB 4HGWB 3DTXB 2ATKB 4X5WA 2DBLH 1G6RH 5LJYH 5ISZD 4G8GE 1U91B 4WW2F 3HB3D 2BC4A 3OF6A 1NQBA 1DQJB 5C0RH 3EDFA 1A6VH 3SBWC 2OK0L 5KG9A 3MV9E 3BVNB 3PL6B 4K8RH 2E9BA 4IDJL 4JY4A 5E00B 3ZDXE 3RNKB 1I1YA 2QADD 1TQBB 3LPFA 3SDXA 4X4YB 3EAKA 2R39A 3QXWA 2HKHL 4KTDL 3BVNA 1HXYB 2EIZB 1EO5A 4NNXA 5H94B 2EO9A 4IRJA 3W0WA 2DQUH 5DD6A 3CSYA 5IT2H 5FUCC 4ISVB 4GSDL 2X6MA 3K1KC 3V7MA 1F2XK 4M93B 1G7IA 1K4DA 4HGWA 2GCYB 1N26A 4L3EB 5I8EB 3NIFE 3QUZB 5DYOA 5I76B 1WJ3A 1A47A 1DUZB 4YDIL 5C0GB 3ZZ1A 2YZ8A 4XZUA 2M26A 5MENA 2X4TB 4R97C 3JZ7A 2V2TA 4NQDD 1K2DA 4XMKL 4P57A 2X70A 3KPPA 1ADQH 4QRRE 1NBZB 3BOVA 1IM3B 1SHMA 4LP5A 1HSAA 1DL7H 4TVPL 3BIAX 4PJEF 5FA3B 5I1LA 4Q9RL 1NCUA 2P5WA 1JNLH 1P9MA 3IFPB 4L4TB 1LEIA 4MLSA 1QFWL 5DVNA 5FECA 5IVZA 4F57L 3F7QA 4PUBL 4WUKH 4HDIA 1HNGA 5KS9A 3MLSL 4Z7VA 4FQ2H 3KS0J 3D18B 4HGMA 1C5CH 1KG0B 4U6HA 5DD5L 5C86A 4WTXA 4MGXA 4XP1H 4OZIB 4JFXB 1KENL 3I84A 1IM9A 3MODL 3O9WC 1T2QL 1OAKH 1JWSB 3AB0B 5LGJB 3LV3B 2O5YL 2R1XB 3C8KA 1FLTX 1WFOA 3HAEA 4P9HL 1SJXA 5GJTL 3CU1A 1T0NB 4TUOA 1S5IL 5LGKA 3MZGB 1KCKA 2P8MB 4L29B 5DK0B 4Y5YC 4LCCC 1K3ZA 3O8XD 4IHOB 3UBXB 2FLRT 3ULVE 1NC2A 4JFQA 4WO4B 3ZHLA 2VZUA 4X6EA 1ZMYA 2H32B 5C0EA 3DMMD 1F42A 3ZT6A 1U8PA 4F9LC 5INCB 1NDGA 2ZOLB 4UT7H 1MFCH 1TMCB 3VFOB 5T1KB 3F12A 2OJEB 4QHKI 3NGBB 1B0RA 4OF7A 5C0FA 2XXCB 5DA0B 3ARTA 3QP3A 3QIUD 4KI5D 3VDAA 3OX8B 1ZWIA 3V6ZA 5J6GB 5ID1A 3HI1B 2ED9A 4HWNA 1A1MB 4OI9A 2DWDA 2LTQC 4WEBL 5BJTA 2VDNL 3GI8L 5HGHA 2Y25A 4X4ZA 3OXRB 4NHCL 5E7BA 3T1FA 4PJ9A 3RVWC 1X9QA 4LLMA 4CVZB 1M7DB 4G8FA 4KKCC 5KOVC 2UV3A 3O6FD 4JO4H 5E9DD 4L8SB 3FZUD 3BQUB 3RTQC 4JFDA 1MLCA 1CFTB 1T5XB 3MRQB 2DQTL 3QSKB 4OGXH 5GIRB 2D0GA 5JUEH 1R5IB 1BOGB 2JK5A 3CX5J 4HIIA 4PJAF 5C07A 2E7CA 5IHZA 3D85D 2Z8WC 1EBPA 4QXTA 1IJ9A 4DZBA 1T4KA 4TUJB 4P9MH 5D2NE 2NTFA 4O02H 3QQ9C 5F70A 1INDH 1WWBX 1CDUA 1NBVH 3QWOA 4LIQL 4U6YB 3M8OH 2JELH 5DC9B 4N0UB 1W72B 2J8OA 3V2AR 4D3CH 4Y19D 3ARDB 3GIVB 5DQJA 4R96B 3UPRA 4FFWC 4LHQB 2WINB 4GMSL 5E4IA 1VFAA 3MV7E 5E5MA 1HQRB 1HXMB 3T0BA 5K93A 1BFTA 2YXFA 1C12A 4HBCH 2DB8A 3RWFA 5BRZD 5C0GA 2BVEA 1JFQL 1I3GH 1UZ8A 4NNYA 4S10A 5DYOB 4ZUWA 3QUXD 1RZKH 3RPKA 1C08A 2R1YB 3I6GA 5DJ8B 5ISZA 2DLIA 3EOAA 1VKXA 4Q2ZA 4FXKB 4ELKA 1QRNA 4JFOA 2AI0L 4LDEB 3VFVB 4PGBA 1YY8B 5IB3B 3RVUC 1HOCA 1MI5A 2GQHA 4GKNB 1FL5A 2HVJB 1B88A 3TBSA 2ZNXA 3CSPA 1UC6A 2EIZA 4NUJA 4P23C 1BVZA 2JKXA 4IJ3C 3OKEA 4OI7A 4HG4J 4O2EA 1UB5B 1EEYB 4KJQC 4DGYH 2OR7A 3Q5TA 5EZLB 3V52L 4NZTL 2R2BA 4OLZH 2GSGA 3TJEL 5CP7B 3IFOB 3GB7B 2VLJB 2V5MA 4FQXD 4PRPE 2XN9B 3UTZB 4ZSOB 2ITDB 1GOGA 4Z7WE 2CXGA 1J0KA 3NCEB 4CL7A 2J1KA 5T5NG 2VQ1A 5DD5H 2F54E 3O45A 4KPHL 1BBDL 4ZAKA 1N4XL 4HUVA 3O2DH 4HXBL 2C4FU 4N0RA 4S1RH 1U8NB 1YYLH 1MLBA 2ESVE 5CJXC 5IOPA 1EHLH 1I85C 1EXUB 4LRNH 2FJHB 4MNGE 1BM3H 3HE6B 5DUML 3O6ML 3HFML 4I2XA 3MYJB 2EIEA 4XC3H 4PS4H 3GZKA 1HE7A 4KHTH 4Y2DA 4XMKH 4P48A 1T5WA 3MR9A 4QYOB 4HD9A 5DVMA 4KC3B 3V4PH 5E8EA 3NOIA 3KYMA 4HPYL 5HHOA 4PGDA 2V5YA 2EE6A 2VDLH 1DFBH 5ENWB 5DHYA 2VUOA 3HZMB 3LSOB 2WIMA 4FABH 43CAA 3BIBX 3SE3C 2RCSL 3DETD 4NKMA 3NA4A 3KPLB 5FM8A 3MFGB 1IGFH 1FFPB 5CGYD 5DTFA 3TZVB 1QLEL 3MUHL 4LARL 4IJ3B 1AD9B 1Q9OA 1QD0A 4HIJA 4MDIA 1S7RB 5DHVA 1B2WH 3GM0A 5CJOL 1XGRA 3U9UB 4RWYL 4OKDA 1HH6A 3MA9H 2DJ4A 1PZUB 5FHBH 2ZSVA 5C3TA 3O8XA 2E7HA 2EH8L 2IALA 4K71C 1NGWB 1P84K 2VXSH 1E4WH 3PWJA 3G5YB 4O2FA 4UV4H 3O3AA 2D4DA 1RHHA 1LE9A 1FO0H 2IAND 2VLME 4X80L 1JRHI 5D7IF 5SV4A 2AEQL 4XHJD 4XCNA 2DBJA 2J88H 2BX5A 2E7LC 1NAMA 3U30C 1FSKC 2DIJA 4J6RH 2CLZA 1IGYB 2P1YA 3GHEH 4MDJA 4LVHC 5IB2A 3L95A 1LK2B 2CKNA 4F9PC 1MCCA 4NWUL 2HLAB 5E7FA 4H88H 4OZGB 4WGVB 1LO3L 2E27L 4H8WL 5IJVA 3D25A 3FB8B 4MCYA 3SQOH 4PRBA 2Q86B 4JPWL 2CK2A 32C2A 3VFPB 4L3EE 2DTSA 2YXMA 5EBGA 1TITA 2H3NA 2VITA 2VYRE 1A6TB 3EOTH 3QZWB 1FZJB 3QRGH 4DTGL 1CGTA 1A9BA 3QULA 2GAZB 5EOCJ 5EWIH 4G6KL 1NKRA 5L7XL 5JOEA 3OZ9H 2YD2A 5EOTA 1QLRB 4ODSH 1HQ4A 3MCKB 3AY4C 3VRLE 5LQBL 1FDLL 5BVPL 1A4JA 1Q9WB 1LP9F 3VXPA 3PGFL 2RR3A 1U8KB 1AHWA 1P7QD 3RDTC 1J8HD 1VCAA 3MNWA 1KF9B 3ZKSD 2XTJC 3HNSH 4G8GB 5A2LH 1C8PA 4Q6IC 5FKPA 1RZ8A 5E8EB 4MS8C 3GHBL 4HQQH 4BK4A 3AUVA 4JKKA 1RZFL 1KV3A 5EU4A 3W39B 4J3TA 1BJ1J 2IAMB 5FHAH 2RB8A 1BVLA 3GJFA 3QQ9D 5I1KL 1KJVA 2N7AA 1PG7L 2JE8A 1TJGH 4YPJA 2W9LA 3QDMB 2Z92A 4G42A 4IIQC 1S7SA 4L8SC 3VXMD 3LB6C 1RV6X 3VXRE 3GUTB 3IDJA 1DLHB 4WO4C 5D2LA 4Z76B 1LP9A 1J8HA 4PRIE 3BAEL 5KJRL 4BSVA 4NHUB 1W0YT 43C9A 3JUYA 2A83B 1ZA3A 4MNQE 5BQ7A 4IS6A 3TV3H 4I0PB 4XBGB 2Q6WA 3D69B 3FTGA 1ZANH 2VXVH 1MI5D 4PP1C 1MCWM 3GUTA 1C16A 3L3DA 3CLFL 3P4LA 2FIRT 3G6AB 5JW4R 3HI6H 4Z7QE 2DIBA 3EYFB 4P5MB 1IMHC 3N9GH 4ZNCD 1UG9A 4ODVH 5EIVA 3NVQA 2FX7H 2X4SA 3VXME 4Z9KB 3NN8B 2LVCA 1MHPH 1QFUL 4G3YH 4U1NB 2BXYA 3OKDB 4P4KD 2YPKA 2HT2C 5LG1A 1AJ7L 3OKOA 5JXEA 4RWYH 1VKXB 2BVOB 2LAGB 2XWTA 1TJIH 2O5XL 4ELMA 5HVHC 5ITFA 1GOFA 1KUMA 5IEHA 2YR3A 4YHOL 4RIRA 2FYYB 4JJ5A 1XR8A 4X6BA 3U82B 3B2VL 1BD2E 4LQFL 1M6OA 2CIIA 3MNZA 4H88L 5IMLB 3GI9H 3EGSA 3LDBB 3IRZA 4GG6F 1ZT7A 3S8WA 5JZ7D 2MPAL 2RHEA 2FSEB 4OLYL 1KB5L 3BKML 5K9JL 5EOTB 5T5FH 4BELD 3A6BL 4LMQE 3V6OC 4AQ1B 5EO0A 2ITCB 1DLFH 5I8KL 2H26A 4XB7A 3AAZA 3IU3A 4IRJD 2H1PH 1X5GA 3TPKA 3WO3B 5L2JA 1U42A 2IBGA 4H25B 3IFLL 5IEKB 1EAPA 1KJ2A 1A6WH 4CU6A 1HHIA 5IW1A 4C4KO 3QI9B 5EC1B 4OQTL 1MJ7L 2E6PA 3DO7B 4M43H 4XNZB 5FAAA 3GO1L 3JV0A 4UOW0 3LQZB 4PJEB 3B9EA 5M95B 4HCRL 3HKFA 4XCNB 2CIIB 1QLFB 5DWUL 3RIFK 4ELMB 3L7FA 2C1PB 2CRZA 5I18L 5GHWH 5FK9B 4BK5A 4GS7B 3AB0C 3GRWH 3GSWA 3T3ME 5IMMA 1V3MA 4LFHD 4G6ML 1KENH 2EDJA 2VLKE 4RAVB 3U1SH 4Y1AE 5HPOA 1NCNA 3MLSH 2X4SB 2GJ6B 3TLRA 4U1GC 1IM9D 4OCWH 3SKOA 1DUYB 5IBUG 2ZUWA 3NH7L 3C08L 4ZFOB 1H0DA 2AK1L 3LN9A 4P5MA 3U2SA 3UJJL 3TNNB 2FR4A 1LE5A 3PQYB 1AD9A 5L88L 4OCXH 4LPVA 1TNNA 3V0WH 4YAQA 3QEHA 4X8JB 5C0EB 5F93C 4NWTH 3UO1L 1XCQA 4ZUUA 2MSPA 5T1LB 1DQDL 3MTRA 1WF5A 4X4ME 4YO0A 4GAGL 5CJBA 4XVSL 4MVBD 2BMKA 1CDGA 5CEZD 4P99A 2HT4C 2GYSA 2R2HB 3MFFA 4LQFH 2PYFA 4Q6YA 3MRLB 5JW4N 1RJYB 4XNQA 1K5NA 5I19H 3GJFB 3PIQB 1PYWB 1LK3H 4N1HB 1UWXH 4LKCA 4TRPH 5B8CB 3BAEH 1BZ9A 1AXIB 5IOPB 1AE6H 1PZ5B 2NX5E 3BP4B 4NN7C 4XNUH 4DFHA 1PKQB 4BJLA 4LEOB 4F2MB 2VDPH 3DXAE 3LS5H 4GW1B 3MLTA 2BRQA 4Y88A 1CFQB 5E4EB 3RL1A 1YEHH 3TA3A 1TQBC 4NZJA 2NY1C 4OAWA 1U58B 1SVCP 5C9KA 5KVDH 2FO1A 1AHWB 4L9DA 4P2QD 1XR9B 2EC9U 3QIBA 5FCSH 5FKAB 3G5VB 4HK0B 4WY7L 1PZ5A 4R0LC 3I3EA 1YMHB 4OCMC 1YEKH 2C4FT 4NJ9H 5T3ZH 4EUPH 5ICYB 5I73B 3NN8A 3SCMB 4XAKD 3VGEA 3CFCL 1P6FA 2AGJL 1I8LA 1YNKL 4NKIL 4JHAH 4XZUB 2A6DB 4YHNA 4R2GC 1JHLH 2KBGA 5HHPA 1HOCB 2RGSA 1FVDA 4PJGB 5KSBB 3IDYB 5IHBA 2KL6A 2GK0A 3LB6D 1U95A 2WBKA 4M7ZC 3BMVA 2WBJC 3PWPE 2DQDL 4K2UL 2UVFA 4LSPL 3IF1B 2X4PB 3GSOA 4KZDH 1KYOK 3D1MC 1YJDL 3ARSA 3IDUA 4G9DB 4OFDA 3K2MC 5AG8A 1O7VA 5J11B 4IRSA 4XWOC 1WT5A 3KPSB 3VD3A 4AH2B 2YZ1A 3LRGA 4LASH 5B39G 3MRRB 1CICD 4JO1H 5D8JH 1N3NA 1NMCB 5E8DH 3S3JA 3ZTNL 3OKKA 1QA9B 3ZE1F 3RY6A 1U9KA 4JHZA 2RIKA 3O6LL 3ARDA 2ZG2A 3MRFB 3RGHA 2OBGA 1H0DB 3U2SB 2UYLB 4WV1B 4NJAH 1DUYA 5KG9B 3QQ4B 1KJVB 2R2CA 3MC0A 3L5HA 1JF1B 4KKLC 2D9QB 1INQB 5HHNB 3S35L 2FX9H 3MGOB 4XH2B 3WDJA 4KUCD 4HSQA 3QUYB 4G7VL 2BY0A 5EU6D 1G1CA 1H15A 2HN7B 5SX5H 1T0PB 1IFHH 4FQLH 2XACC 2A0LD 3V8OA 2AQ1A 4HFWB 3CC5A 5MEND 3W82A 1NUGA 4BKLA 3X14B 4F15C 1ZT1B 2A6JB 4JPWH 5IR1A 4IRSC 4F8TA 4PJHB 2KZ1B 1DBJL 3QUZD 5IW1B 4GG8A 5D7IE 2COQA 4HWBL 3WE6B 2Q3ZA 1QRND 1G7LA 1GZQB 3F6IA 3GRWL 1X5LA 3RY6C 1JZ5A 4KROC 3RWGB 4GRLD 4GQ9H 3WHXA 1J0JA 2V6HA 4XPFL 4S1QH 5D96B 5DDHB 4KZEH 5J6GA 4QRTA 1CFNA 3CK0H 3LIZL 3RBGA 3MR9B 3S36L 1O0VA 2J88L 4OQTA 3BQUD 2GW5A 4DVRL 2XQBH 1NBYB 4YWGL 3GK8H 2FEEL 1B0RB 3MUY1 5C0FB 3QXUA 5C0BB 3NBNA 2BERA 4O4YH 2PR4H 4Z95H 4PBVC 4YEEA 5K59E 2O5YH 3RUGE 5IB2B 3WFBL 5C0JB 2GITB 5D9SA 2CLZB 3ABZA 3PHQB 3QNZA 1NMBL 3MBEC 5DZNA 5GZNC 2P5WE 4DFIA 3D0VA 2H32A 2DM3A 2BRRL 4X6EB 5ALBH 2CQVA 5E6YA 3GBMH 5KS9E 2XN9A 1CD8A 1VFBA 1R0AH 1KB5A 1G7QA 1W2KT 3D39D 4PLNC 1U95B 3TT3H 1WBZB 1ES0B 2QSQA 4HIHB 2PW1A 3CXHJ 4H20L 3MUZ1 2ZSVB 3R8BB 5E99L 3V4UH 1QFHA 1YEFH 3I02A 4DKEH 5E8OA 4N0YL 3WYRA 2VOTA 4LEXL 1P1ZB 3I75A 4XB8A 1NGXA 2X05A 2Y07H 3DI2B 4WTZG 1IM9B 3G6AA 4KKBD 4WU7A 5FKAA 3HR6A 4O4YL 3TZVA 4GUPB 3SDXF 3BDYL 1I8MB 2A83A 1NCBL 1WIPA 1QSEA 2ORBH 3LSOA 3MLTB 4I77H 2NCMA 4XC1L 4GQPH 5J1AA 2VTFA 1IC5L 5HGBB 2BRRH 3Q3GA 3SGDH 5ALCL 4Z76A 1V05A 3DVFA 4LLYA 1OVZA 3PV7A 5J11C 4R96A 4I48B 4P57B 4M7JH 5IBUB 4YNYA 3MBEB 1CTOA 4D94A 4RNRB 3QEGL 4JM2A 2R0KH 4U6VH 2DN7A 1KLUB 2DQDH 1E4XL 2PYFB 5CIPB 1A6VL 2OK0H 1CBVH 5IBLD 4HS8L 5I76A 1YEGL 1HKLH 1MLBB 5E5UB 4WW2C 1BQHB 3Q6GH 4Z7UF 2VSDA 3IT8D 4R90H 2WUBL 2NW2B 1INEH 3NCBB 4HKZA 3DIFA 2VXQL 4AM0B 2EZ0D 1FFOA 3MJ8A 3BZFA 1BJ8A 3FRUB 1LO4L 5IMOB 1VB9A 3UJTL 3MRCA 4QO1A 3EJZC 3VD5A 4NKDB 4FXLA 3BW9A 3TBVB 1EH9A 1MREL 1N5YL 1J05A 3AU1B 2E9IA 2FX9L 1MCQA 1UA6H 5JQ6H 2NXZB 4U1KB 3RNKA 3SDXB 1MVUA 3FQTB 2Q20A 5D1ZB 4KI5E 2DRUA 5F1IA 4ETQB 5I8OL 4R0LA 3P4OA 1JP5A 2BK8A 1T83C 4U1JB 2CDFB 5DK2B 3CFBA 2EECA 4I3GA 4OTXL 5C07E 4LKXB 3DSFH 4ELKB 3BZEB 4JFHD 4UBDC 5EBWA 1KCSH 3GKWH 5EBLA 1KELL 4C56D 4OGYH 5GRVK 4PRBB 4D0CB 4J2XA 1E4KA 1OCWL 4XAWH 5D2NA 5HJ3B 3BP6B 2AABL 5DI8A 1A7BA 1OP3K 2IFGA 3UTSB 3MRGB 4QCIA 2FH8A 1J87A 3IVKB 4LPCA 5JW4M 4UINL 4NFCA 4F37F 1R5VA 5EU3A 1HDMA 4OFIA 4WDIA 5GSRB 3RY5A 2LABA 5CZKA 1FNSH 3H42H 4JZNA 1YY9C 4G9FE 5KOMC 3TCLA 3ZL4H 5IVXB 1MOEA 2AJ3A 2XTLA 4WWKA 5FYKD 4ODWB 7FABL 3E6HB 3VH8B 4F7CB 5C0AD 1RVFL 3QDJE 4XPGH 5IFAH 3T3PE 1OM3H 1JVKA 4NC1E 3MJ7B 4M62L 4U1GB 5KVDL 1MI5E 2HRPH 5FO8B 2RFXB 4MAYC 3BKJH 3P9WB 4OFPA 4A6YL 3P73B 4X4XA 3UX9B 4MMXC 2XZAH 3PWUB 5I1GH 3BPLC 5HHMD 4PD4K 3LV3A 3BZDA 4ORGA 2HYMA 1CT8B 2AK4B 1MFAL 3FQXA 2EDWA 4NIKB 3MRPB 3NPSB 4ZS6C 2DDQH 2APFA 3SE8H 4EDXB 1S7RA 5DHVB 4P2OD 3MOBL 4XMPH 5D7KD 1MAML 4DCQB 4PB9L 3AVEA 3A6CL 4MNQD 1NFIB 3MO1A 1KCLA 1QR1B 4NKMB 4WWKB 4Z7WA 2BSTB 1EUUA 4PJIA 5ITFB 3SKMB 3D6GA 3EYVA 4M43L 5AYUH 1JNNH 5JOPD 3SO3C 4XPBL 4M7JL 4TSBH 3ZTJG 3FONA 5IF0A 3OZ9L 5C09B 1A7QL 2ICES 1XF2A 4I3RL 4MNGA 3LN5B 1OW0A 3BX7C 2Y06H 1UM6H 1OY3B 2NNAB 3QJHB 5JO5A 2HH0H 1WTGT 4QT5B 2A6IB 4UI2A 2Y36H 5GGTA 5JXED 1YEEL 5C09E 3W0WD 4MAYA 3CU7A 1FORL 3HRPA 1L9NA 1RZ7H 4OKVA 4FP8H 5IB4B 1UKSA 3MJ6A 3S37X 2ICWJ 4OLVL 4NO0D 4Q9BA 5IK3A 3QPXL 4OCSL 2W9DH 4UV7H 3VJ6A 4KHXL 3ILPB 2HWZH 3LDBC 4TUKL 1ODAA 1W0WB 1HKFA 1CIUA 2B2XH 4KI5C 1WZ1H 4NQDA 1QHOA 4JPIA 2BOCA 2OTWA 4CN4A 3U0PB 5DFVD 2C7UB 4EN3D 5IESL 2UWEF 3DV4B 3QA3A 4LGRB 4KJPC 1MCPH 2SEBB 2KH2B 1ZLVH 3TT3L 1FFOB 5FYLH 2HVJA 1YN6B 1FL5B 1II4E 5BV7L 2YUVA 4H8WC 3WIFB 4KPHH 1NGPL 3VWJD 3QDJB 4HWEL 1A9EA 2FJFB 1S9XB 3HLAA 1UXSB 4OD2A 1TQCB 5B38G 1KACB 1B2WL 1VDGA 4Z77A 1RUAH 5DD1H 1KLUA 5C0RL 1P7KB 2R4RL 3EYQC 1KBGH 2PO6B 3SOBL 4FP8L 3RWJA 3EJYC 5I1IH 2YEZA 2HFEA 4QXUH 1VENA 5JR1L 1T1YA 4GG6B 5HDBF 5D71H 4LFHG 1A7OL 5DJXA 2X4TA 3MOBH 4JVPA 4XMPL 2AVGA 4OGYL 3X3GL 1LQSR 1F3DJ 3EJYD 5E94B 3EFFA 3QZWA 1WZLA 4PP1D 5IROA 8FABB 1UWGL 5IIEB 9CGTA 4OFKA 1HHHB 1D5BA 4A6YH 2XIDA 5F88A 2DS4A 1ITCA 1BEYL 1SYSA 2F5AL 3VA2C 3MRQA 3V0VA 5KVGH 2J5LC 3VCLA 1IFHL 3ECBA 4E5XA 3U0PA 4HH9B 4HMEA 2I5YL 2XTJB 4MDJB 3ZKNC 1CK0L 5FA4A 2V7HA 3H9HA 4I0PC 4IEFB 4X9IA 5EORL 5EZJB 5M7QA 4CVUA 1A3LL 1T21B 5CEZL 3P2TA 3MZTA 2XZAL 2QBWA 1SBSL 5CEYA 1QKZH 2JF1A 1AH1A 4Q0XH 3DMMB 1TZHA 2QQKL 3DX6A 4UTAH 5I1JL 2FO4B 1RHHB 4S1SH 4RWHA 3T0XA 1FDLH 1HHJB 3QNYA 5GRXG 2VLJD 4MQXD 2NX5B 3O6LH 2QSTA 1DE4B 3IFNH 4Z7NE 3O8XB 2FEDC 3OXSA 4IOIB 2EDNA 5BS0E 4OZFH 4ODXA 5D7JD 3MV11 3DSFL 1A14L 2Q7NA 1EIBA 1NBYA 3EOTL 1TTGA 2CUHA 1ZLWH 4DKFH 3U9UA 1DQLL 5D6DC 4FFVC 1WWWX 4JFDD 4G8IB 3VXRA 4QRTB 3MV8D 3B9VA 3E2HC 3TVMC 3UTTB 4RDQF 1J8HE 4PRIA 1FFPA 1MRFH 4PIRF 3EYVB 4NWUH 4GMTH 3FFCE 3ZLQC 3CX2A 2DQCH 1WFNA 2P5ED 3AREB 3DX7B 4MNQA 5ENWA 3U30B 3SEPA 1AIFB 3QUMH 4JQVC 3UBXA 5DRZB 1AGDB 1ACZA 4NBXB 3NABL 3V4VH 2BXZA 5GJSH 4LEXH 1G7MB 1NKOA 4ZYKB 3SKNB 3MLPA 1YEKL 1T5WB 1B0GB 4I18C 4BUHA 2CR3A 1HHKB 1S5HA 2DL9A 4IIQB 4M5YL 4H26B 4X4XB 4MNHB 5C0CB 2PYEA 4LLWA 3PP3H 2VLKB 2AQ2A 2ATPB 3NACL 2C4XA 3BHBA 3RWDA 1U8NA 3C5ZB 5IFJB 2HFFB 3HG1B 4KY1L 3Q5OA 3HNVH 4ZAKB 4XCFH 3LQAL 2IPTH 4RX4A 4ELME 1KG0A 1Q9LB 3KYKH 1FZOB 1UJTA 4LVHB 4PRNA 3RNQB 3R1GH 1VPOH 4YZFF 3DX9A 4OM1H 1RIUL 1JTPA 3LEXB 4NSKB 2BP3A 4NQXA 2A74A 5MEQB 3RDTB 4WDIB 4MQ7A 4DUVA 4E41E 3M17B 4R6UA 3VCLB 4U7KA 2VKWA 4HUWA 5EH1A 2V2TB 4X7SL 3P0VH 4WW2B 4EXKA 4D0DB 1WICA 4NRYB 1OAKL 5B22A 2V9TA 4MWFA 4G6FB 5ICZB 3IKCB 1S9XA 4MMZC 2CLVA 5I17B 2C5DC 1XFPA 3MJ9A 3KLHC 4U7MA 5EBLB 2UVEA 5IVOA 4RX4D 4LOUC 1NFDB 1XZ0B 4Y0GA 4P46B 4I9WE 1S9YB 1W72L 3WHE0 4S11A 3ZT5A 4CJ1A 4ZTOH 2DKMA 3C60D 3VXTB 1OQOA 1FZKB 1MCRA 2AV1B 1YUHA 4ZUVA 4Z0XA 3RDTA 5GGTH 4OLUL 2M1KA 1IGMH 1ZT4A 3HE7D 1V7ML 2PO6A 1JHKL 3QCVH 4NYLA 1QVOA 5GRYA 3QPQC 1DQJA 1Z9LA 2IH1A 5SX4I 1MFBL 5D1XA 4KTEH 3WFBH 3HLAB 4RA3A 4U1IA 4EDWL 3DYPA 1M1SA 1F00I 4ONFL 1GPOH 4XMLH 5E0QA 4P23A 4XXCA 2C3XA 5J13B 2APXA 4G7YH 4LLAA 5EU7C 2GT9A 3C60A 3O81A 4WUUB 4JKPH 3H2WA 3JUZA 3WL9A 1QVOB 3KPQB 1K8IB 2NNAA 3OKMB 5SX5K 3PWLB 1ORSB 3EFDH 3O11B 2VLRE 4FFYH 3RDTD 5HTSA 4QTIH 2VC2L 4PGEA 2W0FA 4RISL 5HHVH 1ZHKA 4LSDA 2PO6D 5DS8B 1W0WA 3BZ4B 4QF1A 5B38A 1U8MB 4QRUB 3Q3GB 4CNIA 4YZFE 1JNJA 2R23B 4TTDD 1P5UA 3IYLW 5TE6L 4D9RE 2AXHA 3DUSA 4X4MA 3VXSD 2D31A 1XZ0A 1OGTB 2JB5H 3NMEA 3E8UL 1XGQB 4NCDA 4JDZB 4GT7A 2YA2A 3MOQA 4MA1C 2ZCLH 4UTBL 1P4IH 2VO5A 2ARJA 3AM8A 2DQCL 1OGAE 4XXCC 1CXFA 3C9NA 4POYA 2WBJA 1F45A 4HLJA 3OXSB 1U3HA 4AK1A 4S0TD 1J1XL 1JPTL 2VWEC 3HI5H 5INDA 3QHZL 3B6SA 1KB5B 4YK4B 4HF5L 4L3ED 1YYLL 2GTZB 4X9BA 5E56A 3HC0B 5J1TC 4D9RD 1OT2A 1RVFH 4NN6C 4NT6A 4YBQC 1NCWL 3VXSA 2BVTA 3OAUH 2B7DT 2V5RA 3QCTH 3P40A 1QSVA 3TO4D 1GHFH 3DXAB 3BPNB 4KQ4H 5GGUA 4PB0L 1PKQE 4M6OL 4PJDA 3MNVB 1FNSL 5C0DB 1CIDA 1I7ZA 2ATPA 2A1WL 3GSVA 5HPMA 5K9QG 3QUYC 1N0LA 3WO4C 4AG4L 1OGAD 3UAJC 4B41A 4NKOB 3T65B 3EBAA 3P4NA 4PJBB 1I7RB 3VI4E 1NCDH 4URTB 4WI5A 2ZUVA 4JFXA 2XRAL 1OCWH 4FFZH 1G7MA 3RX8A 3VFUB 2G5BB 2IF7A 2ICCA 3L5WA 5EA0L 1XGPA 4P59L 1MEXH 4EIGB 3ARFA 2ZUUA 1QBAA 3SGJA 1TVDA 2LV4A 1X5IA 1NMCC 4OZHA 4XNXL 1YJDH 1B9ZA 2YD1A 3TCLB 5DD0H 3S98A 1FYHB 1DBBL 4FQXC 4FZEL 1X4XA 4QRUA 3ULUL 2OI9C 3RGVC 3PWNB 3O2WL 3TN0B 2G60H 3HZYA 2A6JA 4U6XA 1D5IL 4JDVB 3MOAL 4L3AA 4RGND 3D9AH 3MV8A 1KXQE 2EICA 4OZHF 5I1CH 1UCBL 1MREH 3S5LG 1UB6B 2X7LB 4O9HH 4ODXB 1XMWA 3ARDC 1LO4H 2GJ6E 3IDNA 1LK3L 4Y1AB 4HK3N 4U6TA 5BO1H 3QUYA 5GGVH 1E27B 4FQQB 3PWPD 5C0AB 3U7WH 3SPVA 2VAAA 3QNYB 4LKXA 3P4MB 3PWVA 1Z0NA 4C59B 4LU5L 5B4MD 1E4WL 1NBQA 1JNHB 1IKFH 3O9WB 1XGYL 4JO3L 3QFDA 3CFDA 1LD9B 5F1IB 1BZQK 2JJTA 1HINH 5I71B 3NCFB 3B4NA 2ZCLL 1JGLL 1FV1B 3F5WB 4LP4A 2VIRB 4PJEE 3X12B 1C16B 5DMJB 3BT2H 3KJ6H 1JHTA 2X4QB 2A9ML 4LLYB 4D9QD 1E4JA 5GGSY 1BQUA 5FGBA 3SDAC 1GRWA 2NW3B 4GH7B 3O2WH 4XHQA 1BZ7A 3Q1SL 4C56B 4Q9RH 1BEYH 1RUPL 5D7IA 4Q9QH 2LTQB 2BVUA 5JPMA 3BSZH 2YC1A 5A2FA 2E27H 3CDCA 3CD4A 2IH3B 1SBBA 2Y6SD 5E94A 5HHPB 1D5MB 5TF1H 3ELAT 3FFDB 4FFYL 3I50H 4NM4L 1CF8L 1I4FB 2MPAH 4JM2B 5KS9F 3S4SB 3WLBB 1RSFA 4HUWB 1X5YA 2IPUK 1A1NA 3BGFB 2DJSA 1IGJA 2I60H 2VZ3A 4GKZB 5HHQA 3HFMH 4QXGL 1OF2B 4FXGA 3LKNA 2BNRE 4LCUB 2F54B 2D3VA 3FRPA 1UADC 1QSEB 5KSVB 1T20B 3JVGA 2Z8RA 5CSZA 2XN9E 4YPGA 5L0QB 5EIIA 3Q5YA 3BGFC 1QR1A 4WU5B 1WAAF 5LWYL 1OTSC 5DC4B 3X3FL 4KAQH 1ZGLM 3R06A 1U8LB 3RQ3A 4JM2C 4UQ2B 1CDYA 3GJEA 2FHBA 2CSPA 1J1XH 4N1CA 3K4DA 4H26A 4Y5VA 3MCLL 1IBGL 2EYSB 3L3JA 3SO5A 3TFKD 4MXQC 3C5JB 3MJ9H 1RJLA 2A9NH 3FCTA 3DJ9A 3KXFD 3A6OA 2VLLB 4JCMA 5CCKL 3OV6A 4DVBB 3SKNA 4P2RE 2BMKB 4J8RB 4K94L 5F3BB 3G04B 3QDGE 4S1QL 5JIPA 2NZIA 5ILTH 1QYGH 3QQ3B 4PREA 5FV2A 4MNQB 5FFLA 1P4LB 4HWBH 4DUWA 5ADOL 1G6VK 2ZCKH 2JCCE 4Y1AD 5JHDE 3D0VB 5F7MC 2AJUL 3MV7B 3SDCD 2VH5H 3K7UA 5AUMB 3DRQA 4ZTOL 4O58L 1IQDB 5I8KH 1EHXA 3RVVC 4HEME 1AJ7H 5C0BA 2EDDA 2Z35A 4W81A 4C83B 4P59H 5KVEL 5CINL 5I2IB 1S7XA 3BT2L 3KJ6L 3T3PF 1UM5H 1GIGH 3BEVB 5C70A 4KKCD 3CVHB 3BZEA 4Y5VC 1IC7H 5IJKA 2HG5A 3BPLB 3U6RB 5HHNA 5GRWA 1RZJL 4P9ML 5IV2B 1BECA 1KCUL 4HULB 4WFFD 4LAQH 3C8HA 1GPOL 2Z31C 3ZHDA 1Z0MA 4DGYL 3KPTA 1NAKL 2W65B 3MRBA 3CPLA 3R1GL 5C0BD 1NGYB 1JBJA 2I9TB 3OAUL 4I5BA 2WK2A 4OZIF 5L7XH 1UWEL 1IILE 1JK8A 4OV5A 1A5FH 2V5TA 3QI9A 1F4XH 2OSLB 3MRJA 5BVJB 3P3YA 4OIIH 1H15B 3VI3E 3DGGA 3T0AA 5B4MC 1MH5B 2F53D 2NW2A 1QEWB 1QZ1A 4FTVA 1NFDE 3TO4A 1E6OH 1MF2H 1KPRB 3ZDXF 1GH7A 1IZJA 3UPAA 4JG0H 1GOHA 3BH8B 2HT2D 2X4UA 1L6XA 4L1DA 3WO4B 3TGXA 1RZIB 2IMMA 1KGCE 3GHEL 1A1OB 1K4CA 5EA0H 4LIQH 25C8H 3HE6A 3ALPA 2FSEA 5C2BL 1CZ8H 4FQHB 5HBBA 3MGTB 3BEWA 4E41B 4EVNB 2HFEB 1ZT7B 2FBOJ 2Z4QA 1NPUA 4G9FA 1MRFL 4JFFD 1CVRA 1QFWI 2F53A 1WISA 4EI5B 2VLJA 4CMMB 3VE0B 1IGIL 1ZVHA 3QR2A 2GSGB 1T3FA 4Z6AT 3HG1E 3V5HA 2MCPL 1BJMA 2GUOA 4NZRH 4UT9L 1YNTB 2SEBA 1RZGA 4NQCD 3AGVA 2XOTA 1B0WA 4MXWL 1C1EH 3UMTA 4O5LL 2C3VB 4U1MB 4P4RB 1U0QA 4OZIE 4LCWD 4KDWA 2H8PB 2KPNA 5F1SA 5DMIL 4M7KL 3TH4T 3MXWL 3U9PL 4FQIL 1NC4B 1C08B 2R1YA 3CIQA 1XR9A 3I6GB 3RGVD 3TBVA 3VI4F 1DFBL 4MD5B 1Q0XL 1I1RA 1EV2E 4HS6A 3QZWG 3AMLA 4PJIE 3DURB 3FN9A 3H0TA 1QSFE 4JPKL 3Q6GL 5E2JA 2AERT 3UTTE 3PHQA 3NIDE 1YEGH 3T4YA 3VWKC 2IGFH 5LGHH 2CMRH 1AGEA 4OBRA 3HE7B 2GITA 3WNOA 3VW3H 4UILL 4UNVA